Results: dupa

Query: 4rdvB

MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4rdv-B 73.3  0.0  451   451  100 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   2:  1j6p-A 43.1  2.4  389   407   22 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   3:  3ls9-A 43.0  2.5  418   453   21 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   4:  2paj-A 37.8  2.7  383   421   22 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   5:  2uz9-A 37.6  2.9  394   444   18 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   6:  2oof-A 29.7  3.0  341   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   7:  1k6w-A 29.7  3.3  353   423   16 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   8:  4cqb-A 29.5  3.1  353   402   14 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   9:  3mtw-A 26.6  2.9  331   404   17 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  10:  3mkv-A 26.4  2.7  325   414   19 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  11:  2imr-A 26.0  5.0  316   380   21 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  12:  4c5y-A 25.1  2.9  332   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  13:  3icj-A 24.9  3.3  317   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  14:  2vun-A 24.1  3.3  317   385   15 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  3nqb-A 23.9  3.3  315   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  16:  1onx-A 22.9  3.3  313   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  17:  1yrr-B 22.2  3.6  293   334   15 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  1a4m-A 21.3  3.0  266   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  19:  3ooq-A 20.1  3.3  273   384   17 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  20:  3giq-A 19.9  3.4  307   475   16 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  21:  2ogj-A 19.5  3.7  299   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  3e74-A 19.5  3.5  299   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  23:  1gkp-A 18.9  3.5  311   458   20 PDB  MOLECULE: HYDANTOINASE;                                              
  24:  3gri-A 18.7  3.5  302   422   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  4b3z-D 17.6  3.7  314   477   13 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  26:  3k2g-B 15.6  3.2  236   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  27:  2y1h-B 15.5  3.0  224   265   10 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  28:  1a5k-C 15.2  3.7  305   566   17 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  29:  1bf6-A 15.0  3.6  234   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  2ob3-A 15.0  3.7  233   329   16 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  31:  2vc5-A 14.3  4.0  238   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  32:  4dlf-A 13.0  3.5  220   287   15 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  33:  3irs-A 12.9  3.4  215   281    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  34:  3cjp-A 12.9  3.1  206   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  35:  3gg7-A 12.9  3.4  206   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  4mup-B 12.7  3.2  214   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  37:  3pnu-A 12.7  3.8  231   338   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  38:  2ffi-A 12.6  3.4  213   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  39:  4hk5-D 12.6  3.5  229   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  40:  2qpx-A 12.4  3.8  227   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  41:  4qrn-A 12.3  3.7  227   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  42:  2dvt-A 12.1  3.8  222   325   10 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  43:  2gwg-A 11.5  3.9  222   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  44:  4ofc-A 11.5  3.8  213   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  45:  1v77-A 10.9  2.9  181   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  46:  1itq-A 10.8  3.5  217   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  47:  2a3l-A 10.2  3.6  260   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  48:  4dzi-C 10.0  4.0  207   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3qy6-A  9.5  3.2  181   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  3dcp-A  9.3  3.1  168   277    8 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  51:  1j5s-A  8.7  4.1  233   451    9 PDB  MOLECULE: URONATE ISOMERASE;                                         
  52:  3au2-A  8.6  6.8  191   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  1m65-A  7.8  3.6  181   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3f2b-A  7.2  3.8  176   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1bks-A  7.1  3.7  173   255   12 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  56:  3iac-A  6.6  4.2  223   469   13 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  57:  2anu-A  5.5  3.4  148   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  4.9  3.9  172   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  4.3  4.1  146   284   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4rdvB Sbjct=4rdvB Z-score=73.3

back to top
DSSP  LEEEEEEEEELLEEEEEEEEEELLLLLEEEEELLLLLLLLEELLLLEEELEEEEEELHHH
Query SAIFAERALLPEGWARNVRFEISADGVLAEIRPDANADGAERLGGAVLPGMPNLHSHAFQ   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SAIFAERALLPEGWARNVRFEISADGVLAEIRPDANADGAERLGGAVLPGMPNLHSHAFQ   60
DSSP  LEEEEEEEEELLEEEEEEEEEELLLLLEEEEELLLLLLLLEELLLLEEELEEEEEELHHH


DSSP  HHHLLLLLLLLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHHHLEEEEEEEEL
Query RAMAGLAEVAGNPNDSFWTWRELMYRMVARLSPEQIEVIACQLYIEMLKAGYTAVAEFHY  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RAMAGLAEVAGNPNDSFWTWRELMYRMVARLSPEQIEVIACQLYIEMLKAGYTAVAEFHY  120
DSSP  HHHLLLLLLLLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHHHLEEEEEEEEL


DSSP  LLLLLLLLLLLLLLHHHHHHHHHHHHHLLEEEEEELLLLEEELLLEELLHHHLLLLLLHH
Query VHHDLDGRSYADPAELSLRISRAASAAGIGLTLLPVLYSHAGFGGQPASEGQRRFINGSE  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VHHDLDGRSYADPAELSLRISRAASAAGIGLTLLPVLYSHAGFGGQPASEGQRRFINGSE  180
DSSP  LLLLLLLLLLLLLLHHHHHHHHHHHHHLLEEEEEELLLLEEELLLEELLHHHLLLLLLHH


DSSP  HHHHHHHHHHHHHHHHLLEELEEELLLLLLLHHHHHHHHLLLLLLLLEEEEELLLHHHHH
Query AYLELLQRLRAPLEAAGHSLGLCFHSLRAVTPQQIATVLAAGHDDLPVHIHIAEQQKEVD  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AYLELLQRLRAPLEAAGHSLGLCFHSLRAVTPQQIATVLAAGHDDLPVHIHIAEQQKEVD  240
DSSP  HHHHHHHHHHHHHHHHLLEELEEELLLLLLLHHHHHHHHLLLLLLLLEEEEELLLHHHHH


DSSP  HHHHHHLLLHHHHHHHHLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLL
Query DCQAWSGRRPLQWLYENVAVDQRWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLGDG  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DCQAWSGRRPLQWLYENVAVDQRWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLGDG  300
DSSP  HHHHHHLLLHHHHHHHHLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLL


DSSP  LLLHHHHHHLLLEEEELLLLLLLLLHHHHHHHHHHHHHHHHLLLLLLLLLLLLLHHHHHH
Query IFPATDFLAQGGRLGIGSDSHVSLSVVEELRWLEYGQRLRDRKRNRLYRDDQPMIGRTLY  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IFPATDFLAQGGRLGIGSDSHVSLSVVEELRWLEYGQRLRDRKRNRLYRDDQPMIGRTLY  360
DSSP  LLLHHHHHHLLLEEEELLLLLLLLLHHHHHHHHHHHHHHHHLLLLLLLLLLLLLHHHHHH


DSSP  HHHHHHHHHHHLLLLLLLLLLLLLLEEEELLLLHHHHLLLLHHHHHHHHHHLLHHHEEEE
Query DAALAGGAQALGQPIGSLAVGRRADLLVLDGNDPYLASAEGDALLNRWLFAGGDRQVRDV  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DAALAGGAQALGQPIGSLAVGRRADLLVLDGNDPYLASAEGDALLNRWLFAGGDRQVRDV  420
DSSP  HHHHHHHHHHHLLLLLLLLLLLLLLEEEELLLLHHHHLLLLHHHHHHHHHHLLHHHEEEE


DSSP  EELLEEEELLLLLLLHHHHHHHHHHHHHHHL
Query MVAGRWVVRDGRHAGEERSARAFVQVLGELL  451
ident |||||||||||||||||||||||||||||||
Sbjct MVAGRWVVRDGRHAGEERSARAFVQVLGELL  451
DSSP  EELLEEEELLLLLLLHHHHHHHHHHHHHHHL


No 2: Query=4rdvB Sbjct=1j6pA Z-score=43.1

back to top
DSSP  --LEEEEEEEEEL-LEEEEEEEEEELlLLLEEEEELLLLlLLLEEL-LLLEEELEEEEEE
Query --SAIFAERALLP-EGWARNVRFEISaDGVLAEIRPDANaDGAERL-GGAVLPGMPNLHS   56
ident     |     |            ||   |                | |  | |   | | 
Sbjct hhXIIGNCLILKDfSSEPFWGAVEIE-NGTIKRVLQGEV-KVDLDLsGKLVXPALFNTHT   58
DSSP  leEEEEEEEELLLlLLLLEEEEEEEE-LLEEEEEEELLL-LLLEELlLEEEEELEEEEEE


DSSP  LHHHHHHLLLLLLlllllLLHHHHHH-HHHHHHLLLLHHHHHHHHHHHHHHHHHHLEEEE
Query HAFQRAMAGLAEVagnpnDSFWTWRE-LMYRMVARLSPEQIEVIACQLYIEMLKAGYTAV  115
ident ||      | ||       ||  |          ||              |    |    
Sbjct HAPXTLLRGVAED-----LSFEEWLFsKVLPIEDRLTEKXAYYGTILAQXEXARHGIAGF  113
DSSP  LHHHHHHLLLLLL-----LLHHHHHHlLHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEEE


DSSP  EEEELllllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEeellleellhhhlll
Query AEFHYvhhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHagfggqpasegqrrf  175
ident                         |  |    |    |   |                  
Sbjct VDXYF---------------HEEWIAKAVRDFGXRALLTRGLVDS---------------  143
DSSP  EEEEL---------------LHHHHHHHHHHHLLEEEEEEEELLL---------------


DSSP  llLHHHHHHHHHHHHHHH-HHHL-LEELEEELLLLLLLHHHHHHHHLL-LLLLLLEEEEE
Query inGSEAYLELLQRLRAPL-EAAG-HSLGLCFHSLRAVTPQQIATVLAA-GHDDLPVHIHI  232
ident        ||    |        |    |   ||           |         || || 
Sbjct ngDDGGRLEENLKLYNEWnGFEGrIFVGFGPHSPYLCSEEYLKRVFDTaKSLNAPVTIHL  203
DSSP  llLLLLHHHHHHHHHHHHlLHHHlEEEEEEELLLLLLLHHHHHHHHHHhHHHLLLEEEEE


DSSP  LLLHHHHhhhhhhhllLHHHHHHhHLLLL-lLEEEEELLLLLHHHHHHHHHHLLEEEELH
Query AEQQKEVddcqawsgrRPLQWLYeNVAVD-qRWCLVHATHADPAEVAAMARSGAVAGLCL  291
ident  |  ||            |     |           |  |                    
Sbjct YETSKEE---------YDLEDIL-NIGLKevKTIAAHCVHLPERYFGVLKDIPFFVSHNP  253
DSSP  LLLLLLL---------LLLHHHH-LLLLLllLEEEEELLLLLHHHHHHHLLLLEEEEELH


DSSP  HHHHHLLLLLLLHHHHHHLLLEEEELLLLL---LLLLHHHHHHHHHHHHHHHhlLLLLLl
Query STEANLGDGIFPATDFLAQGGRLGIGSDSH---VSLSVVEELRWLEYGQRLRdrKRNRLy  348
ident      || || |       |     | |      ||    | |     |         | 
Sbjct ASNLKLGNGIAPVQRXIEHGXKVTLGTDGAasnNSLNLFFEXRLASLLQKAQ--NPRNL-  310
DSSP  HHHHHLLLLLLLHHHHHHLLLEEEELLLLLlllLLLLHHHHHHHHHHHHHLL--LLLLL-


DSSP  llllllHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLEEEELLLLHHHHLLLlhHHHHHH
Query rddqpmIGRTLYDAALAGGAQALGQPIGSLAVGRRADLLVLDGNDPYLASAEgdALLNRW  408
ident          |        |||| |   |    |  ||| | |   |           |  
Sbjct ------DVNTCLKXVTYDGAQAXGFKSGKIEEGWNADLVVIDLDLPEXFPVQ--NIKNHL  362
DSSP  ------LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLHHHLLHH--HHHHHH


DSSP  HHHLLHHhEEEEEELLEEEELLLLLL-LHHH-HHHHHHHHHHHHL-
Query LFAGGDRqVRDVMVAGRWVVRDGRHA-GEER-SARAFVQVLGELL-  451
ident   |     |    ||| |   ||           |       ||  
Sbjct VHAFSGE-VFATXVAGKWIYFDGEYPtIDSEeVKRELARIEKELYs  407
DSSP  HHLLLLL-LLEEEELLEEEEELLLLLlLLHHhHHHHHHHHHHHHHl


No 3: Query=4rdvB Sbjct=3ls9A Z-score=43.0

back to top
DSSP  -LEEE-EEEEEEL---LEEEEEEEEEELlLLLEEEEEllLLLLL-----LEEL-LLLEEE
Query -SAIF-AERALLP---EGWARNVRFEISaDGVLAEIRpdANADG-----AERL-GGAVLP   49
ident    |    |       |         |                           |   ||
Sbjct mILIRgLTRVITFddqERELEDADILID-GPKIVAVG--KDLSDrsvsrTIDGrGMIALP   57
DSSP  lEEEEeEEEEELLlllLLEEEEEEEEEE-LLEEEEEE--LLLLLlllleEEELlLEEEEE


DSSP  LEEEEEELHHHHHHLL--LLLLlllllLLHHHHHHHHHHHHLL------LLHHHHHHHHH
Query GMPNLHSHAFQRAMAG--LAEVagnpnDSFWTWRELMYRMVAR------LSPEQIEVIAC  101
ident |  | | |    ||      |           | |      |         |  |   | 
Sbjct GLINSHQHLYEGAMRAipQLER-----VTMASWLEGVLTRSAGwwrdgkFGPDVIREVAR  112
DSSP  LEEEEEELHHHHHHLLlhHHLL-----LLHHHHHHHHHHHHHHhhhlllLLHHHHHHHHH


DSSP  HHHHHHHHHLEEEEEEEELLLLlllLLLLlllLHHHHHHHHHHHHHLLEEEEEELLLLEE
Query QLYIEMLKAGYTAVAEFHYVHHdldGRSYadpAELSLRISRAASAAGIGLTLLPVLYSHA  161
ident     | |  | | ||  |       |               ||   ||            
Sbjct AVLLESLLGGITTVADQHLFFP---GATA---DSYIDATIEAATDLGIRFHAARSSMTLG  166
DSSP  HHHHHHHHLLEEEEEEEELLLL---LLLL---LLHHHHHHHHHHHHLLEEEEEELLLLLL


DSSP  ElLLEELLHHHlllLLLHHHHHHHHHHHH-HHHH---hHLLEELEEELLLLLLLHHHHHH
Query GfGGQPASEGQrrfINGSEAYLELLQRLR-APLE---aAGHSLGLCFHSLRAVTPQQIAT  217
ident    |                       |     |          |         |     
Sbjct KsEGGFCDDLF---VEPVDRVVQHCLGLIdQYHEpepfGMVRIALGPCGVPYDKPELFEA  223
DSSP  HhHLLLLLHHH---LLLHHHHHHHHHHHHhHHLLllllLLEEEEELLLLLLLLLHHHHHH


DSSP  HHLL-LLLLLLEEEEELLLhHHHHHHHHHHLLLHHHHHHHHLLLLLLEEEEELLLLLHHH
Query VLAA-GHDDLPVHIHIAEQqKEVDDCQAWSGRRPLQWLYENVAVDQRWCLVHATHADPAE  276
ident         |   | |  |            |  |   |        |  | ||      |
Sbjct FAQMaADYDVRLHTHFYEP-LDAGMSDHLYGMTPWRFLEKHGWASDRVWLAHAVVPPREE  282
DSSP  HHHHhHHHLLEEEEEELLL-LHHHHHHHHHLLLHHHHHHHLLLLLLLEEEEELLLLLHHH


DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL---LLLLHHHHHHHH
Query VAAMARSGAVAGLCLSTEANLGDGIFPATDFLAQGGRLGIGSDSH---VSLSVVEELRWL  333
ident     |  |             | |  |    |  |   | |               ||  
Sbjct IPEFADAGVAIAHLIAPDLRMGWGLAPIREYLDAGITVGFGTTGSasnDGGNLLGDLRLA  342
DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLlllLLLLHHHHHHHH


DSSP  HHHHHHHHL--LLLLLlllllllHHHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEEL
Query EYGQRLRDR--KRNRLyrddqpmIGRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLD  390
ident     |  |       |         | |   |  | |  ||    | |  || ||     
Sbjct ALAHRPADPnePEKWL-------SARELLRMATRGSAECLGRpDLGVLEEGRAADIACWR  395
DSSP  HHHLHHHLLllHHHLL-------LHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEEE


DSSP  LLLHHHHLLLlhHHHHHHHHH-LLHHhEEEEEELLEEEELLLLL--LLHHHHHHHHHHHH
Query GNDPYLASAEgdALLNRWLFA-GGDRqVRDVMVAGRWVVRDGRH--AGEERSARAFVQVL  447
ident                         ||    | | |   |   |   |  ||         
Sbjct LDGVDRVGVH--DPAIGLIMTgLSDR-ASLVVVNGQVLVENERPvlADLERIVANTTALI  452
DSSP  LLLHHHLLLL--LHHHHHHHLlLLLL-LLEEEELLEEEEELLEEllLLHHHHHHHHHHHL


DSSP  Hhhl
Query Gell  451
ident     
Sbjct P---  453
DSSP  L---


No 4: Query=4rdvB Sbjct=2pajA Z-score=37.8

back to top
DSSP  --LEEE-EEEEEE-------LLEEEEEEEEEELLlLLEEEEEllLLLLL----LEEL-LL
Query --SAIF-AERALL-------PEGWARNVRFEISAdGVLAEIRpdANADG----AERL-GG   45
ident     |  |                       |        |   | |             
Sbjct psTLIRnAAAIMTggrgtadDPSRVPGPDIRIVG-DTIDAIG--ALAPRpgetIVDAtDC   57
DSSP  leEEEElLLEELLlllllllLLLLLLLLLEEEEL-LEEEEEL--LLLLLllleEEELlLL


DSSP  LEEELEEEEEELHHHHHHLLLLlllllllllhhhhhhhhhhHHLLLLHHHHHHHHHHHHH
Query AVLPGMPNLHSHAFQRAMAGLAevagnpndsfwtwrelmyrMVARLSPEQIEVIACQLYI  105
ident    |   | | | ||    |                       |          |    |
Sbjct VIYPAWVNTHHHLFQSLLKGEP-------------------FRALFDERRFRLAARIGLI   98
DSSP  EEEELEELLLLLHHHHHLLLLL-------------------LHHHLLHHHHHHHHHHHHH


DSSP  HHHHHLEEEEEEEELLLLlllLLLLllllHHHHHHHHHHHHHLLEEEEEELLLLEEelll
Query EMLKAGYTAVAEFHYVHHdldGRSYadpaELSLRISRAASAAGIGLTLLPVLYSHAgfgg  165
ident |    |   ||   ||               |      |   |    ||           
Sbjct ELARSGCATVADHNYVYY---PGMP---fDSSAILFEEAEKLGLRFVLLRGGATQT----  148
DSSP  HHHLLLEEEEEELLLLLL---LLLL---lLHHHHHHHHHHHLLLEEEEEELLLLLL----


DSSP  eELLH---HHLLLLLLHHHHHHHHHHHHHHHHH----hLLEELEEELL-LLLLLHHHHHH
Query qPASE---GQRRFINGSEAYLELLQRLRAPLEA----aGHSLGLCFHS-LRAVTPQQIAT  217
ident     |             ||     || |                    |    |     
Sbjct -RQLEadlPTALRPETLDAYVADIERLAARYHDaspraMRRVVMAPTTvLYSISPREMRE  207
DSSP  -LLLLlllLHHHLLLLHHHHHHHHHHHHHHLLLlllllLEEEEELLLLlLLLLLHHHHHH


DSSP  HHlLLLL--LLLEEEEELllhhhhhhhhhhhLLLHHHHHHHHLLLLLLEEEEELLLLLHH
Query VLaAGHD--DLPVHIHIAeqqkevddcqawsGRRPLQWLYENVAVDQRWCLVHATHADPA  275
ident    |      |  | |               |  |     |           |    |  
Sbjct TA-AVARrlGLRMHSHLS-------------GKSPVAFCGEHDWLGSDVWYAHLVKVDAD  253
DSSP  HH-HHHHhlLLEEEEELL-------------LLLHHHHHHHLLLLLLLEEEELLLLLLHH


DSSP  HHHHHHHHLLEEEELHHHHHHLlllllLHHHHHHLLLEEEELLLLL---LLLLHHHHHHH
Query EVAAMARSGAVAGLCLSTEANLgdgifPATDFLAQGGRLGIGSDSH---VSLSVVEELRW  332
ident | |  |  |     |      |     |       |    || |            |   
Sbjct EIALLAQTGTGVAHCPQSNGRL-----PVREMADAGVPVSIGVDGAasnEAADMISEVHM  308
DSSP  HHHHHHHHLLEEEELHHHHHLL-----LLLLHHHHLLLEEELLLHHhhlLLLLHHHHHHH


DSSP  HHHHHHhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELL
Query LEYGQRlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDG  391
ident     ||                          ||||   |    |  |||  ||  |   
Sbjct TWLAQR-----ARLA-------SIAEVIHWGTAGGARVMGLdEVGKVAVGYAADIAVYRL  356
DSSP  HHHHHH-----HLLL-------LHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEEEEEL


DSSP  LLHHHHLLLlhHHHHHHHHHLLHHHEEEEEELLEEEELLLLLLLHH--HHHHHHHHHHHH
Query NDPYLASAEgdALLNRWLFAGGDRQVRDVMVAGRWVVRDGRHAGEE--RSARAFVQVLGE  449
ident  ||                 ||   |     ||  || |    |            |  |
Sbjct DDPRYFGLH--DPAIGPVASGGRPSVMALFSAGKRVVVDDLIEGVDikELGGEARRVVRE  414
DSSP  LLHHHLLLL--LHHHHHHHLLLLLEEEEEEELLEEEEELLLLLLLLhhHHHHHHHHHHHH


DSSP  HL-----
Query LL-----  451
ident ||     
Sbjct LLrevvv  421
DSSP  HHhhhhl


No 5: Query=4rdvB Sbjct=2uz9A Z-score=37.6

back to top
DSSP  ---LEEEEeEEEELL-----EEEEEEEEEELLLLLEEEEELLLL-----------lLLLE
Query ---SAIFAeRALLPE-----GWARNVRFEISADGVLAEIRPDAN-----------aDGAE   41
ident                        |      |  |                          
Sbjct plaHIFRG-TFVHSTwtcpmEVLRDHLLGVSDSGKIVFLEEASQqeklakewcfkpCEIR   59
DSSP  lllEEEEE-EEEELLlllllEEEEEEEEEELLLLLEEEEEEHHHhhhhhhhhlllhHHEE


DSSP  ELL--LLEEELEEEEEELHHHHHHLLLLLLlllllLLHHHHH-HHHHHHHLLL-LHHHHH
Query RLG--GAVLPGMPNLHSHAFQRAMAGLAEVagnpnDSFWTWR-ELMYRMVARL-SPEQIE   97
ident  |       ||    | || |   ||              |          |       |
Sbjct ELShhEFFMPGLVDTHIHASQYSFAGSSID-----LPLLEWLtKYTFPAEHRFqNIDFAE  114
DSSP  ELLllLEEEELEEEEEEEHHHHHHLLLLLL-----LLHHHHHhHLHHHHHHHHhLHHHHH


DSSP  HHHHHHHHHHHHHLEEEEEEEELLLlllllllllllLHHHHHHHHHHHHHLLEEEEEELL
Query VIACQLYIEMLKAGYTAVAEFHYVHhdldgrsyadpAELSLRISRAASAAGIGLTLLPVL  157
ident           || | |    |   |              ||         |       | 
Sbjct EVYTRVVRRTLKNGTTTACYFATIH-----------TDSSLLLADITDKFGQRAFVGKVC  163
DSSP  HHHHHHHHHHHHLLEEEEEEELLLL-----------HHHHHHHHHHHHHHLLEEEEELEE


DSSP  LLEEellleelLHHHLLLL---LLHHHHHHHHHHHHHHhHHHLLEELEEELLLLLLLHHH
Query YSHAgfggqpaSEGQRRFI---NGSEAYLELLQRLRAPlEAAGHSLGLCFHSLRAVTPQQ  214
ident                                                             
Sbjct MDLN-------DTFPEYKEtteESIKETERFVSEMLQK-NYSRVKPIVTPRFSLSCSETL  215
DSSP  LLLL-------LLLLLLLLlhhHHHHHHHHHHHHHHHH-LLLLEEEEEEELLHHHLLHHH


DSSP  HHHHHL--LLLLlLLEEEEELLLHHHHHHHHHHHL--LLHHHHHHHHLLLLLLEEEEELL
Query IATVLA--AGHDdLPVHIHIAEQQKEVDDCQAWSG--RRPLQWLYENVAVDQRWCLVHAT  270
ident            | |    || |   ||                   |          |  
Sbjct MGELGNiaKTRD-LHIQSHISENRDEVEAVKNLYPsyKNYTSVYDKNNLLTNKTVMAHGC  274
DSSP  HHHHHHhhHHHL-LEEEEEELLLHHHHHHHHHHLLllLLHHHHHHHLLLLLLLEEEEELL


DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL--LLLLHHH
Query HADPAEVAAMARSGAVAGLCLSTEANLGDGIFPATDFLAQGGRLGIGSDSH--VSLSVVE  328
ident      |       ||    |      |  |       |      | | |     | |   
Sbjct YLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAggYSYSMLD  334
DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLllLLLLHHH


DSSP  HHHHHHHHHHHHHLL---LLLLlllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLL
Query ELRWLEYGQRLRDRK---RNRLyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRR  383
ident   |                  |               |  || ||||    ||   ||  
Sbjct AIRRAVMVSNILLINkvnEKSL-------TLKEVFRLATLGGSQALGLdgEIGNFEVGKE  387
DSSP  HHHHHHHHHHHHHHLlllLLLL-------LHHHHHHHHLHHHHHHLLLllLLLLLLLLLL


DSSP  LLEEEELLLL--HHHHL-------lllHHHHHHHHHHLLHHHEEEEEELLEEEellLLLL
Query ADLLVLDGND--PYLAS-------aegDALLNRWLFAGGDRQVRDVMVAGRWVvrdGRHA  434
ident  |                          |     |  | ||    | | |  |       
Sbjct FDAILINPKAsdSPIDLfygdffgdisEAVIQKFLYLGDDRNIEEVYVGGKQV---VPFS  444
DSSP  LLEEEELLLLllLLLLLllhhhhllllLHHHHHHHHHLLHHHEEEEEELLEEE---ELLL


DSSP  lhhhhhhhhhhhhhhhl
Query geersarafvqvlgell  451
ident                  
Sbjct -----------------  444
DSSP  -----------------


No 6: Query=4rdvB Sbjct=2oofA Z-score=29.7

back to top
DSSP  ----LEEEEEEEEELL------EEEEEEEEEELlLLLEEEEELLLL---lLLLEELL-LL
Query ----SAIFAERALLPE------GWARNVRFEISaDGVLAEIRPDAN---aDGAERLG-GA   46
ident                       |            |      |                 
Sbjct lnceRVWLNVTPATLRsdladyGLLEPHALGVH-EGRIHALVPXQDlkypAHWQDXKgKL   59
DSSP  llllEEEEEEEELLLLllllllLLLLLEEEEEE-LLEEEEEEEHHHllllLLLEELLlLE


DSSP  EEELEEEEEELHHHhhhllLLLL---LLLLL--llhhhhhHHHHHHHLL---LLHHHHHH
Query VLPGMPNLHSHAFQramagLAEV---AGNPN--dsfwtwrELMYRMVAR---LSPEQIEV   98
ident | ||    | |         ||                        |      |  |   
Sbjct VTPGLIDCHTHLIF--agsRAEEfelRQKGVpyaeiarkgGGIISTVRAtraASEDQLFE  117
DSSP  EEELEEEEEELLLL--lllLHHHhhhHHHLLlhhhhhhllLLHHHHHHHhhhLLHHHHHH


DSSP  HHHHHHHHHHHHLEEEEEEEELLLLlllLLLLlllLHHHHHHHHHHHHHLLEEEEEEL-L
Query IACQLYIEMLKAGYTAVAEFHYVHHdldGRSYadpAELSLRISRAASAAGIGLTLLPV-L  157
ident  |          | | |                          |   |  |         
Sbjct LALPRVKSLIREGVTTVEIKSGYGL---TLED--eLKXLRVARRLGEALPIRVKTTLLaA  172
DSSP  HHHHHHHHHHHHLEEEEEEELLLLL---LHHH--hHHHHHHHHHHHHHLLLEEEEEEEeE


DSSP  LLEeellleeLLHH----hllllLLHHH-HHHHHHHHHhhhhhhlleELEEeLLLL--LL
Query YSHagfggqpASEG----qrrfiNGSEA-YLELLQRLRapleaaghsLGLCfHSLR--AV  210
ident             |                                               
Sbjct HAV-------PPEYrddpdswveTICQEiIPAAAEAGL--------aDAVD-VFCEhiGF  216
DSSP  LLL-------LHHHlllhhhhhhHHHHLhHHHHHHLLL--------lLEEE-EEELllLL


DSSP  LHHHHHHHHLL--LLLLLlEEEEELLLHhhhhhhhhhhllLHHHHHHhhLLLLllEEEEE
Query TPQQIATVLAA--GHDDLpVHIHIAEQQkevddcqawsgrRPLQWLYenVAVDqrWCLVH  268
ident    |   |  |        |  |                                    |
Sbjct SLAQTEQVYLAadQYGLA-VKGHXDQLS----------nlGGSTLAA--NFGA--LSVDH  261
DSSP  LHHHHHHHHHHhhHLLLE-EEEEELLLL----------llLHHHHHH--HLLL--LEEEE


DSSP  LLLLLHHHHHHHHHHLLEEEELHHHHHHLLL-LLLLHHHHHHLLLEEEELLLLL----LL
Query ATHADPAEVAAMARSGAVAGLCLSTEANLGD-GIFPATDFLAQGGRLGIGSDSH----VS  323
ident     ||    | |  | || |       |      |       |      ||        
Sbjct LEYLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKAGVPXAVSSDINpgtaPI  321
DSSP  LLLLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHLLLLEEELLLLLllllLL


DSSP  LLHHHHHHHHHHHHHhhhlllllllllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLL
Query LSVVEELRWLEYGQRlrdrkrnrlyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVG  381
ident  |                                          | |||     | | ||
Sbjct VSLRXAXNXACTLFG---------------lTPVEAXAGVTRHAARALGEqeQLGQLRVG  366
DSSP  LLHHHHHHHHHHHHL---------------lLHHHHHHHLLHHHHHHLLLllLLLLLLLL


DSSP  LLLLEEEELLllhhhhllllhhHHHHHHHhLLHH-HEEEEEELLEEEELllllllhhhhh
Query RRADLLVLDGndpylasaegdaLLNRWLFaGGDR-QVRDVMVAGRWVVRdgrhageersa  440
ident   || ||                            |     | |                
Sbjct XLADFLVWNC-----------gHPAELSY-LIGVdQLVSRVVNGEETLH-----------  403
DSSP  LLLLEEEELL-----------lLLLHHHH-LLLLlLEEEEEELLEELLL-----------


DSSP  hhhhhhhhhhl
Query rafvqvlgell  451
ident            
Sbjct -----------  403
DSSP  -----------


No 7: Query=4rdvB Sbjct=1k6wA Z-score=29.7

back to top
DSSP  --LEEEEEEEEellEEEEEEEEEELLlLLEEEEELL-LLLLL---LEELL-LLEEELEEE
Query --SAIFAERALlpeGWARNVRFEISAdGVLAEIRPD-ANADG---AERLG-GAVLPGMPN   53
ident     |   |     |            |    |                  | | |    
Sbjct alQTIINARLP---GEEGLWQIHLQD-GKISAIDAQsGVMPItenSLDAEqGLVIPPFVE   56
DSSP  llLEEEEELLL---LLLLEEEEEEEL-LEEEEEEEElLLLLLlllEEELLlLEEELLEEE


DSSP  EEELHHHHHHLLL--LLLLllllLLHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHHHL
Query LHSHAFQRAMAGL--AEVAgnpnDSFWTWRELMYRMVARLSPEQIEVIACQLYIEMLKAG  111
ident  | |      ||                  |      | |        | |        |
Sbjct PHIHLDTTQTAGQpnWNQS----GTLFEGIERWAERKALLTHDDVKQRAWQTLKWQIANG  112
DSSP  EEELLLLLLLLLLllLLLL----LLHHHHHHHHHLLHHHLLHHHHHHHHHHHHHHHHHLL


DSSP  EEEEEEEELLLLlllllllllLLHHHHHHHHHHHHH--LLEEEEEELL--LLEEelllee
Query YTAVAEFHYVHHdldgrsyadPAELSLRISRAASAA--GIGLTLLPVL--YSHAgfggqp  167
ident    |     |                             | |                  
Sbjct IQHVRTHVDVSD--------aTLTALKAMLEVKQEVapWIDLQIVAFPqeGILS------  158
DSSP  EEEEEEEEELLL--------lLLHHHHHHHHHHHHHllLLEEEEEEELllLLLL------


DSSP  llhhhlllLLLHHHHHHHHHHHhhhhhhhlleELEEElLLLLL-----LHHHHHHHHL--
Query asegqrrfINGSEAYLELLQRLrapleaaghsLGLCFhSLRAV-----TPQQIATVLA--  220
ident          ||     | |                                      |  
Sbjct -------yPNGEALLEEALRLG---------aDVVGA-IPHFEftreyGVESLHKTFAla  201
DSSP  -------lLLHHHHHHHHHHLL---------lLEEEE-LHHHLllhhhHHHHHHHHHHhh


DSSP  LLLLlLLEEEEELLLHhhHHHHhhhhllLHHHHHHhHLLL----LLLEEEEELLLL----
Query AGHDdLPVHIHIAEQQkeVDDCqawsgrRPLQWLYeNVAV----DQRWCLVHATHA----  272
ident    |      |  |              |         |       |    | |      
Sbjct QKYD-RLIDVHCDEID--DEQS------RFVETVA-ALAHhegmGARVTASHTTAMhsyn  251
DSSP  HHHL-LEEEEEELLLL--LLLL------LHHHHHH-HHHHhhllHHHEEEEELHHHhhll


DSSP  ---LHHHHHHHHHHLLEEEELHHHHHHLL---------lLLLLHHHHHHLLLEEEELLLL
Query ---DPAEVAAMARSGAVAGLCLSTEANLG---------dGIFPATDFLAQGGRLGIGSDS  320
ident              ||            |           ||      |  |     | | 
Sbjct gayTSRLFRLLKMSGINFVANPLVNIHLQgrfdtypkrrGITRVKEMLESGINVCFGHDD  311
DSSP  hhhHHHHHHHHHHHLLEEEELHHHHHHHLllllllllllLLLLHHHHHHLLLLEEELLLL


DSSP  L-------LLLLHHHHHHHHHHHHhhhhllllLLLLlllLLHHHHHHHHHHHHHHHHHLL
Query H-------VSLSVVEELRWLEYGQrlrdrkrnRLYRddqPMIGRTLYDAALAGGAQALGQ  373
ident                 |                |                    |  |  
Sbjct VfdpwyplGTANMLQVLHMGLHVC--------QLMG---YGQINDGLNLITHHSARTLNL  360
DSSP  LlllllllLLLLHHHHHHHHHHHL--------LLLL---HHHHHHHHHHHLHHHHHHLLL


DSSP  LLLLLLLLLLLLEEEELLllhhhhllllhhHHHHHHhHLLHhHEEEEEELLEEEELLLll
Query PIGSLAVGRRADLLVLDGndpylasaegdaLLNRWLfAGGDrQVRDVMVAGRWVVRDGrh  433
ident      | |  | |  |                   |       ||     |         
Sbjct QDYGIAAGNSANLIILPA-----------eNGFDAL-RRQV-PVRYSVRGGKVIASTQ--  405
DSSP  LLLLLLLLLLLLEEEELL-----------lLHHHHH-HHLL-LLLEEEELLEEEEELL--


DSSP  llhhhhhhhhhhhhhhhl
Query ageersarafvqvlgell  451
ident                   
Sbjct paqttvyleqpeaidykr  423
DSSP  llleeeellleeeellll


No 8: Query=4rdvB Sbjct=4cqbA Z-score=29.5

back to top
DSSP  -----LEEEEEEEEEllEEEEeEEEEELLlLLEEEEELLLLLLL--LEELL-LLEEELEE
Query -----SAIFAERALLpeGWARnVRFEISAdGVLAEIRPDANADG--AERLG-GAVLPGMP   52
ident        |                  |        |                  | ||  
Sbjct skdfdLIIRNAYLSE--KDSV-YDIGIVG-DRIIKIEAKIEGTVkdEIDAKgNLVSPGFV   56
DSSP  llleeEEEEEEEELL--LLEE-EEEEEEL-LEEEEEELLLLLLEeeEEELLlLLEEELEE


DSSP  EEEELHHHHHHL-----LLLLLLLlllLLHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHH
Query NLHSHAFQRAMA-----GLAEVAGnpnDSFWTWRELMYRMVARLSPEQIEVIACQLYIEM  107
ident   | |                             |           | |           
Sbjct DAHTHMDKSFTStgerlPKFWSRP---YTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQ  113
DSSP  EEEELHHHLLLLlllllLLLLLLL---LLHHHHHHHHHHHHHHLLHHHHHHHHHHHHHHH


DSSP  HHHLEEEEEEEELLLLLllllllllLLHHHHHHHHHHHHH--LLEEEEEELL--LLEEel
Query LKAGYTAVAEFHYVHHDldgrsyadPAELSLRISRAASAA--GIGLTLLPVL--YSHAgf  163
ident    |         |                     |       |                
Sbjct VLHGTLYTRTHVDVDSV-------aKTKAVEAVLEAKEELkdLIDIQVVAFAqsGFFV--  164
DSSP  HHLLEEEEEEEEELLLL-------lLLHHHHHHHHHHHHLllLLEEEEEEELllLLLL--


DSSP  lleellhhhlllLLLHHHHHHHHHHHhhhhhhhlleELEEELLLL------lLLHHHHHH
Query ggqpasegqrrfINGSEAYLELLQRLrapleaaghsLGLCFHSLR------aVTPQQIAT  217
ident                       |                                     
Sbjct -----------dLESESLIRKSLDMG---------cDLVGGVDPAtrennveGSLDLCFK  204
DSSP  -----------lLLHHHHHHHHHHHL---------lLEEELLLLLlllllhhHHHHHHHH


DSSP  HHLLLLllLLEEEEELLLHHHHhhhhhhhllLHHHHHHHHLL---LLLLEEEEELLLL--
Query VLAAGHddLPVHIHIAEQQKEVddcqawsgrRPLQWLYENVA---VDQRWCLVHATHA--  272
ident              ||                     |           |    ||     
Sbjct LAKEYD--VDIDYHIHDIGTVG--------vYSINRLAQKTIengYKGRVTTSHAWCFad  254
DSSP  HHHHLL--LEEEEEELLLHHHH--------hHHHHHHHHHHHhllLLLLEEEEELLHHhh


DSSP  -----LHHHHHHHHHHLLEEEELHHHHhhllLLLLLHHHHHHLLLEEEELLLLL------
Query -----DPAEVAAMARSGAVAGLCLSTEanlgDGIFPATDFLAQGGRLGIGSDSH------  321
ident                ||     | |          |    |  |  ||  ||        
Sbjct apsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCASDNIrdfwvp  310
DSSP  llhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEELLLLllllll


DSSP  -LLLLHHHHHHHHHHHHHhhhllllllllllLLLHHHHHHHHHHHHHHHHHLL-LLLLLL
Query -VSLSVVEELRWLEYGQRlrdrkrnrlyrddQPMIGRTLYDAALAGGAQALGQ-PIGSLA  379
ident       |                                       ||  ||        
Sbjct fGNGDMVQGALIETQRLE-----------lkTNRDLGLIWKMITSEGARVLGIeKNYGIE  359
DSSP  lLLLLHHHHHHHHHHHHL-----------llLHHHHHHHHHHHLHHHHHHHLLhHHLLLL


DSSP  LLLLLLEEEELLllhhhhllllhhHHHHHHHhLLHHhEEEEEELLEEEELLLLLLLhhhh
Query VGRRADLLVLDGndpylasaegdaLLNRWLFaGGDRqVRDVMVAGRWVVRDGRHAGeers  439
ident ||  ||| ||                              |   ||  | |         
Sbjct VGKKADLVVLNS-----------lSPQWAII-DQAK-RLCVIKNGRIIVKDEVIVA----  402
DSSP  LLLLLLEEEELL-----------lLHHHHHH-HLLL-EEEEEELLEEEEELLEELL----


DSSP  hhhhhhhhhhhl
Query arafvqvlgell  451
ident             
Sbjct ------------  402
DSSP  ------------


No 9: Query=4rdvB Sbjct=3mtwA Z-score=26.6

back to top
DSSP  ---LEEEEEEEEE--LLEEEEEEEEEELlLLLEEEEELlLLLLL-----LEELL-LLEEE
Query ---SAIFAERALL--PEGWARNVRFEISaDGVLAEIRPdANADG-----AERLG-GAVLP   49
ident     |  | | |         |       ||    |             |  |     ||
Sbjct aeiKAVSAARLLDvaSGKYVDNPLVIVT-DGRITSIGK-KGDAVpagatAVDLPgVTLLP   58
DSSP  lleEEEEEEEEEEllLLEEEELEEEEEE-LLEEEEEEE-LLLLLlllleEEEEEeEEEEE


DSSP  LEEEEEELHHHhhHLLLllllllllllhhhhhhhHHHHHLLLLHHHHHHHHHHHHHHHHH
Query GMPNLHSHAFQraMAGLaevagnpndsfwtwrelMYRMVARLSPEQIEVIACQLYIEMLK  109
ident |    | |      |                           |     |         | 
Sbjct GLIDMHVHLDS--LAEV-----------------GGYNSLEYSDRFWSVVQTANAKKTLE   99
DSSP  LEEEEEELLLL--LLLL-----------------LHHHHHHLLHHHHHHHHHHHHHHHHH


DSSP  HLEEEEEEEELLLllllllllllllHHHHHHHHHHH---HHLLEEEEE-ELLLLEEElll
Query AGYTAVAEFHYVHhdldgrsyadpaELSLRISRAAS---AAGIGLTLL-PVLYSHAGfgg  165
ident || | |                           |       |              |   
Sbjct AGFTTVRNVGAAD------------YDDVGLREAIDagyVPGPRIVTAaISFGATGG--h  145
DSSP  LLEEEEEELLLLL------------LHHHHHHHHHHlllLLLLEEEELlLLEELLLL--l


DSSP  eeLLHH----hLLLLL------LHHHHH-HHHHHHhhhhhhhlleELEEELLLL------
Query qpASEG----qRRFIN------GSEAYL-ELLQRLrapleaaghsLGLCFHSLR------  208
ident                               |                             
Sbjct cdSTFFppsmdQKNPFnsdspdEARKAVrTLKKYG---------aQVIXICATGgvfsrg  196
DSSP  llLLLLlhhhlLLLLLllllhhHHHHHHhHHHHLL---------lLEEEEELLLllllll


DSSP  ------LLLHHHHHHHHLL-LLLLLLEEEEELllhhhhhhhhhhhllLHHHHHHhHLLLl
Query ------AVTPQQIATVLAA-GHDDLPVHIHIAeqqkevddcqawsgrRPLQWLYeNVAVd  261
ident         |      |          |  |                            | 
Sbjct nepgqqQLTYEEMKAVVDEaHMAGIKVAAHAH-------------gaSGIREAV-RAGV-  241
DSSP  llllllLLLHHHHHHHHHHhHHLLLEEEEEEL-------------lhHHHHHHH-HLLL-


DSSP  llEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL
Query qrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLG-------------------DGIF  302
ident       ||   |          ||                                    
Sbjct --DTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdiGELQ  299
DSSP  --LEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhhHHHH


DSSP  --LHHHHHHLLLEEEELLL-LLLL-LLHHHHHHHHHHHHhhhhlllllllllllllHHHH
Query --PATDFLAQGGRLGIGSD-SHVS-LSVVEELRWLEYGQrlrdrkrnrlyrddqpmIGRT  358
ident        |  |     | |                                         
Sbjct reNFRKALKAGVKMVYGTDaGIYPhGDNAKQFAVMVRYG----------------aTPLQ  343
DSSP  hhHHHHHHHHLLEEELLLLlLLLLlLLHHHHHHHHHHLL----------------lLHHH


DSSP  HHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLllhhhhllllhhHHHHHHHhLLHHh
Query LYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGndpylasaegdaLLNRWLFaGGDRq  416
ident     |    | |||     |  ||||  |     |                         
Sbjct AIQSATLTAAEALGRskDVGQVAVGRYGDMIAVAG------------DPLADVT-TLEK-  389
DSSP  HHHHLLHHHHHHHLLllLLLLLLLLLLLLEEEELL------------LLLLLHH-HHHL-


DSSP  EEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl
Query VRDVMVAGRWVVRDgrhageersarafvqvlgell  451
ident    ||  |  |                        
Sbjct PVFVMKGGAVVKAP--------------------x  404
DSSP  LLEEEELLEEEELL--------------------l


No 10: Query=4rdvB Sbjct=3mkvA Z-score=26.4

back to top
DSSP  ---LEEEEEEEEELLE--EEEEEEEEELlLLLEEEEELlLLLLL----LEELL-LLEEEL
Query ---SAIFAERALLPEG--WARNVRFEISaDGVLAEIRPdANADG----AERLG-GAVLPG   50
ident            | |            |  ||   |                       ||
Sbjct lttFLFRNGALLDPDHpdLLQGFEILIE-DGFIREVSD-KPIKSsnahVIDVKgKTIMPG   58
DSSP  lleEEEEEEEELLLLLllLEEEEEEEEE-LLEEEEEEL-LLLLLllleEEELLlLEEEEL


DSSP  EEEEEELHHHHHHlllllllllllllhhhhhhHHHHHHLLLLhHHHHHHHHHHHHHHHHH
Query MPNLHSHAFQRAMaglaevagnpndsfwtwreLMYRMVARLSpEQIEVIACQLYIEMLKA  110
ident    || |                            |             |      ||  
Sbjct LIDLHVHVVAIEF-------------------NLPRVATLPN-VLVTLRAVPIMRAMLRR   98
DSSP  EEEEEELLLLLLL-------------------LHHHHLLLLH-HHHHHHHHHHHHHHHHL


DSSP  LEEEEEEEELllllllllllllllhhHHHHHHHHH---HHLLEEEEEE-LLLLEEEllle
Query GYTAVAEFHYvhhdldgrsyadpaelSLRISRAAS---AAGIGLTLLP-VLYSHAGfggq  166
ident | | |                           |       |  |      |    |    
Sbjct GFTTVRDAGG---------------aGYPFKQAVEsglVEGPRLFVSGrALSQTGG---h  140
DSSP  LEEEEEELLL---------------lLHHHHHHHHlllLLLLEEEELLlEEELLLL---l


DSSP  eLLHH------------------hllLLLL----HHHHHHHHHHHHhhhhhhlleELEEE
Query pASEG------------------qrrFING----SEAYLELLQRLRapleaaghsLGLCF  204
ident                                                             
Sbjct aDPRArsdymppdspcgccvrvgalgRVADgvdeVRRAVREELQMG--------aDQIXI  192
DSSP  lLLLLlllllllllllllllllllleEELLlhhhHHHHHHHHHHHL--------lLLEEE


DSSP  LLLL------------LLLHHHHHHHHLL-LLLLLLEEEEELllhhhhhhhhhhhllLHH
Query HSLR------------AVTPQQIATVLAA-GHDDLPVHIHIAeqqkevddcqawsgrRPL  251
ident                       |    |        |  |                    
Sbjct MASGgvasptdpvgvfGYSEDEIRAIVAEaQGRGTYVLAHAY-------------tpAAI  239
DSSP  ELLLllllllllllllLLLHHHHHHHHHHhHLLLLLEEEEEL-------------lhHHH


DSSP  HHHHhHLLLlllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------
Query QWLYeNVAVdqrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLG-------------  298
ident         |       |    |       |  ||     | |   |              
Sbjct ARAV-RCGV---RTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesi  295
DSSP  HHHH-HLLL---LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhh


DSSP  ------LLLL--LHHHHHHLLLEEEELLLLL---LLLLHhHHHHHHHHHhhhhhllllll
Query ------DGIF--PATDFLAQGGRLGIGSDSH---VSLSVvEELRWLEYGqrlrdrkrnrl  347
ident        |            |   | | |       |    | | |              
Sbjct akiadvHGAGlhSIEIMKRAGVKMGFGTDLLgeaQRLQS-DEFRILAEV-----------  343
DSSP  llhhhhHLLHhhHHHHHHHHLLLLLLLLLLLhhhHHHLL-HHHHHHHLL-----------


DSSP  lllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLllhhhhllllhhHH
Query yrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGndpylasaegdaLL  405
ident                |    |  ||     |    |  || || ||              
Sbjct ------lSPAEVIASATIVSAEVLGMqdKLGRIVPGAHADVLVVDG------------NP  385
DSSP  ------lLHHHHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELL------------LL


DSSP  HHHHHHLL--HHHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl
Query NRWLFAGG--DRQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
ident                 ||  ||  |                       
Sbjct LKSVDCLLgqGEHIPLVMKDGRLFVNE-------------------le  414
DSSP  LLLLLLLLllLLLLLEEEELLEEEEEL-------------------ll


No 11: Query=4rdvB Sbjct=2imrA Z-score=26.0

back to top
DSSP  -LEEEEEE-eEELL-EEEEEEEEEELlllleEEEE---LLLL---LLLLEELLLL--EEE
Query -SAIFAER-aLLPE-GWARNVRFEISadgvlAEIR---PDAN---ADGAERLGGA--VLP   49
ident           |         |                 ||        |          |
Sbjct hTPRLLTCdvLYTGaQSPGGVVVVGE-----TVAAaghPDELrrqYPHAAEERAGavIAP   55
DSSP  lLEEEEEEleEELLeELLEEEEEELL-----EEEEeelHHHHhhhLLLLEEEELLleELL


DSSP  LEEEEEELHHHhhhllllllllllllLHHHHHHHHHHHHLLllhhHHHHHHHHHHHHHHH
Query GMPNLHSHAFQramaglaevagnpndSFWTWRELMYRMVARlspeQIEVIACQLYIEMLK  109
ident    | | |                      |                   |         
Sbjct PPVNAHTHLDM-------sayefqalPYFQWIPEVVIRGRH---lRGVAAAQAGADTLTR  105
DSSP  LLLEEEEELLL-------lhhhhhhlHHHHLLHHHHHHHLL---lLHHHHHHHHHHHHHH


DSSP  HLEEEEEEEELLLllllllllllllHHHHHHHHHHhhhLLEEEEEELLLLEeellLEELl
Query AGYTAVAEFHYVHhdldgrsyadpaELSLRISRAAsaaGIGLTLLPVLYSHagfgGQPAs  169
ident  |   |                   |                ||                
Sbjct LGAGGVGDIVWAP------------EVMDALLARE---DLSGTLYFEVLNP----FPDK-  145
DSSP  LLLLLEEEEELLH------------HHHHHHHLLL---LLLEEEEEEELLL----LHHH-


DSSP  hhhlllllLHHHHHHHHHHHHHHHHhHLLEELEEELLLLLLLHHHHHHHHLL-LLLLLLE
Query egqrrfinGSEAYLELLQRLRAPLEaAGHSLGLCFHSLRAVTPQQIATVLAA-GHDDLPV  228
ident            |    | | |      |  |||  |    |                || 
Sbjct -----adeVFAAARTHLERWRRLER-PGLRLGLSPHTPFTVSHRLMRLLSDYaAGEGLPL  199
DSSP  -----hhhHHHHHHHHHHHHHLLLL-LLEEEEEEELLLLLLLHHHHHHHHHHhHHHLLLL


DSSP  EEEELLLHHHHHHHH-------------------------HHHL-LLHHHHHHHHL-LLL
Query HIHIAEQQKEVDDCQ-------------------------AWSG-RRPLQWLYENV-AVD  261
ident  || ||   |                                     |   | |      
Sbjct QIHVAEHPTELEMFRtgggplwdnrmpalyphtlaevigrEPGPdLTPVRYLDELGvLAA  259
DSSP  EEEELLLHHHHHHHHhlllllhhhllhhhllllhhhhhllLLLLlLLHHHHHHHHLlHHH


DSSP  LlEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL
Query QrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLGDGIFPATDFLAQGGRLGIGSDSH  321
ident     |||     |   |  || |     |      |  | |    | | |     | || 
Sbjct R-PTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGVEVALGTDSV  318
DSSP  L-LEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLLHHHHHHLLLLEEELLLLH


DSSP  ---LLLLHHHHHHHHHHHHhhhhlllLLLLllllllhHHHHHHHHHHHHHHHHLlllLLL
Query ---VSLSVVEELRWLEYGQrlrdrkrNRLYrddqpmiGRTLYDAALAGGAQALGqpiGSL  378
ident      | | ||                 |         | |  ||  ||    |      
Sbjct asgETLNVREEVTFARQLY-------PGLD-------PRVLVRAAVKGGQRVVG---TPF  361
DSSP  hhhLLLLLHHHHHHHHHHL-------LLLL-------HHHHHHHHHHHHHHHHL---LLL


DSSP  LL--lllllEEEEllllhhhhllllhhhhhhhhhhllhHHEEeeeelleeeelllllllh
Query AV--grradLLVLdgndpylasaegdallnrwlfaggdRQVRdvmvagrwvvrdgrhage  436
ident                                          |                  
Sbjct LRrgetwqeGFRW-------------------------ELSR------------------  378
DSSP  LLllllllhHHLH-------------------------HHLL------------------


DSSP  hhhhhhhhhhhhhhl
Query ersarafvqvlgell  451
ident                
Sbjct -------------dl  380
DSSP  -------------ll


No 12: Query=4rdvB Sbjct=4c5yA Z-score=25.1

back to top
DSSP  -----LEEEEEEEEE-LLEEEEEEEEEELLlLLEEEEELLLL-------llLLEELLLLE
Query -----SAIFAERALL-PEGWARNVRFEISAdGVLAEIRPDAN-------adGAERLGGAV   47
ident        | |           ||    ||     |     |                   
Sbjct deakvTIIYAGLLIPgDGEPLRNAALVISD-KIIAFVGSEADipkkylrstQSTHRVPVL   59
DSSP  lllleEEEEEEEELLlLLLLEEEEEEEEEL-LEEEEEEEHHHllhhhhhhlLLEEEEEEE


DSSP  EELEEEEEELHHHhhhlllllllllllllhhhhhHHHHHHHLLLLHHHHHHHHHHHHHHH
Query LPGMPNLHSHAFQramaglaevagnpndsfwtwrELMYRMVARLSPEQIEVIACQLYIEM  107
ident  ||    | |                           |       |            | 
Sbjct MPGLWDCHMHFGG-----------------dddyYNDYTSGLATHPASSGARLARGCWEA  102
DSSP  EELEEEEEELLLL-----------------llllLLLLHHHHHLLHHHHHHHHHHHHHHH


DSSP  HHHLEEEEEEEELllllllllllllllhHHHHHHHHHH---HHLLEEEEEE-LLLLEEE-
Query LKAGYTAVAEFHYvhhdldgrsyadpaeLSLRISRAAS---AAGIGLTLLP-VLYSHAG-  162
ident |  |||                             |       |         |   || 
Sbjct LQNGYTSYRDLAG---------------YGCEVAKAINdgtIVGPNVYSSGaALSQTAGh  147
DSSP  HHLLEEEEEELLL---------------LHHHHHHHHHlllLLLLEEEELLlEEELLLLl


DSSP  -----llleeLLHHHL-------------LLLL----LHHHHHHHHHHHHhhhhhhlleE
Query -----fggqpASEGQR-------------RFIN----GSEAYLELLQRLRapleaaghsL  200
ident                                |            |  |            
Sbjct gdifalpageVLGSYGvmnprpgywgagpLCIAdgveEVRRAVRLQIRRG--------aK  199
DSSP  lllllllhhhHHHHHLlllllllllllllEEELllhhHHHHHHHHHHHHL--------lL


DSSP  LEEELLLL------------LLLHHHHHHHHLL-LLLLLLEEEEELllhhhhhhhhhhhl
Query GLCFHSLR------------AVTPQQIATVLAA-GHDDLPVHIHIAeqqkevddcqawsg  247
ident                        |                |  |                
Sbjct VIXVMASGgvmsrddnpnfaQFSPEELKVIVEEaARQNRIVSAHVH-------------g  246
DSSP  LEEEELLLllllllllllllLLLHHHHHHHHHHhHHLLLLEEEEEL-------------l


DSSP  lLHHHHHHhHLLLlllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL---------
Query rRPLQWLYeNVAVdqrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLG---------  298
ident                   | |   ||      |   |       |               
Sbjct kAGIMAAI-KAGC---KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLasngeglvk  302
DSSP  hHHHHHHH-HHLL---LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllll


DSSP  ---------LLLL--LHHHHHHLLLEEEELLLLL-lLLLHhHHHHHHHHHHHhhhlllll
Query ---------DGIF--PATDFLAQGGRLGIGSDSH-vSLSVvEELRWLEYGQRlrdrkrnr  346
ident                        |     | |          ||                
Sbjct eswaklqalADSHlkAYQGAIKAGVTIALGTDTApgGPTA-LELQFAVERGG--------  353
DSSP  lhhhlllhhHHHHhhHHHHHHHLLLLEELLLLLLllLLLH-HHHHHHHHLLL--------


DSSP  llllllllHHHHHHHHHHHHHHHHH---LLLLLLLLLLLLLLEEEELLllhhhhllllhh
Query lyrddqpmIGRTLYDAALAGGAQAL---GQPIGSLAVGRRADLLVLDGndpylasaegda  403
ident                || |             | |  |  ||   |              
Sbjct -------mTPLEAIKAATANAPLSVgpqAPLTGQLREGYEADVIALEE------------  394
DSSP  -------lLHHHHHHHHLLLHHHHHhhhLLLLLLLLLLLLLLEEEELL------------


DSSP  HHHHHHHH-LLHHHEEEEEELLEEEELLlLLLLhhhhhhhhhhhhhhhl
Query LLNRWLFA-GGDRQVRDVMVAGRWVVRDgRHAGeersarafvqvlgell  451
ident               |  |   |                           
Sbjct NPLEDIKVfQEPKAVTHVWKGGKLFKGPgIGPW-------gedarnpfl  436
DSSP  LLLLLHHHhHLHHHEEEEEELLEEEELLlLLLL-------lllllllll


No 13: Query=4rdvB Sbjct=3icjA Z-score=24.9

back to top
DSSP  --LEEEEEEEEEL---LEEEeeEEEEELlLLLEEEEELL-LLLL-------LLEELL-LL
Query --SAIFAERALLP---EGWArnVRFEISaDGVLAEIRPD-ANAD-------GAERLG-GA   46
ident    |                      ||                           |    
Sbjct cmKALINGTIYTSfspVKKV--SGLVIS-NERVLYAGDSsTALRiaelaggEIIDLKgKF   57
DSSP  leEEEELLEEEEEellEEEE--LEEEEE-LLEEEEEELHhHHHHhhhhhllEEEELLlLE


DSSP  EEELEEEEEELHHHHHHL--------------------------lLLLLLL---------
Query VLPGMPNLHSHAFQRAMA--------------------------gLAEVAG---------   71
ident | |     | |     |                                           
Sbjct VMPAFFDSHLHLDELGMSlemvdlrgvksmeelvervkkgrgriiFGFGWDqdelgrwpt  117
DSSP  EEELEEEEEELHHHHHHHhhleellllllhhhhhhhhhlllllleEEEEELhhhhlllll


DSSP  --------------LLLLL----------------------------hhhhHHHHHHHHL
Query --------------NPNDS----------------------------fwtwRELMYRMVA   89
ident                                                     |       
Sbjct redldvidrpvflyRRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIINE  177
DSSP  hhhhlllllleeeeELLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHHH


DSSP  -LLLHHHHHHHHHHHHHHHHHHLEEEEEEEELLLllllllllllllHHHHHHHHH--hHH
Query -RLSPEQIEVIACQLYIEMLKAGYTAVAEFHYVHhdldgrsyadpaELSLRISRA--aSA  146
ident   |                |  |   |                                 
Sbjct kILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE------------KALKALFELereGR  225
DSSP  lLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH------------HHHHHHHHHhhlLL


DSSP  HLLEEEEEELLlleeellleellhhhllllllhhHHHHHH---HHHHhhHHHHLLE-ELE
Query AGIGLTLLPVLyshagfggqpasegqrrfingseAYLELL---QRLRapLEAAGHS-LGL  202
ident                                     |  |          |       | 
Sbjct LKMNVFAYLSP-----------------------ELLDKLeelNLGK--FEGRRLRiWGV  260
DSSP  LLLEEEEEELH-----------------------HHHHHHhhhLLLL--EELLLEEeEEE


DSSP  EeLLLL------------------------LLLHHHHHHHHL--LLLLlLLEEEEELllh
Query CfHSLR------------------------AVTPQQIATVLA--AGHDdLPVHIHIAeqq  236
ident                                     |  |         | |  |     
Sbjct X-LFVDgslgartallsepytdnpttsgelVMNKDEIVEVIEraKPLG-LDVAVHAI---  315
DSSP  E-EELLllllllllllllllllllllllllLLLHHHHHHHHHhhLLLL-LEEEEEEL---


DSSP  hhhhhhhhhhllLHHHHHHH---HLLLLllEEEEELLLLLHHHHHHHHHHLLEEEELHHh
Query kevddcqawsgrRPLQWLYE---NVAVDqrWCLVHATHADPAEVAAMARSGAVAGLCLSt  293
ident                                   ||                        
Sbjct ----------gdKAVDVALDafeEAEFS--GRIEHASLVRDDQLERIKELKVRISAQPH-  362
DSSP  ----------lhHHHHHHHHhhhHHLLL--LEEEELLLLLHHHHHHHHHHLLEEEELLL-


DSSP  HHHLL------------llLLLHHHHHHlLLEEEELLLLLL-LLLHHHHHHHHHHHhHHH
Query EANLG------------dgIFPATDFLAqGGRLGIGSDSHV-SLSVVEELRWLEYGqRLR  340
ident                                 ||   ||                     
Sbjct FIVSDwwivnrvgeerakwAYRLKTLSS-ITKLGFSTDSPIePADPWVSIDAAVNR-YVV  420
DSSP  HHHHLllhhhhhhhhhhhhLLLHHHHHH-HLLEEELLLLLLlLLLHHHHHHHHHHL-LLL


DSSP  HllLLLLLllllllHHHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELLllhhhhll
Query DrkRNRLYrddqpmIGRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDGndpylasa  399
ident |                        | ||       | |  | ||    ||         
Sbjct D--PGERV------SREEALHLYTHGSAQVTLAeDLGKLERGFRAEYIILDR--------  464
DSSP  L--HHHLL------LHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEELL--------


DSSP  llhhHHHHhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query egdaLLNRwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                     
Sbjct ----DPLK--------------------------------------------  468
DSSP  ----LLLL--------------------------------------------


No 14: Query=4rdvB Sbjct=2vunA Z-score=24.1

back to top
DSSP  --LEEE-EEEEEE----LLEEEEeEEEEELlLLLEEEEElLLLLL------lLEELL-LL
Query --SAIF-AERALL----PEGWARnVRFEISaDGVLAEIRpDANAD------gAERLG-GA   46
ident     |                          ||  | |                      
Sbjct skTIIKnIGKIVSgdikSPVLQA-DTIVVE-DGLIAAIG-GEELMkdagdatIIDAAgST   57
DSSP  leEEEElLLEEELllllLLEELL-LEEEEE-LLEEEEEE-LHHHHlllllleEEELLlLE


DSSP  EEELEEEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhhHHHHH-----h
Query VLPGMPNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeqIEVIA-----c  101
ident | ||    | |                                          |      
Sbjct VTPGLLDTHVHVS------------------------------------GGDYAprqktm   81
DSSP  EEELEEEEEELLL------------------------------------LLLEEhhhlee


DSSP  HHHHHHHHHLEEEEEEEEL-LLLL---lllllllllLHHHHHHHHHhHHHLLEEEE-EEL
Query QLYIEMLKAGYTAVAEFHY-VHHD---ldgrsyadpAELSLRISRAaSAAGIGLTL-LPV  156
ident       |  | |                          ||     |   ||         
Sbjct DFISSALHGGVTTMISAGSpHFPGrpkdaagtkalaITLSKSYYNA-RPAGVKVHGgAVI  140
DSSP  LHHHHHHLLLEEEEEELLLlLLLLllllhhhhhhhhHHHHHHHHHL-LHHHLEEELlEEL


DSSP  LLLeeellleellhhhllllLLHHHHHHHHHHHHhhhhhhlleELEEELLLLLL-LHHHH
Query LYShagfggqpasegqrrfiNGSEAYLELLQRLRapleaaghsLGLCFHSLRAV-TPQQI  215
ident |                      |                          |     |   
Sbjct LEK-----------------GLTEEDFIEMKKEG--------vWIVGEVGLGTIkNPEDA  175
DSSP  LLL-----------------LLLHHHHHHHHHLL--------lLEEEEELLLLLlLHHHH


DSSP  HHHHLL-LLLLLLEEEEELlLHHHhHHHHhhhllLHHHHHHhHLLLlllEEEEELL----
Query ATVLAA-GHDDLPVHIHIAeQQKEvDDCQawsgrRPLQWLYeNVAVdqrWCLVHAT----  270
ident |            |  |                                    |      
Sbjct APMVEWaHKHGFKVQMHTG-GTSI-PGSS-----TVTADDV-IKTK--pDVVSHINggpt  225
DSSP  HHHHHHhHHLLLEEEEELL-LLLL-LLLL-----LLLHHHH-HHHL--lLEEELLLllll


DSSP  LLLHHHHHHHHH-HLLEEEELhHHHHhllLLLL--LHHHHHHLLL--EEEELLLLL----
Query HADPAEVAAMAR-SGAVAGLClSTEAnlgDGIF--PATDFLAQGG--RLGIGSDSH----  321
ident      ||                        |    |      |   |   | |      
Sbjct AISVQEVDRIMDeTDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPsgtg  281
DSSP  LLLHHHHHHHHHhLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLllll


DSSP  LLLL-HHHHHHHHHHhhhhhhlllLLLLllllllHHHHHHHHHHHHHHHHHLLLLLLLLL
Query VSLS-VVEELRWLEYgqrlrdrkrNRLYrddqpmIGRTLYDAALAGGAQALGQPIGSLAV  380
ident                                           |        |   |  | 
Sbjct LIPLgILRNMCQIAS---------MSDI------DPEVAVCMATGNSTAVYGLNTGVIAP  326
DSSP  LLLLhHHHHHHHHHH---------HLLL------LHHHHHHHHLHHHHHHHLLLLLLLLL


DSSP  LLLLLEEEELLLLHHhhllllhHHHHHHHH-HLLHhHEEEEEELLEEEELLLLlllhhhh
Query GRRADLLVLDGNDPYlasaegdALLNRWLF-AGGDrQVRDVMVAGRWVVRDGRhageers  439
ident |  |||   |                              |   |  ||   |       
Sbjct GKEADLIIMDTPLGS-----vaEDAMGAIAaGDIP-GISVVLIDGEAVVTKSR-------  373
DSSP  LLLLLEEEEELLLLL-----llLLHHHHHHhLLLL-EEEEEEELLEEEELLLL-------


DSSP  hhhhhhhhhhhl
Query arafvqvlgell  451
ident             
Sbjct ntppakraakil  385
DSSP  llllllllleel


No 15: Query=4rdvB Sbjct=3nqbA Z-score=23.9

back to top
DSSP  ------------------------LEEEEE-EEEELL--EEEEeEEEEELLlLLEEEEEL
Query ------------------------SAIFAE-RALLPE--GWARnVRFEISAdGVLAEIRP   33
ident                                                 |      |    
Sbjct epadlnddtlraravaaargdqrfDVLITGgTLVDVVtgELRP-ADIGIVG-ALIASVHE   58
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELlEEELLLllLEEE-LEEEEEL-LEEEEEEL


DSSP  LLLLLLL--EELL--LLEEELEEEEEELHHHHHhlllllllllllllhhhhhhhhhhhhl
Query DANADGA--ERLG--GAVLPGMPNLHSHAFQRAmaglaevagnpndsfwtwrelmyrmva   89
ident  |    |          | ||    | |                                
Sbjct PASRRDAaqVIDAggAYVSPGLIDTHXHIESSX---------------------------   91
DSSP  LLLLLLEeeEEELllLEEEELEEEEEELHHHHL---------------------------


DSSP  lllhhhhhHHHHHHHHHHHHHLEEEEEEEEL-LLLLlllllllllLHHHHHHHHHHHHHL
Query rlspeqieVIACQLYIEMLKAGYTAVAEFHY-VHHDldgrsyadpAELSLRISRAASAAG  148
ident                      | |                              |     
Sbjct --------ITPAAYAAAVVARGVTTIVWDPHeFGNV-------hgVDGVRWAAKAIENLP  136
DSSP  --------LLHHHHHHHHHLLLEEEEEELLHhHHHH-------hlHHHHHHHHHHHLLLL


DSSP  LEEEEEELLL-LEEEllleeLLHHHLLlLLLHHHHHHHHHHHHhhhhhhlleELEEELLL
Query IGLTLLPVLY-SHAGfggqpASEGQRRfINGSEAYLELLQRLRapleaaghsLGLCFHSL  207
ident     ||       |        |              ||              |      
Sbjct LRAILLAPSCvPSAP-----GLERGGA-DFDAAILADLLSWPE--------iGGIAEIXN  182
DSSP  LEEEEEELLLlLLLL-----LLLLLLL-LLLHHHHHHHHLLLL--------eEEEEEELL


DSSP  L---llLHHHHHHHHL--LLLLlLLEEEEELllhhhhhhhhhhhlllHHHH-HHHHLLll
Query R---avTPQQIATVLA--AGHDdLPVHIHIAeqqkevddcqawsgrrPLQW-LYENVAvd  261
ident                          |  |                   |           
Sbjct XrgvieRDPRXSGIVQagLAAE-KLVCGHAR----------------GLKNaDLNAFXaa  225
DSSP  HhhhhlLLHHHHHHHHhhHHHL-LEEEELLL----------------LLLHhHHHHHHhl


DSSP  llEEEEeLLLLLHhHHHHHHHHLLEEEELhHHHHhllLLLL-LHHHHHHL---LLEEEEL
Query qrWCLVhATHADPaEVAAMARSGAVAGLClSTEAnlgDGIF-PATDFLAQ---GGRLGIG  317
ident                  |  | |    |                                
Sbjct gvSSDH-ELVSGE-DLXAKLRAGLTIELR-GSHD---HLLPeFVAALNTLghlPQTVTLC  279
DSSP  llLEEL-LLLLHH-HHHHHHHLLLEEEEE-LLLH---HHHHhHHHHHHHHlllLLLEEEE


DSSP  LLLLL------LLLHHHHHHHHHHHHhhhhlllllllllllllHHHHHHHHHHHHHHHHH
Query SDSHV------SLSVVEELRWLEYGQrlrdrkrnrlyrddqpmIGRTLYDAALAGGAQAL  371
ident  |                 | |                            ||    || |
Sbjct TDDVFpddllqGGGLDDVVRRLVRYG----------------lKPEWALRAATLNAAQRL  323
DSSP  LLLLLhhhhhhLLLHHHHHHHHHHLL----------------lLHHHHHHHHLHHHHHHH


DSSP  LL-LLLLLLLLLLLLEEEELlllhhhhllllhhHHHHHhhhllhhHEEEEEELLEEEELL
Query GQ-PIGSLAVGRRADLLVLDgndpylasaegdaLLNRWlfaggdrQVRDVMVAGRWVVRD  430
ident |    |  | |||||  |                ||           | |   || |   
Sbjct GRsDLGLIAAGRRADIVVFE-------------DLNGF-------SARHVLASGRAVAEG  363
DSSP  LLlLLLLLLLLLLLLEEEEL-------------LLLLL-------LEEEEEELLEEEEEL


DSSP  LLL-LLHHH---------------------------------------------------
Query GRH-AGEER---------------------------------------------------  438
ident ||                                                          
Sbjct GRXlVDIPTcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkd  423
DSSP  LEElLLLLLlllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  438
ident                                                             
Sbjct gfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagd  483
DSSP  leellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhh


DSSP  -----------------hhhhhhhhhHHHL------------------------------
Query -----------------sarafvqvlGELL------------------------------  451
ident                             |                               
Sbjct xalaanavigtgggxavasegkvtaiLPLPlsglvsdapleevarafedlreavgkvvew  543
DSSP  hhhhhhhhhhllleeeeeelleeeeeEELLlllllllllhhhhhhhhhhhhhhhhhhlll


DSSP  --------------------------------------------
Query --------------------------------------------  451
ident                                             
Sbjct qppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  llllllhhhhhlllllllllleelllleeelllleeellleeel


No 16: Query=4rdvB Sbjct=1onxA Z-score=22.9

back to top
DSSP  ---------LEEEEEEEEELlEEEEEEEEEELlLLLEEEEEllLLLLL-------LEEL-
Query ---------SAIFAERALLPeGWARNVRFEISaDGVLAEIRpdANADG-------AERL-   43
ident                    |              |         |             | 
Sbjct midytaagfTLLQGAHLYAP-EDRGICDVLVA-NGKIIAVA--SNIPSdivpnctVVDLs   56
DSSP  llllhhhllEEEEEEEEELL-LEEEEEEEEEE-LLEEEEEE--LLLLLlllllleEEELl


DSSP  LLLEEELEEEEEELHHHhhhlllllllllllllhhhhhhhHHHHHLLLlhhhhhHHHHhh
Query GGAVLPGMPNLHSHAFQramaglaevagnpndsfwtwrelMYRMVARLspeqieVIACql  103
ident |    ||    | |                                              
Sbjct GQILCPGFIDQHVHLIG---------------------ggGEAGPTTR-----tPEVA--   88
DSSP  LLEEEELEEEEEELLLL---------------------llLLLLHHHL-----lLLLL--


DSSP  HHHHHHHLEEEEEEEEL-LLLLlllllllllLHHHHHHHHHHHHHLLEEEEEE-LLLLee
Query YIEMLKAGYTAVAEFHY-VHHDldgrsyadpAELSLRISRAASAAGIGLTLLP-VLYSha  161
ident       || | |                    |  |   ||    ||    |        
Sbjct LSRLTEAGVTSVVGLLGtDSIS-------rhPESLLAKTRALNEEGISAWMLTgAYHV--  139
DSSP  HHHHHHLLEEEEEELLLlLLLL-------llHHHHHHHHHHHHHHLLEEEEEEeLLLL--


DSSP  ellleellhhhlllLLLH--HHHHHHHHHHHhhhhhhllEELEEELLL----LLLL-HHH
Query gfggqpasegqrrfINGS--EAYLELLQRLRapleaaghSLGLCFHSL----RAVT-PQQ  214
ident                                                      |      
Sbjct --------------PSRTitGSVEKDVAIID--------RVIGVXCAIsdhrSAAPdVYH  177
DSSP  --------------LLLLllLLHHHHHHHLL--------LEEEEEEEEllllLLLLlHHH


DSSP  HHHHHLL--LLLL-----LLEEEEELllhhHHHHhhhhhlllHHHHHhHHLL-----LLL
Query IATVLAA--GHDD-----LPVHIHIAeqqkEVDDcqawsgrrPLQWLyENVA-----VDQ  262
ident  |   |                 |                   ||               
Sbjct LANMAAEsrVGGLlggkpGVTVFHMG----DSKK--------ALQPI-YDLLencdvPIS  224
DSSP  HHHHHHHhhHHHHhhlllLEEEEEEL----LLLL--------LLHHH-HHHHhllllLHH


DSSP  LEEEEELL----LLLHhHHHHHHHHLLeEEELhHHHHhlLLLL--LLHHHHH-HLLL--E
Query RWCLVHAT----HADPaEVAAMARSGAvAGLClSTEAnlGDGI--FPATDFL-AQGG--R  313
ident      |                   |       |                   |     |
Sbjct KLLPTHVNrnvpLFEQ-ALEFARKGGT-IDIT-SSID--EPVApaEGIARAVqAGIPlaR  279
DSSP  HEEEELHHhlhhHHHH-HHHHHHLLLL-EEEE-LLLL--LLLLhhHHHHHHHhLLLLhhH


DSSP  EEELLLLL-----------------LLLL-HHHHHHHHhhhhhhhhlllLLLLllllllH
Query LGIGSDSH-----------------VSLS-VVEELRWLeygqrlrdrkrNRLYrddqpmI  355
ident     ||                          |    |                      
Sbjct VTLSSDGNgsqpffddegnlthigvAGFEtLLETVQVL---------vkDYDF------S  324
DSSP  EEEELLLLleeeeellllleeeeeeLLLHhHHHHHHHH---------hhHHLL------L


DSSP  HHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELLllhhhhllllhhhhhhhhhhllh
Query GRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDGndpylasaegdallnrwlfaggd  414
ident             |  |     |    |  |||||                          
Sbjct ISDALRPLTSSVAGFLNLtGKGEILPGNDADLLVMTP----------------------e  362
DSSP  HHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEELL----------------------l


DSSP  hHEEEEEELLEEEELLLLLLLHhHHHHhhhhhhhhhl
Query rQVRDVMVAGRWVVRDGRHAGEeRSARafvqvlgell  451
ident      |   |   | ||                    
Sbjct lRIEQVYARGKLMVKDGKACVKgTFET---------d  390
DSSP  lLEEEEEELLEEEEELLEELLLlLLLL---------l


No 17: Query=4rdvB Sbjct=1yrrB Z-score=22.2

back to top
DSSP  LEEEEEEEEELLEEEEEEEEEELlLLLEEEEELLLL---lLLLEELL-LLEEELEEEEEE
Query SAIFAERALLPEGWARNVRFEISaDGVLAEIRPDAN---aDGAERLG-GAVLPGMPNLHS   56
ident  |    |              |  ||      | |          |      ||      
Sbjct YALTQGRIFTGHEFLDDHAVVIA-DGLIKSVCPVAElppeIEQRSLNgAILSPGFIDVQL   59
DSSP  LEEELLEEELLLLEELLEEEEEE-LLEEEEEEEHHHllllLLEEELLlLEEEELEEEEEE


DSSP  LhhHHHHlllllllllllllhhhhhhhhhhhHLLLLHhhHHHHHHHHHHHHHHHLEEEEE
Query HafQRAMaglaevagnpndsfwtwrelmyrmVARLSPeqIEVIACQLYIEMLKAGYTAVA  116
ident                                                     | | |   
Sbjct N--GCGG--------------------vqfnDTAEAV--SVETLEIMQKANEKSGCTNYL   95
DSSP  L--EELL--------------------eellLLLLLL--LHHHHHHHHHHHHLLLEEEEE


DSSP  EEELLLLllllllllllLHHHHHHHHHHHHHLLE-EEEEELLLLeeellleellhhhlll
Query EFHYVHHdldgrsyadpAELSLRISRAASAAGIG-LTLLPVLYShagfggqpasegqrrf  175
ident                                    | |                      
Sbjct PTLITTS------delmKQGVRVMREYLAKHPNQaLGLHLEGPW----------------  133
DSSP  EEELLLL------hhhhHHHHHHHHHHHHHLLLLlLLEEEELLL----------------


DSSP  lllhHHHHHHHHHHHhhhhhhllEELEEELLLllLLHHhhHHHHLL-lLLLLLEEEEEll
Query ingsEAYLELLQRLRapleaaghSLGLCFHSLraVTPQqiATVLAA-gHDDLPVHIHIae  234
ident      |    |                             | |          |      
Sbjct --lnAALVDFLCENA-------dVITKVTLAP--EMVP--AEVISKlaNAGIVVSAGH--  178
DSSP  --llLHHHHHHHHLH-------hHEEEEEELH--HHLL--HHHHHHhhHHLLEEEELL--


DSSP  lhhhhhhhhhhhllLHHHHHHHHLLllllEEEEELL--LLLH-----hHHHHHHHH-LLE
Query qqkevddcqawsgrRPLQWLYENVAvdqrWCLVHAT--HADP-----aEVAAMARS-GAV  286
ident                                  |                 |        
Sbjct -------------sNATLKEAKAGFragiTFATHLYnaMPYItgrepgLAGAILDEaDIY  225
DSSP  -------------lLLLHHHHHHHHhhleEEELLLLllLLLLlllllhHHHHHHHLlLLE


DSSP  EEELHHhhhhlLLLLL-LHHHHHHLLL-EEEELLLLL--LLLLHHHHHHHHHHHHHhhhl
Query AGLCLSteanlGDGIF-PATDFLAQGG-RLGIGSDSH--VSLSVVEELRWLEYGQRlrdr  342
ident  |                        |  |    |     ||   |  | |         
Sbjct CGIIAD----gLHVDYaNIRNAKRLKGdKLCLVTDATsgSSLTMIEGVRNLVEHCG----  277
DSSP  EEEELL----lLLLLHhHHHHHHHHHHhHEEEELLLLllLLLLHHHHHHHHHHHHL----


DSSP  llllllllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEEllllhhhhlll
Query krnrlyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLdgndpylasae  400
ident                     |    | | |     | || |  | |              
Sbjct -----------iALDEVLRMATLYPARAIGVekRLGTLAAGKVANLTAF-----------  315
DSSP  -----------lLHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLLEEEE-----------


DSSP  lhhhHHHHhhhllhhHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl
Query gdalLNRWlfaggdrQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
ident                      | |  ||                       
Sbjct ----TPDF-------KITKTIVNGNEVVTQ---------------------  334
DSSP  ----LLLL-------LEEEEEELLEEEEEL---------------------


No 18: Query=4rdvB Sbjct=1a4mA Z-score=21.3

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHH
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFQ   60
ident                                                      || |   
Sbjct -------------------------------------------tpafNKPKVELHVHLDG   17
DSSP  -------------------------------------------llllLLLEEEEEEEHHH


DSSP  HHH------------------------llLLLLlllllLLHHHHHHHHHHHHLLL--LHH
Query RAM------------------------agLAEVagnpnDSFWTWRELMYRMVARL--SPE   94
ident                                        |                   |
Sbjct AIKpetilyfgkkrgialpadtveelrniIGMD---kpLSLPGFLAKFDYYMPVIagCRE   74
DSSP  LLLhhhhhhhhhhhllllllllhhhhhhhHLLL---llLLHHHHHLLHHHHHHHHllLHH


DSSP  HHHHHHHHHHHHHHHHLEEEEEEEEL--LLLL-------LLLL-lLLLLLHHHHHHHHHH
Query QIEVIACQLYIEMLKAGYTAVAEFHY--VHHD-------LDGR-sYADPAELSLRISRAA  144
ident  |  ||        | |   |                           |           
Sbjct AIKRIAYEFVEMKAKEGVVYVEVRYSphLLANskvdpmpWNQTegDVTPDDVVDLVNQGL  134
DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELlhHHLLllllllhHHLLllLLLHHHHHHHHHHHH


DSSP  HHHL----LEEEEEELLLLEEellleellhhhlllllLHHHHHHHHHHHHhhhhhhLLEE
Query SAAG----IGLTLLPVLYSHAgfggqpasegqrrfinGSEAYLELLQRLRapleaaGHSL  200
ident         |          |                  |   |||               
Sbjct QEGEqafgIKVRSILCCMRHQ--------------psWSLEVLELCKKYN-----qKTVV  175
DSSP  HHHHhhhlLEEEEEEEEELLL--------------hhHHHHHHHHHHHLL-----lLLEE


DSSP  LEEELL----lLLLLHHHHHHHHLL--LLLLLlEEEEELLLHhhhhhhhhhhllLHHHHH
Query GLCFHS----lRAVTPQQIATVLAA--GHDDLpVHIHIAEQQkevddcqawsgrRPLQWL  254
ident                                     |  |                    
Sbjct AMDLAGdetieGSSLFPGHVEAYEGavKNGIH-RTVHAGEVG----------spEVVREA  224
DSSP  EEEEELlllllLHHHLHHHHHHHHHhhHHLLE-EEEEELLLL----------lhHHHHHH


DSSP  HHHLLLlllEEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHLLLL----lLLHHHHH
Query YENVAVdqrWCLVHATHA--DPAEVAAMARSGAVAGLCLSTEANLGDG----iFPATDFL  308
ident              |  |   | |              |       |            | 
Sbjct VDILKT---ERVGHGYHTieDEALYNRLLKENMHFEVCPWSSYLTGAWdpkttHAVVRFK  281
DSSP  HHLLLL---LEEEELHHHhhLHHHHHHHHHLLLEEEELHHHHHHLLLLlllllLHHHHHH


DSSP  HLLLEEEELLLLL---LLLLhHHHHHHHHHHHHhhhlllllllllllllHHHHHHHHHHH
Query AQGGRLGIGSDSH---VSLSvVEELRWLEYGQRlrdrkrnrlyrddqpmIGRTLYDAALA  365
ident           |      |                                          
Sbjct NDKANYSLNTDDPlifKSTL-DTDYQMTKKDMG----------------FTEEEFKRLNI  324
DSSP  HLLLLEEELLLLLlllLLLH-HHHHHHHHHLLL----------------LLHHHHHHHHH


DSSP  HHHHHHLLL-----lLLLLlllllleeeellllhhhhllllhhhhhhhhhhllhhheeee
Query GGAQALGQP-----iGSLAvgrradllvldgndpylasaegdallnrwlfaggdrqvrdv  420
ident   |     |                                                   
Sbjct NAAKSSFLPeeekkeLLER-----------------------------------------  343
DSSP  HHHHLLLLLhhhhhhHHHH-----------------------------------------


DSSP  eelleeeelllllllhhhhhhhhhhhhhhhl
Query mvagrwvvrdgrhageersarafvqvlgell  451
ident                                
Sbjct -------------------------lyreyq  349
DSSP  -------------------------hhhhll


No 19: Query=4rdvB Sbjct=3ooqA Z-score=20.1

back to top
DSSP  -LEEEEEEEEE-LLEEEEeEEEEELlLLLEEEEELlLLLL---LLEEL-LLLEEELEEEE
Query -SAIFAERALL-PEGWARnVRFEISaDGVLAEIRPdANAD---GAERL-GGAVLPGMPNL   54
ident                         |  |           |       | |    ||    
Sbjct kILFKNATVFPiTSRPFK-GDVLVS-NGKVEKVGE-NIEDpdaEIVDLtGKFLFPGFVDA   57
DSSP  lEEEEEEEELLlLLLLEE-EEEEEE-LLEEEEEEL-LLLLlllEEEELlLLEEEELEEEE


DSSP  EELH-HHHHHlllllllllllllhhhhhhhHHHHH------------llllhhhHHHHhh
Query HSHA-FQRAMaglaevagnpndsfwtwrelMYRMV------------arlspeqIEVIac  101
ident |||                            |                            
Sbjct HSHIgLFEEG-------------------vGYYYSdgneatdpvtphvkaldgfNPQD--   96
DSSP  EELLlLLLLL-------------------lLHHHLllllllllllllllhhhhlLLLL--


DSSP  HHHHHHHHHLEEEEEEEELllllllllllllllhhhhHHHHHHhhhlleeeeeellllee
Query QLYIEMLKAGYTAVAEFHYvhhdldgrsyadpaelslRISRAAsaagigltllpvlysha  161
ident       |  | | |                        |                     
Sbjct PAIERALAGGVTSVXIVPG--sanpvggqgsvikfrsIIVEEC-----------------  137
DSSP  HHHHHHHLLLEEEEEELLL--lllleeeeeeeeelllLLHHHH-----------------


DSSP  ellleellhhhllllllhhhhhhhhhhhhhhhhhhLLEE-LEEELL-LLLL---------
Query gfggqpasegqrrfingseaylellqrlrapleaaGHSL-GLCFHS-LRAV---------  210
ident                                                             
Sbjct -----------------------------------IVKDpAGLKXAfGENPkrvygerkq  162
DSSP  -----------------------------------EEEEeEEEEEElLHHHhhhhhhlll


DSSP  -------LHHHHHHHH----------------------------LLLL---LLLLEEEEE
Query -------TPQQIATVL----------------------------AAGH---DDLPVHIHI  232
ident        |   |                                          |   | 
Sbjct tpstrxgTAGVIRDYFtkvknyxkkkelaqkegkeftetdlkxeVGEXvlrKKIPARXHA  222
DSSP  llllhhhHHHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhHHHHhhlLLLLEEEEE


DSSP  LllhhhhhhhhhhhllLHHHHHHHHLL-lllLEEEEELLLLLHhHHHHHHHHLLEEEELH
Query AeqqkevddcqawsgrRPLQWLYENVA-vdqRWCLVHATHADPaEVAAMARSGAVAGLCL  291
ident                                     | | |        |          
Sbjct H-------------raDDILTAIRIAEefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGP  268
DSSP  L-------------lhHHHHHHHHHHHhhllLEEEEELLLHHH-HHHHHHHHLLLEEELL


DSSP  hhHHHLL------LLLL-LHHHHHHLLLEEEELLLLLLLL--LHHHHHHHHHHhhhhhhl
Query stEANLG------DGIF-PATDFLAQGGRLGIGSDSHVSL--SVVEELRWLEYgqrlrdr  342
ident              |         |  |       |  |                      
Sbjct --LLTFRtklelkDLTXeTIAKLLKDGVLIALXCDHPVIPleFATVQAATAXR-------  319
DSSP  --LLLLLllhhhlLLLLlHHHHHHHLLLLEEELLLLLLLLhhHHHHHHHHHHH-------


DSSP  llLLLLllllllhHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLllhhhhlll
Query krNRLYrddqpmiGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGndpylasae  400
ident                 |        |  ||    |||   |  ||| |  |         
Sbjct --YGAK-------EEDLLKILTVNPAKILGLedRIGSIEPGKDADLVVWSG---------  361
DSSP  --HLLL-------HHHHHHLLLHHHHHHLLLllLLLLLLLLLLLLEEEELL---------


DSSP  lhhhhhhHHHHLLhhHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl
Query gdallnrWLFAGGdrQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
ident                 |  |   |  | |                      
Sbjct ------hPFDXKS--VVERVYIDGVEVFRR--------------------e  384
DSSP  ------lLLLLLL--LEEEEEELLEEEEEL--------------------l


No 20: Query=4rdvB Sbjct=3giqA Z-score=19.9

back to top
DSSP  ----LEEEEEEEEE--LLEEEEeEEEEELlLLLEEEEEllLLLLL----LEELL-LLEEE
Query ----SAIFAERALL--PEGWARnVRFEISaDGVLAEIRpdANADG----AERLG-GAVLP   49
ident       |              |        ||  | |            |       | |
Sbjct ekldFKITGGWIIDgtGAPRRR-ADLGVR-DGRIAAIG--ELGAHparhAWDASgKIVAP   56
DSSP  lleeEEEELLEELLllLLLLEE-LEEEEE-LLEEEEEE--LLLLLleeeEEELLlLEEEE


DSSP  LEEEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhhHHHHHHHhHHHHHH
Query GMPNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeqIEVIACQlYIEMLK  109
ident |    | |                                        |           
Sbjct GFIDVHGHDD-----------------------------------lMFVEKPD-LRWKTS   80
DSSP  LEEELLLLLL-----------------------------------lHHHHLLL-LHHHHL


DSSP  HLEEEEEEE---ELLL-LLLL-----------lllllLLLHHHHHHHHhhhHHLLEEEEE
Query AGYTAVAEF---HYVH-HDLD-----------grsyaDPAELSLRISRaasAAGIGLTLL  154
ident  | | |             |                                  |    |
Sbjct QGITTVVVGncgVSAApAPLPgntaaalallgetplfADVPAYFAALD-aqRPMINVAAL  139
DSSP  LLEEEEEELlllLLLLlLLLLllllhhhhhhllllllLLHHHHHHHHH-hlLLLLEEEEE


DSSP  ELLLleeellleELLH--hhlllllLHHHHHHHHHHHhhhhhhhlleELEEELLLLL---
Query PVLYshagfggqPASE--gqrrfinGSEAYLELLQRLrapleaaghsLGLCFHSLRA---  209
ident                                  |                    |     
Sbjct VGHAnlrlaamrDPQAaptaaeqqaMQDMLQAALEAG----------AVGFSTGLAYqpg  189
DSSP  EEHHhhhhhhllLLLLlllhhhhhhHHHHHHHHHHHL----------LLEEEEELLLllh


DSSP  --LLHHHHHHHHLL-LLLLLLEEEEELLLHHHHhhhhhhhllLHHHHHHhHLLL--llLE
Query --VTPQQIATVLAA-GHDDLPVHIHIAEQQKEVddcqawsgrRPLQWLYeNVAV--dqRW  264
ident                         ||      |                           
Sbjct avAQAAELEGLARVaAERRRLHTSHIRNEADGV--------eAAVEEVL-AIGRgtgcAT  240
DSSP  hhLLHHHHHHHHHHhHHLLLEEEEELLLLLLLH--------hHHHHHHH-HHHHhhllEE


DSSP  EEEELLL-------lLHHHHHHHHHHL-----LEEEELHhhHHHL---------------
Query CLVHATH-------aDPAEVAAMARSG-----AVAGLCLstEANL---------------  297
ident    |             |  |   |                                   
Sbjct VVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYP--YPGSstiliperaetiddi  298
DSSP  EELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELL--LLEEeeellhhhlllllll


DSSP  ------------------------------------------LLLL----LLHHhhhhlL
Query ------------------------------------------GDGI----FPATdflaqG  311
ident                                                             
Sbjct ritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEdevkRIFQ-----H  353
DSSP  eeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHhhhhHHHH-----L


DSSP  LEEEELLLLL--------LLLL-HHHHHHHHHhhhhhhhlllLLLLllllllHHHHHHHH
Query GRLGIGSDSH--------VSLS-VVEELRWLEygqrlrdrkrNRLYrddqpmIGRTLYDA  362
ident      |||                   |               ||               
Sbjct PCCMVGSDGLpndarphpRLWGsFTRVLGRYV--------reARLM------TLEQAVAR  399
DSSP  LLEEELLLLLllllllllHHHHhHHHHHHHHH--------hhLLLL------LHHHHHHH


DSSP  HHHHHHHHHLL-LLLLLLLLLLLLEEEELlllhhhhllllhhhHHHHH-------hhlLH
Query ALAGGAQALGQ-PIGSLAVGRRADLLVLDgndpylasaegdalLNRWL-------fagGD  414
ident   |  |   |    | |  |  ||  | |                               
Sbjct MTALPARVFGFaERGVLQPGAWADVVVFD--------------PDTVAdratwdeptlAS  445
DSSP  HLHHHHHHHLLlLLLLLLLLLLLLEEEEL--------------LLLLLllllllllllLL


DSSP  HHEEEEEELLEEEELllLLLLHhhhhhhhhhhhhhhl
Query RQVRDVMVAGRWVVRdgRHAGEersarafvqvlgell  451
ident      | | |  |                        
Sbjct VGIAGVLVNGAEVFP--QPPAD-----grpgqvlrax  475
DSSP  LLEEEEEELLEEEEL--LLLLL-----llllllllll


No 21: Query=4rdvB Sbjct=2ogjA Z-score=19.5

back to top
DSSP  ---LEEEEEEE-EELL-EEEEEEEEEELLLLLEEEEEllLLLLL----LEELLLLEEELE
Query ---SAIFAERA-LLPE-GWARNVRFEISADGVLAEIRpdANADG----AERLGGAVLPGM   51
ident                           |  ||  |                       || 
Sbjct qapILLTNVKPvGFGKgASQSSTDILIGGDGKIAAVG--SALQApadtQRIDAAFISPGW   58
DSSP  lllEEEEEEEElLLLLlLLLLLEEEEELLLLLEEEEE--LLLLLllleEELLLLEEEELE


DSSP  EEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhHHHHhhhhHHHH-HHHH
Query PNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeQIEViacqLYIE-MLKA  110
ident   || |                                                |     
Sbjct VDLHVHIW----------------------------------hGGTD-isiRPSEcGAER   83
DSSP  EEEEELLL----------------------------------lLLLL-lllLHHHlLHHH


DSSP  LEEEEEEEE-LLLLlllllllllLLHHHHH-HHHHHhhhLLEEEEEELLL----------
Query GYTAVAEFH-YVHHdldgrsyadPAELSLR-ISRAAsaaGIGLTLLPVLY----------  158
ident | |                            |                |           
Sbjct GVTTLVDAGsAGEA---------NFHGFREyIIEPS---RERIKAFLNLGsiglvacnrv  131
DSSP  LEEEEEEELlLLLL---------LHHHHHHhLLLLL---LLEEEEEEELLllllllllll


DSSP  -LEEEllleellhhhlllLLLHHHHHHHHHHHHHhhhhhllEELEEELLLL--------l
Query -SHAGfggqpasegqrrfINGSEAYLELLQRLRApleaaghSLGLCFHSLR--------a  209
ident                          ||                                 
Sbjct pELRD-----------ikDIDLDRILECYAENSE-------HIVGLXVRAShvitgswgv  173
DSSP  lLLLL-----------hhHLLHHHHHHHHHLLLL-------LEEEEEEEELhhhhlllll


DSSP  lLHHHHHHHHLLLLllLLEEEEELllhhHHHHhhhhhlllHHHHHHHhLLLLlLEEEEEL
Query vTPQQIATVLAAGHddLPVHIHIAeqqkEVDDcqawsgrrPLQWLYEnVAVDqRWCLVHA  269
ident                  |   |      |                 |           | 
Sbjct tPVKLGKKIAKILK--VPXXVHVG----EPPA--------LYDEVLE-ILGP-GDVVTHC  217
DSSP  hHHHHHHHHHHHHL--LLEEEEEL----LLLL--------LHHHHHH-HLLL-LLEEELL


DSSP  L------LLLH-----HHHHHHhhHLLEEEELHHHHhhllLLLL-LHHHHH-HLLLEEEE
Query T------HADP-----AEVAAMarSGAVAGLCLSTEanlgDGIF-PATDFL-AQGGRLGI  316
ident                          |                 |  |            |
Sbjct FngksgsSIXEdedlfNLAERC--EGIRLDIGHGGA----SFSFkVAEAAIaRGLLPFSI  271
DSSP  LllllllLLLLlhhhhHHHHHL--LLLEEELLLLLL----LLLHhHHHHHHhLLLLLLLL


DSSP  LLLLL------LLLLHHHHHHHHHHhhhhhhlllLLLLllllllhHHHHHHHHHHHHHHH
Query GSDSH------VSLSVVEELRWLEYgqrlrdrkrNRLYrddqpmiGRTLYDAALAGGAQA  370
ident   | |                 |                            |     |  
Sbjct STDLHghsxnfPVWDLATTXSKLLS---------VDXP-------FENVVEAVTRNPASV  315
DSSP  LLLLLllllllLLLLHHHHHHHHHH---------LLLL-------HHHHHHLLLHHHHHH


DSSP  HLLLL-lLLLLLLLLLEEEELlllhhhhllllhhhHHHH------------hHHLLhhHE
Query LGQPI-gSLAVGRRADLLVLDgndpylasaegdalLNRW------------lFAGGdrQV  417
ident         | || |||  | |              |                        
Sbjct IRLDXenRLDVGQRADFTVFD--------------LVDAdleatdsngdvsrLKRL-fEP  360
DSSP  LLLLLllLLLLLLLLEEEEEE--------------EEEEeeeeellllleeeEEEE-eEE


DSSP  EEEEELLEEeELLLllllhhhhhhhhhhhhhhhl
Query RDVMVAGRWvVRDGrhageersarafvqvlgell  451
ident |                                 
Sbjct RYAVIGAEA-IAAS--------------ryipra  379
DSSP  EEEEELLEE-EELL--------------llllll


No 22: Query=4rdvB Sbjct=3e74A Z-score=19.5

back to top
DSSP  ---LEEEEEEEEELLEEEEeEEEEELlLLLEEEEEllLLLLL---LEEL-LLLEEELEEE
Query ---SAIFAERALLPEGWARnVRFEISaDGVLAEIRpdANADG---AERL-GGAVLPGMPN   53
ident      |      |       |       |  | |                |  | ||   
Sbjct sfdLIIKNGTVILENEARV-VDIAVK-GGKIAAIG--QDLGDakeVXDAsGLVVSPGXVD   56
DSSP  leeEEEELLEEELLLLEEE-LEEEEE-LLEEEEEE--LLLLLeeeEEELlLLEEEELEEE


DSSP  EEELHhhhhhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEE
Query LHSHAfqramaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYT  113
ident  | |                                                   | | |
Sbjct AHTHI----------------------------------------GYETGTRAAAKGGIT   76
DSSP  EEELL----------------------------------------LHHHHHHHHHHLLEE


DSSP  EEEEEELLLLLlllllllLLLHHHH-HHHHHHhhhLLEEEEEELLLLeeellleellhhh
Query AVAEFHYVHHDldgrsyaDPAELSL-RISRAAsaaGIGLTLLPVLYShagfggqpasegq  172
ident    |                 ||             |    |  | |             
Sbjct TXIEXPLNQLP--atvdrASIELKFdAAKGKL---TIDAAQLGGLVS-------------  118
DSSP  EEEELLLLLLL--llllhHHHHHHHhHHLLLL---LLEEEELEELLL-------------


DSSP  llllLLHHHhHHHHHHHHhhhhhhlleELEEElLLLLLLHHHHHHHHL--LLLLlLLEEE
Query rrfiNGSEAyLELLQRLRapleaaghsLGLCFhSLRAVTPQQIATVLA--AGHDdLPVHI  230
ident           |  |              |      | |   |              ||  
Sbjct ----YNIDR-LHELDEVG--------vVGFXC-FVRDVNDWQFFKGAQklGELG-QPVLV  163
DSSP  ----LLLLL-HHHHHHHL--------lLLEEE-ELLLLLHHHHHHHHHhhHHHL-LLEEE


DSSP  EELllhhHHHHHHH----------------------hhllLHHHHHHHHLL-lllLEEEE
Query HIAeqqkEVDDCQA----------------------wsgrRPLQWLYENVA-vdqRWCLV  267
ident |          |                                           |    
Sbjct HCE----NALICDElgeeakregrvtahdyvasrpvftevEAIRRVLYLAKvagcRLHVC  219
DSSP  ELL----LHHHHHHhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHhhllLEEEL


DSSP  ELLLLLhhHHHHHHHHL-----LEEEELHH-------------hhHHLLLLL------lL
Query HATHADpaEVAAMARSG-----AVAGLCLS-------------teANLGDGI------fP  303
ident |        |    |            |                 |     |        
Sbjct HVSSPE--GVEEVTRARqegqdITCESCPHyfvldtdqfeeigtlAKCSPPIrdlenqkG  277
DSSP  LLLLHH--HHHHHHHHHhllllEEEEELLHhhhllhhhhhhhlhhHLLLLLLllhhhhhH


DSSP  HHHHHHLLLEEEELLLLL------------------LLLL--HHHHHHHhhhhhhhhhll
Query ATDFLAQGGRLGIGSDSH------------------VSLS--VVEELRWleygqrlrdrk  343
ident     |  |      ||                      |                     
Sbjct XWEKLFNGEIDCLVSDHSpcppexkagnixkawggiAGLQscXDVXFDE-----------  326
DSSP  HHHHHHLLLLLEELLLLLllllllllllllllllllLLHHhhHHHHHHH-----------


DSSP  lllllllllLLHHH-HHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELLLL----hhhh
Query rnrlyrddqPMIGR-TLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDGND----pyla  397
ident                          |   |    |  | |  ||      |         
Sbjct -----avqkRGXSLpXFGKLXATNAADIFGLqQKGRIAPGKDADFVFIQPNSsyvltndd  381
DSSP  -----hlllLLLLHhHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEEELLLleellhhh


DSSP  llllhhhhhhhhHHLLhhHEEEEEELLEEEELLL-LLLLHhhhhhhhhhhhhhhl
Query saegdallnrwlFAGGdrQVRDVMVAGRWVVRDG-RHAGEersarafvqvlgell  451
ident                |          |                            
Sbjct leyrhkvspyvgRTIG-aRITKTILRGDVIYDIEqGFPVA------pkgqfilkh  429
DSSP  llllllllllllLEEL-lEEEEEEELLEEEEELLlLLLLL------lllleelll


No 23: Query=4rdvB Sbjct=1gkpA Z-score=18.9

back to top
DSSP  -LEEEEEEEEELLEEEEeEEEEELLlLLEEEEEllLLLLL-----LEELL-LLEEELEEE
Query -SAIFAERALLPEGWARnVRFEISAdGVLAEIRpdANADG-----AERLG-GAVLPGMPN   53
ident    |                           |    |                | ||   
Sbjct pLLIKNGEIITADSRYK-ADIYAEG-ETITRIG--QNLEAppgteVIDATgKYVFPGFID   56
DSSP  lEEEELLEEEELLEEEE-LEEEELL-LLLLEEE--LLLLLlllleEEELLlLEEEELEEE


DSSP  EEELHHHhhhlllllllllllllhhhhhhhHHHHHllllhhhhhHHHHHHHHHHHHHLEE
Query LHSHAFQramaglaevagnpndsfwtwrelMYRMVarlspeqieVIACQLYIEMLKAGYT  113
ident  | |                                                  |  | |
Sbjct PHVHIYL----------------------pFMATF-------akDTHETGSKAALMGGTT   87
DSSP  EEELLLL----------------------eELLEE-------llLLHHHHHHHHHHLLEE


DSSP  EEEEEELLLlllllllllLLLHHHH-HHHHHHhhhLLEEEEEELLLLeeellleellhhh
Query AVAEFHYVHhdldgrsyaDPAELSL-RISRAAsaaGIGLTLLPVLYShagfggqpasegq  172
ident    |                  |                |                    
Sbjct TYIEMCCPS---rnddalEGYQLWKsKAEGNS---YCDYTFHMAVSK-------------  128
DSSP  EEEEEELLL---llllhhHHHHHHHhHHLLLL---LLEEEEEEELLL-------------


DSSP  lllllLHHHHHHHHHHHHHHHhhhllEELEEeLLLL-----LLLHHHHHHHHLL-LLLLL
Query rrfinGSEAYLELLQRLRAPLeaaghSLGLCfHSLR-----AVTPQQIATVLAA-GHDDL  226
ident        |     |    |               |       |        |        
Sbjct -----FDEKTEGQLREIVADG-----ISSFX-IFLSyknffGVDDGEMYQTLRLaKELGV  177
DSSP  -----LLLLHHHHHHHHHHLL-----LLEEE-EEELlllllLLLHHHHHHHHHHhHHHLL


DSSP  LEEEEEL-------------------------lLHHHHhhhhhhhllLHHHHHHHHLL-l
Query PVHIHIA-------------------------eQQKEVddcqawsgrRPLQWLYENVA-v  260
ident  |  |                                |                      
Sbjct IVTAHCEnaelvgrlqqkllsegktgpewhepsRPEAV-------eaEGTARFATFLEtt  230
DSSP  EEEEEELlhhhhhhhhhhhhhlllllhhhllllLLHHH-------hhHHHHHHHHHHHhh


DSSP  llLEEEEELLLLLhhHHHHHHHHL-----LEEEELHHhHHHL------------------
Query dqRWCLVHATHADpaEVAAMARSG-----AVAGLCLStEANL------------------  297
ident       ||          |                      |                  
Sbjct gaTGYVVHLSCKP--ALDAAMAAKargvpIYIESVIP-HFLLdktyaerggveamkyims  287
DSSP  llEEEELLLLLHH--HHHHHHHHHhllllEEEEEEHH-HHHLlhhhhhllhhhhhlllll


DSSP  -LLLL----lLHHHHHHLLLEEEELLLL---------------------LLLL--LHHHH
Query -GDGI----fPATDFLAQGGRLGIGSDS---------------------HVSL--SVVEE  329
ident              | ||||     | |                             |   
Sbjct pPLRDkrnqkVLWDALAQGFIDTVGTDHcpfdteqkllgkeaftaipngIPAIedRVNLL  347
DSSP  lLLLLlhhhhHHHHHHHLLLLLEEELLLllllhhhhhhhlllhhhllllLLLLllHHHHH


DSSP  HHHhhhhhhhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEE
Query LRWleygqrlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLL  387
ident               | ||             |||    |   |     |  |||  ||| 
Sbjct YTY--------gvsRGRL-------DIHRFVDAASTKAAKLFGLfpRKGTIAVGSDADLV  392
DSSP  HHH--------hllLLLL-------LHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLLEE


DSSP  EELLLL-----hhhhllllhhhhhhhhHHLLhhHEEEEEELLEEEELLLLLLLHhhhhhh
Query VLDGND-----pylasaegdallnrwlFAGGdrQVRDVMVAGRWVVRDGRHAGEersara  442
ident | |                           |      | | |   ||||   ||      
Sbjct VYDPQYrgtisvktqhvnndyngfegfEIDG--RPSVVTVRGKVAVRDGQFVGE-kgwgk  449
DSSP  EEELLLleellhhhlllllllllllllEELL--EEEEEEELLEEEEELLEELLL-lllll


DSSP  hhhhhhhhl
Query fvqvlgell  451
ident          
Sbjct llrrepmyf  458
DSSP  lllllllll


No 24: Query=4rdvB Sbjct=3griA Z-score=18.7

back to top
DSSP  -LEEEEeEEEELL-EEEEeEEEEELLlLLEEEEELlLLLLL----LEELL-LLEEELEEE
Query -SAIFAeRALLPE-GWARnVRFEISAdGVLAEIRPdANADG----AERLG-GAVLPGMPN   53
ident    |      |            |    |   | | |                | ||   
Sbjct xKLIKN-GKVLQNgELQQ-ADILIDG-KVIKQIAP-AIEPSngvdIIDAKgHFVSPGFVD   56
DSSP  lEEEEL-LEEEELlEEEE-LEEEEEL-LEEEEEEL-LLLLLllleEEELLlLEEEELEEE


DSSP  EEELHH---HHHHlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHH
Query LHSHAF---QRAMaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKA  110
ident  | |                                                        
Sbjct VHVHLRepgGEYK----------------------------------eTIETGTKAAARG   82
DSSP  EEELLLlllLLLL----------------------------------lLHHHHHHHHHHL


DSSP  LEEEEEEEELLLLlllllllllLLHHHHHHHHHHH-HHLLEEEEEELLLLeeellleell
Query GYTAVAEFHYVHHdldgrsyadPAELSLRISRAAS-AAGIGLTLLPVLYShagfggqpas  169
ident | | |                   |            |                      
Sbjct GFTTVCPXPNTRP------vpdSVEHFEALQKLIDdNAQVRVLPYASITT----------  126
DSSP  LEEEEEELLLLLL------lllLHHHHHHHHHHHHhHLLLEELLLEELLH----------


DSSP  hhhllLLLLHHHHhhHHHHHHHHHhhhlleELEEELLlLLLL-HHHHHHHHLL-LLLLLL
Query egqrrFINGSEAYleLLQRLRAPLeaaghsLGLCFHSlRAVT-PQQIATVLAA-GHDDLP  227
ident         | |        |                    |                   
Sbjct -----RQLGKELV--DFPALVKEG-----aFAFTDDG-VGVQtASXXYEGXIEaAKVNKA  173
DSSP  -----HHLLLLLL--LHHHHHLLL-----lLLEEELL-LLLLlHHHHHHHHHHhHHHLLL


DSSP  EEEEEL-----------------------llHHHHhhhhhhhllLHHHHHHHHLL-lllL
Query VHIHIA-----------------------eqQKEVddcqawsgrRPLQWLYENVA-vdqR  263
ident    |                                                        
Sbjct IVAHCEdnsliyggaxhegkrskelgipgipNICE--------sVQIARDVLLAEaagcH  225
DSSP  EEELLLlhhhllllleellhhhhhhllleelLHHH--------hHHHHHHHHHHHhhllL


DSSP  EEEEELLL--LLHHHHHHH-hHHLLEEEELHH--------------hhHHLLLLL-----
Query WCLVHATH--ADPAEVAAM-aRSGAVAGLCLS--------------teANLGDGI-----  301
ident     |            |        |                                 
Sbjct YHVCHVSTkeSVRVIRDAKraGIHVTAEVTPHhlllteddipgnnaiyKXNPPLRstedr  285
DSSP  EEELLLLLhhHHHHHHHHHhlLLLEEEEELHHhhhllhhhlllllhhhLLLLLLLlhhhh


DSSP  lLHHHHHHLLL-EEEELLLLL-----------------LLLL--HHHHhhhhhhhhhhhh
Query fPATDFLAQGG-RLGIGSDSH-----------------VSLS--VVEElrwleygqrlrd  341
ident       |  |                            |                     
Sbjct eALLEGLLDGTiDCIATDHAPhardekaqpxekapfgiVGSEtaFPLL------------  333
DSSP  hHHHHHHHLLLlLEELLLLLLllhhhhlllllllllllLLLLlhHHHH------------


DSSP  llllllllllLLLHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLEEEELLLLHH----hh
Query rkrnrlyrddQPMIGRTLYDAALAGGAQALGQPIGSLAVGRRADLLVLDGNDPY----la  397
ident                  | |              | |     |||   |           
Sbjct ---ythfvknGDWTLQQLVDYLTIKPCETFNLEYGTLKENGYADLTIIDLDSEQeikged  390
DSSP  ---hhhhlllLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLEEEEELLLLEellhhh


DSSP  llllhhhhhhhhHHLLhhHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl
Query saegdallnrwlFAGGdrQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
ident                         | |                           
Sbjct flskadntpfigYKVY-gNPILTXVEGEVKFEG---------------------  422
DSSP  llllllllllllLEEL-lEEEEEEELLEEEEEL---------------------


No 25: Query=4rdvB Sbjct=4b3zD Z-score=17.6

back to top
DSSP  --LEEEEEEEEELLEEEEeEEEEELlLLLEEEEEllLLLLL-----LEELL-LLEEELEE
Query --SAIFAERALLPEGWARnVRFEISaDGVLAEIRpdANADG-----AERLG-GAVLPGMP   52
ident     |   |                 ||    |    |                | ||  
Sbjct drLLIKGGRIINDDQSLY-ADVYLE-DGLIKQIG--ENLIVpggvkTIEANgRMVIPGGI   56
DSSP  leEEEEEEEEELLLLEEE-EEEEEE-LLEEEEEE--LLLLLlllleEEELLlLEEEELEE


DSSP  EEEELHHHhhhlllllllllllllhhhhhhhhhhhhllllhhhhhHHHHHHHHHHHHHLE
Query NLHSHAFQramaglaevagnpndsfwtwrelmyrmvarlspeqieVIACQLYIEMLKAGY  112
ident                                                  |     |  | 
Sbjct DVNTYLQK----------------------------------taaDDFFQGTRAALVGGT   82
DSSP  EEEELLLL----------------------------------lllLLHHHHHHHHHHLLE


DSSP  EEEEEEELLLLllllllllLLLHHHHHHHHHHH-HHLLEEEEEELLLLeeellleellhh
Query TAVAEFHYVHHdldgrsyaDPAELSLRISRAAS-AAGIGLTLLPVLYShagfggqpaseg  171
ident |                             ||         |     |            
Sbjct TMIIDHVVPEP------gsSLLTSFEKWHEAADtKSCCDYSLHVDITS------------  124
DSSP  EEEEEEELLLL------llLHHHHHHHHHHHHHlLLLLEEEEEEELLL------------


DSSP  hlllllLHHHHHHHHHHH-HHHHhhhllEELEEeLLLL-----LLLHHHHHHHHLL-LLL
Query qrrfinGSEAYLELLQRL-RAPLeaaghSLGLCfHSLR-----AVTPQQIATVLAA-GHD  224
ident             | |  |                              |           
Sbjct ------WYDGVREELEVLvQDKG-----VNSFQ-VYMAykdvyQMSDSQLYEAFTFlKGL  172
DSSP  ------LLLLHHHHHHHHhHLLL-----LLEEE-EELLlllllLLLHHHHHHHHHHhHHH


DSSP  LLLEEEEEL--------------------------lLHHHHhhhhhhhllLHHHHHHHHL
Query DLPVHIHIA--------------------------eQQKEVddcqawsgrRPLQWLYENV  258
ident       |                                                     
Sbjct GAVILVHAEngdliaqeqkrilemgitgpeghalsrPEELE--------aEAVFRAITIA  224
DSSP  LLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhlLHHHH--------hHHHHHHHHHH


DSSP  L-lllLEEEEELLLLLhhHHHHHHHHL-----LEEEELHHHHHHL---------------
Query A-vdqRWCLVHATHADpaEVAAMARSG-----AVAGLCLSTEANL---------------  297
ident                        |                                    
Sbjct GrincPVYITKVMSKS--AADIIALARkkgplVFGEPIAASLGTDgthywsknwakaaaf  282
DSSP  HhhllLEEEEEELLHH--HHHHHHHHHhhlllEEEEELHHHHHLLlhhhhlllhhhhhhl


DSSP  ----LLLL------LLHHHHHHlLLEEEELLLL---------------------LLLL--
Query ----GDGI------FPATDFLAqGGRLGIGSDS---------------------HVSL--  324
ident                        |     ||                             
Sbjct vtspPLSPdpttpdYLTSLLAC-GDLQVTGSGHcpystaqkavgkdnftlipegVNGIee  341
DSSP  llllLLLLlllhhhHHHHHHHH-LLLLLLLLLLllllhhhhhhhlllhhhllllLLLLll


DSSP  LHHHHHHHHHhhhhhhhlllLLLLllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLL
Query SVVEELRWLEygqrlrdrkrNRLYrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGR  382
ident                                            |         |  ||| 
Sbjct RMTVVWDKAV---------aTGKM------DENQFVAVTSTNAAKIFNLypRKGRIAVGS  386
DSSP  HHHHHHHHHL---------lLLLL------LHHHHHHHHLHHHHHHHLLllLLLLLLLLL


DSSP  LLLEEEELlllhhhhllllhhhHHHH-------------------hHHLLhhHEEEEEEL
Query RADLLVLDgndpylasaegdalLNRW-------------------lFAGGdrQVRDVMVA  423
ident  ||    |                                         |      |   
Sbjct DADVVIWD--------------PDKLktitakshksaveynifegmECHG--SPLVVISQ  430
DSSP  LLLEEEEE--------------EEEEeellllllllllllllllllEEEE--EEEEEEEL


DSSP  LEEEELLLLLLLH-------------------hhhhhhhhhhhhhhl
Query GRWVVRDGRHAGE-------------------ersarafvqvlgell  451
ident |  |  ||                                       
Sbjct GKIVFEDGNINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  LEEEEELLEELLLlllllllllllllhhhhhhhhhhhhhllllllll


No 26: Query=4rdvB Sbjct=3k2gB Z-score=15.6

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHH-
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAF-   59
ident                                                  |    | |   
Sbjct ----------------------slselspchvrsgrixtvdgpipssalGHTLXHEHLQn   38
DSSP  ----------------------llllllllllllleeeelleeeehhhlLLEELLLLLLe


DSSP  ------------------hhhhlllLLLLllllllhhHHHHHhHHHHllllhhHHHHHHH
Query ------------------qramaglAEVAgnpndsfwTWRELmYRMVarlspeQIEVIAC  101
ident                                                           | 
Sbjct dcrcwwnppqeperqylaeapisieILSE-----lrqDPFVNkHNIA-----lDDLDLAI   88
DSSP  elhhhllllllhhhhhhhhllllhhHHHH-----hhlLHHHLlLLLE-----eLLHHHHH


DSSP  HHHHHHHHHLEEEEEEEELLLllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEE
Query QLYIEMLKAGYTAVAEFHYVHhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHA  161
ident          |                              |     |         |   
Sbjct AEVKQFAAVGGRSIVDPTCRG----------igrDPVKLRRISAETGVQVVXGAGYYLAS  138
DSSP  HHHHHHHHLLLLEEEELLLLL----------lllLHHHHHHHHHHHLLEEEELLLLLLHH


DSSP  EllleellhhhlllllLHHHHHHHHHHHH--HHHHhhlleELEEELLLL----llLHHHH
Query GfggqpasegqrrfinGSEAYLELLQRLR--APLEaaghsLGLCFHSLR----avTPQQI  215
ident                                                             
Sbjct S---xpetaarlsaddIADEIVAEALEGTdgTDAR----iGLIGEIGVSsdftaeEEKSL  191
DSSP  H---llhhhhlllhhhHHHHHHHHHHLLLllLLLL----lLLEEEELLLllllhhHHHHH


DSSP  HHHHL--LLLLlLLEEEEELLLHhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEEL
Query ATVLA--AGHDdLPVHIHIAEQQkevddcqawsgrRPLQWLYENVA----VDQRWCLVHA  269
ident             ||   |                 |        |           | | 
Sbjct RGAARaqVRTG-LPLXVHLPGWF------------RLAHRVLDLVEeegaDLRHTVLCHX  238
DSSP  HHHHHhhHHHL-LLEEELLLLLL------------LLHHHHHHHHHhlllLHHHEEELLL


DSSP  LLL--LHHHHHHHHHHLLEEE-ELHHhHHHL------LLLL-----lLHHHHHHLLL--E
Query THA--DPAEVAAMARSGAVAG-LCLStEANL------GDGI-----fPATDFLAQGG--R  313
ident      ||   |  |  ||                                     |   |
Sbjct NPShxDPVYQATLAQRGAFLEfDXIG-XDFFyadqgvQCPSddevarAILGLADHGYldR  297
DSSP  HHHllLHHHHHHHHHHLLEEEeLLLL-LLLEelllleELLLhhhhhhHHHHHHHLLLhhH


DSSP  EEELLLL----------lLLLL--HHHHHHHHHhhhhhhhllLLLLlllllllHHHHHHH
Query LGIGSDS----------hVSLS--VVEELRWLEygqrlrdrkRNRLyrddqpmIGRTLYD  361
ident      |                      |  |          |  |           |  
Sbjct ILLSHDVfvkxxltryggNGYAfvTKHFLPRLR---------RHGL-------DDAALET  341
DSSP  EEELLLLllhhhlhhhllLLLLhhHHLHHHHHH---------HLLL-------LHHHHHH


DSSP  HHHHHHHHHhLLLLlllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeee
Query AALAGGAQAlGQPIgslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvm  421
ident                                                             
Sbjct LXVTNPRRV-FDAS----------------------------------------------  354
DSSP  HHLHHHHHH-HLLL----------------------------------------------


DSSP  elleeeelllllllhhhhhhhhhhhhhhhl
Query vagrwvvrdgrhageersarafvqvlgell  451
ident                               
Sbjct --------------------------iegh  358
DSSP  --------------------------llll


No 27: Query=4rdvB Sbjct=2y1hB Z-score=15.5

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELH-H
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHA-F   59
ident                                                  |    | |   
Sbjct -----------------------------------------------GVGLVDCHCHLsA   13
DSSP  -----------------------------------------------LLLEEEEEELLlL


DSSP  HHHHlllllllllllllhhhhhhhhhhhhllllhhhhhHHHHHHHHHHHHHLEEEEEEEE
Query QRAMaglaevagnpndsfwtwrelmyrmvarlspeqieVIACQLYIEMLKAGYTAVAEFH  119
ident                                                  ||   |     
Sbjct PDFD----------------------------------RDLDDVLEKAKKANVVALVAVA   39
DSSP  HHHL----------------------------------LLHHHHHHHHHHLLEEEEEELL


DSSP  LLLLllllllllllLHHHHHHHHHHHhhlLEEEEEELLLLEEellleeLLHHHlllllLH
Query YVHHdldgrsyadpAELSLRISRAASaagIGLTLLPVLYSHAgfggqpASEGQrrfinGS  179
ident                |     |                                      
Sbjct EHSG---------eFEKIMQLSERYN---GFVLPCLGVHPVQ------GLDQRsvtlkDL   81
DSSP  LLHH---------hHHHHHHHHHHLL---LLEEEEELLLLEE------LLLLEellhhHH


DSSP  HHHHHHHHHHHHhhhhhlLEELEEELLLL------------llLHHHHHHHHLL-LLLLL
Query EAYLELLQRLRApleaagHSLGLCFHSLR------------avTPQQIATVLAA-GHDDL  226
ident    |                |      |                 |             |
Sbjct DVALPIIENYKD------RLLAIGEVGLDfsprfagtgeqkeeQRQVLIRQIQLaKRLNL  135
DSSP  HHHHHHHHHHLL------LLLEEEEEEEEllllllllhhhhhhHHHHHHHHHHHhHHHLL


DSSP  LEEEEELllhhhhhhhhhhhllLHHHHHHHH---LLLLlLEEEEELLLLLHhHHHHHHHH
Query PVHIHIAeqqkevddcqawsgrRPLQWLYEN---VAVDqRWCLVHATHADPaEVAAMARS  283
ident ||  |                                     |               | 
Sbjct PVNVHSR---------------SAGRPTINLlqeQGAE-KVLLHAFDGRPS-VAMEGVRA  178
DSSP  LEEEEEE---------------LLHHHHHHHhhhLLLL-LEEEELLLLLHH-HHHHHHHL


DSSP  LLEEEELhHHHHhlLLLLL--LHHHHHhllLEEEELLLLL---------LLLL-HHHHHH
Query GAVAGLClSTEAnlGDGIF--PATDFLaqgGRLGIGSDSH---------VSLS-VVEELR  331
ident |               |                    ||                     
Sbjct GYFFSIP-PSII--RSGQKqkLVKQLP--lTSICLETDSPalgpekqvrNEPWnISISAE  233
DSSP  LLEEEEL-HHHH--LLHHHhhHHHHLL--hHHEEELLLLLlllllllllLLHHhHHHHHH


DSSP  HHHHHHHhhhllllllllllllLHHHHHHHHHHHHHHHHHLLLLlllllllllleeeell
Query WLEYGQRlrdrkrnrlyrddqpMIGRTLYDAALAGGAQALGQPIgslavgrradllvldg  391
ident                                                             
Sbjct YIAQVKG---------------ISVEEVIEVTTQNALKLFPKLR----------------  262
DSSP  HHHHHHL---------------LLHHHHHHHHHHHHHHHLLLHH----------------


DSSP  llhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query ndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                             
Sbjct ---------------------------------------------------------hll  265
DSSP  ---------------------------------------------------------hhl


No 28: Query=4rdvB Sbjct=1a5kC Z-score=15.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------LEEEEEEEEELLEEEEeEEEEELLlLLEEEEeLLLL--------------llLL
Query ------SAIFAERALLPEGWARnVRFEISAdGVLAEIrPDAN--------------adGA   40
ident                   |            |    |   |                   
Sbjct aadcvdLVLTNALIVDHWGIVK-ADIGVKD-GRIFAI-GKAGnpdiqpnvtipigaatEV  117
DSSP  hhhlllEEEEEEEEEELLEEEE-EEEEEEL-LEEEEE-ELEEllllllllleelllllEE


DSSP  EEL-LLLEEELEEEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhhhhhh
Query ERL-GGAVLPGMPNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeqievi   99
ident     |  |  |    | |                                          
Sbjct IAAeGKIVTAGGIDTHIHWI----------------------------------------  137
DSSP  EELlLLEEEELEEEEEEELL----------------------------------------


DSSP  HHHHHHHHHHHLEEEEEEE-----------ELLLllllllllllLLHHHHHHHHHHHHHL
Query ACQLYIEMLKAGYTAVAEF-----------HYVHhdldgrsyadPAELSLRISRAASAAG  148
ident   |   | |  | |                                    |   ||    
Sbjct CPQQAEEALVSGVTTMVGGgtgpaagthatTCTP----------GPWYISRMLQAADSLP  187
DSSP  LLLHHHHHHHHLEEEEEEElllllhhhhhlLLLL----------HHHHHHHHHHHHLLLL


DSSP  LEEEEEELLLLeeellleellhhhlllllLHHHHHHHHHHHhhhhhhhlleELEEELlLL
Query IGLTLLPVLYShagfggqpasegqrrfinGSEAYLELLQRLrapleaaghsLGLCFHsLR  208
ident     ||                          |  |                ||  |   
Sbjct VNIGLLGKGNV-----------------sQPDALREQVAAG---------vIGLEIH-ED  220
DSSP  LEEEEEEELLL-----------------lLHHHHHHHHHHL---------lLEEEEE-HH


DSSP  LL-LHHHHHHHHLL-LLLLLLEEEEElllhhHHHHhhhhhLLLHhHHHHHH-LLLLllEE
Query AV-TPQQIATVLAA-GHDDLPVHIHIaeqqkEVDDcqawsGRRPlQWLYEN-VAVDqrWC  265
ident    ||  |   |      |  |  |                                   
Sbjct WGaTPAAIDCALTVaDEMDIQVALHS----dTLNE-----SGFV-EDTLAAiGGRT--IH  268
DSSP  HLlLHHHHHHHHHHhHHHLLEEEEEL----lLLLL-----LLLH-HHHHHHhLLLL--EE


DSSP  EEELLL----llhHHHHHHHHHLLEEEELhHHHH--------------------------
Query LVHATH----adpAEVAAMARSGAVAGLClSTEA--------------------------  295
ident   |              | |                                        
Sbjct TFHTEGaggghapDIITACAHPNILPSST-NPTLpytlntidehldmlmvchhldpdiae  327
DSSP  ELLLLLlllllllLHHHHHHLLLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhh


DSSP  ----------hllLLLL--LHHHHHhlllEEEELLLL---LLLLLHHHHHHHHHHHHHHh
Query ----------nlgDGIF--PATDFLaqggRLGIGSDS---HVSLSVVEELRWLEYGQRLr  340
ident                                   |||        |              
Sbjct dvafaesrirretIAAEdvLHDLGA----FSLTSSDSqamGRVGEVILRTWQVAHRMKV-  382
DSSP  hhhlllllllhhhHHHHhhHHHLLL----LLEEELLLlllLLLLLHHHHHHHHHHHHHH-


DSSP  HLLLLllllLLLL-----LHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLLl
Query DRKRNrlyrDDQP-----MIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGNd  393
ident  |                              |   |     ||  ||  ||| |     
Sbjct QRGAL----AEETgdndnFRVKRYIAKYTINPALTHGIahEVGSIEVGKLADLVVWSPA-  437
DSSP  HHLLL----LLLLllllhHHHHHHHHLLLHHHHHHLLLllLLLLLLLLLLLLEEEELHH-


DSSP  hhhhllllhhhhhhhhhhLLHHhEEEEEELLEEEELL---------------LLLL--LH
Query pylasaegdallnrwlfaGGDRqVRDVMVAGRWVVRD---------------GRHA--GE  436
ident                    |      |   |                      |      
Sbjct -----------------fFGVK-PATVIKGGMIAIAPmgdinasiptpqpvhYRPMfgAL  479
DSSP  -----------------hLLLL-LLEEEELLEEEEEEellllllllllllleEEELhhHL


DSSP  HH----------------------------------------------------------
Query ER----------------------------------------------------------  438
ident                                                             
Sbjct GSarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt  539
DSSP  HHhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellll


DSSP  --------------hhhhhhhhhhhhl
Query --------------sarafvqvlgell  451
ident                            
Sbjct yevrvdgelitsepadvlpmaqryflf  566
DSSP  lleeelleellllllllllllllllll


No 29: Query=4rdvB Sbjct=1bf6A Z-score=15.0

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHH
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFQ   60
ident                                                  |    | |   
Sbjct --------------------------------------------sfdpTGYTLAHEHLHI   16
DSSP  --------------------------------------------llllLLEEEEEELLLE


DSSP  hhhlllllllllllllhhhHHHHhHHHHLlllhhHHHHHHHHHHHHHHHHLEEEEEEEEL
Query ramaglaevagnpndsfwtWRELmYRMVArlspeQIEVIACQLYIEMLKAGYTAVAEFHY  120
ident                                         ||        |   | |   
Sbjct ----------------dlsGFKN-NVDCR----lDQYAFICQEMNDLMTRGVRNVIEMTN   55
DSSP  ----------------elhHHHL-LHHHE----eLLHHHHHHHHHHHHHLLEEEEEELLL


DSSP  LLllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEEEllLEELlhhhlllllLHH
Query VHhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHAGfgGQPAsegqrrfinGSE  180
ident                            ||        |  |                   
Sbjct RY----------mgrNAQFMLDVMRETGINVVACTGYYQDAF--FPEH-vatrsvqeLAQ  102
DSSP  HH----------hllLHHHHHHHHHHHLLEEEEEELLLLHHH--LLLH-hhhllhhhHHH


DSSP  HHHHHHHHH--HHHHhhhlleELEEELLLL-----lLLHHHHHHHHL--LLLLlLLEEEE
Query AYLELLQRL--RAPLeaaghsLGLCFHSLR-----aVTPQQIATVLA--AGHDdLPVHIH  231
ident               |                                        |   |
Sbjct EMVDEIEQGidGTEL----kaGIIAEIGTSegkitpLEEKVFIAAALahNQTG-RPISTH  157
DSSP  HHHHHHHLLllLLLL----leEEEEEEELLlllllhHHHHHHHHHHHhhHHHL-LLEEEE


DSSP  ELLlhhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEELL-LLLHHHHHHHHHHLLE
Query IAEqqkevddcqawsgrRPLQWLYENVA----VDQRWCLVHAT-HADPAEVAAMARSGAV  286
ident                                    |    |            |   || 
Sbjct TSF-------------sTMGLEQLALLQahgvDLSRVTVGHCDlKDNLDNILKMIDLGAY  204
DSSP  LHH-------------hLLHHHHHHHHHhlllLHHHEEELLLLlLLLHHHHHHHHHLLLE


DSSP  EEELHHHhHHLLLLL----lLHHHHH-HLLL-EEEELLLL-----------lLLLLHH-H
Query AGLCLSTeANLGDGI----fPATDFL-AQGG-RLGIGSDS-----------hVSLSVV-E  328
ident          |                      |     |                     
Sbjct VQFDTIG-KNSYYPDekriaMLHALRdRGLLnRVMLSMDItrrshlkanggyGYDYLLtT  263
DSSP  EEELLLL-LLLLLLHhhhhhHHHHHHhLLLHhHEEELLLLllhhhlhhhlllLLLHHHhL


DSSP  HHHHHHHhhhhhhlllLLLLllllllhHHHHHHHHHHHHHHHHLllllllllllllleee
Query ELRWLEYgqrlrdrkrNRLYrddqpmiGRTLYDAALAGGAQALGqpigslavgrradllv  388
ident     |                                   |                   
Sbjct FIPQLRQ---------SGFS-------QADVDVMLRENPSQFFQ----------------  291
DSSP  HHHHHHH---------LLLL-------HHHHHHHHLHHHHHHLL----------------


DSSP  ellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhh
Query ldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlg  448
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hhl
Query ell  451
ident    
Sbjct ---  291
DSSP  ---


No 30: Query=4rdvB Sbjct=2ob3A Z-score=15.0

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHH
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFQ   60
ident                                                  |    | |   
Sbjct ----------------------------------drintvrgpitiseaGFTLTHEHICG   26
DSSP  ----------------------------------lleeelleeelhhhhLLEEEEELLEE


DSSP  hhhlllllllllllllhhhhhhhhhHHHLL-----lLHHHHHHHHHHHHHHHHHHLEEEE
Query ramaglaevagnpndsfwtwrelmyRMVAR-----lSPEQIEVIACQLYIEMLKAGYTAV  115
ident                                     |       |         ||    
Sbjct ----------------------ssaGFLRAwpeffgSRKALAEKAVRGLRRARAAGVRTI   64
DSSP  ----------------------lllLHHHHlhhhhlLHHHHHHHHHHHHHHHHHLLLLEE


DSSP  EEEELLlllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEeellleeLLHH--hl
Query AEFHYVhhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHagfggqpASEG--qr  173
ident                               ||         |                  
Sbjct VDVSTF----------digrDVSLLAEVSRAADVHIVAATGLWFD-------PPLSmrlr  107
DSSP  EELLLH----------hhllLHHHHHHHHHHHLLEEELEEELLLL-------LLHHhhll


DSSP  llllLHHHHHHHHHHHH--HHHHhhlleELEEeLLLL----llLHHHHHHHHLL-LLLLL
Query rfinGSEAYLELLQRLR--APLEaaghsLGLCfHSLR----avTPQQIATVLAA-GHDDL  226
ident          |   |                                       |      
Sbjct sveeLTQFFLREIQYGIedTGIR----aGIIX-VATTgkatpfQELVLKAAARAsLATGV  162
DSSP  lhhhHHHHHHHHHHLLLllLLLL----lLEEE-EELLllllhhHHHHHHHHHHHhHHHLL


DSSP  LEEEEELLLHhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEELL-LLLHHHHHHHH
Query PVHIHIAEQQkevddcqawsgrRPLQWLYENVA----VDQRWCLVHAT-HADPAEVAAMA  281
ident ||  | |  |            |                 | |  |     |     | |
Sbjct PVTTHTAASQ------------RDGEQQAAIFEseglSPSRVCIGHSDdTDDLSYLTALA  210
DSSP  LEEEELLHHH------------LHHHHHHHHHHhlllLHHHEEELLHHhLLLHHHHHHHH


DSSP  HHLLEEEELHHHHH------------hLLLL-----LLLHHHHHHLLL--EEEELLLLL-
Query RSGAVAGLCLSTEA------------nLGDG-----IFPATDFLAQGG--RLGIGSDSH-  321
ident   |   ||                   ||                ||         |   
Sbjct ARGYLIGLDHIPYSaiglednasasalLGIRswqtrALLIKALIDQGYmkQILVSNDWTf  270
DSSP  HLLLEEEELLLLLLlllllllhhhhhhHLLLlhhhhHHHHHHHHHLLLhhHEEELLLLLl


DSSP  -------------------LLLL-HHHHHHHHHhhhhhhhllLLLLlllllllHHHHHHH
Query -------------------VSLS-VVEELRWLEygqrlrdrkRNRLyrddqpmIGRTLYD  361
ident                                |                        ||  
Sbjct gfssyvtnimdvmdrvnpdGMAFiPLRVIPFLR---------EKGV-------PQETLAG  314
DSSP  eellllllhhhhhhhhlllHHHHhHHLHHHHHH---------HLLL-------LHHHHHH


DSSP  HHHHHHHHHHLllllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeee
Query AALAGGAQALGqpigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvm  421
ident       |  |                                                  
Sbjct ITVTNPARFLS-------------------------------------------------  325
DSSP  HHLHHHHHHHL-------------------------------------------------


DSSP  elleeeelllllllhhhhhhhhhhhhhhhl
Query vagrwvvrdgrhageersarafvqvlgell  451
ident                               
Sbjct --------------------------ptlr  329
DSSP  --------------------------llll


No 31: Query=4rdvB Sbjct=2vc5A Z-score=14.3

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHH
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFQ   60
ident                                                  |    | |   
Sbjct ---------------------------------mriplvgkdsieskdIGFTLIHEHLRV   27
DSSP  ---------------------------------llllllllllllhhhLLLEELLLLLLL


DSSP  hhhlllllllllllllhhhhhhhHHHHHL----LLLHHHHHHHHHHHHHHHHHHLEEEEE
Query ramaglaevagnpndsfwtwrelMYRMVA----RLSPEQIEVIACQLYIEMLKAGYTAVA  116
ident                                            |          |     
Sbjct ----------------------fSEAVRQqwphLYNEDEEFRNAVNEVKRAMQFGVKTIV   65
DSSP  ----------------------lLHHHHHhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEE


DSSP  EEELllllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLeeeLLLEELLhhhllll
Query EFHYvhhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYShagFGGQPASegqrrfi  176
ident                              | || |      |        |         
Sbjct DPTV----------mglgrDIRFMEKVVKATGINLVAGTGIYI---YIDLPFYflnrsid  112
DSSP  ELLL----------lllllLHHHHHHHHHLLLLEEEELEELLL---LLLLLHHhllllhh


DSSP  lLHHHHHHHHHHHH--HHHHhhlleELEEeLLLL-----lLLHHHHHHHHLL-LLLLLLE
Query nGSEAYLELLQRLR--APLEaaghsLGLCfHSLR-----aVTPQQIATVLAA-GHDDLPV  228
ident                                              |     |      | 
Sbjct eIADLFIHDIKEGIqgTLNK----aGFVX-IAADepgitkDVEKVIRAAAIAnKETKVPI  167
DSSP  hHHHHHHHHHHLLLllLLLL----lLLEE-EELLlllllhHHHHHHHHHHHHhHHHLLLE


DSSP  EEEELLLHhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEELL-LLLHHHHHHHHHH
Query HIHIAEQQkevddcqawsgrRPLQWLYENVA----VDQRWCLVHAT-HADPAEVAAMARS  283
ident   |                                        |             |  
Sbjct ITHSNAHN------------NTGLEQQRILTeegvDPGKILIGHLGdTDNIDYIKKIADK  215
DSSP  EEELLLLL------------LHHHHHHHHHHhlllLHHHEEELLHHhLLLHHHHHHHHHL


DSSP  LLEEE-ELHHhhhHLLLL-----LLLHHHHHHLLL--EEEELLLLL--------------
Query GAVAG-LCLSteaNLGDG-----IFPATDFLAQGG--RLGIGSDSH--------------  321
ident |   |                            |      |  |                
Sbjct GSFIGlDRYG---LDLFLpvdkrNETTLRLIKDGYsdKIMISHDYCctidwgtakpeykp  272
DSSP  LLEEEeLLLL---LLLLLlhhhhHHHHHHHHHLLLllLEEELLLLLlllllllllhhhhh


DSSP  -----LLLLhhHHHHHHHHHHhhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLllll
Query -----VSLSvvEELRWLEYGQrlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGqpig  376
ident       |                    ||                               
Sbjct klaprWSIT--LIFEDTIPFL-----kRNGV-------NEEVIATIFKENPKKFFS----  314
DSSP  hhlllLLLL--HHHHLHHHHH-----hLLLL-------LHHHHHHHHLHHHHHHLL----


DSSP  llllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllh
Query slavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhage  436
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhl
Query ersarafvqvlgell  451
ident                
Sbjct ---------------  314
DSSP  ---------------


No 32: Query=4rdvB Sbjct=4dlfA Z-score=13.0

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
ident                                                       | |   
Sbjct ------------------------------------------------ALRIDSHQHFW-   11
DSSP  ------------------------------------------------LLLEEEEELLL-


DSSP  hhhlllllllllllllhhhHHHHhHHHHLLLlhhhhhhHHHHHHHHHHHHLEEEEEEEEL
Query ramaglaevagnpndsfwtWRELmYRMVARLspeqievIACQLYIEMLKAGYTAVAEFHY  120
ident                    |        ||            |   |      |      
Sbjct -----------ryraadypWIGAgMGVLARD------yLPDALHPLMHAQALGASIAVQA   54
DSSP  -----------lllhhhllLLLLlLHHHLLL------lLHHHHHHHHHHLLLLEEEEELL


DSSP  LLLlllllllllllHHHHHHHHHHhhhLLEEEEEELLlleeellleellhhhllllLLHH
Query VHHdldgrsyadpaELSLRISRAAsaaGIGLTLLPVLyshagfggqpasegqrrfiNGSE  180
ident                  |                                          
Sbjct RAG-------rdetAFLLELACDE---ARIAAVVGWE-------------------DLRA   85
DSSP  LLL-------hhhhHHHHHHHLLL---LLEEEEEELL-------------------LLLL


DSSP  -HHHHHHHHhHHHHhhhlLEELEEELLLLL-----LLHH-HHHHHHLL-LLLLLLEEEEE
Query -AYLELLQRlRAPLeaagHSLGLCFHSLRA-----VTPQ-QIATVLAA-GHDDLPVHIHI  232
ident     |                |                    |   |     |       
Sbjct pQLAERVAE-WRGT----KLRGFRHQLQDEadvraFVDDaDFARGVAWlQANDYVYDVLV  140
DSSP  lLHHHHHHL-LLLL----LEEEEEELHHHLllhhhHHHLhHHHHHHHHhHHLLLEEEELL


DSSP  LllhhhhhhhhhhhllLHHHHHHhHLLL---llLEEEE-ELLL-------------lLHH
Query AeqqkevddcqawsgrRPLQWLYeNVAV---dqRWCLV-HATH-------------aDPA  275
ident                 | |                 |                      |
Sbjct F--------------eRQLPDVQ-AFCArhdahWLVLDhAGKPalaefdrddtalarWRA  185
DSSP  L--------------hHHHHHHH-HHHHhllllLEEEHhHHLLlhhhllllllhhhhHHH


DSSP  HHHHHHHHL-LEEEELhhHHHHLL------------lLLLLHHHHHHLLL--EEEELLLL
Query EVAAMARSG-AVAGLClsTEANLG------------dGIFPATDFLAQGG--RLGIGSDS  320
ident      |     |  |                              |   |  ||  ||| 
Sbjct ALRELAALPhVVCKLS--GLVTEAdwrrglrasdlrhIEQCLDAALDAFGpqRLMFGSDW  243
DSSP  HHHHHHLLLlEEEEEL--LLLLLLlllllllhhhhhhHHHHHHHHHHHHLhhHEEELLLL


DSSP  L-----LLLL--HHHHhHHHHhhhhhhhlllLLLLllllllHHHHhHHHH-HHHHHHHHL
Query H-----VSLS--VVEElRWLEygqrlrdrkrNRLYrddqpmIGRTlYDAA-LAGGAQALG  372
ident        |                                        |      |    
Sbjct PvcllaASYDevASLV-ERWA----------ESRL------SAAE-RSALwGGTAARCYA  285
DSSP  LhhhhlLLHHhhHHHH-HHHH----------HHHL------LHHH-HHHHlLHHHHHHLL


DSSP  LLllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeellll
Query QPigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgr  432
ident  |                                                          
Sbjct LP----------------------------------------------------------  287
DSSP  LL----------------------------------------------------------


DSSP  lllhhhhhhhhhhhhhhhl
Query hageersarafvqvlgell  451
ident                    
Sbjct -------------------  287
DSSP  -------------------


No 33: Query=4rdvB Sbjct=3irsA Z-score=12.9

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
ident                                                             
Sbjct ------------------------------------------------LKIIDFRLRPP-   11
DSSP  ------------------------------------------------LLLEELLLLLL-


DSSP  hhhlllllllllllllhhhhHHHHHHH----------hllllhhhhhhHHHHHHHHHHHH
Query ramaglaevagnpndsfwtwRELMYRM----------varlspeqievIACQLYIEMLKA  110
ident                          |                             ||  |
Sbjct --------------amgflnARIYTRPdirnrftrqlgfepapsaeekSLELMFEEMAAA   57
DSSP  --------------lhhhhhLHHHHLHhhhhhhhhhhlllllhhhhhlLHHHHHHHHHHL


DSSP  LEEEEEEEELlllllllllllllLHHHHHHHHHHHhhlLEEEEEELLLLEeellleellh
Query GYTAVAEFHYvhhdldgrsyadpAELSLRISRAASaagIGLTLLPVLYSHagfggqpase  170
ident |                               |                           
Sbjct GIEQGVCVGR----nssvlgsvsNADVAAVAKAYP---DKFHPVGSIEAA----------  100
DSSP  LLLEEEEELL----eellleellHHHHHHHHHHLL---LLEEEEEELLLL----------


DSSP  hhlllllLHHHHHHHHHHHHhhhhhhlleELEEElLLLLL------lHHHHHHHHLL-LL
Query gqrrfinGSEAYLELLQRLRapleaaghsLGLCFhSLRAV------tPQQIATVLAA-GH  223
ident           |       |                                    |    
Sbjct ----trkEAMAQMQEILDLG--------iRIVNL-EPGVWatpmhvdDRRLYPLYAFcED  147
DSSP  ----lhhHHHHHHHHHHHLL--------lLLEEE-LHHHLlllllllLHHHHHHHHHhHH


DSSP  LLLLEEEEELLLhhHHHHHHhhhllLHHHHHHHHLL--lllLEEEEE-LLLLLHHHHHHH
Query DDLPVHIHIAEQqkEVDDCQawsgrRPLQWLYENVA--vdqRWCLVH-ATHADPAEVAAM  280
ident    ||            |                            |             
Sbjct NGIPVIMMTGGN--AGPDIT----yTNPEHIDRVLGdfpdlTVVSSHgNWPWVQEIIHVA  201
DSSP  LLLLEEEELLLL--LLLLHH----hHLHHHHHHHHHhllllLEEEEHhHLLLHHHHHHHH


DSSP  HHHL-LEEEELhhHHHHlLLLLL-LHHHHHHLLL--EEEELLLLL-LLLL--HHHHhHHH
Query ARSG-AVAGLClsTEANlGDGIF-PATDFLAQGG--RLGIGSDSH-VSLS--VVEElRWL  333
ident  |                                  |   |       |          |
Sbjct FRRPnLYLSPD--MYLY-NLPGHaDFIQAANSFLadRMLFGTAYPmCPLKeyTEWF-LTL  257
DSSP  HHLLlEEEELH--HHHL-LLLLHhHHHHHHLLHHhhLLLLLLLLLlLLHHhhHHHH-HLL


DSSP  HhhhhhhhlllllllllllllHHHHHHHHHHHHHHHhHLLLllllllllllleeeellll
Query EygqrlrdrkrnrlyrddqpmIGRTLYDAALAGGAQaLGQPigslavgrradllvldgnd  393
ident                                      |                      
Sbjct P-------------------iKPDAMEKILHGNAER-LLAQ-------------------  278
DSSP  L-------------------lLHHHHHHHHLHHHHH-HHHH-------------------


DSSP  hhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query pylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                           
Sbjct -------------------------------------------------------agr  281
DSSP  -------------------------------------------------------lll


No 34: Query=4rdvB Sbjct=3cjpA Z-score=12.9

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFq   60
ident                                                       | |   
Sbjct -------------------------------------------------LIIDGHTHVI-   10
DSSP  -------------------------------------------------LLEEEEEELL-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhHHHHHHHHHHHHHLEEEEEEEEL
Query ramaglaevagnpndsfwtwrelmyrmvarlspeqieVIACQLYIEMLKAGYTAVAEFHY  120
ident                                               |  ||      |  
Sbjct -------------------------------------LPVEKHIKIMDEAGVDKTILFST   33
DSSP  -------------------------------------LLHHHHHHHHHHHLLLEEEEELL


DSSP  L------------------------lllllLLLL-lllLHHHHHHHHHHHhhlLEEEEEE
Query V------------------------hhdldGRSY-adpAELSLRISRAASaagIGLTLLP  155
ident                                                |            
Sbjct SihpetavnlrdvkkemkklndvvngktnsMIDVrrnsIKELTNVIQAYP---SRYVGFG   90
DSSP  LllhhhlllhhhhhhhhhhhhhhhllllllLHHHhhhhHHHHHHHHHHLL---LLEEEEE


DSSP  LLLLEeellleellhhhlllllLHHHHHHHHHHHHhhhhhhlleELEEELLLL---llLH
Query VLYSHagfggqpasegqrrfinGSEAYLELLQRLRapleaaghsLGLCFHSLR---avTP  212
ident                             |                |              
Sbjct NVPVG------------lsendTNSYIEENIVNNK--------lVGIGELTPAsgqikSL  130
DSSP  LLLLL------------llhhhHHHHHHHHLLLLL--------lLEEEEELLLlllhhHH


DSSP  HHHHHHHLLLLLlLLEEEEElLLHHHHhhhhhhhllLHHHHHHHHLL--lllLEEEEE-L
Query QQIATVLAAGHDdLPVHIHIaEQQKEVddcqawsgrRPLQWLYENVA--vdqRWCLVH-A  269
ident   |          ||  ||                        |           | |  
Sbjct KPIFKYSMDSGS-LPIWIHA-FNPLVL---------QDIKEIAELCKafpkvPVILGHmG  179
DSSP  HHHHHHHHHLLL-LLEEELL-LLLLLH---------HHHHHHHHHHHhllllLEEEHHhH


DSSP  LLLLHHHHHHHHHHL-LEEEELhhHHHHllllllLHHHHHHLL-lEEEELLLLL-LLLLh
Query THADPAEVAAMARSG-AVAGLClsTEANlgdgifPATDFLAQG-gRLGIGSDSH-VSLSv  326
ident        |                                         | |     |  
Sbjct GSNWMTAVELAKEIQnLYLDTS--AYFS----tfVLKIVINELplKCIFGTDMPfGDLQ-  232
DSSP  HHHHHHHHHHHHHLLlEEEELL--LLLL----hhHHHHHHHHLllLEELLLLLLlLLHH-


DSSP  hHHHHHHHHhhhhhhllllLLLLlllllhHHHHHHHHHHHHHHhhLLLLlllllllllle
Query vEELRWLEYgqrlrdrkrnRLYRddqpmiGRTLYDAALAGGAQalGQPIgslavgrradl  386
ident                                                 |           
Sbjct -LSIEAIKK----------MSND------SYVANAVLGDNISR--LLNI-----------  262
DSSP  -HHHHHHHH----------HLLL------HHHHHHHHLHHHHH--HHLL-----------


DSSP  eeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhh
Query lvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqv  446
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  hhhhl
Query lgell  451
ident      
Sbjct -----  262
DSSP  -----


No 35: Query=4rdvB Sbjct=3gg7A Z-score=12.9

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHH
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFQ   60
ident                                                       | |   
Sbjct -------------------------------------------------SLIDFHVHLDL   11
DSSP  -------------------------------------------------LLEEEEELHHH


DSSP  HHhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEeEEEEEEL
Query RAmaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYtAVAEFHY  120
ident                                                       |     
Sbjct YP------------------------------------DPVAVARACEERQL-TVLSVTT   34
DSSP  LL------------------------------------LHHHHHHHHHHLLL-EEEELLL


DSSP  LLllllllllllllhHHHHHHHHHHHhLLEEEEEELL---LLEEellleellhhhlllLL
Query VHhdldgrsyadpaeLSLRISRAASAaGIGLTLLPVL---YSHAgfggqpasegqrrfIN  177
ident                        |                                    
Sbjct TP------------aAWRGTLALAAG-RPHVWTALGFhpeVVSE-------------rAA   68
DSSP  LH------------hHHHHHHHHHLL-LLLEEELLLLlhhHLLL-------------lHH


DSSP  LHHHHHHHHHHHhhhhhhhlleELEEELLLL---------llLHHHHHHHHLL--LLLLL
Query GSEAYLELLQRLrapleaaghsLGLCFHSLR---------avTPQQIATVLAA--GHDDL  226
ident         |                    |                    |     |   
Sbjct DLPWFDRYLPET----------RFVGEVGLDgspslrgtwtqQFAVFQHILRRceDHGGR  118
DSSP  HLHHHHHHHHHL----------LEEEEEELLllhhhhhhhhhHHHHHHHHHHHhhHLLLE


DSSP  LEEEEELllhhhhhhhhhhhllLHHHHHHHHLL---lllLEEEEELLlLLHHHHHHHHHH
Query PVHIHIAeqqkevddcqawsgrRPLQWLYENVA---vdqRWCLVHAThADPAEVAAMARS  283
ident    ||                 |                   |         |       
Sbjct ILSIHSR---------------RAESEVLNCLEanprsgTPILHWYS-GSVTELRRAISL  162
DSSP  EEEEELL---------------LLHHHHHHHHHhlhhheEEEEELLL-LLHHHHHHHHHL


DSSP  LLEEEELhHHHHhlLLLLL--LHHHHHhlllEEEELLLL--------LLLL-LHHHHHHH
Query GAVAGLClSTEAnlGDGIF--PATDFLaqggRLGIGSDS--------HVSL-SVVEELRW  332
ident |        |                     |     |               |      
Sbjct GCWFSVG-PTMV--RTQKGaaLIRSMP--rdRVLTETDGpfleldgqAALPwDVKSVVEG  217
DSSP  LLEEEEL-HHHH--LLHHHhhHHHHLL--hhHEEELLLLllleelleELLHhHHHHHHHH


DSSP  HHHHHHhhhllllllllllllLHHHHHHHHHHHHHHHhHLLLllllllllllleeeelll
Query LEYGQRlrdrkrnrlyrddqpMIGRTLYDAALAGGAQaLGQPigslavgrradllvldgn  392
ident |                                     |                     
Sbjct LSKIWQ---------------IPASEVERIVKENVSR-LLGT------------------  243
DSSP  HHHHHL---------------LLHHHHHHHHHHHHHH-HHHL------------------


DSSP  lhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query dpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                            
Sbjct -----------------------------------------------------------  243
DSSP  -----------------------------------------------------------


No 36: Query=4rdvB Sbjct=4mupB Z-score=12.7

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
ident                                                  |      |   
Sbjct ---------------------------------lvrklsgtapnpafPRGAVDTQMHMY-   26
DSSP  ---------------------------------llllllllllllllLLLLEELLLLLL-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllLLHH---------hhhHHHHHHHHHHHH-H
Query ramaglaevagnpndsfwtwrelmyrmvarLSPE---------qieVIACQLYIEMLK-A  110
ident                                                     |       
Sbjct -----------------------------lPGYPalpggpglppgaLPGPEDYRRLMQwL   57
DSSP  -----------------------------lLLLLllllllllllllLLLHHHHHHHHHhH


DSSP  LEEEEEEEEL-LLLLllllllllLLHHHHHHHHHHHhhlLEEEEEELLlleeellleell
Query GYTAVAEFHY-VHHDldgrsyadPAELSLRISRAASaagIGLTLLPVLyshagfggqpas  169
ident |   |       |               |                               
Sbjct GIDRVIITQGnAHQR--------DNGNTLACVAEMG---EAAHAVVII------------   94
DSSP  LLLEEEEELLhHHLL--------LLHHHHHHHHHHH---HHEEEEELL------------


DSSP  hhhlllllLHHHhHHHHHHHHHHHhhhllEELEEeLLLL----LLLHhHHHHHHlLLLL-
Query egqrrfinGSEAyLELLQRLRAPLeaaghSLGLCfHSLR----AVTPqQIATVLaAGHD-  224
ident                    | |         |                    |       
Sbjct --------DATTtEKDMEKLTAAG-----TVGAR-IMDLpggaVNLS-ELDAVD-ERAHa  138
DSSP  --------LLLLlHHHHHHHHHLL-----EEEEE-EELLllllLLHH-HHHHHH-HHHHh


DSSP  -LLLEEEEELLlhhhhhhhhhhhlllHHHHHHHHLL-lllLEEEE-ELLL--------lL
Query -DLPVHIHIAEqqkevddcqawsgrrPLQWLYENVA-vdqRWCLV-HATH--------aD  273
ident  |  |                      |            ||    |             
Sbjct aDWMVAVQFDG--------------nGLLDHLPRLQkirsRWVFDhHGKFfkgirtdgpE  184
DSSP  lLLEEEEELLH--------------hHHHHHHHHHHllllEEEELhHHHLllllllllhH


DSSP  HHHHHHHHHHL-LEEEELhhHHHHLL-------lLLLLHHHHHHLLL-EEEELLLLLL--
Query PAEVAAMARSG-AVAGLClsTEANLG-------dGIFPATDFLAQGG-RLGIGSDSHV--  322
ident  |        |                                |    |   |       
Sbjct MAALLKLIDRGnLWFKFA--GVYESSrkswpyadVAAFSRVIAAHAPeRIVWGTNWPHns  242
DSSP  HHHHHHHHHHLlEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLHhHEEELLLLLLll


DSSP  -------llLHHHHHHHHHhhhhhhhllllLLLLlllllhHHHHHHHHHHHHHHHHLLLL
Query -------slSVVEELRWLEygqrlrdrkrnRLYRddqpmiGRTLYDAALAGGAQALGQPI  375
ident                  |             |              |             
Sbjct vretaaypdDARLAELTLG-----------WLPD------EAARHRALVENPEALFKLSP  285
DSSP  lllhhhlllHHHHHHHHHL-----------LLLL------HHHHHHHHLHHHHHHHLLLL


DSSP  Lllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllll
Query Gslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhag  435
ident                                                             
Sbjct V-----------------------------------------------------------  286
DSSP  L-----------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhl
Query eersarafvqvlgell  451
ident                 
Sbjct ----------------  286
DSSP  ----------------


No 37: Query=4rdvB Sbjct=3pnuA Z-score=12.7

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleellLLEEELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlgGAVLPGMPNLHSHAFq   60
ident                                                |      | |   
Sbjct ------------------------------------enlyfqsnAMKLKNPLDMHLHLR-   23
DSSP  ------------------------------------llllllllLEEEELLEEEEELLL-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhHHHHHHHHHHHHHHhLEEEEEEEEL
Query ramaglaevagnpndsfwtwrelmyrmvarlspeqIEVIACQLYIEMLKaGYTAVAEFHY  120
ident                                                      |      
Sbjct -----------------------------------DNQMLELIAPLSAR-DFCAAVIMPN   47
DSSP  -----------------------------------LHHHHHHHHHHHHL-LLLEEEELLL


DSSP  LLLlllllllllLLHHHHHHHHHHHHHL----LEEEEEELLlleeellleellhhhllll
Query VHHdldgrsyadPAELSLRISRAASAAG----IGLTLLPVLyshagfggqpasegqrrfi  176
ident               |           |                                 
Sbjct LIP------plcNLEDLKAYKMRILKACkdenFTPLMTLFF-------------------   82
DSSP  LLL------lllLHHHHHHHHHHHHHHHllllLEEEEEEEL-------------------


DSSP  LLHH-HHHHHHHHHhhhhhhhllEELEEeLLLL--------LLLH---HHHHHHHLL-LL
Query NGSE-AYLELLQRLrapleaaghSLGLCfHSLR--------AVTP---QQIATVLAA-GH  223
ident        |                 |                |           | |   
Sbjct KNYDeKFLYSAKDE---------IFGIX-LYPAgittnsngGVSSfdiEYLKPTLEAmSD  132
DSSP  LLLLhHHHHHHLLL---------LLEEE-ELLLllllllllLLLLllhHHHHHHHHHhHH


DSSP  LLLLEEEEEL--llHHHHhhhhhhhllLHHHHHHhHLLL---llLEEEEELLLLLhhHHH
Query DDLPVHIHIA--eqQKEVddcqawsgrRPLQWLYeNVAV---dqRWCLVHATHADpaEVA  278
ident    |   |                             |           | |        
Sbjct LNIPLLVHGEtndfVMDR-------esNFAKIYE-KLAKhfprlKIVMEHITTKT--LCE  182
DSSP  LLLLEEELLLllllHHHL-------lhHHHHHHH-HHHHhllllLEEELLLLLHH--HHH


DSSP  HHHHHL-LEEEELHH--------------hhhHLLLL-------llLHHHHH-hlLLEEE
Query AMARSG-AVAGLCLS--------------teaNLGDG-------ifPATDFL-aqGGRLG  315
ident          |   |                                              
Sbjct LLKDYEnLYATITLHhliitlddviggkmnphLFCKPiakryedkeALCELAfsgYEKVM  242
DSSP  HHHHLLlEEEEELLHhhlllhhhhhlllllhhHLLLLllllhhhhhHHHHHHhllLLLEE


DSSP  ELLLL----------LLLL-LHHHhHHHHHhhhhhhhllLLLLlllllllHHHHHHHHHH
Query IGSDS----------HVSL-SVVEeLRWLEygqrlrdrkRNRLyrddqpmIGRTLYDAAL  364
ident  ||||            |       |  |                         |     
Sbjct FGSDSaphpkgcaagVFSApVILPvLAELF---------KQNS-------SEENLQKFLS  286
DSSP  ELLLLllllllllllLLLHhHHHHhHHHHH---------HHHL-------LHHHHHHHHL


DSSP  HHHHHhhLLLLllllllLLLLE-EEELLLLhhhhllllhhhhhhhhhhllhhheeeeeel
Query AGGAQalGQPIgslavgRRADL-LVLDGNDpylasaegdallnrwlfaggdrqvrdvmva  423
ident                     |  | |                                  
Sbjct DNTCK-iYDLK------FKEDKiLTLEEKE------------------------------  309
DSSP  HHHHH-hHLLL------LLLLLeEEEELLL------------------------------


DSSP  leeeelllllllhhhhhhhHHHHH-------------hhhl
Query grwvvrdgrhageersaraFVQVL-------------gell  451
ident                                          
Sbjct ------------wqvpnvyEDKYNqvvpymageilkfqlkh  338
DSSP  ------------eelllleELLLLeellllllleelleell


No 38: Query=4rdvB Sbjct=2ffiA Z-score=12.6

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
ident                                                       | | | 
Sbjct ----------------------------------------------lhLTAIDSHAHVF-   13
DSSP  ----------------------------------------------llLLLEELLLLLL-


DSSP  hhhlllllllllllllhhhhhHHHHhhHLLLlhhhhhhHHHHHHHHHHHHLEEEEEEEEL
Query ramaglaevagnpndsfwtwrELMYrmVARLspeqievIACQLYIEMLKAGYTAVAEFHY  120
ident                                                   |         
Sbjct ------------srglnlasqRRYA--PNYD------aPLGDYLGQLRAHGFSHGVLVQP   53
DSSP  ------------lhhhhhhllLLLL--LLLL------lLHHHHHHHHHHLLLLEELLLLL


DSSP  --LLLLlllllllllLHHHHHHHHHHHhhllEEEEEELLlleeellleellhhhllllLL
Query --VHHDldgrsyadpAELSLRISRAASaagiGLTLLPVLyshagfggqpasegqrrfiNG  178
ident      |             |            |     |                     
Sbjct sfLGTD---------NRYLLSALQTVP---gQLRGVVXL-------------------ER   82
DSSP  hhHLLL---------LHHHHHHHHHLL---lLLLLLLLL-------------------LL


DSSP  HHHhHHHHHHHHHHhhhhlLEELEEELLLLL--LLHH--hHHHHHLL-LLLLLLEEEEEL
Query SEAyLELLQRLRAPleaagHSLGLCFHSLRA--VTPQ--qIATVLAA-GHDDLPVHIHIA  233
ident        |              |                     |   |     |  |  
Sbjct DVE-QATLAEXARL-----GVRGVRLNLXGQdxPDLTgaqWRPLLERiGEQGWHVELHRQ  136
DSSP  LLL-HHHHHHHHLL-----LLLEEELLLLLLllLLLLlllLHHHHHHhHHHLLEEEELLL


DSSP  llhhhhhhhhhhhlllHHHHHHHHLL-lllLEEEE-ELLL---------LLHHHHHHhhH
Query eqqkevddcqawsgrrPLQWLYENVA-vdqRWCLV-HATH---------ADPAEVAAmaR  282
ident                     |                                      |
Sbjct --------------vaDIPVLVRALQpyglDIVIDhFGRPdarrglgqpGFAELLTLsgR  182
DSSP  --------------llLHHHHHHHHLllllLEEELhHHLLlllllllllLHHHHLLLllL


DSSP  HLLEEEELhhHHHHLL------LLLL--LHHHHHHLLL--EEEELLLLL-------LLLL
Query SGAVAGLClsTEANLG------DGIF--PATDFLAQGG--RLGIGSDSH-------VSLS  325
ident               |                   |  |  ||  |||         ||  
Sbjct GKVWVKVS--GIYRLQgspeenLAFArqALCALEAHYGaeRLXWGSDWPhtqheseVSFG  240
DSSP  LLEEEEEE--LHHHLLllhhhhHHHHhhHHHHHHHHLLhhHEEEELLLLlllllllLLHH


DSSP  -hHHHHHHHHhhhhhhhlllllllllllllHHHHHHHHH-HHHHHHHHLLLLllllllll
Query -vVEELRWLEygqrlrdrkrnrlyrddqpmIGRTLYDAA-LAGGAQALGQPIgslavgrr  383
ident   ||    |                         |  |  |       |           
Sbjct saVEQFEALG--------------------CSAQLRQALlLDTARALFGFEL--------  272
DSSP  hhHHHHHHHL--------------------LLHHHHHHHhLHHHHHHLLLLL--------


DSSP  lleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhh
Query adllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersaraf  443
ident                                                             
Sbjct ------------------------------------------------------------  272
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhl
Query vqvlgell  451
ident         
Sbjct -------e  273
DSSP  -------l


No 39: Query=4rdvB Sbjct=4hk5D Z-score=12.6

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
ident                                                 |     | |   
Sbjct -----------------------------------------------TPVVVDIHTHMY-   12
DSSP  -----------------------------------------------LLLLEEEEEEEL-


DSSP  hhhlllllllllllllhhhhhhhhhhhHLLL-----------------------------
Query ramaglaevagnpndsfwtwrelmyrmVARL-----------------------------   91
ident                             | |                             
Sbjct -----------------------ppsyIAMLekrqtiplvrtfpqadeprlillsselaa   49
DSSP  -----------------------lhhhHHHHhlllllleeeeelleeeeeeellhhhhhh


DSSP  ---------------lhhhhhHHHHHHHHHHHHHLEEEEEEEEL---llllllLLLLLLL
Query ---------------speqieVIACQLYIEMLKAGYTAVAEFHY---vhhdldGRSYADP  133
ident                          |    |   |                         
Sbjct ldaaladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLAnpwfdflapDEAPGIA  109
DSSP  hhhhhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEELlllllllllLLHHHHH


DSSP  LHHHHHHHHHHHHHLLEEEEEELLLLeeellleellhhhlllLLLHHHHHHHHHHHHHHH
Query AELSLRISRAASAAGIGLTLLPVLYShagfggqpasegqrrfINGSEAYLELLQRLRAPL  193
ident        |         |     |                       |      |     
Sbjct DAVNAEFSDMCAQHVGRLFFFAALPL----------------SAPVDAVKASIERVKNLK  153
DSSP  HHHHHHHHHHHHLLLLLEEEEEELLL----------------LLLHHHHHHHHHHHHLLL


DSSP  hhhlLEELEEElLLLLLL----HHHHHHHHLL-LLLLLLEEEEE----------------
Query eaagHSLGLCFhSLRAVT----PQQIATVLAA-GHDDLPVHIHI----------------  232
ident        |                    |  |     | |  |                 
Sbjct ----YCRGIIL-GTSGLGkgldDPHLLPVFEAvADAKLLVFLHPhyglpnevygprseey  208
DSSP  ----LEEEEEE-LLLLLLllllLHHHHHHHHHhHHLLLEEEELLlllllhhhhlllhhhl


DSSP  ---------LLLHhhhhhhhhhhllLHHHHHH-HHLL---lllLEEEE-ELLL-LLHH--
Query ---------AEQQkevddcqawsgrRPLQWLY-ENVA---vdqRWCLV-HATH-ADPA--  275
ident                                |   |          |          |  
Sbjct ghvlplalgFPME----------ttIAVARMYmAGVFdhvrnlQMLLAhSGGTlPFLAgr  258
DSSP  llhhhhhlhHHHH----------hhHHHHHHHhLLHHhhllllLEEEHhHHLLhHHHHhh


DSSP  ----------------------hhHHHHHHLLEEEELHHhhhhllllllLHHHHHHLLL-
Query ----------------------evAAMARSGAVAGLCLSteanlgdgifPATDFLAQGG-  312
ident                                                        |  | 
Sbjct iescivhdghlvktgkvpkdrrtiWTVLKEQIYLDAVIY-------sevGLQAAIASSGa  311
DSSP  hhhhhhllhhhhhllllllllllhHHHHHHLEEEELLLL-------lhhHHHHHHHHHLh


DSSP  -EEEELLLLLLL-----------lLHHHHHHHHHHHhhhhhllllllllllllLHHH-HH
Query -RLGIGSDSHVS-----------lSVVEELRWLEYGqrlrdrkrnrlyrddqpMIGR-TL  359
ident  ||  | |                |                              |    
Sbjct dRLMFGTDHPFFppieedvqgpwdSSRLNAQAVIKA----------------vGEGSsDA  355
DSSP  hHEELLLLLLLLlllllllllllhHHHHHHHHHHHH----------------hLLLLhHH


DSSP  HHHHHHHHHHHhLLLLlllllLLLLleeeellllhhhhllllhhhhhhhhhhllhhheee
Query YDAALAGGAQAlGQPIgslavGRRAdllvldgndpylasaegdallnrwlfaggdrqvrd  419
ident                                                             
Sbjct AAVMGLNAVRV-LSLK-----AELE-----------------------------------  374
DSSP  HHHHLHHHHHH-LLLH-----HHHH-----------------------------------


DSSP  eeeLLEEeelllllllhhhhhhhhhhhhhhhl
Query vmvAGRWvvrdgrhageersarafvqvlgell  451
ident                                 
Sbjct --hHHHH------------------------h  380
DSSP  --hHHHH------------------------l


No 40: Query=4rdvB Sbjct=2qpxA Z-score=12.4

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
ident                                                       | |   
Sbjct -------------------------------------gxddlsefvdQVPLLDHHCHFLi   23
DSSP  -------------------------------------lllllhhhhhHLLEEEEEELLLl


DSSP  ----hhhhlLLLLllllllllHHHH--------------------hhhhhhhhllllhhh
Query ----qramaGLAEvagnpndsFWTW--------------------relmyrmvarlspeq   95
ident           ||                                                
Sbjct dgkvpnrddRLAQ-----vstEADKdypladtknrlayhgflalakefaldannplaaxn   78
DSSP  llllllhhhHHHH-----hllLLLLlllhhhhlllhhhhhhhhhhhhhllllllllllll


DSSP  hhhhhhHHHHHHHHHLEEEEEEEELLlllllllllllllhhhHHHHHHHHHHLLEEEEEE
Query ieviacQLYIEMLKAGYTAVAEFHYVhhdldgrsyadpaelsLRISRAASAAGIGLTLLP  155
ident                                           |     |   ||      
Sbjct dpgyatYNHRIFGHFHFKELLIDTGF----------vpddpiLDLDQTAELVGIPVKAIY  128
DSSP  hhhhhhHHHHHHHHLLEEEEEEELLL----------llllllLLHHHHHHHHLLLEEEEE


DSSP  LLLleeellleellhhhllLLLL---------------HHHHHHHHHHHHhhhhhhlleE
Query VLYshagfggqpasegqrrFING---------------SEAYLELLQRLRapleaaghsL  200
ident  |                                                          
Sbjct RLE----------------THAEdfxlehdnfaawwqaFSNDVKQAKAHG--------fV  164
DSSP  EHH----------------HHHHhhhlllllhhhhhhhHHHHHHLLLLLL--------lL


DSSP  LEEELLLLL--------------------------------lLHHHHHHHHlLLLL--LL
Query GLCFHSLRA--------------------------------vTPQQIATVLaAGHD--DL  226
ident |                                                |        | 
Sbjct GFXSIAAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVA-PFIIaqDX  223
DSSP  LEEELHHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHH-HHHHhhLL


DSSP  LEEEEELLL--hHHHHHhhhhhllLHHHHHhHHLL-----lllLEEEEELLLLLHHHHHH
Query PVHIHIAEQ--qKEVDDcqawsgrRPLQWLyENVA-----vdqRWCLVHATHADPAEVAA  279
ident |   |                                         | |           
Sbjct PLQFHVGYGdadTDXYL-------GNPLLX-RDYLkaftkkglKVVLLHCYPYHREAGYL  275
DSSP  LEEEEELLLlllLLHHH-------LLHHHH-HHHHhhhhhhllLEEEEELLLLHHHHHHH


DSSP  HHHH-LLEEEEL-HHHHHH-lllLLLL--HHHHHhlllEEEELLLLL----LLLL-HHHH
Query MARS-GAVAGLC-LSTEAN-lgdGIFP--ATDFLaqggRLGIGSDSH----VSLS-VVEE  329
ident              |           |            |    ||               
Sbjct ASVFpNLYFDISlLDNLGPsgasRVFNeaVELAP--ytRILFASDAStypeXYGLaARQF  333
DSSP  HHHLlLEEEELLlHHHHLHhhhhHHHHhhLLLLL--hhHEELLLLLLllhhHHHHhHHHH


DSSP  HHHHHHHhhhhhlLLLLlllLLLLLHHHHHHHHHHHHHHHHhLLLLlllllllLLLEEee
Query LRWLEYGqrlrdrKRNRlyrDDQPMIGRTLYDAALAGGAQAlGQPIgslavgrRADLLvl  389
ident    |                 |                |              |      
Sbjct KQALVAH-----fNQLP--fVDLAQKKAWINAICWQTSAKL-YHQE-------RELRV--  376
DSSP  HHHHHHH-----hHLLL--lLLHHHHHHHHHHHHLHHHHHH-LLLH-------HHHLL--


DSSP  llllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhh
Query dgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlge  449
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hl
Query ll  451
ident   
Sbjct --  376
DSSP  --


No 41: Query=4rdvB Sbjct=4qrnA Z-score=12.3

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllLEEELEEEEEELHH-
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggAVLPGMPNLHSHAF-   59
ident                                                             
Sbjct -----------------------------------smtqdlktggEQGYLRIATEEAFAt   25
DSSP  -----------------------------------llllllllllLLLLLLEEEEEEELl


DSSP  -hhhhllllllllllllLHHHHHH-HHHHH--hllllhhhhhHHHH-HHHHHHHHHLEEE
Query -qramaglaevagnpndSFWTWRE-LMYRM--varlspeqieVIAC-QLYIEMLKAGYTA  114
ident                                                     |   |   
Sbjct reiidvylrmirdgtadKGMVSLWgFYAQSpseratqilerlLDLGeRRIADMDATGIDK   85
DSSP  hhhhhhhhhhhhhllllHHHHHHHhHHHHLllhhhhhhhhhhHLLLhHHHHHHHHLLLLE


DSSP  EEEEEL---lllllLLLL-lLLLLHHHHHHHHHHHHHLLEEEEEELLLLeeellleellh
Query VAEFHY---vhhdlDGRS-yADPAELSLRISRAASAAGIGLTLLPVLYShagfggqpase  170
ident               |                 |                           
Sbjct AILALTspgvqplhDLDEarTLATRANDTLADACQKYPDRFIGMGTVAP-----------  134
DSSP  EEEEELllllllllLHHHhhHHHHHHHHHHHHHHHHLLLLEEELLLLLL-----------


DSSP  hhllllLLHHHHHHHHHHH-HHHHhhhllEELEEELLLL--LLLH-HHHHHHHLL-LLLL
Query gqrrfiNGSEAYLELLQRL-RAPLeaaghSLGLCFHSLR--AVTP-QQIATVLAA-GHDD  225
ident          |       |  |          |    |                 |    |
Sbjct ------QDPEWSAREIHRGaRELG-----FKGIQINSHTqgRYLDeEFFDPIFRAlVEVD  183
DSSP  ------LLHHHHHHHHHHHhHLLL-----LLLEEELLLLllLLLLlHHHHHHHHHhHHHL


DSSP  LLEEEEE-----------------llLHHHHHhhhhhhllLHHHHHH-HHLL---lllLE
Query LPVHIHI-----------------aeQQKEVDdcqawsgrRPLQWLY-ENVA---vdqRW  264
ident  |  ||                                    |  |              
Sbjct QPLYIHPatspdsmidpmleagldgaIFGFGV-----etgMHLLRLItIGIFdkypslQI  238
DSSP  LLEEELLllllllllhhhhhhlllllLLHHHH-----hhhHHHHHHHhHLHHhhllllLE


DSSP  EEEE-LLLLLHHH--------------------------hHHHHHHlLEEEELHhhhhhl
Query CLVH-ATHADPAE--------------------------vAAMARSgAVAGLCLsteanl  297
ident    |                                                        
Sbjct MVGHmGEALPYWLyrldymhqagvrsqryermkplkktieGYLKSN-VLVTNSG------  291
DSSP  EELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhhHHHHHL-EEEELLL------


DSSP  lllllLHHHHHHLLL--EEEELLLLL-LLLL--HHHHHHHhhhhhhhhhlllllllllll
Query gdgifPATDFLAQGG--RLGIGSDSH-VSLS--VVEELRWleygqrlrdrkrnrlyrddq  352
ident               |  |     |         |                          
Sbjct vawepAIKFCQQVMGedRVMYAMDYPyQYVAdeVRAMDAM--------------------  331
DSSP  lllhhHHHHHHHHHLhhHEELLLLLLlLLLHhhHHHHHLL--------------------


DSSP  lLHHHHHHHHHHHHHHHHHLLlllllllllllleeeellllhhhhllllhhhhhhhhhhl
Query pMIGRTLYDAALAGGAQALGQpigslavgrradllvldgndpylasaegdallnrwlfag  412
ident  |   |                                                      
Sbjct dMSAQTKKKFFQTNAEKWFKL---------------------------------------  352
DSSP  lLLHHHHHHHHLHHHHHHLLL---------------------------------------


DSSP  lhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query gdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                        
Sbjct ---------------------------------------  352
DSSP  ---------------------------------------


No 42: Query=4rdvB Sbjct=2dvtA Z-score=12.1

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
ident                                                  |   |  |   
Sbjct -----------------------------------------------MQGKVALEEHFA-   12
DSSP  -----------------------------------------------LLLEEEEEEEEL-


DSSP  hhhlllllllllllllhhHHHHH--hHHHHllllhhhhhHHHHH-HHHHHHHHLEEEEEE
Query ramaglaevagnpndsfwTWREL--mYRMVarlspeqieVIACQ-LYIEMLKAGYTAVAE  117
ident                                                  |   |      
Sbjct ----------ipetlqdsAGFVPgdyWKEL-----qhrlLDIQDtRLKLMDAHGIETMIL   57
DSSP  ----------lhhhhhhhLLLLLllhHHHH-----hhhhHLLLLhHHHHHHHLLEEEEEE


DSSP  EEL----llllllLLLLlLLLHHHHHHHHHHHHHLLEEEEEELLlleeellleellhhhl
Query FHY----vhhdldGRSYaDPAELSLRISRAASAAGIGLTLLPVLyshagfggqpasegqr  173
ident                                            |                
Sbjct SLNapavqaipdrRKAIeIARRANDVLAEECAKRPDRFLAFAAL----------------  101
DSSP  EELllhhhhlllhHHHHhHHHHHHHHHHHHHHHLLLLEEEEELL----------------


DSSP  lllLLHHHHHHHHHHH-HHHHhhhllEELEEELLLL--------LLLHH-HHHHHHlLLL
Query rfiNGSEAYLELLQRL-RAPLeaaghSLGLCFHSLR--------AVTPQ-QIATVLaAGH  223
ident        |  | |||             |                     |         
Sbjct -plQDPDAATEELQRCvNDLG-----FVGALVNGFSqegdgqtpLYYDLpQYRPFW-GEV  154
DSSP  -llLLHHHHHHHHHHHhHLLL-----LLEEEEELLLllllllllLLLLLhHHHHHH-HHH


DSSP  L--LLLEEEEE------------------llLHHHHHhhhhhhllLHHHHHH-HHLL---
Query D--DLPVHIHI------------------aeQQKEVDdcqawsgrRPLQWLY-ENVA---  259
ident    | |   |                                        |         
Sbjct EklDVPFYLHPrnplpqdsriydghpwllgpTWAFAQ-----etaVHALRLMaSGLFdeh  209
DSSP  HhhLLLEEEELllllhhhlhhhlllhhhlhhHLHHHH-----hhhHHHHHHHhLLHHhhl


DSSP  lllLEEEEE-LLLLLHHH----------------------hHHHHhHLLEEEELhhHHHH
Query vdqRWCLVH-ATHADPAE----------------------vAAMArSGAVAGLClsTEAN  296
ident       | |                                                   
Sbjct prlNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFHITTS--GNFR  266
DSSP  lllLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEEEELL--LLLL


DSSP  llllllLHHHHHHLLL--EEEELLLLL-LLLL--HHHHhHHHHhhhhhhhllllllllll
Query lgdgifPATDFLAQGG--RLGIGSDSH-VSLS--VVEElRWLEygqrlrdrkrnrlyrdd  351
ident          |     |  |     |                                   
Sbjct ----tqTLIDAILEIGadRILFSTDWPfENIDhaSDWF-NATS-----------------  304
DSSP  ----hhHHHHHHLLLLhhHEELLLLLLlLLHHhhHHHH-HHLL-----------------


DSSP  lllHHHHHHHHHHHHHHHHhLLLLlllllllllleeeellllhhhhllllhhhhhhhhhh
Query qpmIGRTLYDAALAGGAQAlGQPIgslavgrradllvldgndpylasaegdallnrwlfa  411
ident                                                             
Sbjct --iAEADRVKIGRTNARRL-FKLD------------------------------------  325
DSSP  --lLHHHHHHHHLHHHHHH-LLLL------------------------------------


DSSP  llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                         
Sbjct ----------------------------------------  325
DSSP  ----------------------------------------


No 43: Query=4rdvB Sbjct=2gwgA Z-score=11.5

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHH
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFQ   60
ident                                                       | |   
Sbjct -------------------------------------------------XIIDIHGHYTT   11
DSSP  -------------------------------------------------LLEEEEEELLL


DSSP  hhhlllllllllllllhhhhhhhhhHHHLL----------------------LLHHHHHH
Query ramaglaevagnpndsfwtwrelmyRMVAR----------------------LSPEQIEV   98
ident                                                      |      
Sbjct -----------------------apKALEDwrnrqiagikdpsvxpkvselkISDDELQA   48
DSSP  -----------------------llHHHHHhhhhhhhhhhlhhhlllhhhllLLHHHHHH


DSSP  HHH-HHHHHHHHHLEEEEEEEELllllllLLLLlllLHHHHHHHHHHHHHLLEEEEEELL
Query IAC-QLYIEMLKAGYTAVAEFHYvhhdldGRSYadpAELSLRISRAASAAGIGLTLLPVL  157
ident              |                 |    |       |              |
Sbjct SIIeNQLKKXQERGSDLTVFSPR--agdfNVSStwaAICNELCYRVSQLFPDNFIGAAXL  106
DSSP  HHHlLHHHHHHHHLLLEEEEELL--lllhHHHHhhhHHHHHHHHHHHHHLLLLEEEEEEL


DSSP  LLEeellleellhhhlllllLHHHHHHHHHHHHHHHhhhlLEELEEElLLLL--------
Query YSHagfggqpasegqrrfinGSEAYLELLQRLRAPLeaagHSLGLCFhSLRA--------  209
ident                             |                               
Sbjct PQS--------------pgvDPKTCIPELEKCVKEY----GFVAINL-NPDPsgghwtsp  147
DSSP  LLL--------------lllLHHHHHHHHHHHHHLL----LLLEEEE-LLLLllllllll


DSSP  -llHHHHHHHHlLLLL--LLLEEEE-----eLLLHhhhhhhhhhhllLHHHHHHHH-LLL
Query -vtPQQIATVLaAGHD--DLPVHIH-----iAEQQkevddcqawsgrRPLQWLYEN-VAV  260
ident                     |  ||                                   
Sbjct pltDRIWYPIY-EKXVelEIPAXIHvstgahYLNA----------dtTAFXQCVAGdLFK  196
DSSP  lllLHHHHHHH-HHHHhhLLLEEELlllllhHHHH----------hhHHHHHHHHLlHHH


DSSP  L---lLEEEEE-LLLL---LHHH------------hHHHHhHLLEEEELHHhhhhlllll
Query D---qRWCLVH-ATHA---DPAE------------vAAMArSGAVAGLCLSteanlgdgi  301
ident |         |                                     |           
Sbjct DfpelKFVIPHgGGAVpyhWGRFrglaqexkkplleDHVL-NNIFFDTCVY---hqpgid  252
DSSP  HllllLEEELHhHLLLhhhHHHHhhhhhhlllllhhHHLL-LLEEEELLLL---lhhhhh


DSSP  lLHHHHHhllLEEEELLLLLL---------lllhhHHHHHHHHHhhhhhlllLLLLllll
Query fPATDFLaqgGRLGIGSDSHV---------slsvvEELRWLEYGqrlrdrkrNRLYrddq  352
ident    |            |                     |  |            |     
Sbjct lLNTVIP--vDNVLFASEXIGavrgidprtgfyydDTKRYIEAS--------TILT----  298
DSSP  hHHHHLL--hHHEELLLLLLLlllleelllleellLLHHHHHHL--------LLLL----


DSSP  llhHHHHHHHHHHHHHHHH-LLLLllllllLLLLeeeellllhhhhllllhhhhhhhhhh
Query pmiGRTLYDAALAGGAQAL-GQPIgslavgRRADllvldgndpylasaegdallnrwlfa  411
ident                                                             
Sbjct ---PEEKQQIYEGNARRVYpRLDA----alKAKG--------------------------  325
DSSP  ---HHHHHHHHLHHHHHHLhHHHH----hhHHHH--------------------------


DSSP  llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                         
Sbjct ------------------------------------kleh  329
DSSP  ------------------------------------hhll


No 44: Query=4rdvB Sbjct=4ofcA Z-score=11.5

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFq   60
ident                                                       |||   
Sbjct -------------------------------------------------MKIDIHSHIL-   10
DSSP  -------------------------------------------------LLEEEEEELL-


DSSP  hhhlllllllllllllhhhhhhhHHHH------hLLLL--------hhhhhHHHHHHHHH
Query ramaglaevagnpndsfwtwrelMYRM------vARLS--------peqieVIACQLYIE  106
ident                                   | |                      |
Sbjct --------pkewpdlkkrfgyggWVQLqhhskgeAKLLkdgkvfrvvrencWDPEVRIRE   62
DSSP  --------llllllhhhhhllllLEEEeeeelleEEEEelleeeeeeehhhLLHHHHHHH


DSSP  HHHHLEEEEEEEEL---------------LLLLlllllllllLHHHHHHHHHHHhhlLEE
Query MLKAGYTAVAEFHY---------------VHHDldgrsyadpAELSLRISRAASaagIGL  151
ident |   | |  |                                                  
Sbjct MDQKGVTVQALSTVpvmfsywakpedtlnLCQL--------lNNDLASTVVSYP---RRF  111
DSSP  HHHHLLLEEEEELLhhhhlllllhhhhhhHHHH--------hHHHHHHHHHHLL---LLE


DSSP  EEEELLLLEeellleellhhhlllllLHHHHHHHH-HHHHhhhhhhllEELEEElLLLL-
Query TLLPVLYSHagfggqpasegqrrfinGSEAYLELL-QRLRapleaaghSLGLCFhSLRA-  209
ident   |  |                          |     |           |         
Sbjct VGLGTLPMQ--------------apeLAVKEMERCvKELG--------FPGVQI-GTHVn  148
DSSP  EEEELLLLL--------------lhhHHHHHHHHHhHLLL--------LLEEEE-ELEEl


DSSP  ---llHHHHHHHHLL-LLLLLLEEEEE--------------llLHHHhhhhhhhhllLHH
Query ---vtPQQIATVLAA-GHDDLPVHIHI--------------aeQQKEvddcqawsgrRPL  251
ident       |    | ||          |                                  
Sbjct ewdlnAQELFPVYAAaERLKCSLFVHPwdmqmdgrmakywlpwLVGM-----paettIAI  203
DSSP  leellLHHHHHHHHHhHHHLLEEEEELllllllhhhhlllhhhHLHH-----hhhhhHHH


DSSP  HHHHHHLLL----llLEEEEE-LLLLLHHH---------------------hHHHHHHlL
Query QWLYENVAV----dqRWCLVH-ATHADPAE---------------------vAAMARSgA  285
ident                  |  |                                    |  
Sbjct CSMIMGGVFekfpklKVCFAHgGGAFPFTVgrishgfsmrpdlcaqdnpmnpKKYLGS-F  262
DSSP  HHHHLLLHHhhllllLEEELHhHLLHHHHHhhhhhhhhhlhhhhlllllllhHHHLLL-L


DSSP  EEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLL----LLLHhHHHHHHHHhhhh
Query VAGLCLSteanlgdgifPATDFLAQGG--RLGIGSDSHV----SLSVvEELRWLEYgqrl  339
ident                           |      | |                  |     
Sbjct YTDALVH-------dplSLKLLTDVIGkdKVILGTDYPFplgeLEPG-KLIESMEE----  310
DSSP  EEELLLL-------lhhHHHHHHHHHLllLEELLLLLLLllllLLLL-HHHHHLLL----


DSSP  hhlllllllllllllHHHHHHHHHHHHHHHHHLLLlllllllLLLLeeeellllhhhhll
Query rdrkrnrlyrddqpmIGRTLYDAALAGGAQALGQPigslavgRRADllvldgndpylasa  399
ident                   |            ||         |                 
Sbjct --------------fDEETKNKLKAGNALAFLGLE-------RKQF--------------  335
DSSP  --------------lLHHHHHHHHLHHHHHHHLLL-------HHHL--------------


DSSP  llhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query egdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                     
Sbjct ----------------------------------------------------  335
DSSP  ----------------------------------------------------


No 45: Query=4rdvB Sbjct=1v77A Z-score=10.9

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
ident                                                             
Sbjct ------------------------------------------------VKFIEMDIRDK-   11
DSSP  ------------------------------------------------LLLEEEEELLH-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhhhhhHHHHHHHHHlEEEEEEEel
Query ramaglaevagnpndsfwtwrelmyrmvarlspeqieviacQLYIEMLKAgYTAVAEFhy  120
ident                                            |          |     
Sbjct -----------------------------------------EAYELAKEW-FDEVVVS--   27
DSSP  -----------------------------------------HHHHHHHHH-LLEEEEE--


DSSP  llllllllllllllhhhhhhhhhhhhhlleeeeeELLLLeeellleellhhhllllllhh
Query vhhdldgrsyadpaelslrisraasaagigltllPVLYShagfggqpasegqrrfingse  180
ident                                                             
Sbjct ----------------------------------IKFNE---------------------   32
DSSP  ----------------------------------EEELL---------------------


DSSP  hHHHHhHHHHHHHHhHLLEELEEELLLlllLHHHHHHHHLLlLLLLLEEEEELllhhhhh
Query aYLELlQRLRAPLEaAGHSLGLCFHSLravTPQQIATVLAAgHDDLPVHIHIAeqqkevd  240
ident         ||                     |                            
Sbjct -EVDK-EKLREARK-EYGKVAILLSNP---KPSLVRDTVQK-FKSYLIYVESN-------   78
DSSP  -LLLH-HHHHHHHH-HHLLEEEEEELL---LHHHHHHHHHH-LLLLEEEEELL-------


DSSP  hhhhhhlllHHHHHHHhLLLLlLEEEEELL------LLLHHHHHHHHHHLLEEEELHhHH
Query dcqawsgrrPLQWLYEnVAVDqRWCLVHAT------HADPAEVAAMARSGAVAGLCLsTE  294
ident           |                           |      |       |  |   
Sbjct ---------DLRVIRYsIEKG-VDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFSL-RP  127
DSSP  ---------LHHHHHHhHHLL-LLEEELLLllllllLLLHHHHHHHHHHLLEEEEEL-HH


DSSP  HHLL--------LLLL--LHHHHHHLLLEEEELLLLL---LLLLHHHHHHHHHHHHhhhh
Query ANLG--------DGIF--PATDFLAQGGRLGIGSDSH---VSLSVVEELRWLEYGQrlrd  341
ident                             |    |                          
Sbjct LLYSnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQekwDVRYPRDLISLGVVIG----  183
DSSP  HHHLlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLlhhHLLLHHHHHHHHHHLL----


DSSP  lllllllllllllHHHHHHHHHHHHHHHHHLllllllllllllleeeellllhhhhllll
Query rkrnrlyrddqpmIGRTLYDAALAGGAQALGqpigslavgrradllvldgndpylasaeg  401
ident                              |                              
Sbjct ------------mEIPQAKASISMYPEIILK-----------------------------  202
DSSP  ------------lLHHHHHHLLLHHHHHHHL-----------------------------


DSSP  hhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query dallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                   
Sbjct --------------------------------------------------  202
DSSP  --------------------------------------------------


No 46: Query=4rdvB Sbjct=1itqA Z-score=10.8

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
ident                                                       |     
Sbjct -----------------------------------dffrdeaerimrDSPVIDGHNDLP-   24
DSSP  -----------------------------------lhhhhhhhhhhlLLLEEEEEELHH-


DSSP  hhhlllllllllllllhhhhhhhhhhhHLLLLHHH-------hhhhhhhHHHH-HHHHLE
Query ramaglaevagnpndsfwtwrelmyrmVARLSPEQ-------ieviacqLYIE-MLKAGY  112
ident                                                    |        
Sbjct ------------------------wqlLDMFNNRLqderanlttlagthTNIPkLRAGFV   60
DSSP  ------------------------hhhHHHHLLLLllhhhlllllllllLLHHhHHHLLE


DSSP  EEEEEEELL-llllLLLLllllLHHHHHHHHHH---HHHL-----------------LEE
Query TAVAEFHYV-hhdlDGRSyadpAELSLRISRAA---SAAG-----------------IGL  151
ident        |               |      |                             
Sbjct GGQFWSVYTpcdtqNKDAvrrtLEQMDVVHRMCrmyPETFlyvtssagirqafregkVAS  120
DSSP  EEEEEEELLlhhhlLLLHhhhhHHHHHHHHHHHhhlLLLEeelllhhhhhhhhhlllEEE


DSSP  EEEELLLleeellleellhhhllLLLL--HHHHHHHHHHHhhhhhhhlleELEEELLLLL
Query TLLPVLYshagfggqpasegqrrFING--SEAYLELLQRLrapleaaghsLGLCFHSLRA  209
ident                                    | |              |       
Sbjct LIGVEGG----------------HSIDssLGVLRALYQLG---------mRYLTLTHSCN  155
DSSP  EEEEELH----------------HHLLllHHHHHHHHHLL---------eEEEELLLLLL


DSSP  LLH-------------------HHHHHHHLL-LLLLLLEEEEElllhhhhhhhhhhhlll
Query VTP-------------------QQIATVLAA-GHDDLPVHIHIaeqqkevddcqawsgrr  249
ident                            |                                
Sbjct TPWadnwlvdtgdsepqsqglsPFGQRVVKElNRLGVLIDLAH-----------------  198
DSSP  LLLlllhhhlllllllllllllHHHHHHHHHhHHHLLEEELLL-----------------


DSSP  hHHHHHHHL---LLLLlEEEE-ELLL--------LLHHHHHHHHHHLLEEEELHhhHHHL
Query pLQWLYENV---AVDQrWCLV-HATH--------ADPAEVAAMARSGAVAGLCLstEANL  297
ident                                                           | 
Sbjct vSVATMKATlqlSRAP-VIFShSSAYsvcasrrnVPDDVLRLVKQTDSLVMVNF--YNNY  255
DSSP  lLHHHHHHHhhhLLLL-LEELlLLLLllllllllLLHHHHHHHHHHLLEEEELL--LHHH


DSSP  LLL---------llLHHHHHHLLL--EEEELLLLL---------LLLL-HHHHHHHHHhh
Query GDG---------ifPATDFLAQGG--RLGIGSDSH---------VSLS-VVEELRWLEyg  336
ident                        |    | | |              |        |   
Sbjct ISCtnkanlsqvadHLDHIKEVAGarAVGFGGDFDgvprvpeglEDVSkYPDLIAELL--  313
DSSP  HLLlllllhhhhhhHHHHHHHHLLhhHEEELLLLLlllllllllLLLLlHHHHHHHHH--


DSSP  hhhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLllllllllllllleeeellllhhh
Query qrlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGqpigslavgrradllvldgndpyl  396
ident        |                 |                                  
Sbjct -------RRNW-------TEAEVKGALADNLLRVFE------------------------  335
DSSP  -------HLLL-------LHHHHHHHHLHHHHHHHH------------------------


DSSP  hllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query asaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                        
Sbjct ---------------------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  ---------------------hhhhllllllllllllllhhhlllllllllllll


No 47: Query=4rdvB Sbjct=2a3lA Z-score=10.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------leeEEEEEEelleeeeeeeeeellllleeee
Query -----------------------------saiFAERALlpegwarnvrfeisadgvlaei   31
ident                                  |                          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  elllllllleelllleEELEEEEEELHHHHHHL---------------------------
Query rpdanadgaerlggavLPGMPNLHSHAFQRAMA---------------------------   64
ident                        | |                                  
Sbjct --------------fyNVRKVDTHVHHSACMNQkhllrfiksklrkepdevvifrdgtyl  204
DSSP  --------------llLLLEEEEEEELLLLLLHhhhhhhhhhhhhllllllleeelleee


DSSP  ---------------lLLLL----lllllllhHHHHHHH------hhHHLLL-------L
Query ---------------gLAEV----agnpndsfWTWRELM------yrMVARL-------S   92
ident                                      |                      
Sbjct tlrevfesldltgydlNVDLldvhadkstfhrFDKFNLKynpcgqsrLREIFlkqdnliQ  264
DSSP  lhhhhhhhhlllllllLLLLllllllllllllLLLLHHHhllllllhHHHHHlllllllL


DSSP  HHHHHHHHHHHHHHHHHHLEEEEEEEELllllllllllLLLL-HHHHHH--hHHHHhhlL
Query PEQIEVIACQLYIEMLKAGYTAVAEFHYvhhdldgrsyADPA-ELSLRI--sRAASaagI  149
ident       |  |         |                        |   |      |    
Sbjct GRFLGEITKQVFSDLEASKYQMAEYRIS-----iygrkMSEWdQLASWIvnnDLYS---E  316
DSSP  LLLHHHHHHHHHHHHLLLLLEEEEEEEE-----lllllLLHHhHHHHHHhllLLLL---L


DSSP  EEEEEELLLLEeellLEEL--lhhhlllllLHHHHHHHHH---------hhHHHHHhhLL
Query GLTLLPVLYSHagfgGQPA--segqrrfinGSEAYLELLQ---------rlRAPLEaaGH  198
ident     |  |                              |                     
Sbjct NVVWLIQLPRL----YNIYkdmgivtsfqnILDNIFIPLFeatvdpdshpqLHVFL--KQ  370
DSSP  LEEEEEEEELL----HHHHlllllllllhhHHHHHLLHHHhhhhlhhhlllLHHHH--LL


DSSP  EELEEELLLL----------------------llLHHHHHHHHL--LLLL---------L
Query SLGLCFHSLR----------------------avTPQQIATVLA--AGHD---------D  225
ident   |                                        |                
Sbjct VVGFDLVDDEskperrptkhmptpaqwtnafnpaFSYYVYYCYAnlYVLNklreskgmtT  430
DSSP  EEEEEEELLLllllllllllllllllllllllllHHHHHHHHHHhhHHHHhhhllllllL


DSSP  LLEEEEELLlHHHHhhhhhhhllLHHHHHHHHllllllEEEEELLLL--LHHHHHHHHHH
Query LPVHIHIAEqQKEVddcqawsgrRPLQWLYENvavdqrWCLVHATHA--DPAEVAAMARS  283
ident      |  |                |                |       |         
Sbjct ITLRPHSGE-AGDI---------DHLAATFLT-----cHSIAHGINLrkSPVLQYLYYLA  475
DSSP  LEELLLLLL-LLLL---------HHHHHHHHH-----lLLLLLLHHHhhLHHHHHHHHHH


DSSP  LLEEEELHHHHHhLLLL---LLLHHHHHHLLLEEEELLLLLL-----lLLHHHHHHHHHH
Query GAVAGLCLSTEAnLGDG---IFPATDFLAQGGRLGIGSDSHV-----sLSVVEELRWLEY  335
ident                       |   |   |       |            |||      
Sbjct QIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDPLqihltkEPLVEEYSIAAS  534
DSSP  LLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLHHhhllllLHHHHHHHHHHH


DSSP  HHHhhhlllllllllllllHHHHHHHHHHHhHHHHHLLL----llLLLLLLllleeeell
Query GQRlrdrkrnrlyrddqpmIGRTLYDAALAgGAQALGQP----igSLAVGRradllvldg  391
ident                        |   |        |                       
Sbjct VWK---------------lSACDLCEIARN-SVYQSGFShalkshWIGKDY---------  569
DSSP  HHL---------------lLHHHHHHHHHH-HHHHLLLLhhhhhhHLLLLL---------


DSSP  llhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query ndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                             
Sbjct -------------ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  -------------llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 48: Query=4rdvB Sbjct=4dziC Z-score=10.0

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
ident                                                         |   
Sbjct ---------------------------------------------alNYRVIDVDNHYYe   15
DSSP  ---------------------------------------------llLLLEEEEEEELLl


DSSP  ----------------hhhhlllllllllllllhhHHHHHhHHHHLLL------------
Query ----------------qramaglaevagnpndsfwTWRELmYRMVARL------------   91
ident                                                             
Sbjct pldsftrhldkkfkrrgvqmlsdgkrtwavigdrvNHFIP-NPTFDPIivpgcldllfrg   74
DSSP  llllllllllhhhlllleeeeelllleeeeelleeLLLLL-LLLLLLEelllllhhhhhl


DSSP  -----------------lhhhhhHHHHHHHHHHHHHLEEEEEEEE-----------llll
Query -----------------speqieVIACQLYIEMLKAGYTAVAEFH-----------yvhh  123
ident                                 |                           
Sbjct eipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdie  134
DSSP  lllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhh


DSSP  llllllllllLHHHHHHHhhhhhhLLEEEEEELLLLeeellleellhhhllllLLHHHHH
Query dldgrsyadpAELSLRISraasaaGIGLTLLPVLYShagfggqpasegqrrfiNGSEAYL  183
ident             |                  |                            
Sbjct atmasvhafnLWLDEDWG--fdrpDHRIIAAPIVSL-----------------ADPTRAV  175
DSSP  hhhhhhhhhhHHHHHHLL--llllLLLEEELLLLLL-----------------LLHHHHH


DSSP  HHHHHHHHHHhhhllEELEEELLLLL-------lLHHH-HHHHHlLLLL--LLLEEEEEl
Query ELLQRLRAPLeaaghSLGLCFHSLRA-------vTPQQ-IATVLaAGHD--DLPVHIHIa  233
ident |      |                                  |  |       ||  |  
Sbjct EEVDFVLARG-----AKLVLVRPAPVpglvkprsLGDRsHDPVW-ARLAeaGVPVGFHL-  228
DSSP  HHHHHHHHLL-----LLLEELLLLLLllllllllLLLHhHHHHH-HHHHhhLLLEEEEL-


DSSP  llhhhhhHHHHH---------------hllLHHHHHHHHLL--------lllLEEEEELL
Query eqqkevdDCQAW---------------sgrRPLQWLYENVA--------vdqRWCLVHAT  270
ident                               |                             
Sbjct ----sdsGYLHIaaawggakdpldqvllddRAIHDTMASMIvhgvftrhpklKAVSIENG  284
DSSP  ----lllLLHHHhhhllllllhhhhhhhllHHHHHHHHHHHhllhhhhllllLEEEELLL


DSSP  -LLLHHH------------------hhhhHHHLLEEEElhhhhhhllllLLLHHHHHHLL
Query -HADPAE------------------vaamARSGAVAGLclsteanlgdgIFPATDFLAQG  311
ident                               |                             
Sbjct sYFVHRLikrlkkaantqpqyfpedpveqLRNNVWIAP---------yyEDDLPELARVI  335
DSSP  lLHHHHHhhhhhhhhhhlhhhllllhhhhHHHHEEELL---------llLLLHHHHHHHH


DSSP  L--EEEELLLLLL---LLLHHHHHhHHHHHhhhhhlllllllllllllHHHHHHHHHHHH
Query G--RLGIGSDSHV---SLSVVEELrWLEYGqrlrdrkrnrlyrddqpmIGRTLYDAALAG  366
ident |      |||        | |        |                              
Sbjct GvdKILFGSDWPHgegLASPVSFT-AELKG-----------------fSESDIRKIMRDN  377
DSSP  LhhHLLLLLLLLLlllLLLHHHHH-HHHLL-----------------lLHHHHHHHHLHH


DSSP  HHHHHLllllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeellee
Query GAQALGqpigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrw  426
ident     ||                                                      
Sbjct ALDLLG------------------------------------------------------  383
DSSP  HHHHHL------------------------------------------------------


DSSP  eelllllllhhhhhhhhhhhhhhhl
Query vvrdgrhageersarafvqvlgell  451
ident                          
Sbjct --------------------vqvgs  388
DSSP  --------------------lllll


No 49: Query=4rdvB Sbjct=3qy6A Z-score=9.5

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeelEEEEEELH--
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpgMPNLHSHA--   58
ident                                                   |   | |   
Sbjct --------------------------------------------------MIDIHCHIlp   10
DSSP  --------------------------------------------------LEELLLLLll


DSSP  ---HHHHhlllllllllllllhhhhhhhhhhhhllllhhhHHHHHHHHHHHHHHHLEEEE
Query ---FQRAmaglaevagnpndsfwtwrelmyrmvarlspeqIEVIACQLYIEMLKAGYTAV  115
ident                                                        |    
Sbjct amdDGAG---------------------------------DSADSIEMARAAVRQGIRTI   37
DSSP  lllLLLL---------------------------------LHHHHHHHHHHHHHLLLLEE


DSSP  EEEELlllllllllllllLHHHHHHHHHHHHH-----LLEEEEEElllleeellleellh
Query AEFHYvhhdldgrsyadpAELSLRISRAASAA-----GIGLTLLPvlyshagfggqpase  170
ident                   |                                         
Sbjct IATPH---hnngvyknepAAVREAADQLNKRLikediPLHVLPGQ---------------   79
DSSP  ELLLE---ellllllllhHHHHHHHHHHHHHHhhlllLLEEELLL---------------


DSSP  hhllllllhhhhhhhhhhhhhhhhhhlleeleEELLLllllhhHHHHHHLLL-----llL
Query gqrrfingseaylellqrlrapleaaghslglCFHSLravtpqQIATVLAAG-----hdD  225
ident                                                 ||          
Sbjct --------------------------------EIRIY-----gEVEQDLAKRqllslndT  102
DSSP  --------------------------------EEELL-----lLHHHHHHLLllllhhhL


DSSP  LLEEEEElllHHHHhhhhhhhlllhhHHHHHH-LLLL---lLEEEEELLL-----llHHH
Query LPVHIHIaeqQKEVddcqawsgrrplQWLYEN-VAVD---qRWCLVHATH-----adPAE  276
ident     |        |                                |          |  
Sbjct KYILIEF--pFDHV-----------pRYAEQLfYDLQlkgyIPVIAHPERnreirenPSL  149
DSSP  LEEEEEL--lLLLL-----------lLLHHHHhHHHHhlllEEEEELHHHlhhhhhlLHH


DSSP  HHHHHHHLLEEEELHHH-hHHLL---LLLL--LHHHHhhllLEEEELLLLL----LLLLH
Query VAAMARSGAVAGLCLST-eANLG---DGIF--PATDFlaqgGRLGIGSDSH----VSLSV  326
ident        ||             |                        || |         
Sbjct LYHLVEKGAASQITSGSlaGIFGkqlKAFSlrLVEAN----LIHFVASDAHnvktRNFHT  205
DSSP  HHHHHHLLLEEEEEHHHhlLLLLhhhHHHHhhHHHLL----LLLEEELLLLllllLLLLH


DSSP  HHHHHHHHhhhhhhhlllLLLLllllllhHHHHHHhHHHHHHHhHLLLllllllllllle
Query VEELRWLEygqrlrdrkrNRLYrddqpmiGRTLYDaALAGGAQaLGQPigslavgrradl  386
ident  | |  ||                         |          |               
Sbjct QEALYVLE----------KEFG-------SELPYM-LTENAEL-LLRN------------  234
DSSP  HHHHHHHH----------HHHL-------LHHHHH-HHHHHHH-HHLL------------


DSSP  eeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhh
Query lvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqv  446
ident                                                             
Sbjct ----------------------------------------------------qtifrqpp  242
DSSP  ----------------------------------------------------llllllll


DSSP  hhhhl
Query lgell  451
ident      
Sbjct qpvkr  247
DSSP  lllll


No 50: Query=4rdvB Sbjct=3dcpA Z-score=9.3

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFq   60
ident                                                       | |   
Sbjct -------------------------------------------------XKRDGHTHTE-   10
DSSP  -------------------------------------------------LLEEEEELLL-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEEEEEEEEL
Query ramaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYTAVAEFHY  120
ident                                                             
Sbjct ------------------------------fcphgthdDVEEXVLKAIELDFDEYSIVEH   40
DSSP  ------------------------------llllllllLHHHHHHHHHHLLLLEEEEEEE


DSSP  ----------------------LLLLlllllllllLHHHHHHHHHHHHHL--LEEEEEEl
Query ----------------------VHHDldgrsyadpAELSLRISRAASAAG--IGLTLLPv  156
ident                                                             
Sbjct aplssefxkntagdkeavttasXAXS-------dlPYYFKKXNHIKKKYAsdLLIHIGF-   92
DSSP  llllhhhhhllllllhhhhlllLLHH-------hhHHHHHHHHHHHHHLLllLEEEEEE-


DSSP  llleeellleellhhhllllllhhhhhhhhhhhhhhhhhhlleeleeeLLLLllLHHHHH
Query lyshagfggqpasegqrrfingseaylellqrlrapleaaghslglcfHSLRavTPQQIA  216
ident                                                             
Sbjct -----------------------------------------------eVDYLigYEDFTR  105
DSSP  -----------------------------------------------eEELLllLHHHHH


DSSP  HHHLLLLL-llLEEEEE------------------------------lllHHHHhhhhhh
Query TVLAAGHD-dlPVHIHI------------------------------aeqQKEVddcqaw  245
ident   |                                               |         
Sbjct DFLNEYGPqtdDGVLSLhflegqggfrsidfsaedynegivqfyggfeqaQLAY------  159
DSSP  HHHHHHHHhllEEEEELleeeelleeeellllhhhhhhhlhhhhllhhhhHHHH------


DSSP  hllLHHHHHHHHL-llllLEEEEELLL---------------------lLHHHHHHHHHH
Query sgrRPLQWLYENV-avdqRWCLVHATH---------------------aDPAEVAAMARS  283
ident           |            |                              |     
Sbjct --lEGVKQSIEADlglfkPRRXGHISLcqkfqqffgedtsdfseevxekFRVILALVKKR  217
DSSP  --hHHHHHHHHLLlllllLLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHH


DSSP  LLEEEELHhHHHHL---LLLLL---LHHHHHHLLLEEEELLLLL--LLLLhhHHHHHHHH
Query GAVAGLCLsTEANL---GDGIF---PATDFLAQGGRLGIGSDSH--VSLSvvEELRWLEY  335
ident                  |         |           |||||                
Sbjct DYELDFNT-AGLFKplcGETYPpkkIVTLASELQIPFVYGSDSHgvQDIG--RGYSTYCQ  274
DSSP  LLEEEEEL-HHHHLlllLLLLLlhhHHHHHHHLLLLEEEELLLLlhHHLL--LLHHHHHH


DSSP  HHHhhhlllllllllllllhhhhhhhhhhhhhhhhhlllllllllllllleeeellllhh
Query GQRlrdrkrnrlyrddqpmigrtlydaalaggaqalgqpigslavgrradllvldgndpy  395
ident                                                             
Sbjct KLE---------------------------------------------------------  277
DSSP  HLL---------------------------------------------------------


DSSP  hhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query lasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                         
Sbjct --------------------------------------------------------  277
DSSP  --------------------------------------------------------


No 51: Query=4rdvB Sbjct=1j5sA Z-score=8.7

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
ident                                                       | |   
Sbjct ------------------------hmflgedylltnraavrlfnevkDLPIVDPHNHLDa   36
DSSP  ------------------------llllllllllllhhhhhhhhhhlLLLEEELLLLLLh


DSSP  --------------hhhhLLLLLL--LLLL------------------------------
Query --------------qramAGLAEV--AGNP------------------------------   73
ident                                                             
Sbjct kdivenkpwndiwevegaTDHYVWelMRRCgvseeyitgsrsnkekwlalakvfprfvgn   96
DSSP  hhhhhllllllhhhhhllLLHHHHhhHHHLlllhhhllllllhhhhhhhhhhhhhhhlll


DSSP  -----------lllhhhhhhhhhhhhllllhhhhhhhhhHHHHHHHHHLEEEEEEEELLL
Query -----------ndsfwtwrelmyrmvarlspeqieviacQLYIEMLKAGYTAVAEFHYVH  122
ident                                                             
Sbjct ptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTDDPV  156
DSSP  hhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLLLLL


DSSP  llllllllllllhHHHHHHHHHHHHL-LEEEEEELL--LLEEellleELLHHHLL-----
Query hdldgrsyadpaeLSLRISRAASAAG-IGLTLLPVL--YSHAgfggqPASEGQRR-----  174
ident                     |  |                                    
Sbjct ------------sTLEHHRKAKEAVEgVTILPTWRPdrAMNV-----DKEGWREYvekmg  199
DSSP  ------------lLLHHHHHHHHHLLlLEEELLLLLhhHHLL-----LLLLHHHHhhhhh


DSSP  ---------lllLHHHHHHHHHHHHHHHhhhllEELEEeLLLL-----------------
Query ---------finGSEAYLELLQRLRAPLeaaghSLGLCfHSLR-----------------  208
ident                |                       | |                  
Sbjct erygedtstldgFLNALWKSHEHFKEHG-----CVASD-HALLepsvyyvdenraravhe  253
DSSP  hhhllllllhhhHHHHHHHHHHHHHLLL-----LLEEE-EEELllllllllhhhhhhhhh


DSSP  --------------llLHHHHHHHHlLLLL--LLLEEEEELLL-----------------
Query --------------avTPQQIATVLaAGHD--DLPVHIHIAEQ-----------------  235
ident                                       ||                    
Sbjct kafsgekltqdeindyKAFMMVQFG-KMNQetNWVTQLHIGALrdyrdslfktlgpdsgg  312
DSSP  hhlllllllhhhhhhhHHHHHHHHH-HHHHhhLLEEEEEELEEllllhhhhhhlllllll


DSSP  hHHHHhhhhhhLLLHhHHHHHHLL----lllLEEEeELLL--LLHHHHHHHHHHL-LEEE
Query qKEVDdcqawsGRRPlQWLYENVA----vdqRWCLvHATH--ADPAEVAAMARSG-AVAG  288
ident              |                    |         |              |
Sbjct dISTN------FLRI-AEGLRYFLnefdgklKIVL-YVLDptHLPTISTIARAFPnVYVG  364
DSSP  lEELL------LLLH-HHHHHHHHhhlllllLEEE-EELLhhHHHHHHHHHHHLLlEEEL


DSSP  ElhhhhhhLLLL-----llLHHHHHHLLL---EEEELLLLL---LLLL-HHHHHHHHHHH
Query LclsteanLGDG-----ifPATDFLAQGG---RLGIGSDSH---VSLS-VVEELRWLEYG  336
ident                                   |   ||       |      | |   
Sbjct A-----pwWFNDspfgmemHLKYLASVDLlynLAGMVTDSRkllSFGSrTEMFRRVLSNV  419
DSSP  L-----llLLLLlhhhhhhHHHHHHLLLLhhhLLLLLLLLLlllHHHHhHHHHHHHHHHH


DSSP  HHH-hhLLLLlllllllLLHHHHHHHHHHHHHHHHHLllllllllllllleeeellllhh
Query QRL-rdRKRNrlyrddqPMIGRTLYDAALAGGAQALGqpigslavgrradllvldgndpy  395
ident                               |                             
Sbjct VGEmveKGQI-----piKEARELVKHVSYDGPKALFF-----------------------  451
DSSP  HHHhhhLLLL-----lhHHHHHHHHHHHLHHHHHHHL-----------------------


DSSP  hhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query lasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                         
Sbjct --------------------------------------------------------  451
DSSP  --------------------------------------------------------


No 52: Query=4rdvB Sbjct=3au2A Z-score=8.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  -----------------------leeeeeeeeelleeeeeeeeeellllleeeeellLLL
Query -----------------------saifaerallpegwarnvrfeisadgvlaeirpdANA   37
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalPGV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhllLLL


DSSP  LlleELLL----------------------------------------------------
Query DgaeRLGG----------------------------------------------------   45
ident                                                             
Sbjct E--rAELCgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkn  238
DSSP  L--eEEELhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   45
ident                                                             
Sbjct glqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagetee  298
DSSP  lleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhh


DSSP  --------------------------------leeELEEeeeelhhhhhhllllllllll
Query --------------------------------avlPGMPnlhshafqramaglaevagnp   73
ident                                                             
Sbjct evyaalglpwippplredqgeveaalegrlpklleLPQV---------------------  337
DSSP  hhhhhlllllllhhhlllllhhhhhhlllllllllHHHL---------------------


DSSP  lllhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhleEEEEEEELLLlllllllllll
Query ndsfwtwrelmyrmvarlspeqieviacqlyiemlkagyTAVAEFHYVHhdldgrsyadp  133
ident                                              |              
Sbjct ---------------------------------------KGDLQVHSTY--------sdg  350
DSSP  ---------------------------------------LEEEEELLLL--------lll


DSSP  lhHHHHHHHHHHHHLLEEEEEELLLLEeellleellhhhlllLLLHHHHHHHHHHHHHHH
Query aeLSLRISRAASAAGIGLTLLPVLYSHagfggqpasegqrrfINGSEAYLELLQRLRAPL  193
ident          ||   |                               |  |      |   
Sbjct qnTLEELWEAAKTMGYRYLAVTDHSPA----------vrvagGPSPEEALKRVGEIRRFN  400
DSSP  llLHHHHHHHHHHHLLLEEEEEEELHH----------hhlllLLLHHHHHHHHHHHHHHH


DSSP  -HHHL-LEELEEELLLL-lllhhHHHHHHLLllllLLEEEEElllhHHHHHhhHHHLL-L
Query -EAAG-HSLGLCFHSLR-avtpqQIATVLAAghddLPVHIHIaeqqKEVDDcqAWSGR-R  249
ident         |                  ||        |                      
Sbjct eTHGPpYLLAGAEVDIHpdgtldYPDWVLRE---lDLVLVSV---hSRFNL--PKADQtK  452
DSSP  hHHLLlEEEEEEEEELLllllllLLHHHHLL---lLEEEEEL---lLLLLL--LHHHHhH


DSSP  HHHHHHhHLLLlllEEEEELL-----------llLHHHHHHHHHHLLEEEELH-HHHHhl
Query PLQWLYeNVAVdqrWCLVHAT-----------haDPAEVAAMARSGAVAGLCL-STEAnl  297
ident  |              | | |               |        |              
Sbjct RLLKAL-ENPF--vHVLAHPTarllgrrapieadWEAVFQKAKEKGVAVEIDGyYDRM--  507
DSSP  HHHHHH-LLLL--lLEELLLLlllllllllllllHHHHHHHHHHHLLEEEEELlLLLL--


DSSP  lllllLHHHHHHLLLEEEELLL-----LLLL-LLHHHHHHHHHhhhhhhhllllllllll
Query gdgifPATDFLAQGGRLGIGSD-----SHVS-LSVVEELRWLEygqrlrdrkrnrlyrdd  351
ident       |      |       |             |                        
Sbjct dlpddLARMAYGMGLWISLSTDahqtdHLRFmELAVGTAQRAW-----------------  550
DSSP  lllhhHHHHHHHLLLLEEEELLlllhhHHHHhHHHHHHHHHLL-----------------


DSSP  lllhhhhHHHHHhhHHHHhhlLLLLllllllllleeeellllhhhhllllhhhhhhhhhh
Query qpmigrtLYDAAlaGGAQalgQPIGslavgrradllvldgndpylasaegdallnrwlfa  411
ident                                                             
Sbjct ------iGPERV--LNTL--dYEDL-----------------------------------  565
DSSP  ------lLLLLL--HHHL--lHHHH-----------------------------------


DSSP  llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                         
Sbjct ------------------------------lswlkarrgv  575
DSSP  ------------------------------hhhhhlllll


No 53: Query=4rdvB Sbjct=1m65A Z-score=7.8

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeleeeeeelhhh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpgmpnlhshafq   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhlEEEEEEEEL
Query ramaglaevagnpndsfwtwrelmyrmvarlspeqieviacqlyiemlkagYTAVAEFHY  120
ident                                                    |      | 
Sbjct ---------------------------------------------------YPVDLHMHT    9
DSSP  ---------------------------------------------------LLEELLLLL


DSSP  LLLLllllllllllHHHHHHHHHHHHHLLEEEEEELLLLEeellleellhhhllLLLLHH
Query VHHDldgrsyadpaELSLRISRAASAAGIGLTLLPVLYSHagfggqpasegqrrFINGSE  180
ident |                      |   || |                             
Sbjct VAST-------haySTLSDYIAQAKQKGIKLFAITDHGPD------------meDAPHHW   50
DSSP  LLLL-------lllLLHHHHHHHHHHHLLLEEEEEEELLL------------llLLLLLH


DSSP  HHHHhHHHHHhhHHHHL-LEELEEELLLL-lllhhHHHH-HHLLllllLLEEEEElllhh
Query AYLElLQRLRapLEAAG-HSLGLCFHSLR-avtpqQIAT-VLAAghddLPVHIHIaeqqk  237
ident                 |   |                                       
Sbjct HFIN-MRIWP--RVVDGvGILRGIEANIKnvdgeiDCSGkMFDS---lDLIIAGFhepvf  104
DSSP  HHHH-HHHLL--LEELLeEEEEEEEEELLllllllLLLHhHHHH---lLEEEEELlllll


DSSP  HHHHHHHhhllLHHHHHHHHLLLlllEEEEELL-----LLLHHHHHHHHHHLLEEEELHH
Query EVDDCQAwsgrRPLQWLYENVAVdqrWCLVHAT-----HADPAEVAAMARSGAVAGLCLS  292
ident    |                  |       |           |   | |          |
Sbjct APHDKAT--ntQAMIATIASGNV---HIISHPGnpkyeIDVKAVAEAAAKHQVALEINNS  159
DSSP  LLLLHHH--hhHHHHHHHHLLLL---LEELLLLlllllLLHHHHHHHHHHHLLEEEEELL


DSSP  HhhhlllLLLL-HHHHHHLLLEEEELLL------llllLLHHHHHHHHHhhhhhhhllll
Query TeanlgdGIFP-ATDFLAQGGRLGIGSD------shvsLSVVEELRWLEygqrlrdrkrn  345
ident             |      ||    |||                |               
Sbjct S------NCREvAAAVRDAGGWVALGSDshtaftmgefEECLKILDAVD-----------  202
DSSP  L------LHHHhHHHHHHHLLLEEEELLlllhhhllllHHHHHHHHHLL-----------


DSSP  lllllllllhhhhHHHHhhHHHHhhhlLLLL---------lllllLLLLeeeellllhhh
Query rlyrddqpmigrtLYDAalAGGAqalgQPIG---------slavgRRADllvldgndpyl  396
ident                                                             
Sbjct ------------fPPER--ILNV---sPRRLlnflesrgmapiaeFADL-----------  234
DSSP  ------------lLHHH--LHHH---lHHHHhhhhhhllllllhhHLLL-----------


DSSP  hllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query asaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                        
Sbjct -------------------------------------------------------  234
DSSP  -------------------------------------------------------


No 54: Query=4rdvB Sbjct=3f2bA Z-score=7.2

back to top
DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------s    1
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  eeeeeeeeelleeeeeeeeeellllleeeeelllllllleellllEEELEEEEEELHHhh
Query aifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggaVLPGMPNLHSHAFqr   61
ident                                                     || |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapEGEKRVELHLHTP--  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllLLLLLLLLLLLLL--


DSSP  hhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEEEEEEEELL
Query amaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYTAVAEFHYV  121
ident                                          |     | |  | |     
Sbjct -----------------------------msqmdavtSVTKLIEQAKKWGHPAIAVTDHA  149
DSSP  -----------------------------llllllllLHHHHHHHHHHLLLLLEEELLLL


DSSP  LllllllllllllhHHHHHHHHHHHHLLEEEEEELLL-----------------------
Query HhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLY-----------------------  158
ident                      ||   |                                 
Sbjct V-----------vqSFPEAYSAAKKHGMKVIYGLEANivddpfhvtllaqnetglknlfk  198
DSSP  L-----------llLHHHHHHHHHHHLLLEEEEEEEEeellleeeeeeellhhhhhhhhh


DSSP  ---LEEElLLEELLhhhllllllhhhhhhhhhhhhhhhhhhlleeleeellllLLLHHHH
Query ---SHAGfGGQPASegqrrfingseaylellqrlrapleaaghslglcfhslrAVTPQQI  215
ident                                                             
Sbjct lvsLSHI-QYFHRV--------------------------------------pRIPRSVL  219
DSSP  hhhHHHL-LLLLLL--------------------------------------lLEEHHHH


DSSP  HHHHllllLLLLEeeeelllhhhhhhhhhhhlllhhhhhhhhlllllleEEEEL---lLL
Query ATVLaaghDDLPVhihiaeqqkevddcqawsgrrplqwlyenvavdqrwCLVHA---tHA  272
ident         | | |                                               
Sbjct VKHR----DGLLV------------------------------------GSGCDkgelFD  239
DSSP  HHLL----LLEEE------------------------------------ELLLLllllLL


DSSP  LHhhHHHHhHHLLEEEELHhhHHHLLL--------LLLLHHHHHHLL----LEEEELLLL
Query DPaeVAAMaRSGAVAGLCLstEANLGD--------GIFPATDFLAQG----GRLGIGSDS  320
ident          |                                  | |             
Sbjct NV--EDIA-RFYDFLEVHP--PDVYKPlyvkdeemIKNIIRSIVALGekldIPVVATGNV  294
DSSP  LL--LLLH-HHLLLEEELL--HHHHLLlllllhhhHHHHHHHHHHHHhhllLLEEELLLL


DSSP  -------------------------------LLLLLHHHHHHHHHHhhhhhhllllllll
Query -------------------------------HVSLSVVEELRWLEYgqrlrdrkrnrlyr  349
ident                                       | |                   
Sbjct hylnpedkiyrkilihsqgganplnrhelpdVYFRTTNEMLDCFSF--------------  340
DSSP  llllhhhhhhhhhhhhllhhhllllllllllLLLLLHHHHHHHHHH--------------


DSSP  lllllHHHHHHHHHHHHHHHHHLLL-----------------------------------
Query ddqpmIGRTLYDAALAGGAQALGQP-----------------------------------  374
ident                                                             
Sbjct ----lGPEKAKEIVVDNTQKIASLIgdvkpikdelytpriegadeeiremsyrrakeiyg  396
DSSP  ----hHHHHHHHHHLHHHHHHHHLLlllllllllllllllllhhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  374
ident                                                             
Sbjct dplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmte  456
DSSP  llllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhll


DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------igs  377
ident                                                             
Sbjct itevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgf  516
DSSP  llllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhll


DSSP  lllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhh
Query lavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhagee  437
ident                                                             
Sbjct kgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnl  576
DSSP  llllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhlll


DSSP  hhhhhhhhhHHHHL----------------------------------------------
Query rsarafvqvLGELL----------------------------------------------  451
ident          |                                                  
Sbjct elrgaeidrLAAGCtgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfd  636
DSSP  lllhhhhhhHHHHHllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct fhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqi  696
DSSP  hhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct mcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctl  756
DSSP  llllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct sevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckk  816
DSSP  hhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct ikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrie  876
DSSP  llllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct einakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnai  936
DSSP  hhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhl


DSSP  ----------------------------------------------------------
Query ----------------------------------------------------------  451
ident                                                           
Sbjct pglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  llllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 55: Query=4rdvB Sbjct=1bksA Z-score=7.1

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleellllEEELEEEeEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggaVLPGMPNlHSHAFq   60
ident                                                             
Sbjct ----------------------------------meryenlfaqlnDRREGAF-VPFVT-   24
DSSP  ----------------------------------lhhhhhhhhhhhHLLLLEE-EEEEE-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllLLHHHHHHHHHHHHHHHhhhleeeEEEEEL
Query ramaglaevagnpndsfwtwrelmyrmvarLSPEQIEVIACQLYIEMlkagytaVAEFHY  120
ident                                  ||   |   |            |    
Sbjct ---------------------------lgdPGIEQSLKIIDTLIDAG------aDALELG   51
DSSP  ---------------------------lllLLHHHHHHHHHHHHHLL------lLLEEEE


DSSP  LL------------------llLLLLLLlLLLHHHHHHHHHHHhhllEEEEEELLLLeee
Query VH------------------hdLDGRSYaDPAELSLRISRAASaagiGLTLLPVLYShag  162
ident |                               |    |                 |    
Sbjct VPfsdpladgptiqnanlrafaAGVTPA-QCFEMLALIREKHP----TIPIGLLMYA---  103
DSSP  LLllllllllhhhhhhhhhhhhHLLLHH-HHHHHHHHHHHHLL----LLLEEEEELH---


DSSP  llleellhhhlllLLLH----HHHHHHHHHHHhhhhhhlleELEEELlllLLLHHHHHHH
Query fggqpasegqrrfINGS----EAYLELLQRLRapleaaghsLGLCFHslrAVTPQQIATV  218
ident                       |                            |     |  
Sbjct -------------NLVFnngiDAFYARCEQVG--------vDSVLVA---DVPVEESAPF  139
DSSP  -------------HHHHlllhHHHHHHHHHHL--------lLEEEEL---LLLHHHLHHH


DSSP  HLL-LLLLLLEEEEELllhhhhhhhhhhhllLHHHHHHHhLLLL-lLEEEEELlLLLHHH
Query LAA-GHDDLPVHIHIAeqqkevddcqawsgrRPLQWLYEnVAVD-qRWCLVHAtHADPAE  276
ident   |                                 |         |             
Sbjct RQAaLRHNIAPIFICP--------------pNADDDLLR-QVASygRGYTYLLaLPLHHL  184
DSSP  HHHhHHLLLEEEEEEL--------------lLLLHHHHH-HHHHhlLLLEEELlLLHHHH


DSSP  HHHHHH-HLLEEEELhhHHHHlllllllhhhhhhllleEEELLLLL--------------
Query VAAMAR-SGAVAGLClsTEANlgdgifpatdflaqggrLGIGSDSH--------------  321
ident          | |                           |  | |               
Sbjct IEKLKEyHAAPALQG-fGISS-----peqvsaavragaAGAISGSAivkiieknlaspkq  238
DSSP  HHHHHHhLLLLEEEL-lLLLL-----hhhhhhhhhhllLEEEELLHhhhhhhhllllhhh


DSSP  -------LLLL-HHHHHhhhhhhhhhhhlllllllllllllhhhhhhhhhhhhhhhhhll
Query -------VSLS-VVEELrwleygqrlrdrkrnrlyrddqpmigrtlydaalaggaqalgq  373
ident                                                             
Sbjct mlaelrsFVSAmKAASR-------------------------------------------  255
DSSP  hhhhhhhHHHHhHHLLL-------------------------------------------


DSSP  lllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllll
Query pigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrh  433
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhl
Query ageersarafvqvlgell  451
ident                   
Sbjct ------------------  255
DSSP  ------------------


No 56: Query=4rdvB Sbjct=3iacA Z-score=6.6

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
ident                                                       | |   
Sbjct -----------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCHLSp   37
DSSP  -----------------------llllllllllllhhhhhhhhhlllLLLEEELLLLLLh


DSSP  -----------hhhHLLL----LLLL--LLLL----------------------------
Query -----------qraMAGL----AEVA--GNPN----------------------------   74
ident                          |                                  
Sbjct qeiaddrrfdnlgqIWLEgdhyKWRAlrSAGVdeslitgketsdyekyxawantvpktlg   97
DSSP  hhhhhllllllhhhHHHLlllhHHHHhhHLLLlhhhlllllllhhhhhhhhhhhhhhlll


DSSP  ----------------llhhhhhhhhhhhhllllhhhhhhhhhHHHHHHHHHLEEEEEEE
Query ----------------dsfwtwrelmyrmvarlspeqieviacQLYIEMLKAGYTAVAEF  118
ident                                                         |   
Sbjct nplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTT  157
DSSP  lhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELL


DSSP  ELlllllllllllllLHHHhHHHHHHHH---HLLEEEEEELLLLeeellleellHHHL--
Query HYvhhdldgrsyadpAELSlRISRAASA---AGIGLTLLPVLYShagfggqpasEGQR--  173
ident                        |   |     |                     |    
Sbjct DD------------pIDSL-EYHRQIAAddsIDIEVAPSWRPDK----vfkielDGFVdy  200
DSSP  LL------------lLLLL-HHHHHHHHlllLLLEEELLLLLHH----hhllllLLHHhh


DSSP  ---------lllllhhhhHHHHHHHHHHHHHHlLEELEEeLLLL----------------
Query ---------rfingseayLELLQRLRAPLEAAgHSLGLCfHSLR----------------  208
ident                      | |      |         |                   
Sbjct lrkleaaadvsitrfddlRQALTRRLDHFAAC-GCRASD-HGIEtlrfapvpddaqldai  258
DSSP  hhhhhhhhllllllhhhhHHHHHHHHHHHHHL-LLLEEE-EEELlllllllllhhhhhhh


DSSP  ------------llLHHHHHHHHLL--LLLL---LLEEEEELLL----------------
Query ------------avTPQQIATVLAA--GHDD---LPVHIHIAEQ----------------  235
ident                 |    ||                ||                   
Sbjct lgkrlagetlseleIAQFTTAVLVWlgRQYAargWVXQLHIGAIrnnntrxfrllgpdtg  318
DSSP  hhhhhllllllhhhHHHHHHHHHHHhhHHHHhhlLEEEEEELEEllllhhhhhhhlllll


DSSP  --HHHHhhhhhhhllLHHHHHHHHLL-------lllLEEEEeLLLLLhhHHHHHHHHL--
Query --QKEVddcqawsgrRPLQWLYENVA-------vdqRWCLVhATHADpaEVAAMARSG--  284
ident                    |                   |              |     
Sbjct fdSIGD---------NNISWALSRLLdsxdvtnelpKTILY-CLNPR--DNEVLATXIgn  366
DSSP  llEELL---------LLLHHHHHHHHhhhhllllllEEEEE-ELLHH--HHHHHHHHHhh


DSSP  ---------LEEEElhhhhhhllLLLL---LHHHHHHLL-------lEEEELLL-LLLLL
Query ---------AVAGLclsteanlgDGIF---PATDFLAQG-------gRLGIGSD-SHVSL  324
ident             |                      | |           |   |      
Sbjct fqgpgiagkVQFGS-------gwWFNDqkdGXLRQLEQLsqxgllsqFVGXLTDsRSFLS  419
DSSP  lllllllllEEELL-------llHHHLlhhHHHHHHHHHhhhllhhhLLLLLLLlLLLLL


DSSP  LhhHHHHHHHHHhhhhhlllLLLLlLLLL----------LHHHHHHHHHHHHHHHhHLLL
Query SvvEELRWLEYGqrlrdrkrNRLYrDDQP----------MIGRTLYDAALAGGAQaLGQP  374
ident                       |                   |   |             
Sbjct Y--TRHEYFRRI-------lCNLL-GQWAqdgeipddeaXLSRXVQDICFNNAQR-YFTI  468
DSSP  L--HHHHHHHHH-------hHHHH-HHHHhlllllllhhHHHHHHHHHHLHHHHH-HLLL


DSSP  llllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeellllll
Query igslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrha  434
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhl
Query geersarafvqvlgell  451
ident                  
Sbjct ----------------k  469
DSSP  ----------------l


No 57: Query=4rdvB Sbjct=2anuA Z-score=5.5

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELH--
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHA--   58
ident                                                       | |   
Sbjct ----------------------------------------------tEWLLCDFHVHTnx   14
DSSP  ----------------------------------------------lEEEEEEEEELLll


DSSP  --HHHHhlllllllllllllhhhhhhhhhhhhllllhhhhhhhHHHHHHHHHHHLEEEEE
Query --FQRAmaglaevagnpndsfwtwrelmyrmvarlspeqieviACQLYIEMLKAGYTAVA  116
ident                                                     | |   | 
Sbjct sdGHLP-------------------------------------LGEVVDLFGKHGVDVVS   37
DSSP  llLLLL-------------------------------------HHHHHHHHHHLLLLEEE


DSSP  EEEL------------------LLLLllllllLLLLHHHHHHHHHHHHHL----LEEEEE
Query EFHY------------------VHHDldgrsyADPAELSLRISRAASAAG----IGLTLL  154
ident                                         |  |    |       |   
Sbjct ITDHivdrrtleqrkrngeplgAITE------DKFQDYLKRLWREQKRAWeeygXILIPG   91
DSSP  EEEEeelhhhhhhhhhllllllLLLL------LLHHHHHHHHHHHHHHHHhhhlLEEEEE


DSSP  ELLLLEEELlleellhhhlllLLLHhhhhhhhhhhhhhhhhhlleeleeelllllllhhH
Query PVLYSHAGFggqpasegqrrfINGSeaylellqrlrapleaaghslglcfhslravtpqQ  214
ident                                                             
Sbjct VEITNNTDLyhivavdvkeyvDPSL----------------------------------P  117
DSSP  EEEEELLLLeeeeeellllllLLLL----------------------------------L


DSSP  HHHHHLL-LLLLLLEEEEELLLhhhHHHHhhhhlllhHHHHhHHLLLLllEEEEE----l
Query IATVLAA-GHDDLPVHIHIAEQqkeVDDCqawsgrrpLQWLyENVAVDqrWCLVH----a  269
ident               |                           |                 
Sbjct VEEIVEKlKEQNALVIAAHPDR--kKLSW------ylWANX-ERFKDT-fDAWEIanrdd  167
DSSP  HHHHHHHhHHLLLEEEELLLLL--lLLLL------hhHHLL-LLLLLL-lLEEEEeelle


DSSP  LLLLhhhHHHHhhhlLEEEElhhhhhhlllllllhhhhhhllleeeeLLLLL--LLLLhh
Query THADpaeVAAMarsgAVAGLclsteanlgdgifpatdflaqggrlgiGSDSH--VSLSvv  327
ident                                                 || |        
Sbjct LFNS--vGVKK----YRYVA---------------------------NSDFHelWHVY--  192
DSSP  ELHH--hHHLL----LLEEE---------------------------ELLLLlhHHHL--


DSSP  hhhhhhhhhhhhhhlllllllllllllhhhhhhhhHHHHhhhhhllllllllllLLLLee
Query eelrwleygqrlrdrkrnrlyrddqpmigrtlydaALAGgaqalgqpigslavgRRADll  387
ident                                     |                       
Sbjct --------------------------------swkTLVK---------------SEKN--  203
DSSP  --------------------------------leeEEEE---------------ELLL--


DSSP  eellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhh
Query vldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvl  447
ident                                                             
Sbjct -------------------------------------------ieaikeairkntdvaiy  220
DSSP  -------------------------------------------hhhhhhhhhhllleeee


DSSP  hhhl
Query gell  451
ident     
Sbjct lxrk  224
DSSP  elll


No 58: Query=4rdvB Sbjct=3e38A Z-score=4.9

back to top
DSSP  --leeeeeeeEELLEeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELH
Query --saifaeraLLPEGwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHA   58
ident            |                                            | | 
Sbjct aqrrneiqvpDLDGY----------------------------------TTLKCDFHXHS   26
DSSP  llllllllllLLLLL----------------------------------EEEEEELLLLL


DSSP  ---HHHHhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEEEE
Query ---FQRAmaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYTAV  115
ident                                                   |    |  | 
Sbjct vfsDGLV------------------------------------WPTVRVDEAYRDGLDAI   50
DSSP  lllLLLL------------------------------------LHHHHHHHHHHLLLLEE


DSSP  EEEEL--LLLLLLllllllLLHHHHhHHHHHHHHL----LEEEEEELLLLEeellleell
Query AEFHY--VHHDLDgrsyadPAELSLrISRAASAAG----IGLTLLPVLYSHagfggqpas  169
ident                                        | |                  
Sbjct SLTEHieYRPHKQ----dvVSDHNR-SFDLCREQAeklgILLIKGSEITRA---------   96
DSSP  LLEEEllLLLLLL----llLLLLLH-HHHHHHHHHhhhlLEELLEEEEELL---------


DSSP  hhhllllllhhhhhhhhhhhhhhhhhhllEELEeelllllllhHHHHHHHLL-lLLLLLE
Query egqrrfingseaylellqrlrapleaaghSLGLcfhslravtpQQIATVLAA-gHDDLPV  228
ident                                                             
Sbjct ---------------------xapghfnaIFLS---dsnpleqKDYKDAFREakKQGAFX  132
DSSP  ---------------------lllleeeeELLL---llhhhllLLHHHHHHHhhHLLLEE


DSSP  EEE-ELLL--HHHHhhhhhhhlllHHHHHHhHLLL-LLLEeeeelllllhhhhhhhhhhl
Query HIH-IAEQ--QKEVddcqawsgrrPLQWLYeNVAV-DQRWclvhathadpaevaamarsg  284
ident           |                                                 
Sbjct FWNhPGWDsqQPDT---------tKWWPEH-TALYqEGCX--------------------  162
DSSP  EELlLLLLllLLLL---------lLLLHHH-HHHHhLLLL--------------------


DSSP  LEEE-ELHHHHhhllllLLLHHhHHHLLLEEEELLLLLL---------------------
Query AVAG-LCLSTEanlgdgIFPATdFLAQGGRLGIGSDSHV---------------------  322
ident                         |         || |                      
Sbjct HGIEvANGHLY-----xPEAIQwCLDKNLTXIGTSDIHQpiqtdydfekgehrtxtfvfa  217
DSSP  LEEEeEELLEE-----lLHHHHhHHHHLLEEEEELLLLLlhhhhllhhhllllleeeeee


DSSP  -------------lllhhhhHHHHHhhhhhhhlllllLLLLLLLLhhhhhhhhhhhhhhh
Query -------------slsvveeLRWLEygqrlrdrkrnrLYRDDQPMigrtlydaalaggaq  369
ident                        |                |                   
Sbjct kerslqgirealdnrrtaayFHELL-----------iGREDLLRP---------------  251
DSSP  llllhhhhhhhhhllleeeeELLEE-----------eLLHHHHHH---------------


DSSP  hhlllllllllllllleeeellllhhhhlllLHHH-----------------hhHHHHH-
Query algqpigslavgrradllvldgndpylasaeGDAL-----------------lnRWLFA-  411
ident                                                         |   
Sbjct -----------------------------ffEKCVkieevsrneqgvtlsitnvTDLVLk  282
DSSP  -----------------------------hhHHHEeeeeeeeelleeeeeeeelLLLLEe


DSSP  --------------------llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl
Query --------------------ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
ident                                                             
Sbjct lkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=4rdvB Sbjct=2yb1A Z-score=4.3

back to top
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeelEEEEEELHHh
Query saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpgMPNLHSHAFq   60
ident                                                      || |   
Sbjct -------------------------------------------------aNIDLHFHSR-   10
DSSP  -------------------------------------------------lLEELLLLLL-


DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhHHHHHHHHHhHHHHhhlEEEEEEEEL
Query ramaglaevagnpndsfwtwrelmyrmvarlspeQIEVIACQLyIEMLkagYTAVAEFHY  120
ident                                                        |    
Sbjct ----------------------------tsdgalTPTEVIDRA-AARA---PALLALTDH   38
DSSP  ----------------------------llllllLHHHHHHHH-HLLL---LLEEEELLL


DSSP  llllllllllllllHHHHHHHHHHHHHLLEEEEEELLLleeELLL---------------
Query vhhdldgrsyadpaELSLRISRAASAAGIGLTLLPVLYshaGFGG---------------  165
ident                       ||   ||                               
Sbjct -----------dctGGLAEAAAAAARRGIPFLNGVEVS-vsWGRHtvhivglgidpaepa   86
DSSP  -----------lllLLHHHHHHHHHHLLLLEEEEEEEE-eeELLEeeeeeeellllllhh


DSSP  --------eELLH-----------------------------HHLLllllhhhhhhhhhh
Query --------qPASE-----------------------------GQRRfingseaylellqr  188
ident                                                             
Sbjct laaglksirEGRLerarqmgasleaagiagcfdgamrwcdnpEMIS-rthfarhlvdsga  145
DSSP  hhhhhhhhhLLHHhhhhhhhhhhhhlllllhhhhhhlllllhHHLL-hhhhhhhhhhlll


DSSP  hhhhhhhhlleeleeelllllllhHHHHHHHLL-lLLLLLEE-EEELLlhHHHHhhhhhh
Query lrapleaaghslglcfhslravtpQQIATVLAA-gHDDLPVH-IHIAEqqKEVDdcqaws  246
ident                                             |               
Sbjct vkdmrtvfrkyltpgkpgyvshqwASLEDAVGWivGAGGMAViAHPGR--YDMG------  197
DSSP  lllhhhhhhhllllllllllllllLLHHHHHHHhhHLLLEEEeLLHHH--LLLL------


DSSP  lLLHHHHHHHHLLllllEEEEE--------LLLLlhhhHHHHHHHLLEEEelhhhhhhll
Query gRRPLQWLYENVAvdqrWCLVH--------ATHAdpaeVAAMARSGAVAGlclsteanlg  298
ident  |     |                        |          | |  |           
Sbjct -RTLIERLILDFQaaggQGIEVasgshsldDMHK---fALHADRHGLYAS----------  243
DSSP  -HHHHHHHHHHHHhlllLEEEEeellllhhHHHH---hHHHHHHHLLEEE----------


DSSP  lllllhhhhhhllleeeELLLLLLLllhhhhhhhhhhhhhhhhlllllllllllllhhhh
Query dgifpatdflaqggrlgIGSDSHVSlsvveelrwleygqrlrdrkrnrlyrddqpmigrt  358
ident                   ||| |                                     
Sbjct -----------------SGSDFHAP--------------------------gedvghted  260
DSSP  -----------------EELLLLLL--------------------------lllllllll


DSSP  hhhhhhHHHHHhhLLLLlllllllllleeeellllhhhhllllhhhhhhhhhhllhhhee
Query lydaalAGGAQalGQPIgslavgrradllvldgndpylasaegdallnrwlfaggdrqvr  418
ident                                                             
Sbjct lppicrPIWRE--LEAR-------------------------------------------  275
DSSP  llllllLHHHH--LHHH-------------------------------------------


DSSP  eeeELLEeeelllllllhhhhhhhhhhhhhhhl
Query dvmVAGRwvvrdgrhageersarafvqvlgell  451
ident     |                            
Sbjct ilrPADA------------------------en  284
DSSP  lllLLHH------------------------hl