Results: dupa

Query: 4qrnA

MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4qrn-A 65.5  0.0  352   352  100 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   2:  2dvt-A 42.5  2.0  313   325   33 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   3:  4ofc-A 36.5  2.2  303   335   25 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   4:  4hk5-D 35.4  2.7  316   380   20 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   5:  2gwg-A 27.6  3.0  274   329   22 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   6:  4dzi-C 27.4  3.2  305   388   17 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
   7:  4dlf-A 20.9  2.9  243   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   8:  3cjp-A 20.7  2.6  225   262   20 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   9:  3irs-A 20.5  3.1  245   281   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  10:  2ffi-A 19.6  3.1  235   273   20 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  11:  4mup-B 17.4  3.4  235   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  12:  1gkp-A 16.7  3.2  249   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  4b3z-D 16.2  3.1  248   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  14:  1itq-A 15.8  3.3  234   369   10 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  15:  1onx-A 15.3  2.9  225   390    8 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  16:  3gri-A 15.3  3.1  236   422    7 PDB  MOLECULE: DIHYDROOROTASE;                                            
  17:  4cqb-A 15.1  4.3  235   402    9 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  18:  3pnu-A 15.0  3.3  221   338   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  19:  1bf6-A 15.0  3.3  224   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  20:  2qpx-A 14.9  3.5  220   376    9 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  21:  3k2g-B 14.7  3.4  233   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  22:  2vun-A 14.6  3.1  213   385   11 PDB  MOLECULE: ENAMIDASE;                                                 
  23:  1yrr-B 14.5  3.0  212   334    8 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  24:  2y1h-B 14.5  3.3  212   265    8 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  25:  3giq-A 14.2  3.4  227   475   10 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  26:  2ob3-A 14.1  3.5  220   329   10 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  27:  2paj-A 14.1  3.4  218   421   10 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  28:  3e74-A 14.1  3.2  226   429   12 PDB  MOLECULE: ALLANTOINASE;                                              
  29:  1k6w-A 14.0  3.9  231   423   11 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  30:  3ls9-A 13.9  3.6  228   453    9 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  31:  1j6p-A 13.7  3.8  224   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  2vc5-A 13.6  3.4  215   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  1a4m-A 13.5  3.8  230   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  34:  3nqb-A 13.3  3.3  212   587   13 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  35:  2imr-A 13.1  4.1  237   380    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  36:  3mtw-A 12.9  3.7  209   404    8 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  37:  1j5s-A 12.8  4.0  239   451    8 PDB  MOLECULE: URONATE ISOMERASE;                                         
  38:  3gg7-A 12.8  3.3  203   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  39:  2uz9-A 12.7  3.6  216   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  40:  2oof-A 12.6  4.1  223   403   10 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  41:  3mkv-A 12.5  3.9  210   414   13 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  42:  4rdv-B 12.3  3.7  227   451   10 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  43:  3icj-A 12.2  3.5  211   468    8 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  44:  4c5y-A 12.0  3.8  207   436   11 PDB  MOLECULE: OCHRATOXINASE;                                             
  45:  1a5k-C 11.8  3.1  206   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  46:  3iac-A 11.7  3.8  230   469    7 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  47:  2ogj-A 11.6  3.7  212   379    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  48:  3ooq-A 10.8  3.6  193   384   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  3qy6-A  9.9  3.6  187   247    9 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  2a3l-A  8.4  4.0  219   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  1v77-A  8.4  3.5  164   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  52:  3dcp-A  8.2  3.7  178   277    6 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3f2b-A  7.7  3.8  167   994   10 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  3au2-A  7.6  3.6  180   575    7 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  1bks-A  6.7  3.7  169   255   12 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  56:  1m65-A  5.8  4.0  160   234    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  57:  2anu-A  5.6  3.6  140   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  5.5  3.9  157   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  4.6  3.7  143   284   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4qrnA Sbjct=4qrnA Z-score=65.5

back to top
DSSP  LLLLLLLLLLLLLLLLEEEEEEELLHHHHHHHHHHHHHLLLLHHHHHHHHHHHHLLLHHH
Query SMTQDLKTGGEQGYLRIATEEAFATREIIDVYLRMIRDGTADKGMVSLWGFYAQSPSERA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SMTQDLKTGGEQGYLRIATEEAFATREIIDVYLRMIRDGTADKGMVSLWGFYAQSPSERA   60
DSSP  LLLLLLLLLLLLLLLLEEEEEEELLHHHHHHHHHHHHHLLLLHHHHHHHHHHHHLLLHHH


DSSP  HHHHHHHHLLLHHHHHHHHHLLLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHHHHHHH
Query TQILERLLDLGERRIADMDATGIDKAILALTSPGVQPLHDLDEARTLATRANDTLADACQ  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TQILERLLDLGERRIADMDATGIDKAILALTSPGVQPLHDLDEARTLATRANDTLADACQ  120
DSSP  HHHHHHHHLLLHHHHHHHHHLLLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHHHHHHH


DSSP  HLLLLEEELLLLLLLLHHHHHHHHHHHHHLLLLLLEEELLLLLLLLLLLHHHHHHHHHHH
Query KYPDRFIGMGTVAPQDPEWSAREIHRGARELGFKGIQINSHTQGRYLDEEFFDPIFRALV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KYPDRFIGMGTVAPQDPEWSAREIHRGARELGFKGIQINSHTQGRYLDEEFFDPIFRALV  180
DSSP  HLLLLEEELLLLLLLLHHHHHHHHHHHHHLLLLLLEEELLLLLLLLLLLHHHHHHHHHHH


DSSP  HHLLLEEELLLLLLLLLLHHHHHHLLLLLLLHHHHHHHHHHHHHHHHLHHHHLLLLLEEE
Query EVDQPLYIHPATSPDSMIDPMLEAGLDGAIFGFGVETGMHLLRLITIGIFDKYPSLQIMV  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EVDQPLYIHPATSPDSMIDPMLEAGLDGAIFGFGVETGMHLLRLITIGIFDKYPSLQIMV  240
DSSP  HHLLLEEELLLLLLLLLLHHHHHHLLLLLLLHHHHHHHHHHHHHHHHLHHHHLLLLLEEE


DSSP  LHHHHLHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLHHHHHHHLEEEELLLLLLHHHHHH
Query GHMGEALPYWLYRLDYMHQAGVRSQRYERMKPLKKTIEGYLKSNVLVTNSGVAWEPAIKF  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GHMGEALPYWLYRLDYMHQAGVRSQRYERMKPLKKTIEGYLKSNVLVTNSGVAWEPAIKF  300
DSSP  LHHHHLHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLHHHHHHHLEEEELLLLLLHHHHHH


DSSP  HHHHHLHHHEELLLLLLLLLLHHHHHHHHLLLLLHHHHHHHHLHHHHHHLLL
Query CQQVMGEDRVMYAMDYPYQYVADEVRAMDAMDMSAQTKKKFFQTNAEKWFKL  352
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CQQVMGEDRVMYAMDYPYQYVADEVRAMDAMDMSAQTKKKFFQTNAEKWFKL  352
DSSP  HHHHHLHHHEELLLLLLLLLLHHHHHHHHLLLLLHHHHHHHHLHHHHHHLLL


No 2: Query=4qrnA Sbjct=2dvtA Z-score=42.5

back to top
DSSP  llllllllllllLLLLEEEEEEELLHHHHHhhhhhhhhllllhhhhhHHHHHhhLLLHhH
Query smtqdlktggeqGYLRIATEEAFATREIIDvylrmirdgtadkgmvsLWGFYaqSPSErA   60
ident                  | || ||  |                      ||         
Sbjct ------------MQGKVALEEHFAIPETLQ----------------dSAGFV--PGDY-W   29
DSSP  ------------LLLEEEEEEEELLHHHHH----------------hHLLLL--LLLH-H


DSSP  HHHHHHHHLLLHHHHHHHHHLLLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHHHHHHH
Query TQILERLLDLGERRIADMDATGIDKAILALTSPGVQPLHDLDEARTLATRANDTLADACQ  120
ident      ||||    |   ||| ||   || |  | ||   |   |   | |||| ||  | 
Sbjct KELQHRLLDIQDTRLKLMDAHGIETMILSLNAPAVQAIPDRRKAIEIARRANDVLAEECA   89
DSSP  HHHHHHHHLLLLHHHHHHHHLLEEEEEEEELLLHHHHLLLHHHHHHHHHHHHHHHHHHHH


DSSP  HLLLLEEELLLLLLLLHHHHHHHHHHHHHLLLLLLEEELLLLL------LLLLLLHHHHH
Query KYPDRFIGMGTVAPQDPEWSAREIHRGARELGFKGIQINSHTQ------GRYLDEEFFDP  174
ident | ||||        |||     |  |    ||| |   |   |        | |     |
Sbjct KRPDRFLAFAALPLQDPDAATEELQRCVNDLGFVGALVNGFSQegdgqtPLYYDLPQYRP  149
DSSP  HLLLLEEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEELLLLllllllLLLLLLHHHHH


DSSP  HHHHHHHHLLLEEELLLLLLLLLLHHHHHHL-LLLLLLHHHHHHHHHHHHHHHHLHHHHL
Query IFRALVEVDQPLYIHPATSPDSMIDPMLEAG-LDGAIFGFGVETGMHLLRLITIGIFDKY  233
ident         | | | ||                | |    |  ||  | |||   | ||  
Sbjct FWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPwLLGPTWAFAQETAVHALRLMASGLFDEH  209
DSSP  HHHHHHHHLLLEEEELLLLLHHHLHHHLLLHhHLHHHLHHHHHHHHHHHHHHHLLHHHHL


DSSP  LLLLEEELHHHHLHHHHHHHHHHHhhhhhHLLLlLLLLlLLLLHHHHHHHLEEEELLLLL
Query PSLQIMVGHMGEALPYWLYRLDYMhqagvRSQRyERMKpLKKTIEGYLKSNVLVTNSGVA  293
ident | | |  ||||| |||   | |             |    |     |   |   | ||  
Sbjct PRLNIILGHMGEGLPYMMWRIDHR--nawVKLP-PRYP-AKRRFMDYFNENFHITTSGNF  265
DSSP  LLLLEEELHHHLLHHHHHHHHHHL--lllLLLL-LLLL-LLLLHHHHHHHHEEEELLLLL


DSSP  LHHHHHHHHHHHLHHHEELLLLLLLLLLHHHHHHHHLLLLLHHHHHHHHLHHHHHHLLL-
Query WEPAIKFCQQVMGEDRVMYAMDYPYQYVADEVRAMDAMDMSAQTKKKFFQTNAEKWFKL-  352
ident             | ||     | |            |         |   |||   ||| 
Sbjct RTQTLIDAILEIGADRILFSTDWPFENIDHASDWFNATSIAEADRVKIGRTNARRLFKLd  325
DSSP  LHHHHHHHHLLLLHHHEELLLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHLLLl


No 3: Query=4qrnA Sbjct=4ofcA Z-score=36.5

back to top
DSSP  llllllllllllllLLEEEEEEELLHH---------hhHHHH-----------HHHHHll
Query smtqdlktggeqgyLRIATEEAFATRE---------iiDVYL-----------RMIRDgt   40
ident                 |         |                                 
Sbjct --------------MKIDIHSHILPKEwpdlkkrfgygGWVQlqhhskgeaklLKDGK--   44
DSSP  --------------LLEEEEEELLLLLlllhhhhhlllLLEEeeeeelleeeeEELLE--


DSSP  llhhhhhhhHHHHhlllhhhhhHHHHHHLlLHHHHHHHHHLLLLEEEEEELLL-LLLLLl
Query adkgmvslwGFYAqspseratqILERLLDlGERRIADMDATGIDKAILALTSP-GVQPLh   99
ident           |             |   |  | ||  ||  |     |            
Sbjct ---------VFRV---------VRENCWD-PEVRIREMDQKGVTVQALSTVPVmFSYWA-   84
DSSP  ---------EEEE---------EEHHHLL-HHHHHHHHHHHLLLEEEEELLHHhHLLLL-


DSSP  LHHHHHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLHHHHHHHHHHHHHLLLLLLEEEL
Query DLDEARTLATRANDTLADACQKYPDRFIGMGTVAPQDPEWSAREIHRGARELGFKGIQIN  159
ident        |    |  ||     || || | ||   | ||    |  |   |||| | || 
Sbjct KPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIG  144
DSSP  LHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEE


DSSP  LLLLLLLLLLHHHHHHHHHHHHHLLLEEELLLLLlllLLHH-HHHHLLLLlLLHHHHHHH
Query SHTQGRYLDEEFFDPIFRALVEVDQPLYIHPATSpdsMIDP-MLEAGLDGaIFGFGVETG  218
ident  |     |      |   |       |  ||        |  |    |     |   || 
Sbjct THVNEWDLNAQELFPVYAAAERLKCSLFVHPWDM---QMDGrMAKYWLPW-LVGMPAETT  200
DSSP  LEELLEELLLHHHHHHHHHHHHHLLEEEEELLLL---LLLHhHHLLLHHH-HLHHHHHHH


DSSP  HHHHHHHHHLHHHHLLLLLEEELHHHHLHHHHHHHHHHHHHHHHhlllLLLLLLLLLLHH
Query MHLLRLITIGIFDKYPSLQIMVGHMGEALPYWLYRLDYMHQAGVrsqrYERMKPLKKTIE  278
ident       |  | | | | |     | | | |    |                         
Sbjct IAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRP----DLCAQDNPMNPK  256
DSSP  HHHHHHHLLLHHHHLLLLLEEELHHHLLHHHHHHHHHHHHHHLH----HHHLLLLLLLHH


DSSP  HHHHhLEEEELLlLLLHHHHHHHHHHHLHHHEELLLLLLL--LLLHhHHHHHHLLL-LLH
Query GYLKsNVLVTNSgVAWEPAIKFCQQVMGEDRVMYAMDYPY--QYVAdEVRAMDAMD-MSA  335
ident  ||          |      |    | | | |    |||               |     
Sbjct KYLG-SFYTDAL-VHDPLSLKLLTDVIGKDKVILGTDYPFplGELE-PGKLIESMEeFDE  313
DSSP  HHLL-LLEEELL-LLLHHHHHHHHHHHLLLLEELLLLLLLllLLLL-LLHHHHHLLlLLH


DSSP  HHHHHHHLHHHHHHLLL-----
Query QTKKKFFQTNAEKWFKL-----  352
ident  || |    ||     |     
Sbjct ETKNKLKAGNALAFLGLerkqf  335
DSSP  HHHHHHHLHHHHHHHLLlhhhl


No 4: Query=4qrnA Sbjct=4hk5D Z-score=35.4

back to top
DSSP  llllllllllllLLLLEEEEEEELLHHHHHHHHHHhhhLLLL---hhhhhhhHHHH----
Query smtqdlktggeqGYLRIATEEAFATREIIDVYLRMirdGTAD---kgmvslwGFYA----   53
ident                             |          |                    
Sbjct ------------TPVVVDIHTHMYPPSYIAMLEKR---QTIPlvrtfpqadePRLIllss   45
DSSP  ------------LLLLEEEEEEELLHHHHHHHHLL---LLLLeeeeelleeeEEEEllhh


DSSP  -------------hlLLHHHhhHHHHHHLLlHHHHHHHHHLLLLEEEEEELLLLLLLLlL
Query -------------qsPSERAtqILERLLDLgERRIADMDATGIDKAILALTSPGVQPLhD  100
ident                   |          |       ||  ||      |  |    |  
Sbjct elaaldaaladpaakLPGRP--LSTHFASL-AQKMHFMDTNGIRVSVISLANPWFDFL-A  101
DSSP  hhhhhhhhhhlllllLLLEE--LLHHHLLH-HHHHHHHHHLLLLEEEEEELLLLLLLL-L


DSSP  HHHHHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLL-HHHHHHHHHHHHHLLLLLLEEEL
Query LDEARTLATRANDTLADACQKYPDRFIGMGTVAPQD-PEWSAREIHRGARELGFKGIQIN  159
ident  |||   |   |    | |     |                   | |        ||   
Sbjct PDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSApVDAVKASIERVKNLKYCRGIILG  161
DSSP  LLLHHHHHHHHHHHHHHHHHLLLLLEEEEEELLLLLlHHHHHHHHHHHHLLLLEEEEEEL


DSSP  LLLLLLLLLLHHHHHHHHHHHHHLLLEEELLLLLlllLLHHHHH------hLLLLLLLHH
Query SHTQGRYLDEEFFDPIFRALVEVDQPLYIHPATSpdsMIDPMLE------aGLDGAIFGF  213
ident     |  ||     | | |          ||                           ||
Sbjct TSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYG---LPNEVYGprseeygHVLPLALGF  218
DSSP  LLLLLLLLLLHHHHHHHHHHHHLLLEEEELLLLL---LLHHHHLllhhhllLHHHHHLHH


DSSP  HHHHHHHHHHHHHHLHHHHLLLLLEEELHHHHLHHHHHHHHHHHHHHHhhLLLL-LLLLL
Query GVETGMHLLRLITIGIFDKYPSLQIMVGHMGEALPYWLYRLDYMHQAGvrSQRY-ERMKP  272
ident   ||     |    | ||    ||    | |  ||    |                   |
Sbjct PMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHD--GHLVkTGKVP  276
DSSP  HHHHHHHHHHHHHLLHHHHLLLLLEEEHHHHLLHHHHHHHHHHHHHLL--HHHHhLLLLL


DSSP  -lLLLHHHHHHHLEEEELLlLLLHHHHHHHHHHHLHHHEELLLLLLLLL--------LHH
Query -lKKTIEGYLKSNVLVTNSgVAWEPAIKFCQQVMGEDRVMYAMDYPYQY--------VAD  323
ident     ||   ||            |          | || |   | |             |
Sbjct kdRRTIWTVLKEQIYLDAV-IYSEVGLQAAIASSGADRLMFGTDHPFFPpieedvqgPWD  335
DSSP  llLLLHHHHHHHLEEEELL-LLLHHHHHHHHHHHLHHHEELLLLLLLLLllllllllLLH


DSSP  HHHHHHL---LLLL--HHHHHHHHLHHHHHHLLL-----------
Query EVRAMDA---MDMS--AQTKKKFFQTNAEKWFKL-----------  352
ident   |                       ||     |           
Sbjct SSRLNAQaviKAVGegSSDAAAVMGLNAVRVLSLkaelehhhhhh  380
DSSP  HHHHHHHhhhHHHLllLHHHHHHHLHHHHHHLLLhhhhhhhhhhl


No 5: Query=4qrnA Sbjct=2gwgA Z-score=27.6

back to top
DSSP  llllllllllllllLLEEEEEEEL--lHHHHHHHHHHHHHLLllhhhhhhhhhhhhlllh
Query smtqdlktggeqgyLRIATEEAFA--tREIIDVYLRMIRDGTadkgmvslwgfyaqspse   58
ident                 |              |   | |                      
Sbjct --------------XIIDIHGHYTtapKALEDWRNRQIAGIK--------dpsvxpkvse   38
DSSP  --------------LLEEEEEELLlllHHHHHHHHHHHHHHH--------lhhhlllhhh


DSSP  hhhhhhhhhhLLLHHHHHHHHHLLLLEEEEEELLllllllLLHHHHHHHHHHHHHHHHHH
Query ratqilerllDLGERRIADMDATGIDKAILALTSpgvqplHDLDEARTLATRANDTLADA  118
ident              |         | |               |     | |   |      
Sbjct lkisddelqaSIIENQLKKXQERGSDLTVFSPRA------GDFNVSSTWAAICNELCYRV   92
DSSP  llllhhhhhhHHHLLHHHHHHHHLLLEEEEELLL------LLHHHHHHHHHHHHHHHHHH


DSSP  HHHLLLLEEELLLLLLL---LHHHHHHHHHHHHHLLLLLLEEELLLLL-----LLLLLLH
Query CQKYPDRFIGMGTVAPQ---DPEWSAREIHRGARELGFKGIQINSHTQ-----GRYLDEE  170
ident  |  || |||          ||     |      | ||  |  |            |   
Sbjct SQLFPDNFIGAAXLPQSpgvDPKTCIPELEKCVKEYGFVAINLNPDPSgghwtSPPLTDR  152
DSSP  HHHLLLLEEEEEELLLLlllLHHHHHHHHHHHHHLLLLLEEEELLLLLlllllLLLLLLH


DSSP  HHHHHHHHHHHHLLLEEELLLlllllllhhhhhhllllLLLHHHHHHHHHHHHHHHHLHH
Query FFDPIFRALVEVDQPLYIHPAtspdsmidpmleagldgAIFGFGVETGMHLLRLITIGIF  230
ident    ||    ||   |  ||                                        |
Sbjct IWYPIYEKXVELEIPAXIHVS-----------------TGAHYLNADTTAFXQCVAGDLF  195
DSSP  HHHHHHHHHHHHLLLEEELLL-----------------LLLHHHHHHHHHHHHHHHLLHH


DSSP  HHLLLLLEEELHHHHLHHHHHHHHHHHHHHHHhllllllllllLLLHHHHHHHLEEEELL
Query DKYPSLQIMVGHMGEALPYWLYRLDYMHQAGVrsqryermkplKKTIEGYLKSNVLVTNS  290
ident    | |     | | | ||   |     |              |   |     |      
Sbjct KDFPELKFVIPHGGGAVPYHWGRFRGLAQEXK-----------KPLLEDHVLNNIFFDTC  244
DSSP  HHLLLLLEEELHHHLLLHHHHHHHHHHHHHLL-----------LLLHHHHLLLLEEEELL


DSSP  lLLLHHHHHHHHHHHLHHHEELLLLLLLLL---------LHHH-HHHHHLLL-LLHHHHH
Query gVAWEPAIKFCQQVMGEDRVMYAMDYPYQY---------VADE-VRAMDAMD-MSAQTKK  339
ident  |   | |     |   | |  |                  |   |   |        | 
Sbjct -VYHQPGIDLLNTVIPVDNVLFASEXIGAVrgidprtgfYYDDtKRYIEASTiLTPEEKQ  303
DSSP  -LLLHHHHHHHHHHLLHHHEELLLLLLLLLlleelllleELLLlHHHHHHLLlLLHHHHH


DSSP  HHHLHHHHHHLLL-------------
Query KFFQTNAEKWFKL-------------  352
ident      ||                   
Sbjct QIYEGNARRVYPRldaalkakgkleh  329
DSSP  HHHLHHHHHHLHHhhhhhhhhhhhll


No 6: Query=4qrnA Sbjct=4dziC Z-score=27.4

back to top
DSSP  llllllllllLLLLLLEEEEEEELL-HHHH--------------------hhhHHHHhHL
Query smtqdlktggEQGYLRIATEEAFAT-REII--------------------dvyLRMIrDG   39
ident              |  |                                         | 
Sbjct ----------ALNYRVIDVDNHYYEpLDSFtrhldkkfkrrgvqmlsdgkrtwAVIG-DR   49
DSSP  ----------LLLLLEEEEEEELLLlLLLLlllllhhhlllleeeeelllleeEEEL-LE


DSSP  LLlhhhhHHHHHhHHLLLhhHHHH----------------------------hHHHHLlL
Query TAdkgmvSLWGFyAQSPSerATQI----------------------------lERLLDlG   71
ident                                                             
Sbjct VN-----HFIPN-PTFDP--IIVPgcldllfrgeipdgvdpaslmkverladhPEYQN-R  100
DSSP  EL-----LLLLL-LLLLL--EELLlllhhhhhllllllllhhhllleelhhhlHHHLL-H


DSSP  HHHHHHHHHLLLLEEEEEEL--LLLLLLL-LLHHHHHHHHHHHHHHHHHH---HHHLlLL
Query ERRIADMDATGIDKAILALT--SPGVQPL-HDLDEARTLATRANDTLADA---CQKYpDR  125
ident   ||| ||   |  |    |        | ||           |  |            |
Sbjct DARIAVMDEQDIETAFMLPTfgCGVEEALkHDIEATMASVHAFNLWLDEDwgfDRPD-HR  159
DSSP  HHHHHHHHHHLEEEEEEELLhhHHHHHHLlLLHHHHHHHHHHHHHHHHHHlllLLLL-LL


DSSP  EEELLLLLLLLHHHHHHHHHHHHHlLLLLLEEELLLL-----lLLLLLLHHHHHHHHHHH
Query FIGMGTVAPQDPEWSAREIHRGAReLGFKGIQINSHT-----qGRYLDEEFFDPIFRALV  180
ident  |    |   ||     |        | |               | |     ||    | 
Sbjct IIAAPIVSLADPTRAVEEVDFVLA-RGAKLVLVRPAPvpglvkPRSLGDRSHDPVWARLA  218
DSSP  EEELLLLLLLLHHHHHHHHHHHHH-LLLLLEELLLLLllllllLLLLLLHHHHHHHHHHH


DSSP  HHLLLEEELLL-LLLLlLLHH----hhHHLLLlllLHHHHHHHHHHHHHHHHLHHHHLLL
Query EVDQPLYIHPA-TSPDsMIDP----mlEAGLDgaiFGFGVETGMHLLRLITIGIFDKYPS  235
ident |   |   |         |                              |  | |   | 
Sbjct EAGVPVGFHLSdSGYL-HIAAawggakDPLDQ--vLLDDRAIHDTMASMIVHGVFTRHPK  275
DSSP  HHLLLEEEELLlLLLH-HHHHhlllllLHHHH--hHHLLHHHHHHHHHHHHLLHHHHLLL


DSSP  LLEEE-LHHHhLHHHHHHHHHHHHHHHHHlllllllLLLLLLHHHHHHHLEEEELllLLL
Query LQIMV-GHMGeALPYWLYRLDYMHQAGVRsqryermKPLKKTIEGYLKSNVLVTNsgVAW  294
ident |               |                             |  ||         
Sbjct LKAVSiENGS-YFVHRLIKRLKKAANTQP-------QYFPEDPVEQLRNNVWIAP--YYE  325
DSSP  LLEEEeLLLL-LHHHHHHHHHHHHHHHLH-------HHLLLLHHHHHHHHEEELL--LLL


DSSP  HhHHHHHHHHHLHHHEELLLLLLL--LLLHhhHHHHHLLL-LLHHHHHHHHLHHHHHHLL
Query EpAIKFCQQVMGEDRVMYAMDYPY--QYVAdeVRAMDAMD-MSAQTKKKFFQTNAEKWFK  351
ident          | | |      | |         |         |     |    ||     
Sbjct D-DLPELARVIGVDKILFGSDWPHgeGLAS-pVSFTAELKgFSESDIRKIMRDNALDLLG  383
DSSP  L-LHHHHHHHHLHHHLLLLLLLLLllLLLL-hHHHHHHHLlLLHHHHHHHHLHHHHHHHL


DSSP  ----l
Query ----l  352
ident      
Sbjct vqvgs  388
DSSP  lllll


No 7: Query=4qrnA Sbjct=4dlfA Z-score=20.9

back to top
DSSP  lllllllllllllLLLEEEEEEELLHhhHHHHhhhhhhllllhhhhhhHHHHHHLllhhH
Query smtqdlktggeqgYLRIATEEAFATReiIDVYlrmirdgtadkgmvslWGFYAQSpserA   60
ident               |||     |                                     
Sbjct -------------ALRIDSHQHFWRY--RAAD----------------YPWIGAG----M   25
DSSP  -------------LLLEEEEELLLLL--LHHH----------------LLLLLLL----L


DSSP  HHHHHhhHLLLHHHHHHHHHLLLLEEEEEELLLlllllllhhhhhhhHHHHHHHHHHHHH
Query TQILErlLDLGERRIADMDATGIDKAILALTSPgvqplhdldeartlATRANDTLADACQ  120
ident          |       | |      |                           |     
Sbjct GVLAR--DYLPDALHPLMHAQALGASIAVQARA--------------GRDETAFLLELAC   69
DSSP  HHHLL--LLLHHHHHHHHHHLLLLEEEEELLLL--------------LHHHHHHHHHHHL


DSSP  HlLLLE-EELLLLLLLLhHHHHHHHHHHhHLLLLLLEEELL-LLLL--LLLLLHHHHHHH
Query KyPDRF-IGMGTVAPQDpEWSAREIHRGaRELGFKGIQINS-HTQG--RYLDEEFFDPIF  176
ident     |     |          |       |     |               |   |    
Sbjct D-EARIaAVVGWEDLRA-PQLAERVAEW-RGTKLRGFRHQLqDEADvrAFVDDADFARGV  126
DSSP  L-LLLEeEEEELLLLLL-LLHHHHHHLL-LLLLEEEEEELHhHLLLhhHHHHLHHHHHHH


DSSP  HHHHHHLLLEEELLllllllllhhhhhhlllllllhHHHHhHHHHHHHHhHLHHhhllLL
Query RALVEVDQPLYIHPatspdsmidpmleagldgaifgFGVEtGMHLLRLItIGIFdkypSL  236
ident   |   |                             |                       
Sbjct AWLQANDYVYDVLV----------------------FERQ-LPDVQAFC-ARHD----AH  158
DSSP  HHHHHLLLEEEELL----------------------LHHH-HHHHHHHH-HHLL----LL


DSSP  LEEELHHHHL-------------hHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-
Query QIMVGHMGEA-------------lPYWLyrldymhqagvrsqryermkplkktiEGYLK-  282
ident      | |                                                    
Sbjct WLVLDHAGKPalaefdrddtalarWRAA-------------------------lRELAAl  193
DSSP  LEEEHHHHLLlhhhllllllhhhhHHHH-------------------------hHHHHLl


DSSP  HLEEEELLLLL----------------LHHHHHHHHHHHLHHHEELLLLLLLLL----LH
Query SNVLVTNSGVA----------------WEPAIKFCQQVMGEDRVMYAMDYPYQY----VA  322
ident   |    ||                   |          |  | |   | |         
Sbjct PHVVCKLSGLVteadwrrglrasdlrhIEQCLDAALDAFGPQRLMFGSDWPVCLlaasYD  253
DSSP  LLEEEEELLLLllllllllllhhhhhhHHHHHHHHHHHHLHHHEEELLLLLHHHhlllHH


DSSP  HHHHHHHLL---LLLHHHHHHHHLHHHHHHLLL-
Query DEVRAMDAM---DMSAQTKKKFFQTNAEKWFKL-  352
ident               ||          |     | 
Sbjct EVASLVERWaesRLSAAERSALWGGTAARCYALp  287
DSSP  HHHHHHHHHhhhHLLHHHHHHHLLHHHHHHLLLl


No 8: Query=4qrnA Sbjct=3cjpA Z-score=20.7

back to top
DSSP  llllllllllllllLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqgyLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident               | |                                           
Sbjct --------------LIIDGHTHV-------------------------------------    9
DSSP  --------------LLEEEEEEL-------------------------------------


DSSP  hhhhhhHHLLlHHHHHHHHHLLLLEEEEEEL------------------------lllLL
Query tqilerLLDLgERRIADMDATGIDKAILALT------------------------spgVQ   96
ident        |   |  |  ||  | || ||  |                             
Sbjct ------ILPV-EKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngkTN   62
DSSP  ------LLLH-HHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllLL


DSSP  LLllhhhhHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLHH-HHHHHHH-HHHHlLLLL
Query PLhdldeaRTLATRANDTLADACQKYPDRFIGMGTVAPQDPE-WSAREIH-RGAReLGFK  154
ident                   |    | || |  | | |     |      |           
Sbjct SM------IDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSEnDTNSYIEeNIVN-NKLV  115
DSSP  LL------HHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLLHhHHHHHHHhHLLL-LLLL


DSSP  LEE-ELLLlllLLLLLhhHHHHHHHHH-HHLLLEEELLllllllllhhhhhhlllllllh
Query GIQ-INSHtqgRYLDEefFDPIFRALV-EVDQPLYIHPatspdsmidpmleagldgaifg  212
ident ||                  |||         |  ||                       
Sbjct GIGeLTPA--sGQIKS--LKPIFKYSMdSGSLPIWIHA----------------------  149
DSSP  EEEeELLL--lLLHHH--HHHHHHHHHhLLLLLEEELL----------------------


DSSP  hHHHHH-HHHHHHHhhLHHHHLLLLLEEELHHHHLHHHHhhhhhhhhhhhhhllllllll
Query fGVETG-MHLLRLItiGIFDKYPSLQIMVGHMGEALPYWlyrldymhqagvrsqryermk  271
ident                       |      ||||                           
Sbjct -FNPLVlQDIKEIA--ELCKAFPKVPVILGHMGGSNWMT---------------------  185
DSSP  -LLLLLhHHHHHHH--HHHHHLLLLLEEEHHHHHHHHHH---------------------


DSSP  lllllhhHHHH--HLEEEELLLLLLHHHHHHHHHHhLHHHEELLLLLLLLLLHHHHHHHH
Query plkktieGYLK--SNVLVTNSGVAWEPAIKFCQQVmGEDRVMYAMDYPYQYVADEVRAMD  329
ident           |   |     |        |               | |         |  
Sbjct -----avELAKeiQNLYLDTSAYFSTFVLKIVINE-LPLKCIFGTDMPFGDLQLSIEAIK  239
DSSP  -----hhHHHHhlLLEEEELLLLLLHHHHHHHHHH-LLLLEELLLLLLLLLHHHHHHHHH


DSSP  LLLLLHHHHHHHHLHHHHHHLLL
Query AMDMSAQTKKKFFQTNAEKWFKL  352
ident  |             |       
Sbjct KMSNDSYVANAVLGDNISRLLNI  262
DSSP  HHLLLHHHHHHHHLHHHHHHHLL


No 9: Query=4qrnA Sbjct=3irsA Z-score=20.5

back to top
DSSP  lllllllllllllLLLEEEEEEE---LLHHHHhhhhhhhhhllllhhhhhhHHHHHHL--
Query smtqdlktggeqgYLRIATEEAF---ATREIIdvylrmirdgtadkgmvslWGFYAQS--   55
ident                 |                                           
Sbjct -------------LKIIDFRLRPpamGFLNAR----------------iytRPDIRNRft   31
DSSP  -------------LLLEELLLLLllhHHHHLH----------------hhhLHHHHHHhh


DSSP  ---llhhhhHHHHHhhllLHHHHHHHHHLLLLEEEEEElllLLLLLllhhhhhhhhhHHH
Query ---pseratQILERlldlGERRIADMDATGIDKAILALtspGVQPLhdldeartlatRAN  112
ident             |      |     | | ||                            |
Sbjct rqlgfepapSAEEK---sLELMFEEMAAAGIEQGVCVG---RNSSV--------lgsVSN   77
DSSP  hhhlllllhHHHHL---lHHHHHHHHHHLLLLEEEEEL---LEELL--------leeLLH


DSSP  HHHHHHHHHLLLLEEELLLLLLLLHHHHHHHHHHHHhLLLLLLEEEL-LLLL-LLLLLLH
Query DTLADACQKYPDRFIGMGTVAPQDPEWSAREIHRGArELGFKGIQIN-SHTQ-GRYLDEE  170
ident    |     ||| |   |                    ||                 |  
Sbjct ADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEIL-DLGIRIVNLEpGVWAtPMHVDDR  136
DSSP  HHHHHHHHHLLLLEEEEEELLLLLHHHHHHHHHHHH-HLLLLLEEELhHHLLlLLLLLLH


DSSP  HHHHHHHHHHHHLLLEEEL---LLLLLllllhhhhhhlllllllhhhHHHHHhHHHHHhh
Query FFDPIFRALVEVDQPLYIH---PATSPdsmidpmleagldgaifgfgVETGMhLLRLIti  227
ident    |          |        |                                    
Sbjct RLYPLYAFCEDNGIPVIMMtggNAGPD--------------------ITYTN-PEHID--  173
DSSP  HHHHHHHHHHHLLLLEEEElllLLLLL--------------------HHHHL-HHHHH--


DSSP  LHHHHLLLLLEEELHHHHLHHHHhhhhhhhhhhhhhlllllllllllllhHHHHH--HLE
Query GIFDKYPSLQIMVGHMGEALPYWlyrldymhqagvrsqryermkplkktiEGYLK--SNV  285
ident       | |     |                                           | 
Sbjct RVLGDFPDLTVVSSHGNWPWVQE--------------------------iIHVAFrrPNL  207
DSSP  HHHHHLLLLLEEEEHHHLLLHHH--------------------------hHHHHHhlLLE


DSSP  EEELLLLLL----HHHHHHHHHHHLHHHEELLLLLLLLLLHHHHHHHHLLLLLHHHHHHH
Query LVTNSGVAW----EPAIKFCQQVMGEDRVMYAMDYPYQYVADEVRAMDAMDMSAQTKKKF  341
ident                           ||      ||                      | 
Sbjct YLSPDMYLYnlpgHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKI  267
DSSP  EEELHHHHLllllHHHHHHHHLLHHHHLLLLLLLLLLLLHHHHHHHHHLLLLLHHHHHHH


DSSP  HLHHHHHHLLL---
Query FQTNAEKWFKL---  352
ident    |||        
Sbjct LHGNAERLLAQagr  281
DSSP  HLHHHHHHHHHlll


No 10: Query=4qrnA Sbjct=2ffiA Z-score=19.6

back to top
DSSP  llllllllllllllLLEEEEEEELLHHHHHHHHhhhhhllllhhhhhhHHHHhhlllhhh
Query smtqdlktggeqgyLRIATEEAFATREIIDVYLrmirdgtadkgmvslWGFYaqspsera   60
ident                 |        |                                  
Sbjct -----------lhlTAIDSHAHVFSRGLNLASQ---------------RRYA--------   26
DSSP  -----------lllLLEELLLLLLLHHHHHHLL---------------LLLL--------


DSSP  hhHHHHhHLLLhHHHHHHHHLLLLEEEEEELLLLLlllllhhhhhhhhhhHHHHHHHHHH
Query tqILERlLDLGeRRIADMDATGIDKAILALTSPGVqplhdldeartlatrANDTLADACQ  120
ident          ||        | |     |   |                   |  |  | |
Sbjct --PNYD-APLG-DYLGQLRAHGFSHGVLVQPSFLG--------------tDNRYLLSALQ   68
DSSP  --LLLL-LLHH-HHHHHHHHLLLLEELLLLLHHHL--------------lLLHHHHHHHH


DSSP  HLLLLEEELLLLLlllHHHHHHHHHHHHHlLLLLLEEELLLLLLLL-LLLHHHHHHHHHH
Query KYPDRFIGMGTVApqdPEWSAREIHRGAReLGFKGIQINSHTQGRY-LDEEFFDPIFRAL  179
ident   |    |                   || ||  |   |   |    |      |     
Sbjct TVPGQLRGVVXLE---RDVEQATLAEXAR-LGVRGVRLNLXGQDXPdLTGAQWRPLLERI  124
DSSP  HLLLLLLLLLLLL---LLLLHHHHHHHHL-LLLLEEELLLLLLLLLlLLLLLLHHHHHHH


DSSP  HHHLLLEEELlllllllllhhhhhhlllllllhhhhHHHHHHHHHHHhLHHHhlLLLLEE
Query VEVDQPLYIHpatspdsmidpmleagldgaifgfgvETGMHLLRLITiGIFDkyPSLQIM  239
ident  |       |                                  |           | | 
Sbjct GEQGWHVELH--------------------------RQVADIPVLVR-ALQP--YGLDIV  155
DSSP  HHHLLEEEEL--------------------------LLLLLHHHHHH-HHLL--LLLLEE


DSSP  ELHHHHL--------hHHHHhhhhhhhhhhhhlllllllllllllHHHHhHHLEEEELLL
Query VGHMGEA--------lPYWLyrldymhqagvrsqryermkplkktIEGYlKSNVLVTNSG  291
ident   | |                                                | |  ||
Sbjct IDHFGRPdarrglgqpGFAE-----------------------llTLSG-RGKVWVKVSG  191
DSSP  ELHHHLLlllllllllLHHH-----------------------hlLLLL-LLLEEEEEEL


DSSP  L------------lLHHHHHHHHHHHLHHHEELLLLLLL------LLLHHHHHHHHLLLL
Query V------------aWEPAIKFCQQVMGEDRVMYAMDYPY------QYVADEVRAMDAMDM  333
ident                  |        |  |     | |             |    |   
Sbjct IyrlqgspeenlafARQALCALEAHYGAERLXWGSDWPHtqheseVSFGSAVEQFEALGC  251
DSSP  HhhllllhhhhhhhHHHHHHHHHHHLLHHHEEEELLLLLllllllLLHHHHHHHHHHHLL


DSSP  LHHHHHHHHLHHHHHHLLL---
Query SAQTKKKFFQTNAEKWFKL---  352
ident |||         |   |     
Sbjct SAQLRQALLLDTARALFGFele  273
DSSP  LHHHHHHHHLHHHHHHLLLlll


No 11: Query=4qrnA Sbjct=4mupB Z-score=17.4

back to top
DSSP  ---lllLLLLlllLLLL-LLEEEEEEELLHHHHhhhhhhhhhllllhhHHHHHhhhhhll
Query ---smtQDLKtggEQGY-LRIATEEAFATREIIdvylrmirdgtadkgMVSLWgfyaqsp   56
ident                       |                                     
Sbjct lvrklsGTAP--nPAFPrGAVDTQMHMYLPGYP-------------alPGGPG-------   38
DSSP  llllllLLLL--lLLLLlLLEELLLLLLLLLLL-------------llLLLLL-------


DSSP  lhhHHHHHhhhHLLLhHHHHHHHHLLLLEEEEEELLLLLLllllhhhhhhhhhhHHHHHH
Query serATQILerlLDLGeRRIADMDATGIDKAILALTSPGVQplhdldeartlatrANDTLA  116
ident        |             |   |||  |                        |    
Sbjct --lPPGAL---PGPE-DYRRLMQWLGIDRVIITQGNAHQR--------------DNGNTL   78
DSSP  --lLLLLL---LLHH-HHHHHHHHHLLLEEEEELLHHHLL--------------LLHHHH


DSSP  HHHHHLLLLEEELLLLllllHHHHHH-HHHHHHhLLLLLLEEELLLL-lllLLLLhhhHH
Query DACQKYPDRFIGMGTVapqdPEWSAR-EIHRGArELGFKGIQINSHT-qgrYLDEeffDP  174
ident                                     |  |  |         | |   | 
Sbjct ACVAEMGEAAHAVVII----DATTTEkDMEKLT-AAGTVGARIMDLPggavNLSE--lDA  131
DSSP  HHHHHHHHHEEEEELL----LLLLLHhHHHHHH-HLLEEEEEEELLLllllLHHH--hHH


DSSP  HHHHHHHHLLLEEELLllllllllhhhhhhlllllllhhhhhHHHHHHHHHhHLHHhhLL
Query IFRALVEVDQPLYIHPatspdsmidpmleagldgaifgfgveTGMHLLRLItIGIFdkYP  234
ident         |                                  |  ||            
Sbjct VDERAHAADWMVAVQF--------------------------DGNGLLDHL-PRLQ--KI  162
DSSP  HHHHHHHLLLEEEEEL--------------------------LHHHHHHHH-HHHH--LL


DSSP  LLLEEELHHHHL-hhHHHHHHhhhhhhhhhllllllllllllLHHHHHH-HLEEEELLLL
Query SLQIMVGHMGEA-lpYWLYRLdymhqagvrsqryermkplkkTIEGYLK-SNVLVTNSGV  292
ident        | |                                         |      ||
Sbjct RSRWVFDHHGKFfkgIRTDGP------------------emaALLKLIDrGNLWFKFAGV  204
DSSP  LLEEEELHHHHLlllLLLLLH------------------hhhHHHHHHHhLLEEEEELLH


DSSP  -----------lLHHHHHHHHHHhLHHHEELLLLLLL---------llLHHHHHHHHLLl
Query -----------aWEPAIKFCQQVmGEDRVMYAMDYPY---------qyVADEVRAMDAMd  332
ident                            |       |             |          
Sbjct yessrkswpyadVAAFSRVIAAH-APERIVWGTNWPHnsvretaaypdDARLAELTLGWl  263
DSSP  hhllllllllhhHHHHHHHHHHH-LHHHEEELLLLLLlllllhhhlllHHHHHHHHHLLl


DSSP  LLHHHHHHHHLHHHHHHLLL---
Query MSAQTKKKFFQTNAEKWFKL---  352
ident             | |  |||   
Sbjct PDEAARHRALVENPEALFKLspv  286
DSSP  LLHHHHHHHHLHHHHHHHLLlll


No 12: Query=4qrnA Sbjct=1gkpA Z-score=16.7

back to top
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE
Query --------------------------------------smtqdlktggEQGYLRIATEEA   22
ident                                                       |     
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkYVFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeellllEEEELEEEEEEL


DSSP  -ELLHhhhhhhhhhhhhllllhhhhhhHHHHhhlllhhhhhhHHHHhllLHHHHHHHHHL
Query -FATReiidvylrmirdgtadkgmvslWGFYaqspseratqiLERLldlGERRIADMDAT   81
ident                                                   |         
Sbjct iYLPF----------------------MATF-----------AKDT---HETGSKAALMG   84
DSSP  lLLEE----------------------LLEE-----------LLLL---HHHHHHHHHHL


DSSP  LLLEEEEEELllLLLLlllhhhhhHHHHHHHHHHHHHHHHL-lLLEEELLLLLLLLhHHH
Query GIDKAILALTspGVQPlhdldearTLATRANDTLADACQKY-pDRFIGMGTVAPQDpEWS  140
ident |    |                    |                        |   | |  
Sbjct GTTTYIEMCC--PSRN--------DDALEGYQLWKSKAEGNsyCDYTFHMAVSKFD-EKT  133
DSSP  LEEEEEEEEL--LLLL--------LLHHHHHHHHHHHHLLLllLEEEEEEELLLLL-LLH


DSSP  HHHHHHHHHLlLLLLEEELLLLLLllllLHHH-HHHHHHHHHHLLLEEELL--llLLLLL
Query AREIHRGARElGFKGIQINSHTQGryldEEFF-DPIFRALVEVDQPLYIHP--atSPDSM  197
ident            |     |                   |   |       |          
Sbjct EGQLREIVAD-GISSFXIFLSYKNffgvDDGEmYQTLRLAKELGVIVTAHCenaeLVGRL  192
DSSP  HHHHHHHHHL-LLLEEEEEELLLLllllLHHHhHHHHHHHHHHLLEEEEEEllhhHHHHH


DSSP  LHH------hhHHLLLllllHHHHHHHHHHHHHHhhLHHHHLLlLLEEELHHHHL-HHHH
Query IDP------mlEAGLDgaifGFGVETGMHLLRLItiGIFDKYPsLQIMVGHMGEA-LPYW  250
ident                                |                | |         
Sbjct QQKllsegktgPEWHE--psRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCKpALDA  247
DSSP  HHHhhhlllllHHHLL--llLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLHhHHHH


DSSP  hhhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL-------------
Query lyrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW-------------  294
ident                                                             
Sbjct --------------------------aMAAKArgVPIYIESViPHFLldktyaerggvea  281
DSSP  --------------------------hHHHHHllLLEEEEEEhHHHHllhhhhhllhhhh


DSSP  --------------HHHHHHHHHhhLHHHEELLLLLL-------------------LLLL
Query --------------EPAIKFCQQvmGEDRVMYAMDYP-------------------YQYV  321
ident                                   |                         
Sbjct mkyimspplrdkrnQKVLWDALA--QGFIDTVGTDHCpfdteqkllgkeaftaipnGIPA  339
DSSP  hlllllllllllhhHHHHHHHHH--LLLLLEEELLLLlllhhhhhhhlllhhhlllLLLL


DSSP  -HHHHHHHHLL-----LLLHHHHHHHHLHHHHHHLLL-----------------------
Query -ADEVRAMDAM-----DMSAQTKKKFFQTNAEKWFKL-----------------------  352
ident   | |                       | | | | |                       
Sbjct iEDRVNLLYTYgvsrgRLDIHRFVDAASTKAAKLFGLfprkgtiavgsdadlvvydpqyr  399
DSSP  lLLHHHHHHHHhllllLLLHHHHHHHHLHHHHHHLLLlllllllllllllleeeeellll


DSSP  -----------------------------------------------------------
Query -----------------------------------------------------------  352
ident                                                            
Sbjct gtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  eellhhhllllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 13: Query=4qrnA Sbjct=4b3zD Z-score=16.2

back to top
DSSP  ---------------------------------------llllllllllLLLLLLEEEEE
Query ---------------------------------------smtqdlktggEQGYLRIATEE   21
ident                                                        |    
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrMVIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeellllEEEELEEEEEE


DSSP  EELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhHHHHhllLHHHHHHHHHL
Query AFATReiidvylrmirdgtadkgmvslwgfyaqspseratqiLERLldlGERRIADMDAT   81
ident                                                             
Sbjct YLQKT-------------------------------------AADD---FFQGTRAALVG   80
DSSP  LLLLL-------------------------------------LLLL---HHHHHHHHHHL


DSSP  LLLEEEEEELlllllllllhhHHHHHHHHHHHHHHHHHHHL-lLLEEELLLLLLLLhHHH
Query GIDKAILALTspgvqplhdldEARTLATRANDTLADACQKY-pDRFIGMGTVAPQDpEWS  140
ident |    |               |              |                       
Sbjct GTTMIIDHVV----------pEPGSSLLTSFEKWHEAADTKscCDYSLHVDITSWY-DGV  129
DSSP  LEEEEEEEEL----------lLLLLLHHHHHHHHHHHHHLLllLEEEEEEELLLLL-LLH


DSSP  HHHHHHHHHLLLLLLEEELLLLLL-lLLLLHHHHHHHHHHHHHLLLEEELLL--lLLLLL
Query AREIHRGARELGFKGIQINSHTQG-rYLDEEFFDPIFRALVEVDQPLYIHPA--tSPDSM  197
ident   |        |    |                   |  |         |          
Sbjct REELEVLVQDKGVNSFQVYMAYKDvyQMSDSQLYEAFTFLKGLGAVILVHAEngdLIAQE  189
DSSP  HHHHHHHHHLLLLLEEEEELLLLLllLLLHHHHHHHHHHHHHHLLEEEEELLlhhHHHHH


DSSP  LHHH-----hhHLLLLlllHHHHHHHHHHHHHHhhLHHHHLLlLLEEELHHHH-LHHHhh
Query IDPM-----leAGLDGaifGFGVETGMHLLRLItiGIFDKYPsLQIMVGHMGE-ALPYwl  251
ident                               | |   |                       
Sbjct QKRIlemgitgPEGHA-lsRPEELEAEAVFRAI--TIAGRIN-CPVYITKVMSkSAAD--  243
DSSP  HHHHhhlllllLHHHH-hhLLHHHHHHHHHHHH--HHHHHHL-LLEEEEEELLhHHHH--


DSSP  hhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL--------------
Query yrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW--------------  294
ident                               |    |                        
Sbjct ------------------------iiALARKkgPLVFGEPIaASLGtdgthywsknwaka  279
DSSP  ------------------------hhHHHHHhlLLEEEEELhHHHHlllhhhhlllhhhh


DSSP  ---------------HHHHHHH-HHHHlhhHEELLLLLL-------------------LL
Query ---------------EPAIKFC-QQVMgedRVMYAMDYP-------------------YQ  319
ident                                                             
Sbjct aafvtspplspdpttPDYLTSLlACGD---LQVTGSGHCpystaqkavgkdnftlipeGV  336
DSSP  hhllllllllllllhHHHHHHHhHHLL---LLLLLLLLLlllhhhhhhhlllhhhlllLL


DSSP  LL-HHHHHHHHLL-----LLLHHHHHHHHLHHHHHHLLL---------------------
Query YV-ADEVRAMDAM-----DMSAQTKKKFFQTNAEKWFKL---------------------  352
ident                    |          ||| | | |                     
Sbjct NGiEERMTVVWDKavatgKMDENQFVAVTSTNAAKIFNLyprkgriavgsdadvviwdpd  396
DSSP  LLlLLHHHHHHHHhllllLLLHHHHHHHHLHHHHHHHLLlllllllllllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct klktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafp  456
DSSP  eeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllll


DSSP  ---------------------
Query ---------------------  352
ident                      
Sbjct ehlyqrvkirnkvfglqgvsr  477
DSSP  hhhhhhhhhhhhhllllllll


No 14: Query=4qrnA Sbjct=1itqA Z-score=15.8

back to top
DSSP  LLLLlllllLLLL--LLLEEEEEEE---LLHHhhhhhhhhhhhllllhhhhhhhhhhhhl
Query SMTQdlktgGEQG--YLRIATEEAF---ATREiidvylrmirdgtadkgmvslwgfyaqs   55
ident                   |                                         
Sbjct DFFR--deaERIMrdSPVIDGHNDLpwqLLDM------------------fnnrlqdera   40
DSSP  LHHH--hhhHHHHllLLEEEEEELHhhhHHHH------------------hllllllhhh


DSSP  llhhHHHHhhhhhlllhhHHHHHHHLLLLEEEEEELllLLLLLllHHHHHHHHHHHHHHH
Query pserATQIlerlldlgerRIADMDATGIDKAILALTspGVQPLhdLDEARTLATRANDTL  115
ident                    |    |                       |        |  
Sbjct nlttLAGT--------htNIPKLRAGFVGGQFWSVY--TPCDT-qNKDAVRRTLEQMDVV   89
DSSP  llllLLLL--------llLHHHHHHLLEEEEEEEEL--LLHHH-lLLLHHHHHHHHHHHH


DSSP  HHHHH-----HLLL---------------LEEELLL--lLLLLHhhhHHHHHHHHHlLLL
Query ADACQ-----KYPD---------------RFIGMGT--vAPQDPewsAREIHRGAReLGF  153
ident    |                                                     || 
Sbjct HRMCRmypetFLYVtssagirqafregkvASLIGVEgghSIDSS---LGVLRALYQ-LGM  145
DSSP  HHHHHhllllEEELllhhhhhhhhhllleEEEEEEElhhHLLLL---HHHHHHHHH-LLE


DSSP  LLEEE-LLLLlLLLL----------------LLHHHHHHHHHHHHHLLLEEELLllllll
Query KGIQI-NSHTqGRYL----------------DEEFFDPIFRALVEVDQPLYIHPatspds  196
ident        |                          |       |                 
Sbjct RYLTLtHSCN-TPWAdnwlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH------  198
DSSP  EEEELlLLLL-LLLLllhhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL------


DSSP  llhhhhhhlllllllhhhhhhhhHHHHHHHhLHHHHLlLLLEEE-LHHH--------HLH
Query midpmleagldgaifgfgvetgmHLLRLITiGIFDKYpSLQIMV-GHMG--------EAL  247
ident                                                             
Sbjct -----------------------VSVATMK-ATLQLS-RAPVIFsHSSAysvcasrrNVP  233
DSSP  -----------------------LLHHHHH-HHHHHL-LLLLEElLLLLllllllllLLL


DSSP  HhhhhhhhhhhhhhhhllllllllllllLHHHHHHHL-EEEELLLL-------------l
Query PywlyrldymhqagvrsqryermkplkkTIEGYLKSN-VLVTNSGV-------------a  293
ident                                   |    ||                   
Sbjct D---------------------------DVLRLVKQTdSLVMVNFYnnyisctnkanlsq  266
DSSP  H---------------------------HHHHHHHHHlLEEEELLLhhhhlllllllhhh


DSSP  LHHHHHHHHHHHLHHHEELLLLLLLL--------LLHHhHHHHHLL----LLLHHHHHHH
Query WEPAIKFCQQVMGEDRVMYAMDYPYQ--------YVADeVRAMDAM----DMSAQTKKKF  341
ident           | |   |    |             |        |            |  
Sbjct VADHLDHIKEVAGARAVGFGGDFDGVprvpegleDVSK-YPDLIAEllrrNWTEAEVKGA  325
DSSP  HHHHHHHHHHHLLHHHEEELLLLLLLllllllllLLLL-HHHHHHHhhhlLLLHHHHHHH


DSSP  HLHHHHHHLL---------------------------------l
Query FQTNAEKWFK---------------------------------l  352
ident    |    |                                   
Sbjct LADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll


No 15: Query=4qrnA Sbjct=1onxA Z-score=15.3

back to top
DSSP  ------------------------------------------------llllllllllLL
Query ------------------------------------------------smtqdlktggEQ   12
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqIL   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllEE


DSSP  LLLLEEEEEE--ELLHhhhhhhhhhhhhllllhhhhhHHHHHHhlllhhhhhhhhhHHLL
Query GYLRIATEEA--FATReiidvylrmirdgtadkgmvsLWGFYAqspseratqilerLLDL   70
ident     |                                  |                    
Sbjct CPGFIDQHVHliGGGG---------------------EAGPTT------------rTPEV   87
DSSP  EELEEEEEELllLLLL---------------------LLLHHH------------lLLLL


DSSP  lhhHHHHHHHLLLLEEEEEELLLLLlllllhhhhhhhhhhHHHHHHHHHHHLL---LLEE
Query gerRIADMDATGIDKAILALTSPGVqplhdldeartlatrANDTLADACQKYP---DRFI  127
ident            |       |                        |               
Sbjct ---ALSRLTEAGVTSVVGLLGTDSI-------------srHPESLLAKTRALNeegISAW  131
DSSP  ---LHHHHHHLLEEEEEELLLLLLL-------------llLHHHHHHHHHHHHhhlLEEE


DSSP  ELLL-lLLLLhhhhhHHHHHHH-HLLLLLLEEELL----LLLLllllLHHH-HHHHHHHH
Query GMGT-vAPQDpewsaREIHRGA-RELGFKGIQINS----HTQGryldEEFF-DPIFRALV  180
ident                              |                              
Sbjct MLTGayHVPS-rtitGSVEKDVaIIDRVIGVXCAIsdhrSAAP----DVYHlANMAAESR  186
DSSP  EEEEllLLLL-llllLLHHHHHhHLLLEEEEEEEEllllLLLL----LHHHhHHHHHHHH


DSSP  HHL------LLEEELLllllllllhhhhhhlllllllhHHHHhhHHHHHHHhhLHHH-HL
Query EVD------QPLYIHPatspdsmidpmleagldgaifgFGVEtgMHLLRLItiGIFD-KY  233
ident               |                               |             
Sbjct VGGllggkpGVTVFHM----------------------GDSK--KALQPIY--DLLEnCD  220
DSSP  HHHhhhlllLEEEEEE----------------------LLLL--LLLHHHH--HHHHlLL


DSSP  LLL-LEEELHHHHL--HHHHhhhhhhhhhhhhhlllllllllllllhhHHHHHLEEEELL
Query PSL-QIMVGHMGEA--LPYWlyrldymhqagvrsqryermkplkktieGYLKSNVLVTNS  290
ident          |      |                                           
Sbjct VPIsKLLPTHVNRNvpLFEQ--------------------------alEFARKGGTIDIT  254
DSSP  LLHhHEEEELHHHLhhHHHH--------------------------hhHHHHLLLLEEEE


DSSP  LL-----LLHHHHHHHHHH-HLHHHEELLLLLLL----------------LLLHhHHHHH
Query GV-----AWEPAIKFCQQV-MGEDRVMYAMDYPY----------------QYVAdEVRAM  328
ident        |    |    |      ||    |                             
Sbjct SSidepvAPAEGIARAVQAgIPLARVTLSSDGNGsqpffddegnlthigvAGFE-TLLET  313
DSSP  LLlllllLHHHHHHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeeeLLLH-HHHHH


DSSP  HLL-----LLLHHHHHHHHLHHHHHHLLL-------------------------------
Query DAM-----DMSAQTKKKFFQTNAEKWFKL-------------------------------  352
ident         | |                 |                               
Sbjct VQVlvkdyDFSISDALRPLTSSVAGFLNLtgkgeilpgndadllvmtpelrieqvyargk  373
DSSP  HHHhhhhhLLLHHHHHHHHLHHHHHHLLLllllllllllllleeeellllleeeeeelle


DSSP  -----------------
Query -----------------  352
ident                  
Sbjct lmvkdgkacvkgtfetd  390
DSSP  eeeelleelllllllll


No 16: Query=4qrnA Sbjct=3griA Z-score=15.3

back to top
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE
Query --------------------------------------smtqdlktggEQGYLRIATEEA   22
ident                                                             
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghFVSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeellllEEEELEEEEEEL


DSSP  -ELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhHHHHhHLLLhHHHHHHHHL
Query -FATReiidvylrmirdgtadkgmvslwgfyaqspseratqILERlLDLGeRRIADMDAT   81
ident                                                             
Sbjct lREPG------------------------------------GEYK-ETIE-TGTKAAARG   82
DSSP  lLLLL------------------------------------LLLL-LLHH-HHHHHHHHL


DSSP  LLLEEEEEELlllllllllhhhhhhhHHHHHHHHHHHHHHLL-LLEEELLLLL----LLL
Query GIDKAILALTspgvqplhdldeartlATRANDTLADACQKYP-DRFIGMGTVA----PQD  136
ident |                                |          |               
Sbjct GFTTVCPXPN----------trpvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKE  132
DSSP  LEEEEEELLL----------llllllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLL


DSSP  HhhhhHHHHHHHHlLLLLLEEELLLLlllLLLLhHHHHHHHHHHHHLLLEEELLLLLLll
Query PewsaREIHRGAReLGFKGIQINSHTqgrYLDEeFFDPIFRALVEVDQPLYIHPATSPds  196
ident                |                             |      |       
Sbjct L----VDFPALVK-EGAFAFTDDGVG--vQTAS-XXYEGXIEAAKVNKAIVAHCEDNS--  182
DSSP  L----LLHHHHHL-LLLLLEEELLLL--lLLHH-HHHHHHHHHHHHLLLEEELLLLHH--


DSSP  LLHHHH----------hHLLLllllhhHHHHHHHHHHHHhhLHHHHLLlLLEEELHHHH-
Query MIDPML----------eAGLDgaifgfGVETGMHLLRLItiGIFDKYPsLQIMVGHMGE-  245
ident  |                                  |                | |    
Sbjct LIYGGAxhegkrskelgIPGI-----pNICESVQIARDV--LLAEAAG-CHYHVCHVSTk  234
DSSP  HLLLLLeellhhhhhhlLLEE-----lLHHHHHHHHHHH--HHHHHHL-LLEEELLLLLh


DSSP  LHHHhhhhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL--------
Query ALPYwlyrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW--------  294
ident                                          |                  
Sbjct ESVR--------------------------viRDAKRagIHVTAEVTpHHLLlteddipg  268
DSSP  HHHH--------------------------hhHHHHHllLLEEEEELhHHHHllhhhlll


DSSP  ----------------hHHHHHHHHHHLhhHEELLLLLL----------------LLLL-
Query ----------------ePAIKFCQQVMGedRVMYAMDYP----------------YQYV-  321
ident                   |               | |                       
Sbjct nnaiykxnpplrstedrEALLEGLLDGT--IDCIATDHAphardekaqpxekapfGIVGs  326
DSSP  llhhhllllllllhhhhHHHHHHHHLLL--LLEELLLLLlllhhhhlllllllllLLLLl


DSSP  HHHHHHHHLLL-----LLHHHHHHHHLHHHHHHLLL------------------------
Query ADEVRAMDAMD-----MSAQTKKKFFQTNAEKWFKL------------------------  352
ident                    |             | |                        
Sbjct ETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLeygtlkengyadltiidldseqei  386
DSSP  LLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllllllleeeeelllleel


DSSP  ------------------------------------
Query ------------------------------------  352
ident                                     
Sbjct kgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  lhhhllllllllllllleelleeeeeeelleeeeel


No 17: Query=4qrnA Sbjct=4cqbA Z-score=15.1

back to top
DSSP  ---------------------------------------llllllllllLLLLLLEEEEE
Query ---------------------------------------smtqdlktggEQGYLRIATEE   21
ident                                                             
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnLVSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllLEEELEEEEEE


DSSP  EELLhhhhhhhhhhhhhllllhhhhhhhhHHHHLL--------------lhhhhhhhhhh
Query AFATreiidvylrmirdgtadkgmvslwgFYAQSP--------------seratqilerl   67
ident                                                             
Sbjct HMDK-----------------sftstgerLPKFWSrpytrdaaiedglkyyknatheeik  103
DSSP  LHHH-----------------llllllllLLLLLLllllhhhhhhhhhhhhhhllhhhhh


DSSP  HLLLhHHHHHHHHLLLLEEEEEEllllllllllhhhHHHHHHHHHHHHHHHHHHLL--LL
Query LDLGeRRIADMDATGIDKAILALtspgvqplhdldeARTLATRANDTLADACQKYP--DR  125
ident               |                          | |      |         
Sbjct RHVI-EHAHMQVLHGTLYTRTHV-----------dvDSVAKTKAVEAVLEAKEELKdlID  151
DSSP  HHHH-HHHHHHHHLLEEEEEEEE-----------elLLLLLLHHHHHHHHHHHHLLllLE


DSSP  EEELLLL--LLLLHHHHHHHHHHHHHLlLLLLEEELLL--LLLLLLLlhhhHHHHHHHHH
Query FIGMGTV--APQDPEWSAREIHRGARElGFKGIQINSH--TQGRYLDeeffDPIFRALVE  181
ident                 |   |       |                      |  |    |
Sbjct IQVVAFAqsGFFVDLESESLIRKSLDM-GCDLVGGVDPatRENNVEG--slDLCFKLAKE  208
DSSP  EEEEEELllLLLLLLLHHHHHHHHHHH-LLLEEELLLLllLLLLHHH--hhHHHHHHHHH


DSSP  HLLLEEELLLlllllllhhhhhhlllllllhHHHHHHHHHHHHHhhLHHHHLLLL-LEEE
Query VDQPLYIHPAtspdsmidpmleagldgaifgFGVETGMHLLRLItiGIFDKYPSL-QIMV  240
ident  |     |                        |        ||                 
Sbjct YDVDIDYHIH--------------------dIGTVGVYSINRLA--QKTIENGYKgRVTT  246
DSSP  LLLEEEEEEL--------------------lLHHHHHHHHHHHH--HHHHHLLLLlLEEE


DSSP  LHhHHLH----hhHHHHhhhhhhhhhhlllllllllllllHHHHHHH-LEEEELL-LLLL
Query GHmGEAL----pyWLYRldymhqagvrsqryermkplkktIEGYLKS-NVLVTNS-GVAW  294
ident  |           ||                              |              
Sbjct SH-AWCFadapseWLDE-----------------------AIPLYKDsGMKFVTCfSSTP  282
DSSP  EE-LLHHhhllhhHHHH-----------------------HHHHHHHhLLEEEEElLLLL


DSSP  HHH-HHHHHHHHLhhHEELLLLLL-----LLLL---HHHHHHHHLL-----lLLHHHHHH
Query EPA-IKFCQQVMGedRVMYAMDYP-----YQYV---ADEVRAMDAM-----dMSAQTKKK  340
ident                    | |                                     |
Sbjct PTMpVIKLLEAGI--NLGCASDNIrdfwvPFGNgdmVQGALIETQRlelktnRDLGLIWK  340
DSSP  LLLlHHHHHHLLL--EEEEELLLLlllllLLLLllhHHHHHHHHHHhllllhHHHHHHHH


DSSP  HHLHHHHHHLLL------------------------------------------------
Query FFQTNAEKWFKL------------------------------------------------  352
ident                                                             
Sbjct MITSEGARVLGIeknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdevi  400
DSSP  HHLHHHHHHHLLhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeellee


DSSP  --
Query --  352
ident   
Sbjct va  402
DSSP  ll


No 18: Query=4qrnA Sbjct=3pnuA Z-score=15.0

back to top
DSSP  ------LLLLlllllllLLLLLEEEEEEellhhhhhhhhhhhhhllllhhhhhhhhhhhh
Query ------SMTQdlktggeQGYLRIATEEAfatreiidvylrmirdgtadkgmvslwgfyaq   54
ident       |                                                     
Sbjct enlyfqSNAM-------KLKNPLDMHLH--------------------------------   21
DSSP  llllllLLLE-------EEELLEEEEEL--------------------------------


DSSP  lllhhhhhhhhHHHL-lLHHHHHHHHHlLLLEEEEEELlllllllllhhhhhhHHHHHHH
Query spseratqileRLLD-lGERRIADMDAtGIDKAILALTspgvqplhdldeartLATRAND  113
ident                   |             |                           
Sbjct -----------LRDNqmLELIAPLSAR-DFCAAVIMPN----------lipplCNLEDLK   59
DSSP  -----------LLLHhhHHHHHHHHHL-LLLEEEELLL----------lllllLLHHHHH


DSSP  HHHHHHHHL----lLLEEELLLLLLllhhHHHHHHHHHHHllLLLLEEELLL--------
Query TLADACQKY----pDRFIGMGTVAPqdpeWSAREIHRGARelGFKGIQINSH--------  161
ident        |                                     ||             
Sbjct AYKMRILKAckdenFTPLMTLFFKN----YDEKFLYSAKD--EIFGIXLYPAgittnsng  113
DSSP  HHHHHHHHHhllllLEEEEEEELLL----LLHHHHHHHLL--LLLEEEELLLllllllll


DSSP  LLLLLlLLHHHHHHHHHHHHHLLLEEELLLLLlllllhhhhhhLLLLlllHHHHHHHHHH
Query TQGRYlDEEFFDPIFRALVEVDQPLYIHPATSpdsmidpmleaGLDGaifGFGVETGMHL  221
ident       | |   |   |      ||  |  |                             
Sbjct GVSSF-DIEYLKPTLEAMSDLNIPLLVHGETN-----------DFVM---DRESNFAKIY  158
DSSP  LLLLL-LHHHHHHHHHHHHHLLLLEEELLLLL-----------LLHH---HLLHHHHHHH


DSSP  HHHHhHLHHhhllLLLEEELHH-hhLHHHhhhhhhhhhhhhhhlllllllllllllhHHH
Query LRLItIGIFdkypSLQIMVGHM-geALPYwlyrldymhqagvrsqryermkplkktiEGY  280
ident   |           | |   |     |                                |
Sbjct EKLA-KHFP----RLKIVMEHIttkTLCE--------------------------llKDY  187
DSSP  HHHH-HHLL----LLLEEELLLllhHHHH--------------------------hhHHL


DSSP  HhhLEEEELL-LLLL--------------------------hHHHHHHHhhhlHHHEELL
Query LksNVLVTNS-GVAW--------------------------ePAIKFCQqvmgEDRVMYA  313
ident    |   |                                   |            ||  
Sbjct E--NLYATITlHHLIitlddviggkmnphlfckpiakryedkEALCELA-fsgYEKVMFG  244
DSSP  L--LEEEEELlHHHLllhhhhhlllllhhhllllllllhhhhHHHHHHH-hllLLLEEEL


DSSP  LLLL--------LLLL-HHHHHHHHLL---LLLHHHHHHHHLHHHHHHLLL---------
Query MDYP--------YQYV-ADEVRAMDAM---DMSAQTKKKFFQTNAEKWFKL---------  352
ident  |                              |     ||   |  |   |         
Sbjct SDSAphpkgcaaGVFSaPVILPVLAELfkqNSSEENLQKFLSDNTCKIYDLkfkedkilt  304
DSSP  LLLLllllllllLLLLhHHHHHHHHHHhhhHLLHHHHHHHHLHHHHHHHLLlllllleee


DSSP  ----------------------------------
Query ----------------------------------  352
ident                                   
Sbjct leekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  eellleelllleelllleellllllleelleell


No 19: Query=4qrnA Sbjct=1bf6A Z-score=15.0

back to top
DSSP  lllllllllllllLLLEEEEEE-ELLHhhHHHHHhhhhhllllhhhhhhhhhhhhlllhh
Query smtqdlktggeqgYLRIATEEA-FATReiIDVYLrmirdgtadkgmvslwgfyaqspser   59
ident                     |                                       
Sbjct ---------sfdpTGYTLAHEHlHIDL--SGFKN--------------------------   23
DSSP  ---------llllLLEEEEEELlLEEL--HHHHL--------------------------


DSSP  hHHHHhhhHLLLHHHHHHHHHLL---LLEEEEEEllllllllllhhhhhhhHHHHhhHHH
Query aTQILerlLDLGERRIADMDATG---IDKAILALtspgvqplhdldeartlATRAndTLA  116
ident         ||        |           |                            |
Sbjct nVDCR---LDQYAFICQEMNDLMtrgVRNVIEMT----------------nRYMG--RNA   62
DSSP  lHHHE---ELLHHHHHHHHHHHHhllEEEEEELL----------------lHHHL--LLH


DSSP  HHHHHLL----LLEEELLLL----------llLLHHHHHHHHHHHHHLL------LLLLE
Query DACQKYP----DRFIGMGTV----------apQDPEWSAREIHRGAREL------GFKGI  156
ident                                       | |                  |
Sbjct QFMLDVMretgINVVACTGYyqdaffpehvatRSVQELAQEMVDEIEQGidgtelKAGII  122
DSSP  HHHHHHHhhhlLEEEEEELLllhhhlllhhhhLLHHHHHHHHHHHHHLLllllllLEEEE


DSSP  E-ELLL---lLLLLLllhhhHHHHHHHHHHLLLEEELLLlllllllhhhhhhlllllllh
Query Q-INSH---tQGRYLdeeffDPIFRALVEVDQPLYIHPAtspdsmidpmleagldgaifg  212
ident   |                      |      |   |                       
Sbjct AeIGTSegkiTPLEE--kvfIAAALAHNQTGRPISTHTS---------------------  159
DSSP  EeEELLllllLHHHH--hhhHHHHHHHHHHLLLEEEELH---------------------


DSSP  HHHHhhhhHHHHHHhLHHHHLLLL-LEEELHHHHLhHHHHhhhhhhhhhhhhllllllll
Query FGVEtgmhLLRLITiGIFDKYPSL-QIMVGHMGEAlPYWLyrldymhqagvrsqryermk  271
ident |        |             |    |||                             
Sbjct FSTM----GLEQLA-LLQAHGVDLsRVTVGHCDLKdNLDN--------------------  194
DSSP  HHLL----HHHHHH-HHHHLLLLHhHEEELLLLLLlLHHH--------------------


DSSP  lllllhHHHHHHLEEEELLLLL---------LHHHHHHHHHHHLHHHEELLLLLL-----
Query plkktiEGYLKSNVLVTNSGVA---------WEPAIKFCQQVMGEDRVMYAMDYP-----  317
ident                |                              |||  ||       
Sbjct -----iLKMIDLGAYVQFDTIGknsyypdekRIAMLHALRDRGLLNRVMLSMDITrrshl  249
DSSP  -----hHHHHHLLLEEEELLLLllllllhhhHHHHHHHHHHLLLHHHEEELLLLLlhhhl


DSSP  ----llLLHHHH-HHHHLLL---LLHHHHHHHHLHHHHHHLLl
Query ----yqYVADEV-RAMDAMD---MSAQTKKKFFQTNAEKWFKl  352
ident                         |          |    |  
Sbjct kanggyGYDYLLtTFIPQLRqsgFSQADVDVMLRENPSQFFQ-  291
DSSP  hhhlllLLLHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHLL-


No 20: Query=4qrnA Sbjct=2qpxA Z-score=14.9

back to top
DSSP  lllllllllllLLLLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhHHLLLHHH
Query smtqdlktggeQGYLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyAQSPSERA   60
ident                       |                                   | 
Sbjct --gxddlsefvDQVPLLDHHCHF------------------------lidgkVPNRDDRL   34
DSSP  --lllllhhhhHHLLEEEEEELL------------------------lllllLLLHHHHH


DSSP  HHH--------------------------------------hhhhhlllhHHHHHHHHLL
Query TQI--------------------------------------lerlldlgeRRIADMDATG   82
ident  |                                                          
Sbjct AQVsteadkdypladtknrlayhgflalakefaldannplaaxndpgyatYNHRIFGHFH   94
DSSP  HHHlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLL


DSSP  LLEEEEEELLllllllllhhhhhhhhhhhhhhhhHHHHHLL----LLEEELLL--LLLL-
Query IDKAILALTSpgvqplhdldeartlatrandtlaDACQKYP----DRFIGMGT--VAPQ-  135
ident                                                             
Sbjct FKELLIDTGF------------------vpddpiLDLDQTAelvgIPVKAIYRleTHAEd  136
DSSP  EEEEEEELLL------------------llllllLLHHHHHhhhlLLEEEEEEhhHHHHh


DSSP  ----------LHHHHHHHHHHHHHlLLLLLEEELLL------------------------
Query ----------DPEWSAREIHRGAReLGFKGIQINSH------------------------  161
ident                           || |                              
Sbjct fxlehdnfaaWWQAFSNDVKQAKA-HGFVGFXSIAAyrvglhlepvnvieaaagfdtwkh  195
DSSP  hhlllllhhhHHHHHHHHHHLLLL-LLLLLEEELHHhhlllllllllhhhhhhhhhhhhh


DSSP  -----LLLLlllLHHH-HHHHHHHHHHLLLEEELlllllllllhhhhhhllllLLLHH-H
Query -----TQGRyldEEFF-DPIFRALVEVDQPLYIHpatspdsmidpmleagldgAIFGF-G  214
ident                            | ||  |                          
Sbjct sgekrLTSK-plIDYXlYHVAPFIIAQDXPLQFH----------------vgyGDADTdX  238
DSSP  hllllLLLH-hhHHHHhHHHHHHHHHHLLLEEEE----------------ellLLLLLlH


DSSP  HHHHhhHHHHHhhLHHHHLL--LLLEEELHhHHLHHHhhhhhhhhhhhhhhlllllllll
Query VETGmhLLRLItiGIFDKYP--SLQIMVGHmGEALPYwlyrldymhqagvrsqryermkp  272
ident        |               |     |                              
Sbjct YLGN--PLLXR--DYLKAFTkkGLKVVLLH-CYPYHR-----------------------  270
DSSP  HHLL--HHHHH--HHHHHHHhhLLLEEEEE-LLLLHH-----------------------


DSSP  llllhhhHHHH--LEEEELLLLL------LHHHHHHHHHHHLHHHEELLLLLLL--lLLH
Query lkktiegYLKS--NVLVTNSGVA------WEPAIKFCQQVMGEDRVMYAMDYPY--qYVA  322
ident              |     |                        |   | |         
Sbjct ---eagyLASVfpNLYFDISLLDnlgpsgASRVFNEAVELAPYTRILFASDASTypeXYG  327
DSSP  ---hhhhHHHHllLEEEELLLHHhhlhhhHHHHHHHHLLLLLHHHEELLLLLLLlhhHHH


DSSP  HHHHHHHL--LLLL-----------HHHHHHHHLHHHHHHLLL------
Query DEVRAMDA--MDMS-----------AQTKKKFFQTNAEKWFKL------  352
ident    |                                  |          
Sbjct LAARQFKQalVAHFnqlpfvdlaqkKAWINAICWQTSAKLYHQerelrv  376
DSSP  HHHHHHHHhhHHHHhllllllhhhhHHHHHHHHLHHHHHHLLLhhhhll


No 21: Query=4qrnA Sbjct=3k2gB Z-score=14.7

back to top
DSSP  -------------llllllllllllllLLEEEEEE-ELLHhhhhhhhhhhhhllllhhhh
Query -------------smtqdlktggeqgyLRIATEEA-FATReiidvylrmirdgtadkgmv   46
ident                                  |                          
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDC--------------------   40
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEEL--------------------


DSSP  hHHHH-------hhHLLLHH--------------HHHHHhHHHLlLHHHHHHHHHLL---
Query sLWGF-------yaQSPSER--------------ATQILeRLLDlGERRIADMDATG---   82
ident   |                                      | |     ||         
Sbjct rCWWNppqeperqyLAEAPIsieilselrqdpfvNKHNI-ALDD-LDLAIAEVKQFAavg   98
DSSP  hHHLLllllhhhhhHHHLLLlhhhhhhhhllhhhLLLLL-EELL-HHHHHHHHHHHHhll


DSSP  LLEEEEEEllllllllllhhhhhhhHHHHhhHHHHHHHHLL----LLEEELLLL------
Query IDKAILALtspgvqplhdldeartlATRAndTLADACQKYP----DRFIGMGTV------  132
ident                                                             
Sbjct GRSIVDPT----------------cRGIG--RDPVKLRRISaetgVQVVXGAGYylassx  140
DSSP  LLEEEELL----------------lLLLL--LLHHHHHHHHhhhlLEEEELLLLllhhhl


DSSP  ----llLLHHHHHHHHHHHHHL------LLLLLEE-ELLL--LLLLLLllhhhHHHHHHH
Query ----apQDPEWSAREIHRGARE------LGFKGIQ-INSH--TQGRYLdeeffDPIFRAL  179
ident             | ||   | |           |  |                    || 
Sbjct petaarLSADDIADEIVAEALEgtdgtdARIGLIGeIGVSsdFTAEEE--kslRGAARAQ  198
DSSP  lhhhhlLLHHHHHHHHHHHHHLllllllLLLLLEEeELLLllLLHHHH--hhhHHHHHHH


DSSP  HHHLLLEEELLllllllllhhhhhhlllllllhHHHHhhHHHHHHHhHLHHhHLLLL--L
Query VEVDQPLYIHPatspdsmidpmleagldgaifgFGVEtgMHLLRLItIGIFdKYPSL--Q  237
ident |    ||  |                        |        |                
Sbjct VRTGLPLXVHL----------------------PGWF--RLAHRVL-DLVE-EEGADlrH  232
DSSP  HHHLLLEEELL----------------------LLLL--LLHHHHH-HHHH-HLLLLhhH


DSSP  EEELHHHHLHhHHHHhhhhhhhhhhhlllllllllllllhHHHHHHLEEEELLLLL----
Query IMVGHMGEALpYWLYrldymhqagvrsqryermkplkktiEGYLKSNVLVTNSGVA----  293
ident     |                                                       
Sbjct TVLCHXNPSH-XDPV-----------------------yqATLAQRGAFLEFDXIGxdff  268
DSSP  EEELLLHHHL-LLHH-----------------------hhHHHHHHLLEEEELLLLllle


DSSP  -------------LHHHHHHHHHHHLHHHEELLLLLLL---------lLLHHHHHHHHLL
Query -------------WEPAIKFCQQVMGEDRVMYAMDYPY---------qYVADEVRAMDAM  331
ident                 ||         ||     |               |         
Sbjct yadqgvqcpsddeVARAILGLADHGYLDRILLSHDVFVkxxltryggnGYAFVTKHFLPR  328
DSSP  elllleelllhhhHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhlllLLLHHHHLHHHH


DSSP  ----LLLHHHHHHHHLHHHHHHLL-----l
Query ----DMSAQTKKKFFQTNAEKWFK-----l  352
ident                 ||    |       
Sbjct lrrhGLDDAALETLXVTNPRRVFDasiegh  358
DSSP  hhhlLLLHHHHHHHHLHHHHHHHLllllll


No 22: Query=4qrnA Sbjct=2vunA Z-score=14.6

back to top
DSSP  ----------------------------------------------llllllllllLLLL
Query ----------------------------------------------smtqdlktggEQGY   14
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagsTVTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeellllEEEE


DSSP  LLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhhlLLHH-
Query LRIATEEAFAtreiidvylrmirdgtadkgmvslwgfyaqspseratqilerlldLGER-   73
ident     |                                                   |   
Sbjct GLLDTHVHVS---------------------------------------------GGDYa   75
DSSP  LEEEEEELLL---------------------------------------------LLLEe


DSSP  -------HHHHHHHLLLLEEEE-EELLllllllllhhhHHHHHHHHHHHHHHHHHHLL--
Query -------RIADMDATGIDKAIL-ALTSpgvqplhdldeARTLATRANDTLADACQKYP--  123
ident         |      |    |                           ||          
Sbjct prqktmdFISSALHGGVTTMISaGSPH-----fpgrpkDAAGTKALAITLSKSYYNARpa  130
DSSP  hhhleelHHHHHHLLLEEEEEElLLLL-----llllllLHHHHHHHHHHHHHHHHHLLhh


DSSP  -LLEEE-LLLLLlLLHHhhHHHHHHHHHLLlLLLEEELLlllllLLLLhhHHHHHHHHHH
Query -DRFIG-MGTVApQDPEwsAREIHRGARELgFKGIQINShtqgrYLDEefFDPIFRALVE  181
ident      |                      |                       |       
Sbjct gVKVHGgAVILE-KGLT--EEDFIEMKKEG-VWIVGEVGlgtikNPED--AAPMVEWAHK  184
DSSP  hLEEELlEELLL-LLLL--HHHHHHHHHLL-LLEEEEELlllllLHHH--HHHHHHHHHH


DSSP  HLLLEEELL-lLLLLLLLhhhhhhlllllllhhhHHHHHHHHHHhhhlhhhhllllLEEE
Query VDQPLYIHP-aTSPDSMIdpmleagldgaifgfgVETGMHLLRLitigifdkypslQIMV  240
ident        |   ||                       |                      |
Sbjct HGFKVQMHTggTSIPGSS----------------TVTADDVIKT-----------kPDVV  217
DSSP  LLLEEEEELllLLLLLLL----------------LLLHHHHHHH-----------lLLEE


DSSP  LHH-------hhLHHHHhhhhhhhhhhhhhlllllllllllllhHHHHhhlEEEELL-LL
Query GHM-------geALPYWlyrldymhqagvrsqryermkplkktiEGYLksnVLVTNS-GV  292
ident  |                                                          
Sbjct SHInggptaisvQEVDR-------------------------imDETD---FAMEIVqCG  249
DSSP  ELLllllllllhHHHHH-------------------------hhHHLL---LEEEEElLL


DSSP  LLhHHHHHHHHHH----LHHHEELLLLLLL--LLLHHHHHHHHLL-----LLLHHHHHHH
Query AWePAIKFCQQVM----GEDRVMYAMDYPY--QYVADEVRAMDAM-----DMSAQTKKKF  341
ident                     ||    | |                     |         
Sbjct NP-KIADYVARRAaekgQLGRVIFGNDAPSgtGLIPLGILRNMCQiasmsDIDPEVAVCM  308
DSSP  LH-HHHHHHHHHHhhhlLHHHEEEELLLLLllLLLLLHHHHHHHHhhhhlLLLHHHHHHH


DSSP  HLHHHHHHLLL-------------------------------------------------
Query FQTNAEKWFKL-------------------------------------------------  352
ident    |      |                                                 
Sbjct ATGNSTAVYGLntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeav  368
DSSP  HLHHHHHHHLLlllllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleee


DSSP  -----------------
Query -----------------  352
ident                  
Sbjct vtksrntppakraakil  385
DSSP  ellllllllllllleel


No 23: Query=4qrnA Sbjct=1yrrB Z-score=14.5

back to top
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE
Query --------------------------------------smtqdlktggEQGYLRIATEEA   22
ident                                                       |     
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaILSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeellllEEEELEEEEEEL


DSSP  ------ELLHHHHhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhHLLLhHHHH
Query ------FATREIIdvylrmirdgtadkgmvslwgfyaqspseratqilerlLDLGeRRIA   76
ident       |                                              |      
Sbjct gcggvqFNDTAEA-----------------------------------vsvETLE-IMQK   84
DSSP  eelleeLLLLLLL-----------------------------------llhHHHH-HHHH


DSSP  HHHHLLLLEEEEEEllLLLLllllhhhhHHHHHHHHHHHHHHHHHLLLLEEE-LLLLLLl
Query DMDATGIDKAILALtsPGVQplhdldeaRTLATRANDTLADACQKYPDRFIG-MGTVAPq  135
ident      |       |                |             | |    |        
Sbjct ANEKSGCTNYLPTL--ITTS--------DELMKQGVRVMREYLAKHPNQALGlHLEGPW-  133
DSSP  HHHLLLEEEEEEEE--LLLL--------HHHHHHHHHHHHHHHHHLLLLLLLeEEELLL-


DSSP  lhHHHHHHHHHHHhlLLLLLEEElllllllLLLLhhhHHHHHHHHHHLLLEEELllllll
Query dpEWSAREIHRGAreLGFKGIQInshtqgrYLDEeffDPIFRALVEVDQPLYIHpatspd  195
ident             |                              |                
Sbjct lnAALVDFLCENA--DVITKVTL-----apEMVP---AEVISKLANAGIVVSAG------  177
DSSP  llLHHHHHHHHLH--HHEEEEEE-----lhHHLL---HHHHHHHHHHLLEEEEL------


DSSP  lllhhhhhhlllllllhhhhhHHHHhHHHHHhLHHHhlllLLEEELHHHHlhhhHHHHHH
Query smidpmleagldgaifgfgveTGMHlLRLITiGIFDkypsLQIMVGHMGEalpyWLYRLD  255
ident                           |       |           |             
Sbjct ---------------------HSNAtLKEAK-AGFR---aGITFATHLYN-ampYITGRE  211
DSSP  ---------------------LLLLlHHHHH-HHHH---hLEEEELLLLL-lllLLLLLL


DSSP  hhhhhhhhlllllllllllllhhhHHHHlEEEELlLLLL----HHHHHHHHHHHLhHHEE
Query ymhqagvrsqryermkplkktiegYLKSnVLVTNsGVAW----EPAIKFCQQVMGeDRVM  311
ident                                               |       | |   
Sbjct ----------------pglagailDEAD-IYCGI-IADGlhvdYANIRNAKRLKG-DKLC  252
DSSP  ----------------lhhhhhhhHLLL-LEEEE-ELLLllllHHHHHHHHHHHH-HHEE


DSSP  LLLLLL-LLLLHhhHHHHHLL----LLLHHHHHHHHLHHHHHHLLL--------------
Query YAMDYP-YQYVAdeVRAMDAM----DMSAQTKKKFFQTNAEKWFKL--------------  352
ident    |                                                        
Sbjct LVTDATsGSSLT-mIEGVRNLvehcGIALDEVLRMATLYPARAIGVekrlgtlaagkvan  311
DSSP  EELLLLlLLLLL-hHHHHHHHhhhhLLLHHHHHHHHLHHHHHHLLLllllllllllllll


DSSP  -----------------------
Query -----------------------  352
ident                        
Sbjct ltaftpdfkitktivngnevvtq  334
DSSP  eeeellllleeeeeelleeeeel


No 24: Query=4qrnA Sbjct=2y1hB Z-score=14.5

back to top
DSSP  llllllllllllLLLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqGYLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident             |                                               
Sbjct ------------GVGLVDCHCHLSA-----------------------------------   13
DSSP  ------------LLLEEEEEELLLL-----------------------------------


DSSP  hhhhHHHHllLHHHHHHHHHLLLLEEEEEELlllllllllhhhhhhhhHHHHHHHHHHHH
Query tqilERLLdlGERRIADMDATGIDKAILALTspgvqplhdldeartlaTRANDTLADACQ  120
ident                                                             
Sbjct ----PDFDrdLDDVLEKAKKANVVALVAVAE----------------hSGEFEKIMQLSE   53
DSSP  ----HHHLllHHHHHHHHHHLLEEEEEELLL----------------lHHHHHHHHHHHH


DSSP  HLLLLEEELLLL-----------lLLLHHHHHHHHHHHHHllLLLLE-EELLL-------
Query KYPDRFIGMGTV-----------aPQDPEWSAREIHRGARelGFKGI-QINSH-------  161
ident  |         |              |       |           |             
Sbjct RYNGFVLPCLGVhpvqgldqrsvtLKDLDVALPIIENYKD--RLLAIgEVGLDfsprfag  111
DSSP  HLLLLEEEEELLlleelllleellHHHHHHHHHHHHHHLL--LLLEEeEEEEElllllll


DSSP  --lLLLLLLLhhhHHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhhhhhHHH
Query --tQGRYLDEeffDPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgfgveTGM  219
ident    |                     |   |                              
Sbjct tgeQKEEQRQ-vlIRQIQLAKRLNLPVNVH---------------------------SRS  143
DSSP  lhhHHHHHHH-hhHHHHHHHHHHLLLEEEE---------------------------EEL


DSSP  HHHHHHhhLHHHHLLLLLEEELHhHHLHHHHhhhhhhhhhhhhhlllllllllllllhHH
Query HLLRLItiGIFDKYPSLQIMVGHmGEALPYWlyrldymhqagvrsqryermkplkktiEG  279
ident      |                      |                               
Sbjct AGRPTI--NLLQEQGAEKVLLHA-FDGRPSV--------------------------aME  174
DSSP  LHHHHH--HHHHHLLLLLEEEEL-LLLLHHH--------------------------hHH


DSSP  HHHHLEEEELLLLLL-hhHHHHHHHHHLHHHEELLLLLLL--------LLLHhhHHHHH-
Query YLKSNVLVTNSGVAW-epAIKFCQQVMGEDRVMYAMDYPY--------QYVAdeVRAMD-  329
ident                                     | |                     
Sbjct GVRAGYFFSIPPSIIrsgQKQKLVKQLPLTSICLETDSPAlgpekqvrNEPWniSISAEy  234
DSSP  HHHLLLEEEELHHHHllhHHHHHHHHLLHHHEEELLLLLLllllllllLLHHhhHHHHHh


DSSP  ---lLLLL-HHHHHHHhLHHHHHHLLL-----
Query ---aMDMS-AQTKKKFfQTNAEKWFKL-----  352
ident        |           || | |       
Sbjct iaqvKGISvEEVIEVT-TQNALKLFPKlrhll  265
DSSP  hhhhHLLLhHHHHHHH-HHHHHHHLLLhhhhl


No 25: Query=4qrnA Sbjct=3giqA Z-score=14.2

back to top
DSSP  ------------------------------------------llllllllllLLLLLLEE
Query ------------------------------------------smtqdlktggEQGYLRIA   18
ident                                                           | 
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkIVAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeellllEEEELEEE


DSSP  EEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhHHLL--LHHHhH
Query TEEAFatreiidvylrmirdgtadkgmvslwgfyaqspseratqilerLLDL--GERRiA   76
ident                                                  |          
Sbjct VHGHD-------------------------------------------DLMFveKPDL-R   76
DSSP  LLLLL-------------------------------------------LLHHhhLLLL-H


DSSP  HHHHLLLLEEEEEeLLLL---lllLLLHH------hhhhhhHHHHHHHHHHHH--HLLLL
Query DMDATGIDKAILAlTSPG---vqpLHDLD------eartlaTRANDTLADACQ--KYPDR  125
ident      ||                 |                         |         
Sbjct WKTSQGITTVVVG-NCGVsaapapLPGNTaaalallgetplFADVPAYFAALDaqRPMIN  135
DSSP  HHHLLLEEEEEEL-LLLLllllllLLLLLlhhhhhhlllllLLLHHHHHHHHHhlLLLLE


DSSP  EEELLL--LLLL-------------LHHHHHHHHHHHHHlLLLLLEEELLL--LLLLLll
Query FIGMGT--VAPQ-------------DPEWSAREIHRGAReLGFKGIQINSH--TQGRYld  168
ident                                          |  |               
Sbjct VAALVGhaNLRLaamrdpqaaptaaEQQAMQDMLQAALE-AGAVGFSTGLAyqPGAVA--  192
DSSP  EEEEEEhhHHHHhhlllllllllhhHHHHHHHHHHHHHH-HLLLEEEEELLllLHHHL--


DSSP  LHHH-HHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhHHHH-hHHHHHHHHh
Query EEFF-DPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgFGVE-tGMHLLRLIt  226
ident          |   |       |                                      
Sbjct QAAElEGLARVAAERRRLHTSHI---------------------rNEADgvEAAVEEVL-  230
DSSP  LHHHhHHHHHHHHHLLLEEEEEL---------------------lLLLLlhHHHHHHHH-


DSSP  hLHHHHLlLLLEEELhHHHL-------hHHHHhhhhhhhhhhhhlllllllllllllHHH
Query iGIFDKYpSLQIMVGhMGEA-------lPYWLyrldymhqagvrsqryermkplkktIEG  279
ident   |          |                                           |  
Sbjct -AIGRGT-GCATVVS-HHKCmmpqnwgrSRAT----------------------lanIDR  265
DSSP  -HHHHHH-LLEEEEL-LLLLllhhhlllHHHH----------------------hhhHHH


DSSP  HHH--HLEEEELlLLLL-------------------------------------------
Query YLK--SNVLVTNsGVAW-------------------------------------------  294
ident        |                                                    
Sbjct AREqgVEVALDI-YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcd  324
DSSP  HHHllLLEEEEE-LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlll


DSSP  -------------------HHHHHHHHHhhlHHHEELLLLLLL-------LLLHhHHHHH
Query -------------------EPAIKFCQQvmgEDRVMYAMDYPY-------QYVAdEVRAM  328
ident                    |   |   |       |   |                    
Sbjct kttaarrlapagaiyfamdEDEVKRIFQ---HPCCMVGSDGLPndarphpRLWG-SFTRV  380
DSSP  hhhhhhhhlleeeeeelllHHHHHHHHH---LLLEEELLLLLLlllllllHHHH-HHHHH


DSSP  HLL------LLLHHHHHHHHLHHHHHHLLL------------------------------
Query DAM------DMSAQTKKKFFQTNAEKWFKL------------------------------  352
ident           |                |                                
Sbjct LGRyvrearLMTLEQAVARMTALPARVFGFaergvlqpgawadvvvfdpdtvadratwde  440
DSSP  HHHhhhhllLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeelllllllllllll


DSSP  -----------------------------------
Query -----------------------------------  352
ident                                    
Sbjct ptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  llllllleeeeeelleeeellllllllllllllll


No 26: Query=4qrnA Sbjct=2ob3A Z-score=14.1

back to top
DSSP  -llllllllllllllLLEEEEEE--ELLHHHHHHHhhhhhhllllhhhhhhhhhhhhlll
Query -smtqdlktggeqgyLRIATEEA--FATREIIDVYlrmirdgtadkgmvslwgfyaqsps   57
ident                    | |                                      
Sbjct drintvrgpitiseaGFTLTHEHicGSSAGFLRAW-------------------------   35
DSSP  lleeelleeelhhhhLLEEEEELleELLLLHHHHL-------------------------


DSSP  hhhhhhhhhhhllLHHHHHHHHHLL---LLEEEEEEllllllllllhhhhhhhHHHHhhH
Query eratqilerlldlGERRIADMDATG---IDKAILALtspgvqplhdldeartlATRAndT  114
ident               |                                             
Sbjct ---peffgsrkalAEKAVRGLRRARaagVRTIVDVS-----------------TFDI-gR   74
DSSP  ---hhhhllhhhhHHHHHHHHHHHHhllLLEEEELL-----------------LHHH-lL


DSSP  HHHHHHHLL----LLEEELLLL--------llLLHHHHHHHHHHHHHLL------LLLLE
Query LADACQKYP----DRFIGMGTV--------apQDPEWSAREIHRGAREL------GFKGI  156
ident                                    |       |               |
Sbjct DVSLLAEVSraadVHIVAATGLwfdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGII  134
DSSP  LHHHHHHHHhhhlLEEELEEELlllllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEE


DSSP  EELLL--LLLLLLllhhhHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhHH
Query QINSH--TQGRYLdeeffDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgFG  214
ident                       ||      |   |                         
Sbjct XVATTgkATPFQE--lvlKAAARASLATGVPVTTHT----------------------AA  170
DSSP  EEELLllLLHHHH--hhhHHHHHHHHHHLLLEEEEL----------------------LH


DSSP  HHhhHHHHHHHhHLHHHHLLLL-LEEELHHHHLHHHHHhhhhhhhhhhhhllllllllll
Query VEtgMHLLRLItIGIFDKYPSL-QIMVGHMGEALPYWLyrldymhqagvrsqryermkpl  273
ident                     |      ||                               
Sbjct SQ--RDGEQQA-AIFESEGLSPsRVCIGHSDDTDDLSY----------------------  205
DSSP  HH--LHHHHHH-HHHHHLLLLHhHEEELLHHHLLLHHH----------------------


DSSP  lllhHHHHHHLEEEELLLLL-----------------------LHHHHHHHHHHHLHHHE
Query kktiEGYLKSNVLVTNSGVA-----------------------WEPAIKFCQQVMGEDRV  310
ident             |                                  ||           
Sbjct ---lTALAARGYLIGLDHIPysaiglednasasallgirswqtRALLIKALIDQGYMKQI  262
DSSP  ---hHHHHHLLLEEEELLLLlllllllllhhhhhhhllllhhhHHHHHHHHHHLLLHHHE


DSSP  ELLLLLL------------------llLLHHHHHHHHLL----LLLHHHHHHHHLHHHHH
Query MYAMDYP------------------yqYVADEVRAMDAM----DMSAQTKKKFFQTNAEK  348
ident     |                        |                  |      ||   
Sbjct LVSNDWTfgfssyvtnimdvmdrvnpdGMAFIPLRVIPFlrekGVPQETLAGITVTNPAR  322
DSSP  EELLLLLleellllllhhhhhhhhlllHHHHHHHLHHHHhhhlLLLHHHHHHHHLHHHHH


DSSP  HLL---l
Query WFK---l  352
ident        
Sbjct FLSptlr  329
DSSP  HHLllll


No 27: Query=4qrnA Sbjct=2pajA Z-score=14.1

back to top
DSSP  -----------------------------------------------llllllllllLLL
Query -----------------------------------------------smtqdlktggEQG   13
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcVIY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeellllEEE


DSSP  LLLEEEEEEEL------lhHHHHHhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhh
Query YLRIATEEAFA------trEIIDVylrmirdgtadkgmvslwgfyaqspseratqilerl   67
ident      |                                                      
Sbjct PAWVNTHHHLFqsllkgepFRALF------------------------------derrfr   90
DSSP  ELEELLLLLHHhhhlllllLHHHL------------------------------lhhhhh


DSSP  HLLLhHHHHHHHHLLLLEEEEEELlllllllllhhhHHHHhhHHHHHHHHHHHHLLLLEE
Query LDLGeRRIADMDATGIDKAILALTspgvqplhdldeARTLatRANDTLADACQKYPDRFI  127
ident |             |                                |     |   || 
Sbjct LAAR-IGLIELARSGCATVADHNY----------vyYPGMpfDSSAILFEEAEKLGLRFV  139
DSSP  HHHH-HHHHHHHLLLEEEEEELLL----------llLLLLllLHHHHHHHHHHHLLLEEE


DSSP  ELLLLLLL---------------LHHHHHHHHHHHHHLLL--------LLLEEE-LLLLl
Query GMGTVAPQ---------------DPEWSAREIHRGARELG--------FKGIQI-NSHTq  163
ident      | |                       | | |                        
Sbjct LLRGGATQtrqleadlptalrpeTLDAYVADIERLAARYHdaspramrRVVMAPtTVLY-  198
DSSP  EEELLLLLlllllllllhhhlllLHHHHHHHHHHHHHHLLllllllleEEEELLlLLLL-


DSSP  llLLLLhHHHHHHHHHHHHLLLEEELLLlllllllhhhhhhlllllllhhhhhhhHHHHH
Query grYLDEeFFDPIFRALVEVDQPLYIHPAtspdsmidpmleagldgaifgfgvetgMHLLR  223
ident                          |                                  
Sbjct -sISPR-EMRETAAVARRLGLRMHSHLS-------------------------gkSPVAF  231
DSSP  -lLLHH-HHHHHHHHHHHLLLEEEEELL-------------------------llLHHHH


DSSP  HHHHlhhhhllllLEEELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-
Query LITIgifdkypslQIMVGHmGEALPYWLyrldymhqagvrsqryermkplkktiEGYLK-  282
ident                   |                                      |  
Sbjct CGEH----dwlgsDVWYAH-LVKVDADE--------------------------IALLAq  260
DSSP  HHHL----lllllLEEEEL-LLLLLHHH--------------------------HHHHHh


DSSP  HLEEEELL--LLLLhhHHHHHHHHHLhhHEELLLLLL-LLLL---HHHHHHHHLLL----
Query SNVLVTNS--GVAWepAIKFCQQVMGedRVMYAMDYP-YQYV---ADEVRAMDAMD----  332
ident     |                        |    |            ||           
Sbjct TGTGVAHCpqSNGR-lPVREMADAGV--PVSIGVDGAaSNEAadmISEVHMTWLAQrarl  317
DSSP  HLLEEEELhhHHHL-lLLLLHHHHLL--LEEELLLHHhHLLLllhHHHHHHHHHHHhhll


DSSP  LLHHHHHHHHLHHHHHHLLL----------------------------------------
Query MSAQTKKKFFQTNAEKWFKL----------------------------------------  352
ident  |                 |                                        
Sbjct ASIAEVIHWGTAGGARVMGLdevgkvavgyaadiavyrlddpryfglhdpaigpvasggr  377
DSSP  LLHHHHHHHHLHHHHHHHLLllllllllllllleeeeelllhhhlllllhhhhhhhllll


DSSP  --------------------------------------------
Query --------------------------------------------  352
ident                                             
Sbjct psvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  leeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 28: Query=4qrnA Sbjct=3e74A Z-score=14.1

back to top
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE
Query --------------------------------------smtqdlktggEQGYLRIATEEA   22
ident                                                             
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEELEEEEEEL


DSSP  EllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhhlLLHHHHHHHHHLL
Query FatreiidvylrmirdgtadkgmvslwgfyaqspseratqilerlldLGERRIADMDATG   82
ident                                                  |         |
Sbjct I----------------------------------------------GYETGTRAAAKGG   74
DSSP  L----------------------------------------------LHHHHHHHHHHLL


DSSP  LLEEEEEELLllllllllhhhhhhhhHHHH---HHHHHHHHHL----lLLEEELLLLLLl
Query IDKAILALTSpgvqplhdldeartlaTRAN---DTLADACQKY----pDRFIGMGTVAPq  135
ident |   |                       |                         |     
Sbjct ITTXIEXPLN---------------qLPATvdrASIELKFDAAkgkltIDAAQLGGLVS-  118
DSSP  EEEEEELLLL---------------lLLLLllhHHHHHHHHHHlllllLEEEELEELLL-


DSSP  lhhHHHHHHHHHHHlLLLLLEEELLllllllllLHHH-HHHHHHHHHHLLLEEELLLLLL
Query dpeWSAREIHRGAReLGFKGIQINShtqgryldEEFF-DPIFRALVEVDQPLYIHPATSP  194
ident          |      |  |                        | |  ||   |     
Sbjct ---YNIDRLHELDE-VGVVGFXCFV-----rdvNDWQfFKGAQKLGELGQPVLVHCENAL  169
DSSP  ---LLLLLHHHHHH-HLLLLEEEEL-----lllLHHHhHHHHHHHHHHLLLEEEELLLHH


DSSP  LlLLHHHHHH-----------LLLLlllhhHHHHHHHHHHHHhhLHHHHLlLLLEEELHH
Query DsMIDPMLEA-----------GLDGaifgfGVETGMHLLRLItiGIFDKYpSLQIMVGHM  243
ident         ||                             |                | | 
Sbjct I-CDELGEEAkregrvtahdyVASR----pVFTEVEAIRRVL--YLAKVA-GCRLHVCHV  221
DSSP  H-HHHHHHHHhhhllllhhhhHHLL----lHHHHHHHHHHHH--HHHHHH-LLLEEELLL


DSSP  HH-LHHHhhhhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL-----
Query GE-ALPYwlyrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW-----  294
ident                                                             
Sbjct SSpEGVE--------------------------evTRARQegQDITCESCpHYFVldtdq  255
DSSP  LLhHHHH--------------------------hhHHHHHllLLEEEEELlHHHHllhhh


DSSP  -------------------hHHHHHHHHHHLhhHEELLLLLL----------------LL
Query -------------------ePAIKFCQQVMGedRVMYAMDYP----------------YQ  319
ident                                        |                    
Sbjct feeigtlakcsppirdlenqKGXWEKLFNGE--IDCLVSDHSpcppexkagnixkawgGI  313
DSSP  hhhhlhhhllllllllhhhhHHHHHHHHLLL--LLEELLLLLllllllllllllllllLL


DSSP  LL-HHHHHHHHLL-----LLLHHHHHHHHLHHHHHHLLL---------------------
Query YV-ADEVRAMDAM-----DMSAQTKKKFFQTNAEKWFKL---------------------  352
ident                     |     |   |||   | |                     
Sbjct AGlQSCXDVXFDEavqkrGXSLPXFGKLXATNAADIFGLqqkgriapgkdadfvfiqpns  373
DSSP  LLhHHHHHHHHHHhllllLLLHHHHHHHHLHHHHHHLLLllllllllllllleeeeelll


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  352
ident                                                         
Sbjct syvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  leellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 29: Query=4qrnA Sbjct=1k6wA Z-score=14.0

back to top
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE
Query --------------------------------------smtqdlktggEQGYLRIATEEA   22
ident                                                             
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqgLVIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeellllEEELLEEEEEEL


DSSP  ELLhhhhhhhhhhhhhllllhHHHHHHHHHHHLllhhhhhhhhhhHLLLhHHHHHHHHLL
Query FATreiidvylrmirdgtadkGMVSLWGFYAQSpseratqilerlLDLGeRRIADMDATG   82
ident   |                           |                          | |
Sbjct LDT-----tqtagqpnwnqsgTLFEGIERWAER--kallthddvkQRAW-QTLKWQIANG  112
DSSP  LLL-----lllllllllllllLHHHHHHHHHLL--hhhllhhhhhHHHH-HHHHHHHHLL


DSSP  LLEEEEEEllllllllllhhhhHHHHhHHHHHHHHHHHHLL--LLEEELLLL---LLLLh
Query IDKAILALtspgvqplhdldeaRTLAtRANDTLADACQKYP--DRFIGMGTV---APQDp  137
ident |                           |        |                      
Sbjct IQHVRTHV-----------dvsDATL-TALKAMLEVKQEVApwIDLQIVAFPqegILSY-  159
DSSP  EEEEEEEE-----------ellLLLL-HHHHHHHHHHHHHLllLEEEEEEELlllLLLL-


DSSP  HHHHHHHHHHHHLlLLLLEEELL-LLLL-LLLLLhhhHHHHHHHHHHLLLEEELllllll
Query EWSAREIHRGARElGFKGIQINS-HTQG-RYLDEeffDPIFRALVEVDQPLYIHpatspd  195
ident            |  |               |  |      |      |     |      
Sbjct PNGEALLEEALRL-GADVVGAIPhFEFTrEYGVE-slHKTFALAQKYDRLIDVH------  211
DSSP  LLHHHHHHHHHHL-LLLEEEELHhHLLLhHHHHH-hhHHHHHHHHHHLLEEEEE------


DSSP  lllhhhhhhlllllllhHHHH-hHHHHHHhhhhLHHHHLLLL-LEEELHhHHLHHHHHHH
Query smidpmleagldgaifgFGVE-tGMHLLRlitiGIFDKYPSL-QIMVGHmGEALPYWLYR  253
ident                                                 |   |       
Sbjct ---------------cdEIDDeqSRFVET--vaALAHHEGMGaRVTASH-TTAMHSYNGA  253
DSSP  ---------------elLLLLllLLHHHH--hhHHHHHHLLHhHEEEEE-LHHHHHLLHH


DSSP  HHhhhhhhhhllllllllllllLHHHHHH-HLEEEELLLL---------------llhhH
Query LDymhqagvrsqryermkplkkTIEGYLK-SNVLVTNSGV---------------awepA  297
ident                            || |                             
Sbjct YT-------------------sRLFRLLKmSGINFVANPLvnihlqgrfdtypkrrgitR  294
DSSP  HH-------------------hHHHHHHHhHLLEEEELHHhhhhhllllllllllllllL


DSSP  HHHHHHHHLhhHEELLLLLLL-------lLLHHHHHHH-------hllLLLHhHHHHHHL
Query IKFCQQVMGedRVMYAMDYPY-------qYVADEVRAM-------damDMSAqTKKKFFQ  343
ident  |          |    |                |  |                      
Sbjct VKEMLESGI--NVCFGHDDVFdpwyplgtANMLQVLHMglhvcqlmgyGQIN-DGLNLIT  351
DSSP  HHHHHHLLL--LEEELLLLLLllllllllLLHHHHHHHhhhhlllllhHHHH-HHHHHHL


DSSP  HHHHHHLLL---------------------------------------------------
Query TNAEKWFKL---------------------------------------------------  352
ident         |                                                   
Sbjct HHSARTLNLqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttv  411
DSSP  HHHHHHLLLlllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleee


DSSP  ------------
Query ------------  352
ident             
Sbjct yleqpeaidykr  423
DSSP  ellleeeellll


No 30: Query=4qrnA Sbjct=3ls9A Z-score=13.9

back to top
DSSP  -------------------------------------------llllllllllLLLLLLE
Query -------------------------------------------smtqdlktggEQGYLRI   17
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmIALPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleEEEELEE


DSSP  EEEEEELlhhhhhhhhhhhhhllllHHHHHHHhHHHHL----llhhhhhhhhhhHLLLhH
Query ATEEAFAtreiidvylrmirdgtadKGMVSLWgFYAQS----pseratqilerlLDLGeR   73
ident                               |                             
Sbjct NSHQHLY-----egamraipqlervTMASWLE-GVLTRsagwwrdgkfgpdvirEVAR-A  113
DSSP  EEEELHH-----hhhhlllhhhlllLHHHHHH-HHHHHhhhhhhlllllhhhhhHHHH-H


DSSP  HHHHHHHLLLLEEEEEEllLLLLllllhhHHHHHhhHHHHHHHHHHHHLLLLEEELLLLL
Query RIADMDATGIDKAILALtsPGVQplhdldEARTLatRANDTLADACQKYPDRFIGMGTVA  133
ident         ||                    |        |    |      ||       
Sbjct VLLESLLGGITTVADQH--LFFP------GATAD--SYIDATIEAATDLGIRFHAARSSM  163
DSSP  HHHHHHHLLEEEEEEEE--LLLL------LLLLL--LHHHHHHHHHHHHLLEEEEEELLL


DSSP  L--------------LLHHHHHHHHHHHHHLLL--------LLLEEELLLlllllllLHH
Query P--------------QDPEWSAREIHRGARELG--------FKGIQINSHtqgryldEEF  171
ident                                                             
Sbjct TlgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvRIALGPCGV----pydKPE  219
DSSP  LllhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleEEEELLLLL----lllLHH


DSSP  H-HHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhHHHH-------hhhhHHH
Query F-DPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgFGVE-------tgmhLLR  223
ident             |  |  |                                        |
Sbjct LfEAFAQMAADYDVRLHTH---------------------fyEPLDagmsdhlygmtPWR  258
DSSP  HhHHHHHHHHHHLLEEEEE---------------------elLLLHhhhhhhhhlllHHH


DSSP  HHHHLHHhhllLLLEEELhHHHLhhHHHHhhhhhhhhhhhlllllllllllllHHHHHH-
Query LITIGIFdkypSLQIMVGhMGEAlpYWLYrldymhqagvrsqryermkplkktIEGYLK-  282
ident            |                                                
Sbjct FLEKHGW---aSDRVWLA-HAVV--PPRE------------------------EIPEFAd  288
DSSP  HHHHLLL---lLLLEEEE-ELLL--LLHH------------------------HHHHHHh


DSSP  HLEEEELLLL------llhhHHHHHHHHHLhhHEELLLLLL-LLLL---HHHHHHHHL--
Query SNVLVTNSGV------awepAIKFCQQVMGedRVMYAMDYP-YQYV---ADEVRAMDA--  330
ident   |                  |           |                   |      
Sbjct AGVAIAHLIApdlrmgwglaPIREYLDAGI--TVGFGTTGSaSNDGgnlLGDLRLAALah  346
DSSP  HLLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLlLLLLllhHHHHHHHHHhl


DSSP  ---------lLLLHHHHHHHHLHHHHHHLLL-----------------------------
Query ---------mDMSAQTKKKFFQTNAEKWFKL-----------------------------  352
ident             ||                                              
Sbjct rpadpnepekWLSARELLRMATRGSAECLGRpdlgvleegraadiacwrldgvdrvgvhd  406
DSSP  hhhllllhhhLLLHHHHHHHLLHHHHHHLLLllllllllllllleeeeelllhhhlllll


DSSP  -----------------------------------------------
Query -----------------------------------------------  352
ident                                                
Sbjct paiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  hhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 31: Query=4qrnA Sbjct=1j6pA Z-score=13.7

back to top
DSSP  -------------------------------------llllllllllLLLLLLEEEEEEE
Query -------------------------------------smtqdlktggEQGYLRIATEEAF   23
ident                                                        |    
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgkLVXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleEEEELEEEEEELH


DSSP  LlhhhhhhhhhhhhhlllLHHH-HHHHHHHHHlllhhhhhhhhhhHLLLhHHHHHHHHLL
Query AtreiidvylrmirdgtaDKGM-VSLWGFYAQspseratqilerlLDLGeRRIADMDATG   82
ident                                                            |
Sbjct P----xtllrgvaedlsfEEWLfSKVLPIEDR------ltekxayYGTI-LAQXEXARHG  109
DSSP  H----hhhhllllllllhHHHHhLLHHHHHLL------llhhhhhHHHH-HHHHHHHLLL


DSSP  LLEEEEEEllllllllllhhhhhhhhhhHHHHHHHHHHHLLLLEEELLLLLLL--LHHHH
Query IDKAILALtspgvqplhdldeartlatrANDTLADACQKYPDRFIGMGTVAPQ--DPEWS  140
ident |                                | |      |            |    
Sbjct IAGFVDXY-------------------fHEEWIAKAVRDFGXRALLTRGLVDSngDDGGR  150
DSSP  EEEEEEEE-------------------lLHHHHHHHHHHHLLEEEEEEEELLLllLLLLH


DSSP  HHHHHHHHHLLL------LLLEEE-LLLLllllllLHHH-HHHHHHHHHHLLLEEELLll
Query AREIHRGARELG------FKGIQI-NSHTqgryldEEFF-DPIFRALVEVDQPLYIHPat  192
ident   |      |        | |               |      |        |  ||   
Sbjct LEENLKLYNEWNgfegriFVGFGPhSPYL-----cSEEYlKRVFDTAKSLNAPVTIHL--  203
DSSP  HHHHHHHHHHHLlhhhleEEEEEElLLLL-----lLHHHhHHHHHHHHHHLLLEEEEE--


DSSP  llllllhhhhhhlllllllhHHHHhhHHHHHHHhHLHHhhlLLLLEEELHhHHLHHHHHh
Query spdsmidpmleagldgaifgFGVEtgMHLLRLItIGIFdkyPSLQIMVGHmGEALPYWLy  252
ident                        |    |                    |    ||    
Sbjct ------------------yeTSKE-eYDLEDIL-NIGL---KEVKTIAAH-CVHLPERY-  238
DSSP  ------------------llLLLL-lLLLHHHH-LLLL---LLLLEEEEE-LLLLLHHH-


DSSP  hhhhhhhhhhhlllllllllllllhHHHHHHLEEEELLLL------llhhHHHHHHHHHL
Query rldymhqagvrsqryermkplkktiEGYLKSNVLVTNSGV------awepAIKFCQQVMG  306
ident                                   |                         
Sbjct ------------------------fGVLKDIPFFVSHNPAsnlklgngiaPVQRXIEHGX  274
DSSP  ------------------------hHHHLLLLEEEEELHHhhhhllllllLHHHHHHLLL


DSSP  hhHEELLLLLL-LLLL---HHHHHHHHLL-------LLLHHHHHHHHLHHHHHHLLL---
Query edRVMYAMDYP-YQYV---ADEVRAMDAM-------DMSAQTKKKFFQTNAEKWFKL---  352
ident    |    |            | |                 |  |               
Sbjct --KVTLGTDGAaSNNSlnlFFEXRLASLLqkaqnprNLDVNTCLKXVTYDGAQAXGFksg  332
DSSP  --EEEELLLLLlLLLLllhHHHHHHHHHHhhlllllLLLHHHHHHHHLHHHHHHHLLlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct kieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidse  392
DSSP  llllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhh


DSSP  ---------------
Query ---------------  352
ident                
Sbjct evkrelariekelys  407
DSSP  hhhhhhhhhhhhhhl


No 32: Query=4qrnA Sbjct=2vc5A Z-score=13.6

back to top
DSSP  --llllllllllllllLLEEEEEE-ELLHhHHHHHHHhhhhllllhhhhhhhhhhhhlll
Query --smtqdlktggeqgyLRIATEEA-FATReIIDVYLRmirdgtadkgmvslwgfyaqsps   57
ident                       |                                     
Sbjct mriplvgkdsieskdiGFTLIHEHlRVFS-EAVRQQW-----------------------   36
DSSP  llllllllllllhhhlLLEELLLLlLLLL-HHHHHHL-----------------------


DSSP  hhhhhhhhhhhllLHHHHHHHHHLL---LLEEEEEEllllllllllhhhhhhhhhhHHHH
Query eratqilerlldlGERRIADMDATG---IDKAILALtspgvqplhdldeartlatrANDT  114
ident                                                           | 
Sbjct ----phlynedeeFRNAVNEVKRAMqfgVKTIVDPT----------------vmglGRDI   76
DSSP  ----hhhllhhhhHHHHHHHHHHHHhllLLEEEELL----------------llllLLLH


DSSP  hhHHHHHLL----LLEEELLLL----------llLLHHHHHHHHHHHHHLL------LLL
Query laDACQKYP----DRFIGMGTV----------apQDPEWSAREIHRGAREL------GFK  154
ident       |                                 |        |          
Sbjct --RFMEKVVkatgINLVAGTGIyiyidlpfyflnRSIDEIADLFIHDIKEGiqgtlnKAG  134
DSSP  --HHHHHHHhlllLEEEELEELlllllllhhhllLLHHHHHHHHHHHHHLLllllllLLL


DSSP  LEEELL---LLLLLLLllhhhHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllll
Query GIQINS---HTQGRYLdeeffDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaif  211
ident    |                      |  |   |   |                      
Sbjct FVXIAAdepGITKDVE--kviRAAAIANKETKVPIITHS---------------------  171
DSSP  LEEEELlllLLLHHHH--hhhHHHHHHHHHHLLLEEEEL---------------------


DSSP  hHHHHhhHHHHHHHHhLHHHHLLLL-LEEELHHHHLhHHHHhhhhhhhhhhhhlllllll
Query gFGVEtgMHLLRLITiGIFDKYPSL-QIMVGHMGEAlPYWLyrldymhqagvrsqryerm  270
ident           |                |  || |                          
Sbjct -NAHN--NTGLEQQR-ILTEEGVDPgKILIGHLGDTdNIDY-------------------  208
DSSP  -LLLL--LHHHHHHH-HHHHLLLLHhHEEELLHHHLlLHHH-------------------


DSSP  llllllhhhHHHHLEEEELLLL---------lLHHHHHHHHHHHLHHHEELLLLLL----
Query kplkktiegYLKSNVLVTNSGV---------aWEPAIKFCQQVMGEDRVMYAMDYP----  317
ident                                               |  |   ||     
Sbjct ------ikkIADKGSFIGLDRYgldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctid  262
DSSP  ------hhhHHHLLLEEEELLLlllllllhhhHHHHHHHHHHLLLLLLEEELLLLLllll


DSSP  --------------lLLLHHHHHHHHLLL----LLHHHHHHHHLHHHHHHLLl
Query --------------yQYVADEVRAMDAMD----MSAQTKKKFFQTNAEKWFKl  352
ident                                           |  |  | |  
Sbjct wgtakpeykpklaprWSITLIFEDTIPFLkrngVNEEVIATIFKENPKKFFS-  314
DSSP  lllllhhhhhhhlllLLLLHHHHLHHHHHhlllLLHHHHHHHHLHHHHHHLL-


No 33: Query=4qrnA Sbjct=1a4mA Z-score=13.5

back to top
DSSP  lllllllllllLLLLLEEEEEEEL----------------------lhhhhhhhhhhhhh
Query smtqdlktggeQGYLRIATEEAFA----------------------treiidvylrmird   38
ident                                                             
Sbjct --------tpaFNKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkp   52
DSSP  --------lllLLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllll


DSSP  lllLHHHhHHHHHHHHlllhhhhhhhhhhhLLLHhHHHHHHHLLLLEEEEEEllllllll
Query gtaDKGMvSLWGFYAQspseratqilerllDLGErRIADMDATGIDKAILALtspgvqpl   98
ident              |                   |         |                
Sbjct lslPGFL-AKFDYYMP---viagcreaikrIAYE-FVEMKAKEGVVYVEVRYsphllans  107
DSSP  llhHHHH-LLHHHHHH---hhlllhhhhhhHHHH-HHHHHHHLLEEEEEEEEllhhhlll


DSSP  lLHHH------hhHHHHHHHHHHHHHHHHLL----LLEEELLLL---LLLLHHHHHHHHH
Query hDLDE------arTLATRANDTLADACQKYP----DRFIGMGTV---APQDPEWSAREIH  145
ident                     |      |                    |           
Sbjct kVDPMpwnqtegdVTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrhQPSWSLEVLELCK  167
DSSP  lLLLLhhhlllllLLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEellLHHHHHHHHHHHH


DSSP  HHHHlLLLLLEEELLL-lLLLLLLLHHHHHHHHHHHHHLLLEEELlllllllllhhhhhh
Query RGAReLGFKGIQINSH-tQGRYLDEEFFDPIFRALVEVDQPLYIHpatspdsmidpmlea  204
ident                                    |        |               
Sbjct KYNQ-KTVVAMDLAGDetIEGSSLFPGHVEAYEGAVKNGIHRTVH---------------  211
DSSP  HLLL-LLEEEEEEELLllLLLHHHLHHHHHHHHHHHHHLLEEEEE---------------


DSSP  lllllllhHHHHhHHHHHHHHHhlhhhhlllLLEEELHhHHLHhHHHHHHhhhhhhhhhl
Query gldgaifgFGVEtGMHLLRLITigifdkypsLQIMVGHmGEALpYWLYRLdymhqagvrs  264
ident                                    ||| |         |          
Sbjct ------agEVGS-PEVVREAVD-------ilKTERVGH-GYHT-IEDEAL----------  245
DSSP  ------elLLLL-HHHHHHHHH-------llLLLEEEE-LHHH-HHLHHH----------


DSSP  llllllllllllhHHHHHHlEEEELLLL----------llhHHHHHHHHHhlHHHEELLL
Query qryermkplkktiEGYLKSnVLVTNSGV----------awePAIKFCQQVmgEDRVMYAM  314
ident                 ||                        |                 
Sbjct ------------yNRLLKEnMHFEVCPWssyltgawdpkttHAVVRFKND--KANYSLNT  291
DSSP  ------------hHHHHHLlLEEEELHHhhhhlllllllllLHHHHHHHL--LLLEEELL


DSSP  LLLL---LLLHHHHHHHHL-LLLLHHHHHHHhLHHHHHHLLL-----------------
Query DYPY---QYVADEVRAMDA-MDMSAQTKKKFfQTNAEKWFKL-----------------  352
ident | |                 |       |     || |   |                 
Sbjct DDPLifkSTLDTDYQMTKKdMGFTEEEFKRL-NINAAKSSFLpeeekkellerlyreyq  349
DSSP  LLLLlllLLHHHHHHHHHHlLLLLHHHHHHH-HHHHHHLLLLlhhhhhhhhhhhhhhll


No 34: Query=4qrnA Sbjct=3nqbA Z-score=13.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ----llllllllllLLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhhhhhhhll
Query ----smtqdlktggEQGYLRIATEEAFAtreiidvylrmirdgtadkgmvslwgfyaqsp   56
ident                     | |                                     
Sbjct srrdaaqvidaggaYVSPGLIDTHXHIE--------------------------------   88
DSSP  lllleeeeeellllEEEELEEEEEELHH--------------------------------


DSSP  lhhhhhhhhHHHLLLhHHHHHHHHLLLLEEEEEELLllllllllhhhhHHHHHHHHHHHH
Query seratqileRLLDLGeRRIADMDATGIDKAILALTSpgvqplhdldeaRTLATRANDTLA  116
ident                    |   | |                                 |
Sbjct --------sSXITPA-AYAAAVVARGVTTIVWDPHE----------fgNVHGVDGVRWAA  129
DSSP  --------hHLLLHH-HHHHHHHLLLEEEEEELLHH----------hhHHHLHHHHHHHH


DSSP  HHHHHLLLLEEELLLLL------------lLLHHHHHHHHHHhhhlLLLLLEEELLLlll
Query DACQKYPDRFIGMGTVA------------pQDPEWSAREIHRgareLGFKGIQINSHtqg  164
ident  |    | | |                    |    |             ||        
Sbjct KAIENLPLRAILLAPSCvpsapglerggadFDAAILADLLSW----PEIGGIAEIXN--x  183
DSSP  HHHLLLLLEEEEEELLLlllllllllllllLLHHHHHHHHLL----LLEEEEEEELL--h


DSSP  LLLL-LHHH-HHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhhhhhHHHH-h
Query RYLD-EEFF-DPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgfgveTGMH-l  221
ident |           |  |          |                                 
Sbjct RGVIeRDPRxSGIVQAGLAAEKLVCGH---------------------------ARGLkn  216
DSSP  HHHHlLLHHhHHHHHHHHHHLLEEEEL---------------------------LLLLlh


DSSP  hHHHHhlHHHHlllLLEEELhhHHLHHHhhhhhhhhhhhhhhlllllllllllllhhHHH
Query lRLITigIFDKypsLQIMVGhmGEALPYwlyrldymhqagvrsqryermkplkktieGYL  281
ident   |                                                        |
Sbjct aDLNA--FXAA---GVSSDH--ELVSGE--------------------------dlxAKL  243
DSSP  hHHHH--HHHL---LLLEEL--LLLLHH--------------------------hhhHHH


DSSP  HHLEEEELL-LLLL-HHHHHHHHH--hhLHHHEELLLLLLL--LLLHH-----hHHHHHL
Query KSNVLVTNS-GVAW-EPAIKFCQQ--vmGEDRVMYAMDYPY--QYVAD-----eVRAMDA  330
ident                 |               |    |                ||    
Sbjct RAGLTIELRgSHDHlLPEFVAALNtlghLPQTVTLCTDDVFpdDLLQGgglddvVRRLVR  303
DSSP  HLLLEEEEElLLHHhHHHHHHHHHhhllLLLLEEEELLLLLhhHHHHLllhhhhHHHHHH


DSSP  LLLLHHHHHHHHLHHHHHHLLL--------------------------------------
Query MDMSAQTKKKFFQTNAEKWFKL--------------------------------------  352
ident               ||                                            
Sbjct YGLKPEWALRAATLNAAQRLGRsdlgliaagrradivvfedlngfsarhvlasgravaeg  363
DSSP  LLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllllleeeeeelleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct grxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkd  423
DSSP  leelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct gfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagd  483
DSSP  leellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct xalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvew  543
DSSP  hhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlll


DSSP  --------------------------------------------
Query --------------------------------------------  352
ident                                             
Sbjct qppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  llllllhhhhhlllllllllleelllleeelllleeellleeel


No 35: Query=4qrnA Sbjct=2imrA Z-score=13.1

back to top
DSSP  -----------------------------------------------LLLLllllllLLL
Query -----------------------------------------------SMTQdlktggEQG   13
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeRAGA------VIA   54
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeELLL------EEL


DSSP  LLLEEEEEE-ELLHHhhhhhhhhhhhllllhhhhHHHHHHhhllLHHHHHHHHHHH--LL
Query YLRIATEEA-FATREiidvylrmirdgtadkgmvSLWGFYaqspSERATQILERLL--DL   70
ident                                              |              
Sbjct PPPVNAHTHlDMSAY--------------efqalPYFQWI----PEVVIRGRHLRGvaAA   96
DSSP  LLLLEEEEElLLLHH--------------hhhhlHHHHLL----HHHHHHHLLLLHhhHH


DSSP  LHhHHHHHHHLLLLEEEEEEllllllllllhhhhhhhhhhHHHHHHHHHHhLLLLE-EEL
Query GErRIADMDATGIDKAILALtspgvqplhdldeartlatrANDTLADACQkYPDRF-IGM  129
ident            |                            |            |      
Sbjct QA-GADTLTRLGAGGVGDIV-------------------wAPEVMDALLA-REDLSgTLY  135
DSSP  HH-HHHHHHHLLLLLEEEEE-------------------lLHHHHHHHHL-LLLLLeEEE


DSSP  LLLLL-------LLHHHHHHHHHHHhHLLL----LLLEEELLLLllllllLHHH-HHHHH
Query GTVAP-------QDPEWSAREIHRGaRELG----FKGIQINSHTqgryldEEFF-DPIFR  177
ident   |                    |  | |       |                       
Sbjct FEVLNpfpdkadEVFAAARTHLERW-RRLErpglRLGLSPHTPF----tvSHRLmRLLSD  190
DSSP  EEELLllhhhhhHHHHHHHHHHHHH-HLLLllleEEEEEELLLL----llLHHHhHHHHH


DSSP  HHHHHLLLEEELL------lllllLLLHHHHHHL--------llllllhhhhhhhHHHHH
Query ALVEVDQPLYIHP------atspdSMIDPMLEAG--------ldgaifgfgvetgMHLLR  223
ident        || ||                |                               
Sbjct YAAGEGLPLQIHVaehptelemfrTGGGPLWDNRmpalyphtlaevigrepgpdlTPVRY  250
DSSP  HHHHHLLLLEEEElllhhhhhhhhHLLLLLHHHLlhhhllllhhhhhllllllllLHHHH


DSSP  HHHHLHHhhllLLLEEELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-
Query LITIGIFdkypSLQIMVGHmGEALPYWLyrldymhqagvrsqryermkplkktiEGYLK-  282
ident |   |             |                                         
Sbjct LDELGVL----AARPTLVH-MVNVTPDD--------------------------IARVAr  279
DSSP  HHHHLLH----HHLLEEEE-LLLLLHHH--------------------------HHHHHh


DSSP  HLEEEELLLL------llhhHHHHHHHHHLhhHEELLLLLL-LLLL---hHHHHHHHLL-
Query SNVLVTNSGV------awepAIKFCQQVMGedRVMYAMDYP-YQYV---aDEVRAMDAM-  331
ident     |                            |    |            ||       
Sbjct AGCAVVTCPRsnhhlecgtfDWPAFAAAGV--EVALGTDSVaSGETlnvrEEVTFARQLy  337
DSSP  HLLLEEELHHhhhhllllllLHHHHHHLLL--LEEELLLLHhHHLLlllhHHHHHHHHHl


DSSP  -LLLHHHHHHHHLHHHHHHLL---------------------l
Query -DMSAQTKKKFFQTNAEKWFK---------------------l  352
ident                                            
Sbjct pGLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  lLLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 36: Query=4qrnA Sbjct=3mtwA Z-score=12.9

back to top
DSSP  --------------------------------------------llllllllllLLLLLL
Query --------------------------------------------smtqdlktggEQGYLR   16
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvTLLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeEEEELE


DSSP  EEEEEEELlhhhhhhhhhhhhhllllhhhhhHHHHHHHLllhhhhhhhhhhHLLLhHHHH
Query IATEEAFAtreiidvylrmirdgtadkgmvsLWGFYAQSpseratqilerlLDLGeRRIA   76
ident |                                                           
Sbjct IDMHVHLD------------------slaevGGYNSLEY------sdrfwsVVQT-ANAK   95
DSSP  EEEEELLL------------------lllllLHHHHHHL------lhhhhhHHHH-HHHH


DSSP  HHHHLLLLEEEEEELlllllllllhhhhhhhhhhHHHHHHHHHHHLL------lLEEEL-
Query DMDATGIDKAILALTspgvqplhdldeartlatrANDTLADACQKYP------dRFIGM-  129
ident      |                            |                   |     
Sbjct KTLEAGFTTVRNVGA-------------------ADYDDVGLREAIDagyvpgpRIVTAa  136
DSSP  HHHHLLEEEEEELLL-------------------LLLHHHHHHHHHHlllllllEEEELl


DSSP  LLLL----------------------LLLHHHHHHHHHHHHHlLLLLLEEELLL------
Query GTVA----------------------PQDPEWSAREIHRGAReLGFKGIQINSH------  161
ident                              |              |   | |         
Sbjct ISFGatgghcdstffppsmdqknpfnSDSPDEARKAVRTLKK-YGAQVIXICATggvfsr  195
DSSP  LLEEllllllllllllhhhlllllllLLLHHHHHHHHHHHHH-LLLLEEEEELLllllll


DSSP  ---llllLLLLHHHHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhhhhhHH
Query ---tqgrYLDEEFFDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgfgveTG  218
ident         |  |                  |                             
Sbjct gnepgqqQLTYEEMKAVVDEAHMAGIKVAAHA-------------------------hGA  230
DSSP  lllllllLLLHHHHHHHHHHHHHLLLEEEEEE-------------------------lLH


DSSP  HHHHHhhhhlhhhhlllLLEEELHhHHLHHHHhhhhhhhhhhhhhlllllllllllllhh
Query MHLLRlitigifdkypsLQIMVGHmGEALPYWlyrldymhqagvrsqryermkplkktie  278
ident                        |                                    
Sbjct SGIRE--------avraGVDTIEH-ASLVDDE--------------------------gi  255
DSSP  HHHHH--------hhhlLLLEEEE-LLLLLHH--------------------------hh


DSSP  HHHH-HLEEEELlLLLL----------------------------HHHHHHHHHHHLhhH
Query GYLK-SNVLVTNsGVAW----------------------------EPAIKFCQQVMGedR  309
ident                                                             
Sbjct KLAVqKGAYFSM-DIYNtdytqaegkkngvlednlrkdrdigelqRENFRKALKAGV--K  312
DSSP  HHHHhHLLEEEL-LLLLhhhhhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--E


DSSP  EELLLLLLL-LLLHhhHHHHHLLL---LLHHHHHHHHLHHHHHHLLL-------------
Query VMYAMDYPY-QYVAdeVRAMDAMD---MSAQTKKKFFQTNAEKWFKL-------------  352
ident   |  |                |                 |                   
Sbjct MVYGTDAGIyPHGD-nAKQFAVMVrygATPLQAIQSATLTAAEALGRskdvgqvavgryg  371
DSSP  EELLLLLLLlLLLL-hHHHHHHHHhllLLHHHHHHHLLHHHHHHHLLlllllllllllll


DSSP  ---------------------------------
Query ---------------------------------  352
ident                                  
Sbjct dmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  leeeelllllllhhhhhllleeeelleeeelll


No 37: Query=4qrnA Sbjct=1j5sA Z-score=12.8

back to top
DSSP  ----LLLL-------lllllllLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhh
Query ----SMTQ-------dlktggeQGYLRIATEEAFAtreiidvylrmirdgtadkgmvslw   49
ident                                                             
Sbjct hmflGEDYlltnraavrlfnevKDLPIVDPHNHLD-------------------akdive   41
DSSP  llllLLLLllllhhhhhhhhhhLLLLEEELLLLLL-------------------hhhhhh


DSSP  hhhhhLLLH-HHHHH---------------------------------------------
Query gfyaqSPSE-RATQI---------------------------------------------   63
ident         |                                                   
Sbjct nkpwnDIWEvEGATDhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyew  101
DSSP  lllllLHHHhHLLLLhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhh


DSSP  -------------------------hhhhhlllhHHHHHHHHLLLLEEEEEEllllllll
Query -------------------------lerlldlgeRRIADMDATGIDKAILALtspgvqpl   98
ident                                                             
Sbjct ihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTD--------  153
DSSP  hhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLL--------


DSSP  llhhhhhhhHHHHHHHHHHHHHHL-lLLEEELLLL--LLLL-------------------
Query hdldeartlATRANDTLADACQKY-pDRFIGMGTV--APQD-------------------  136
ident                    |                 |                      
Sbjct --------dPVSTLEHHRKAKEAVegVTILPTWRPdrAMNVdkegwreyvekmgeryged  205
DSSP  --------lLLLLLHHHHHHHHHLllLEEELLLLLhhHHLLllllhhhhhhhhhhhhlll


DSSP  -------HHHHHHHHHHHHhLLLLLLEEELLLlllLLLL---------------------
Query -------PEWSAREIHRGArELGFKGIQINSHtqgRYLD---------------------  168
ident                     | |                                     
Sbjct tstldgfLNALWKSHEHFK-EHGCVASDHALL---EPSVyyvdenraravhekafsgekl  261
DSSP  lllhhhhHHHHHHHHHHHH-LLLLLEEEEEEL---LLLLllllhhhhhhhhhhhllllll


DSSP  --------LHHH-HHHHHHHHHHLLLEEEL-LLLLllllLHHHHH-----hLLLLlllHH
Query --------EEFF-DPIFRALVEVDQPLYIH-PATSpdsmIDPMLE-----aGLDGaifGF  213
ident           |          |       |  |          |                
Sbjct tqdeindyKAFMmVQFGKMNQETNWVTQLHiGALR---dYRDSLFktlgpdSGGD---IS  315
DSSP  lhhhhhhhHHHHhHHHHHHHHHHLLEEEEEeLEEL---lLLHHHHhhllllLLLL---EE


DSSP  HHhhhHHHHHHHHhLHHHHLL-LLLEEELhhhHLHHHHhhhhhhhhhhhhhlllllllll
Query GVetgMHLLRLITiGIFDKYP-SLQIMVGhmgEALPYWlyrldymhqagvrsqryermkp  272
ident                        | |                                  
Sbjct TN--fLRIAEGLR-YFLNEFDgKLKIVLYvldPTHLPT----------------------  350
DSSP  LL--lLLHHHHHH-HHHHHLLlLLLEEEEellHHHHHH----------------------


DSSP  llllhhHHHH--HLEE-EELL--LLLL---HHHHHHHHHHHLHHHE-ELLLLLLL-lLLH
Query lkktieGYLK--SNVL-VTNS--GVAW---EPAIKFCQQVMGEDRV-MYAMDYPY-qYVA  322
ident              ||               |   |    |           |        
Sbjct ----isTIARafPNVYvGAPWwfNDSPfgmEMHLKYLASVDLLYNLaGMVTDSRKllSFG  406
DSSP  ----hhHHHHhlLLEEeLLLLllLLLHhhhHHHHHHHHLLLLHHHLlLLLLLLLLllHHH


DSSP  HHHHHHHL--LLLL--------------HHHHHHHHLHHHHHHLLl
Query DEVRAMDA--MDMS--------------AQTKKKFFQTNAEKWFKl  352
ident                                 |          |  
Sbjct SRTEMFRRvlSNVVgemvekgqipikeaRELVKHVSYDGPKALFF-  451
DSSP  HHHHHHHHhhHHHHhhhhhlllllhhhhHHHHHHHHLHHHHHHHL-


No 38: Query=4qrnA Sbjct=3gg7A Z-score=12.8

back to top
DSSP  llllllllllllllLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqgyLRIATEEAFAtreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident                 |                                           
Sbjct --------------SLIDFHVHLD------------------------------------   10
DSSP  --------------LLEEEEELHH------------------------------------


DSSP  hhhhhHHHLLLhHHHHHHHHlLLLEEEEEELlllllllllhhhhhhhhhHHHHHHHHHHH
Query tqileRLLDLGeRRIADMDAtGIDKAILALTspgvqplhdldeartlatRANDTLADACQ  120
ident         |                     |                   |         
Sbjct -----LYPDPV-AVARACEE-RQLTVLSVTT----------------tpAAWRGTLALAA   47
DSSP  -----HLLLHH-HHHHHHHH-LLLEEEELLL----------------lhHHHHHHHHHHL


DSSP  HLlLLEEELLLL-------llLLHHHHHHHhHHHHhllllLLEE-ELLL------lLLLL
Query KYpDRFIGMGTV-------apQDPEWSAREiHRGArelgfKGIQ-INSH------tQGRY  166
ident                       |  |  |                               
Sbjct GR-PHVWTALGFhpevvseraADLPWFDRY-LPET-----RFVGeVGLDgspslrgTWTQ  100
DSSP  LL-LLEEELLLLlhhhllllhHHLHHHHHH-HHHL-----LEEEeEELLllhhhhhHHHH


DSSP  LLLhhhHHHHHHHHHH-LLLEEELlllllllllhhhhhhlllllllhhhhhHHHHHHHHH
Query LDEeffDPIFRALVEV-DQPLYIHpatspdsmidpmleagldgaifgfgveTGMHLLRLI  225
ident         | |         | ||                                    
Sbjct QFA-vfQHILRRCEDHgGRILSIH---------------------------SRRAESEVL  132
DSSP  HHH-hhHHHHHHHHHLlLEEEEEE---------------------------LLLLHHHHH


DSSP  hhLHHHHLLL-LLEEELHhhHLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHHHL
Query tiGIFDKYPS-LQIMVGHmgEALPYWLyrldymhqagvrsqryermkplkktiEGYLKSN  284
ident         |                                                   
Sbjct --NCLEANPRsGTPILHW--YSGSVTE-------------------------lRRAISLG  163
DSSP  --HHHHHLHHhEEEEEEL--LLLLHHH-------------------------hHHHHHLL


DSSP  EEEELLLL-LLHHHHHHHHHHHLHHHEELLLLLLLLLL------hhHHHHHHL--LLLL-
Query VLVTNSGV-AWEPAIKFCQQVMGEDRVMYAMDYPYQYV------adEVRAMDA--MDMS-  334
ident                      |  |||    | |             |            
Sbjct CWFSVGPTmVRTQKGAALIRSMPRDRVLTETDGPFLELdgqaalpwDVKSVVEglSKIWq  223
DSSP  LEEEELHHhHLLHHHHHHHHHLLHHHEEELLLLLLLEElleellhhHHHHHHHhhHHHHl


DSSP  ---HHHHHHHhLHHHHHHLLl
Query ---AQTKKKFfQTNAEKWFKl  352
ident              |       
Sbjct ipaSEVERIV-KENVSRLLGt  243
DSSP  llhHHHHHHH-HHHHHHHHHl


No 39: Query=4qrnA Sbjct=2uz9A Z-score=12.7

back to top
DSSP  -------------------------------------------------------lllll
Query -------------------------------------------------------smtqd    5
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  llllllLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhHHHHHHhhlllhhhhhhhh
Query lktggeQGYLRIATEEAFAtreiidvylrmirdgtadkgmvSLWGFYaqspseratqile   65
ident              |                                |             
Sbjct lshhefFMPGLVDTHIHAS--------qysfagssidlpllEWLTKYtfpaehrfqnidf  112
DSSP  llllleEEELEEEEEEEHH--------hhhhllllllllhhHHHHHLhhhhhhhhhlhhh


DSSP  hhHLLLhHHHHHHHHLLLLEEEEEEllllllllllhhhhhhhHHHHHHHHHHHHHHLLLL
Query rlLDLGeRRIADMDATGIDKAILALtspgvqplhdldeartlATRANDTLADACQKYPDR  125
ident        |        |   |                      |     |||   |   |
Sbjct aeEVYT-RVVRRTLKNGTTTACYFA---------------tiHTDSSLLLADITDKFGQR  156
DSSP  hhHHHH-HHHHHHHHLLEEEEEEEL---------------llLHHHHHHHHHHHHHHLLE


DSSP  EEELLLLLL---------LLHHHHHHHHHHHHHLLL-------LLLEEE-LLLLllllll
Query FIGMGTVAP---------QDPEWSAREIHRGARELG-------FKGIQI-NSHTqgryld  168
ident                      | |  |  |   |                 |        
Sbjct AFVGKVCMDlndtfpeykETTEESIKETERFVSEMLqknysrvKPIVTPrFSLS-----c  211
DSSP  EEEELEELLlllllllllLLHHHHHHHHHHHHHHHHhhlllleEEEEEElLHHH-----l


DSSP  LHHH-HHHHHHHHHHLLLEEELLllllllllhhhhhhlllllLLHHHHH-------hhHH
Query EEFF-DPIFRALVEVDQPLYIHPatspdsmidpmleagldgaIFGFGVE-------tgMH  220
ident  |             |     |                                      
Sbjct SETLmGELGNIAKTRDLHIQSHI-----------------seNRDEVEAvknlypsykNY  254
DSSP  LHHHhHHHHHHHHHHLLEEEEEE-----------------llLHHHHHHhhhhlllllLH


DSSP  HHHHHHhlhhhhllLLLEEELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhhHH
Query LLRLITigifdkypSLQIMVGHmGEALPYWLyrldymhqagvrsqryermkplkktieGY  280
ident                      | |  |                                 
Sbjct TSVYDK----nnllTNKTVMAH-GCYLSAEE--------------------------lNV  283
DSSP  HHHHHH----llllLLLEEEEE-LLLLLHHH--------------------------hHH


DSSP  HHHL-EEEELLLL------llhhHHHHHHHHHLhhHEELLLLLLLLLL---HHHHHHHHL
Query LKSN-VLVTNSGV------awepAIKFCQQVMGedRVMYAMDYPYQYV---ADEVRAMDA  330
ident                                          |    |     |  |    
Sbjct FHERgASIAHCPNsnlslssgflNVLEVLKHEV--KIGLGTDVAGGYSysmLDAIRRAVM  341
DSSP  HHHHlLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLLLLLllhHHHHHHHHH


DSSP  ------------lLLLHHHHHHHHLHHHHHHLLL--------------------------
Query ------------mDMSAQTKKKFFQTNAEKWFKL--------------------------  352
ident                                  |                          
Sbjct vsnillinkvnekSLTLKEVFRLATLGGSQALGLdgeignfevgkefdailinpkasdsp  401
DSSP  hhhhhhhllllllLLLHHHHHHHHLHHHHHHLLLlllllllllllllleeeellllllll


DSSP  -------------------------------------------
Query -------------------------------------------  352
ident                                            
Sbjct idlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  lllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 40: Query=4qrnA Sbjct=2oofA Z-score=12.6

back to top
DSSP  ------------------------------------------------lllllllllllL
Query ------------------------------------------------smtqdlktggeQ   12
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklV   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllleE


DSSP  LLLLEEEEEE-ELLHhhhhhhhhhhhhllllhhhhhhhhhHHHLLLHHH-----------
Query GYLRIATEEA-FATReiidvylrmirdgtadkgmvslwgfYAQSPSERA-----------   60
ident     |                                    |     |            
Sbjct TPGLIDCHTHlIFAG------------------------sRAEEFELRQkgvpyaeiark   96
DSSP  EELEEEEEELlLLLL------------------------lLHHHHHHHHhlllhhhhhhl


DSSP  -------------hhhhhhhhLLLHhHHHHHHHLLLLEEEEEEllLLLLllllhhhHHHH
Query -------------tqilerllDLGErRIADMDATGIDKAILALtsPGVQplhdldeARTL  107
ident                           |       |                         
Sbjct gggiistvratraasedqlfeLALP-RVKSLIREGVTTVEIKS--GYGL-------TLED  146
DSSP  lllhhhhhhhhhhllhhhhhhHHHH-HHHHHHHHLEEEEEEEL--LLLL-------LHHH


DSSP  HHHHHHHHHHHHHHLLLLEEELLLL-----------llLLHHHHH-HHHHHHHHLLLLLL
Query ATRANDTLADACQKYPDRFIGMGTV-----------apQDPEWSA-REIHRGARELGFKG  155
ident                | |                       |      |   |       
Sbjct ELKXLRVARRLGEALPIRVKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGLADA  206
DSSP  HHHHHHHHHHHHHHLLLEEEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLLLLE


DSSP  EEELLLlLLLLLLLhhhHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhHHH
Query IQINSHtQGRYLDEeffDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgFGV  215
ident         |  |          |          |                          
Sbjct VDVFCEhIGFSLAQ--tEQVYLAADQYGLAVKGHX---------------------dQLS  243
DSSP  EEEEELlLLLLHHH--hHHHHHHHHHLLLEEEEEE---------------------lLLL


DSSP  HhhHHHHhhhhhlhhhhllLLLE-EELHhHHLHHHHhhhhhhhhhhhhhlllllllllll
Query EtgMHLLrlitigifdkypSLQI-MVGHmGEALPYWlyrldymhqagvrsqryermkplk  274
ident                          | |  | |                           
Sbjct N-lGGST---------laaNFGAlSVDH-LEYLDPE------------------------  268
DSSP  L-lLHHH---------hhhHLLLlEEEE-LLLLLHH------------------------


DSSP  llhhHHHHHL-EEEELL-LLLL------hhHHHHHHHHHLhhHEELLLLLL----LLLL-
Query ktieGYLKSN-VLVTNS-GVAW------epAIKFCQQVMGedRVMYAMDYP----YQYV-  321
ident       |    |  |                                 |           
Sbjct --giQALAHRgVVATLLpTAFYflketklpPVVALRKAGV--PXAVSSDINpgtaPIVSl  324
DSSP  --hhHHHHHHlLEEEELhHHHHhlllllllLHHHHHHLLL--LEEELLLLLllllLLLLh


DSSP  HHHHHHHHLL-LLLHHHHHHHHLHHHHHHLLL----------------------------
Query ADEVRAMDAM-DMSAQTKKKFFQTNAEKWFKL----------------------------  352
ident                          |                                  
Sbjct RXAXNXACTLfGLTPVEAXAGVTRHAARALGEqeqlgqlrvgxladflvwncghpaelsy  384
DSSP  HHHHHHHHHHhLLLHHHHHHHLLHHHHHHLLLlllllllllllllleeeellllllhhhh


DSSP  -------------------
Query -------------------  352
ident                    
Sbjct ligvdqlvsrvvngeetlh  403
DSSP  lllllleeeeeelleelll


No 41: Query=4qrnA Sbjct=3mkvA Z-score=12.5

back to top
DSSP  -------------------------------------------llllllllllLLLLLLE
Query -------------------------------------------smtqdlktggEQGYLRI   17
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgkTIMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeellllEEEELEE


DSSP  EEEEEEL-----LHHHHHHHHhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhhllLH
Query ATEEAFA-----TREIIDVYLrmirdgtadkgmvslwgfyaqspseratqilerlldlGE   72
ident                                                             
Sbjct DLHVHVVaiefnLPRVATLPN-------------------------------vlvtlrAV   89
DSSP  EEEELLLlllllHHHHLLLLH-------------------------------hhhhhhHH


DSSP  HHHHHHHHLLLLEEEEEELlllllllllhhhhhhhhhhhhhhHHHHHHHLL------LLE
Query RRIADMDATGIDKAILALTspgvqplhdldeartlatrandtLADACQKYP------DRF  126
ident      |   |      |                              |          | 
Sbjct PIMRAMLRRGFTTVRDAGG----------------------aGYPFKQAVEsglvegPRL  127
DSSP  HHHHHHHHLLEEEEEELLL----------------------lLHHHHHHHHllllllLEE


DSSP  EELL-LLLL---------------------------------LLHHHHHHHHHHHHHlLL
Query IGMG-TVAP---------------------------------QDPEWSAREIHRGAReLG  152
ident    |                                             |         |
Sbjct FVSGrALSQtgghadprarsdymppdspcgccvrvgalgrvaDGVDEVRRAVREELQ-MG  186
DSSP  EELLlEEELllllllllllllllllllllllllllllleeelLLHHHHHHHHHHHHH-HL


DSSP  LLLEEELLL---------llLLLLlLHHH-HHHHHHHHHHLLLEEELLllllllllhhhh
Query FKGIQINSH---------tqGRYLdEEFF-DPIFRALVEVDQPLYIHPatspdsmidpml  202
ident    | |                    |     |             |             
Sbjct ADQIXIMASggvasptdpvgVFGY-SEDEiRAIVAEAQGRGTYVLAHA------------  233
DSSP  LLLEEEELLlllllllllllLLLL-LHHHhHHHHHHHHLLLLLEEEEE------------


DSSP  hhlllllllhhhhhHHHHHHHHHHhlhhhhlllLLEEELHhHHLHHHHhhhhhhhhhhhh
Query eagldgaifgfgveTGMHLLRLITigifdkypsLQIMVGHmGEALPYWlyrldymhqagv  262
ident               |     |                  | |                  
Sbjct -------------yTPAAIARAVR--------cGVRTIEH-GNLIDDE------------  259
DSSP  -------------lLHHHHHHHHH--------lLLLEEEE-LLLLLHH------------


DSSP  hlllllllllllllhhHHHH-HLEEEELLLL---------------------------lL
Query rsqryermkplkktieGYLK-SNVLVTNSGV---------------------------aW  294
ident                          |    |                             
Sbjct --------------taRLVAeHGAYVVPTLVtydalasegekyglppesiakiadvhgaG  305
DSSP  --------------hhHHHHhHLLEEELLHHhhhhhhhhlllllllhhhhllhhhhhllH


DSSP  HHHHHHHHHHHLhhHEELLLLLL--LLLL-HHHHHHHhLLLLLHHHHHHHHLHHHHHHLL
Query EPAIKFCQQVMGedRVMYAMDYP--YQYV-ADEVRAMdAMDMSAQTKKKFFQTNAEKWFK  351
ident    |                |     |    || |   |   |                 
Sbjct LHSIEIMKRAGV--KMGFGTDLLgeAQRLqSDEFRIL-AEVLSPAEVIASATIVSAEVLG  362
DSSP  HHHHHHHHHHLL--LLLLLLLLLhhHHHHlLHHHHHH-HLLLLHHHHHHHLLHHHHHHLL


DSSP  L---------------------------------------------------
Query L---------------------------------------------------  352
ident                                                     
Sbjct Mqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  Llllllllllllllleeeellllllllllllllllllleeeelleeeeelll


No 42: Query=4qrnA Sbjct=4rdvB Z-score=12.3

back to top
DSSP  -----------------------------------llllllllllLLLLLLEEEEEEELl
Query -----------------------------------smtqdlktggEQGYLRIATEEAFAt   25
ident                                                             
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggAVLPGMPNLHSHAF-   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllLEEELEEEEEELHH-


DSSP  hhhhhhhhhhhhhllllHHHHHHHhHHHHLllhhhhhhhhhhHLLLhHHHHHHHHLLLLE
Query reiidvylrmirdgtadKGMVSLWgFYAQSpseratqilerlLDLGeRRIADMDATGIDK   85
ident                                                     |   |   
Sbjct -qramaglaevagnpndSFWTWRE-LMYRM--varlspeqieVIAC-QLYIEMLKAGYTA  114
DSSP  -hhhhllllllllllllLHHHHHH-HHHHH--hllllhhhhhHHHH-HHHHHHHHHLEEE


DSSP  EEEEELllllllllLHHHhhHHHHHHHHHHHHHHHHLLLLEEELLLLLL-----------
Query AILALTspgvqplhDLDEarTLATRANDTLADACQKYPDRFIGMGTVAP-----------  134
ident               |                 |                           
Sbjct VAEFHY---vhhdlDGRS-yADPAELSLRISRAASAAGIGLTLLPVLYShagfggqpase  170
DSSP  EEEEEL---lllllLLLL-lLLLLHHHHHHHHHHHHHLLEEEEEELLLLeeellleellh


DSSP  ------LLHHHHHHHHHHHhHLLL-----LLLEEELLLLllLLLLlHHHHHHHHHhHHHL
Query ------QDPEWSAREIHRGaRELG-----FKGIQINSHTqgRYLDeEFFDPIFRAlVEVD  183
ident          |       |  |          |    |                 |    |
Sbjct gqrrfiNGSEAYLELLQRL-RAPLeaaghSLGLCFHSLR--AVTP-QQIATVLAA-GHDD  225
DSSP  hhllllLLHHHHHHHHHHH-HHHHhhhllEELEEELLLL--LLLH-HHHHHHHLL-LLLL


DSSP  LLEEELLllllllllhhhhhhlllllLLHHHH-----hhhHHHHHHHhHLHHhhllllLE
Query QPLYIHPatspdsmidpmleagldgaIFGFGV-----etgMHLLRLItIGIFdkypslQI  238
ident  |  ||                                    |  |              
Sbjct LPVHIHI-----------------aeQQKEVDdcqawsgrRPLQWLY-ENVA---vdqRW  264
DSSP  LLEEEEE-----------------llLHHHHHhhhhhhllLHHHHHH-HHLL---lllLE


DSSP  EELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhhHHHHHL-EEEELLL------
Query MVGHmGEALPYWLyrldymhqagvrsqryermkplkktieGYLKSN-VLVTNSG------  291
ident    |                                                        
Sbjct CLVH-ATHADPAE--------------------------vAAMARSgAVAGLCLsteanl  297
DSSP  EEEE-LLLLLHHH--------------------------hHHHHHHlLEEEELHhhhhhl


DSSP  lllhhHHHHHHHHHLhhHEELLLLLLlLLLHhhHHHHHLL--------------------
Query vawepAIKFCQQVMGedRVMYAMDYPyQYVAdeVRAMDAM--------------------  331
ident               |  |     |         |                          
Sbjct gdgifPATDFLAQGG--RLGIGSDSH-VSLS--VVEELRWleygqrlrdrkrnrlyrddq  352
DSSP  lllllLHHHHHHLLL--EEEELLLLL-LLLL--HHHHHHHhhhhhhhhhlllllllllll


DSSP  lLLHHHHHHHHLHHHHHHLLL---------------------------------------
Query dMSAQTKKKFFQTNAEKWFKL---------------------------------------  352
ident  |   |                                                      
Sbjct pMIGRTLYDAALAGGAQALGQpigslavgrradllvldgndpylasaegdallnrwlfag  412
DSSP  lLHHHHHHHHHHHHHHHHHLLlllllllllllleeeellllhhhhllllhhhhhhhhhhl


DSSP  ---------------------------------------
Query ---------------------------------------  352
ident                                        
Sbjct gdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  lhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 43: Query=4qrnA Sbjct=3icjA Z-score=12.2

back to top
DSSP  ----------------------------------------------lllllllllllLLL
Query ----------------------------------------------smtqdlktggeQGY   14
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfVMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleEEE


DSSP  LLEEEEEEEL--------------------------------------------------
Query LRIATEEAFA--------------------------------------------------   24
ident                                                             
Sbjct AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ----------------------------------------------------lHHHHHHH
Query ----------------------------------------------------tREIIDVY   32
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkIINEKIL  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhHHHHLLL


DSSP  hhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhHLLLhHHHHHHHHLLLLEEEEEEll
Query lrmirdgtadkgmvslwgfyaqspseratqilerlLDLGeRRIADMDATGIDKAILALts   92
ident                                                  |          
Sbjct -----------------------------tvkdykHYIE-SAQEHLLSLGVHSVGFMS--  208
DSSP  -----------------------------lhhhhhHHHH-HHHHHHHHLLEEEEEEEE--


DSSP  llllllllhhhhhhhHHHHHHHHHHHH--hHLLLLEEELLLLLlllhhhHHHH--hhHHH
Query pgvqplhdldeartlATRANDTLADAC--qKYPDRFIGMGTVApqdpewSARE--ihRGA  148
ident                   |   |                                   | 
Sbjct --------------vGEKALKALFELEregRLKMNVFAYLSPE-----lLDKLeelnLGK  249
DSSP  --------------eLHHHHHHHHHHHhllLLLLEEEEEELHH-----hHHHHhhhlLLL


DSSP  HL---lLLLLEEELLL---------------------lLLLLLLLHhhHHHHHHHHHHLL
Query RE---lGFKGIQINSH---------------------tQGRYLDEEffDPIFRALVEVDQ  184
ident  |       |                                   |              
Sbjct FEgrrlRIWGVXLFVDgslgartallsepytdnpttsgELVMNKDE-iVEVIERAKPLGL  308
DSSP  EEllleEEEEEEEELLllllllllllllllllllllllLLLLLHHH-hHHHHHHHLLLLL


DSSP  LEEELlllllllllhhhhhhlllllllhhhhHHHHHHHHHHhhLHHHHLLlLLEEELHhH
Query PLYIHpatspdsmidpmleagldgaifgfgvETGMHLLRLItiGIFDKYPsLQIMVGHmG  244
ident     |                                        |           |  
Sbjct DVAVH-------------------------aIGDKAVDVAL--DAFEEAE-FSGRIEH-A  339
DSSP  EEEEE-------------------------eLLHHHHHHHH--HHHHHHL-LLLEEEE-L


DSSP  HLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-HLEEEELLLLLL---------
Query EALPYWLyrldymhqagvrsqryermkplkktiEGYLK-SNVLVTNSGVAW---------  294
ident                                      |   |                  
Sbjct SLVRDDQ--------------------------LERIKeLKVRISAQPHFIvsdwwivnr  373
DSSP  LLLLHHH--------------------------HHHHHhHLLEEEELLLHHhhlllhhhh


DSSP  --------hhHHHHHHHHHlhhHEELLLLLLLLLLHhhHHHHHLL-----------LLLH
Query --------epAIKFCQQVMgedRVMYAMDYPYQYVAdeVRAMDAM-----------DMSA  335
ident             |               | |                           | 
Sbjct vgeerakwayRLKTLSSIT---KLGFSTDSPIEPAD--PWVSIDAavnryvvdpgeRVSR  428
DSSP  hhhhhhhhllLHHHHHHHL---LEEELLLLLLLLLL--HHHHHHHhhhlllllhhhLLLH


DSSP  HHHHHHHLHHHHHHLLL-----------------------
Query QTKKKFFQTNAEKWFKL-----------------------  352
ident                                         
Sbjct EEALHLYTHGSAQVTLAedlgklergfraeyiildrdplk  468
DSSP  HHHHHHLLHHHHHHLLLllllllllllllleeeellllll


No 44: Query=4qrnA Sbjct=4c5yA Z-score=12.0

back to top
DSSP  -----------------------------------------------llllllllllLLL
Query -----------------------------------------------smtqdlktggEQG   13
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpVLM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeEEE


DSSP  LLLEEEEEEEL--------LHHHHHHhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhh
Query YLRIATEEAFA--------TREIIDVylrmirdgtadkgmvslwgfyaqspseratqile   65
ident          |                                                  
Sbjct PGLWDCHMHFGgdddyyndYTSGLAT------------------------------hpas   90
DSSP  ELEEEEEELLLllllllllLHHHHHL------------------------------lhhh


DSSP  hhhLLLHhHHHHHHHLLLLEEEEEELlllllllllhhhhhhhhhhhhhHHHHHHHHLL--
Query rllDLGErRIADMDATGIDKAILALTspgvqplhdldeartlatrandTLADACQKYP--  123
ident     |           |                                           
Sbjct sgaRLAR-GCWEALQNGYTSYRDLAG----------------------YGCEVAKAINdg  127
DSSP  hhhHHHH-HHHHHHHLLEEEEEELLL----------------------LHHHHHHHHHll


DSSP  ----LLEEEL-LLLLL-------------------------------------LLHHHHH
Query ----DRFIGM-GTVAP-------------------------------------QDPEWSA  141
ident                                                         |   
Sbjct tivgPNVYSSgAALSQtaghgdifalpagevlgsygvmnprpgywgagplciaDGVEEVR  187
DSSP  llllLEEEELlLEEELlllllllllllhhhhhhhhlllllllllllllleeelLLHHHHH


DSSP  HHHHHHHHlLLLLLEEELLL---------llLLLLlLHHH-HHHHHHHHHHLLLEEELLl
Query REIHRGAReLGFKGIQINSH---------tqGRYLdEEFF-DPIFRALVEVDQPLYIHPa  191
ident |      |  | | |                            |             |  
Sbjct RAVRLQIR-RGAKVIXVMASggvmsrddnpnFAQF-SPEElKVIVEEAARQNRIVSAHV-  244
DSSP  HHHHHHHH-HLLLLEEEELLlllllllllllLLLL-LHHHhHHHHHHHHHLLLLEEEEE-


DSSP  lllllllhhhhhhlllllllhhhhHHHHHHHHHHhhlhhhhlllLLEEELHhHHLHHHHh
Query tspdsmidpmleagldgaifgfgvETGMHLLRLItigifdkypsLQIMVGHmGEALPYWl  251
ident                                  |                |         
Sbjct ------------------------HGKAGIMAAI--------kaGCKSLEH-VSYADEE-  270
DSSP  ------------------------LLHHHHHHHH--------hhLLLEEEE-LLLLLHH-


DSSP  hhhhhhhhhhhhlllllllllllllhhHHHH-HLEEEELLLL------------------
Query yrldymhqagvrsqryermkplkktieGYLK-SNVLVTNSGV------------------  292
ident                               |    |                        
Sbjct -------------------------vwELMKeKGILYVATRSvieiflasngeglvkesw  305
DSSP  -------------------------hhHHHHhHLLEEELLHHhhhhhhhhllllllllhh


DSSP  --------llHHHHHHHHHHHLhhHEELLLLLL-lLLLHhHHHHHHLL--LLLHHHHHHH
Query --------awEPAIKFCQQVMGedRVMYAMDYP-yQYVAdEVRAMDAM--DMSAQTKKKF  341
ident             |                 |       |            |      | 
Sbjct aklqaladshLKAYQGAIKAGV--TIALGTDTApgGPTA-LELQFAVErgGMTPLEAIKA  362
DSSP  hlllhhhhhhHHHHHHHHHLLL--LEELLLLLLllLLLH-HHHHHHHHllLLLHHHHHHH


DSSP  HLHHHHHHLL--------------------------------------------------
Query FQTNAEKWFK--------------------------------------------------  351
ident    ||                                                       
Sbjct ATANAPLSVGpqapltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgp  422
DSSP  HLLLHHHHHHhhlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeeell


DSSP  -------------l
Query -------------l  352
ident               
Sbjct gigpwgedarnpfl  436
DSSP  llllllllllllll


No 45: Query=4qrnA Sbjct=1a5kC Z-score=11.8

back to top
DSSP  --------------------LLLL------------------------------------
Query --------------------SMTQ------------------------------------    4
ident                                                             
Sbjct snisrqayadmfgptvgdkvRLADtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeELLLllleeelleellllllllllllllllllllllllll


DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------dlk    7
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  lllLLLLLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhh
Query tggEQGYLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyaqspseratqilerl   67
ident          | |                                                
Sbjct egkIVTAGGIDTHIHW--------------------------------------------  136
DSSP  lllEEEELEEEEEEEL--------------------------------------------


DSSP  HLLLhhHHHHHHHLLLLEEEEEE------LLLLllllllhhhhhhhHHHHHHHHHHHHHH
Query LDLGerRIADMDATGIDKAILAL------TSPGvqplhdldeartlATRANDTLADACQK  121
ident               |              |                          |   
Sbjct ICPQ--QAEEALVSGVTTMVGGGtgpaagTHAT---------tctpGPWYISRMLQAADS  185
DSSP  LLLL--HHHHHHHHLEEEEEEELllllhhHHHL---------llllHHHHHHHHHHHHLL


DSSP  LLLLEEELLLLlLLLHHHHHHHHHHHhhlllLLLEEELLLLllLLLLLhhhHHHHHHHHH
Query YPDRFIGMGTVaPQDPEWSAREIHRGarelgFKGIQINSHTqgRYLDEeffDPIFRALVE  181
ident  |      |      |         |       |  |              |       |
Sbjct LPVNIGLLGKGnVSQPDALREQVAAG-----VIGLEIHEDW--GATPA-aiDCALTVADE  237
DSSP  LLLEEEEEEELlLLLHHHHHHHHHHL-----LLEEEEEHHH--LLLHH-hhHHHHHHHHH


DSSP  HLLLEEELlllllllllhhhhhhlllllllhhhhHHHH----hhHHHHHhLHHHhlllLL
Query VDQPLYIHpatspdsmidpmleagldgaifgfgvETGM----hlLRLITiGIFDkypsLQ  237
ident  |     |                                           |        
Sbjct MDIQVALH--------------------------SDTLnesgfvEDTLA-AIGG----RT  266
DSSP  HLLEEEEE--------------------------LLLLlllllhHHHHH-HHLL----LL


DSSP  EEELHHHH-------LHHHhhhhhhhhhhhhhhlllllllllllllhhhhHHHLEEEELL
Query IMVGHMGE-------ALPYwlyrldymhqagvrsqryermkplkktiegyLKSNVLVTNS  290
ident |   |                                                | |    
Sbjct IHTFHTEGaggghapDIIT-----------------------------acAHPNILPSST  297
DSSP  EEELLLLLlllllllLHHH-----------------------------hhHLLLEEEEEE


DSSP  LLLLH---------------------------------------HHHHHHH-HHHLhhhE
Query GVAWE---------------------------------------PAIKFCQ-QVMGedrV  310
ident                                              |              
Sbjct NPTLPytlntidehldmlmvchhldpdiaedvafaesrirretiAAEDVLHdLGAF---S  354
DSSP  HHHLLllllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhHHHHHHHhLLLL---L


DSSP  ELLLLLLL--LLLHhhHHHHHLLL-------------------lLHHHHHHHHLHHHHHH
Query MYAMDYPY--QYVAdeVRAMDAMD-------------------mSAQTKKKFFQTNAEKW  349
ident     |                                                  |    
Sbjct LTSSDSQAmgRVGE-vILRTWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALT  413
DSSP  EEELLLLLllLLLL-hHHHHHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHH


DSSP  LLL---------------------------------------------------------
Query FKL---------------------------------------------------------  352
ident                                                             
Sbjct HGIahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyr  473
DSSP  LLLlllllllllllllleeeelhhhlllllleeeelleeeeeeellllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct pmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpni  533
DSSP  elhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllle


DSSP  ---------------------------------
Query ---------------------------------  352
ident                                  
Sbjct tvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  eelllllleeelleellllllllllllllllll


No 46: Query=4qrnA Sbjct=3iacA Z-score=11.7

back to top
DSSP  ----LLLL--------lllllllLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhh
Query ----SMTQ--------dlktggeQGYLRIATEEAFAtreiidvylrmirdgtadkgmvsl   48
ident                                                             
Sbjct atfxTEDFllkndiartlyhkyaAPXPIYDFHCHLS------------------------   36
DSSP  llllLLLLllllhhhhhhhhhllLLLLEEELLLLLL------------------------


DSSP  hhhhhhlllhhhhhhhhhhHLLLH------------------------------------
Query wgfyaqspseratqilerlLDLGE------------------------------------   72
ident                                                             
Sbjct ------------------pQEIADdrrfdnlgqiwlegdhykwralrsagvdeslitgke   78
DSSP  ------------------hHHHHHllllllhhhhhhllllhhhhhhhhllllhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   72
ident                                                             
Sbjct tsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatp  138
DSSP  llhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllh


DSSP  --HHHHHHHHLLLLEEEEEEllllllllllhhhhhhhHHHHHHHHHHHHHH--LLLLEEE
Query --RRIADMDATGIDKAILALtspgvqplhdldeartlATRANDTLADACQK--YPDRFIG  128
ident                                                             
Sbjct afSARGIXQQXNVRXVGTTD----------------dPIDSLEYHRQIAADdsIDIEVAP  182
DSSP  hhLHHHHHHHLLEEEEELLL----------------lLLLLLHHHHHHHHLllLLLEEEL


DSSP  LLLLLLL----------------------------LHHHHHHHHHHHHhLLLLLLEEELL
Query MGTVAPQ----------------------------DPEWSAREIHRGArELGFKGIQINS  160
ident                                          |     |   |        
Sbjct SWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLDHFA-ACGCRASDHGI  241
DSSP  LLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHH-HLLLLEEEEEE


DSSP  LlllLLLL------------------------------LHHH-HHHHHHHHHHLLLEEEL
Query HtqgRYLD------------------------------EEFF-DPIFRALVEVDQPLYIH  189
ident                                                |           |
Sbjct E---TLRFapvpddaqldailgkrlagetlseleiaqfTTAVlVWLGRQYAARGWVXQLH  298
DSSP  L---LLLLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHhHHHHHHHHHHLLEEEEE


DSSP  LLLLLllllhhHHHH----------lLLLLLLhhhhhhhhHHHHHHHhLHHHHLLLLLEE
Query PATSPdsmidpMLEA----------gLDGAIFgfgvetgmHLLRLITiGIFDKYPSLQIM  239
ident                            |             | ||               
Sbjct IGAIR------NNNTrxfrllgpdtgFDSIGD---nniswALSRLLD-SXDVTNELPKTI  348
DSSP  ELEEL------LLLHhhhhhhlllllLLEELL---lllhhHHHHHHH-HHHLLLLLLEEE


DSSP  EL----hhhhLHHHhhhhhhhhhhhhhhlllllllllllllhHHHH----hHLEEEELL-
Query VG----hmgeALPYwlyrldymhqagvrsqryermkplkktiEGYL----kSNVLVTNS-  290
ident            |                                         |      
Sbjct LYclnprdneVLAT--------------------------xiGNFQgpgiaGKVQFGSGw  382
DSSP  EEellhhhhhHHHH--------------------------hhHHLLlllllLLEEELLLl


DSSP  --LLLL---HHHHHHHHHHHLH-HHEELLLLLLLlLLHHHHHHHHL--LLLL--------
Query --GVAW---EPAIKFCQQVMGE-DRVMYAMDYPYqYVADEVRAMDA--MDMS--------  334
ident                  |       |    |                             
Sbjct wfNDQKdgxLRQLEQLSQXGLLsQFVGXLTDSRSfLSYTRHEYFRRilCNLLgqwaqdge  442
DSSP  hhHLLHhhhHHHHHHHHHHLLHhHLLLLLLLLLLlLLLHHHHHHHHhhHHHHhhhhhlll


DSSP  --------HHHHHHHHLHHHHHHLL-l
Query --------AQTKKKFFQTNAEKWFK-l  352
ident                   ||   |   
Sbjct ipddeaxlSRXVQDICFNNAQRYFTik  469
DSSP  llllhhhhHHHHHHHHLHHHHHHLLll


No 47: Query=4qrnA Sbjct=2ogjA Z-score=11.6

back to top
DSSP  ------------------------------------------llllllllllLLLLLLEE
Query ------------------------------------------smtqdlktggEQGYLRIA   18
ident                                                             
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaaFISPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeellllEEEELEEE


DSSP  EEEE-ELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhHHHHlllhhHHHH
Query TEEA-FATReiidvylrmirdgtadkgmvslwgfyaqspseratqilERLLdlgerRIAD   77
ident                                                         |   
Sbjct LHVHiWHGG-------------------------------------tDISI-----RPSE   78
DSSP  EEELlLLLL-------------------------------------lLLLL-----LHHH


DSSP  -HHHLLLLEEEEEELlllllllllhhhhhhhHHHHHHHHHH-HHHHLLLLEEELLLLL--
Query -MDATGIDKAILALTspgvqplhdldeartlATRANDTLAD-ACQKYPDRFIGMGTVA--  133
ident      |      |                                    |          
Sbjct cGAERGVTTLVDAGS---------------aGEANFHGFREyIIEPSRERIKAFLNLGsi  123
DSSP  lLHHHLEEEEEEELL---------------lLLLLHHHHHHhLLLLLLLEEEEEEELLll


DSSP  ---------------lLLHHHHHHHHHHHHhlLLLLLEEELL---LLLL---LLLLlhhh
Query ---------------pQDPEWSAREIHRGAreLGFKGIQINS---HTQG---RYLDeeff  172
ident                  |                  |         |             
Sbjct glvacnrvpelrdikdIDLDRILECYAENS--EHIVGLXVRAshvITGSwgvTPVK----  177
DSSP  lllllllllllllhhhLLHHHHHHHHHLLL--LLEEEEEEEElhhHHLLlllHHHH----


DSSP  hhhhhHHHHHLLLEEELLLLLlllllhhhhhhlllllllhhhHHHHHHHHHHhhhlhhhh
Query dpifrALVEVDQPLYIHPATSpdsmidpmleagldgaifgfgVETGMHLLRLitigifdk  232
ident             |   |                               |  |        
Sbjct -lgkkIAKILKVPXXVHVGEP--------------------pALYDEVLEIL--------  208
DSSP  -hhhhHHHHHLLLEEEEELLL--------------------lLLHHHHHHHL--------


DSSP  lllLLEEELHHH----hLHHHHHHHHhhhhhhhhhlllllllllllllHHHHhhHLEEEE
Query ypsLQIMVGHMG----eALPYWLYRLdymhqagvrsqryermkplkktIEGYlkSNVLVT  288
ident        | |               |                       |          
Sbjct --gPGDVVTHCFngksgSSIXEDEDL-------------------fnlAERC--EGIRLD  245
DSSP  --lLLLEEELLLlllllLLLLLLHHH-------------------hhhHHHL--LLLEEE


DSSP  LLL---LLLHHHHHHHH-HHHLhhHEELLLLLL-LLLL---HHHHHHHHLL---LLLHHH
Query NSG---VAWEPAIKFCQ-QVMGedRVMYAMDYP-YQYV---ADEVRAMDAM---DMSAQT  337
ident                               |           |           |     
Sbjct IGHggaSFSFKVAEAAIaRGLL--PFSISTDLHgHSXNfpvWDLATTXSKLlsvDXPFEN  303
DSSP  LLLlllLLLHHHHHHHHhLLLL--LLLLLLLLLlLLLLlllLLHHHHHHHHhhlLLLHHH


DSSP  HHHHHLHHHHHHLLL---------------------------------------------
Query KKKFFQTNAEKWFKL---------------------------------------------  352
ident        |      |                                             
Sbjct VVEAVTRNPASVIRLdxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfeprya  363
DSSP  HHHLLLHHHHHHLLLlllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeee


DSSP  ----------------
Query ----------------  352
ident                 
Sbjct vigaeaiaasryipra  379
DSSP  eelleeeellllllll


No 48: Query=4qrnA Sbjct=3ooqA Z-score=10.8

back to top
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE
Query --------------------------------------smtqdlktggEQGYLRIATEEA   22
ident                                                             
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkFLFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeellllEEEELEEEEEEL


DSSP  EllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhHHHHHH-------------hhhHL
Query FatreiidvylrmirdgtadkgmvslwgfyaqspseRATQIL-------------erlLD   69
ident                                                             
Sbjct I----------------------------glfeegvGYYYSDgneatdpvtphvkaldGF   92
DSSP  L----------------------------lllllllLHHHLLlllllllllllllhhhHL


DSSP  LLHH-HHHHHHHLLLLEEEEEELLLLllllllhhhhhhhhhhhhhhhhhHHHHLLLleee
Query LGER-RIADMDATGIDKAILALTSPGvqplhdldeartlatrandtladACQKYPDrfig  128
ident       |    | |         |                                    
Sbjct NPQDpAIERALAGGVTSVXIVPGSAN---------pvggqgsvikfrsiIVEECIV----  139
DSSP  LLLLhHHHHHHLLLEEEEEELLLLLL---------leeeeeeeeellllLHHHHEE----


DSSP  llllllllhhhhhhhhhhhhhllLLLLEEELLL-------------LLLL--LLLL-HHH
Query mgtvapqdpewsareihrgarelGFKGIQINSH-------------TQGR--YLDE-EFF  172
ident                           |                      |          
Sbjct ----------------------kDPAGLKXAFGenpkrvygerkqtPSTRxgTAGViRDY  177
DSSP  ----------------------eEEEEEEEELLhhhhhhhhhllllLLLHhhHHHHhHHH


DSSP  HH---------------------------HHHHHHHHLLLEEELLllllllllhhhhhhl
Query DP---------------------------IFRALVEVDQPLYIHPatspdsmidpmleag  205
ident                                        |   |                
Sbjct FTkvknyxkkkelaqkegkeftetdlkxeVGEXVLRKKIPARXHA---------------  222
DSSP  HHhhhhhhhhhhhhhhlllllllllhhhhHHHHHHLLLLLEEEEE---------------


DSSP  llllllhhhhhHHHHHHHHHHhLHHHHLllLLEEELHhHHLHHHHhhhhhhhhhhhhhll
Query ldgaifgfgveTGMHLLRLITiGIFDKYpsLQIMVGHmGEALPYWlyrldymhqagvrsq  265
ident                 |  |                | |                     
Sbjct ----------hRADDILTAIR-IAEEFG--FNLVIEH-GTEAYKI---------------  253
DSSP  ----------lLHHHHHHHHH-HHHHHL--LLEEEEE-LLLHHHH---------------


DSSP  lllllllllllhhHHHH-HLEEEELLLLL-----------LHHHHHHHHHHHLhhHEELL
Query ryermkplkktieGYLK-SNVLVTNSGVA-----------WEPAIKFCQQVMGedRVMYA  313
ident                |      |                     |               
Sbjct ------------sKVLAeKKIPVVVGPLLtfrtklelkdlTXETIAKLLKDGV--LIALX  299
DSSP  ------------hHHHHhHLLLEEELLLLlllllhhhlllLLLHHHHHHHLLL--LEEEL


DSSP  LLLLLLLlHHHHHHHHLLL---LLHHHHHHHHLHHHHHHLLL------------------
Query MDYPYQYvADEVRAMDAMD---MSAQTKKKFFQTNAEKWFKL------------------  352
ident  | |                         |    |  |   |                  
Sbjct CDHPVIPlEFATVQAATAXrygAKEEDLLKILTVNPAKILGLedrigsiepgkdadlvvw  359
DSSP  LLLLLLLhHHHHHHHHHHHhhlLLHHHHHHLLLHHHHHHLLLlllllllllllllleeee


DSSP  -------------------------
Query -------------------------  352
ident                          
Sbjct sghpfdxksvvervyidgvevfrre  384
DSSP  lllllllllleeeeeelleeeeell


No 49: Query=4qrnA Sbjct=3qy6A Z-score=9.9

back to top
DSSP  lllllllllllllllLEEEEE-EELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhh
Query smtqdlktggeqgylRIATEE-AFATreiidvylrmirdgtadkgmvslwgfyaqspser   59
ident                 |                                           
Sbjct ---------------MIDIHChILPA----------------------------------   11
DSSP  ---------------LEELLLlLLLL----------------------------------


DSSP  hhhhhhHHHLL--LHHHHHHHHHLLLLEEEEEELllLLLLLllhhhhhhHHHHHHHHHHH
Query atqileRLLDL--GERRIADMDATGIDKAILALTspGVQPLhdldeartLATRANDTLAD  117
ident          |              ||   |                              
Sbjct ---mddGAGDSadSIEMARAAVRQGIRTIIATPH--HNNGV-----yknEPAAVREAADQ   61
DSSP  ---lllLLLLHhhHHHHHHHHHHLLLLEEELLLE--ELLLL-----lllLHHHHHHHHHH


DSSP  HHHHL-----lLLEEELLllllllhhhhhhhhhhhhhlllllleEELLLllllllllhhh
Query ACQKY-----pDRFIGMGtvapqdpewsareihrgarelgfkgiQINSHtqgryldeeff  172
ident                                              |              
Sbjct LNKRLikedipLHVLPGQ--------------------------EIRIY--------gev   87
DSSP  HHHHHhhllllLEEELLL--------------------------EEELL--------llh


DSSP  HHHHHH----hhhhLLLEEELLLlllllllhhhhhhlllllllhHHHHhhHHHHHHHhHL
Query DPIFRA----lvevDQPLYIHPAtspdsmidpmleagldgaifgFGVEtgMHLLRLItIG  228
ident                    |                        |          |    
Sbjct EQDLAKrqllslndTKYILIEFP---------------------FDHV-pRYAEQLF-YD  124
DSSP  HHHHHLlllllhhhLLEEEEELL---------------------LLLL-lLLHHHHH-HH


DSSP  HHhhLLLLLEEELHHHHL-hHHHHhhhhhhhhhhhhlllllllllllllhHHHHHHLEEE
Query IFdkYPSLQIMVGHMGEA-lPYWLyrldymhqagvrsqryermkplkktiEGYLKSNVLV  287
ident              |                                              
Sbjct LQ--LKGYIPVIAHPERNreIREN----------------------psllYHLVEKGAAS  160
DSSP  HH--HLLLEEEEELHHHLhhHHHL----------------------lhhhHHHHHLLLEE


DSSP  ELL-LLLL-------HHHHHHHHHHHLhhHEELLLLLL----LLLLhhHHHHHHLL--LL
Query TNS-GVAW-------EPAIKFCQQVMGedRVMYAMDYP----YQYVadEVRAMDAM--DM  333
ident     |                            | |               |        
Sbjct QITsGSLAgifgkqlKAFSLRLVEANL--IHFVASDAHnvktRNFH--TQEALYVLekEF  216
DSSP  EEEhHHHLllllhhhHHHHHHHHHLLL--LLEEELLLLllllLLLL--HHHHHHHHhhHH


DSSP  LHHHHHHHhLHHHHHHLLL-------------
Query SAQTKKKFfQTNAEKWFKL-------------  352
ident            |||                  
Sbjct GSELPYML-TENAELLLRNqtifrqppqpvkr  247
DSSP  LLHHHHHH-HHHHHHHHLLlllllllllllll


No 50: Query=4qrnA Sbjct=2a3lA Z-score=8.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------llllllllllLLLLLLEEEEEEEL--------
Query ----------------------------smtqdlktggEQGYLRIATEEAFA--------   24
ident                                               |             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLLLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   24
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -lhhHHHHHHhhhhhllllhhhhhhhHHHHH-lllhhhhhhhhhhhLLLHhHHHHHHHLL
Query -treIIDVYLrmirdgtadkgmvslwGFYAQ-spseratqilerllDLGErRIADMDATG   82
ident                                                       |  |  
Sbjct nlkyNPCGQS----------------RLREIflkqdnliqgrflgeITKQ-VFSDLEASK  283
DSSP  hhhhLLLLLL----------------HHHHHhlllllllllllhhhHHHH-HHHHHLLLL


DSSP  LLEEEEEEllllLLLLllhhhHHHHHHHHHHHHhhhhHHLLLLEEELLLL----------
Query IDKAILALtspgVQPLhdldeARTLATRANDTLadacQKYPDRFIGMGTV----------  132
ident    |                                   |                    
Sbjct YQMAEYRI---sIYGR-----KMSEWDQLASWI-vnnDLYSENVVWLIQLprlyniykdm  334
DSSP  LEEEEEEE---eLLLL-----LLLHHHHHHHHH-hllLLLLLLEEEEEEEellhhhhlll


DSSP  -----llLLHHHHHH---------hhhhhhHLLL--LLLEEELL----------------
Query -----apQDPEWSAR---------eihrgaRELG--FKGIQINS----------------  160
ident                                       |                     
Sbjct givtsfqNILDNIFIplfeatvdpdshpqlHVFLkqVVGFDLVDdeskperrptkhmptp  394
DSSP  llllllhHHHHHHLLhhhhhhhlhhhllllHHHHllEEEEEEELllllllllllllllll


DSSP  -----llLLLL--LLLHhHHHHHHHHHHH------LLLEEELlllllllllhhhhhhlll
Query -----htQGRY--LDEEfFDPIFRALVEV------DQPLYIHpatspdsmidpmleagld  207
ident                                       |  |                  
Sbjct aqwtnafNPAFsyYVYYcYANLYVLNKLReskgmtTITLRPH------------------  436
DSSP  lllllllLLLHhhHHHHhHHHHHHHHHHHllllllLLEELLL------------------


DSSP  llllhHHHHhHHHHHHHHHhlhhhhllllLEEELHhHHLHhHHHHhhhhhhhhhhhllll
Query gaifgFGVEtGMHLLRLITigifdkypslQIMVGHmGEALpYWLYrldymhqagvrsqry  267
ident             ||                    | |  |                    
Sbjct ---sgEAGD-IDHLAATFL---------tCHSIAH-GINL-RKSP---------------  466
DSSP  ---llLLLL-LHHHHHHHH---------hLLLLLL-LHHH-HHLH---------------


DSSP  llllllllLHHHHHH-HLEEEELLLL--------llhHHHHHHHHHHLhhHEELLLLLLL
Query ermkplkkTIEGYLK-SNVLVTNSGV--------awePAIKFCQQVMGedRVMYAMDYPY  318
ident                        |                           |    | | 
Sbjct --------VLQYLYYlAQIGLAMSPLsnnslfldyhrNPFPVFFLRGL--NVSLSTDDPL  516
DSSP  --------HHHHHHHhHLLLEEELHHhhlllllllllLLHHHHHHLLL--LEEELLLLHH


DSSP  LLL---HHHHHHHHLL----LLLHHHHHHHHlHHHHHHLLL-------------------
Query QYV---ADEVRAMDAM----DMSAQTKKKFFqTNAEKWFKL-------------------  352
ident |        |            ||         |                          
Sbjct QIHltkEPLVEEYSIAasvwKLSACDLCEIA-RNSVYQSGFshalkshwigkdyykrgpd  575
DSSP  HHLlllLHHHHHHHHHhhhhLLLHHHHHHHH-HHHHHHLLLlhhhhhhhlllllllllhh


DSSP  -----------------------------------------
Query -----------------------------------------  352
ident                                          
Sbjct gndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 51: Query=4qrnA Sbjct=1v77A Z-score=8.4

back to top
DSSP  lllllllllllllLLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqgYLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident                 |                                           
Sbjct -------------VKFIEMDIRD-------------------------------------   10
DSSP  -------------LLLEEEEELL-------------------------------------


DSSP  hhhhhhhhlllhHHHHHHHHlLLLEEEEEELllLLLLlllhhhhhhhHHHHHHHHHHHHh
Query tqilerlldlgeRRIADMDAtGIDKAILALTspGVQPlhdldeartlATRANDTLADACq  120
ident                        |                                    
Sbjct -----------kEAYELAKE-WFDEVVVSIK--FNEE---------vDKEKLREARKEY-   46
DSSP  -----------hHHHHHHHH-HLLEEEEEEE--ELLL---------lLHHHHHHHHHHH-


DSSP  hlllleEELLllllllhhhhhhhhhhhhhlllllleEELLlllllLLLLhhhhHHHHHHh
Query kypdrfIGMGtvapqdpewsareihrgarelgfkgiQINShtqgrYLDEeffdPIFRALv  180
ident                                                             
Sbjct -----gKVAI--------------------------LLSN-----PKPS-lvrDTVQKF-   68
DSSP  -----lLEEE--------------------------EEEL-----LLHH-hhhHHHHHL-


DSSP  hHLLLEEELLllllllllhhhhhhlllllllhhhhHHHHHHHHHhhhlhhhhlllLLEEE
Query eVDQPLYIHPatspdsmidpmleagldgaifgfgvETGMHLLRLitigifdkypsLQIMV  240
ident       |                                                     
Sbjct -KSYLIYVES-------------------------NDLRVIRYS--------iekGVDAI   94
DSSP  -LLLEEEEEL-------------------------LLHHHHHHH--------hhlLLLEE


DSSP  LH----hhhLHHHHHhhhhhhhhhhhhlllllllllllllHHHHHHHL-EEEELLL----
Query GH----mgeALPYWLyrldymhqagvrsqryermkplkktIEGYLKSN-VLVTNSG----  291
ident                                                  |    |     
Sbjct ISpwvnrkdPGIDHV-------------------------LAKLMVKKnVALGFSLrpll  129
DSSP  ELlllllllLLLLHH-------------------------HHHHHHHHlLEEEEELhhhh


DSSP  -----------llLHHHHHHHHHHHLhhHEELLLLLLL--LLLH-HHHHHHHLL-LLLHH
Query -----------vaWEPAIKFCQQVMGedRVMYAMDYPY--QYVA-DEVRAMDAM-DMSAQ  336
ident                 | |         |                           |   
Sbjct ysnpyeranllrfMMKAWKLVEKYKV--RRFLTSSAQEkwDVRYpRDLISLGVViGMEIP  187
DSSP  hllhhhhhhhhhhHHHHHHHHHHHLL--LEEEELLLLLhhHLLLhHHHHHHHHHlLLLHH


DSSP  HHHHHHLHHHHHHLLl
Query TKKKFFQTNAEKWFKl  352
ident   |       |   | 
Sbjct QAKASISMYPEIILK-  202
DSSP  HHHHLLLHHHHHHHL-


No 52: Query=4qrnA Sbjct=3dcpA Z-score=8.2

back to top
DSSP  llllllllllllllLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqgyLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident                                                             
Sbjct --------------XKRDGHTHTEF---------------------------------cp   13
DSSP  --------------LLEEEEELLLL---------------------------------ll


DSSP  HHHHhhhHLLLhHHHHHHHHLLLLEEEEEELllLLLLLL-------------lhhhHHHH
Query TQILerlLDLGeRRIADMDATGIDKAILALTspGVQPLH-------------dldeARTL  107
ident         |              |                                |   
Sbjct HGTH---DDVE-EXVLKAIELDFDEYSIVEH--APLSSEfxkntagdkeavttasxAXSD   67
DSSP  LLLL---LLHH-HHHHHHHHLLLLEEEEEEE--LLLLHHhhhllllllhhhhllllLHHH


DSSP  HHHHHHHHHHHHHHLL--LLEEEL------llllLLLHHHHHHHHHHhhhlllLLLEeel
Query ATRANDTLADACQKYP--DRFIGM------gtvaPQDPEWSAREIHRgarelgFKGIqin  159
ident              ||                                             
Sbjct LPYYFKKXNHIKKKYAsdLLIHIGfevdyligyeDFTRDFLNEYGPQ------TDDG---  118
DSSP  HHHHHHHHHHHHHHLLllLEEEEEeeeelllllhHHHHHHHHHHHHH------LLEE---


DSSP  llllllllllhhhhhhhhhhhhhllleEELLLLLL--LLLL-----hHHHHHLL------
Query shtqgryldeeffdpifralvevdqplYIHPATSP--DSMI-----dPMLEAGL------  206
ident                                                     |       
Sbjct ---------------------------VLSLHFLEgqGGFRsidfsaEDYNEGIvqfygg  151
DSSP  ---------------------------EEELLEEEelLEEEellllhHHHHHHLhhhhll


DSSP  -lllllHHHHHHHHHHHHHhhhlhhhhlllllEEELHH----------------------
Query -dgaifGFGVETGMHLLRLitigifdkypslqIMVGHM----------------------  243
ident                                    ||                       
Sbjct feqaqlAYLEGVKQSIEAD-------lglfkpRRXGHIslcqkfqqffgedtsdfseevx  204
DSSP  hhhhhhHHHHHHHHHHHLL-------llllllLEELLLlhhhllhhhhlllhhhllhhhh


DSSP  --hhlHHHHhhhhhhhhhhhhhlllllllllllllhhhhHHHLEEEELLL----------
Query --geaLPYWlyrldymhqagvrsqryermkplkktiegyLKSNVLVTNSG----------  291
ident                                         |                   
Sbjct ekfrvILAL-----------------------------vKKRDYELDFNTaglfkplcge  235
DSSP  hhhhhHHHH-----------------------------hHHHLLEEEEELhhhhllllll


DSSP  -LLLHHHHHHHHHHHLhhHEELLLLLL--lLLLHhHHHHHHLLLLlhhhhhhhhlhhhhh
Query -VAWEPAIKFCQQVMGedRVMYAMDYP--yQYVAdEVRAMDAMDMsaqtkkkffqtnaek  348
ident                      |  |                                   
Sbjct tYPPKKIVTLASELQI--PFVYGSDSHgvqDIGR-GYSTYCQKLE---------------  277
DSSP  lLLLHHHHHHHHHLLL--LEEEELLLLlhhHLLL-LHHHHHHHLL---------------


DSSP  hlll
Query wfkl  352
ident     
Sbjct ----  277
DSSP  ----


No 53: Query=4qrnA Sbjct=3f2bA Z-score=7.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------lllLLLLllLLLLLLLEEEEEEE-
Query ------------------------------------smtQDLKtgGEQGYLRIATEEAF-   23
ident                                                 |  |        
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaaneRQDT--APEGEKRVELHLHTp  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllLLLL--LLLLLLLLLLLLLLl


DSSP  LLHHhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhHHHHhhLLLHhHHHHHHHLLL
Query ATREiidvylrmirdgtadkgmvslwgfyaqspseratqILERllDLGErRIADMDATGI   83
ident                                                    |      | 
Sbjct MSQM-----------------------------------DAVT--SVTK-LIEQAKKWGH  140
DSSP  LLLL-----------------------------------LLLL--LHHH-HHHHHHHLLL


DSSP  LEEEEEELLllllllllhhhhhhhhhhHHHHHhHHHHHLL----LLEEELLllllllhhh
Query DKAILALTSpgvqplhdldeartlatrANDTLaDACQKYP----DRFIGMGtvapqdpew  139
ident                                                |            
Sbjct PAIAVTDHA------------------VVQSF-PEAYSAAkkhgMKVIYGL---------  172
DSSP  LLEEELLLL------------------LLLLH-HHHHHHHhhhlLLEEEEE---------


DSSP  hhhhhhhhhhlllllleEELLL-----------------------------LLLLllllh
Query sareihrgarelgfkgiQINSH-----------------------------TQGRyldee  170
ident                    |                                  |     
Sbjct -----------------EANIVddpfhvtllaqnetglknlfklvslshiqYFHR-vpri  214
DSSP  -----------------EEEEEllleeeeeeellhhhhhhhhhhhhhhhllLLLL-llle


DSSP  hhHHHHHHHhhHLLLEeellllllllllhhhhhhlllllllhhhhhhhhhhhhhhhhlhh
Query ffDPIFRALveVDQPLyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigif  230
ident                                                             
Sbjct prSVLVKHR--DGLLV--------------------------------------------  228
DSSP  ehHHHHHLL--LLEEE--------------------------------------------


DSSP  hhllllleEELH--hhHLHHhhhhhhhhhhhhhhhlllllllllllllHHHHhHHLE-EE
Query dkypslqiMVGH--mgEALPywlyrldymhqagvrsqryermkplkktIEGYlKSNV-LV  287
ident           |                                      |          
Sbjct --------GSGCdkgeLFDN----------------------------VEDI-ARFYdFL  251
DSSP  --------ELLLllllLLLL----------------------------LLLL-HHHLlLE


DSSP  ELlLLLL-------------HHHHHHHHHHHL--hhHEELLLLLL---------------
Query TNsGVAW-------------EPAIKFCQQVMG--edRVMYAMDYP---------------  317
ident                        |             |                      
Sbjct EV-HPPDvykplyvkdeemiKNIIRSIVALGEkldiPVVATGNVHylnpedkiyrkilih  310
DSSP  EE-LLHHhhlllllllhhhhHHHHHHHHHHHHhlllLEEELLLLLlllhhhhhhhhhhhh


DSSP  ---------------LLLLHhhHHHHHL--LLLLHHHHHHHHLHHHHHHLLL--------
Query ---------------YQYVAdeVRAMDA--MDMSAQTKKKFFQTNAEKWFKL--------  352
ident                          |            |     |  |   |        
Sbjct sqgganplnrhelpdVYFRT--TNEMLDcfSFLGPEKAKEIVVDNTQKIASLigdvkpik  368
DSSP  llhhhllllllllllLLLLL--HHHHHHhhHHHHHHHHHHHHLHHHHHHHHLllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct delytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishk  428
DSSP  llllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct lvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfd  488
DSSP  hhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct lpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgedn  548
DSSP  llllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct vyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvp  608
DSSP  eeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct dymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgid  668
DSSP  llllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct pktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfsel  728
DSSP  hhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct vqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvr  788
DSSP  hhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct kgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyy  848
DSSP  llllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct asyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfs  908
DSSP  hhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct fknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgkl  968
DSSP  ellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhll


DSSP  --------------------------
Query --------------------------  352
ident                           
Sbjct sktlleylesrgcldslpdhnqlslf  994
DSSP  lhhhhhhhhhllllllllllllllll


No 54: Query=4qrnA Sbjct=3au2A Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------lllllllllllllLLLEEEEEEELLhhhhhhhhhhhhh
Query ----------------------smtqdlktggeqgYLRIATEEAFATreiidvylrmird   38
ident                                                             
Sbjct yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTY-------------  347
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLL-------------


DSSP  llllhhhhhhhhhhhhlllhhhhhhhhhHHLLLHHHHHHHHHLLLLEEEEEELllLLLLL
Query gtadkgmvslwgfyaqspseratqilerLLDLGERRIADMDATGIDKAILALTspGVQPL   98
ident                                  |         |                
Sbjct --------------------------sdGQNTLEELWEAAKTMGYRYLAVTDH-sPAVRV  380
DSSP  --------------------------llLLLLHHHHHHHHHHHLLLEEEEEEE-lHHHHL


DSSP  llhhhhhHHHH-HHHHHHHHHHHHLL-----lLEEELLLLLLLlhhhHHHHhHHHHHllL
Query hdldearTLAT-RANDTLADACQKYP-----dRFIGMGTVAPQdpewSAREiHRGARelG  152
ident                                        |                |   
Sbjct ------aGGPSpEEALKRVGEIRRFNethgppYLLAGAEVDIHpdgtLDYP-DWVLR--E  431
DSSP  ------lLLLLhHHHHHHHHHHHHHHhhhlllEEEEEEEEELLllllLLLL-HHHHL--L


DSSP  LLLEEELLlLLLL-----lLLLHhhHHHHHHhhhHLLLEEELlllllllllhhhhhhlll
Query FKGIQINShTQGR-----yLDEEffDPIFRAlveVDQPLYIHpatspdsmidpmleagld  207
ident                                          |                  
Sbjct LDLVLVSV-HSRFnlpkadQTKR-lLKALEN---PFVHVLAH---------------pta  471
DSSP  LLEEEEEL-LLLLlllhhhHHHH-hHHHHLL---LLLLEELL---------------lll


DSSP  lLLLHhhhhhhhhhhHHHHhLHHHH-lLLLLEEELH-----hHHLHHhhhhhhhhhhhhh
Query gAIFGfgvetgmhllRLITiGIFDK-yPSLQIMVGH-----mGEALPywlyrldymhqag  261
ident                       | |                                   
Sbjct rLLGR-----rapieADWE-AVFQKakEKGVAVEIDgyydrmDLPDD-------------  512
DSSP  lLLLL-----lllllLLHH-HHHHHhhHHLLEEEEEllllllLLLHH-------------


DSSP  hhlllllllllllllhhHHHHHLEEEELL----------LLLL-hHHHHHHhhHHLHHHE
Query vrsqryermkplkktieGYLKSNVLVTNS----------GVAW-ePAIKFCqqVMGEDRV  310
ident                             |                          |  ||
Sbjct --------------larMAYGMGLWISLStdahqtdhlrFMELavGTAQRA--WIGPERV  556
DSSP  --------------hhhHHHHLLLLEEEElllllhhhhhHHHHhhHHHHHL--LLLLLLL


DSSP  ELlllllllllhhhhhhhhlllllhhhhhhHHLH-HHHHHLL----l
Query MYamdypyqyvadevramdamdmsaqtkkkFFQT-NAEKWFK----l  352
ident                                        | |     
Sbjct LN----------------------------TLDYeDLLSWLKarrgv  575
DSSP  HH----------------------------HLLHhHHHHHHHlllll


No 55: Query=4qrnA Sbjct=1bksA Z-score=6.7

back to top
DSSP  -llllllllllllllllEEEEEEELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhh
Query -smtqdlktggeqgylrIATEEAFATReiidvylrmirdgtadkgmvslwgfyaqspser   59
ident                                                             
Sbjct meryenlfaqlndrregAFVPFVTLGD---------------------------------   27
DSSP  lhhhhhhhhhhhhllllEEEEEEELLL---------------------------------


DSSP  hhhhhhhhHLLLhHHHHHHHhlLLLEEEEEElllLLLLL------------llhhhhhhH
Query atqilerlLDLGeRRIADMDatGIDKAILALtspGVQPL------------hdldeartL  107
ident           |        |      |                                 
Sbjct ----pgieQSLK-IIDTLID--AGADALELG---VPFSDpladgptiqnanlrafaagvT   77
DSSP  ----llhhHHHH-HHHHHHH--LLLLLEEEE---LLLLLlllllhhhhhhhhhhhhhllL


DSSP  HHHHHHHHHHHHHHLLLlEEELLLLLLLLHH--HHHHHHHHHHhLLLLLLEEELLLllll
Query ATRANDTLADACQKYPDrFIGMGTVAPQDPE--WSAREIHRGArELGFKGIQINSHtqgr  165
ident        ||    | |                        |     |             
Sbjct PAQCFEMLALIREKHPT-IPIGLLMYANLVFnnGIDAFYARCE-QVGVDSVLVADV----  131
DSSP  HHHHHHHHHHHHHHLLL-LLEEEEELHHHHHllLHHHHHHHHH-HHLLLEEEELLL----


DSSP  LLLLhhHHHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhHHHHhhhhHHHHH
Query YLDEefFDPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgFGVEtgmhLLRLI  225
ident    |    |   |                                          |||  
Sbjct PVEE--SAPFRQAALRHNIAPIFI----------------------cPPNA-dddLLRQV  166
DSSP  LHHH--LHHHHHHHHHLLLEEEEE----------------------eLLLL-lhhHHHHH


DSSP  hhlhhhhllllLEEELH---hhhLHHHHhhhhhhhhhhhhhlllllllllllllhHHHHh
Query tigifdkypslQIMVGH---mgeALPYWlyrldymhqagvrsqryermkplkktiEGYLk  282
ident                         |                              |    
Sbjct -------asygRGYTYLlalplhHLIEK-------------------------lkEYHA-  193
DSSP  -------hhhlLLLEEEllllhhHHHHH-------------------------hhHHLL-


DSSP  hlEEEELLL------LLLHhHHHHHhhhhlhhhEELLLLLLL------------------
Query snVLVTNSG------VAWEpAIKFCqqvmgedrVMYAMDYPY------------------  318
ident                     |                                       
Sbjct --APALQGFgisspeQVSA-AVRAG-------aAGAISGSAIvkiieknlaspkqmlael  243
DSSP  --LLEEELLllllhhHHHH-HHHHL-------lLEEEELLHHhhhhhhllllhhhhhhhh


DSSP  -lLLHHHHHHHHlllllhhhhhhhhlhhhhhhlll
Query -qYVADEVRAMDamdmsaqtkkkffqtnaekwfkl  352
ident    |     |                         
Sbjct rsFVSAMKAASR-----------------------  255
DSSP  hhHHHHHHHLLL-----------------------


No 56: Query=4qrnA Sbjct=1m65A Z-score=5.8

back to top
DSSP  llllllllllllllLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqgyLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident                                                             
Sbjct --------------YPVDLHMHTVA-----------------------------------   11
DSSP  --------------LLEELLLLLLL-----------------------------------


DSSP  hhhhhhHHLLLhHHHHHHHHLLLLEEEEEELLlLLLLlllhhhhhhHHHHHHHHHHHhhH
Query tqilerLLDLGeRRIADMDATGIDKAILALTSpGVQPlhdldeartLATRANDTLADacQ  120
ident          |    ||     ||                                     
Sbjct --sthaYSTLS-DYIAQAKQKGIKLFAITDHG-PDME-------daPHHWHFINMRI--W   58
DSSP  --llllLLLHH-HHHHHHHHHLLLEEEEEEEL-LLLL-------llLLLHHHHHHHH--L


DSSP  HLL---LLEEELLllllllhhhhhhHHHHHHHllLLLLEEE-lLLLLlLLLL-lhhhhhh
Query KYP---DRFIGMGtvapqdpewsarEIHRGARelGFKGIQI-nSHTQgRYLD-eeffdpi  175
ident                                       |                     
Sbjct PRVvdgVGILRGIeaniknvdgeidCSGKMFD--SLDLIIAgfHEPV-FAPHdkatntqa  115
DSSP  LLEellEEEEEEEeeelllllllllLLHHHHH--HLLEEEEelLLLL-LLLLlhhhhhhh


DSSP  hhhhhhhLLLEEellllllllllhhhhhhlllllllhhhhhhhhhhhhhhhhlhhhhlll
Query fralvevDQPLYihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkyps  235
ident                                                             
Sbjct miatiasGNVHI------------------------------------------------  127
DSSP  hhhhhhlLLLLE------------------------------------------------


DSSP  lleeeLHHHHLhhhhhhhhhhhhhhhhhlllllllllllllhhHHHHHL-EEEELLLLll
Query lqimvGHMGEAlpywlyrldymhqagvrsqryermkplkktieGYLKSN-VLVTNSGVaw  294
ident       | |                                         |         
Sbjct ----iSHPGNP----------------------kyeidvkavaEAAAKHqVALEINNS--  159
DSSP  ----eLLLLLL----------------------lllllhhhhhHHHHHHlLEEEEELL--


DSSP  hhHHHHHHHHHL--hHHEELLLLLLLLLLhhHHHHHHL--LLLLhHHHHHHHLH--HHHH
Query epAIKFCQQVMG--eDRVMYAMDYPYQYVadEVRAMDA--MDMSaQTKKKFFQT--NAEK  348
ident                  |    |        |                            
Sbjct -sNCREVAAAVRdagGWVALGSDSHTAFTmgEFEECLKilDAVDfPPERILNVSprRLLN  218
DSSP  -lLHHHHHHHHHhhlLLEEEELLLLLHHHllLLHHHHHhhHHLLlLHHHLHHHLhhHHHH


DSSP  HLL------------l
Query WFK------------l  352
ident                 
Sbjct FLEsrgmapiaefadl  234
DSSP  HHHhllllllhhhlll


No 57: Query=4qrnA Sbjct=2anuA Z-score=5.6

back to top
DSSP  llllllllllllLLLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqGYLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident               |                                             
Sbjct -----------tEWLLCDFHVHTNX-----------------------------------   14
DSSP  -----------lEEEEEEEEELLLL-----------------------------------


DSSP  hhhhhhHHLLLhHHHHHHHHLLLLEEEEEEL-----------------LLLLlllllhhh
Query tqilerLLDLGeRRIADMDATGIDKAILALT-----------------SPGVqplhdlde  103
ident        | ||          | |                                    
Sbjct ---sdgHLPLG-EVVDLFGKHGVDVVSITDHivdrrtleqrkrngeplGAIT--------   62
DSSP  ---lllLLLHH-HHHHHHHHLLLLEEEEEEEeelhhhhhhhhhlllllLLLL--------


DSSP  hHHHHHHHHHHHHHHHHHLL----LLEEELL-----------------lLLLLLHhhhhh
Query aRTLATRANDTLADACQKYP----DRFIGMG-----------------tVAPQDPewsar  142
ident            |               |                                
Sbjct -EDKFQDYLKRLWREQKRAWeeygXILIPGVeitnntdlyhivavdvkeYVDPSL-----  116
DSSP  -LLLHHHHHHHHHHHHHHHHhhhlLEEEEEEeeeelllleeeeeellllLLLLLL-----


DSSP  hhhhhhhlllllleeelllllllllllhhhHHHHHHHHHHLLLEeellllllllllhhhh
Query eihrgarelgfkgiqinshtqgryldeeffDPIFRALVEVDQPLyihpatspdsmidpml  202
ident                                 |   | |                     
Sbjct ----------------------------pvEEIVEKLKEQNALV----------------  132
DSSP  ----------------------------lhHHHHHHHHHLLLEE----------------


DSSP  hhlllllllhhhhhhhhhhhhhhhhlhhhhllllleEELH-----hhhlHHHHhhhhhhh
Query eagldgaifgfgvetgmhllrlitigifdkypslqiMVGH-----mgeaLPYWlyrldym  257
ident                                        |         |          
Sbjct ------------------------------------IAAHpdrkklswyLWAN-------  149
DSSP  ------------------------------------EELLllllllllhHHHL-------


DSSP  hhhhhhlllllllllllllhHHHHhhlEEEE-LLLLLLhhhHHHHHHHHLhhHEELLLLL
Query hqagvrsqryermkplkktiEGYLksnVLVT-NSGVAWepaIKFCQQVMGedRVMYAMDY  316
ident                     |                               |     | 
Sbjct -------------------xERFKdtfDAWEiANRDDL---FNSVGVKKY--RYVANSDF  185
DSSP  -------------------lLLLLlllLEEEeEELLEE---LHHHHHLLL--LEEEELLL


DSSP  L--LLLLhhhhhhhhlllllhhhhhhHHLH----hhhHHLLL--------------
Query P--YQYVadevramdamdmsaqtkkkFFQT----naeKWFKL--------------  352
ident                                                         
Sbjct HelWHVY-----------------swKTLVkseknieAIKEAirkntdvaiylxrk  224
DSSP  LlhHHHL-----------------leEEEEeelllhhHHHHHhhhllleeeeelll


No 58: Query=4qrnA Sbjct=3e38A Z-score=5.5

back to top
DSSP  llllLLLLlLLLL------LLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhh
Query smtqDLKTgGEQG------YLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaq   54
ident                     |                                       
Sbjct --aqRRNE-IQVPdldgytTLKCDFHXHSVF-----------------------------   28
DSSP  --llLLLL-LLLLllllleEEEEELLLLLLL-----------------------------


DSSP  lllhhhhhhhhhHHLLLhHHHHHHHHLLLLEEEEEELlLLLLllllhhhHHHHhHHHHhH
Query spseratqilerLLDLGeRRIADMDATGIDKAILALTsPGVQplhdldeARTLaTRANdT  114
ident             |      |       | |   |                       |  
Sbjct ---------sdgLVWPT-VRVDEAYRDGLDAISLTEHiEYRP------hKQDVvSDHN-R   71
DSSP  ---------lllLLLHH-HHHHHHHHLLLLEELLEEElLLLL------lLLLLlLLLL-H


DSSP  HHHHHHHLL----LLEEELLllllllhhhhhhhhhhhhhlllllleEELLL---------
Query LADACQKYP----DRFIGMGtvapqdpewsareihrgarelgfkgiQINSH---------  161
ident   | |           |                              |            
Sbjct SFDLCREQAeklgILLIKGS--------------------------EITRAxapghfnai  105
DSSP  HHHHHHHHHhhhlLEELLEE--------------------------EEELLlllleeeee


DSSP  --llllllllhHHHHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllHHHHhhhh
Query --tqgryldeeFFDPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifGFGVetgm  219
ident                 ||                                          
Sbjct flsdsnpleqkDYKDAFREAKKQGAFXFWN------------------hpgwDSQQpdtt  147
DSSP  lllllhhhlllLHHHHHHHHHHLLLEEEEL------------------llllLLLLllll


DSSP  hhHHHHhHLHHhhlLLLLEeelhhhhlhhhhhhhhhhhhhhhhhlllllllllllllhhh
Query hlLRLItIGIFdkyPSLQImvghmgealpywlyrldymhqagvrsqryermkplkktieg  279
ident                                                             
Sbjct kwWPEH-TALY---QEGCX-----------------------------------------  162
DSSP  llLHHH-HHHH---HLLLL-----------------------------------------


DSSP  hhhhlEEEE-LLLLLLhhhHHHHHHHHL--hhHEELLLLLLL-------lllHHHHhhhh
Query ylksnVLVT-NSGVAWepaIKFCQQVMG--edRVMYAMDYPY-------qyvADEVramd  329
ident             |           |             |                     
Sbjct -----HGIEvANGHLY---XPEAIQWCLdknlTXIGTSDIHQpiqtdydfekGEHR----  210
DSSP  -----LEEEeEELLEE---LLHHHHHHHhhllEEEEELLLLLlhhhhllhhhLLLL----


DSSP  lllllhhhhhhHHLH-------hHHHHLL-------------------------------
Query amdmsaqtkkkFFQT-------nAEKWFK-------------------------------  351
ident             |                                               
Sbjct ---------txTFVFakerslqgIREALDnrrtaayfhelligredllrpffekcvkiee  261
DSSP  ---------leEEEEellllhhhHHHHHHllleeeeelleeellhhhhhhhhhhheeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  351
ident                                                             
Sbjct vsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdv  321
DSSP  eeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeelllllllee


DSSP  --------------------l
Query --------------------l  352
ident                      
Sbjct nfevtnfivapdkglkytisl  342
DSSP  eeeeeeeeeelleeeeeeeel


No 59: Query=4qrnA Sbjct=2yb1A Z-score=4.6

back to top
DSSP  llllllllllllllLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh
Query smtqdlktggeqgyLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
ident                 |       |                                   
Sbjct --------------ANIDLHFHSRT-----------------------------------   11
DSSP  --------------LLEELLLLLLL-----------------------------------


DSSP  hhhHHHH--HLLLhHHHHHHhhllLLEEEEEeLLLLllllllhhhhhhhhhhHHHHHHHH
Query tqiLERL--LDLGeRRIADMdatgIDKAILAlTSPGvqplhdldeartlatrANDTLADA  118
ident               |  |           |                           | |
Sbjct -sdGALTptEVID-RAAARA----PALLALT-DHDC--------------tgGLAEAAAA   50
DSSP  -llLLLLhhHHHH-HHHLLL----LLEEEEL-LLLL--------------llLHHHHHHH


DSSP  HHHLLlLEEELLllllllhhhhhhhhhhhhhllllLLEE--------ellLLLL------
Query CQKYPdRFIGMGtvapqdpewsareihrgarelgfKGIQ--------insHTQG------  164
ident            |                                         |      
Sbjct AARRG-IPFLNG------vevsvswgrhtvhivglGIDPaepalaaglksIREGrlerar  103
DSSP  HHHLL-LLEEEE------eeeeeeelleeeeeeeeLLLLllhhhhhhhhhHHLLhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  164
ident                                                             
Sbjct qmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpg  163
DSSP  hhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllll


DSSP  ----LLLLlhhhHHHHHHHHHHLLLeeellllllllllhhhhhhlllllllhhhhhhhhh
Query ----RYLDeeffDPIFRALVEVDQPlyihpatspdsmidpmleagldgaifgfgvetgmh  220
ident                    |                                        
Sbjct yvshQWAS---lEDAVGWIVGAGGM-----------------------------------  185
DSSP  llllLLLL---hHHHHHHHHHLLLE-----------------------------------


DSSP  hhhhhhhlhhhhlllllEEELHhHHLHhHHHHhhhhhhhhhhhlllllllllllllHHHH
Query llrlitigifdkypslqIMVGHmGEALpYWLYrldymhqagvrsqryermkplkktIEGY  280
ident                      |                                      
Sbjct -----------------AVIAH-PGRYdMGRT------------------------LIER  203
DSSP  -----------------EEELL-HHHLlLLHH------------------------HHHH


DSSP  ------hhhLEEEE-LLLLLLHHHHHHHHHHHL--hHHEELLLLLLLlllhhhhhhhhll
Query ------lksNVLVT-NSGVAWEPAIKFCQQVMG--eDRVMYAMDYPYqyvadevramdam  331
ident                 ||                         |                
Sbjct lildfqaagGQGIEvASGSHSLDDMHKFALHADrhgLYASSGSDFHA------pgedvgh  257
DSSP  hhhhhhhllLLEEEeEELLLLHHHHHHHHHHHHhhlLEEEEELLLLL------lllllll


DSSP  lllhhHHHHhhlhHHHHHLLL----------
Query dmsaqTKKKffqtNAEKWFKL----------  352
ident                                
Sbjct tedlpPICR----PIWRELEArilrpadaen  284
DSSP  lllllLLLL----LHHHHLHHhlllllhhhl