Results: dupa

Query: 4ofcA

MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4ofc-A 61.7  0.0  335   335  100 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   2:  4qrn-A 36.5  2.2  303   352   25 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   3:  4hk5-D 36.3  2.6  316   380   23 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   4:  2dvt-A 35.8  2.1  295   325   22 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   5:  2gwg-A 30.1  3.0  281   329   21 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   6:  4dzi-C 29.0  3.4  314   388   22 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
   7:  3cjp-A 21.6  2.4  225   262   23 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   8:  4dlf-A 20.2  2.9  235   287   13 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   9:  3irs-A 19.8  3.0  236   281   19 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  10:  2ffi-A 19.4  2.9  235   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  11:  4mup-B 17.6  3.1  229   286   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  12:  1gkp-A 17.2  3.1  244   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  4b3z-D 17.0  3.2  247   477   11 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  14:  1yrr-B 16.0  2.9  216   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  15:  2y1h-B 15.8  3.2  214   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  16:  2vun-A 15.8  3.1  224   385   17 PDB  MOLECULE: ENAMIDASE;                                                 
  17:  4cqb-A 15.4  4.1  230   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  18:  1itq-A 15.2  3.6  232   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  19:  2paj-A 15.0  3.3  213   421   15 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  20:  3gri-A 14.9  3.1  227   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  1k6w-A 14.8  4.0  233   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  22:  2qpx-A 14.6  3.4  220   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  23:  3giq-A 14.5  3.2  224   475   10 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  24:  1onx-A 14.5  3.0  224   390   13 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  25:  3pnu-A 14.5  3.2  220   338   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  26:  2ob3-A 14.4  3.3  218   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  27:  1bf6-A 14.3  3.3  217   291   14 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  28:  3k2g-B 14.2  3.6  224   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  3ls9-A 14.2  3.9  228   453   13 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  30:  3gg7-A 14.1  3.5  208   243   15 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  31:  1j6p-A 13.9  3.4  214   407   15 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  3e74-A 13.7  3.3  222   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  33:  3mtw-A 13.7  3.5  205   404   16 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  34:  2vc5-A 13.7  3.6  220   314   14 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  35:  1a4m-A 13.5  4.1  230   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  36:  4c5y-A 13.2  3.5  209   436   13 PDB  MOLECULE: OCHRATOXINASE;                                             
  37:  2oof-A 13.2  4.1  225   403   13 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  38:  3nqb-A 13.1  3.1  205   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  39:  2ogj-A 13.0  3.4  221   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  40:  3mkv-A 12.9  3.6  208   414   14 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  41:  2imr-A 12.7  3.8  215   380   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  42:  3icj-A 12.6  4.1  217   468   15 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  43:  1a5k-C 12.5  3.1  206   566   15 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  44:  2uz9-A 12.2  3.8  210   444   14 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  45:  1j5s-A 12.0  3.5  227   451    9 PDB  MOLECULE: URONATE ISOMERASE;                                         
  46:  3iac-A 11.9  3.8  234   469    7 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  47:  4rdv-B 11.5  3.8  213   451   15 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  48:  3qy6-A 10.9  3.3  190   247   11 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  3ooq-A 10.4  3.7  194   384   18 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  2a3l-A  9.3  3.9  222   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  3dcp-A  8.2  3.5  169   277    7 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  52:  1v77-A  8.1  3.5  157   202    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  53:  1m65-A  7.7  3.7  178   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3au2-A  7.6  3.8  175   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  3f2b-A  7.4  3.5  158   994    8 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2anu-A  5.4  3.4  139   224   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  57:  2yb1-A  4.8  3.8  144   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  4.7  3.9  140   342   14 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  1bks-A  3.8  4.0  132   255    5 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4ofcA Sbjct=4ofcA Z-score=61.7

back to top
DSSP  LLEEEEEELLLLLLLLHHHHHLLLLLEEEEEEELLEEEEEELLEEEEEEEHHHLLHHHHH
Query MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRI   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRI   60
DSSP  LLEEEEEELLLLLLLLHHHHHLLLLLEEEEEEELLEEEEEELLEEEEEEEHHHLLHHHHH


DSSP  HHHHHHLLLEEEEELLHHHHLLLLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLL
Query REMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQ  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct REMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQ  120
DSSP  HHHHHHLLLEEEEELLHHHHLLLLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLL


DSSP  LHHHHHHHHHHHHHLLLLLEEEEELEELLEELLLHHHHHHHHHHHHHLLEEEEELLLLLL
Query APELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQM  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct APELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQM  180
DSSP  LHHHHHHHHHHHHHLLLLLEEEEELEELLEELLLHHHHHHHHHHHHHLLEEEEELLLLLL


DSSP  LHHHHLLLHHHHLHHHHHHHHHHHHHHLLLHHHHLLLLLEEELHHHLLHHHHHHHHHHHH
Query DGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF  240
DSSP  LHHHHLLLHHHHLHHHHHHHHHHHHHHLLLHHHHLLLLLEEELHHHLLHHHHHHHHHHHH


DSSP  HHLHHHHLLLLLLLHHHHLLLLEEELLLLLHHHHHHHHHHHLLLLEELLLLLLLLLLLLL
Query SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE  300
DSSP  HHLHHHHLLLLLLLHHHHLLLLEEELLLLLHHHHHHHHHHHLLLLEELLLLLLLLLLLLL


DSSP  LLHHHHHLLLLLHHHHHHHHLHHHHHHHLLLHHHL
Query PGKLIESMEEFDEETKNKLKAGNALAFLGLERKQF  335
ident |||||||||||||||||||||||||||||||||||
Sbjct PGKLIESMEEFDEETKNKLKAGNALAFLGLERKQF  335
DSSP  LLHHHHHLLLLLHHHHHHHHLHHHHHHHLLLHHHL


No 2: Query=4ofcA Sbjct=4qrnA Z-score=36.5

back to top
DSSP  --------------LLEEEEEELLLLLlllhhhhhlllLLEEeeeeelleeeeEELLE--
Query --------------MKIDIHSHILPKEwpdlkkrfgygGWVQlqhhskgeaklLKDGK--   44
ident                 |         |                                 
Sbjct smtqdlktggeqgyLRIATEEAFATRE---------iiDVYL-----------RMIRDgt   40
DSSP  llllllllllllllLLEEEEEEELLHH---------hhHHHH-----------HHHHHll


DSSP  ---------EEEE---------EEHHHLL-HHHHHHHHHHHLLLEEEEELLHHhHLLLL-
Query ---------VFRV---------VRENCWD-PEVRIREMDQKGVTVQALSTVPVmFSYWA-   84
ident           |             |   |  | ||  ||  |     |            
Sbjct adkgmvslwGFYAqspseratqILERLLDlGERRIADMDATGIDKAILALTSP-GVQPLh   99
DSSP  llhhhhhhhHHHHhlllhhhhhHHHHHHLlLHHHHHHHHHLLLLEEEEEELLL-LLLLLl


DSSP  LHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEE
Query KPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIG  144
ident        |    |  ||     || || | ||   | ||    |  |   |||| | || 
Sbjct DLDEARTLATRANDTLADACQKYPDRFIGMGTVAPQDPEWSAREIHRGARELGFKGIQIN  159
DSSP  LHHHHHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLHHHHHHHHHHHHHLLLLLLEEEL


DSSP  LEELLEELLLHHHHHHHHHHHHHLLEEEEELLLL---LLLHhHHLLLHHH-HLHHHHHHH
Query THVNEWDLNAQELFPVYAAAERLKCSLFVHPWDM---QMDGrMAKYWLPW-LVGMPAETT  200
ident  |     |      |   |       |  ||        |  |    |     |   || 
Sbjct SHTQGRYLDEEFFDPIFRALVEVDQPLYIHPATSpdsMIDP-MLEAGLDGaIFGFGVETG  218
DSSP  LLLLLLLLLLHHHHHHHHHHHHHLLLEEELLLLLlllLLHH-HHHHLLLLlLLHHHHHHH


DSSP  HHHHHHHLLLHHHHLLLLLEEELHHHLLHHHHHHHHHHHHHHLH----HHHLLLLLLLHH
Query IAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRP----DLCAQDNPMNPK  256
ident       |  | | | | |     | | | |    |                         
Sbjct MHLLRLITIGIFDKYPSLQIMVGHMGEALPYWLYRLDYMHQAGVrsqrYERMKPLKKTIE  278
DSSP  HHHHHHHHHLHHHHLLLLLEEELHHHHLHHHHHHHHHHHHHHHHhlllLLLLLLLLLLHH


DSSP  HHLL-LLEEELL-LLLHHHHHHHHHHHLLLLEELLLLLLLllLLLL-LLHHHHHLLlLLH
Query KYLG-SFYTDAL-VHDPLSLKLLTDVIGKDKVILGTDYPFplGELE-PGKLIESMEeFDE  313
ident  ||          |      |    | | | |    |||               |     
Sbjct GYLKsNVLVTNSgVAWEPAIKFCQQVMGEDRVMYAMDYPY--QYVAdEVRAMDAMD-MSA  335
DSSP  HHHHhLEEEELLlLLLHHHHHHHHHHHLHHHEELLLLLLL--LLLHhHHHHHHLLL-LLH


DSSP  HHHHHHHLHHHHHHHLLlhhhl
Query ETKNKLKAGNALAFLGLerkqf  335
ident  || |    ||     |     
Sbjct QTKKKFFQTNAEKWFKL-----  352
DSSP  HHHHHHHLHHHHHHLLL-----


No 3: Query=4ofcA Sbjct=4hk5D Z-score=36.3

back to top
DSSP  --lLEEEEEELLLLL--LLLHHhhhllLLLEEEEEE-eLLEEEEE---------------
Query --mKIDIHSHILPKE--WPDLKkrfgyGGWVQLQHH-sKGEAKLL---------------   40
ident      ||| |  |        |                  |  |                
Sbjct tpvVVDIHTHMYPPSyiAMLEK----rQTIPLVRTFpqADEPRLIllsselaaldaalad   56
DSSP  lllLEEEEEEELLHHhhHHHHL----lLLLLEEEEEllEEEEEEEllhhhhhhhhhhhhl


DSSP  -ellEEEEEEEHHHLLHHHHHHHHHHHLLLEEEEELLHHhHLLLLLHHHHHHHHHHHHHH
Query -kdgKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVmFSYWAKPEDTLNLCQLLNND   99
ident        |               ||  |  |   |           |          |  
Sbjct paakLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANP-WFDFLAPDEAPGIADAVNAE  115
DSSP  llllLLLEELLHHHLLHHHHHHHHHHLLLLEEEEEELLL-LLLLLLLLLHHHHHHHHHHH


DSSP  HHHHHHHLLLLEEEEELLLLLL-HHHHHHHHHHHHHLLLLLEEEEELEELLEELLLHHHH
Query LASTVVSYPRRFVGLGTLPMQA-PELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELF  158
ident           |      ||  |         ||        |   ||      |    | 
Sbjct FSDMCAQHVGRLFFFAALPLSApVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLL  175
DSSP  HHHHHHLLLLLEEEEEELLLLLlHHHHHHHHHHHHLLLLEEEEEELLLLLLLLLLLHHHH


DSSP  HHHHHHHHHLLEEEEELLLLLLLHHH------HLLLHHHHLHHHHHHHHHHHHHHLLLHH
Query PVYAAAERLKCSLFVHPWDMQMDGRM------AKYWLPWLVGMPAETTIAICSMIMGGVF  212
ident ||  |    |   | ||                   ||   | | |||||   | | |||
Sbjct PVFEAVADAKLLVFLHPHYGLPNEVYgprseeYGHVLPLALGFPMETTIAVARMYMAGVF  235
DSSP  HHHHHHHHLLLEEEELLLLLLLHHHHlllhhhLLLHHHHHLHHHHHHHHHHHHHHHLLHH


DSSP  HHLLLLLEEELHHHLLHHHHHHHHHHHHHHLHHH----hllllLLLHHHHLL-LLEEELL
Query EKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDL----caqdnPMNPKKYLG-SFYTDAL  267
ident      |    || ||  ||  |||         |                |    | || 
Sbjct DHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLvktgkvpkdRRTIWTVLKeQIYLDAV  295
DSSP  HHLLLLLEEEHHHHLLHHHHHHHHHHHHHLLHHHhhlllllllLLLHHHHHHhLEEEELL


DSSP  LLLHHHHHHHHHHHLLLLEELLLLLLLL----------llLLLL-LHHHHHLLLLLHHHH
Query VHDPLSLKLLTDVIGKDKVILGTDYPFP----------lgELEP-GKLIESMEEFDEETK  316
ident       |       | |    ||| ||                                 
Sbjct IYSEVGLQAAIASSGADRLMFGTDHPFFppieedvqgpwdSSRLnAQAVIKAVGEGSSDA  355
DSSP  LLLHHHHHHHHHHHLHHHEELLLLLLLLlllllllllllhHHHHhHHHHHHHHLLLLHHH


DSSP  HHHHLHHHHHHHlLLHHHL-------
Query NKLKAGNALAFLgLERKQF-------  335
ident       ||   |              
Sbjct AAVMGLNAVRVL-SLKAELehhhhhh  380
DSSP  HHHHLHHHHHHL-LLHHHHhhhhhhl


No 4: Query=4ofcA Sbjct=2dvtA Z-score=35.8

back to top
DSSP  --LLEEEEEELLLLllllhhhhhllllLEEEeeeelleeeeeelleEEEE-------EEH
Query --MKIDIHSHILPKewpdlkkrfgyggWVQLqhhskgeakllkdgkVFRV-------VRE   51
ident    |     |                                       |          
Sbjct mqGKVALEEHFAIP-------------ETLQ-------------dsAGFVpgdywkeLQH   34
DSSP  llLEEEEEEEELLH-------------HHHH-------------hhLLLLlllhhhhHHH


DSSP  HHLLH-HHHHHHHHHHLLLEEEEELLHHHHLLLLLHHHHHHHHHHHHHHHHHHHHHLLLL
Query NCWDP-EVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRR  110
ident    |    |   ||  |     ||                      |  ||      | |
Sbjct RLLDIqDTRLKLMDAHGIETMILSLNAPAVQAIPDRRKAIEIARRANDVLAEECAKRPDR   94
DSSP  HHHLLlLHHHHHHHHLLEEEEEEEELLLHHHHLLLHHHHHHHHHHHHHHHHHHHHHLLLL


DSSP  EEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEELEEL------LEELLLHHHHHHHHHH
Query FVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVN------EWDLNAQELFPVYAAA  164
ident |     || | |  |  |  |||  ||| |                        |     
Sbjct FLAFAALPLQDPDAATEELQRCVNDLGFVGALVNGFSQegdgqtPLYYDLPQYRPFWGEV  154
DSSP  EEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEELLLLllllllLLLLLLHHHHHHHHHH


DSSP  HHHLLEEEEELLLLLL--LHHHH-LLLHHH-HLHHHHHHHHHHHHHHLLLHHHHLLLLLE
Query ERLKCSLFVHPWDMQM--DGRMA-KYWLPW-LVGMPAETTIAICSMIMGGVFEKFPKLKV  220
ident | |      ||               ||         ||          | |   | |  
Sbjct EKLDVPFYLHPRNPLPqdSRIYDgHPWLLGpTWAFAQETAVHALRLMASGLFDEHPRLNI  214
DSSP  HHHLLLEEEELLLLLHhhLHHHLlLHHHLHhHLHHHHHHHHHHHHHHHLLHHHHLLLLLE


DSSP  EELHHHLLHHHHHHHHHHH---hhHLHHhhlLLLLLLHHHH-LLLLEEELL-LLLHHHHH
Query CFAHGGGAFPFTVGRISHG---fsMRPDlcaQDNPMNPKKY-LGSFYTDAL-VHDPLSLK  275
ident    | |   |    || |        |             |    |            | 
Sbjct ILGHMGEGLPYMMWRIDHRnawvkLPPR---YPAKRRFMDYfNENFHITTSgNFRTQTLI  271
DSSP  EELHHHLLHHHHHHHHHHLlllllLLLL---LLLLLLHHHHhHHHEEEELLlLLLHHHHH


DSSP  HHHHHHLLLLEELLLLLLLllLLLL-LLHHHHHLlLLLHHHHHHHHLHHHHHHHLLLhhh
Query LLTDVIGKDKVILGTDYPFplGELE-PGKLIESMeEFDEETKNKLKAGNALAFLGLErkq  334
ident      || |     || ||                   |    |    ||     |    
Sbjct DAILEIGADRILFSTDWPF--ENIDhASDWFNAT-SIAEADRVKIGRTNARRLFKLD---  325
DSSP  HHHLLLLHHHEELLLLLLL--LLHHhHHHHHHHL-LLLHHHHHHHHLHHHHHHLLLL---


DSSP  l
Query f  335
ident  
Sbjct -  325
DSSP  -


No 5: Query=4ofcA Sbjct=2gwgA Z-score=30.1

back to top
DSSP  LLEEEEEEL-LLLL--LLLHHHHHLLL--------lleEEEEeelleeeeeelleeeeee
Query MKIDIHSHI-LPKE--WPDLKKRFGYG--------gwvQLQHhskgeakllkdgkvfrvv   49
ident   |||| |                                                    
Sbjct XIIDIHGHYtTAPKalEDWRNRQIAGIkdpsvxpkvseLKIS-----------------d   43
DSSP  LLEEEEEELlLLLHhhHHHHHHHHHHHhlhhhlllhhhLLLL-----------------h


DSSP  ehhhlLHHH-HHHHHHHHLLLEEEEELLHhhhlllLLHHHHHHHHHHHHHHHHHHHHHLL
Query rencwDPEV-RIREMDQKGVTVQALSTVPvmfsywAKPEDTLNLCQLLNNDLASTVVSYP  108
ident                   |      |                      |          |
Sbjct delqaSIIEnQLKKXQERGSDLTVFSPRA------GDFNVSSTWAAICNELCYRVSQLFP   97
DSSP  hhhhhHHHLlHHHHHHHHLLLEEEEELLL------LLHHHHHHHHHHHHHHHHHHHHHLL


DSSP  LLEEEEELLLLL---LHHHHHHHHHHHHHLLLLLEEEEELEEL-----LEELLLHHHHHH
Query RRFVGLGTLPMQ---APELAVKEMERCVKELGFPGVQIGTHVN-----EWDLNAQELFPV  160
ident   | |   ||      |     | | |||| ||                  |      | 
Sbjct DNFIGAAXLPQSpgvDPKTCIPELEKCVKEYGFVAINLNPDPSgghwtSPPLTDRIWYPI  157
DSSP  LLEEEEEELLLLlllLHHHHHHHHHHHHHLLLLLEEEELLLLLlllllLLLLLLHHHHHH


DSSP  HHHHHHHLLEEEEELLlllllhhhhlllhHHHLhHHHHHHHHHHHHHLLLHHHHLLLLLE
Query YAAAERLKCSLFVHPWdmqmdgrmakywlPWLVgMPAETTIAICSMIMGGVFEKFPKLKV  220
ident |     |      |                         | |      |  |  || || 
Sbjct YEKXVELEIPAXIHVS-------------TGAH-YLNADTTAFXQCVAGDLFKDFPELKF  203
DSSP  HHHHHHHLLLEEELLL-------------LLLH-HHHHHHHHHHHHHHLLHHHHLLLLLE


DSSP  EELHHHLLHHHHHHHHHHHHHHLHhhhllllLLLHHH-HLLLLEEELLLLLHHHHHHHHH
Query CFAHGGGAFPFTVGRISHGFSMRPdlcaqdnPMNPKK-YLGSFYTDALVHDPLSLKLLTD  279
ident    ||||| |   ||                        |     |  |       ||  
Sbjct VIPHGGGAVPYHWGRFRGLAQEXK-------KPLLEDhVLNNIFFDTCVYHQPGIDLLNT  256
DSSP  EELHHHLLLHHHHHHHHHHHHHLL-------LLLHHHhLLLLEEEELLLLLHHHHHHHHH


DSSP  HHLLLLEELLLLLLLLL---------lLLLLLHHHHHLLLLLHHHHHHHHLHHHHHHHL-
Query VIGKDKVILGTDYPFPL---------gELEPGKLIESMEEFDEETKNKLKAGNALAFLG-  329
ident ||  | |                           ||       | |     |||      
Sbjct VIPVDNVLFASEXIGAVrgidprtgfyYDDTKRYIEASTILTPEEKQQIYEGNARRVYPr  316
DSSP  HLLHHHEELLLLLLLLLlleelllleeLLLLHHHHHHLLLLLHHHHHHHHLHHHHHHLHh


DSSP  LLHHHL-------
Query LERKQF-------  335
ident |            
Sbjct LDAALKakgkleh  329
DSSP  HHHHHHhhhhhll


No 6: Query=4ofcA Sbjct=4dziC Z-score=29.0

back to top
DSSP  ----LLEEEEEELLLLLL---LLHHHHHlLLLLEEEEEEELleeEEEE-LLEE-EEEE--
Query ----MKIDIHSHILPKEW---PDLKKRFgYGGWVQLQHHSKgeaKLLK-DGKV-FRVV--   49
ident       ||   |           | | |     ||     |        |    |     
Sbjct alnyRVIDVDNHYYEPLDsftRHLDKKF-KRRGVQMLSDGK-rtWAVIgDRVNhFIPNpt   58
DSSP  llllLEEEEEEELLLLLLlllLLLLHHH-LLLLEEEEELLL-leEEEElLEELlLLLLll


DSSP  -----------------------------------EHHHLLHHHHHHHHHHHLLLEEEEE
Query -----------------------------------RENCWDPEVRIREMDQKGVTVQALS   74
ident                                             ||  ||          
Sbjct fdpiivpgcldllfrgeipdgvdpaslmkverladHPEYQNRDARIAVMDEQDIETAFML  118
DSSP  llleelllllhhhhhllllllllhhhllleelhhhLHHHLLHHHHHHHHHHHLEEEEEEE


DSSP  LL--HHHH--LLLLlHHHHHHHHHHHHHHHHHHHH--HLLLLEEEEELLLLLLHHHHHHH
Query TV--PVMF--SYWAkPEDTLNLCQLLNNDLASTVV--SYPRRFVGLGTLPMQAPELAVKE  128
ident                 | |       |  |           |           |  || |
Sbjct PTfgCGVEeaLKHD-IEATMASVHAFNLWLDEDWGfdRPDHRIIAAPIVSLADPTRAVEE  177
DSSP  LLhhHHHHhhLLLL-HHHHHHHHHHHHHHHHHHLLllLLLLLEEELLLLLLLLHHHHHHH


DSSP  HHHHHHlLLLLEEEEELEEL-----LEELLLHHHHHHHHHHHHHLLEEEEEL--LLLL--
Query MERCVKeLGFPGVQIGTHVN-----EWDLNAQELFPVYAAAERLKCSLFVHP--WDMQ--  179
ident         |   |               |      || |           |         
Sbjct VDFVLA-RGAKLVLVRPAPVpglvkPRSLGDRSHDPVWARLAEAGVPVGFHLsdSGYLhi  236
DSSP  HHHHHH-LLLLLEELLLLLLlllllLLLLLLHHHHHHHHHHHHHLLLEEEELllLLLHhh


DSSP  LLHH--hHLLLHHhHLHHHHHHHHHHHHHHLLLHHHHLLLLLEEE-LHHHlLHHHH-HHH
Query MDGR--mAKYWLPwLVGMPAETTIAICSMIMGGVFEKFPKLKVCF-AHGGgAFPFT-VGR  235
ident                            |||  |||   ||||      |   |      |
Sbjct AAAWggaKDPLDQ-VLLDDRAIHDTMASMIVHGVFTRHPKLKAVSiENGS-YFVHRlIKR  294
DSSP  HHHLlllLLHHHH-HHHLLHHHHHHHHHHHHLLHHHHLLLLLEEEeLLLL-LHHHHhHHH


DSSP  HHHHHHHLHHHHllllLLLHHHHLLL-LEEElLLLLhHHHHHHHHHHLLLLEELLLLLLL
Query ISHGFSMRPDLCaqdnPMNPKKYLGS-FYTDaLVHDpLSLKLLTDVIGKDKVILGTDYPF  294
ident         |       |  |   |               |  |  ||| ||   | | | 
Sbjct LKKAANTQPQYF----PEDPVEQLRNnVWIA-PYYE-DDLPELARVIGVDKILFGSDWPH  348
DSSP  HHHHHHHLHHHL----LLLHHHHHHHhEEEL-LLLL-LLHHHHHHHHLHHHLLLLLLLLL


DSSP  LLLLLLLLHHHHHLLLLLHHHHHHHHLHHHHHHHLllhhhl
Query PLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGlerkqf  335
ident   |   |         | |    |    |||  ||      
Sbjct GEGLASPVSFTAELKGFSESDIRKIMRDNALDLLG-vqvgs  388
DSSP  LLLLLLHHHHHHHHLLLLHHHHHHHHLHHHHHHHL-lllll


No 7: Query=4ofcA Sbjct=3cjpA Z-score=21.6

back to top
DSSP  lLEEEEEELlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH
Query mKIDIHSHIlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
ident   || | |                                                |  |
Sbjct lIIDGHTHV-------------------------------------------ILPVEKHI   17
DSSP  lLEEEEEEL-------------------------------------------LLLHHHHH


DSSP  HHHHHHLLLEEEEELL-------------------HHHH----LLLLlhhhhHHHHHHHH
Query REMDQKGVTVQALSTV-------------------PVMF----SYWAkpedtLNLCQLLN   97
ident   ||  ||    |                                               
Sbjct KIMDEAGVDKTILFSTsihpetavnlrdvkkemkkLNDVvngkTNSM-----IDVRRNSI   72
DSSP  HHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhHHHHhlllLLLL-----HHHHHHHH


DSSP  HHHHHHHHHLLLLEEEEELLLLLL-HHHHHHHHHHHHHLLLLLEEE-EELEellEELLLh
Query NDLASTVVSYPRRFVGLGTLPMQA-PELAVKEMERCVKELGFPGVQ-IGTHvneWDLNAq  155
ident   |      || | || |  |            |         |                
Sbjct KELTNVIQAYPSRYVGFGNVPVGLsENDTNSYIEENIVNNKLVGIGeLTPA--sGQIKS-  129
DSSP  HHHHHHHHHLLLLEEEEELLLLLLlHHHHHHHHHHHLLLLLLLEEEeELLL--lLLHHH-


DSSP  hHHHHHHHHHHH-LLEEEEELllllllhhhhlllhhhhlhhHHHHHH-HHHHHHllLHHH
Query eLFPVYAAAERL-KCSLFVHPwdmqmdgrmakywlpwlvgmPAETTI-AICSMImgGVFE  213
ident  | |               |                             |          
Sbjct -LKPIFKYSMDSgSLPIWIHA--------------------FNPLVLqDIKEIA--ELCK  166
DSSP  -HHHHHHHHHHLlLLLEEELL--------------------LLLLLHhHHHHHH--HHHH


DSSP  HLLLLLEEELHHHLLHHHHhhhhhhhhhhlhhhhlllllllhhHHLL---LLEEELL-LL
Query KFPKLKVCFAHGGGAFPFTvgrishgfsmrpdlcaqdnpmnpkKYLG---SFYTDAL-VH  269
ident  |||  |   | ||    |                                 | |     
Sbjct AFPKVPVILGHMGGSNWMT----------------------avELAKeiqNLYLDTSaYF  204
DSSP  HLLLLLEEEHHHHHHHHHH----------------------hhHHHHhllLEEEELLlLL


DSSP  LHHHHHHHHHHhLLLLEELLLLLLLllLLLL-LLHHHHHLllLLHHHHHHHHLHHHHHHH
Query DPLSLKLLTDViGKDKVILGTDYPFplGELE-PGKLIESMeeFDEETKNKLKAGNALAFL  328
ident     ||         | | ||| ||  | |      |  |   |    |     |    |
Sbjct STFVLKIVINE-LPLKCIFGTDMPF--GDLQlSIEAIKKM-sNDSYVANAVLGDNISRLL  260
DSSP  LHHHHHHHHHH-LLLLEELLLLLLL--LLHHhHHHHHHHH-lLLHHHHHHHHLHHHHHHH


DSSP  LLlhhhl
Query GLerkqf  335
ident        
Sbjct NI-----  262
DSSP  LL-----


No 8: Query=4ofcA Sbjct=4dlfA Z-score=20.2

back to top
DSSP  -lLEEEEEELLLLLlllhhhhhllllLEEEeeeelleeeeeelleEEEE--EEHHhlLHH
Query -mKIDIHSHILPKEwpdlkkrfgyggWVQLqhhskgeakllkdgkVFRV--VRENcwDPE   57
ident    || | |                                           |     | 
Sbjct alRIDSHQHFWRYR-----------aADYP------------wigAGMGvlARDY--LPD   35
DSSP  llLEEEEELLLLLL-----------hHHLL------------lllLLLHhhLLLL--LHH


DSSP  HHHHHHHHHLLLEEEEELLHHhhlllllhhhhhhhHHHHHHHHHHHHHHlLLLE-EEEEL
Query VRIREMDQKGVTVQALSTVPVmfsywakpedtlnlCQLLNNDLASTVVSyPRRF-VGLGT  116
ident      |                                    |         |     | 
Sbjct ALHPLMHAQALGASIAVQARA--------------GRDETAFLLELACD-EARIaAVVGW   80
DSSP  HHHHHHHHLLLLEEEEELLLL--------------LHHHHHHHHHHHLL-LLLEeEEEEL


DSSP  LLLLLhHHHHHHHHHHhHLLLLLEEEEEL-EELL--EELLLHHHHHHHHHHHHHLLEEEE
Query LPMQApELAVKEMERCvKELGFPGVQIGT-HVNE--WDLNAQELFPVYAAAERLKCSLFV  173
ident     |                  |                        |          |
Sbjct EDLRA-PQLAERVAEW-RGTKLRGFRHQLqDEADvrAFVDDADFARGVAWLQANDYVYDV  138
DSSP  LLLLL-LLHHHHHHLL-LLLLEEEEEELHhHLLLhhHHHHLHHHHHHHHHHHHLLLEEEE


DSSP  ELllllllhhhhlllhhhhlhhhhhHHHHHHHHHllLHHHHLLLLLEEELHHHLL-----
Query HPwdmqmdgrmakywlpwlvgmpaeTTIAICSMImgGVFEKFPKLKVCFAHGGGA-----  228
ident                                                   | |       
Sbjct LV-----------------------FERQLPDVQ--AFCARHDAHWLVLDHAGKPalaef  173
DSSP  LL-----------------------LHHHHHHHH--HHHHHLLLLLEEEHHHHLLlhhhl


DSSP  --------hHHHHhhhhhhhhhlhhhhlllllllhHHHLLL--LEEELLLL---------
Query --------fPFTVgrishgfsmrpdlcaqdnpmnpKKYLGS--FYTDALVH---------  269
ident                                                             
Sbjct drddtalarWRAA---------------------lRELAALphVVCKLSGLvteadwrrg  212
DSSP  lllllhhhhHHHH---------------------hHHHHLLllEEEEELLLlllllllll


DSSP  --------LHHHHHHHHHHHLLLLEELLLLLLLLL---lLLLLLHHHHHL--LLLLHHHH
Query --------DPLSLKLLTDVIGKDKVILGTDYPFPL---gELEPGKLIESM--EEFDEETK  316
ident             |    |  |      | | |  |      |   | |            
Sbjct lrasdlrhIEQCLDAALDAFGPQRLMFGSDWPVCLlaasYDEVASLVERWaeSRLSAAER  272
DSSP  llhhhhhhHHHHHHHHHHHHLHHHEEELLLLLHHHhlllHHHHHHHHHHHhhHHLLHHHH


DSSP  HHHHLHHHHHHHLLLhhhl
Query NKLKAGNALAFLGLErkqf  335
ident   |  | |     |     
Sbjct SALWGGTAARCYALP----  287
DSSP  HHHLLHHHHHHLLLL----


No 9: Query=4ofcA Sbjct=3irsA Z-score=19.8

back to top
DSSP  -LLEEEEEEL---LLLLlllhhhhhllllleeeeeeellEEEEeelleEEEE--------
Query -MKIDIHSHI---LPKEwpdlkkrfgyggwvqlqhhskgEAKLlkdgkVFRV--------   48
ident    ||                                             |         
Sbjct lKIIDFRLRPpamGFLN-------------------ariYTRP-----DIRNrftrqlgf   36
DSSP  lLLEELLLLLllhHHHH-------------------lhhHHLH-----HHHHhhhhhhll


DSSP  ------EEHHhllHHHHHHHHHHHLLLEEEEELLhhHHLLlllhhhhhhhhhHHHHHHHH
Query ------VRENcwdPEVRIREMDQKGVTVQALSTVpvMFSYwakpedtlnlcqLLNNDLAS  102
ident               |    ||   |             |               | | | 
Sbjct epapsaEEKS---LELMFEEMAAAGIEQGVCVGR--NSSV---------lgsVSNADVAA   82
DSSP  lllhhhHHLL---HHHHHHHHHHLLLLEEEEELL--EELL---------leeLLHHHHHH


DSSP  HHHHLLLLEEEEELLLLLLHHHHHHHHHHHHhLLLLLEEEEELEE--LLEELLLHHHHHH
Query TVVSYPRRFVGLGTLPMQAPELAVKEMERCVkELGFPGVQIGTHV--NEWDLNAQELFPV  160
ident     ||  |   |         |   |      ||   |     |           | | 
Sbjct VAKAYPDKFHPVGSIEAATRKEAMAQMQEIL-DLGIRIVNLEPGVwaTPMHVDDRRLYPL  141
DSSP  HHHHLLLLEEEEEELLLLLHHHHHHHHHHHH-HLLLLLEEELHHHllLLLLLLLHHHHHH


DSSP  HHHHHHHLLEEEEEL---LLLLllhhhhlllhhhhlhhhHHHHhhHHHHHllLHHHHLLL
Query YAAAERLKCSLFVHP---WDMQmdgrmakywlpwlvgmpAETTiaICSMImgGVFEKFPK  217
ident ||  |                                    |           |   || 
Sbjct YAFCEDNGIPVIMMTggnAGPD----------------iTYTN--PEHID--RVLGDFPD  181
DSSP  HHHHHHLLLLEEEELlllLLLL----------------hHHHL--HHHHH--HHHHHLLL


DSSP  LLEEELHHHLLHHHHhhhhhhhhhhlhhhhlllllllhHHHLlLLEEELL--LLLHHHHH
Query LKVCFAHGGGAFPFTvgrishgfsmrpdlcaqdnpmnpKKYLgSFYTDAL--VHDPLSLK  275
ident | |   ||                                     |              
Sbjct LTVVSSHGNWPWVQE------------------iihvaFRRP-NLYLSPDmyLYNLPGHA  222
DSSP  LLEEEEHHHLLLHHH------------------hhhhhHHLL-LEEEELHhhHLLLLLHH


DSSP  HHHHH---hLLLLEELLLLLLLllLLLL-LLHHHHHLlLLLHHHHHHHHLHHHHHHHLLl
Query LLTDV---iGKDKVILGTDYPFplGELE-PGKLIESMeEFDEETKNKLKAGNALAFLGLe  331
ident            |    || ||     |                   |   |||   |   
Sbjct DFIQAansfLADRMLFGTAYPM--CPLKeYTEWFLTL-PIKPDAMEKILHGNAERLLAQ-  278
DSSP  HHHHHhllhHHHLLLLLLLLLL--LLHHhHHHHHHLL-LLLHHHHHHHHLHHHHHHHHH-


DSSP  hhhl
Query rkqf  335
ident     
Sbjct -agr  281
DSSP  -lll


No 10: Query=4ofcA Sbjct=2ffiA Z-score=19.4

back to top
DSSP  ---lLEEEEEELLLL-LLLLhhhhhlllllEEEEeeelleeeeeelleeEEEEEHhhLLH
Query ---mKIDIHSHILPK-EWPDlkkrfgyggwVQLQhhskgeakllkdgkvFRVVREncWDP   56
ident      || | |                    |                            
Sbjct lhltAIDSHAHVFSRgLNLA----------SQRR---------------YAPNYD--APL   33
DSSP  llllLEELLLLLLLHhHHHH----------LLLL---------------LLLLLL--LLH


DSSP  HHHHHHHHHHLLLEEEEELLHHHHlllllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEEL
Query EVRIREMDQKGVTVQALSTVPVMFsywakpedtlnlcqlLNNDLASTVVSYPRRFVGLGT  116
ident           |     |                       |  | |     |    |   
Sbjct GDYLGQLRAHGFSHGVLVQPSFLG--------------tDNRYLLSALQTVPGQLRGVVX   79
DSSP  HHHHHHHHHLLLLEELLLLLHHHL--------------lLLHHHHHHHHHLLLLLLLLLL


DSSP  LLllLHHHhHHHHHHHHHlLLLLEEEEEL-eELLEELLLHHHHHHHHHHHHHLLEEEEEL
Query LPmqAPELaVKEMERCVKeLGFPGVQIGT-hVNEWDLNAQELFPVYAAAERLKCSLFVHP  175
ident |                  ||  ||          ||      |              | 
Sbjct LE--RDVE-QATLAEXAR-LGVRGVRLNLxgQDXPDLTGAQWRPLLERIGEQGWHVELHR  135
DSSP  LL--LLLL-HHHHHHHHL-LLLLEEELLLllLLLLLLLLLLLHHHHHHHHHHLLEEEELL


DSSP  llllllhhhhlllhhhhlhhhhHHHHhHHHHHLLlHHHHLllLLEEELHHHLL-------
Query wdmqmdgrmakywlpwlvgmpaETTIaICSMIMGgVFEKFpkLKVCFAHGGGA-------  228
ident                            |              |     | |         
Sbjct ----------------------QVAD-IPVLVRA-LQPYG--LDIVIDHFGRPdarrglg  169
DSSP  ----------------------LLLL-HHHHHHH-HLLLL--LLEEELHHHLLlllllll


DSSP  --HHHHHhhhhhhhhhlhhhhlllllllhHHHLLLLEEELLLL-------------LHHH
Query --FPFTVgrishgfsmrpdlcaqdnpmnpKKYLGSFYTDALVH-------------DPLS  273
ident                                  |                          
Sbjct qpGFAEL--------------------ltLSGRGKVWVKVSGIyrlqgspeenlafARQA  209
DSSP  llLHHHH--------------------llLLLLLLEEEEEELHhhllllhhhhhhhHHHH


DSSP  HHHHHHHHLLLLEELLLLLLLLL-----lLLLLLHHHHHLLlLLHHHHHHHHLHHHHHHH
Query LKLLTDVIGKDKVILGTDYPFPL-----gELEPGKLIESMEeFDEETKNKLKAGNALAFL  328
ident |  |    |      | | |                 |            |    | |  
Sbjct LCALEAHYGAERLXWGSDWPHTQhesevsFGSAVEQFEALG-CSAQLRQALLLDTARALF  268
DSSP  HHHHHHHLLHHHEEEELLLLLLLllllllHHHHHHHHHHHL-LLHHHHHHHHLHHHHHHL


DSSP  lLLHHHl
Query gLERKQf  335
ident        
Sbjct -GFELE-  273
DSSP  -LLLLL-


No 11: Query=4ofcA Sbjct=4mupB Z-score=17.6

back to top
DSSP  ----------------lLEEEEEELLLLLLllhhhhhlllLLEEEeeeelleeeeeelle
Query ----------------mKIDIHSHILPKEWpdlkkrfgygGWVQLqhhskgeakllkdgk   44
ident                    |   |                                    
Sbjct lvrklsgtapnpafprgAVDTQMHMYLPGY-------palPGGPG---------------   38
DSSP  lllllllllllllllllLEELLLLLLLLLL-------lllLLLLL---------------


DSSP  eeEEEEHHhlLHHHHHHHHHHHLLLEEEEELLHHHHLllllhhhhhhhhhhHHHHHHHHH
Query vfRVVRENcwDPEVRIREMDQKGVTVQALSTVPVMFSywakpedtlnlcqlLNNDLASTV  104
ident            ||   | |   |                             |      |
Sbjct -lPPGALP--GPEDYRRLMQWLGIDRVIITQGNAHQR--------------DNGNTLACV   81
DSSP  -lLLLLLL--LHHHHHHHHHHHLLLEEEEELLHHHLL--------------LLHHHHHHH


DSSP  HHLLLLEEEEELLLlllhHHHHH-HHHHHHhLLLLLEEEEELE-elleELLLhhHHHHHH
Query VSYPRRFVGLGTLPmqapELAVK-EMERCVkELGFPGVQIGTH-vnewDLNAqeLFPVYA  162
ident                          ||      |  |  |         |    |  |  
Sbjct AEMGEAAHAVVIID----ATTTEkDMEKLT-AAGTVGARIMDLpggavNLSE--LDAVDE  134
DSSP  HHHHHHEEEEELLL----LLLLHhHHHHHH-HLLEEEEEEELLlllllLHHH--HHHHHH


DSSP  HHHHHLLEEEEELllllllhhhhlllhhhhlhhhhHHHHhHHHHHllLHHHHLlLLLEEE
Query AAERLKCSLFVHPwdmqmdgrmakywlpwlvgmpaETTIaICSMImgGVFEKFpKLKVCF  222
ident  |        |                                        |       |
Sbjct RAHAADWMVAVQF----------------------DGNG-LLDHL--PRLQKI-RSRWVF  168
DSSP  HHHHLLLEEEEEL----------------------LHHH-HHHHH--HHHHLL-LLEEEE


DSSP  LHHHLLhhHHHHHHHhhhhhlhhhhlllllllhHHHLLL-----LEEELLLL--------
Query AHGGGAfpFTVGRIShgfsmrpdlcaqdnpmnpKKYLGS-----FYTDALVH--------  269
ident  | |                                |                       
Sbjct DHHGKFfkGIRTDGP----------------emAALLKLidrgnLWFKFAGVyessrksw  212
DSSP  LHHHHLllLLLLLLH----------------hhHHHHHHhhhllEEEEELLHhhllllll


DSSP  ----LHHHHHHHHHHhLLLLEELLLLLLLLL-------LLLL-LLHHHHHLllLLHHHHH
Query ----DPLSLKLLTDViGKDKVILGTDYPFPL-------GELE-PGKLIESMeeFDEETKN  317
ident                        ||  |                  |       ||    
Sbjct pyadVAAFSRVIAAH-APERIVWGTNWPHNSvretaayPDDArLAELTLGW-lPDEAARH  270
DSSP  llhhHHHHHHHHHHH-LHHHEEELLLLLLLLlllhhhlLLHHhHHHHHHLL-lLLHHHHH


DSSP  HHHLHHHHHHHLLLHHhl
Query KLKAGNALAFLGLERKqf  335
ident      |  |   |     
Sbjct RALVENPEALFKLSPV--  286
DSSP  HHHLHHHHHHHLLLLL--


No 12: Query=4ofcA Sbjct=1gkpA Z-score=17.2

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------MKIDIHSH    8
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLLlllllhhhhhlllllEEEEeeelleeeeeelleeeeeEEHHhlLHHHHHHHHHHHLL
Query ILPkewpdlkkrfgyggwVQLQhhskgeakllkdgkvfrvVRENcwDPEVRIREMDQKGV   68
ident |                                               |         | 
Sbjct IYL--------------pFMAT------------------FAKD--THETGSKAALMGGT   86
DSSP  LLL--------------eELLE------------------ELLL--LHHHHHHHHHHLLE


DSSP  LEEEEELLhhHHLLlllhhhhhHHHHHHHHHHHHHHHHL-lLLEEEEELLLLLLhHHHHH
Query TVQALSTVpvMFSYwakpedtlNLCQLLNNDLASTVVSY-pRRFVGLGTLPMQApELAVK  127
ident |                                |                     |    
Sbjct TTYIEMCC--PSRN--------DDALEGYQLWKSKAEGNsyCDYTFHMAVSKFD-EKTEG  135
DSSP  EEEEEEEL--LLLL--------LLHHHHHHHHHHHHLLLllLEEEEEEELLLLL-LLHHH


DSSP  HHHHHHHLlLLLEEEEELEELLeellLHHH-HHHHHHHHHHLLEEEEEL-----lllLLL
Query EMERCVKElGFPGVQIGTHVNEwdlnAQEL-FPVYAAAERLKCSLFVHP-----wdmQMD  181
ident      |   |     |                     |  |      |            
Sbjct QLREIVAD-GISSFXIFLSYKNffgvDDGEmYQTLRLAKELGVIVTAHCenaelvgrLQQ  194
DSSP  HHHHHHHL-LLLEEEEEELLLLllllLHHHhHHHHHHHHHHLLEEEEEEllhhhhhhHHH


DSSP  HH-----hHLLLHHhhlHHHHHHHHHHHHHHllLHHHHLLlLLEEELHHHL-LHHHhhhh
Query GR-----mAKYWLPwlvGMPAETTIAICSMImgGVFEKFPkLKVCFAHGGG-AFPFtvgr  235
ident            |        |               |          |            
Sbjct KLlsegktGPEWHE-psRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCkPALD----  246
DSSP  HHhhllllLHHHLL-llLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLhHHHH----


DSSP  hhhhhhhlhhhhlllllllhHHHL---lLLEEEL--LLLL--------------------
Query ishgfsmrpdlcaqdnpmnpKKYL---gSFYTDA--LVHD--------------------  270
ident                               |                             
Sbjct ------------------aaMAAKargvPIYIESviPHFLldktyaerggveamkyimsp  288
DSSP  ------------------hhHHHHhlllLEEEEEehHHHHllhhhhhllhhhhhllllll


DSSP  -------HHHHHHHHHhhLLLLEELLLLLLL------------------LLLL-lLLLHH
Query -------PLSLKLLTDviGKDKVILGTDYPF------------------PLGE-lEPGKL  304
ident           |              |||                               |
Sbjct plrdkrnQKVLWDALA--QGFIDTVGTDHCPfdteqkllgkeaftaipnGIPAieDRVNL  346
DSSP  lllllhhHHHHHHHHH--LLLLLEEELLLLLllhhhhhhhlllhhhlllLLLLllLHHHH


DSSP  H-HHLL---LLLHHHHHHHHLHHHHHHHLLLHHH--------------------------
Query I-ESME---EFDEETKNKLKAGNALAFLGLERKQ--------------------------  334
ident            |           |    ||                              
Sbjct LyTYGVsrgRLDIHRFVDAASTKAAKLFGLFPRKgtiavgsdadlvvydpqyrgtisvkt  406
DSSP  HhHHHLlllLLLHHHHHHHHLHHHHHHLLLLLLLlllllllllleeeeelllleellhhh


DSSP  ---------------------------------------------------l
Query ---------------------------------------------------f  335
ident                                                     
Sbjct qhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  llllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 13: Query=4ofcA Sbjct=4b3zD Z-score=17.0

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------MKIDIHS    7
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  ELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeEEHHhlLHHHHHHHHHHHL
Query HILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvVRENcwDPEVRIREMDQKG   67
ident                                                |     |     |
Sbjct YLQK-------------------------------------TAAD--DFFQGTRAALVGG   81
DSSP  LLLL-------------------------------------LLLL--LHHHHHHHHHHLL


DSSP  LLEEEEELlhhHHLLlllhhhhHHHHHHHHHHHHHHHHHL-lLLEEEEELLLLLLhHHHH
Query VTVQALSTvpvMFSYwakpedtLNLCQLLNNDLASTVVSY-pRRFVGLGTLPMQApELAV  126
ident  |                                                          
Sbjct TTMIIDHV---VPEP-------GSSLLTSFEKWHEAADTKscCDYSLHVDITSWY-DGVR  130
DSSP  EEEEEEEE---LLLL-------LLLHHHHHHHHHHHHHLLllLEEEEEEELLLLL-LLHH


DSSP  HHHHHHHHLLLLLEEEEELEELL--EELLlHHHHHHHHHHHHHLLEEEEELL---lLLLL
Query KEMERCVKELGFPGVQIGTHVNE--WDLNaQELFPVYAAAERLKCSLFVHPW---dMQMD  181
ident  | |  |   |    |                |         |     ||          
Sbjct EELEVLVQDKGVNSFQVYMAYKDvyQMSD-SQLYEAFTFLKGLGAVILVHAEngdlIAQE  189
DSSP  HHHHHHHHLLLLLEEEEELLLLLllLLLH-HHHHHHHHHHHHHLLEEEEELLlhhhHHHH


DSSP  -HHHH------LLLHHhhlHHHHHHHHHHHHHHllLHHHHLLlLLEEELHHHL-LHHHhh
Query -GRMA------KYWLPwlvGMPAETTIAICSMImgGVFEKFPkLKVCFAHGGG-AFPFtv  233
ident   |                        |    |            |              
Sbjct qKRILemgitgPEGHA-lsRPEELEAEAVFRAI--TIAGRIN-CPVYITKVMSkSAAD--  243
DSSP  hHHHHhlllllLHHHH-hhLLHHHHHHHHHHHH--HHHHHHL-LLEEEEEELLhHHHH--


DSSP  hhhhhhhhhlhhhhlllllllhHHHL---lLLEEEL--LLLL------------------
Query grishgfsmrpdlcaqdnpmnpKKYL---gSFYTDA--LVHD------------------  270
ident                                                             
Sbjct --------------------iiALARkkgpLVFGEPiaASLGtdgthywsknwakaaafv  283
DSSP  --------------------hhHHHHhhllLEEEEElhHHHHlllhhhhlllhhhhhhll


DSSP  -----------HHHHHHHH-HHHLlllEELLLLLLL------------------LLLL-L
Query -----------PLSLKLLT-DVIGkdkVILGTDYPF------------------PLGE-L  299
ident            |  |  |            |                             
Sbjct tspplspdpttPDYLTSLLaCGDL---QVTGSGHCPystaqkavgkdnftlipeGVNGiE  340
DSSP  llllllllllhHHHHHHHHhHLLL---LLLLLLLLLllhhhhhhhlllhhhlllLLLLlL


DSSP  LLLHHHHHL----LLLLHHHHHHHHLHHHHHHHlLLHHHL--------------------
Query EPGKLIESM----EEFDEETKNKLKAGNALAFLgLERKQF--------------------  335
ident |               ||         ||                               
Sbjct ERMTVVWDKavatGKMDENQFVAVTSTNAAKIF-NLYPRKgriavgsdadvviwdpdklk  399
DSSP  LHHHHHHHHhlllLLLLHHHHHHHHLHHHHHHH-LLLLLLlllllllllleeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct titakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehl  459
DSSP  elllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhh


DSSP  ------------------
Query ------------------  335
ident                   
Sbjct yqrvkirnkvfglqgvsr  477
DSSP  hhhhhhhhhhllllllll


No 14: Query=4ofcA Sbjct=1yrrB Z-score=16.0

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------MKIDIHSH    8
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  llllllllhhhhhllllleeeeeeelleeeeeelleeeeeeEHHH----------LLHHH
Query ilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvRENC----------WDPEV   58
ident                                                           | 
Sbjct ---------------------------------------gcGGVQfndtaeavsvETLEI   81
DSSP  ---------------------------------------eeLLEElllllllllhHHHHH


DSSP  HHHHHHHHLLLEEEEELlhhHHLLlllhhhhHHHHHHHHHHHHHHHHHLLLLEEE-EELL
Query RIREMDQKGVTVQALSTvpvMFSYwakpedtLNLCQLLNNDLASTVVSYPRRFVG-LGTL  117
ident         | |                      |               |    |     
Sbjct MQKANEKSGCTNYLPTL---ITTS-------DELMKQGVRVMREYLAKHPNQALGlHLEG  131
DSSP  HHHHHHLLLEEEEEEEE---LLLL-------HHHHHHHHHHHHHHHHHLLLLLLLeEEEL


DSSP  LLllhHHHHHHHHHHHhlLLLLEEEEEleelleeLLLHhHHHHHHHHHHHLLEEEEELll
Query PMqapELAVKEMERCVkeLGFPGVQIGthvnewdLNAQeLFPVYAAAERLKCSLFVHPwd  177
ident |       |              |                  |                 
Sbjct PW-lnAALVDFLCENA--DVITKVTLA-------PEMV-PAEVISKLANAGIVVSAGH--  178
DSSP  LL-llLHHHHHHHHLH--HHEEEEEEL-------HHHL-LHHHHHHHHHHLLEEEELL--


DSSP  llllhhhhlllhhhhlhhhhhHHHHHHHHHllLHHHHlllLLEEELHHHLlhhhHHHHHH
Query mqmdgrmakywlpwlvgmpaeTTIAICSMImgGVFEKfpkLKVCFAHGGGafpfTVGRIS  237
ident                                   |           |             
Sbjct ---------------------SNATLKEAK--AGFRA---GITFATHLYN-ampYITGRE  211
DSSP  ---------------------LLLLHHHHH--HHHHH---LEEEELLLLL-lllLLLLLL


DSSP  hhhhhlhhhhlllllllhhhHLLLLEEELL----LLLHHHHHHHHHHHLlLLEELLLLLL
Query hgfsmrpdlcaqdnpmnpkkYLGSFYTDAL----VHDPLSLKLLTDVIGkDKVILGTDYP  293
ident                          |          |           | ||  | ||  
Sbjct ------------pglagailDEADIYCGIIadglHVDYANIRNAKRLKG-DKLCLVTDAT  258
DSSP  ------------lhhhhhhhHLLLLEEEEEllllLLLHHHHHHHHHHHH-HHEEEELLLL


DSSP  lLLLLLLLLHHHHHLL---LLLHHHHHHHHLHHHHHHHLLLHHH----------------
Query fPLGELEPGKLIESME---EFDEETKNKLKAGNALAFLGLERKQ----------------  334
ident      |                                | |                   
Sbjct -SGSSLTMIEGVRNLVehcGIALDEVLRMATLYPARAIGVEKRLgtlaagkvanltaftp  317
DSSP  -LLLLLLHHHHHHHHHhhhLLLHHHHHHHHLHHHHHHLLLLLLLlllllllllleeeell


DSSP  ----------------l
Query ----------------f  335
ident                  
Sbjct dfkitktivngnevvtq  334
DSSP  llleeeeeelleeeeel


No 15: Query=4ofcA Sbjct=2y1hB Z-score=15.8

back to top
DSSP  --LLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeeHHHL-LHH
Query --MKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrENCW-DPE   57
ident      | | |                                               |  
Sbjct gvGLVDCHCHLSA---------------------------------------PDFDrDLD   21
DSSP  llLEEEEEELLLL---------------------------------------HHHLlLHH


DSSP  HHHHHHHHHLLLEEEEELLhhhhlllllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELL
Query VRIREMDQKGVTVQALSTVpvmfsywakpedtlnlCQLLNNDLASTVVSYPRRFVGLGTL  117
ident           |                                      |          
Sbjct DVLEKAKKANVVALVAVAE----------------HSGEFEKIMQLSERYNGFVLPCLGV   65
DSSP  HHHHHHHHLLEEEEEELLL----------------LHHHHHHHHHHHHHLLLLEEEEELL


DSSP  -----------llLLHHHHHHHHHHHHHllLLLEE-EEELE----------eLLEEllLH
Query -----------pmQAPELAVKEMERCVKelGFPGV-QIGTH----------vNEWDlnAQ  155
ident                   |    |              |              |     |
Sbjct hpvqgldqrsvtlKDLDVALPIIENYKD--RLLAIgEVGLDfsprfagtgeqKEEQ--RQ  121
DSSP  lleelllleellhHHHHHHHHHHHHHLL--LLLEEeEEEEEllllllllhhhHHHH--HH


DSSP  HHHHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhhhhhHHHHhHHHHLlLHHHHL
Query ELFPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgmpaeTTIAiCSMIMgGVFEKF  215
ident  |      | ||     ||                                |     |  
Sbjct VLIRQIQLAKRLNLPVNVHS-----------------------RSAG-RPTIN-LLQEQG  156
DSSP  HHHHHHHHHHHHLLLEEEEE-----------------------ELLH-HHHHH-HHHHLL


DSSP  lLLLEEELHhHLLHHHhhhhhhhhhhhlhhhhlllllllhhHHLL--LLEEELL-LLLH-
Query pKLKVCFAHgGGAFPFtvgrishgfsmrpdlcaqdnpmnpkKYLG--SFYTDAL-VHDP-  271
ident    ||         |                                             
Sbjct -AEKVLLHA-FDGRPS-----------------------vaMEGVraGYFFSIPpSIIRs  191
DSSP  -LLLEEEEL-LLLLHH-----------------------hhHHHHhlLLEEEELhHHHLl


DSSP  ----HHHHHHhhhhLLLLEELLLLLLllLLLL---------LLLHHHHH-LLLLL---HH
Query ----LSLKLLtdviGKDKVILGTDYPfpLGEL---------EPGKLIES-MEEFD---EE  314
ident        | |          | || |                     |          ||
Sbjct gqkqKLVKQL----PLTSICLETDSP--ALGPekqvrnepwNISISAEYiAQVKGisvEE  245
DSSP  hhhhHHHHHL----LHHHEEELLLLL--LLLLlllllllhhHHHHHHHHhHHHHLllhHH


DSSP  HHHHHhLHHHHHHHLLLHHHL
Query TKNKLkAGNALAFLGLERKQF  335
ident         |||      |   
Sbjct VIEVT-TQNALKLFPKLRHLL  265
DSSP  HHHHH-HHHHHHHLLLHHHHL


No 16: Query=4ofcA Sbjct=2vunA Z-score=15.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeEEHHhllhhHHH
Query mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvVRENcwdpeVRI   60
ident    | | |                                                   |
Sbjct gLLDTHVHVSG-------------------------------gdyaprQKTM-----DFI   84
DSSP  lEEEEEELLLL-------------------------------lleehhHLEE-----LHH


DSSP  HHHHHHLLLEEEE-ELLH--HHHLllllhhhHHHHHHHHHHHHHHHHHHLL---LLEEE-
Query REMDQKGVTVQAL-STVP--VMFSywakpedTLNLCQLLNNDLASTVVSYP---RRFVG-  113
ident       |||                             |   |               | 
Sbjct SSALHGGVTTMISaGSPHfpGRPK-------DAAGTKALAITLSKSYYNARpagVKVHGg  137
DSSP  HHHHLLLEEEEEElLLLLllLLLL-------LHHHHHHHHHHHHHHHHHLLhhhLEEELl


DSSP  EELLLlLLHHhhHHHHHHHHHLLlLLEEE-EELEElleELLLhHHHHHHHHHHHHLLEEE
Query LGTLPmQAPElaVKEMERCVKELgFPGVQ-IGTHVnewDLNAqELFPVYAAAERLKCSLF  172
ident    |                ||     |   |              |    |        
Sbjct AVILE-KGLT--EEDFIEMKKEG-VWIVGeVGLGT--iKNPE-DAAPMVEWAHKHGFKVQ  190
DSSP  EELLL-LLLL--HHHHHHHHHLL-LLEEEeELLLL--lLLHH-HHHHHHHHHHHLLLEEE


DSSP  EE-llLLLLlhhhhlllhhhhlhhhHHHHhhHHHHHLllhhhhllllLEEELHHHL---L
Query VH-pwDMQMdgrmakywlpwlvgmpAETTiaICSMIMggvfekfpklKVCFAHGGG---A  228
ident  |                          |      |                |  |   |
Sbjct MHtggTSIP--------------gsSTVT--ADDVIK--------tkPDVVSHINGgptA  226
DSSP  EElllLLLL--------------llLLLL--HHHHHH--------hlLLEEELLLLlllL


DSSP  HHHHHhhhhhhhhhlhhhhlllllllhHHHL--LLLEEELL-lLLHHHHHHHHHHH----
Query FPFTVgrishgfsmrpdlcaqdnpmnpKKYL--GSFYTDAL-vHDPLSLKLLTDVI----  281
ident                                    |         |              
Sbjct ISVQE---------------------vDRIMdeTDFAMEIVqcGNPKIADYVARRAaekg  265
DSSP  LLHHH---------------------hHHHHhhLLLEEEEEllLLHHHHHHHHHHHhhhl


DSSP  LLLLEELLLLLLLLLL-LLLLL-HHHHHL---LLLLHHHHHHHHLHHHHHHHLLL-----
Query GKDKVILGTDYPFPLG-ELEPG-KLIESM---EEFDEETKNKLKAGNALAFLGLE-----  331
ident     || | | |   |                   | |       ||  |  ||      
Sbjct QLGRVIFGNDAPSGTGlIPLGIlRNMCQIasmSDIDPEVAVCMATGNSTAVYGLNtgvia  325
DSSP  LHHHEEEELLLLLLLLlLLLHHhHHHHHHhhhLLLLHHHHHHHHLHHHHHHHLLLlllll


DSSP  --HHHL------------------------------------------------------
Query --RKQF------------------------------------------------------  335
ident                                                             
Sbjct pgKEADliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  llLLLLeeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 17: Query=4ofcA Sbjct=4cqbA Z-score=15.4

back to top
DSSP  -----------------------------------------------------lLEEEEE
Query -----------------------------------------------------mKIDIHS    7
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE


DSSP  ELLL-----------lllllhhhhhlllLLEEEeeeelleeeeeelleeeeeeehhhLLH
Query HILP-----------kewpdlkkrfgygGWVQLqhhskgeakllkdgkvfrvvrencWDP   56
ident |                                                           
Sbjct HMDKsftstgerlpkfwsrpytrdaaieDGLKY--------------yknatheeikRHV  106
DSSP  LHHHllllllllllllllllllhhhhhhHHHHH--------------hhhllhhhhhHHH


DSSP  HHHHHHHHHHLLLEEEEELlhhhhlllllhhhHHHHHHHHHHHHHHHHHHLL--LLEEEE
Query EVRIREMDQKGVTVQALSTvpvmfsywakpedTLNLCQLLNNDLASTVVSYP--RRFVGL  114
ident           |                                                 
Sbjct IEHAHMQVLHGTLYTRTHV-----------dvDSVAKTKAVEAVLEAKEELKdlIDIQVV  155
DSSP  HHHHHHHHHLLEEEEEEEE-----------elLLLLLLHHHHHHHHHHHHLLllLEEEEE


DSSP  ELL--LLLLHHHHHHHHHHHHHlLLLLEEEEELE--ELLEellLHHH-HHHHHHHHHHLL
Query GTL--PMQAPELAVKEMERCVKeLGFPGVQIGTH--VNEWdlnAQEL-FPVYAAAERLKC  169
ident                         |   |                         |     
Sbjct AFAqsGFFVDLESESLIRKSLD-MGCDLVGGVDPatRENN---VEGSlDLCFKLAKEYDV  211
DSSP  EELllLLLLLLLHHHHHHHHHH-HLLLEEELLLLllLLLL---HHHHhHHHHHHHHHLLL


DSSP  EEEEELLlllllhhhhlllhhhhlhHHHH-HHHHHHHHHllLHHHHLLL-lLEEELHhHL
Query SLFVHPWdmqmdgrmakywlpwlvgMPAE-TTIAICSMImgGVFEKFPK-lKVCFAHgGG  227
ident     |                             |                 |   |   
Sbjct DIDYHIH------------------DIGTvGVYSINRLA--QKTIENGYkgRVTTSH-AW  250
DSSP  EEEEEEL------------------LLHHhHHHHHHHHH--HHHHHLLLllLEEEEE-LL


DSSP  LH----hhHHHHhhhhhhhlhhhhlllllllHHHHLL--LLEEELL---LLLHhHHHHHH
Query AF----pfTVGRishgfsmrpdlcaqdnpmnPKKYLG--SFYTDAL---VHDPlSLKLLT  278
ident  |                                                        | 
Sbjct CFadapseWLDE-------------------AIPLYKdsGMKFVTCfssTPPTmPVIKLL  291
DSSP  HHhhllhhHHHH-------------------HHHHHHhhLLEEEEElllLLLLlLHHHHH


DSSP  HHHLllLEELLLLLL----LLLL---llLLLHHHH-HLLL---LLHHHHHHHHLHHHHHH
Query DVIGkdKVILGTDYP----FPLG---elEPGKLIE-SMEE---FDEETKNKLKAGNALAF  327
ident             |       | |               |     |     |         
Sbjct EAGI--NLGCASDNIrdfwVPFGngdmvQGALIETqRLELktnRDLGLIWKMITSEGARV  349
DSSP  HLLL--EEEEELLLLllllLLLLlllhhHHHHHHHhHHLLllhHHHHHHHHHHLHHHHHH


DSSP  HLLLHH---------------------------------------------hl
Query LGLERK---------------------------------------------qf  335
ident || |                                                 
Sbjct LGIEKNygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  HLLHHHlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 18: Query=4ofcA Sbjct=1itqA Z-score=15.2

back to top
DSSP  --------------LLEEEEEELL----LLLLllhhhhhllllleEEEEeelLEEEeeel
Query --------------MKIDIHSHIL----PKEWpdlkkrfgyggwvQLQHhskGEAKllkd   42
ident                 || |                          ||      |     
Sbjct dffrdeaerimrdsPVIDGHNDLPwqllDMFN------------nRLQD---ERAN----   41
DSSP  lhhhhhhhhhhlllLEEEEEELHHhhhhHHHL------------lLLLL---HHHL----


DSSP  leeeeeEEHHhllhhHHHHHHHHHLLLEEEEELlhhHHLLLLLHHHHHHHHHHHHHHHHH
Query gkvfrvVRENcwdpeVRIREMDQKGVTVQALSTvpvMFSYWAKPEDTLNLCQLLNNDLAS  102
ident                  |       |  |  |             |              
Sbjct ---lttLAGT----hTNIPKLRAGFVGGQFWSV---YTPCDTQNKDAVRRTLEQMDVVHR   91
DSSP  ---lllLLLL----lLLHHHHHHLLEEEEEEEE---LLLHHHLLLLHHHHHHHHHHHHHH


DSSP  HHH-----HLLL---------------LEEEEEL--lLLLLHhhhHHHHHHHHHlLLLLE
Query TVV-----SYPR---------------RFVGLGT--lPMQAPelaVKEMERCVKeLGFPG  140
ident                                                        ||   
Sbjct MCRmypetFLYVtssagirqafregkvASLIGVEgghSIDSS---LGVLRALYQ-LGMRY  147
DSSP  HHHhllllEEELllhhhhhhhhhllleEEEEEEElhhHLLLL---HHHHHHHHH-LLEEE


DSSP  EEEEL-EELLEEL---------------LLHHHHHHHHHHHHHLLEEEEELllllllhhh
Query VQIGT-HVNEWDL---------------NAQELFPVYAAAERLKCSLFVHPwdmqmdgrm  184
ident           |                        |     ||                 
Sbjct LTLTHsCNTPWADnwlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH---------  198
DSSP  EELLLlLLLLLLLlhhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL---------


DSSP  hlllhhhhlhhhhhhhhHHHHHHllLHHHHLlLLLEEE-LHHH--------LLHHhhhhh
Query akywlpwlvgmpaettiAICSMImgGVFEKFpKLKVCF-AHGG--------GAFPftvgr  235
ident                      |             | |                      
Sbjct ----------------vSVATMK--ATLQLS-RAPVIFsHSSAysvcasrrNVPD-----  234
DSSP  ----------------lLHHHHH--HHHHHL-LLLLEElLLLLllllllllLLLH-----


DSSP  hhhhhhhlhhhhlllllllhhhHLLL--LEEELLL--------------LLHHHHHHHHH
Query ishgfsmrpdlcaqdnpmnpkkYLGS--FYTDALV--------------HDPLSLKLLTD  279
ident                                                       |     
Sbjct ------------------dvlrLVKQtdSLVMVNFynnyisctnkanlsQVADHLDHIKE  276
DSSP  ------------------hhhhHHHHhlLEEEELLlhhhhlllllllhhHHHHHHHHHHH


DSSP  HHLLLLEELLLLLL-LLLL------llLLLHHHHHL--LLLLHHHHHHHHLHHHHHHHL-
Query VIGKDKVILGTDYP-FPLG------elEPGKLIESM--EEFDEETKNKLKAGNALAFLG-  329
ident | |   |  | |    |              ||         |       | | |     
Sbjct VAGARAVGFGGDFDgVPRVpegledvsKYPDLIAELlrRNWTEAEVKGALADNLLRVFEa  336
DSSP  HLLHHHEEELLLLLlLLLLllllllllLHHHHHHHHhhLLLLHHHHHHHHLHHHHHHHHh


DSSP  ---------------------------llhhhl
Query ---------------------------lerkqf  335
ident                                  
Sbjct veqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhhllllllllllllllhhhlllllllllllll


No 19: Query=4ofcA Sbjct=2pajA Z-score=15.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  -LLEEEEEELL-----------lLLLLlhhhhhllllleeeeeeelleeeeeelleeeee
Query -MKIDIHSHIL-----------pKEWPdlkkrfgyggwvqlqhhskgeakllkdgkvfrv   48
ident       | |                                                   
Sbjct pAWVNTHHHLFqsllkgepfralFDER---------------------------------   87
DSSP  eLEELLLLLHHhhhllllllhhhLLHH---------------------------------


DSSP  eehhhLLHHHHHHHHHHHLLLEEEEELLhhhhlllllhhhHHHHhhHHHHHHHHHHHHLL
Query vrencWDPEVRIREMDQKGVTVQALSTVpvmfsywakpedTLNLcqLLNNDLASTVVSYP  108
ident              |    |    |                           |        
Sbjct --rfrLAARIGLIELARSGCATVADHNY----------vyYPGMpfDSSAILFEEAEKLG  135
DSSP  --hhhHHHHHHHHHHHLLLEEEEEELLL----------llLLLLllLHHHHHHHHHHHLL


DSSP  LLEEEEELLLLL---------------LHHHHHHHHHHHHHLLL--------LLEEEE-E
Query RRFVGLGTLPMQ---------------APELAVKEMERCVKELG--------FPGVQI-G  144
ident  ||| |     |                    |   ||                      
Sbjct LRFVLLRGGATQtrqleadlptalrpeTLDAYVADIERLAARYHdaspramrRVVMAPtT  195
DSSP  LEEEEEELLLLLlllllllllhhhlllLHHHHHHHHHHHHHHLLllllllleEEEELLlL


DSSP  LEElleellLHHHHHHHHHHHHHLLEEEEELLlllllhhhhlllhhhhlhhhhhhhHHHH
Query THVnewdlnAQELFPVYAAAERLKCSLFVHPWdmqmdgrmakywlpwlvgmpaettIAIC  204
ident            |     | | ||      |                              
Sbjct VLY---sisPREMRETAAVARRLGLRMHSHLS----------------------gkSPVA  230
DSSP  LLL---lllHHHHHHHHHHHHHLLLEEEEELL----------------------llLHHH


DSSP  HHHlLLHHhhllllLEEELHhHLLHHHHHhhhhhhhhhlhhhhlllllllhhHHLL--LL
Query SMImGGVFekfpklKVCFAHgGGAFPFTVgrishgfsmrpdlcaqdnpmnpkKYLG--SF  262
ident                |  ||                                  |     
Sbjct FCG-EHDW---lgsDVWYAH-LVKVDADE----------------------iALLAqtGT  263
DSSP  HHH-HLLL---lllLEEEEL-LLLLLHHH----------------------hHHHHhhLL


DSSP  EEELLLL--lhhHHHHHHHHHLllLEELLLLLLLlLLLL----LLLHHHH-HLLL--LLH
Query YTDALVH--dplSLKLLTDVIGkdKVILGTDYPFpLGEL----EPGKLIE-SMEE--FDE  313
ident                   |      |  | |      |                      
Sbjct GVAHCPQsngrlPVREMADAGV--PVSIGVDGAA-SNEAadmiSEVHMTWlAQRArlASI  320
DSSP  EEEELHHhhhllLLLLHHHHLL--LEEELLLHHH-HLLLllhhHHHHHHHhHHHHllLLH


DSSP  HHHHHHHLHHHHHHHLLLHH----------------------------------------
Query ETKNKLKAGNALAFLGLERK----------------------------------------  333
ident                ||                                           
Sbjct AEVIHWGTAGGARVMGLDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsv  380
DSSP  HHHHHHHLHHHHHHHLLLLLlllllllllleeeeelllhhhlllllhhhhhhhlllllee


DSSP  ---------------------------------------hl
Query ---------------------------------------qf  335
ident                                          
Sbjct malfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 20: Query=4ofcA Sbjct=3griA Z-score=14.9

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------MKIDIHSH    8
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  -LLLLllllhhhhhllllleeeeeeelleeeeeelleeeeeEEHHhlLHHHHHHHHHHHL
Query -ILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvVRENcwDPEVRIREMDQKG   67
ident    |                                             |         |
Sbjct lREPG-----------------------------------gEYKE--TIETGTKAAARGG   83
DSSP  lLLLL-----------------------------------lLLLL--LHHHHHHHHHHLL


DSSP  LLEEEEELLhhhhlllllhhhhhhhHHHHHHHHHHHHHHLL-LLEEEEELLL----LLLH
Query VTVQALSTVpvmfsywakpedtlnlCQLLNNDLASTVVSYP-RRFVGLGTLP----MQAP  122
ident  |                              |          |                
Sbjct FTTVCPXPN----------trpvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKEL  133
DSSP  EEEEEELLL----------llllllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLLL


DSSP  hhhhHHHHHHHHlLLLLEEEEELEElleellLHHH-HHHHHHHHHHLLEEEEELLL--LL
Query elavKEMERCVKeLGFPGVQIGTHVnewdlnAQEL-FPVYAAAERLKCSLFVHPWD--MQ  179
ident           ||  |                           |         |  |    
Sbjct ----VDFPALVK-EGAFAFTDDGVG----vqTASXxYEGXIEAAKVNKAIVAHCEDnsLI  184
DSSP  ----LLHHHHHL-LLLLLEEELLLL----llLHHHhHHHHHHHHHHLLLEEELLLLhhHL


DSSP  LLhhhhlllHHHHL-----------hhHHHHHHHHHHHHllLHHHHLLlLLEEELhHHLL
Query MDgrmakywLPWLV-----------gmPAETTIAICSMImgGVFEKFPkLKVCFAhGGGA  228
ident                                   |         |               
Sbjct YG-------GAXHEgkrskelgipgipNICESVQIARDV--LLAEAAG-CHYHVC-HVST  233
DSSP  LL-------LLEELlhhhhhhllleelLHHHHHHHHHHH--HHHHHHL-LLEEEL-LLLL


DSSP  --HHHHhhhhhhhhhhlhhhhlllllllhHHHL---lLLEEELL-LLLH-----------
Query --FPFTvgrishgfsmrpdlcaqdnpmnpKKYL---gSFYTDAL-VHDP-----------  271
ident                                               |             
Sbjct keSVRV----------------------iRDAKragiHVTAEVTpHHLLlteddipgnna  271
DSSP  hhHHHH----------------------hHHHHhlllLEEEEELhHHHHllhhhlllllh


DSSP  --------------HHHHHHH-HHHLlllEELLLLLLL---------------LLLL-LL
Query --------------LSLKLLT-DVIGkdkVILGTDYPF---------------PLGE-LE  300
ident                 |     |          ||                         
Sbjct iykxnpplrstedrEALLEGLlDGTI---DCIATDHAPhardekaqpxekapfGIVGsET  328
DSSP  hhllllllllhhhhHHHHHHHhLLLL---LEELLLLLLllhhhhlllllllllLLLLlLL


DSSP  LLHHHHHLL----LLLHHHHHHHHLHHHHHHHLLLH------------------------
Query PGKLIESME----EFDEETKNKLKAGNALAFLGLER------------------------  332
ident    |                             ||                         
Sbjct AFPLLYTHFvkngDWTLQQLVDYLTIKPCETFNLEYgtlkengyadltiidldseqeikg  388
DSSP  HHHHHHHHHllllLLLHHHHHHHHLHHHHHHLLLLLlllllllllleeeeelllleellh


DSSP  -------------------------------hhl
Query -------------------------------kqf  335
ident                                   
Sbjct edflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  hhllllllllllllleelleeeeeeelleeeeel


No 21: Query=4ofcA Sbjct=1k6wA Z-score=14.8

back to top
DSSP  ----------------------------------------------------lLEEEEEE
Query ----------------------------------------------------mKIDIHSH    8
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL


DSSP  LLLlllllhhhhhllllleeeEEEE-------lleeEEEElleeeeeeehhhLLHHHHHH
Query ILPkewpdlkkrfgyggwvqlQHHS-------kgeaKLLKdgkvfrvvrencWDPEVRIR   61
ident                      |                                      
Sbjct LDT-------------tqtagQPNWnqsgtlfegieRWAE-rkallthddvkQRAWQTLK  106
DSSP  LLL-------------lllllLLLLlllllhhhhhhHHHL-lhhhllhhhhhHHHHHHHH


DSSP  HHHHHLLLEEEEELlhhhhlllllhhhHHHHhHHHHHHHHHHHHHLL--LLEEEEELL--
Query EMDQKGVTVQALSTvpvmfsywakpedTLNLcQLLNNDLASTVVSYP--RRFVGLGTL--  117
ident      |                                                      
Sbjct WQIANGIQHVRTHV-----------dvSDAT-LTALKAMLEVKQEVApwIDLQIVAFPqe  154
DSSP  HHHHLLEEEEEEEE-----------elLLLL-LHHHHHHHHHHHHHLllLEEEEEEELll


DSSP  LLLLHHHHHHHHHHHHHlLLLLEEEEELE-ELLE-ELLLhhHHHHHHHHHHHLLEEEEEL
Query PMQAPELAVKEMERCVKeLGFPGVQIGTH-VNEW-DLNAqeLFPVYAAAERLKCSLFVHP  175
ident             |     ||   |    |            |    | |        || 
Sbjct GILSYPNGEALLEEALR-LGADVVGAIPHfEFTReYGVE-sLHKTFALAQKYDRLIDVHC  212
DSSP  LLLLLLLHHHHHHHHHH-LLLLEEEELHHhLLLHhHHHH-hHHHHHHHHHHHLLEEEEEE


DSSP  llllllhhhhlllhhhhlhHHHHhHHHHHHHHllLHHHHLLL-lLEEELHhHLLHHHHHH
Query wdmqmdgrmakywlpwlvgMPAEtTIAICSMImgGVFEKFPK-lKVCFAHgGGAFPFTVG  234
ident                       |                      |   |   |     |
Sbjct -----------------deIDDEqSRFVETVA--ALAHHEGMgaRVTASH-TTAMHSYNG  252
DSSP  -----------------llLLLLlLLHHHHHH--HHHHHHLLhhHEEEEE-LHHHHHLLH


DSSP  HHHhhhhhlhhhhlllllllHHHHLL--LLEEELLLL----------------lhhHHHH
Query RIShgfsmrpdlcaqdnpmnPKKYLG--SFYTDALVH----------------dplSLKL  276
ident                         |        |                        | 
Sbjct AYT---------------srLFRLLKmsGINFVANPLvnihlqgrfdtypkrrgitRVKE  297
DSSP  HHH---------------hhHHHHHHhhLLEEEELHHhhhhhllllllllllllllLHHH


DSSP  HHHHHLllLEELLLLLL----LLLL---llLLLHHHH---HLLL--LLHHHHhHHHLHHH
Query LTDVIGkdKVILGTDYP----FPLG---elEPGKLIE---SMEE--FDEETKnKLKAGNA  324
ident          |  | |       |||                             |     
Sbjct MLESGI--NVCFGHDDVfdpwYPLGtanmlQVLHMGLhvcQLMGygQINDGL-NLITHHS  354
DSSP  HHHLLL--LEEELLLLLllllLLLLlllhhHHHHHHHhhlLLLLhhHHHHHH-HHHLHHH


DSSP  HHHHLLLHHH--------------------------------------------------
Query LAFLGLERKQ--------------------------------------------------  334
ident    | |                                                      
Sbjct ARTLNLQDYGiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyle  414
DSSP  HHHLLLLLLLlllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeell


DSSP  --------l
Query --------f  335
ident          
Sbjct qpeaidykr  423
DSSP  leeeellll


No 22: Query=4ofcA Sbjct=2qpxA Z-score=14.6

back to top
DSSP  ------------LLEEEEEELLLLLlllhhhhhllllleeeeeeELLEEEeeelleeeEE
Query ------------MKIDIHSHILPKEwpdlkkrfgyggwvqlqhhSKGEAKllkdgkvfRV   48
ident                | | | |                                      
Sbjct gxddlsefvdqvPLLDHHCHFLIDG-----------------kvPNRDDR-------lAQ   36
DSSP  lllllhhhhhhlLEEEEEELLLLLL-----------------llLLHHHH-------hHH


DSSP  EE---------------------------------------hhhllhHHHHHHHHHHLLL
Query VR---------------------------------------encwdpEVRIREMDQKGVT   69
ident |                                                  |        
Sbjct VSteadkdypladtknrlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFK   96
DSSP  HLllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEE


DSSP  EEEEELLHHhhlllllhhhhhhhhhhhhhhhhHHHHHLL----LLEEEEELL--LLLL--
Query VQALSTVPVmfsywakpedtlnlcqllnndlaSTVVSYP----RRFVGLGTL--PMQA--  121
ident      |  |                                          |        
Sbjct ELLIDTGFV------------------pddpiLDLDQTAelvgIPVKAIYRLetHAEDfx  138
DSSP  EEEEELLLL------------------lllllLLHHHHHhhhlLLEEEEEEHhhHHHHhh


DSSP  ---------hHHHHHHHHHHHHlLLLLEEEEELE--------------------------
Query ---------pELAVKEMERCVKeLGFPGVQIGTH--------------------------  146
ident                         || |                                
Sbjct lehdnfaawwQAFSNDVKQAKA-HGFVGFXSIAAyrvglhlepvnvieaaagfdtwkhsg  197
DSSP  lllllhhhhhHHHHHHHHLLLL-LLLLLEEELHHhhlllllllllhhhhhhhhhhhhhhl


DSSP  ---ELLEellLHHHHHHHHHHHHHLLEEEEEL-lLLLLlhhhhlllhhhhlhhhHHHHhh
Query ---VNEWdlnAQELFPVYAAAERLKCSLFVHP-wDMQMdgrmakywlpwlvgmpAETTia  202
ident              |  |          |  |                             
Sbjct ekrLTSKpliDYXLYHVAPFIIAQDXPLQFHVgyGDAD-------------tdxYLGN--  242
DSSP  lllLLLHhhhHHHHHHHHHHHHHHLLLEEEEEllLLLL-------------llhHHLL--


DSSP  HHHHHllLHHHHLL--LLLEEELHhHLLHHHhhhhhhhhhhhlhhhhlllllllhhhHLL
Query ICSMImgGVFEKFP--KLKVCFAHgGGAFPFtvgrishgfsmrpdlcaqdnpmnpkkYLG  260
ident             |    |||   |                                    
Sbjct PLLXR--DYLKAFTkkGLKVVLLH-CYPYHR----------------------eagyLAS  277
DSSP  HHHHH--HHHHHHHhhLLLEEEEE-LLLLHH----------------------hhhhHHH


DSSP  L---LEEELL-------lLLHHHHHHHHHHHLLLLEELLLLLL----lllLLLLLLH-HH
Query S---FYTDAL-------vHDPLSLKLLTDVIGKDKVILGTDYP----fplGELEPGK-LI  305
ident      | |                                |               |   
Sbjct VfpnLYFDISlldnlgpsGASRVFNEAVELAPYTRILFASDAStypexygLAARQFKqAL  337
DSSP  HlllEEEELLlhhhhlhhHHHHHHHHHLLLLLHHHEELLLLLLllhhhhhHHHHHHHhHH


DSSP  HHLLL--------lLHHHHHHHHLHHHHHHHLLlHHHL--
Query ESMEE--------fDEETKNKLKAGNALAFLGLeRKQF--  335
ident                    |                    
Sbjct VAHFNqlpfvdlaqKKAWINAICWQTSAKLYHQ-ERELrv  376
DSSP  HHHHHllllllhhhHHHHHHHHHLHHHHHHLLL-HHHHll


No 23: Query=4ofcA Sbjct=3giqA Z-score=14.5

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------MKID    4
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  EEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeehHHLLHHHHhHHHH
Query IHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvreNCWDPEVRiREMD   64
ident  | |                                                    |   
Sbjct VHGHDDL----------------------------------------MFVEKPDL-RWKT   79
DSSP  LLLLLLL----------------------------------------HHHHLLLL-HHHH


DSSP  HHLLLEEEEE------------llhHHHLllllhhhhhhhhHHHHHHHHHHHH-HLLL-L
Query QKGVTVQALS------------tvpVMFSywakpedtlnlcQLLNNDLASTVV-SYPR-R  110
ident   | |                                                   |   
Sbjct SQGITTVVVGncgvsaapaplpgntAAAL----allgetplFADVPAYFAALDaQRPMiN  135
DSSP  LLLEEEEEELlllllllllllllllLHHH----hhhlllllLLLHHHHHHHHHhLLLLlE


DSSP  EEEEEL--LLLL-------------LHHHHHHHHHHHHHlLLLLEEEEELE---ELLEel
Query FVGLGT--LPMQ-------------APELAVKEMERCVKeLGFPGVQIGTH---VNEWdl  152
ident    |                                     |  |   |           
Sbjct VAALVGhaNLRLaamrdpqaaptaaEQQAMQDMLQAALE-AGAVGFSTGLAyqpGAVA--  192
DSSP  EEEEEEhhHHHHhhlllllllllhhHHHHHHHHHHHHHH-HLLLEEEEELLlllHHHL--


DSSP  lLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlHHHHHHHHHHHHHHllLH
Query nAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvGMPAETTIAICSMImgGV  211
ident             |         |                           |         
Sbjct -QAAElEGLARVAAERRRLHTSHI-----------------rNEADGVEAAVEEVL--AI  232
DSSP  -LHHHhHHHHHHHHHLLLEEEEEL-----------------lLLLLLHHHHHHHHH--HH


DSSP  HHHLLlLLEEELhHHLL-------hHHHHhhhhhhhhhlhhhhlllllllhHHHL---lL
Query FEKFPkLKVCFAhGGGA-------fPFTVgrishgfsmrpdlcaqdnpmnpKKYL---gS  261
ident                                                             
Sbjct GRGTG-CATVVS-HHKCmmpqnwgrSRAT------------------laniDRAReqgvE  272
DSSP  HHHHL-LEEEEL-LLLLllhhhlllHHHH------------------hhhhHHHHhlllL


DSSP  LEEELLLLL---------------------------------------------------
Query FYTDALVHD---------------------------------------------------  270
ident    |                                                        
Sbjct VALDIYPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrl  332
DSSP  EEEEELLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhh


DSSP  -----------HHHHHHHHHhhlLLLEELLLLLLL----LLLL-LLLLHHHHHL-----L
Query -----------PLSLKLLTDvigKDKVILGTDYPF----PLGE-LEPGKLIESM-----E  309
ident                |             | |       |                    
Sbjct apagaiyfamdEDEVKRIFQ---HPCCMVGSDGLPndarPHPRlWGSFTRVLGRyvreaR  389
DSSP  lleeeeeelllHHHHHHHHH---LLLEEELLLLLLllllLLLHhHHHHHHHHHHhhhhlL


DSSP  LLLHHHHHHHHLHHHHHHHLLLHH------------------------------------
Query EFDEETKNKLKAGNALAFLGLERK------------------------------------  333
ident     |              |                                        
Sbjct LMTLEQAVARMTALPARVFGFAERgvlqpgawadvvvfdpdtvadratwdeptlasvgia  449
DSSP  LLLHHHHHHHHLHHHHHHHLLLLLlllllllllleeeellllllllllllllllllllee


DSSP  ------------------------hl
Query ------------------------qf  335
ident                           
Sbjct gvlvngaevfpqppadgrpgqvlrax  475
DSSP  eeeelleeeellllllllllllllll


No 24: Query=4ofcA Sbjct=1onxA Z-score=14.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --LLEEEEEELLllllllhhhhhllllleeeeeeelleeEEEElleeEEEEehhHLLHhh
Query --MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeaKLLKdgkvFRVVrenCWDPev   58
ident     || | |                                                  
Sbjct cpGFIDQHVHLI------------------------gggGEAG----PTTR---TPEV--   87
DSSP  eeLEEEEEELLL------------------------lllLLLL----HHHL---LLLL--


DSSP  HHHHHHHHLLLEEEEELlHHHHLllllhhhhhhhhhhHHHHHHHHHHHLL---LLEEEEE
Query RIREMDQKGVTVQALSTvPVMFSywakpedtlnlcqlLNNDLASTVVSYP---RRFVGLG  115
ident         |||                              |                | 
Sbjct ALSRLTEAGVTSVVGLL-GTDSI------------srHPESLLAKTRALNeegISAWMLT  134
DSSP  LHHHHHHLLEEEEEELL-LLLLL------------llLHHHHHHHHHHHHhhlLEEEEEE


DSSP  L--LLLLlhhhhhHHHHHHHHLLLLLEEEEELE---ELLEellLHHH-HHHHHHHHHHL-
Query T--LPMQapelavKEMERCVKELGFPGVQIGTH---VNEWdlnAQEL-FPVYAAAERLK-  168
ident                           ||                        |       
Sbjct GayHVPS-rtitgSVEKDVAIIDRVIGVXCAISdhrSAAP---DVYHlANMAAESRVGGl  190
DSSP  EllLLLL-lllllLHHHHHHHLLLEEEEEEEELlllLLLL---LHHHhHHHHHHHHHHHh


DSSP  -----LEEEEElllllllhhhhlllhhhhlhHHHHhhHHHHHHHllLHHH--HLLLLLEE
Query -----CSLFVHpwdmqmdgrmakywlpwlvgMPAEttIAICSMImgGVFE--KFPKLKVC  221
ident           |                    |      |          |    |  |  
Sbjct lggkpGVTVFH--------------------MGDS-kKALQPIY--DLLEncDVPISKLL  227
DSSP  hhlllLEEEEE--------------------ELLL-lLLLHHHH--HHHHllLLLHHHEE


DSSP  ELHHHLL--HHHHhhhhhhhhhhlhhhhlllllllhhHHLL-LLEEELL------lLLHH
Query FAHGGGA--FPFTvgrishgfsmrpdlcaqdnpmnpkKYLG-SFYTDAL------vHDPL  272
ident   |                                           |             
Sbjct PTHVNRNvpLFEQ----------------------alEFARkGGTIDITssidepvAPAE  265
DSSP  EELHHHLhhHHHH----------------------hhHHHHlLLLEEEElllllllLHHH


DSSP  HHHHHHHH-HLLLLEELLLLLLL---------------LLLLLLLLHHHHHL---LLLLH
Query SLKLLTDV-IGKDKVILGTDYPF---------------PLGELEPGKLIESM---EEFDE  313
ident          |    | |  |                    |                |  
Sbjct GIARAVQAgIPLARVTLSSDGNGsqpffddegnlthigVAGFETLLETVQVLvkdYDFSI  325
DSSP  HHHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeeELLLHHHHHHHHHHhhhHLLLH


DSSP  HHHHHHHLHHHHHHHLLLHH----------------------------------------
Query ETKNKLKAGNALAFLGLERK----------------------------------------  333
ident              || |  |                                        
Sbjct SDALRPLTSSVAGFLNLTGKgeilpgndadllvmtpelrieqvyargklmvkdgkacvkg  385
DSSP  HHHHHHHLHHHHHHLLLLLLlllllllllleeeellllleeeeeelleeeeelleellll


DSSP  ---hl
Query ---qf  335
ident      
Sbjct tfetd  390
DSSP  lllll


No 25: Query=4ofcA Sbjct=3pnuA Z-score=14.5

back to top
DSSP  -------------lLEEEEEELLLLllllhhhhhllllleeeeeeelleeeeeelleeee
Query -------------mKIDIHSHILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfr   47
ident                 | | |                                       
Sbjct enlyfqsnamklknPLDMHLHLRDN-----------------------------------   25
DSSP  llllllllleeeelLEEEEELLLLH-----------------------------------


DSSP  eeehhhlLHHHHHHHHHHhLLLEEEEELLhhhhlllllhhhhhhHHHHhHHHHHHHHHHL
Query vvrencwDPEVRIREMDQkGVTVQALSTVpvmfsywakpedtlnLCQLlNNDLASTVVSY  107
ident          |                                         ||       
Sbjct ------qMLELIAPLSAR-DFCAAVIMPN------------lipPLCN-LEDLKAYKMRI   65
DSSP  ------hHHHHHHHHHHL-LLLEEEELLL------------lllLLLL-HHHHHHHHHHH


DSSP  L-------LLEEEEELLLLllhhHHHHHHHHHHHllLLLEEEEELE---------ELLEe
Query P-------RRFVGLGTLPMqapeLAVKEMERCVKelGFPGVQIGTH---------VNEWd  151
ident                           |            |               |    
Sbjct LkackdenFTPLMTLFFKN----YDEKFLYSAKD--EIFGIXLYPAgittnsnggVSSF-  118
DSSP  HhhhllllLEEEEEEELLL----LLHHHHHHHLL--LLLEEEELLLlllllllllLLLL-


DSSP  lLLHHHHHHHHHHHHHLLEEEEELLLLLllhhhhlllhHHHLHHHHHhHHHHHHHhlllh
Query lNAQELFPVYAAAERLKCSLFVHPWDMQmdgrmakywlPWLVGMPAEtTIAICSMimggv  211
ident      | |   |   |   | ||                                     
Sbjct -DIEYLKPTLEAMSDLNIPLLVHGETND----------FVMDRESNF-AKIYEKL-----  161
DSSP  -LHHHHHHHHHHHHHLLLLEEELLLLLL----------LHHHLLHHH-HHHHHHH-----


DSSP  HHHLLLLLEEELHHHL-LHHHhhhhhhhhhhhlhhhhlllllllhHHHLlLLEEELL-LL
Query FEKFPKLKVCFAHGGG-AFPFtvgrishgfsmrpdlcaqdnpmnpKKYLgSFYTDAL-VH  269
ident    || ||    |                                | |    |      |
Sbjct AKHFPRLKIVMEHITTkTLCE----------------------llKDYE-NLYATITlHH  198
DSSP  HHHLLLLLEEELLLLLhHHHH----------------------hhHHLL-LEEEEELlHH


DSSP  LH---------------------------HHHHHHHhhhlLLLEELLLLLLL-------L
Query DP---------------------------LSLKLLTdvigKDKVILGTDYPF-------P  295
ident                                |  |       ||  | |           
Sbjct LIitlddviggkmnphlfckpiakryedkEALCELA-fsgYEKVMFGSDSAPhpkgcaaG  257
DSSP  HLllhhhhhlllllhhhllllllllhhhhHHHHHHH-hllLLLEEELLLLLLlllllllL


DSSP  LLLL-LLLHHHHHL--LLLLHHHHHHHHLHHHHHHhLLLHHH------------------
Query LGEL-EPGKLIESM--EEFDEETKNKLKAGNALAFlGLERKQ------------------  334
ident                     ||   |    |                             
Sbjct VFSApVILPVLAELfkQNSSEENLQKFLSDNTCKI-YDLKFKedkiltleekewqvpnvy  316
DSSP  LLLHhHHHHHHHHHhhHHLLHHHHHHHHLHHHHHH-HLLLLLllleeeeellleelllle


DSSP  ---------------------l
Query ---------------------f  335
ident                       
Sbjct edkynqvvpymageilkfqlkh  338
DSSP  elllleellllllleelleell


No 26: Query=4ofcA Sbjct=2ob3A Z-score=14.4

back to top
DSSP  ---------------lLEEEEEELLL----lLLLLhhhhhllllleEEEEeelleeeeee
Query ---------------mKIDIHSHILP----kEWPDlkkrfgyggwvQLQHhskgeakllk   41
ident                     | ||                                    
Sbjct drintvrgpitiseagFTLTHEHICGssagfLRAW---------peFFGS----------   41
DSSP  lleeelleeelhhhhlLEEEEELLEEllllhHHHL---------hhHHLL----------


DSSP  lleeeeeEEHHhllHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhhHHHHhHHH
Query dgkvfrvVRENcwdPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlcQLLNnDLA  101
ident          |         |     ||                              |  
Sbjct ----rkaLAEK---AVRGLRRARAAGVRTIVDVS----------------tfDIGR-DVS   77
DSSP  ----hhhHHHH---HHHHHHHHHHLLLLEEEELL----------------lhHHLL-LHH


DSSP  HHhHHLL----LLEEEEELL--------llLLHHHHHHHHHHHHHLL------LLLEEEE
Query STvVSYP----RRFVGLGTL--------pmQAPELAVKEMERCVKEL------GFPGVQI  143
ident               |    |             |       |                  
Sbjct LL-AEVSraadVHIVAATGLwfdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGIIXV  136
DSSP  HH-HHHHhhhlLEEELEEELlllllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEEEE


DSSP  ELE--ELLEellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhh
Query GTH--VNEWdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEtt  200
ident  |                    |          |                          
Sbjct ATTgkATPF---QELVlKAAARASLATGVPVTTHT-------------------AASQ--  172
DSSP  ELLllLLHH---HHHHhHHHHHHHHHHLLLEEEEL-------------------LHHH--


DSSP  HHHHHHHlLLHHHHLLLL-LEEELHHHLLHHHHHhhhhhhhhhlhhhhlllllllhhhhL
Query IAICSMImGGVFEKFPKL-KVCFAHGGGAFPFTVgrishgfsmrpdlcaqdnpmnpkkyL  259
ident                     ||  |                                   
Sbjct RDGEQQA-AIFESEGLSPsRVCIGHSDDTDDLSY--------------------ltalaA  211
DSSP  LHHHHHH-HHHHHLLLLHhHEEELLHHHLLLHHH--------------------hhhhhH


DSSP  LLLEEELLLL------------------------LHHHHHHHHHHhLLLLEELLLLLL--
Query GSFYTDALVH------------------------DPLSLKLLTDViGKDKVILGTDYP--  293
ident                                     |  | | |           |    
Sbjct RGYLIGLDHIpysaiglednasasallgirswqtRALLIKALIDQgYMKQILVSNDWTfg  271
DSSP  LLLEEEELLLllllllllllhhhhhhhllllhhhHHHHHHHHHHLlLHHHEEELLLLLle


DSSP  ---------------lllllLLLL-HHHHHL--LLLLHHHHHHHHLHHHHHHHLllhhhl
Query ---------------fplgeLEPG-KLIESM--EEFDEETKNKLKAGNALAFLGlerkqf  335
ident                            |          ||       |   ||       
Sbjct fssyvtnimdvmdrvnpdgmAFIPlRVIPFLreKGVPQETLAGITVTNPARFLS--ptlr  329
DSSP  ellllllhhhhhhhhlllhhHHHHhLHHHHHhhLLLLHHHHHHHHLHHHHHHHL--llll


No 27: Query=4ofcA Sbjct=1bf6A Z-score=14.3

back to top
DSSP  -----lLEEEEEE-LLLLllllhhhhhllllleeeeeeelleeEEEElleeEEEEehhHL
Query -----mKIDIHSH-ILPKewpdlkkrfgyggwvqlqhhskgeaKLLKdgkvFRVVrenCW   54
ident           | |                                 |      |      
Sbjct sfdptgYTLAHEHlHIDL-------------------------SGFK----NNVD-crLD   30
DSSP  llllllEEEEEELlLEEL-------------------------HHHH----LLHH-heEL


DSSP  LHHHHHHHHHHHL---LLEEEEELlhhhhlllllhhhhhhhHHHHhhHHHHHHHHLL---
Query DPEVRIREMDQKG---VTVQALSTvpvmfsywakpedtlnlCQLLnnDLASTVVSYP---  108
ident        ||       |      |                         |          
Sbjct QYAFICQEMNDLMtrgVRNVIEMT----------------nRYMG--RNAQFMLDVMret   72
DSSP  LHHHHHHHHHHHHhllEEEEEELL----------------lHHHL--LLHHHHHHHHhhh


DSSP  -LLEEEEELL----------llLLHHHHHHHHHHHHHLL------LLLEEE-EELE---E
Query -RRFVGLGTL----------pmQAPELAVKEMERCVKEL------GFPGVQ-IGTH---V  147
ident     |                         ||                    |||     
Sbjct gINVVACTGYyqdaffpehvatRSVQELAQEMVDEIEQGidgtelKAGIIAeIGTSegkI  132
DSSP  lLEEEEEELLllhhhlllhhhhLLHHHHHHHHHHHHHLLllllllLEEEEEeEELLlllL


DSSP  LLEellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhHHHHHH
Query NEWdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttIAICSM  206
ident                 |          |                                
Sbjct TPL---EEKVfIAAALAHNQTGRPISTHT-------------------SFST--MGLEQL  168
DSSP  LHH---HHHHhHHHHHHHHHHLLLEEEEL-------------------HHHL--LHHHHH


DSSP  HllLHHHHLLLL-LEEELHHHLLhHHHHhhhhhhhhhlhhhhlllllllhhhhLLLLEEE
Query ImgGVFEKFPKL-KVCFAHGGGAfPFTVgrishgfsmrpdlcaqdnpmnpkkyLGSFYTD  265
ident            |  |   |                                      |  
Sbjct A--LLQAHGVDLsRVTVGHCDLKdNLDN--------------------ilkmiDLGAYVQ  206
DSSP  H--HHHHLLLLHhHEEELLLLLLlLHHH--------------------hhhhhHLLLEEE


DSSP  LL----------llLHHHHHHHHHHhLLLLEELLLLLLL--------lllLLLLL-HHHH
Query AL----------vhDPLSLKLLTDViGKDKVILGTDYPF--------plgELEPG-KLIE  306
ident                   |  | |      | |  |                      | 
Sbjct FDtigknsyypdekRIAMLHALRDRgLLNRVMLSMDITRrshlkanggygYDYLLtTFIP  266
DSSP  ELlllllllllhhhHHHHHHHHHHLlLHHHEEELLLLLLhhhlhhhllllLLHHHhLHHH


DSSP  HL--LLLLHHHHHHHHLHHHHHHHLllhhhl
Query SM--EEFDEETKNKLKAGNALAFLGlerkqf  335
ident       |           |   |        
Sbjct QLrqSGFSQADVDVMLRENPSQFFQ------  291
DSSP  HHhhLLLLHHHHHHHHLHHHHHHLL------


No 28: Query=4ofcA Sbjct=3k2gB Z-score=14.2

back to top
DSSP  ---------------------------lLEEEEEELLLLllllhhhhhllllleeeeeee
Query ---------------------------mKIDIHSHILPKewpdlkkrfgyggwvqlqhhs   33
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalgHTLXHEHLQND---------------------   39
DSSP  llllllllllllleeeelleeeehhhllLEELLLLLLEE---------------------


DSSP  lleEEEEELL-------------------------eEEEEEEHhHLLHHHHHHHHHHHL-
Query kgeAKLLKDG-------------------------kVFRVVREnCWDPEVRIREMDQKG-   67
ident                                     |         |    | |  |   
Sbjct --cRCWWNPPqeperqylaeapisieilselrqdpfVNKHNIA-LDDLDLAIAEVKQFAa   96
DSSP  --lHHHLLLLllhhhhhhhhllllhhhhhhhhllhhHLLLLLE-ELLHHHHHHHHHHHHh


DSSP  --LLEEEEELlhhhhlllllhhhhhhhhhhhhhHHHHHHHHLL----LLEEEEELL----
Query --VTVQALSTvpvmfsywakpedtlnlcqllnnDLASTVVSYP----RRFVGLGTL----  117
ident          |                                        |         
Sbjct vgGRSIVDPT------------------crgigRDPVKLRRISaetgVQVVXGAGYylas  138
DSSP  llLLEEEELL------------------lllllLLHHHHHHHHhhhlLEEEELLLLllhh


DSSP  ------llLLHHHHHHHHHHHHHL------LLLLEEE-EELE--ELLEellLHHH-HHHH
Query ------pmQAPELAVKEMERCVKE------LGFPGVQ-IGTH--VNEWdlnAQEL-FPVY  161
ident                 |      |              ||                    
Sbjct sxpetaarLSADDIADEIVAEALEgtdgtdARIGLIGeIGVSsdFTAE---EEKSlRGAA  195
DSSP  hllhhhhlLLHHHHHHHHHHHHHLllllllLLLLLEEeELLLllLLHH---HHHHhHHHH


DSSP  HHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhHHHHHHHlLLHHHHLLLL-LE
Query AAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttIAICSMImGGVFEKFPKL-KV  220
ident  |  |    | ||                                    | |    |   
Sbjct RAQVRTGLPLXVHL-------------------PGWF--RLAHRVL-DLVEEEGADLrHT  233
DSSP  HHHHHHLLLEEELL-------------------LLLL--LLHHHHH-HHHHHLLLLHhHE


DSSP  EELHhHLLHHHHHHhhhhhhhhlhhhhlllllllhhHHLL-LLEEELLLL----------
Query CFAHgGGAFPFTVGrishgfsmrpdlcaqdnpmnpkKYLG-SFYTDALVH----------  269
ident    |                                                        
Sbjct VLCH-XNPSHXDPV-------------------yqaTLAQrGAFLEFDXIgxdffyadqg  273
DSSP  EELL-LHHHLLLHH-------------------hhhHHHHhLLEEEELLLlllleellll


DSSP  -----LHHHHHHHHHH---hLLLLEELLLLLLL--------llllLLLL-HHHHHLL--L
Query -----DPLSLKLLTDV---iGKDKVILGTDYPF--------plgeLEPG-KLIESME--E  310
ident      |                |   |  |                              
Sbjct vqcpsDDEVARAILGLadhgYLDRILLSHDVFVkxxltryggngyAFVTkHFLPRLRrhG  333
DSSP  eelllHHHHHHHHHHHhhllLHHHEEELLLLLLhhhlhhhlllllLHHHhLHHHHHHhlL


DSSP  LLHHHHHHHHLHHHHHHHLllhhhl
Query FDEETKNKLKAGNALAFLGlerkqf  335
ident  |      |   |            
Sbjct LDDAALETLXVTNPRRVFDasiegh  358
DSSP  LLHHHHHHHHLHHHHHHHLllllll


No 29: Query=4ofcA Sbjct=3ls9A Z-score=14.2

back to top
DSSP  ---------------------------------------------------------lLE
Query ---------------------------------------------------------mKI    3
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelEE


DSSP  EEEEELL-----------------------lllLLLHHHhhllllLEEEeeeelleeeee
Query DIHSHIL-----------------------pkeWPDLKKrfgyggWVQLqhhskgeakll   40
ident   | |                                                       
Sbjct NSHQHLYegamraipqlervtmaswlegvltrsAGWWRD------GKFG-----------  103
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhHHHHHL------LLLL-----------


DSSP  elleeeeeeehhhLLHHHHHHHHHHHLLLEEEEELlhHHHLllllhHHHHHhhhHHHHHH
Query kdgkvfrvvrencWDPEVRIREMDQKGVTVQALSTvpVMFSywakpEDTLNlcqLLNNDL  100
ident                      |    | |  |       |        |           
Sbjct --------pdvirEVARAVLLESLLGGITTVADQH--LFFP-----GATAD---SYIDAT  145
DSSP  --------hhhhhHHHHHHHHHHHHLLEEEEEEEE--LLLL-----LLLLL---LHHHHH


DSSP  HHHHHHLLLLEEEEELL--------------llLLHHHHHHHHHHHHHLLL--------L
Query ASTVVSYPRRFVGLGTL--------------pmQAPELAVKEMERCVKELG--------F  138
ident          ||                            |                    
Sbjct IEAATDLGIRFHAARSSmtlgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvR  205
DSSP  HHHHHHHLLEEEEEELLllllhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleE


DSSP  LEEEE-ELEElleellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHH
Query PGVQI-GTHVnewdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMP  196
ident       |           ||       |      |  |                     |
Sbjct IALGPcGVPY-----dKPELfEAFAQMAADYDVRLHTHF------------------yEP  242
DSSP  EEELLlLLLL-----lLHHHhHHHHHHHHHHLLEEEEEE------------------lLL


DSSP  HH--------hhHHHHHHHlLLHHhhlLLLLEEELHhHLLHhhHHHHhhhhhhhlhhhhl
Query AE--------ttIAICSMImGGVFekfPKLKVCFAHgGGAFpfTVGRishgfsmrpdlca  248
ident                                |  ||                        
Sbjct LDagmsdhlygmTPWRFLE-KHGW---ASDRVWLAH-AVVP--PREE-------------  282
DSSP  LHhhhhhhhhllLHHHHHH-HLLL---LLLLEEEEE-LLLL--LHHH-------------


DSSP  llllllhhHHLL--LLEEELLLL-------lhhHHHHHHHHHLllLEELLLLLLLlLLLL
Query qdnpmnpkKYLG--SFYTDALVH-------dplSLKLLTDVIGkdKVILGTDYPFpLGEL  299
ident                     |                  |      |  ||         
Sbjct -------iPEFAdaGVAIAHLIApdlrmgwglaPIREYLDAGI--TVGFGTTGSA-SNDG  332
DSSP  -------hHHHHhhLLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLL-LLLL


DSSP  -LLLHHHHHLL-------------LLLHHHHHHHHLHHHHHHHLLL--------HHHL--
Query -EPGKLIESME-------------EFDEETKNKLKAGNALAFLGLE--------RKQF--  335
ident                                           ||          |     
Sbjct gNLLGDLRLAAlahrpadpnepekWLSARELLRMATRGSAECLGRPdlgvleegRAADia  392
DSSP  lLHHHHHHHHHhhlhhhllllhhhLLLHHHHHHHLLHHHHHHLLLLllllllllLLLLee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct cwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttali  452
DSSP  eeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhl


DSSP  -
Query -  335
ident  
Sbjct p  453
DSSP  l


No 30: Query=4ofcA Sbjct=3gg7A Z-score=14.1

back to top
DSSP  LLEEEEEELLllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH
Query MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
ident   || | |                                              ||    
Sbjct SLIDFHVHLD-----------------------------------------lYPDPVAVA   19
DSSP  LLEEEEELHH-----------------------------------------hLLLHHHHH


DSSP  HHHHHHLLlEEEEELLhhhhlllllhhhhhhhhhHHHHHHHHHHHHLlLLEEEEELL---
Query REMDQKGVtVQALSTVpvmfsywakpedtlnlcqLLNNDLASTVVSYpRRFVGLGTL---  117
ident |             |                                             
Sbjct RACEERQL-TVLSVTT----------------tpAAWRGTLALAAGR-PHVWTALGFhpe   61
DSSP  HHHHHLLL-EEEELLL----------------lhHHHHHHHHHHLLL-LLEEELLLLlhh


DSSP  LLLL-HHHHhHHHHHHHHllLLLEEE-EELE-----eLLEEllLHHH-HHHHHHHHHH-L
Query PMQA-PELAvKEMERCVKelGFPGVQ-IGTH-----vNEWDlnAQEL-FPVYAAAERL-K  168
ident               |         |   |          |               |    
Sbjct VVSErAADL-PWFDRYLP--ETRFVGeVGLDgspslrGTWT-qQFAVfQHILRRCEDHgG  117
DSSP  HLLLlHHHL-HHHHHHHH--HLLEEEeEELLllhhhhHHHH-hHHHHhHHHHHHHHHLlL


DSSP  LEEEEElllllllhhhhlllhhhhlhhhhhHHHHHHHHHllLHHHHLLL-LLEEELhHHL
Query CSLFVHpwdmqmdgrmakywlpwlvgmpaeTTIAICSMImgGVFEKFPK-LKVCFAhGGG  227
ident   |  |                           |          |  |            
Sbjct RILSIH------------------------SRRAESEVL--NCLEANPRsGTPILH-WYS  150
DSSP  EEEEEE------------------------LLLLHHHHH--HHHHHLHHhEEEEEE-LLL


DSSP  LhHHHHhhhhhhhhhlhhhhlllllllhHHHLL-LLEEELL--LLLHHHHHHHHHHHLLL
Query AfPFTVgrishgfsmrpdlcaqdnpmnpKKYLG-SFYTDAL--VHDPLSLKLLTDVIGKD  284
ident     |                                               |      |
Sbjct G-SVTE---------------------lRRAISlGCWFSVGptMVRTQKGAALIRSMPRD  188
DSSP  L-LHHH---------------------hHHHHHlLLEEEELhhHHLLHHHHHHHHHLLHH


DSSP  LEELLLLLLLLL------llLLLLHHHHH-LLLLL---HHHHHHHhLHHHHHHHLllhhh
Query KVILGTDYPFPL------geLEPGKLIES-MEEFD---EETKNKLkAGNALAFLGlerkq  334
ident  |   || ||                 |           |        |    ||     
Sbjct RVLTETDGPFLEldgqaalpWDVKSVVEGlSKIWQipaSEVERIV-KENVSRLLG-----  242
DSSP  HEEELLLLLLLEelleellhHHHHHHHHHhHHHHLllhHHHHHHH-HHHHHHHHH-----


DSSP  l
Query f  335
ident  
Sbjct t  243
DSSP  l


No 31: Query=4ofcA Sbjct=1j6pA Z-score=13.9

back to top
DSSP  ---------------------------------------------------lLEEEEEEL
Query ---------------------------------------------------mKIDIHSHI    9
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpaLFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeelEEEEEELH


DSSP  LllllllhhhhhllllleeeeeeelleeeeeelleEEEE-------eehhhLLHHHHHHH
Query LpkewpdlkkrfgyggwvqlqhhskgeakllkdgkVFRV-------vrencWDPEVRIRE   62
ident                                                            |
Sbjct P----------------xtllrgvaedlsfeewlfSKVLpiedrltekxayYGTILAQXE  104
DSSP  H----------------hhhhllllllllhhhhhhLLHHhhhllllhhhhhHHHHHHHHH


DSSP  HHHHLLLEEEEELlhhhhlllllhhhhhhhhhhHHHHHHHHHHHLlLLEE-EEELLLL--
Query MDQKGVTVQALSTvpvmfsywakpedtlnlcqlLNNDLASTVVSYpRRFV-GLGTLPM--  119
ident     |                                 |  |             |    
Sbjct XARHGIAGFVDXY-------------------fHEEWIAKAVRDF-GXRAlLTRGLVDsn  144
DSSP  HHLLLEEEEEEEE-------------------lLHHHHHHHHHHH-LLEEeEEEEELLll


DSSP  LLHHHHHHHHHHHHHLLL------LLEEEE-ELEElleellLHHHHHHHHHHHHHLLEEE
Query QAPELAVKEMERCVKELG------FPGVQI-GTHVnewdlnAQELFPVYAAAERLKCSLF  172
ident         |      |        | |                 |  |   |  |     
Sbjct GDDGGRLEENLKLYNEWNgfegriFVGFGPhSPYL----csEEYLKRVFDTAKSLNAPVT  200
DSSP  LLLLLHHHHHHHHHHHHLlhhhleEEEEEElLLLL----llHHHHHHHHHHHHHHLLLEE


DSSP  EELllllllhhhhlllhhhHLHHhhhhhHHHHHHHlLLHHhhlLLLLEEELHhHLLHHHH
Query VHPwdmqmdgrmakywlpwLVGMpaettIAICSMImGGVFekfPKLKVCFAHgGGAFPFT  232
ident  |                                            |   ||     |  
Sbjct IHL--------------yeTSKE----eYDLEDIL-NIGL---KEVKTIAAH-CVHLPER  237
DSSP  EEE--------------llLLLL----lLLLHHHH-LLLL---LLLLEEEEE-LLLLLHH


DSSP  HhhhhhhhhhlhhhhlllllllhHHHLLL-LEEELLLL-------lhhHHHHHHHHHLll
Query VgrishgfsmrpdlcaqdnpmnpKKYLGS-FYTDALVH-------dplSLKLLTDVIGkd  284
ident                               |                             
Sbjct Y---------------------fGVLKDIpFFVSHNPAsnlklgngiaPVQRXIEHGX--  274
DSSP  H---------------------hHHHLLLlEEEEELHHhhhhllllllLHHHHHHLLL--


DSSP  LEELLLLLLLlLLLL----LLLHHHHHL------LLLLHHHHHHHHLHHHHHHHLLL---
Query KVILGTDYPFpLGEL----EPGKLIESM------EEFDEETKNKLKAGNALAFLGLE---  331
ident || ||||                |             |  |  |          |     
Sbjct KVTLGTDGAA-SNNSlnlfFEXRLASLLqkaqnpRNLDVNTCLKXVTYDGAQAXGFKsgk  333
DSSP  EEEELLLLLL-LLLLllhhHHHHHHHHHhhllllLLLLHHHHHHHHLHHHHHHHLLLlll


DSSP  -----HHHL---------------------------------------------------
Query -----RKQF---------------------------------------------------  335
ident                                                             
Sbjct ieegwNADLvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidsee  393
DSSP  lllllLLLEeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhh


DSSP  --------------
Query --------------  335
ident               
Sbjct vkrelariekelys  407
DSSP  hhhhhhhhhhhhhl


No 32: Query=4ofcA Sbjct=3e74A Z-score=13.7

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------MKIDIHSH    8
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhhlLHHHHHHHHHHHLL
Query IlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwDPEVRIREMDQKGV   68
ident |                                               |   |     | 
Sbjct I---------------------------------------------GYETGTRAAAKGGI   75
DSSP  L---------------------------------------------LHHHHHHHHHHLLE


DSSP  LEEEEELLHHHhlllllhhhhhhhHHHHHHHHHH-hhhhllLLEEEEELLLLllhhHHHH
Query TVQALSTVPVMfsywakpedtlnlCQLLNNDLAS-tvvsypRRFVGLGTLPMqapeLAVK  127
ident |                                             || |          
Sbjct TTXIEXPLNQL---------patvDRASIELKFDaakgkltIDAAQLGGLVS----YNID  122
DSSP  EEEEELLLLLL---------llllLHHHHHHHHHhhlllllLEEEELEELLL----LLLL


DSSP  HHHHHHHlLLLLEEEEELeelleellLHHH-HHHHHHHHHHLLEEEEEL---llLLLL-H
Query EMERCVKeLGFPGVQIGThvnewdlnAQEL-FPVYAAAERLKCSLFVHP---wdMQMD-G  182
ident          |  |                  |        |     ||            
Sbjct RLHELDE-VGVVGFXCFV-----rdvNDWQfFKGAQKLGELGQPVLVHCenaliCDELgE  176
DSSP  LHHHHHH-HLLLLEEEEL-----lllLHHHhHHHHHHHHHHLLLEEEELllhhhHHHHhH


DSSP  HHH-------LLLHHhhlHHHHHHHHHHHHHHlLLHHHHLllLLEEELHHHL-LHHHhhh
Query RMA-------KYWLPwlvGMPAETTIAICSMImGGVFEKFpkLKVCFAHGGG-AFPFtvg  234
ident                           ||                    |           
Sbjct EAKregrvtaHDYVA--sRPVFTEVEAIRRVL-YLAKVAG--CRLHVCHVSSpEGVE---  228
DSSP  HHHhhllllhHHHHH--lLLHHHHHHHHHHHH-HHHHHHL--LLEEELLLLLhHHHH---


DSSP  hhhhhhhhlhhhhlllllllhHHHL---lLLEEELL-LLLH-------------------
Query rishgfsmrpdlcaqdnpmnpKKYL---gSFYTDAL-VHDP-------------------  271
ident                                                             
Sbjct -------------------evTRARqegqDITCESCpHYFVldtdqfeeigtlakcsppi  269
DSSP  -------------------hhHHHHhlllLEEEEELlHHHHllhhhhhhhlhhhllllll


DSSP  -------HHHHHHHHHHlllLEELLLLLLL---------------LLLLL-LLLHHHH-H
Query -------LSLKLLTDVIgkdKVILGTDYPF---------------PLGEL-EPGKLIE-S  307
ident             |          |  |                      |          
Sbjct rdlenqkGXWEKLFNGE---IDCLVSDHSPcppexkagnixkawgGIAGLqSCXDVXFdE  326
DSSP  llhhhhhHHHHHHHLLL---LLEELLLLLLlllllllllllllllLLLLHhHHHHHHHhH


DSSP  LLL---LLHHHHHHHHLHHHHHHHLLL--------HHHL---------------------
Query MEE---FDEETKNKLKAGNALAFLGLE--------RKQF---------------------  335
ident              || | ||    ||                                  
Sbjct AVQkrgXSLPXFGKLXATNAADIFGLQqkgriapgKDADfvfiqpnssyvltnddleyrh  386
DSSP  HLLlllLLHHHHHHHHLHHHHHHLLLLllllllllLLLLeeeeelllleellhhhlllll


DSSP  -------------------------------------------
Query -------------------------------------------  335
ident                                            
Sbjct kvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  lllllllleelleeeeeeelleeeeelllllllllllleelll


No 33: Query=4ofcA Sbjct=3mtwA Z-score=13.7

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------MK    2
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EEEEEELLllllllhhhhhllllleeeeeeellEEEEEElleeeeeeehhhLLHHHHHHH
Query IDIHSHILpkewpdlkkrfgyggwvqlqhhskgEAKLLKdgkvfrvvrencWDPEVRIRE   62
ident || | |                           |                          
Sbjct IDMHVHLD----------------------slaEVGGYN--sleysdrfwsVVQTANAKK   96
DSSP  EEEEELLL----------------------lllLLLHHH--hhhllhhhhhHHHHHHHHH


DSSP  HHHHLLLEEEEELLhhhhlllllhhhhhhhhhhHHHHHHHHHHHLL------lLEEEEEL
Query MDQKGVTVQALSTVpvmfsywakpedtlnlcqlLNNDLASTVVSYP------rRFVGLGT  116
ident     | |                             |                | |    
Sbjct TLEAGFTTVRNVGA-------------------ADYDDVGLREAIDagyvpgpRIVTAAI  137
DSSP  HHHLLEEEEEELLL-------------------LLLHHHHHHHHHHlllllllEEEELLL


DSSP  -----------------------LLLLLHHHHHHHHHHHHHlLLLLEEEEELE-------
Query -----------------------LPMQAPELAVKEMERCVKeLGFPGVQIGTH-------  146
ident                             |  | |      |  |     |          
Sbjct sfgatgghcdstffppsmdqknpFNSDSPDEARKAVRTLKK-YGAQVIXICATggvfsrg  196
DSSP  leellllllllllllhhhlllllLLLLLHHHHHHHHHHHHH-LLLLEEEEELLlllllll


DSSP  -elleELLLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhhhhHHHHHHH
Query -vnewDLNAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgmpaETTIAIC  204
ident           |    |   |         |                            | 
Sbjct nepgqQQLTYEEmKAVVDEAHMAGIKVAAHA----------------------HGASGIR  234
DSSP  lllllLLLLHHHhHHHHHHHHHLLLEEEEEE----------------------LLHHHHH


DSSP  HHhlllhhhhlllllEEELHhHLLHHHHhhhhhhhhhhlhhhhlllllllhhHHLL--LL
Query SMimggvfekfpklkVCFAHgGGAFPFTvgrishgfsmrpdlcaqdnpmnpkKYLG--SF  262
ident                    |                                |       
Sbjct EA--------vragvDTIEH-ASLVDDE----------------------giKLAVqkGA  263
DSSP  HH--------hhlllLEEEE-LLLLLHH----------------------hhHHHHhhLL


DSSP  EEELLLL----------------------------lHHHHHHHHHHHLllLEELLLLLLL
Query YTDALVH----------------------------dPLSLKLLTDVIGkdKVILGTDYPF  294
ident |                                                 |   |||   
Sbjct YFSMDIYntdytqaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAGI  321
DSSP  EEELLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLLL


DSSP  LllllLLLHHHHH--LLLLLHHHHHHHHLHHHHHHHLLlHHHL-----------------
Query PlgelEPGKLIES--MEEFDEETKNKLKAGNALAFLGLeRKQF-----------------  335
ident         |                      |   ||   |                   
Sbjct Y-phgDNAKQFAVmvRYGATPLQAIQSATLTAAEALGR-SKDVgqvavgrygdmiavagd  379
DSSP  L-lllLHHHHHHHhhHLLLLHHHHHHHLLHHHHHHHLL-LLLLlllllllllleeeelll


DSSP  -------------------------
Query -------------------------  335
ident                          
Sbjct pladvttlekpvfvmkggavvkapx  404
DSSP  llllhhhhhllleeeelleeeelll


No 34: Query=4ofcA Sbjct=2vc5A Z-score=13.7

back to top
DSSP  ----------------lLEEEEEELLLL---lLLLHhhhhllllleEEEEeelleeeeee
Query ----------------mKIDIHSHILPK---eWPDLkkrfgyggwvQLQHhskgeakllk   41
ident                     || |                                    
Sbjct mriplvgkdsieskdigFTLIHEHLRVFseavRQQW--------phLYNE----------   42
DSSP  llllllllllllhhhllLEELLLLLLLLlhhhHHHL--------hhHLLH----------


DSSP  lleeeeEEEHhhlLHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhHHHHhhHHH
Query dgkvfrVVREncwDPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlCQLLnnDLA  101
ident                        | ||      |                   |      
Sbjct -----dEEFR---NAVNEVKRAMQFGVKTIVDPT----------------vMGLG--RDI   76
DSSP  -----hHHHH---HHHHHHHHHHHLLLLEEEELL----------------lLLLL--LLH


DSSP  HHHHHLL----LLEEEEELL----------lllLHHHHHHHHHHHHHLL------LLLEE
Query STVVSYP----RRFVGLGTL----------pmqAPELAVKEMERCVKEL------GFPGV  141
ident               |                               ||           |
Sbjct RFMEKVVkatgINLVAGTGIyiyidlpfyflnrSIDEIADLFIHDIKEGiqgtlnKAGFV  136
DSSP  HHHHHHHhlllLEEEELEELlllllllhhhlllLHHHHHHHHHHHHHLLllllllLLLLE


DSSP  EEELE---ELLEellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHH
Query QIGTH---VNEWdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPA  197
ident  |                       |    |     |                       
Sbjct XIAADepgITKD---VEKViRAAAIANKETKVPIITHS-------------------NAH  174
DSSP  EEELLlllLLHH---HHHHhHHHHHHHHHHLLLEEEEL-------------------LLL


DSSP  HhhHHHHHHHlLLHHHHLLLL-LEEELHHHLLhHHHHhhhhhhhhhlhhhhlllllllhh
Query EttIAICSMImGGVFEKFPKL-KVCFAHGGGAfPFTVgrishgfsmrpdlcaqdnpmnpk  256
ident                |      |    | |                              
Sbjct N--NTGLEQQ-RILTEEGVDPgKILIGHLGDTdNIDY--------------------ikk  211
DSSP  L--LHHHHHH-HHHHHLLLLHhHEEELLHHHLlLHHH--------------------hhh


DSSP  hhLLLLEEELLLL----------LHHHHHHHHHHHLLLLEELLLLLL-------------
Query kyLGSFYTDALVH----------DPLSLKLLTDVIGKDKVILGTDYP-------------  293
ident                               |      ||     ||              
Sbjct iaDKGSFIGLDRYgldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctidwgtakpeyk  271
DSSP  hhHLLLEEEELLLlllllllhhhHHHHHHHHHHLLLLLLEEELLLLLlllllllllhhhh


DSSP  ----lllllLLLL-HHHHHL--LLLLHHHHHHHHLHHHHHHHLllhhhl
Query ----fplgeLEPG-KLIESM--EEFDEETKNKLKAGNALAFLGlerkqf  335
ident                 |         ||        |   |        
Sbjct pklaprwsiTLIFeDTIPFLkrNGVNEEVIATIFKENPKKFFS------  314
DSSP  hhhllllllLHHHhLHHHHHhlLLLLHHHHHHHHLHHHHHHLL------


No 35: Query=4ofcA Sbjct=1a4mA Z-score=13.5

back to top
DSSP  ------LLEEEEEELLllllllhhhhhllllleeeeeeelLEEE---eeeLLEE------
Query ------MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskGEAK---llkDGKV------   45
ident        |   | |                                              
Sbjct tpafnkPKVELHVHLD-------------------gaikpETILyfgkkrGIALpadtve   41
DSSP  llllllLEEEEEEEHH-------------------hlllhHHHHhhhhhhLLLLllllhh


DSSP  ---------------------EEEE---------ehhHLLHhhHHHHHHHHLLLEEEEEL
Query ---------------------FRVV---------renCWDPevRIREMDQKGVTVQALST   75
ident                                                    ||       
Sbjct elrniigmdkplslpgflakfDYYMpviagcreaikrIAYE--FVEMKAKEGVVYVEVRY   99
DSSP  hhhhhhlllllllhhhhhllhHHHHhhhlllhhhhhhHHHH--HHHHHHHLLEEEEEEEE


DSSP  lhhhhlllLLHHH------hhhHHHHHHHHHHHHHHHLL----LLEEEEELL---lLLLH
Query vpvmfsywAKPED------tlnLCQLLNNDLASTVVSYP----RRFVGLGTL---pMQAP  122
ident                                                             
Sbjct sphllansKVDPMpwnqtegdvTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrhqPSWS  159
DSSP  llhhhlllLLLLLhhhllllllLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEelllHHHH


DSSP  HHHHHHHHHHHhlLLLLEEEEE-leeLLEELLLHHHHHHHHHHHHHLLEEEEELllllll
Query ELAVKEMERCVkeLGFPGVQIG-thvNEWDLNAQELFPVYAAAERLKCSLFVHPwdmqmd  181
ident                            |           |  |        ||       
Sbjct LEVLELCKKYN-qKTVVAMDLAgdetIEGSSLFPGHVEAYEGAVKNGIHRTVHA------  212
DSSP  HHHHHHHHHLL-lLLEEEEEEEllllLLLHHHLHHHHHHHHHHHHHLLEEEEEE------


DSSP  hhhhlllhhhhlhHHHHhHHHHHHHHlLLHHhhlllllEEELHhHLLHhHHHHHHhhhhh
Query grmakywlpwlvgMPAEtTIAICSMImGGVFekfpklkVCFAHgGGAFpFTVGRIshgfs  241
ident                                           | |               
Sbjct ------------gEVGS-PEVVREAV-DILK------tERVGH-GYHT-IEDEAL-----  245
DSSP  ------------lLLLL-HHHHHHHH-HLLL------lLEEEE-LHHH-HHLHHH-----


DSSP  hlhhhhlllllllhHHHL-LLLEEELLLL-----------lhHHHHHHHHHHLllLEELL
Query mrpdlcaqdnpmnpKKYL-GSFYTDALVH-----------dpLSLKLLTDVIGkdKVILG  289
ident                  |                                        | 
Sbjct -------------yNRLLkENMHFEVCPWssyltgawdpkttHAVVRFKNDKA--NYSLN  290
DSSP  -------------hHHHHhLLLEEEELHHhhhhlllllllllLHHHHHHHLLL--LEEEL


DSSP  LLLLLLLllLLLLHHHHHLL---LLLHHHHHHHhLHHHHHH-HLLL--HHHL--------
Query TDYPFPLgeLEPGKLIESME---EFDEETKNKLkAGNALAF-LGLE--RKQF--------  335
ident || |                    | ||    |   ||       |   |          
Sbjct TDDPLIF-kSTLDTDYQMTKkdmGFTEEEFKRL-NINAAKSsFLPEeeKKELlerlyrey  348
DSSP  LLLLLLL-lLLHHHHHHHHHhllLLLHHHHHHH-HHHHHHLlLLLHhhHHHHhhhhhhhl


DSSP  -
Query -  335
ident  
Sbjct q  349
DSSP  l


No 36: Query=4ofcA Sbjct=4c5yA Z-score=13.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -lLEEEEEELLLLLlllhhhhhllllleeeeeeellEEEEeelleeEEEE------ehhh
Query -mKIDIHSHILPKEwpdlkkrfgyggwvqlqhhskgEAKLlkdgkvFRVV------renc   53
ident     | | |                                                   
Sbjct pgLWDCHMHFGGDD----------------------DYYN------DYTSglathpassg   92
DSSP  elEEEEEELLLLLL----------------------LLLL------LLHHhhhllhhhhh


DSSP  lLHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhhhhhhhHHHHHHHHLL-----
Query wDPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlcqllnnDLASTVVSYP-----  108
ident         |  | | |                                            
Sbjct aRLARGCWEALQNGYTSYRDLA----------------------gYGCEVAKAINdgtiv  130
DSSP  hHHHHHHHHHHHLLEEEEEELL----------------------lLHHHHHHHHHlllll


DSSP  -LLEEEE-ELLL-------------------------------------LLLHHHHHHHH
Query -RRFVGL-GTLP-------------------------------------MQAPELAVKEM  129
ident           |                                          |      
Sbjct gPNVYSSgAALSqtaghgdifalpagevlgsygvmnprpgywgagplciADGVEEVRRAV  190
DSSP  lLEEEELlLEEEllllllllllllhhhhhhhhlllllllllllllleeeLLLHHHHHHHH


DSSP  HHHHhLLLLLEEEEELE--------elleELLLHHH-HHHHHHHHHHLLEEEEELlllll
Query ERCVkELGFPGVQIGTH--------vnewDLNAQEL-FPVYAAAERLKCSLFVHPwdmqm  180
ident        |                          |        | |       |      
Sbjct RLQI-RRGAKVIXVMASggvmsrddnpnfAQFSPEElKVIVEEAARQNRIVSAHV-----  244
DSSP  HHHH-HHLLLLEEEELLllllllllllllLLLLHHHhHHHHHHHHHLLLLEEEEE-----


DSSP  lhhhhlllhhhhlhhhhHHHHHHHHHHLllhhhhlllLLEEELHhHLLHHHHHhhhhhhh
Query dgrmakywlpwlvgmpaETTIAICSMIMggvfekfpkLKVCFAHgGGAFPFTVgrishgf  240
ident                       |   |                |        |       
Sbjct -----------------HGKAGIMAAIK--------aGCKSLEH-VSYADEEV-------  271
DSSP  -----------------LLHHHHHHHHH--------hLLLEEEE-LLLLLHHH-------


DSSP  hhlhhhhlllllllhhHHLL--LLEEELLLL---------------------------lH
Query smrpdlcaqdnpmnpkKYLG--SFYTDALVH---------------------------dP  271
ident                            |                                
Sbjct ---------------wELMKekGILYVATRSvieiflasngeglvkeswaklqaladshL  316
DSSP  ---------------hHHHHhhLLEEELLHHhhhhhhhhllllllllhhhlllhhhhhhH


DSSP  HHHHHHHHHHLllLEELLLLLLlllLLLLLLHHHHHLlLLLHHHHHHHHLHHHHHHHL--
Query LSLKLLTDVIGkdKVILGTDYPfplGELEPGKLIESMeEFDEETKNKLKAGNALAFLG--  329
ident                 ||||                          |    ||    |  
Sbjct KAYQGAIKAGV--TIALGTDTApggPTALELQFAVERgGMTPLEAIKAATANAPLSVGpq  374
DSSP  HHHHHHHHLLL--LEELLLLLLlllLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHHHhh


DSSP  LLHH--------------------------------------------------------
Query LERK--------------------------------------------------------  333
ident                                                             
Sbjct APLTgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnp  434
DSSP  LLLLlllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllll


DSSP  hl
Query qf  335
ident   
Sbjct fl  436
DSSP  ll


No 37: Query=4ofcA Sbjct=2oofA Z-score=13.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --lLEEEEEELLLLllllhhhhhllllleeeeeeellEEEE-------------eELLEE
Query --mKIDIHSHILPKewpdlkkrfgyggwvqlqhhskgEAKL-------------lKDGKV   45
ident     || | |                                                | 
Sbjct tpgLIDCHTHLIFA-----------------------GSRAeefelrqkgvpyaeIARKG   97
DSSP  eelEEEEEELLLLL-----------------------LLLHhhhhhhhhlllhhhHHHLL


DSSP  EE-----------eeehhhlLHHHHHHHHHHHLLLEEEEELlHHHHlllllhhhHHHHHH
Query FR-----------vvrencwDPEVRIREMDQKGVTVQALSTvPVMFsywakpedTLNLCQ   94
ident                         |       |||                   ||    
Sbjct GGiistvratraasedqlfeLALPRVKSLIREGVTTVEIKS-GYGL--------TLEDEL  148
DSSP  LLhhhhhhhhhhllhhhhhhHHHHHHHHHHHHLEEEEEEEL-LLLL--------LHHHHH


DSSP  HHHHHHHHHHHHLLLLEEEEELL-----------llLLHHHHH-HHHHHHHHLLLLLEEE
Query LLNNDLASTVVSYPRRFVGLGTL-----------pmQAPELAV-KEMERCVKELGFPGVQ  142
ident              | |                       |                  | 
Sbjct KXLRVARRLGEALPIRVKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGLADAVD  208
DSSP  HHHHHHHHHHHHLLLEEEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLLLLEEE


DSSP  EELEellEELLLhhHHHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhHH
Query IGTHvneWDLNAqeLFPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttIA  202
ident          |       || ||         |                            
Sbjct VFCEhigFSLAQ--TEQVYLAADQYGLAVKGHX------------------dQLSN-lGG  247
DSSP  EEELlllLLHHH--HHHHHHHHHHLLLEEEEEE------------------lLLLL-lLH


DSSP  HHHhhlllhhhhlLLLLEEELHhHLLHHHHhhhhhhhhhhlhhhhlllllllhhHHLL--
Query ICSmimggvfekfPKLKVCFAHgGGAFPFTvgrishgfsmrpdlcaqdnpmnpkKYLG--  260
ident                      |                                  |   
Sbjct STL--------aaNFGALSVDH-LEYLDPE----------------------giQALAhr  276
DSSP  HHH--------hhHLLLLEEEE-LLLLLHH----------------------hhHHHHhh


DSSP  LLEEELLLL--------lhhHHHHHHHHHLllLEELLLLLLLLLL-LLLL---LHHHHHL
Query SFYTDALVH--------dplSLKLLTDVIGkdKVILGTDYPFPLG-ELEP---GKLIESM  308
ident       |                 |             |                     
Sbjct GVVATLLPTafyflketklpPVVALRKAGV--PXAVSSDINPGTApIVSLrxaXNXACTL  334
DSSP  LLEEEELHHhhhhlllllllLHHHHHHLLL--LEEELLLLLLLLLlLLLHhhhHHHHHHH


DSSP  LLLLHHHHHHHHLHHHHHHHLLLHHH----------------------------------
Query EEFDEETKNKLKAGNALAFLGLERKQ----------------------------------  334
ident                |   ||                                       
Sbjct FGLTPVEAXAGVTRHAARALGEQEQLgqlrvgxladflvwncghpaelsyligvdqlvsr  394
DSSP  HLLLHHHHHHHLLHHHHHHLLLLLLLlllllllllleeeellllllhhhhlllllleeee


DSSP  --------l
Query --------f  335
ident          
Sbjct vvngeetlh  403
DSSP  eelleelll


No 38: Query=4ofcA Sbjct=3nqbA Z-score=13.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------LLEEEEEELLllllllhhhhhllllleeeeeeelleeeeeel
Query ------------------MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeakllkd   42
ident                     || | ||                                 
Sbjct srrdaaqvidaggayvspGLIDTHXHIE--------------------------------   88
DSSP  lllleeeeeelllleeeeLEEEEEELHH--------------------------------


DSSP  leeeeeeehHHLLHHHHHHHHHHHLLLEEEEELLhHHHLllllhhhhhhHHHHHHHHHHH
Query gkvfrvvreNCWDPEVRIREMDQKGVTVQALSTVpVMFSywakpedtlnLCQLLNNDLAS  102
ident              |          |||                               | 
Sbjct --------sSXITPAAYAAAVVARGVTTIVWDPH-EFGN---------vHGVDGVRWAAK  130
DSSP  --------hHLLLHHHHHHHHHLLLEEEEEELLH-HHHH---------hHLHHHHHHHHH


DSSP  HHHHLlLLEEEEELLL------------lLLHHHHHHHHHHhhhlLLLLEEEEELEellE
Query TVVSYpRRFVGLGTLP------------mQAPELAVKEMERcvkeLGFPGVQIGTHvneW  150
ident        |   |                                     |          
Sbjct AIENLpLRAILLAPSCvpsapglerggadFDAAILADLLSW----PEIGGIAEIXN--xR  184
DSSP  HHLLLlLEEEEEELLLlllllllllllllLLHHHHHHHHLL----LLEEEEEEELL--hH


DSSP  ELL-LHHH-HHHHHHHHHHLLEEEEElllllllhhhhlllhhhhlhhhhhHHHH-hhHHH
Query DLN-AQEL-FPVYAAAERLKCSLFVHpwdmqmdgrmakywlpwlvgmpaeTTIA-icSMI  207
ident               |          |                                  
Sbjct GVIeRDPRxSGIVQAGLAAEKLVCGH------------------------ARGLknaDLN  220
DSSP  HHHlLLHHhHHHHHHHHHHLLEEEEL------------------------LLLLlhhHHH


DSSP  LllHHHHLllllEEELhHHLL--HHHHhhhhhhhhhhlhhhhlllllllhhhhLLLLEEE
Query MggVFEKFpklkVCFAhGGGA--FPFTvgrishgfsmrpdlcaqdnpmnpkkyLGSFYTD  265
ident                                                             
Sbjct A--FXAAG---vSSDH-ELVSgeDLXA------------------------klRAGLTIE  250
DSSP  H--HHHLL---lLEEL-LLLLhhHHHH------------------------hhHLLLEEE


DSSP  LL----lLLHHHHHHH-hhhhLLLLEELLLLLLLL------llllLLLHHHHHLLlLLHH
Query AL----vHDPLSLKLL-tdviGKDKVILGTDYPFP------lgelEPGKLIESMEeFDEE  314
ident          |     |         | | ||  ||                        |
Sbjct LRgshdhLLPEFVAALntlghLPQTVTLCTDDVFPddllqgggldDVVRRLVRYG-LKPE  309
DSSP  EElllhhHHHHHHHHHhhhllLLLLEEEELLLLLHhhhhhlllhhHHHHHHHHLL-LLHH


DSSP  HHHHHHLHHHHHHHLLL--------HHHL-------------------------------
Query TKNKLKAGNALAFLGLE--------RKQF-------------------------------  335
ident         ||   ||          |                                  
Sbjct WALRAATLNAAQRLGRSdlgliaagRRADivvfedlngfsarhvlasgravaeggrxlvd  369
DSSP  HHHHHHLHHHHHHHLLLllllllllLLLLeeeellllllleeeeeelleeeeelleelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct iptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvpp  429
DSSP  llllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct egatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaan  489
DSSP  lleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct avigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylv  549
DSSP  hhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllll


DSSP  --------------------------------------
Query --------------------------------------  335
ident                                       
Sbjct fkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhhlllllllllleelllleeelllleeellleeel


No 39: Query=4ofcA Sbjct=2ogjA Z-score=13.0

back to top
DSSP  --------------------------------------------------------lLEE
Query --------------------------------------------------------mKID    4
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE


DSSP  EEEELLLLllllhhhhhllllleeeeeeelleeeeeelleeeeeeeHHHLlhhhHHHH-H
Query IHSHILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrENCWdpevRIRE-M   63
ident  | ||                                                 |  |  
Sbjct LHVHIWHG------------------------------------gtDISI----RPSEcG   80
DSSP  EEELLLLL------------------------------------llLLLL----LHHHlL


DSSP  HHHLLLEEEEELLhhhhlllllhhhhhhhHHHHHHHHHH-HHHHLlLLEEEEELLL----
Query DQKGVTVQALSTVpvmfsywakpedtlnlCQLLNNDLAS-TVVSYpRRFVGLGTLP----  118
ident    |||                                         |      |     
Sbjct AERGVTTLVDAGS---------------aGEANFHGFREyIIEPSrERIKAFLNLGsigl  125
DSSP  HHHLEEEEEEELL---------------lLLLLHHHHHHhLLLLLlLEEEEEEELLllll


DSSP  --------LLLHHHH-HHHHHHHHHLLL--LLEEEEELE---ELLEELllHHHHHHHHHH
Query --------MQAPELA-VKEMERCVKELG--FPGVQIGTH---VNEWDLnaQELFPVYAAA  164
ident                       |  |      |            |             |
Sbjct vacnrvpeLRDIKDIdLDRILECYAENSehIVGLXVRAShviTGSWGV--TPVKLGKKIA  183
DSSP  llllllllLLLHHHLlHHHHHHHHHLLLllEEEEEEEELhhhHLLLLL--HHHHHHHHHH


DSSP  HHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhhHHHHHHllLHHHhllllLEEELH
Query ERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttiAICSMImgGVFEkfpklKVCFAH  224
ident   ||    ||                                                 |
Sbjct KILKVPXXVHV-------------------GEPP--aLYDEVL--EILG----pGDVVTH  216
DSSP  HHHLLLEEEEE-------------------LLLL--lLHHHHH--HHLL----lLLEEEL


DSSP  HHL----LHHHHHHHHhhhhhhlhhhhlllllllhHHHL--LLLEEELL----LLLHHHH
Query GGG----AFPFTVGRIshgfsmrpdlcaqdnpmnpKKYL--GSFYTDAL----VHDPLSL  274
ident                                               |             
Sbjct CFNgksgSSIXEDEDL------------------fNLAErcEGIRLDIGhggaSFSFKVA  258
DSSP  LLLllllLLLLLLHHH------------------hHHHHhlLLLEEELLllllLLLHHHH


DSSP  HHHH-HHHLllLEELLLLLLLLLL---LLLLLHHHHHLL--LLLHHHHHHHHLHHHHHHH
Query KLLT-DVIGkdKVILGTDYPFPLG---ELEPGKLIESME--EFDEETKNKLKAGNALAFL  328
ident                 ||                           |        |     
Sbjct EAAIaRGLL--PFSISTDLHGHSXnfpVWDLATTXSKLLsvDXPFENVVEAVTRNPASVI  316
DSSP  HHHHhLLLL--LLLLLLLLLLLLLlllLLLHHHHHHHHHhlLLLHHHHHHLLLHHHHHHL


DSSP  LLLHH-------------------------------------------------------
Query GLERK-------------------------------------------------------  333
ident  |                                                          
Sbjct RLDXEnrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryi  376
DSSP  LLLLLllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeelllll


DSSP  -hl
Query -qf  335
ident    
Sbjct pra  379
DSSP  lll


No 40: Query=4ofcA Sbjct=3mkvA Z-score=12.9

back to top
DSSP  ---------------------------------------------------------lLE
Query ---------------------------------------------------------mKI    3
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE


DSSP  EEEEELLllllllhhhhhlllllEEEEEeelleeeeeelleeeeeEEHHhllhHHHHHHH
Query DIHSHILpkewpdlkkrfgyggwVQLQHhskgeakllkdgkvfrvVRENcwdpEVRIREM   63
ident | | |                    |                               | |
Sbjct DLHVHVV-------aiefnlprvATLPN--------------vlvTLRA----VPIMRAM   95
DSSP  EEEELLL-------lllllhhhhLLLLH--------------hhhHHHH----HHHHHHH


DSSP  HHHLLLEEEEELLhhhhlllllhhhhhhhhhhhhhhHHHHHHHLL------lLEEEE-EL
Query DQKGVTVQALSTVpvmfsywakpedtlnlcqllnndLASTVVSYP------rRFVGL-GT  116
ident    | |                                              |       
Sbjct LRRGFTTVRDAGG----------------------aGYPFKQAVEsglvegpRLFVSgRA  133
DSSP  HHLLEEEEEELLL----------------------lLHHHHHHHHlllllllEEEELlLE


DSSP  LL---------------------------------LLLHHHHHHHHHHHHHlLLLLEEEE
Query LP---------------------------------MQAPELAVKEMERCVKeLGFPGVQI  143
ident |                                                    |     |
Sbjct LSqtgghadprarsdymppdspcgccvrvgalgrvADGVDEVRRAVREELQ-MGADQIXI  192
DSSP  EElllllllllllllllllllllllllllllleeeLLLHHHHHHHHHHHHH-HLLLLEEE


DSSP  ELE--------ellEELLLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlh
Query GTH--------vneWDLNAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvg  194
ident                            | |         |                    
Sbjct MASggvasptdpvgVFGYSEDEiRAIVAEAQGRGTYVLAHA-------------------  233
DSSP  ELLlllllllllllLLLLLHHHhHHHHHHHHLLLLLEEEEE-------------------


DSSP  hhhHHHHHHHHHHLllhhhhlllLLEEELHhHLLHHHHHhhhhhhhhhlhhhhlllllll
Query mpaETTIAICSMIMggvfekfpkLKVCFAHgGGAFPFTVgrishgfsmrpdlcaqdnpmn  254
ident     |  ||                    | |                            
Sbjct ---YTPAAIARAVR--------cGVRTIEH-GNLIDDET---------------------  260
DSSP  ---LLHHHHHHHHH--------lLLLEEEE-LLLLLHHH---------------------


DSSP  hhHHLL--LLEEELLLL----------------------------LHHHHHHHHHHHLll
Query pkKYLG--SFYTDALVH----------------------------DPLSLKLLTDVIGkd  284
ident           |                                     |           
Sbjct -aRLVAehGAYVVPTLVtydalasegekyglppesiakiadvhgaGLHSIEIMKRAGV--  317
DSSP  -hHHHHhhLLEEELLHHhhhhhhhhlllllllhhhhllhhhhhllHHHHHHHHHHHLL--


DSSP  LEELLLLLLLLL--lLLLLLHHHHHLllLLHHHHHHHHLHHHHHHHLLLHHH--------
Query KVILGTDYPFPL--gELEPGKLIESMeeFDEETKNKLKAGNALAFLGLERKQ--------  334
ident |   |||                                      ||   |         
Sbjct KMGFGTDLLGEAqrlQSDEFRILAEV--LSPAEVIASATIVSAEVLGMQDKLgrivpgah  375
DSSP  LLLLLLLLLHHHhhhLLHHHHHHHLL--LLHHHHHHHLLHHHHHHLLLLLLLllllllll


DSSP  --------------------------------------l
Query --------------------------------------f  335
ident                                        
Sbjct advlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  lleeeellllllllllllllllllleeeelleeeeelll


No 41: Query=4ofcA Sbjct=2imrA Z-score=12.7

back to top
DSSP  -------------------------------------------------------LLEEE
Query -------------------------------------------------------MKIDI    5
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  EEELLllllllhhhhhllllleeeeeeelleeeeeelleEEEE--EEHHHL--LHHHHHH
Query HSHILpkewpdlkkrfgyggwvqlqhhskgeakllkdgkVFRV--VRENCW--DPEVRIR   61
ident | |                                       |   |             
Sbjct HTHLD-------------------msayefqalpyfqwiPEVVirGRHLRGvaAAQAGAD  101
DSSP  EEELL-------------------llhhhhhhlhhhhllHHHHhhHLLLLHhhHHHHHHH


DSSP  HHHHHLLLEEEEELlhhhhlllllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEELLLLL-
Query EMDQKGVTVQALSTvpvmfsywakpedtlnlcqlLNNDLASTVVSYPRRFVGLGTLPMQ-  120
ident      |                                                      
Sbjct TLTRLGAGGVGDIV-------------------wAPEVMDALLAREDLSGTLYFEVLNPf  142
DSSP  HHHHLLLLLEEEEE-------------------lLHHHHHHHHLLLLLLEEEEEEELLLl


DSSP  ---LHHHHHHHHHHHhHLLL-------LLEEEE-ELEElleellLHHH-HHHHHHHHHHL
Query ---APELAVKEMERCvKELG-------FPGVQI-GTHVnewdlnAQEL-FPVYAAAERLK  168
ident    | |                       |                 |       |    
Sbjct pdkADEVFAAARTHL-ERWRrlerpglRLGLSPhTPFT-----vSHRLmRLLSDYAAGEG  196
DSSP  hhhHHHHHHHHHHHH-HHHHlllllleEEEEEElLLLL-----lLHHHhHHHHHHHHHHL


DSSP  LEEEEELllllllhhhhlllhhhHLHHHH-------------------------------
Query CSLFVHPwdmqmdgrmakywlpwLVGMPA-------------------------------  197
ident   |  |                                                      
Sbjct LPLQIHV--------------aeHPTELEmfrtgggplwdnrmpalyphtlaevigrepg  242
DSSP  LLLEEEE--------------llLHHHHHhhhhlllllhhhllhhhllllhhhhhlllll


DSSP  hhhHHHHHHHLLLHHHhlllLLEEELhHHLLhHHHHhhhhhhhhhlhhhhlllllllhhH
Query ettIAICSMIMGGVFEkfpkLKVCFAhGGGAfPFTVgrishgfsmrpdlcaqdnpmnpkK  257
ident             ||                                              
Sbjct pdlTPVRYLDELGVLA----ARPTLV-HMVN-VTPD---------------------diA  275
DSSP  lllLHHHHHHHHLLHH----HLLEEE-ELLL-LLHH---------------------hhH


DSSP  HLL--LLEEELLLL-------lhhHHHHHHHHHLllLEELLLLLlLLLL-llLLLH---H
Query YLG--SFYTDALVH-------dplSLKLLTDVIGkdKVILGTDYpFPLG-elEPGK---L  304
ident                                      | ||||     |           
Sbjct RVAraGCAVVTCPRsnhhlecgtfDWPAFAAAGV--EVALGTDS-VASGetlNVREevtF  332
DSSP  HHHhhLLLEEELHHhhhhllllllLHHHHHHLLL--LEEELLLL-HHHHlllLLHHhhhH


DSSP  HHH-LLLLLHHHHHHHHLHHHHHHHlLLHH-----------------hl
Query IES-MEEFDEETKNKLKAGNALAFLgLERK-----------------qf  335
ident         |                                        
Sbjct ARQlYPGLDPRVLVRAAVKGGQRVV-GTPFlrrgetwqegfrwelsrdl  380
DSSP  HHHhLLLLLHHHHHHHHHHHHHHHH-LLLLllllllllhhhlhhhllll


No 42: Query=4ofcA Sbjct=3icjA Z-score=12.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEEEEEELL--------------------------------------------------
Query MKIDIHSHIL--------------------------------------------------   10
ident    | | |                                                    
Sbjct AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ----------------------------------llllllhhhhHLLL--LLEEEeeeel
Query ----------------------------------pkewpdlkkrFGYG--GWVQLqhhsk   34
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivrERALeeSRKII-----  175
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeeHHHHhhHHHHH-----


DSSP  leeeeeelleeeeeeehhhLLHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhHH
Query geakllkdgkvfrvvrencWDPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlCQ   94
ident                       |         ||                          
Sbjct --------nekiltvkdykHYIESAQEHLLSLGVHSVGFMS----------------vGE  211
DSSP  --------hhllllhhhhhHHHHHHHHHHHHLLEEEEEEEE----------------eLH


DSSP  HHHHHHHHHH--hHLLLLEEEEELLLlllhhhHHHH--hhHHHH---llLLLEEEEELE-
Query LLNNDLASTV--vSYPRRFVGLGTLPmqapelAVKE--meRCVK---elGFPGVQIGTH-  146
ident      |                            |                 ||      
Sbjct KALKALFELEregRLKMNVFAYLSPE-----lLDKLeelnLGKFegrrlRIWGVXLFVDg  266
DSSP  HHHHHHHHHHhllLLLLEEEEEELHH-----hHHHHhhhlLLLEellleEEEEEEEELLl


DSSP  --------------------eLLEELLLHhHHHHHHHHHHHLLEEEEELllllllhhhhl
Query --------------------vNEWDLNAQeLFPVYAAAERLKCSLFVHPwdmqmdgrmak  186
ident                                  |   |  |     ||            
Sbjct slgartallsepytdnpttsgELVMNKDE-IVEVIERAKPLGLDVAVHA-----------  314
DSSP  lllllllllllllllllllllLLLLLHHH-HHHHHHHHLLLLLEEEEEE-----------


DSSP  llhhhhlhhhhHHHHHHHHHHllLHHHHLLlLLEEELhHHLLhHHHHhhhhhhhhhlhhh
Query ywlpwlvgmpaETTIAICSMImgGVFEKFPkLKVCFAhGGGAfPFTVgrishgfsmrpdl  246
ident                |         ||                                 
Sbjct -----------IGDKAVDVAL--DAFEEAE-FSGRIE-HASL-VRDD-------------  345
DSSP  -----------LLHHHHHHHH--HHHHHHL-LLLEEE-ELLL-LLHH-------------


DSSP  hlllllllHHHHLL--LLEEELLLLLH------------------hHHHHHHHHHlllLE
Query caqdnpmnPKKYLG--SFYTDALVHDP------------------lSLKLLTDVIgkdKV  286
ident                      |  |                      || |       | 
Sbjct --------QLERIKelKVRISAQPHFIvsdwwivnrvgeerakwayRLKTLSSIT---KL  394
DSSP  --------HHHHHHhhLLEEEELLLHHhhlllhhhhhhhhhhhhllLHHHHHHHL---LE


DSSP  ELLLLLLLllLLLLLLHHHHHLL---------LLLHHHHHHHHLHHHHHHHLLL------
Query ILGTDYPFplGELEPGKLIESME---------EFDEETKNKLKAGNALAFLGLE------  331
ident    || |       |   |                 |    |           |      
Sbjct GFSTDSPI--EPADPWVSIDAAVnryvvdpgeRVSREEALHLYTHGSAQVTLAEdlgkle  452
DSSP  EELLLLLL--LLLLHHHHHHHHHhlllllhhhLLLHHHHHHHLLHHHHHHLLLLllllll


DSSP  --HHHL----------
Query --RKQF----------  335
ident                 
Sbjct rgFRAEyiildrdplk  468
DSSP  llLLLLeeeellllll


No 43: Query=4ofcA Sbjct=1a5kC Z-score=12.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------LLEEEEEELlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhH
Query -------MKIDIHSHIlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenC   53
ident          || | |                                             
Sbjct egkivtaGGIDTHIHW-------------------------------------------I  137
DSSP  llleeeeLEEEEEEEL-------------------------------------------L


DSSP  LLHhhHHHHHHHHLLLEEEEEL------LHHHhlllllhhhhhhhHHHHHHHHHHHHHHL
Query WDPevRIREMDQKGVTVQALST------VPVMfsywakpedtlnlCQLLNNDLASTVVSY  107
ident         |    |||                                          | 
Sbjct CPQ--QAEEALVSGVTTMVGGGtgpaagTHAT---------tctpGPWYISRMLQAADSL  186
DSSP  LLL--HHHHHHHHLEEEEEEELllllhhHHHL---------llllHHHHHHHHHHHHLLL


DSSP  LLLEEEEELLlLLLHhHHHHHHHHHhhllLLLEEEEELEEllEELLLhhhHHHHHHHHHH
Query PRRFVGLGTLpMQAPeLAVKEMERCvkelGFPGVQIGTHVneWDLNAqelFPVYAAAERL  167
ident |     ||      |  |  |        |  |  |          |         |   
Sbjct PVNIGLLGKGnVSQP-DALREQVAA----GVIGLEIHEDW--GATPA-aiDCALTVADEM  238
DSSP  LLEEEEEEELlLLLH-HHHHHHHHH----LLLEEEEEHHH--LLLHH-hhHHHHHHHHHH


DSSP  LLEEEEELllllllhhhhlllhhhhlhhhhHHHH---hHHHHHllLHHHhlllLLEEELH
Query KCSLFVHPwdmqmdgrmakywlpwlvgmpaETTI---aICSMImgGVFEkfpkLKVCFAH  224
ident       |                        |                           |
Sbjct DIQVALHS----------------------DTLNesgfVEDTL--AAIG---gRTIHTFH  271
DSSP  LLEEEEEL----------------------LLLLllllHHHHH--HHHL---lLLEEELL


DSSP  HHL-------LHHHhhhhhhhhhhhlhhhhlllllllhhhHLLLLEEELL--LLLH----
Query GGG-------AFPFtvgrishgfsmrpdlcaqdnpmnpkkYLGSFYTDAL--VHDP----  271
ident   |                                                         
Sbjct TEGaggghapDIIT------------------------acAHPNILPSSTnpTLPYtlnt  307
DSSP  LLLlllllllLHHH------------------------hhHLLLEEEEEEhhHLLLlllh


DSSP  ----------------------------------HHHHHHH-HHHLlllEELLLLLLLlL
Query ----------------------------------LSLKLLT-DVIGkdkVILGTDYPFpL  296
ident                                        |              |     
Sbjct idehldmlmvchhldpdiaedvafaesrirretiAAEDVLHdLGAF---SLTSSDSQA-M  363
DSSP  hhhhhhhhhhhhllllllhhhhhlllllllhhhhHHHHHHHhLLLL---LEEELLLLL-L


DSSP  LLL-LLLHHHHH-LLLL-----------------LHHHHHHHHLHHHHHHHLLLHHH---
Query GEL-EPGKLIES-MEEF-----------------DEETKNKLKAGNALAFLGLERKQ---  334
ident |   |                                        |     |        
Sbjct GRVgEVILRTWQvAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAHEVgsi  423
DSSP  LLLlLHHHHHHHhHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLLLLlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  334
ident                                                             
Sbjct evgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsar  483
DSSP  llllllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  334
ident                                                             
Sbjct hhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevr  543
DSSP  hhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellllllee


DSSP  ----------------------l
Query ----------------------f  335
ident                        
Sbjct vdgelitsepadvlpmaqryflf  566
DSSP  elleellllllllllllllllll


No 44: Query=4ofcA Sbjct=2uz9A Z-score=12.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------lLEEEEEELL---------------------------llLLLLhhhhhlll
Query ---------mKIDIHSHIL---------------------------pkEWPDlkkrfgyg   24
ident             | | |                                           
Sbjct lshheffmpgLVDTHIHASqysfagssidlpllewltkytfpaehrfqNIDF--------  112
DSSP  llllleeeelEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhLHHH--------


DSSP  lleeeeeeelleeeeeelleeeeeeehhHLLH-HHHHHHHhhhlLLEEEEELlhhhhlll
Query gwvqlqhhskgeakllkdgkvfrvvrenCWDP-EVRIREMdqkgVTVQALSTvpvmfsyw   83
ident                                              |              
Sbjct ------------------------aeevYTRVvRRTLKNG----TTTACYFA--------  136
DSSP  ------------------------hhhhHHHHhHHHHHLL----EEEEEEEL--------


DSSP  llhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELLLLL---------LHHHHHHHHHHHHH
Query akpedtlnlCQLLNNDLASTVVSYPRRFVGLGTLPMQ---------APELAVKEMERCVK  134
ident                 ||        |                     |   || || | 
Sbjct -------tiHTDSSLLLADITDKFGQRAFVGKVCMDLndtfpeykeTTEESIKETERFVS  189
DSSP  -------llLHHHHHHHHHHHHHHLLEEEEELEELLLlllllllllLHHHHHHHHHHHHH


DSSP  LLL-------LLEEE-EELEElleellLHHH-HHHHHHHHHHLLEEEEELllllllhhhh
Query ELG-------FPGVQ-IGTHVnewdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrma  185
ident |          | |                |       |         |           
Sbjct EMLqknysrvKPIVTpRFSLS-----cSETLmGELGNIAKTRDLHIQSHI----------  234
DSSP  HHHhhlllleEEEEEeLLHHH-----lLHHHhHHHHHHHHHHLLEEEEEE----------


DSSP  lllhhhHLHHHH-------hhhHHHHHHHLLlhhhhlllLLEEELHhHLLHHHHHhhhhh
Query kywlpwLVGMPA-------ettIAICSMIMGgvfekfpkLKVCFAHgGGAFPFTVgrish  238
ident                                         |   || |            
Sbjct ----seNRDEVEavknlypsykNYTSVYDKN----nlltNKTVMAH-GCYLSAEE-----  280
DSSP  ----llLHHHHHhhhhhlllllLHHHHHHHL----llllLLEEEEE-LLLLLHHH-----


DSSP  hhhhlhhhhlllllllhhHHLL--LLEEELLLL-------lhhHHHHHHHHHLllLEELL
Query gfsmrpdlcaqdnpmnpkKYLG--SFYTDALVH-------dplSLKLLTDVIGkdKVILG  289
ident                                                        |  ||
Sbjct -----------------lNVFHerGASIAHCPNsnlslssgflNVLEVLKHEV--KIGLG  321
DSSP  -----------------hHHHHhhLLEEEELHHhhhhllllllLHHHHHHLLL--EEEEL


DSSP  LLLLllLLLL----LLLHHHHH-----------lLLLLHHHHHHHHLHHHHH-HHLLL--
Query TDYPfpLGEL----EPGKLIES-----------mEEFDEETKNKLKAGNALA-FLGLE--  331
ident ||     |                                    |               
Sbjct TDVA--GGYSysmlDAIRRAVMvsnillinkvneKSLTLKEVFRLATLGGSQaLGLDGei  379
DSSP  LLLL--LLLLllhhHHHHHHHHhhhhhhhlllllLLLLHHHHHHHHLHHHHHhLLLLLll


DSSP  ------HHHL--------------------------------------------------
Query ------RKQF--------------------------------------------------  335
ident                                                             
Sbjct gnfevgKEFDailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkq  439
DSSP  llllllLLLLeeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeellee


DSSP  -----
Query -----  335
ident      
Sbjct vvpfs  444
DSSP  eelll


No 45: Query=4ofcA Sbjct=1j5sA Z-score=12.0

back to top
DSSP  -------------------------LLEEEEEELLllllllhhhhhllllleeeeeeell
Query -------------------------MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskg   35
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLD-------------------------   35
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL-------------------------


DSSP  eeeeeelleeeeeeehhhLLHH--------------------------------------
Query eakllkdgkvfrvvrencWDPE--------------------------------------   57
ident                    |                                        
Sbjct -----------------aKDIVenkpwndiwevegatdhyvwelmrrcgvseeyitgsrs   78
DSSP  -----------------hHHHHhllllllhhhhhllllhhhhhhhhhllllhhhllllll


DSSP  ---------------------------------------------------------HHH
Query ---------------------------------------------------------VRI   60
ident                                                             
Sbjct nkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQ  138
DSSP  hhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHH


DSSP  HHHHHHLLLEEEEELlhhhhlllllhhhhhhhHHHHHHHHHHHHHHL-lLLEEEEELL--
Query REMDQKGVTVQALSTvpvmfsywakpedtlnlCQLLNNDLASTVVSY-pRRFVGLGTL--  117
ident        |                                                    
Sbjct KLLRDMKVEILCTTD----------------dPVSTLEHHRKAKEAVegVTILPTWRPdr  182
DSSP  HHHHHLLEEEEELLL----------------lLLLLLHHHHHHHHHLllLEEELLLLLhh


DSSP  LLLL--------------------------HHHHHHHHHHHHhLLLLLEEEEELEelleE
Query PMQA--------------------------PELAVKEMERCVkELGFPGVQIGTHvnewD  151
ident  |                                 |  |    | |              
Sbjct AMNVdkegwreyvekmgerygedtstldgfLNALWKSHEHFK-EHGCVASDHALL----E  237
DSSP  HHLLllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHH-LLLLLEEEEEEL----L


DSSP  LLL-------------------------------HHHHHHHHHHHHHLLEEEEEL-LLLL
Query LNA-------------------------------QELFPVYAAAERLKCSLFVHP-WDMQ  179
ident                                                      |      
Sbjct PSVyyvdenraravhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHIgALRD  297
DSSP  LLLllllhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEElEELL


DSSP  LLHHHH-----lLLHHhhlHHHHhhhHHHHHHHllLHHHHLL-LLLEEElhHHLL--HHH
Query MDGRMA-----kYWLPwlvGMPAettIAICSMImgGVFEKFP-KLKVCFahGGGA--FPF  231
ident                                         |  |||              
Sbjct YRDSLFktlgpdSGGD---ISTN-flRIAEGLR--YFLNEFDgKLKIVL--YVLDptHLP  349
DSSP  LLHHHHhhllllLLLL---EELL-llLHHHHHH--HHHHHLLlLLLEEE--EELLhhHHH


DSSP  HhhhhhhhhhhlhhhhlllllllhHHHL---lLLEEELL--LLLHHHHHHHHHHH-----
Query TvgrishgfsmrpdlcaqdnpmnpKKYL---gSFYTDAL--VHDPLSLKLLTDVI-----  281
ident |                                           |               
Sbjct T---------------------isTIARafpnVYVGAPWwfNDSPFGMEMHLKYLasvdl  388
DSSP  H---------------------hhHHHHhlllEEELLLLllLLLHHHHHHHHHHHhllll


DSSP  LLLLEELLLLLLLLlLLLLLLHHHHH--LLLL-------------LHHHHHHHHLHHHHH
Query GKDKVILGTDYPFPlGELEPGKLIES--MEEF-------------DEETKNKLKAGNALA  326
ident         ||                                     |           |
Sbjct LYNLAGMVTDSRKLlSFGSRTEMFRRvlSNVVgemvekgqipikeARELVKHVSYDGPKA  448
DSSP  HHHLLLLLLLLLLLlHHHHHHHHHHHhhHHHHhhhhhlllllhhhHHHHHHHHHLHHHHH


DSSP  HHLllhhhl
Query FLGlerkqf  335
ident          
Sbjct LFF------  451
DSSP  HHL------


No 46: Query=4ofcA Sbjct=3iacA Z-score=11.9

back to top
DSSP  --------------------------LLEEEEEE-LLLLllllhhhhhllllleeeeeeE
Query --------------------------MKIDIHSH-ILPKewpdlkkrfgyggwvqlqhhS   33
ident                              | | |                          
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHlSPQE-------------iaddrrfD   47
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLlLHHH-------------hhhllllL


DSSP  LLEEeeeelleeeEEEE-------------------------------------------
Query KGEAkllkdgkvfRVVR-------------------------------------------   50
ident                                                             
Sbjct NLGQ--------iWLEGdhykwralrsagvdeslitgketsdyekyxawantvpktlgnp   99
DSSP  LHHH--------hHHLLllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllh


DSSP  ----------------------------------hhhllhhHHHHHHHHHLLLEEEEELl
Query ----------------------------------encwdpeVRIREMDQKGVTVQALSTv   76
ident                                                 |  |        
Sbjct lyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD-  158
DSSP  hhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL-


DSSP  hhhhlllllhhhhhhhHHHHhHHHHHHHHH--LLLLEEEEELLLLL--------------
Query pvmfsywakpedtlnlCQLLnNDLASTVVS--YPRRFVGLGTLPMQ--------------  120
ident                    |                                        
Sbjct --------------dpIDSL-EYHRQIAADdsIDIEVAPSWRPDKVfkieldgfvdylrk  203
DSSP  --------------llLLLL-HHHHHHHHLllLLLEEELLLLLHHHhllllllhhhhhhh


DSSP  --------------LHHHHHHHHHHHHhLLLLLEEEEELEellEELL-------------
Query --------------APELAVKEMERCVkELGFPGVQIGTHvneWDLN-------------  153
ident                               |      |                      
Sbjct leaaadvsitrfddLRQALTRRLDHFA-ACGCRASDHGIE---TLRFapvpddaqldail  259
DSSP  hhhhhllllllhhhHHHHHHHHHHHHH-HLLLLEEEEEEL---LLLLlllllhhhhhhhh


DSSP  -----------------LHHH-HHHHHHHHHHLLEEEEEL-LLLLLLHHH-----hlLLH
Query -----------------AQEL-FPVYAAAERLKCSLFVHP-WDMQMDGRM-----akYWL  189
ident                                       |         |           
Sbjct gkrlagetlseleiaqfTTAVlVWLGRQYAARGWVXQLHIgAIRNNNTRXfrllgpdTGF  319
DSSP  hhhhllllllhhhhhhhHHHHhHHHHHHHHHHLLEEEEEElEELLLLHHHhhhhlllLLL


DSSP  HhhlHHHHhhhHHHHHHHllLHHHHLL----LLLEEElhHHLL--HHHHhhhhhhhhhhl
Query PwlvGMPAettIAICSMImgGVFEKFP----KLKVCFahGGGA--FPFTvgrishgfsmr  243
ident                                  |                          
Sbjct D---SIGD--nNISWALS--RLLDSXDvtneLPKTIL--YCLNprDNEV-----------  359
DSSP  L---EELL--lLLHHHHH--HHHHHHHllllLLEEEE--EELLhhHHHH-----------


DSSP  hhhhlllllllhHHHL--------LLLEEELL---LLLHHHHHHHHHHH-----LLLLEE
Query pdlcaqdnpmnpKKYL--------GSFYTDAL---VHDPLSLKLLTDVI-----GKDKVI  287
ident                         |                                 | 
Sbjct ----------laTXIGnfqgpgiaGKVQFGSGwwfNDQKDGXLRQLEQLsqxglLSQFVG  409
DSSP  ----------hhHHHHhlllllllLLEEELLLlhhHLLHHHHHHHHHHHhhhllHHHLLL


DSSP  LLLLLLLlllLLLLLH-HHHH-LLLL---------------LHHHHHHHHLHHHHHHHLL
Query LGTDYPFplgELEPGK-LIES-MEEF---------------DEETKNKLKAGNALAFLGL  330
ident   ||                                                ||      
Sbjct XLTDSRS-flSYTRHEyFRRIlCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTI  468
DSSP  LLLLLLL-llLLHHHHhHHHHhHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLL


DSSP  lhhhl
Query erkqf  335
ident      
Sbjct ----k  469
DSSP  ----l


No 47: Query=4ofcA Sbjct=4rdvB Z-score=11.5

back to top
DSSP  -------------------------------------------------LLEEEEEELL-
Query -------------------------------------------------MKIDIHSHIL-   10
ident                                                       |||   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHh


DSSP  --------llllllhhhhhllllLEEEeeeelleEEEEelleeeeeeehhhLLHHHHHHH
Query --------pkewpdlkkrfgyggWVQLqhhskgeAKLLkdgkvfrvvrencWDPEVRIRE   62
ident                                   | |                      |
Sbjct ramaglaevagnpndsfwtwrelMYRM------vARLS--------peqieVIACQLYIE  106
DSSP  hhhlllllllllllllhhhhhhhHHHH------hLLLL--------hhhhhHHHHHHHHH


DSSP  HHHHLLLEEEEELLhhhhlllllhhhhhhHHHH--------hHHHHHHHHHHLL---LLE
Query MDQKGVTVQALSTVpvmfsywakpedtlnLCQL--------lNNDLASTVVSYP---RRF  111
ident |   | |  |                                                  
Sbjct MLKAGYTAVAEFHY---------------VHHDldgrsyadpAELSLRISRAASaagIGL  151
DSSP  HHHHLEEEEEEEEL---------------LLLLlllllllllLHHHHHHHHHHHhhlLEE


DSSP  EEEELLLLL--------------lhhHHHHHHHHHhHLLL--------LLEEEE-ELEEl
Query VGLGTLPMQ--------------apeLAVKEMERCvKELG--------FPGVQI-GTHVn  148
ident   |  |                          |     |           |         
Sbjct TLLPVLYSHagfggqpasegqrrfinGSEAYLELL-QRLRapleaaghSLGLCFhSLRA-  209
DSSP  EEEELLLLEeellleellhhhlllllLHHHHHHHH-HHHHhhhhhhllEELEEElLLLL-


DSSP  leellLHHHHHHHHHhHHHLLEEEEELllllllhhhhlllhhhHLHH-----hhhhhHHH
Query ewdlnAQELFPVYAAaERLKCSLFVHPwdmqmdgrmakywlpwLVGM-----paettIAI  203
ident       |    | ||          |                                  
Sbjct ---vtPQQIATVLAA-GHDDLPVHIHI--------------aeQQKEvddcqawsgrRPL  251
DSSP  ---llHHHHHHHHLL-LLLLLLEEEEE--------------llLHHHhhhhhhhhllLHH


DSSP  HHHHLLLHHhhllllLEEELHhHLLHHHHHhhhhhhhhhlhhhhlllllllhHHHLLL-L
Query CSMIMGGVFekfpklKVCFAHgGGAFPFTVgrishgfsmrpdlcaqdnpmnpKKYLGS-F  262
ident                  |  |                                    |  
Sbjct QWLYENVAV----dqRWCLVH-ATHADPAE---------------------vAAMARSgA  285
DSSP  HHHHHHLLL----llLEEEEE-LLLLLHHH---------------------hHHHHHHlL


DSSP  EEELLLL-------lhhHHHHHHHHHLllLEELLLLLLLllllLLLL-HHHHHLLL----
Query YTDALVH-------dplSLKLLTDVIGkdKVILGTDYPFplgeLEPG-KLIESMEE----  310
ident                           |      | |                  |     
Sbjct VAGLCLSteanlgdgifPATDFLAQGG--RLGIGSDSHV----SLSVvEELRWLEYgqrl  339
DSSP  EEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLL----LLLHhHHHHHHHHhhhh


DSSP  --------------lLHHHHHHHHLHHHHHHHLLL-------HHHL--------------
Query --------------fDEETKNKLKAGNALAFLGLE-------RKQF--------------  335
ident                   |            ||         |                 
Sbjct rdrkrnrlyrddqpmIGRTLYDAALAGGAQALGQPigslavgRRADllvldgndpylasa  399
DSSP  hhlllllllllllllHHHHHHHHHHHHHHHHHLLLlllllllLLLLeeeellllhhhhll


DSSP  ----------------------------------------------------
Query ----------------------------------------------------  335
ident                                                     
Sbjct egdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 48: Query=4ofcA Sbjct=3qy6A Z-score=10.9

back to top
DSSP  lLEEEEEE-LLLLllllhhhhhllllleeeeeeelleeeeeelleeeeeeehHHLL--HH
Query mKIDIHSH-ILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvreNCWD--PE   57
ident   |||| |                                                    
Sbjct -MIDIHCHiLPAM------------------------------------ddgAGDSadSI   23
DSSP  -LEELLLLlLLLL------------------------------------lllLLLHhhHH


DSSP  HHHHHHHHHLLLEEEEELLHhhHLLLllhhhhhhHHHHHHHHHHHHHHHL-----lLLEE
Query VRIREMDQKGVTVQALSTVPvmFSYWakpedtlnLCQLLNNDLASTVVSY-----pRRFV  112
ident    |     |                                                  
Sbjct EMARAAVRQGIRTIIATPHH--NNGV-----yknEPAAVREAADQLNKRLikedipLHVL   76
DSSP  HHHHHHHHLLLLEEELLLEE--LLLL-----lllLHHHHHHHHHHHHHHHhhllllLEEE


DSSP  EEellllllhhhhhhhhhhhhhllllleEEEELEelleelllhhHHHHHHH----hhhhL
Query GLgtlpmqapelavkemercvkelgfpgVQIGTHvnewdlnaqeLFPVYAA----aerlK  168
ident                               |                  |          
Sbjct PG--------------------------QEIRIY--------geVEQDLAKrqllslndT  102
DSSP  LL--------------------------LEEELL--------llHHHHHHLlllllhhhL


DSSP  LEEEEELllllllhhhhlllhhhhlhHHHHhhhHHHHHHllLHHHHLL--LLLEEELHHH
Query CSLFVHPwdmqmdgrmakywlpwlvgMPAEttiAICSMImgGVFEKFP--KLKVCFAHGG  226
ident                                            |            ||  
Sbjct KYILIEF-------------------PFDH---VPRYAE--QLFYDLQlkGYIPVIAHPE  138
DSSP  LEEEEEL-------------------LLLL---LLLLHH--HHHHHHHhlLLEEEEELHH


DSSP  LL--HHHHHHhhhhhhhhlhhhhlllllllhHHHLL-LLEEELL--LLLH-------HHH
Query GA--FPFTVGrishgfsmrpdlcaqdnpmnpKKYLG-SFYTDAL--VHDP-------LSL  274
ident                                                             
Sbjct RNreIRENPS-------------------llYHLVEkGAASQITsgSLAGifgkqlkAFS  179
DSSP  HLhhHHHLLH-------------------hhHHHHHlLLEEEEEhhHHLLlllhhhhHHH


DSSP  HHHH-HHHLlllEELLLLLLL--LLLLlLLLHHHHHL-LLLLHHHHHHHhLHHHHHHHLL
Query KLLT-DVIGkdkVILGTDYPF--PLGElEPGKLIESM-EEFDEETKNKLkAGNALAFLGL  330
ident   |              |                     ||  |    |   ||   |  
Sbjct LRLVeANLI---HFVASDAHNvkTRNF-HTQEALYVLeKEFGSELPYML-TENAELLLRN  234
DSSP  HHHHhLLLL---LEEELLLLLllLLLL-LHHHHHHHHhHHHLLHHHHHH-HHHHHHHHLL


DSSP  L--------hhhl
Query E--------rkqf  335
ident              
Sbjct Qtifrqppqpvkr  247
DSSP  Lllllllllllll


No 49: Query=4ofcA Sbjct=3ooqA Z-score=10.4

back to top
DSSP  ----------------------------------------------------lLEEEEEE
Query ----------------------------------------------------mKIDIHSH    8
ident                                                        | |||
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL


DSSP  LlllllllhhhhhllllleeeeeeelLEEEeeelleeeEEEE--------------hhHL
Query IlpkewpdlkkrfgyggwvqlqhhskGEAKllkdgkvfRVVR--------------enCW   54
ident |                         |                                 
Sbjct I--------------------glfeeGVGY--------YYSDgneatdpvtphvkaldGF   92
DSSP  L--------------------lllllLLLH--------HHLLlllllllllllllhhhHL


DSSP  LHHH-HHHHHHHHLLLEEEEELLHHHhlllllhhhhhhhhhhhhhhhhhHHHHLLLLeee
Query DPEV-RIREMDQKGVTVQALSTVPVMfsywakpedtlnlcqllnndlasTVVSYPRRfvg  113
ident  |    |      |||                                  |         
Sbjct NPQDpAIERALAGGVTSVXIVPGSAN---------pvggqgsvikfrsiIVEECIVK---  140
DSSP  LLLLhHHHHHHLLLEEEEEELLLLLL---------leeeeeeeeellllLHHHHEEE---


DSSP  eellllllhhhhhhhhhhhhhllLLLEEEEELE----------------ELLEELlLHHH
Query lgtlpmqapelavkemercvkelGFPGVQIGTH----------------VNEWDLnAQEL  157
ident                           |                                 
Sbjct -----------------------DPAGLKXAFGenpkrvygerkqtpstRXGTAGvIRDY  177
DSSP  -----------------------EEEEEEEELLhhhhhhhhhlllllllHHHHHHhHHHH


DSSP  HH---------------------------hHHHHHHHLLEEEEELllllllhhhhlllhh
Query FP---------------------------vYAAAERLKCSLFVHPwdmqmdgrmakywlp  190
ident |                                  | |     |                
Sbjct FTkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHA---------------  222
DSSP  HHhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEE---------------


DSSP  hhlhhhhHHHHHHHHHHlLLHHHHLllLLEEELHhHLLHHHHHhhhhhhhhhlhhhhlll
Query wlvgmpaETTIAICSMImGGVFEKFpkLKVCFAHgGGAFPFTVgrishgfsmrpdlcaqd  250
ident             |   |     |          | |                        
Sbjct -------HRADDILTAI-RIAEEFG--FNLVIEH-GTEAYKIS-----------------  254
DSSP  -------LLHHHHHHHH-HHHHHHL--LLEEEEE-LLLHHHHH-----------------


DSSP  llllhHHHL-LLLEEE-LLLL-----------LHHHHHHHHHHHLllLEELLLLLlllLL
Query npmnpKKYL-GSFYTD-ALVH-----------DPLSLKLLTDVIGkdKVILGTDYpfpLG  297
ident      |                                 |          |  |      
Sbjct -----KVLAeKKIPVVvGPLLtfrtklelkdlTXETIAKLLKDGV--LIALXCDH---PV  304
DSSP  -----HHHHhHLLLEEeLLLLlllllhhhlllLLLHHHHHHHLLL--LEEELLLL---LL


DSSP  LL--LLLHHHHHLL--LLLHHHHHHHHLHHHHHHHLLLHHH-------------------
Query EL--EPGKLIESME--EFDEETKNKLKAGNALAFLGLERKQ-------------------  334
ident                    ||   |    |    ||||                      
Sbjct IPleFATVQAATAXryGAKEEDLLKILTVNPAKILGLEDRIgsiepgkdadlvvwsghpf  364
DSSP  LLhhHHHHHHHHHHhhLLLHHHHHHLLLHHHHHHLLLLLLLlllllllllleeeelllll


DSSP  -------------------l
Query -------------------f  335
ident                     
Sbjct dxksvvervyidgvevfrre  384
DSSP  llllleeeeeelleeeeell


No 50: Query=4ofcA Sbjct=2a3lA Z-score=9.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------LLEEEEEELL--------
Query ------------------------------------------MKIDIHSHIL--------   10
ident                                            | | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  --------------------------------------------------llllllhhhh
Query --------------------------------------------------pkewpdlkkr   20
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  hllllLEEEEEeelleEEEE-elleeeeeeehhhlLHHHHHHHHHHHLLLEEEEELlhhH
Query fgyggWVQLQHhskgeAKLL-kdgkvfrvvrencwDPEVRIREMDQKGVTVQALSTvpvM   79
ident                                                             
Sbjct nlkynPCGQSR-----LREIflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRI---S  292
DSSP  hhhhlLLLLLH-----HHHHhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEE---E


DSSP  HLLlllhhHHHHHHHHHHHHHhhhhHHLLLLEEEEELL---------------llLLHHH
Query FSYwakpeDTLNLCQLLNNDLastvVSYPRRFVGLGTL---------------pmQAPEL  124
ident                 |          |    | |  |                      
Sbjct IYG-----RKMSEWDQLASWI-vnnDLYSENVVWLIQLprlyniykdmgivtsfqNILDN  346
DSSP  LLL-----LLLLHHHHHHHHH-hllLLLLLLEEEEEEEellhhhhlllllllllhHHHHH


DSSP  HHHHHH---------hhhHLLL--LLEEEEE---------------------leeLLEEL
Query AVKEME---------rcvKELG--FPGVQIG---------------------thvNEWDL  152
ident                           |                            |    
Sbjct IFIPLFeatvdpdshpqlHVFLkqVVGFDLVddeskperrptkhmptpaqwtnafNPAFS  406
DSSP  HLLHHHhhhhlhhhllllHHHHllEEEEEEEllllllllllllllllllllllllLLLHH


DSSP  LLhhhHHHHHHHHHH----------LLEEEEELllllllhhhhlllhhhhlhHHHHhHHH
Query NAqelFPVYAAAERL----------KCSLFVHPwdmqmdgrmakywlpwlvgMPAEtTIA  202
ident         ||    |             |  |                            
Sbjct YY--vYYCYANLYVLnklreskgmtTITLRPHS------------------gEAGD-IDH  445
DSSP  HH--hHHHHHHHHHHhhhhllllllLLEELLLL------------------lLLLL-LHH


DSSP  HHHHHLllhhhhllllLEEELHhHLLHhHHHHHhhhhhhhlhhhhlllllllHHHHLL--
Query ICSMIMggvfekfpklKVCFAHgGGAFpFTVGRishgfsmrpdlcaqdnpmnPKKYLG--  260
ident                     || |                                    
Sbjct LAATFL---------tCHSIAH-GINL-RKSPV-------------------LQYLYYla  475
DSSP  HHHHHH---------hLLLLLL-LHHH-HHLHH-------------------HHHHHHhh


DSSP  LLEEELLLL--------LHHH-HHHHHHHHLllLEELLLLLLLLL--llLLLLHHHHHL-
Query SFYTDALVH--------DPLS-LKLLTDVIGkdKVILGTDYPFPL--geLEPGKLIESM-  308
ident                                   | | || |                  
Sbjct QIGLAMSPLsnnslfldYHRNpFPVFFLRGL--NVSLSTDDPLQIhltkEPLVEEYSIAa  533
DSSP  LLLEEELHHhhllllllLLLLlHHHHHHLLL--LEEELLLLHHHHllllLHHHHHHHHHh


DSSP  --LLLLHHHHHHHHlHHHHHHHLLLHHHL-------------------------------
Query --EEFDEETKNKLKaGNALAFLGLERKQF-------------------------------  335
ident                 |     |                                     
Sbjct svWKLSACDLCEIA-RNSVYQSGFSHALKshwigkdyykrgpdgndihktnvphirvefr  592
DSSP  hhHLLLHHHHHHHH-HHHHHHLLLLHHHHhhhlllllllllhhhllhhhhlllhhhhhhh


DSSP  ------------------------
Query ------------------------  335
ident                         
Sbjct dtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhlllllllllllll


No 51: Query=4ofcA Sbjct=3dcpA Z-score=8.2

back to top
DSSP  lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeEEEHhHLLHhHHH
Query mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrVVREnCWDPeVRI   60
ident  | | | |                                                    
Sbjct xKRDGHTHTEF----------------------------------cpHGTH-DDVE-EXV   24
DSSP  lLEEEEELLLL----------------------------------llLLLL-LLHH-HHH


DSSP  HHHHHHLLLEEEEELLhhhHLLLLL--------------hhhHHHHHHHHHHHHHHHHHH
Query REMDQKGVTVQALSTVpvmFSYWAK--------------pedTLNLCQLLNNDLASTVVS  106
ident                                                             
Sbjct LKAIELDFDEYSIVEH---APLSSEfxkntagdkeavttasxAXSDLPYYFKKXNHIKKK   81
DSSP  HHHHHLLLLEEEEEEE---LLLLHHhhhllllllhhhhllllLHHHHHHHHHHHHHHHHH


DSSP  LL--LLEEEEE------llllLLHHHHHHhHHHHhhlllLLEEeeeleelleelllhhhh
Query YP--RRFVGLG------tlpmQAPELAVKeMERCvkelgFPGVqigthvnewdlnaqelf  158
ident |                                                           
Sbjct YAsdLLIHIGFevdyligyedFTRDFLNE-YGPQ-----TDDG-----------------  118
DSSP  LLllLEEEEEEeeelllllhhHHHHHHHH-HHHH-----LLEE-----------------


DSSP  hhhhhhhhhlleeEEELLLLLLL--------------HHHH---lllhhhHLHHHHHHHH
Query pvyaaaerlkcslFVHPWDMQMD--------------GRMA---kywlpwLVGMPAETTI  201
ident                                                             
Sbjct -------------VLSLHFLEGQggfrsidfsaedynEGIVqfyggfeqaQLAYLEGVKQ  165
DSSP  -------------EEELLEEEELleeeellllhhhhhHHLHhhhllhhhhHHHHHHHHHH


DSSP  HHHHHhlllhhhhlllllEEELHH------------------------hllHHHHhhhhh
Query AICSMimggvfekfpklkVCFAHG------------------------ggaFPFTvgris  237
ident  |                    |                                     
Sbjct SIEAD-------lglfkpRRXGHIslcqkfqqffgedtsdfseevxekfrvILAL-----  213
DSSP  HHHLL-------llllllLEELLLlhhhllhhhhlllhhhllhhhhhhhhhHHHH-----


DSSP  hhhhhlhhhhlllllllhhhHLLLLEEELL------------LLLHHHHHHHHHHHLllL
Query hgfsmrpdlcaqdnpmnpkkYLGSFYTDAL------------VHDPLSLKLLTDVIGkdK  285
ident                            |                      |         
Sbjct -------------------vKKRDYELDFNtaglfkplcgetYPPKKIVTLASELQI--P  252
DSSP  -------------------hHHHLLEEEEElhhhhlllllllLLLHHHHHHHHHLLL--L


DSSP  EELLLLLLlllllLLLLHHHHHLllllhhhhhhhhlhhhhhhhlllhhhl
Query VILGTDYPfplgeLEPGKLIESMeefdeetknklkagnalaflglerkqf  335
ident    | |                                            
Sbjct FVYGSDSHgvqdiGRGYSTYCQK-------------------------le  277
DSSP  EEEELLLLlhhhlLLLHHHHHHH-------------------------ll


No 52: Query=4ofcA Sbjct=1v77A Z-score=8.1

back to top
DSSP  -lLEEEEEELlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhhllHHHH
Query -mKIDIHSHIlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdPEVR   59
ident    |                                                     |  
Sbjct vkFIEMDIRD----------------------------------------------KEAY   14
DSSP  llLEEEEELL----------------------------------------------HHHH


DSSP  HHHHHhhLLLEEEEELLhhHHLLlllhhhhhhhHHHHHHHHHHHHhhlllleEEEEllll
Query IREMDqkGVTVQALSTVpvMFSYwakpedtlnlCQLLNNDLASTVvsyprrfVGLGtlpm  119
ident               |                                             
Sbjct ELAKE--WFDEVVVSIK--FNEE---------vDKEKLREARKEY------gKVAI----   51
DSSP  HHHHH--HLLEEEEEEE--ELLL---------lLHHHHHHHHHHH------lLEEE----


DSSP  llhhhhhhhhhhhhhllllleeEEELEelleELLLhhhHHHHHHHHhhLLEEEEELllll
Query qapelavkemercvkelgfpgvQIGTHvnewDLNAqelFPVYAAAErlKCSLFVHPwdmq  179
ident                                                      |      
Sbjct ----------------------LLSNP----KPSL--vRDTVQKFK--SYLIYVES----   77
DSSP  ----------------------EEELL----LHHH--hHHHHHHLL--LLEEEEEL----


DSSP  llhhhhlllhhhhlhhhhHHHHHHHHHhlllhhhhlllllEEELhHHLL-----HHHHHh
Query mdgrmakywlpwlvgmpaETTIAICSMimggvfekfpklkVCFAhGGGA-----FPFTVg  234
ident                        |                                  | 
Sbjct ------------------NDLRVIRYS--------iekgvDAII-SPWVnrkdpGIDHV-  109
DSSP  ------------------LLHHHHHHH--------hhlllLEEE-LLLLlllllLLLHH-


DSSP  hhhhhhhhlhhhhlllllllhhHHLL--LLEEELL----------------llLHHHHHH
Query rishgfsmrpdlcaqdnpmnpkKYLG--SFYTDAL----------------vhDPLSLKL  276
ident                       |                                   ||
Sbjct --------------------laKLMVkkNVALGFSlrpllysnpyeranllrfMMKAWKL  149
DSSP  --------------------hhHHHHhhLLEEEEElhhhhhllhhhhhhhhhhHHHHHHH


DSSP  HHHHHLllLEELLLLLLL---lllllLLLHHHHHLlLLLHHHHHHHHLHHHHHHHLllhh
Query LTDVIGkdKVILGTDYPF---plgelEPGKLIESMeEFDEETKNKLKAGNALAFLGlerk  333
ident            |                  |                       |     
Sbjct VEKYKV--RRFLTSSAQEkwdvryprDLISLGVVI-GMEIPQAKASISMYPEIILK----  202
DSSP  HHHHLL--LEEEELLLLLhhhlllhhHHHHHHHHL-LLLHHHHHHLLLHHHHHHHL----


DSSP  hl
Query qf  335
ident   
Sbjct --  202
DSSP  --


No 53: Query=4ofcA Sbjct=1m65A Z-score=7.7

back to top
DSSP  lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH
Query mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
ident    | | |                                                   |
Sbjct yPVDLHMHTVA-------------------------------------sthaYSTLSDYI   23
DSSP  lLEELLLLLLL-------------------------------------llllLLLHHHHH


DSSP  HHHHHHLLLEEEEELLhhHHLLLllhhhhhhHHHHHHHHHHHhhhHLLL----LEEEEEL
Query REMDQKGVTVQALSTVpvMFSYWakpedtlnLCQLLNNDLAStvvSYPR----RFVGLGT  116
ident     |||    |                                                
Sbjct AQAKQKGIKLFAITDH--GPDME------daPHHWHFINMRI---WPRVvdgvGILRGIE   72
DSSP  HHHHHHLLLEEEEEEE--LLLLL------llLLLHHHHHHHH---LLLEelleEEEEEEE


DSSP  LLLLL-HHHHhhHHHHHHhlLLLLEEEEELE--ELLE--ellLHHH-HHHHHHHhhhlle
Query LPMQA-PELAvkEMERCVkeLGFPGVQIGTH--VNEW--dlnAQEL-FPVYAAAerlkcs  170
ident                             | |  |                 |        
Sbjct ANIKNvDGEI-dCSGKMF--DSLDLIIAGFHepVFAPhdkatNTQAmIATIASG----nv  125
DSSP  EELLLlLLLL-lLLHHHH--HHLLEEEEELLllLLLLllhhhHHHHhHHHHHLL----ll


DSSP  EEEELllllllhhhhlllhhhhlhhhhHHHH-hhHHHHllLHHHH-lLLLLEEELHhhLL
Query LFVHPwdmqmdgrmakywlpwlvgmpaETTI-aiCSMImgGVFEK-fPKLKVCFAHggGA  228
ident                                          | |                
Sbjct HIISH----------------------PGNPkyeIDVK--AVAEAaaKHQVALEINnsSN  161
DSSP  LEELL----------------------LLLLlllLLHH--HHHHHhhHHLLEEEEEllLL


DSSP  HHHhhhhhhhhhhhlhhhhlllllllhHHHLlLLEEE-------------lLLLLhhHHH
Query FPFtvgrishgfsmrpdlcaqdnpmnpKKYLgSFYTD-------------aLVHDplSLK  275
ident                                                           | 
Sbjct CRE-------------------vaaavRDAG-GWVALgsdshtaftmgefeECLK--ILD  199
DSSP  HHH-------------------hhhhhHHHL-LLEEEelllllhhhllllhHHHH--HHH


DSSP  HhhHHHLLLLEELllllllllllllllhhhhhlllllhhhhhhHHLHHHHHHHL----LL
Query LltDVIGKDKVILgtdypfplgelepgkliesmeefdeetknkLKAGNALAFLG----LE  331
ident                                                  | ||       
Sbjct A--VDFPPERILN------------------------------VSPRRLLNFLEsrgmAP  227
DSSP  H--LLLLHHHLHH------------------------------HLHHHHHHHHHhlllLL


DSSP  HHHL---
Query RKQF---  335
ident    |   
Sbjct IAEFadl  234
DSSP  LHHHlll


No 54: Query=4ofcA Sbjct=3au2A Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------LLEEEEEELLLlllllhhhhhlll
Query ------------------------------------MKIDIHSHILPkewpdlkkrfgyg   24
ident                                      | |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTY-------------  347
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLL-------------


DSSP  lleeeeeeelleeeeeelleeeeeeehHHLLHhHHHHHHHHHLLLEEEEELLHH-hHLLL
Query gwvqlqhhskgeakllkdgkvfrvvreNCWDPeVRIREMDQKGVTVQALSTVPV-mFSYW   83
ident                                           |    |            
Sbjct ------------------------sdgQNTLE-ELWEAAKTMGYRYLAVTDHSPavRVAG  382
DSSP  ------------------------lllLLLHH-HHHHHHHHHLLLEEEEEEELHhhHLLL


DSSP  llhhhHHHHHHHHHHHHHHHHHHLLL-LEEEEellllllhhhhhhhhhhhhhllllleEE
Query akpedTLNLCQLLNNDLASTVVSYPR-RFVGLgtlpmqapelavkemercvkelgfpgVQ  142
ident                                                             
Sbjct ---gpSPEEALKRVGEIRRFNETHGPpYLLAG--------------------------AE  413
DSSP  ---llLHHHHHHHHHHHHHHHHHHLLlEEEEE--------------------------EE


DSSP  EELEellEELLlhhhhhHHHHhhhhllEEEEELLLLlllhhhhlllhhhhlhhhhhhhHH
Query IGTHvneWDLNaqelfpVYAAaerlkcSLFVHPWDMqmdgrmakywlpwlvgmpaettIA  202
ident    |    |                     |                             
Sbjct VDIH---PDGT---ldyPDWV-lreldLVLVSVHSR-------------fnlpkadqtKR  453
DSSP  EELL---LLLL---lllLHHH-hllllEEEEELLLL-------------llllhhhhhHH


DSSP  HHHHHlllhhhhllLLLEEELHhHLLH--------hHHHHhhhhhhhhlhhhhlllllll
Query ICSMImggvfekfpKLKVCFAHgGGAF--------pFTVGrishgfsmrpdlcaqdnpmn  254
ident                     ||   |                                  
Sbjct LLKAL-------enPFVHVLAH-PTARllgrrapieADWE-------------------a  486
DSSP  HHHHH-------llLLLLEELL-LLLLlllllllllLLHH-------------------h


DSSP  hhHHLL--LLEEELLLLL--hhhHHHHHHHHL--lLLEELLLLLLLllLLLLLlHHHHH-
Query pkKYLG--SFYTDALVHD--plsLKLLTDVIG--kDKVILGTDYPFplGELEPgKLIES-  307
ident                           |            | ||            |    
Sbjct vfQKAKekGVAVEIDGYYdrmdlPDDLARMAYgmgLWISLSTDAHQtdHLRFM-ELAVGt  545
DSSP  hhHHHHhhLLEEEEELLLlllllLHHHHHHHHhllLLEEEELLLLLhhHHHHH-HHHHHh


DSSP  -LLLLlhhHHHHHHLH----hHHHHHLllhhhl
Query -MEEFdeeTKNKLKAG----nALAFLGlerkqf  335
ident                       |  |       
Sbjct aQRAW--iGPERVLNTldyedLLSWLK-arrgv  575
DSSP  hHHLL--lLLLLLHHHllhhhHHHHHH-lllll


No 55: Query=4ofcA Sbjct=3f2bA Z-score=7.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEEEEEELLLl
Query ------------------------------------------------MKIDIHSHILPk   12
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPM-  119
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLL-


DSSP  llllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHHHHHHHHLLLEEE
Query ewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRIREMDQKGVTVQA   72
ident                                                |      |    |
Sbjct -----------------------------------sqmdaVTSVTKLIEQAKKWGHPAIA  144
DSSP  -----------------------------------lllllLLLHHHHHHHHHHLLLLLEE


DSSP  EELLHhhhlllllhhhhhhhhhhHHHHHhHHHHHLL----LLEEEEellllllhhhhhhh
Query LSTVPvmfsywakpedtlnlcqlLNNDLaSTVVSYP----RRFVGLgtlpmqapelavke  128
ident                                  |                          
Sbjct VTDHA------------------VVQSF-PEAYSAAkkhgMKVIYG--------------  171
DSSP  ELLLL------------------LLLLH-HHHHHHHhhhlLLEEEE--------------


DSSP  hhhhhhllllleEEEEleelleELLL----------------------------------
Query mercvkelgfpgVQIGthvnewDLNA----------------------------------  154
ident                                                             
Sbjct ------------LEAN------IVDDpfhvtllaqnetglknlfklvslshiqyfhrvpr  213
DSSP  ------------EEEE------EELLleeeeeeellhhhhhhhhhhhhhhhlllllllll


DSSP  hhHHHHHHHHhhHLLEeeeelllllllhhhhlllhhhhlhhhhhhhhhhhhhhlllhhhh
Query qeLFPVYAAAerLKCSlfvhpwdmqmdgrmakywlpwlvgmpaettiaicsmimggvfek  214
ident                                                             
Sbjct ipRSVLVKHR--DGLL--------------------------------------------  227
DSSP  eeHHHHHHLL--LLEE--------------------------------------------


DSSP  lllllEEELH---hHLLHhhhhhhhhhhhhhlhhhhlllllllHHHHLLLL-EEELLLLL
Query fpklkVCFAH---gGGAFpftvgrishgfsmrpdlcaqdnpmnPKKYLGSF-YTDALVHD  270
ident      |                                                     |
Sbjct -----VGSGCdkgeLFDN-------------------------VEDIARFYdFLEVHPPD  257
DSSP  -----EELLLllllLLLL-------------------------LLLLHHHLlLEEELLHH


DSSP  -------------HHHHHHHHHHHL--lLLEELLLLLLL---------------------
Query -------------PLSLKLLTDVIG--kDKVILGTDYPF---------------------  294
ident                               |                             
Sbjct vykplyvkdeemiKNIIRSIVALGEkldIPVVATGNVHYlnpedkiyrkilihsqgganp  317
DSSP  hhlllllllhhhhHHHHHHHHHHHHhllLLEEELLLLLLllhhhhhhhhhhhhllhhhll


DSSP  ------LLLLLLLL-HHHHHLLLLLHHHHHHHHLHHHHHHHLL-----------------
Query ------PLGELEPG-KLIESMEEFDEETKNKLKAGNALAFLGL-----------------  330
ident       |                   |        |      |                 
Sbjct lnrhelPDVYFRTTnEMLDCFSFLGPEKAKEIVVDNTQKIASLigdvkpikdelytprie  377
DSSP  llllllLLLLLLLHhHHHHHHHHHHHHHHHHHHLHHHHHHHHLlllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct gadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddg  437
DSSP  lhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct ylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprc  497
DSSP  llleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct gtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigt  557
DSSP  lllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct vadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydft  617
DSSP  llhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct piqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddp  677
DSSP  leelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct dvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshg  737
DSSP  hhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct tdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpef  797
DSSP  lllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct eaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvrae  857
DSSP  hhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct dfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrs  917
DSSP  lllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  330
ident                                                             
Sbjct qatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleyle  977
DSSP  llllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhh


DSSP  ------------lhhhl
Query ------------erkqf  335
ident                  
Sbjct srgcldslpdhnqlslf  994
DSSP  hllllllllllllllll


No 56: Query=4ofcA Sbjct=2anuA Z-score=5.4

back to top
DSSP  ---lLEEEEEELLllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehHHLL--
Query ---mKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvreNCWD--   55
ident       | | |                                                 
Sbjct tewlLCDFHVHTN------------------------------------xsdghLPLGev   24
DSSP  leeeEEEEEELLL------------------------------------lllllLLHHhh


DSSP  HHHHHHHHhhhlLLEEEEELLH----------------HHHLllllhhhhHHHHHHHHHH
Query PEVRIREMdqkgVTVQALSTVP----------------VMFSywakpedtLNLCQLLNND   99
ident             | |                                       |     
Sbjct VDLFGKHG----VDVVSITDHIvdrrtleqrkrngeplGAIT--------EDKFQDYLKR   72
DSSP  HHHHHHLL----LLEEEEEEEEelhhhhhhhhhlllllLLLL--------LLLHHHHHHH


DSSP  HHHHHHHLL----LLEEEEellllllhhhhhhhhhhhhhllllleEEEELEEL-------
Query LASTVVSYP----RRFVGLgtlpmqapelavkemercvkelgfpgVQIGTHVN-------  148
ident |                                            | |            
Sbjct LWREQKRAWeeygXILIPG--------------------------VEITNNTDlyhivav  106
DSSP  HHHHHHHHHhhhlLEEEEE--------------------------EEEEELLLleeeeee


DSSP  ------leELLLhhhhHHHHHHHHHLLEeeeelllllllhhhhlllhhhhlhhhhhhhhh
Query ------ewDLNAqelfPVYAAAERLKCSlfvhpwdmqmdgrmakywlpwlvgmpaettia  202
ident          |                                                  
Sbjct dvkeyvdpSLPV---eEIVEKLKEQNAL--------------------------------  131
DSSP  llllllllLLLH---hHHHHHHHHLLLE--------------------------------


DSSP  hhhhhlllhhhhlllllEEELH--------hhLLHHhhhhhhhhhhhhlhhhhlllllll
Query icsmimggvfekfpklkVCFAH--------ggGAFPftvgrishgfsmrpdlcaqdnpmn  254
ident                  |  ||           |                          
Sbjct -----------------VIAAHpdrkklswylWANX------------------------  150
DSSP  -----------------EEELLllllllllhhHHLL------------------------


DSSP  hHHHLLLL-EEEL--LLLLhhhHHHHHHHHLllLEELLLLLLLLLLlLLLLhhhhhllll
Query pKKYLGSF-YTDA--LVHDplsLKLLTDVIGkdKVILGTDYPFPLGeLEPGkliesmeef  311
ident        |                               |                    
Sbjct -ERFKDTFdAWEIanRDDL---FNSVGVKKY--RYVANSDFHELWH-VYSW---------  194
DSSP  -LLLLLLLlEEEEeeLLEE---LHHHHHLLL--LEEEELLLLLHHH-HLLE---------


DSSP  lhhhhhhhhlhhhhhhhllLHHHL---------------------
Query deetknklkagnalaflglERKQF---------------------  335
ident                                              
Sbjct ---------------ktlvKSEKNieaikeairkntdvaiylxrk  224
DSSP  ---------------eeeeEELLLhhhhhhhhhhllleeeeelll


No 57: Query=4ofcA Sbjct=2yb1A Z-score=4.8

back to top
DSSP  LLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH
Query MKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
ident   || | |                                               |   |
Sbjct ANIDLHFHSRT--------------------------------------sdgALTPTEVI   22
DSSP  LLEELLLLLLL--------------------------------------lllLLLHHHHH


DSSP  HHHHHHLLLEEEEELLhhhhlllllhhhhhhhhhhHHHHHHHHHHHLL---LLEEEEEll
Query REMDQKGVTVQALSTVpvmfsywakpedtlnlcqlLNNDLASTVVSYP---RRFVGLGtl  117
ident            ||                          ||            |      
Sbjct DRAAARAPALLALTDH------------------dCTGGLAEAAAAAArrgIPFLNGV--   62
DSSP  HHHHLLLLLEEEELLL------------------lLLLLHHHHHHHHHhllLLEEEEE--


DSSP  llllhhhhhhhhhhhhhllllleeEEELEELLE---------------------------
Query pmqapelavkemercvkelgfpgvQIGTHVNEW---------------------------  150
ident                                                             
Sbjct ------------------------EVSVSWGRHtvhivglgidpaepalaaglksiregr   98
DSSP  ------------------------EEEEEELLEeeeeeeellllllhhhhhhhhhhhllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  150
ident                                                             
Sbjct lerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkylt  158
DSSP  hhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlll


DSSP  -------elllhhhhhHHHHHHHHLLEEEEElllllllhhhhlllhhhhlhHHHH-hhHH
Query -------dlnaqelfpVYAAAERLKCSLFVHpwdmqmdgrmakywlpwlvgMPAE-ttIA  202
ident                                                             
Sbjct pgkpgyvshqwasledAVGWIVGAGGMAVIA-----------------hpgRYDMgrtLI  201
DSSP  lllllllllllllhhhHHHHHHHLLLEEEEL-----------------lhhHLLLlhhHH


DSSP  HHHHHlllhhhhlLLLLEeelhhhllhhhhhhhhhhhhhhlhhhhlllllllhhhhllll
Query ICSMImggvfekfPKLKVcfahgggafpftvgrishgfsmrpdlcaqdnpmnpkkylgsf  262
ident                                                             
Sbjct ERLIL-----dfqAAGGQ------------------------------------------  214
DSSP  HHHHH-----hhhHLLLL------------------------------------------


DSSP  EEELL--LLLHHHHHHHHHHHL--llLEELLLLLLLLlllllLLHHHhhlllllhhHHHH
Query YTDAL--VHDPLSLKLLTDVIG--kdKVILGTDYPFPlgelePGKLIesmeefdeeTKNK  318
ident         |                     | |   |                       
Sbjct GIEVAsgSHSLDDMHKFALHADrhglYASSGSDFHAPgedvgHTEDL--------pPICR  266
DSSP  EEEEEelLLLHHHHHHHHHHHHhhllEEEEELLLLLLlllllLLLLL--------lLLLL


DSSP  hhlHHHHHhHLLL-----hhhl
Query lkaGNALAfLGLE-----rkqf  335
ident          |            
Sbjct ---PIWRE-LEARilrpadaen  284
DSSP  ---LHHHH-LHHHlllllhhhl


No 58: Query=4ofcA Sbjct=3e38A Z-score=4.7

back to top
DSSP  -----------------lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeell
Query -----------------mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdg   43
ident                   | | | |                                   
Sbjct aqrrneiqvpdldgyttlKCDFHXHSVF--------------------------------   28
DSSP  llllllllllllllleeeEEELLLLLLL--------------------------------


DSSP  eeeeeeehhHLLHHHHHHHHHHHLLLEEEEELLHHHHLllllhhhHHHHHHHHHhHHHHH
Query kvfrvvrenCWDPEVRIREMDQKGVTVQALSTVPVMFSywakpedTLNLCQLLNnDLAST  103
ident             | ||  |    |     |                       |      
Sbjct ------sdgLVWPTVRVDEAYRDGLDAISLTEHIEYRP------hKQDVVSDHN-RSFDL   75
DSSP  ------lllLLLHHHHHHHHHHLLLLEELLEEELLLLL------lLLLLLLLLL-HHHHH


DSSP  HHHLL----LLEEEEellllllhhhhhhhhhhhhhllllleeEEELE-----------el
Query VVSYP----RRFVGLgtlpmqapelavkemercvkelgfpgvQIGTH-----------vn  148
ident                                            |                
Sbjct CREQAeklgILLIKG--------------------------sEITRAxapghfnaiflsd  109
DSSP  HHHHHhhhlLEELLE--------------------------eEEELLlllleeeeellll


DSSP  leelllhHHHHHHHHHHhHLLEeeeelllllllhhhhlllhhhhlhhhhhhhhhhhhhhl
Query ewdlnaqELFPVYAAAErLKCSlfvhpwdmqmdgrmakywlpwlvgmpaettiaicsmim  208
ident                |                                            
Sbjct snpleqkDYKDAFREAK-KQGA--------------------------------------  130
DSSP  lhhhlllLHHHHHHHHH-HLLL--------------------------------------


DSSP  llhhhhllllLEEELHHHLL-----hHHHHhhhhhhhhhlhhhhlllllllhhhhlllLE
Query ggvfekfpklKVCFAHGGGA-----fPFTVgrishgfsmrpdlcaqdnpmnpkkylgsFY  263
ident                | |                                          
Sbjct ----------FXFWNHPGWDsqqpdtTKWW----------------pehtalyqegcxHG  164
DSSP  ----------EEEELLLLLLllllllLLLL----------------hhhhhhhhllllLE


DSSP  EE-LLLLLHhhHHHHHHHHL--lLLEELLLLLLL-------llllLLLLhhhhhlllllh
Query TD-ALVHDPlsLKLLTDVIG--kDKVILGTDYPF-------plgeLEPGkliesmeefde  313
ident    |  |                   |   |                             
Sbjct IEvANGHLY--XPEAIQWCLdknLTXIGTSDIHQpiqtdydfekgEHRT-----------  211
DSSP  EEeEELLEE--LLHHHHHHHhhlLEEEEELLLLLlhhhhllhhhlLLLL-----------


DSSP  hhhhhhHLHHhhhhhllLHHHL--------------------------------------
Query etknklKAGNalaflglERKQF--------------------------------------  335
ident                                                             
Sbjct -----xTFVF------aKERSLqgirealdnrrtaayfhelligredllrpffekcvkie  260
DSSP  -----eEEEE------eLLLLHhhhhhhhhllleeeeelleeellhhhhhhhhhhheeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct evsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggd  320
DSSP  eeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllle


DSSP  ----------------------
Query ----------------------  335
ident                       
Sbjct vnfevtnfivapdkglkytisl  342
DSSP  eeeeeeeeeeelleeeeeeeel


No 59: Query=4ofcA Sbjct=1bksA Z-score=3.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad   60
DSSP  lhhhhhhhhhhhhlllleeeeeeelllllhhhhhhhhhhhhhllllleeeelllllllll


DSSP  ---------------------------------LLEEEeEELLLLllllhhhhhllllle
Query ---------------------------------MKIDIhSHILPKewpdlkkrfgyggwv   27
ident                                                             
Sbjct gptiqnanlrafaagvtpaqcfemlalirekhpTIPIG-LLMYAN---------------  104
DSSP  lhhhhhhhhhhhhhlllhhhhhhhhhhhhhhllLLLEE-EEELHH---------------


DSSP  eeeeeelleeeeeelleeeeeEEHHhlLHHHHHHHHhhhlllEEEEELLhhhhlllllhh
Query qlqhhskgeakllkdgkvfrvVRENcwDPEVRIREMdqkgvtVQALSTVpvmfsywakpe   87
ident                                           |                 
Sbjct ------------------lvfNNGIdaFYARCEQVG------VDSVLVA-----------  129
DSSP  ------------------hhhLLLHhhHHHHHHHHL------LLEEEEL-----------


DSSP  hhhhHHHHHhHHHHHHHHHLLllEEEEELLLLLLHHHHHHHHHHHHhlllLLEEEEElee
Query dtlnLCQLLnNDLASTVVSYPrrFVGLGTLPMQAPELAVKEMERCVkelgFPGVQIGthv  147
ident                               |  |                          
Sbjct --dvPVEES-APFRQAALRHN--IAPIFICPPNADDDLLRQVASYG----RGYTYLL---  177
DSSP  --llLHHHL-HHHHHHHHHLL--LEEEEEELLLLLHHHHHHHHHHL----LLLEEEL---


DSSP  lleelllHHHHHHHHHHHHHLL-EEEEELllllllhhhhlllhhhhlhhhhHHHH-hHHH
Query newdlnaQELFPVYAAAERLKC-SLFVHPwdmqmdgrmakywlpwlvgmpaETTI-aICS  205
ident          |                                                 |
Sbjct ------aLPLHHLIEKLKEYHAaPALQGF----------------------GISSpeQVS  209
DSSP  ------lLLHHHHHHHHHHHLLlLEEELL----------------------LLLLhhHHH


DSSP  HhlLLHHhhlllllEEELHHHLLhhhhhhhhhhhhhhlhhhhlllllllhhhhlllleee
Query MimGGVFekfpklkVCFAHGGGAfpftvgrishgfsmrpdlcaqdnpmnpkkylgsfytd  265
ident                    |                                        
Sbjct A-aVRAG------aAGAISGSAI----------------------------vkiieknla  234
DSSP  H-hHHHL------lLEEEELLHH----------------------------hhhhhhlll


DSSP  llllLHHHHHHHHHHHLllleelllllllllllllllhhhhhlllllhhhhhhhhlhhhh
Query alvhDPLSLKLLTDVIGkdkvilgtdypfplgelepgkliesmeefdeetknklkagnal  325
ident         |                                                   
Sbjct spkqMLAELRSFVSAMK-------------------------------------------  251
DSSP  lhhhHHHHHHHHHHHHH-------------------------------------------


DSSP  hhhlllhhhl
Query aflglerkqf  335
ident           
Sbjct ------aasr  255
DSSP  ------hlll