Results: dupa

Query: 4mupB

MOLECULE: AMIDOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4mup-B 55.3  0.0  286   286  100 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   2:  2ffi-A 27.4  2.5  255   273   20 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
   3:  4dlf-A 25.3  2.8  250   287   16 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   4:  3cjp-A 19.5  2.5  210   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   5:  4hk5-D 19.2  3.3  243   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   6:  3irs-A 18.2  3.0  225   281   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   7:  4ofc-A 17.6  3.1  229   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   8:  2dvt-A 17.5  3.1  230   325   17 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   9:  4qrn-A 17.4  3.4  235   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  10:  2gwg-A 17.2  3.5  231   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  11:  2y1h-B 17.1  3.1  215   265   10 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  12:  2ob3-A 16.6  3.1  221   329   14 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  13:  2vc5-A 16.2  3.1  218   314   10 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  14:  1gkp-A 16.0  3.1  232   458   13 PDB  MOLECULE: HYDANTOINASE;                                              
  15:  1onx-A 16.0  3.3  227   390   13 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  16:  2vun-A 15.9  3.1  226   385   15 PDB  MOLECULE: ENAMIDASE;                                                 
  17:  1bf6-A 15.8  3.4  224   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  18:  2ogj-A 15.7  3.0  222   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  19:  2paj-A 15.7  3.0  213   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  20:  2oof-A 15.5  3.3  220   403   10 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  21:  3k2g-B 15.4  3.2  224   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  22:  3pnu-A 15.2  3.5  230   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  23:  4b3z-D 15.1  3.3  234   477   11 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  24:  3gri-A 15.0  3.2  225   422    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  3ls9-A 14.9  3.1  216   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  26:  1k6w-A 14.8  3.8  226   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  27:  1yrr-B 14.8  3.3  212   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  28:  1itq-A 14.8  3.4  230   369   13 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  29:  3giq-A 14.7  3.3  226   475   16 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  30:  3mtw-A 14.7  3.3  211   404   14 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  31:  1j6p-A 14.5  3.2  213   407   11 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  4c5y-A 14.5  4.1  221   436   10 PDB  MOLECULE: OCHRATOXINASE;                                             
  33:  4cqb-A 14.4  3.8  219   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  34:  2qpx-A 14.4  3.4  215   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  35:  3gg7-A 14.3  3.2  204   243   13 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  3nqb-A 14.1  3.3  210   587   13 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  37:  3mkv-A 14.0  3.4  211   414   10 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  38:  3e74-A 13.9  3.5  222   429   12 PDB  MOLECULE: ALLANTOINASE;                                              
  39:  4dzi-C 13.9  3.3  219   388   15 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  40:  1a4m-A 13.8  3.5  228   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  41:  3icj-A 13.6  3.4  220   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  42:  1a5k-C 13.5  3.2  212   566   13 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  43:  2imr-A 13.4  3.5  224   380   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  44:  1v77-A 13.1  3.1  181   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  45:  3iac-A 13.1  3.0  210   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  46:  1j5s-A 13.0  3.0  210   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  47:  4rdv-B 12.7  3.2  214   451   12 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  48:  3qy6-A 12.7  3.3  193   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  2uz9-A 12.6  3.4  218   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  50:  3au2-A 10.9  3.3  186   575   13 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  51:  2a3l-A 10.4  3.6  213   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3ooq-A 10.3  3.8  195   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  53:  3dcp-A  9.8  3.3  179   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  9.0  3.5  169   234   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  8.9  3.9  186   994    7 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  7.4  4.0  181   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  3e38-A  6.6  3.8  160   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2yb1-A  6.3  3.5  147   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  2anu-A  5.7  3.5  143   224   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4mupB Sbjct=4mupB Z-score=55.3

back to top
DSSP  LLLLLLLLLLLLLLLLLLEELLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHLLL
Query LVRKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGID   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LVRKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGID   60
DSSP  LLLLLLLLLLLLLLLLLLEELLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHLLL


DSSP  EEEEELLHHHLLLLHHHHHHHHHHHHHEEEEELLLLLLLHHHHHHHHHLLEEEEEEELLL
Query RVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLP  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLP  120
DSSP  EEEEELLHHHLLLLHHHHHHHHHHHHHEEEEELLLLLLLHHHHHHHHHLLEEEEEEELLL


DSSP  LLLLLHHHHHHHHHHHHHLLLEEEEELLHHHHHHHHHHHHLLLLEEEELHHHHLLLLLLL
Query GGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRT  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRT  180
DSSP  LLLLLHHHHHHHHHHHHHLLLEEEEELLHHHHHHHHHHHHLLLLEEEELHHHHLLLLLLL


DSSP  LLHHHHHHHHHHHHLLEEEEELLHHHLLLLLLLLHHHHHHHHHHHHHLHHHEEELLLLLL
Query DGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTNWPH  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTNWPH  240
DSSP  LLHHHHHHHHHHHHLLEEEEELLHHHLLLLLLLLHHHHHHHHHHHHHLHHHEEELLLLLL


DSSP  LLLLLHHHLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL
Query NSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV  286
ident ||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV  286
DSSP  LLLLLHHHLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL


No 2: Query=4mupB Sbjct=2ffiA Z-score=27.4

back to top
DSSP  lllllllllllllllLLLEELLLLLLLLLLLllllllLLLLLlLLLHHHHHHHHHHHLLL
Query lvrklsgtapnpafpRGAVDTQMHMYLPGYPalpggpGLPPGaLPGPEDYRRLMQWLGID   60
ident                  | |   |    |          |        ||       |  
Sbjct -------------lhLTAIDSHAHVFSRGLNlasqrrYAPNY-DAPLGDYLGQLRAHGFS   46
DSSP  -------------llLLLEELLLLLLLHHHHhhllllLLLLL-LLLHHHHHHHHHHLLLL


DSSP  EEEEELLHHHLLLLHHHHHHHHHHHHHEEEEELLLLLLLHHHHHHHHHLLEEEEEEELLL
Query RVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLP  120
ident      |      ||   |            ||                 |  | |     
Sbjct HGVLVQPSFLGTDNRYLLSALQTVPGQLRGVVXLERDVEQATLAEXARLGVRGVRLNLXG  106
DSSP  EELLLLLHHHLLLLHHHHHHHHHLLLLLLLLLLLLLLLLHHHHHHHHLLLLLEEELLLLL


DSSP  LlllLHHH----HHHHHHHHHHLLLEEEEELLHHHHhhhHHHHHLL---LLEEEELHHHH
Query GgavNLSE----LDAVDERAHAADWMVAVQFDGNGLldhLPRLQKI---RSRWVFDHHGK  173
ident                  ||     | |                          | || | 
Sbjct Q--dXPDLtgaqWRPLLERIGEQGWHVELHRQVADI---PVLVRALqpyGLDIVIDHFGR  161
DSSP  L--lLLLLllllLHHHHHHHHHHLLEEEELLLLLLH---HHHHHHHlllLLLEEELHHHL


DSSP  LLLLLLLLLHHHHHHHHHHHHLLEEEEELLHHHLLLLLLL-LHHHHHHHHHHHHH-LHHH
Query FFKGIRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWP-YADVAAFSRVIAAH-APER  231
ident          |  | || |  ||  | |  | |          |          ||   ||
Sbjct PDARRGLGQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEEnLAFARQALCALEAHyGAER  221
DSSP  LLLLLLLLLLLHHHHLLLLLLLLEEEEEELHHHLLLLHHHhHHHHHHHHHHHHHHlLHHH


DSSP  EEELLLLLLLLLLlhhHLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL
Query IVWGTNWPHNSVRetaAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV  286
ident   ||  |||                |           |   |     |||     
Sbjct LXWGSDWPHTQHE---SEVSFGSAVEQFEALGCSAQLRQALLLDTARALFGFELE  273
DSSP  EEEELLLLLLLLL---LLLLHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLL


No 3: Query=4mupB Sbjct=4dlfA Z-score=25.3

back to top
DSSP  lllllllllllllllLLLEELLLLLLLLLllllLLLLLL-----lLLLLLLHHHHHHHHH
Query lvrklsgtapnpafpRGAVDTQMHMYLPGypalPGGPGL-----pPGALPGPEDYRRLMQ   55
ident                    |   |            |              |     || 
Sbjct ---------------ALRIDSHQHFWRYR---aADYPWIgagmgvLARDYLPDALHPLMH   42
DSSP  ---------------LLLEEEEELLLLLL---hHHLLLLllllhhHLLLLLHHHHHHHHH


DSSP  HHLLLEEEEELLHhHLLL-LHHHHHHHHHhHHHE-EEEEL-LLLL-LLHHHHHHHHHLLE
Query WLGIDRVIITQGNaHQRD-NGNTLACVAEmGEAA-HAVVI-IDAT-TTEKDMEKLTAAGT  111
ident        |  |     ||     |             |                      
Sbjct AQALGASIAVQAR-AGRDeTAFLLELACD-EARIaAVVGWeDLRApQLAERVAEWRGTKL  100
DSSP  HLLLLEEEEELLL-LLHHhHHHHHHHHLL-LLLEeEEEELlLLLLlLHHHHHHLLLLLLE


DSSP  EEEEEELLL--llllLHHH--HHHHHHHHHHLLLEEEEELLHHHHHHHHHHHHLL-LLEE
Query VGARIMDLP--ggavNLSE--LDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKI-RSRW  166
ident  | |                          | |    |      | |             
Sbjct RGFRHQLQDeadvraFVDDadFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHdAHWL  160
DSSP  EEEEELHHHlllhhhHHHLhhHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHHLlLLLE


DSSP  EELHHHHLLL------llLLLLhHHHHHHHHHHHLLEEEEELLHHHLLL----LLLL-LH
Query VFDHHGKFFK------giRTDGpEMAALLKLIDRGNLWFKFAGVYESSR----KSWP-YA  215
ident | || ||                  |||  |        |  |                 
Sbjct VLDHAGKPALaefdrddtALAR-WRAALRELAALPHVVCKLSGLVTEADwrrgLRASdLR  219
DSSP  EEHHHHLLLHhhllllllHHHH-HHHHHHHHHLLLLEEEEELLLLLLLLllllLLHHhHH


DSSP  HHHHHHHHHHHH-LHHHEEELLLLLLLLLllhhhLLLHHHHHHHHHLLL--LLHH-HHHH
Query DVAAFSRVIAAH-APERIVWGTNWPHNSVretaaYPDDARLAELTLGWL--PDEA-ARHR  271
ident               | |   |  ||                | |   |      |  |  
Sbjct HIEQCLDAALDAfGPQRLMFGSDWPVCLL-----AASYDEVASLVERWAesRLSAaERSA  274
DSSP  HHHHHHHHHHHHhLHHHEEELLLLLHHHH-----LLLHHHHHHHHHHHHhhHLLHhHHHH


DSSP  HHLHHHHHHHLLLll
Query ALVENPEALFKLSpv  286
ident            |   
Sbjct LWGGTAARCYALP--  287
DSSP  HLLHHHHHHLLLL--


No 4: Query=4mupB Sbjct=3cjpA Z-score=19.5

back to top
DSSP  llllllllllllllllLLEELLLLLLllllllllllllllllllLLHHHHHHHHHHHLLL
Query lvrklsgtapnpafprGAVDTQMHMYlpgypalpggpglppgalPGPEDYRRLMQWLGID   60
ident                    |   |                       |     |   | |
Sbjct ----------------LIIDGHTHVI------------------LPVEKHIKIMDEAGVD   26
DSSP  ----------------LLEEEEEELL------------------LLHHHHHHHHHHHLLL


DSSP  EEEEELLHH-------------------------------HLLL-LHHHHHHHHHHHHHE
Query RVIITQGNA-------------------------------HQRD-NGNTLACVAEMGEAA   88
ident   |                                       |                 
Sbjct KTILFSTSIhpetavnlrdvkkemkklndvvngktnsmidVRRNsIKELTNVIQAYPSRY   86
DSSP  EEEEELLLLlhhhlllhhhhhhhhhhhhhhhlllllllhhHHHHhHHHHHHHHHHLLLLE


DSSP  EEEELL--------LLLLLHHHHHHHHhllEEEEE-EELLllllllHHHHHHHHHHHH-H
Query HAVVII--------DATTTEKDMEKLTaagTVGAR-IMDLpggavnLSELDAVDERAH-A  138
ident                    |           ||                |          
Sbjct VGFGNVpvglsendTNSYIEENIVNNK---LVGIGeLTPA---sgqIKSLKPIFKYSMdS  140
DSSP  EEEELLlllllhhhHHHHHHHHLLLLL---LLEEEeELLL---lllHHHHHHHHHHHHhL


DSSP  LLLEEEEELLHHHHHHHHHHHHLL-----LLEEEELHHHHLllllllllhHHHHHHHHHH
Query ADWMVAVQFDGNGLLDHLPRLQKI-----RSRWVFDHHGKFfkgirtdgpEMAALLKLID  193
ident               |                     | |                  |  
Sbjct GSLPIWIHAFNPLVLQDIKEIAELckafpKVPVILGHMGGS---------NWMTAVELAK  191
DSSP  LLLLEEELLLLLLLHHHHHHHHHHhhhllLLLEEEHHHHHH---------HHHHHHHHHH


DSSP  -HLLEEEEELLHHhllllllllhhHHHHHHHHHHHLHHHEEELLLLLLlllllhhhllLH
Query -RGNLWFKFAGVYessrkswpyadVAAFSRVIAAHAPERIVWGTNWPHnsvretaaypDD  252
ident    ||                               |     ||  |           | 
Sbjct eIQNLYLDTSAYF-----------STFVLKIVINELPLKCIFGTDMPF---------gDL  231
DSSP  hLLLEEEELLLLL-----------LHHHHHHHHHHLLLLEELLLLLLL---------lLH


DSSP  HHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLlll
Query ARLAELTLGWLPDEAARHRALVENPEALFKLspv  286
ident     |       |       |  |   |      
Sbjct QLSIEAIKKMSNDSYVANAVLGDNISRLLNI---  262
DSSP  HHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL---


No 5: Query=4mupB Sbjct=4hk5D Z-score=19.2

back to top
DSSP  llllllllllllllLLLLEELLLLLLLLLLLLLL-----LLLL-----------------
Query lvrklsgtapnpafPRGAVDTQMHMYLPGYPALP-----GGPG-----------------   38
ident                   ||   ||| | | |                            
Sbjct --------------TPVVVDIHTHMYPPSYIAMLekrqtIPLVrtfpqadeprlillsse   46
DSSP  --------------LLLLEEEEEEELLHHHHHHHhllllLLEEeeelleeeeeeellhhh


DSSP  ----------------lLLLLLL--LHHHHHHHHHHHLLLEEEEELLHHHLL--------
Query ----------------lPPGALP--GPEDYRRLMQWLGIDRVIITQGNAHQR--------   72
ident                   |              |   ||    |   |            
Sbjct laaldaaladpaaklpgRPLSTHfaSLAQKMHFMDTNGIRVSVISLANPWFDflapdeap  106
DSSP  hhhhhhhhhllllllllEELLHHhlLHHHHHHHHHHLLLLEEEEEELLLLLLllllllhh


DSSP  -----LLHHHHHHHHHHHHHEEEEELLLL-----LLLHhHHHHHHH-LLEEEEEEELlll
Query -----DNGNTLACVAEMGEAAHAVVIIDA-----TTTEkDMEKLTA-AGTVGARIMDlpg  121
ident       |       |                          |         |        
Sbjct giadaVNAEFSDMCAQHVGRLFFFAALPLsapvdAVKA-SIERVKNlKYCRGIILGT---  162
DSSP  hhhhhHHHHHHHHHHLLLLLEEEEEELLLlllhhHHHH-HHHHHHLlLLEEEEEELL---


DSSP  lllLHHH-------HHHHHHHHHHLLLEEEEEL---------------------------
Query gavNLSE-------LDAVDERAHAADWMVAVQF---------------------------  147
ident               |  | |    |   |                               
Sbjct ---SGLGkglddphLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfp  219
DSSP  ---LLLLlllllhhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhh


DSSP  --LHHHHHHHH--HHHHLL-LLEEEELHHHHLlllLLLLLH------------------h
Query --DGNGLLDHL--PRLQKI-RSRWVFDHHGKFfkgIRTDGP------------------e  184
ident                            | |                              
Sbjct meTTIAVARMYmaGVFDHVrNLQMLLAHSGGT-lpFLAGRIescivhdghlvktgkvpkd  278
DSSP  hhHHHHHHHHHhlLHHHHLlLLLEEEHHHHLL-hhHHHHHHhhhhhllhhhhhlllllll


DSSP  hhHHHHHHHhLLEEEEELLHhhllllllllhhHHHHHHHHHHH-LHHHEEELLLLLLlLL
Query maALLKLIDrGNLWFKFAGVyessrkswpyadVAAFSRVIAAH-APERIVWGTNWPHnSV  243
ident                                          |     |   ||  |    
Sbjct rrTIWTVLK-EQIYLDAVIY------------SEVGLQAAIASsGADRLMFGTDHPF-FP  324
DSSP  llLHHHHHH-HLEEEELLLL------------LHHHHHHHHHHhLHHHEELLLLLLL-LL


DSSP  LLHHHL---LLHHHHHHHHHL-LLLL-HHHHHHHHLHHHHHHHLLLL--------l
Query RETAAY---PDDARLAELTLG-WLPD-EAARHRALVENPEALFKLSP--------v  286
ident           |  ||                      |      |           
Sbjct PIEEDVqgpWDSSRLNAQAVIkAVGEgSSDAAAVMGLNAVRVLSLKAelehhhhhh  380
DSSP  LLLLLLlllLHHHHHHHHHHHhHHLLlLHHHHHHHLHHHHHHLLLHHhhhhhhhhl


No 6: Query=4mupB Sbjct=3irsA Z-score=18.2

back to top
DSSP  lllllllllllllllLLLEELLLLLLLLlLLLLllllLLLL-------------------
Query lvrklsgtapnpafpRGAVDTQMHMYLPgYPALpggpGLPP-------------------   41
ident                    |                                        
Sbjct ---------------LKIIDFRLRPPAMgFLNA----RIYTrpdirnrftrqlgfepaps   41
DSSP  ---------------LLLEELLLLLLLHhHHHL----HHHHlhhhhhhhhhhhlllllhh


DSSP  -LLLLLhHHHHHHHHHHLLLEEEEELL----HHHLlLLHHHHHHHHHHHHHEEEEELL--
Query -GALPGpEDYRRLMQWLGIDRVIITQG----NAHQrDNGNTLACVAEMGEAAHAVVII--   94
ident        |     |   ||                  |    |         | |  |  
Sbjct aEEKSL-ELMFEEMAAAGIEQGVCVGRnssvLGSV-SNADVAAVAKAYPDKFHPVGSIea   99
DSSP  hHHLLH-HHHHHHHHHLLLLEEEEELLeellLEEL-LHHHHHHHHHHLLLLEEEEEELll


DSSP  --lLLLLhHHHHHHHHLLEEEEEEELLLL-lllLHHH--HHHHHHHHHHLLLEEEEELL-
Query --dATTTeKDMEKLTAAGTVGARIMDLPG-gavNLSE--LDAVDERAHAADWMVAVQFD-  148
ident           |      |                     |             |      
Sbjct atrKEAM-AQMQEILDLGIRIVNLEPGVWatpmHVDDrrLYPLYAFCEDNGIPVIMMTGg  158
DSSP  llhHHHH-HHHHHHHHLLLLLEEELHHHLllllLLLLhhHHHHHHHHHHLLLLEEEELLl


DSSP  -------hHHHHHHHHHHHLL-LLEEEELHHHHLllLLLLllhhHHHHHHHHhhlLEEEE
Query -------gNGLLDHLPRLQKI-RSRWVFDHHGKFfkGIRTdgpeMAALLKLIdrgNLWFK  200
ident                  |        |  |                         ||   
Sbjct nagpdityTNPEHIDRVLGDFpDLTVVSSHGNWP--WVQE---iIHVAFRRP---NLYLS  210
DSSP  lllllhhhHLHHHHHHHHHHLlLLLEEEEHHHLL--LHHH---hHHHHHHLL---LEEEE


DSSP  ELLHHhlllllllLHHHHHHHHHHH-HHLHHHEEELLLLLLlllllhhhllLHHHHHHHh
Query FAGVYessrkswpYADVAAFSRVIA-AHAPERIVWGTNWPHnsvretaaypDDARLAELt  259
ident                   |     |      |   ||  |                    
Sbjct PDMYL-------yNLPGHADFIQAAnSFLADRMLFGTAYPM------cplkEYTEWFLT-  256
DSSP  LHHHH-------lLLLLHHHHHHHHlLHHHHLLLLLLLLLL------llhhHHHHHHHL-


DSSP  hLLLLlHHHHHHHHLHHHHHHHLLlll
Query lGWLPdEAARHRALVENPEALFKLspv  286
ident         |    |  | | |      
Sbjct -LPIK-PDAMEKILHGNAERLLAQagr  281
DSSP  -LLLL-HHHHHHHHLHHHHHHHHHlll


No 7: Query=4mupB Sbjct=4ofcA Z-score=17.6

back to top
DSSP  lllllllllllllllllLEELLLLLLLLLL-------lllLLLLL---------------
Query lvrklsgtapnpafprgAVDTQMHMYLPGY-------palPGGPG---------------   38
ident                    |   |                                    
Sbjct ----------------mKIDIHSHILPKEWpdlkkrfgygGWVQLqhhskgeakllkdgk   44
DSSP  ----------------lLEEEEEELLLLLLllhhhhhlllLLEEEeeeelleeeeeelle


DSSP  -lLLLLLL--LHHHHHHHHHHHLLLEEEEELLHHHLL--------------LLHHHHHHH
Query -lPPGALP--GPEDYRRLMQWLGIDRVIITQGNAHQR--------------DNGNTLACV   81
ident            ||   | |   |                             |      |
Sbjct vfRVVRENcwDPEVRIREMDQKGVTVQALSTVPVMFSywakpedtlnlcqlLNNDLASTV  104
DSSP  eeEEEEHHhlLHHHHHHHHHHHLLLEEEEELLHHHHLllllhhhhhhhhhhHHHHHHHHH


DSSP  HHHHHHEEEEELLL----LLLLHhHHHHHH-HLLEEEEEEELLlllllLHHH--HHHHHH
Query AEMGEAAHAVVIID----ATTTEkDMEKLT-AAGTVGARIMDLpggavNLSE--LDAVDE  134
ident                          ||      |  |  |         |    |  |  
Sbjct VSYPRRFVGLGTLPmqapELAVK-EMERCVkELGFPGVQIGTH-vnewDLNAqeLFPVYA  162
DSSP  HHLLLLEEEEELLLlllhHHHHH-HHHHHHhLLLLLEEEEELE-elleELLLhhHHHHHH


DSSP  HHHHLLLEEEEEL----------------------LHHH-HHHHH--HHHHLL-LLEEEE
Query RAHAADWMVAVQF----------------------DGNG-LLDHL--PRLQKI-RSRWVF  168
ident  |        |                                        |       |
Sbjct AAERLKCSLFVHPwdmqmdgrmakywlpwlvgmpaETTIaICSMImgGVFEKFpKLKVCF  222
DSSP  HHHHHLLEEEEELllllllhhhhlllhhhhlhhhhHHHHhHHHHHllLHHHHLlLLLEEE


DSSP  LHHHHLllLLLLLLH----------------hhHHHHHHhhhllEEEEELLHhhllllll
Query DHHGKFfkGIRTDGP----------------emAALLKLidrgnLWFKFAGVyessrksw  212
ident  | |                                |                       
Sbjct AHGGGAfpFTVGRIShgfsmrpdlcaqdnpmnpKKYLGS-----FYTDALVH--------  269
DSSP  LHHHLLhhHHHHHHHhhhhhlhhhhlllllllhHHHLLL-----LEEELLLL--------


DSSP  llhhHHHHHHHHHHH-LHHHEEELLLLLLLLlllhhhlLLHHhHHHHHHLL-lLLHHHHH
Query pyadVAAFSRVIAAH-APERIVWGTNWPHNSvretaayPDDArLAELTLGW-lPDEAARH  270
ident                        ||  |                  |       ||    
Sbjct ----DPLSLKLLTDViGKDKVILGTDYPFPL-------GELE-PGKLIESMeeFDEETKN  317
DSSP  ----LHHHHHHHHHHhLLLLEELLLLLLLLL-------LLLL-LLHHHHHLllLLHHHHH


DSSP  HHHLHHHHHHHLLLLL--
Query RALVENPEALFKLSPV--  286
ident      |  |   |     
Sbjct KLKAGNALAFLGLERKqf  335
DSSP  HHHLHHHHHHHLLLHHhl


No 8: Query=4mupB Sbjct=2dvtA Z-score=17.5

back to top
DSSP  llllllllllllllLLLLEELLLLLLlllLLLLlllLLLL----------LLLL---LLH
Query lvrklsgtapnpafPRGAVDTQMHMYlpgYPALpggPGLP----------PGAL---PGP   47
ident                 | |    |      |                             
Sbjct --------------MQGKVALEEHFA---IPET---LQDSagfvpgdywkELQHrllDIQ   40
DSSP  --------------LLLEEEEEEEEL---LHHH---HHHHlllllllhhhHHHHhhhLLL


DSSP  HHHHHHHHHHLLLEEEEELLHHHL--------------lLLHHHHHHHHHHHHHEEEEEL
Query EDYRRLMQWLGIDRVIITQGNAHQ--------------rDNGNTLACVAEMGEAAHAVVI   93
ident      ||   ||   |                        |       |       |   
Sbjct DTRLKLMDAHGIETMILSLNAPAVqaipdrrkaieiarrANDVLAEECAKRPDRFLAFAA  100
DSSP  LHHHHHHHHLLEEEEEEEELLLHHhhlllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEEL


DSSP  LL----LLLLHhHHHHHH-HLLEEEEEEELLL-----llllLHHH--HHHHHHHHHHLLL
Query ID----ATTTEkDMEKLT-AAGTVGARIMDLP-----ggavNLSE--LDAVDERAHAADW  141
ident          ||          | |||                                | 
Sbjct LPlqdpDAATE-ELQRCVnDLGFVGALVNGFSqegdgqtplYYDLpqYRPFWGEVEKLDV  159
DSSP  LLlllhHHHHH-HHHHHHhLLLLLEEEEELLLlllllllllLLLLhhHHHHHHHHHHHLL


DSSP  EEEEEL---------------------------LHHHHHHHHH-HHHL--LLLEEEELHH
Query MVAVQF---------------------------DGNGLLDHLP-RLQK--IRSRWVFDHH  171
ident                                       |      |     |      | 
Sbjct PFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALRLMAsGLFDehPRLNIILGHM  219
DSSP  LEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHHHHHlLHHHhlLLLLEEELHH


DSSP  HHLlllLLLLLH--------------hhhHHHHHHHHlLEEEEELLHhhllllllllhhH
Query GKFfkgIRTDGP--------------emaALLKLIDRgNLWFKFAGVyessrkswpyadV  217
ident |                                     |      |              
Sbjct GEG-lpYMMWRIdhrnawvklpprypakrRFMDYFNE-NFHITTSGN-----------fR  266
DSSP  HLL-hhHHHHHHhhlllllllllllllllLHHHHHHH-HEEEELLLL-----------lL


DSSP  HHHHHHHHHH-LHHHEEELLLLLLlllllhhhlLLHHHHHHHHHLLLLLHHHHHHHHLHH
Query AAFSRVIAAH-APERIVWGTNWPHnsvretaayPDDARLAELTLGWLPDEAARHRALVEN  276
ident               ||   | ||                          || |      |
Sbjct TQTLIDAILEiGADRILFSTDWPF---------ENIDHASDWFNATSIAEADRVKIGRTN  317
DSSP  HHHHHHHHLLlLHHHEELLLLLLL---------LLHHHHHHHHHHLLLLHHHHHHHHLHH


DSSP  HHHHHLLLll
Query PEALFKLSpv  286
ident    ||||   
Sbjct ARRLFKLD--  325
DSSP  HHHHLLLL--


No 9: Query=4mupB Sbjct=4qrnA Z-score=17.4

back to top
DSSP  llllllLLLL--lLLLLlLLEELLLLLLLLLLL-------------llLLLLL-------
Query lvrklsGTAP--nPAFPrGAVDTQMHMYLPGYP-------------alPGGPG-------   38
ident                       |                                     
Sbjct ---smtQDLKtggEQGY-LRIATEEAFATREIIdvylrmirdgtadkgMVSLWgfyaqsp   56
DSSP  ---lllLLLLlllLLLL-LLEEEEEEELLHHHHhhhhhhhhhllllhhHHHHHhhhhhll


DSSP  --lLLLLL---LLHH-HHHHHHHHHLLLEEEEELLHHHLL--------------LLHHHH
Query --lPPGAL---PGPE-DYRRLMQWLGIDRVIITQGNAHQR--------------DNGNTL   78
ident        |             |   |||  |                        |    
Sbjct serATQILerlLDLGeRRIADMDATGIDKAILALTSPGVQplhdldeartlatrANDTLA  116
DSSP  lhhHHHHHhhhHLLLhHHHHHHHHLLLLEEEEEELLLLLLllllhhhhhhhhhhHHHHHH


DSSP  HHHHHHHHHEEEEELL----LLLLLHhHHHHHH-HLLEEEEEEELLLllllLHHH--hHH
Query ACVAEMGEAAHAVVII----DATTTEkDMEKLT-AAGTVGARIMDLPggavNLSE--lDA  131
ident                                     |  |  |         | |   | 
Sbjct DACQKYPDRFIGMGTVapqdPEWSAR-EIHRGArELGFKGIQINSHT-qgrYLDEeffDP  174
DSSP  HHHHHLLLLEEELLLLllllHHHHHH-HHHHHHhLLLLLLEEELLLL-lllLLLLhhhHH


DSSP  HHHHHHHLLLEEEEEL--------------------------LHHHHHHHH-HHHH--LL
Query VDERAHAADWMVAVQF--------------------------DGNGLLDHL-PRLQ--KI  162
ident         |                                  |  ||            
Sbjct IFRALVEVDQPLYIHPatspdsmidpmleagldgaifgfgveTGMHLLRLItIGIFdkYP  234
DSSP  HHHHHHHHLLLEEELLllllllllhhhhhhlllllllhhhhhHHHHHHHHHhHLHHhhLL


DSSP  LLEEEELHHHHLlllLLLLLH------------------hhhHHHHHHHhLLEEEEELLH
Query RSRWVFDHHGKFfkgIRTDGP------------------emaALLKLIDrGNLWFKFAGV  204
ident        | |                                         |      ||
Sbjct SLQIMVGHMGEA-lpYWLYRLdymhqagvrsqryermkplkkTIEGYLK-SNVLVTNSGV  292
DSSP  LLLEEELHHHHL-hhHHHHHHhhhhhhhhhllllllllllllLHHHHHH-HLEEEELLLL


DSSP  hhllllllllhhHHHHHHHHHHH-LHHHEEELLLLLLlllllhhhlllHHHHHHHHHLLl
Query yessrkswpyadVAAFSRVIAAH-APERIVWGTNWPHnsvretaaypdDARLAELTLGWl  263
ident                            |       |             |          
Sbjct -----------aWEPAIKFCQQVmGEDRVMYAMDYPY---------qyVADEVRAMDAMd  332
DSSP  -----------lLHHHHHHHHHHhLHHHEELLLLLLL---------llLHHHHHHHHLLl


DSSP  LLHHHHHHHHLHHHHHHHLLlll
Query PDEAARHRALVENPEALFKLspv  286
ident             | |  |||   
Sbjct MSAQTKKKFFQTNAEKWFKL---  352
DSSP  LLHHHHHHHHLHHHHHHLLL---


No 10: Query=4mupB Sbjct=2gwgA Z-score=17.2

back to top
DSSP  llllllllllllllllLLEELLLLL-LLLLlLLLLL------------------llllll
Query lvrklsgtapnpafprGAVDTQMHM-YLPGyPALPG------------------gpglpp   41
ident                    |   |    |                               
Sbjct ----------------XIIDIHGHYtTAPKaLEDWRnrqiagikdpsvxpkvselkisdd   44
DSSP  ----------------LLEEEEEELlLLLHhHHHHHhhhhhhhhlhhhlllhhhllllhh


DSSP  llllLHHH-HHHHHHHHLLLEEEEELLH-------hHLLL-LHHHHHHHHHHHHHEEEEE
Query galpGPED-YRRLMQWLGIDRVIITQGN-------aHQRD-NGNTLACVAEMGEAAHAVV   92
ident               |  | |                     |                  
Sbjct elqaSIIEnQLKKXQERGSDLTVFSPRAgdfnvsstWAAIcNELCYRVSQLFPDNFIGAA  104
DSSP  hhhhHHHLlHHHHHHHHLLLEEEEELLLllhhhhhhHHHHhHHHHHHHHHHLLLLEEEEE


DSSP  LL-------LLLLLhHHHHHHHH-LLEEEEEEELLL------lllllhHHHHHHHHHHHH
Query II-------DATTTeKDMEKLTA-AGTVGARIMDLP------ggavnlSELDAVDERAHA  138
ident            |      ||     | |       |                   |    
Sbjct XLpqspgvdPKTCI-PELEKCVKeYGFVAINLNPDPsgghwtsppltdRIWYPIYEKXVE  163
DSSP  ELlllllllHHHHH-HHHHHHHHlLLLLEEEELLLLllllllllllllHHHHHHHHHHHH


DSSP  LLLEEEEE---------LLHHHHHHHH-HHHH--LLLLEEEELHHHHLlllLLLLLHH--
Query ADWMVAVQ---------FDGNGLLDHL-PRLQ--KIRSRWVFDHHGKFfkgIRTDGPE--  184
ident                   |           |         |  | |              
Sbjct LEIPAXIHvstgahylnADTTAFXQCVaGDLFkdFPELKFVIPHGGGA-vpYHWGRFRgl  222
DSSP  HLLLEEELlllllhhhhHHHHHHHHHHhLLHHhhLLLLLEEELHHHLL-lhHHHHHHHhh


DSSP  ------hhHHHHHHhhLLEEEEELLHHhlllllllLHHHHHHHHHHhhhLHHHEEELLLL
Query ------maALLKLIdrGNLWFKFAGVYessrkswpYADVAAFSRVIaahAPERIVWGTNW  238
ident                  |  |                       ||              
Sbjct aqexkkplLEDHVL--NNIFFDTCVYH--------QPGIDLLNTVI---PVDNVLFASEX  269
DSSP  hhhlllllHHHHLL--LLEEEELLLLL--------HHHHHHHHHHL---LHHHEELLLLL


DSSP  LLLLLLLHH--HLLLHHhHHHHHHLL-lLLHHHHHHHHLHHHHHHHL--LLLL-------
Query PHNSVRETA--AYPDDArLAELTLGW-lPDEAARHRALVENPEALFK--LSPV-------  286
ident                |                        |                   
Sbjct IGAVRGIDPrtGFYYDD-TKRYIEAStiLTPEEKQQIYEGNARRVYPrlDAALkakgkle  328
DSSP  LLLLLLEELllLEELLL-LHHHHHHLllLLHHHHHHHHLHHHHHHLHhhHHHHhhhhhhl


DSSP  -
Query -  286
ident  
Sbjct h  329
DSSP  l


No 11: Query=4mupB Sbjct=2y1hB Z-score=17.1

back to top
DSSP  llllllllllllllLLLLEELLLLLLlllllllllllLLLLllLLLHHHHHHHHHhHLLL
Query lvrklsgtapnpafPRGAVDTQMHMYlpgypalpggpGLPPgaLPGPEDYRRLMQwLGID   60
ident                 | ||   |                                    
Sbjct --------------GVGLVDCHCHLS----------aPDFD--RDLDDVLEKAKK-ANVV   33
DSSP  --------------LLLEEEEEELLL----------lHHHL--LLHHHHHHHHHH-LLEE


DSSP  EEEEELlhhHLLL-LHHHHHHHHHHHHHEEEEELL---------------LLLLLhHHHH
Query RVIITQgnaHQRD-NGNTLACVAEMGEAAHAVVII---------------DATTTeKDME  104
ident                                                            |
Sbjct ALVAVA---EHSGeFEKIMQLSERYNGFVLPCLGVhpvqgldqrsvtlkdLDVAL-PIIE   89
DSSP  EEEELL---LLHHhHHHHHHHHHHLLLLEEEEELLlleelllleellhhhHHHHH-HHHH


DSSP  HHHHlLEEEE-EEELLLL---------lllLHHHHHHHHHHHHHLLLEEEEELLhHHHHH
Query KLTAaGTVGA-RIMDLPG---------gavNLSELDAVDERAHAADWMVAVQFDgNGLLD  154
ident                                   |      |      | |         
Sbjct NYKD-RLLAIgEVGLDFSprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR-SAGRP  147
DSSP  HHLL-LLLEEeEEEEELLllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE-LLHHH


DSSP  HHHHHHL-LLLEEEELhHHHLllllllllhHHHHHHHHHHHLlEEEEELLHhhllllllL
Query HLPRLQK-IRSRWVFDhHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAGVyessrkswP  213
ident     ||                                   |   |              
Sbjct TINLLQEqGAEKVLLH-AFDG---------RPSVAMEGVRAG-YFFSIPPS-------iI  189
DSSP  HHHHHHHlLLLLEEEE-LLLL---------LHHHHHHHHHLL-LEEEELHH-------hH


DSSP  LHH-HHHHHHHHhhhLHHHEEELLLLLLlllllhhHLLLhhhHHHHHHLLLL------LH
Query YAD-VAAFSRVIaahAPERIVWGTNWPHnsvretaAYPDdarLAELTLGWLP------DE  266
ident                    |   |  |                                |
Sbjct RSGqKQKLVKQL---PLTSICLETDSPA--lgpekQVRNepwNISISAEYIAqvkgisVE  244
DSSP  LLHhHHHHHHHL---LHHHEEELLLLLL--lllllLLLLlhhHHHHHHHHHHhhhlllHH


DSSP  HHHHHHhLHHHHHHH-LLLL-l
Query AARHRAlVENPEALF-KLSP-v  286
ident          |   || ||    
Sbjct EVIEVT-TQNALKLFpKLRHll  265
DSSP  HHHHHH-HHHHHHHLlLHHHhl


No 12: Query=4mupB Sbjct=2ob3A Z-score=16.6

back to top
DSSP  llllllllllllllllLLEELLLLLL-lllLLLL-llllllllLLLL-LHHHHHHHHHHH
Query lvrklsgtapnpafprGAVDTQMHMY-lpgYPAL-pggpglppGALP-GPEDYRRLMQWL   57
ident                 |   |  |                    ||        |     
Sbjct -drintvrgpitiseaGFTLTHEHICgssaGFLRawpeffgsrKALAeKAVRGLRRARAA   59
DSSP  -lleeelleeelhhhhLLEEEEELLEelllLHHHhlhhhhllhHHHHhHHHHHHHHHHHL


DSSP  LLLEEEEELlhhhlLLLHHHHHHHHHHH----hHEEEEELL---------------LLLL
Query GIDRVIITQgnahqRDNGNTLACVAEMG----eAAHAVVII---------------DATT   98
ident |              | |      ||          |                       
Sbjct GVRTIVDVS----tFDIGRDVSLLAEVSraadvHIVAATGLwfdpplsmrlrsveeLTQF  115
DSSP  LLLEEEELL----lHHHLLLHHHHHHHHhhhllEEELEEELlllllhhhhlllhhhHHHH


DSSP  lHHHHHHH---hHLLEEEEEEELL-lllllLHHHHHHHHHHHHHLLLEEEEELLHHHHhh
Query tEKDMEKL---tAAGTVGARIMDL-pggavNLSELDAVDERAHAADWMVAVQFDGNGLld  154
ident                                   | |      |    |           
Sbjct fLREIQYGiedtGIRAGIIXVATTgkatpfQELVLKAAARASLATGVPVTTHTAASQR-d  174
DSSP  hHHHHHLLllllLLLLLEEEEELLllllhhHHHHHHHHHHHHHHHLLLEEEELLHHHL-h


DSSP  hHHHHHLLL------lEEEELHHHHLllllllllhHHHHHHHHHHHLlEEEEELLHHH--
Query hLPRLQKIR------sRWVFDHHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAGVYE--  206
ident                 |    |                 |  |  ||             
Sbjct gEQQAAIFEseglspsRVCIGHSDDT--------dDLSYLTALAARG-YLIGLDHIPYsa  225
DSSP  hHHHHHHHHhllllhhHEEELLHHHL--------lLHHHHHHHHHLL-LEEEELLLLLll


DSSP  ------------LLLLllLLHHHHHHHHHHHH-HLHHHEEELLLLL-------llLLLLh
Query ------------SSRKswPYADVAAFSRVIAA-HAPERIVWGTNWP-------hnSVREt  246
ident                        |              |     |               
Sbjct iglednasasalLGIR--SWQTRALLIKALIDqGYMKQILVSNDWTfgfssyvtnIMDVm  283
DSSP  llllllhhhhhhHLLL--LHHHHHHHHHHHHHlLLHHHEEELLLLLleellllllHHHHh


DSSP  hHLLLH-hHHHH-HHHLLL----LLHHHHHHHHLHHHHHHHLllll
Query aAYPDD-aRLAE-LTLGWL----PDEAARHRALVENPEALFKlspv  286
ident      |            |              | ||         
Sbjct dRVNPDgmAFIPlRVIPFLrekgVPQETLAGITVTNPARFLSptlr  329
DSSP  hHHLLLhhHHHHhLHHHHHhhllLLHHHHHHHHLHHHHHHHLllll


No 13: Query=4mupB Sbjct=2vc5A Z-score=16.2

back to top
DSSP  llllllllllllllllLLEELLLLLLllllLLLL----lllllllLLLL-LHHHHHHHHH
Query lvrklsgtapnpafprGAVDTQMHMYlpgyPALP----ggpglppGALP-GPEDYRRLMQ   55
ident                 |      |                                    
Sbjct mriplvgkdsieskdiGFTLIHEHLR---vFSEAvrqqwphlyneDEEFrNAVNEVKRAM   57
DSSP  llllllllllllhhhlLLEELLLLLL---lLLHHhhhhlhhhllhHHHHhHHHHHHHHHH


DSSP  HHLLLEEEEEL-LHHHllllhHHHHHHHHHH----HHEEEEEL-----------------
Query WLGIDRVIITQ-GNAHqrdngNTLACVAEMG----EAAHAVVI-----------------   93
ident   |                                    |                    
Sbjct QFGVKTIVDPTvMGLG-----RDIRFMEKVVkatgINLVAGTGiyiyidlpfyflnrsid  112
DSSP  HLLLLEEEELLlLLLL-----LLHHHHHHHHhlllLEEEELEEllllllllhhhllllhh


DSSP  lLLLLlHHHHHHH---hHLLEEEEEEELLL--llllLHHHHHHHHHHHHHLLLEEEEELL
Query iDATTtEKDMEKL---tAAGTVGARIMDLP--ggavNLSELDAVDERAHAADWMVAVQFD  148
ident   |     |                |                |                 
Sbjct eIADLfIHDIKEGiqgtLNKAGFVXIAADEpgitkdVEKVIRAAAIANKETKVPIITHSN  172
DSSP  hHHHHhHHHHHLLllllLLLLLLEEEELLLllllhhHHHHHHHHHHHHHHHLLLEEEELL


DSSP  HHHHhhhHHHHHLLL------lEEEELHHHHLllllllllhhHHHHHHHHHHLlEEEEEL
Query GNGLldhLPRLQKIR------sRWVFDHHGKFfkgirtdgpeMAALLKLIDRGnLWFKFA  202
ident        |                   | |                 |  | |       
Sbjct AHNN-tgLEQQRILTeegvdpgKILIGHLGDT--------dnIDYIKKIADKG-SFIGLD  222
DSSP  LLLL-hhHHHHHHHHhllllhhHEEELLHHHL--------llHHHHHHHHHLL-LEEEEL


DSSP  LH--HHLLLllllLHHHHHHHHHHHH-HLHHHEEELLLLL----lllLLLHHH----LLL
Query GV--YESSRkswpYADVAAFSRVIAA-HAPERIVWGTNWP----hnsVRETAA----YPD  251
ident                                 |                           
Sbjct RYglDLFLP----VDKRNETTLRLIKdGYSDKIMISHDYCctidwgtAKPEYKpklaPRW  278
DSSP  LLllLLLLL----HHHHHHHHHHHHHlLLLLLEEELLLLLlllllllLLHHHHhhhlLLL


DSSP  HhHHHH-HHHL----llLLHHHHHHHHLHHHHHHHLllll
Query DaRLAE-LTLG----wlPDEAARHRALVENPEALFKlspv  286
ident    |    |          |        |||   |     
Sbjct SiTLIFeDTIPflkrngVNEEVIATIFKENPKKFFS----  314
DSSP  LlLHHHhLHHHhhhlllLLHHHHHHHHLHHHHHHLL----


No 14: Query=4mupB Sbjct=1gkpA Z-score=16.0

back to top
DSSP  ------------------------------------llllllllllllllLLLLEELLLL
Query ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
ident                                                     |  |   |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  LLllllllllllLLLLlllLLLHHHHHHHHHHHLLLEEEEELLhhHLLL------LHHHH
Query MYlpgypalpggPGLPpgaLPGPEDYRRLMQWLGIDRVIITQGnaHQRD------NGNTL   78
ident  |                     |         |    |        |            
Sbjct IY-------lpfMATF--aKDTHETGSKAALMGGTTTYIEMCC--PSRNddalegYQLWK  109
DSSP  LL-------leeLLEE--lLLLHHHHHHHHHHLLEEEEEEEEL--LLLLllhhhhHHHHH


DSSP  HHHHHHH-hHEEEEELL-LLLL-LHHHHHHHHHLLEEEEEEELLLL-lLLLHH-HHHHHH
Query ACVAEMG-eAAHAVVII-DATT-TEKDMEKLTAAGTVGARIMDLPG-gAVNLS-ELDAVD  133
ident                        ||       | |     |             |     
Sbjct SKAEGNSycDYTFHMAVsKFDEkTEGQLREIVADGISSFXIFLSYKnfFGVDDgEMYQTL  169
DSSP  HHHLLLLllEEEEEEELlLLLLlHHHHHHHHHHLLLLEEEEEELLLllLLLLHhHHHHHH


DSSP  HHHHHLLLEEEEELL-----------------------------hHHHHhhHHHHHLL--
Query ERAHAADWMVAVQFD-----------------------------gNGLLdhLPRLQKI--  162
ident   |      |                                                  
Sbjct RLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEgtARFATFLet  229
DSSP  HHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHhhHHHHHHHhh


DSSP  -LLEEEELHHHhlllllllllHHHHHHHHHHH-HLLEEEEELLHH---------------
Query -RSRWVFDHHGkffkgirtdgPEMAALLKLID-RGNLWFKFAGVY---------------  205
ident         |            |   |                                  
Sbjct tGATGYVVHLS--------ckPALDAAMAAKArGVPIYIESVIPHflldktyaerggvea  281
DSSP  hLLEEEELLLL--------lhHHHHHHHHHHHlLLLEEEEEEHHHhhllhhhhhllhhhh


DSSP  -------HLLLlllllHHHHHHHHHHHHHLHhHEEELLLLLLllLLLH------------
Query -------ESSRkswpyADVAAFSRVIAAHAPeRIVWGTNWPHnsVRET------------  246
ident                            |        ||                      
Sbjct mkyimspPLRD-----KRNQKVLWDALAQGF-IDTVGTDHCP--FDTEqkllgkeaftai  333
DSSP  hllllllLLLL-----LHHHHHHHHHHHLLL-LLEEELLLLL--LLHHhhhhhlllhhhl


DSSP  hhLLLH-HHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHLLLLL--------------
Query aaYPDD-ARLAELTLGWL-----PDEAARHRALVENPEALFKLSPV--------------  286
ident             |           |      |       || | |               
Sbjct pnGIPAiEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGLFPRkgtiavgsdadlvv  393
DSSP  llLLLLlLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLLLllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct ydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrr  453
DSSP  eelllleellhhhllllllllllllleelleeeeeeelleeeeelleellllllllllll


DSSP  -----
Query -----  286
ident      
Sbjct epmyf  458
DSSP  lllll


No 15: Query=4mupB Sbjct=1onxA Z-score=16.0

back to top
DSSP  ----------------------------------------------llllllllllllll
Query ----------------------------------------------lvrklsgtapnpaf   14
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  LLLLEELLLLLLllllllllllllllLLLLLLHhhHHHHHHHHLLLEEEEELLHHHL-lL
Query PRGAVDTQMHMYlpgypalpggpglpPGALPGPedYRRLMQWLGIDRVIITQGNAHQ-rD   73
ident   |  |   |                    |            |   |    |       
Sbjct CPGFIDQHVHLI------ggggeagpTTRTPEV--ALSRLTEAGVTSVVGLLGTDSIsrH  112
DSSP  EELEEEEEELLL------lllllllhHHLLLLL--LHHHHHHLLEEEEEELLLLLLLllL


DSSP  LHHHHHHHHHHH---HHEEEEEL-------lllLLLHHHHHHHhhLLEEEEEEEL-LLLL
Query NGNTLACVAEMG---EAAHAVVI-------idaTTTEKDMEKLtaAGTVGARIMD-LPGG  122
ident     ||           |                  |||          |          
Sbjct PESLLAKTRALNeegISAWMLTGayhvpsrtitGSVEKDVAII--DRVIGVXCAIsDHRS  170
DSSP  HHHHHHHHHHHHhhlLEEEEEEEllllllllllLLHHHHHHHL--LLEEEEEEEElLLLL


DSSP  lLLHH--HHHHHHHHHHHLL------LEEEEELL-hHHHHHH-HHHH--HLLL-LEEEEL
Query aVNLS--ELDAVDERAHAAD------WMVAVQFD-gNGLLDH-LPRL--QKIR-SRWVFD  169
ident         |                              |      |       |     
Sbjct -AAPDvyHLANMAAESRVGGllggkpGVTVFHMGdsKKALQPiYDLLenCDVPiSKLLPT  229
DSSP  -LLLLhhHHHHHHHHHHHHHhhhlllLEEEEEELllLLLLHHhHHHHhlLLLLhHHEEEE


DSSP  HHHHLLLllllllhhhHHHHHHHHHLlEEEEEL-LHHHLLllllllhhHHHHHHHHHH--
Query HHGKFFKgirtdgpemAALLKLIDRGnLWFKFA-GVYESSrkswpyadVAAFSRVIAA--  226
ident |                  |     |           |           |          
Sbjct HVNRNVP-------lfEQALEFARKG-GTIDITsSIDEPV-------aPAEGIARAVQag  274
DSSP  LHHHLHH-------hhHHHHHHHHLL-LLEEEElLLLLLL-------lHHHHHHHHHHll


DSSP  HLHHHEEELLLLLLLLLL------lhHHLLlHHHHHHHHHLLL-----LLHHHHHHHHLH
Query HAPERIVWGTNWPHNSVR------etAAYPdDARLAELTLGWL-----PDEAARHRALVE  275
ident     |                                 |   |            | |  
Sbjct IPLARVTLSSDGNGSQPFfddegnltHIGVaGFETLLETVQVLvkdydFSISDALRPLTS  334
DSSP  LLHHHEEEELLLLLEEEEellllleeEEEElLLHHHHHHHHHHhhhhlLLHHHHHHHHLH


DSSP  HHHHHHLLLLL---------------------------------------------
Query NPEALFKLSPV---------------------------------------------  286
ident        |                                                
Sbjct SVAGFLNLTGKgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  HHHHHLLLLLLlllllllllleeeellllleeeeeelleeeeelleelllllllll


No 16: Query=4mupB Sbjct=2vunA Z-score=15.9

back to top
DSSP  --------------------------------------------llllllllllllllLL
Query --------------------------------------------lvrklsgtapnpafPR   16
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LLEELLLLLLLlllllllllllLLLLLlllhHHHHHHHHHHLLLEEEEELLH---HHLL-
Query GAVDTQMHMYLpgypalpggpgLPPGAlpgpEDYRRLMQWLGIDRVIITQGN---AHQR-   72
ident |  ||  |                        |        |    |             
Sbjct GLLDTHVHVSG-------gdyaPRQKT----MDFISSALHGGVTTMISAGSPhfpGRPKd  109
DSSP  LEEEEEELLLL-------lleeHHHLE----ELHHHHHHLLLEEEEEELLLLlllLLLLl


DSSP  ---LLHHHHHHHHHHH------hHEEE-EELLLLLLLHHHHHHHHHLLEEEEEEELlllL
Query ---DNGNTLACVAEMG------eAAHA-VVIIDATTTEKDMEKLTAAGTVGARIMDlpgG  122
ident                          |   ||     || |       |           |
Sbjct aagTKALAITLSKSYYnarpagvKVHGgAVILEKGLTEEDFIEMKKEGVWIVGEVG--lG  167
DSSP  hhhHHHHHHHHHHHHHhllhhhlEEELlEELLLLLLLHHHHHHHHHLLLLEEEEEL--lL


DSSP  LLLH-HHHHHHHHHHHHLLLEEEEELLH------HHHHhhHHHHHLLLlEEEELHHHH--
Query AVNL-SELDAVDERAHAADWMVAVQFDG------NGLLdhLPRLQKIRsRWVFDHHGK--  173
ident             | ||     |     |                 |     |  |     
Sbjct TIKNpEDAAPMVEWAHKHGFKVQMHTGGtsipgsSTVT--ADDVIKTK-PDVVSHINGgp  224
DSSP  LLLLhHHHHHHHHHHHHLLLEEEEELLLllllllLLLL--HHHHHHHL-LLEEELLLLll


DSSP  -LLLLlllllHHHHHH-HHHHhhllEEEEELLhHHLLllllllhHHHHHHHHHHH--HLH
Query -FFKGirtdgPEMAAL-LKLIdrgnLWFKFAGvYESSrkswpyaDVAAFSRVIAA--HAP  229
ident            |                                  |      ||     
Sbjct tAISV-----QEVDRImDETD----FAMEIVQ-CGNP-------KIADYVARRAAekGQL  267
DSSP  lLLLH-----HHHHHHhHHLL----LEEEEEL-LLLH-------HHHHHHHHHHHhhLLH


DSSP  HHEEELLLLLLLLLllhhhlLLHHhHHHHHHLLL-----LLHHHHHHHHLHHHHHHHLLL
Query ERIVWGTNWPHNSVretaayPDDArLAELTLGWL-----PDEAARHRALVENPEALFKLS  284
ident  |   |   |                              |          |  |   | 
Sbjct GRVIFGNDAPSGTG------LIPL-GILRNMCQIasmsdIDPEVAVCMATGNSTAVYGLN  320
DSSP  HHEEEELLLLLLLL------LLLL-HHHHHHHHHhhhllLLHHHHHHHHLHHHHHHHLLL


DSSP  LL----------------------------------------------------------
Query PV----------------------------------------------------------  286
ident                                                             
Sbjct TGviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakr  380
DSSP  LLllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllll


DSSP  -----
Query -----  286
ident      
Sbjct aakil  385
DSSP  lleel


No 17: Query=4mupB Sbjct=1bf6A Z-score=15.8

back to top
DSSP  lllllllllllllllLLLEELLLLLLlllllLLLLL-LLLLllllLLHHHHHHHHHHHL-
Query lvrklsgtapnpafpRGAVDTQMHMYlpgypALPGG-PGLPpgalPGPEDYRRLMQWLG-   58
ident                 |      |                              |  |  
Sbjct -----------sfdpTGYTLAHEHLH---idLSGFKnNVDC--rlDQYAFICQEMNDLMt   44
DSSP  -----------llllLLEEEEEELLL---eeLHHHHlLHHH--eeLLHHHHHHHHHHHHh


DSSP  --LLEEEEELlhhhlLLLHHHHHHHHHHH----hHEEEEELL-----------------L
Query --IDRVIITQgnahqRDNGNTLACVAEMG----eAAHAVVII-----------------D   95
ident      ||        |  |                  |                      
Sbjct rgVRNVIEMT----nRYMGRNAQFMLDVMretgiNVVACTGYyqdaffpehvatrsvqeL  100
DSSP  llEEEEEELL----lHHHLLLHHHHHHHHhhhllEEEEEELLllhhhlllhhhhllhhhH


DSSP  LLLlHHHHHHH---hHLLEEEEE-EELL--lllllLHHHHHHHHHHHHHLLLEEEEELLH
Query ATTtEKDMEKL---tAAGTVGAR-IMDL--pggavNLSELDAVDERAHAADWMVAVQFDG  149
ident |       |               |                |                  
Sbjct AQEmVDEIEQGidgtELKAGIIAeIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF  160
DSSP  HHHhHHHHHLLllllLLLEEEEEeEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH


DSSP  HHHhhhHHHHHLLL------lEEEELHHHHLllllllllhHHHHHHHHHHHLlEEEEELL
Query NGLldhLPRLQKIR------sRWVFDHHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAG  203
ident       |  |           |    |                  || || |     |  
Sbjct STM--gLEQLALLQahgvdlsRVTVGHCDLK--------dNLDNILKMIDLG-AYVQFDT  209
DSSP  HLL--hHHHHHHHHhllllhhHEEELLLLLL--------lLHHHHHHHHHLL-LEEEELL


DSSP  HHHLLLlllLLHHHHHHHHHHHH-HLHHHEEELLLLlLLLL-llHHHLLLHHhHHHH-HH
Query VYESSRkswPYADVAAFSRVIAA-HAPERIVWGTNWpHNSV-reTAAYPDDArLAEL-TL  260
ident     |    |     |            |                               
Sbjct IGKNSY--yPDEKRIAMLHALRDrGLLNRVMLSMDI-TRRShlkANGGYGYD-YLLTtFI  265
DSSP  LLLLLL--lLHHHHHHHHHHHHHlLLHHHEEELLLL-LLHHhlhHHLLLLLL-HHHHlHH


DSSP  LLL----LLHHHHHHHHLHHHHHHHLllll
Query GWL----PDEAARHRALVENPEALFKlspv  286
ident   |       |     | |||   |     
Sbjct PQLrqsgFSQADVDVMLRENPSQFFQ----  291
DSSP  HHHhhllLLHHHHHHHHLHHHHHHLL----


No 18: Query=4mupB Sbjct=2ogjA Z-score=15.7

back to top
DSSP  ----------------------------------------llllllllllllllLLLLEE
Query ----------------------------------------lvrklsgtapnpafPRGAVD   20
ident                                                         | ||
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE


DSSP  LLLLLLLlLLLLllllllllllllLLHHHHhhhHHHHLLLEEEEELLhhhlLLLHHHH-H
Query TQMHMYLpGYPAlpggpglppgalPGPEDYrrlMQWLGIDRVIITQGnahqRDNGNTL-A   79
ident    |    |                 |          |                      
Sbjct LHVHIWH-GGTD----------isIRPSEC---GAERGVTTLVDAGS-ageANFHGFReY  105
DSSP  EEELLLL-LLLL----------llLLHHHL---LHHHLEEEEEEELL-lllLLHHHHHhH


DSSP  HHHHHHHHEEEEELLL------------------LLLL--HHHHHHHHhLLEEEEEEELL
Query CVAEMGEAAHAVVIID------------------ATTT--EKDMEKLTaAGTVGARIMDL  119
ident       |   |                                         ||      
Sbjct IIEPSRERIKAFLNLGsiglvacnrvpelrdikdIDLDriLECYAENS-EHIVGLXVRAS  164
DSSP  LLLLLLLEEEEEEELLlllllllllllllllhhhLLHHhhHHHHHLLL-LLEEEEEEEEL


DSSP  LLL--lllHHHHHHHHHHHHHLLLEEEEELLhhhhhHHHHHHHLLLLEEEELHHHHLLL-
Query PGG--avnLSELDAVDERAHAADWMVAVQFDgngllDHLPRLQKIRSRWVFDHHGKFFK-  176
ident                   |        |             |       |  |       
Sbjct HVItgswgVTPVKLGKKIAKILKVPXXVHVG-eppaLYDEVLEILGPGDVVTHCFNGKSg  223
DSSP  HHHhllllLHHHHHHHHHHHHHLLLEEEEEL-llllLHHHHHHHLLLLLEEELLLLLLLl


DSSP  --LLLLlLHHHHHHHHHHhhlLEEEEELL-hHHLLlllllLHHHHHHH-HHHHhhlhhhE
Query --GIRTdGPEMAALLKLIdrgNLWFKFAG-vYESSrkswpYADVAAFS-RVIAahaperI  232
ident                                   |          |   |          
Sbjct ssIXED-EDLFNLAERCE---GIRLDIGHggASFS-----FKVAEAAIaRGLL-----pF  269
DSSP  llLLLL-HHHHHHHHHLL---LLEEELLLllLLLL-----HHHHHHHHhLLLL-----lL


DSSP  EELLLLL--LLLLllhhhLLLH-HHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL---
Query VWGTNWP--HNSVretaaYPDD-ARLAELTLGWLPDEAARHRALVENPEALFKLSPV---  286
ident    |                 | |      |           |   ||     |      
Sbjct SISTDLHghSXNF-----PVWDlATTXSKLLSVDXPFENVVEAVTRNPASVIRLDXEnrl  324
DSSP  LLLLLLLllLLLL-----LLLLhHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLLLlll


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  286
ident                                                        
Sbjct dvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  lllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 19: Query=4mupB Sbjct=2pajA Z-score=15.7

back to top
DSSP  ---------------------------------------------llllllllllllllL
Query ---------------------------------------------lvrklsgtapnpafP   15
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLLEELLLLLL-----------lLLLLlllllllllllllLLHHHHHHHHHHHLLLEEEE
Query RGAVDTQMHMY-----------lPGYPalpggpglppgalPGPEDYRRLMQWLGIDRVII   64
ident    | |  |                                            |   |  
Sbjct PAWVNTHHHLFqsllkgepfralFDER----------rfrLAARIGLIELARSGCATVAD  110
DSSP  ELEELLLLLHHhhhllllllhhhLLHH----------hhhHHHHHHHHHHHLLLEEEEEE


DSSP  ELLhhHLLL---lHHHHHHHHHHH---HHEEEEEL------------------llLLLLH
Query TQGnaHQRD---nGNTLACVAEMG---EAAHAVVI------------------idATTTE  100
ident                      |                                      
Sbjct HNY--VYYPgmpfDSSAILFEEAEklgLRFVLLRGgatqtrqleadlptalrpetLDAYV  168
DSSP  LLL--LLLLllllLHHHHHHHHHHhllLEEEEEELlllllllllllllhhhllllHHHHH


DSSP  HHHHHHHHL---------LEEEEEE-ELLLlllLLHH-HHHHHHHHHHHLLLEEEEELLh
Query KDMEKLTAA---------GTVGARI-MDLPggaVNLS-ELDAVDERAHAADWMVAVQFDg  149
ident  | | | |            |       |         |       |             
Sbjct ADIERLAARyhdaspramRRVVMAPtTVLY---SISPrEMRETAAVARRLGLRMHSHLS-  224
DSSP  HHHHHHHHHlllllllllEEEEELLlLLLL---LLLHhHHHHHHHHHHHLLLEEEEELL-


DSSP  hhhHHHHHHHHLLL---lEEEELhHHHLllllllllhHHHHHHHHHHHLlEEEEEL--LH
Query nglLDHLPRLQKIR---sRWVFDhHGKFfkgirtdgpEMAALLKLIDRGnLWFKFA--GV  204
ident                         |                   |   |           
Sbjct --gKSPVAFCGEHDwlgsDVWYA-HLVK--------vDADEIALLAQTG-TGVAHCpqSN  272
DSSP  --lLLHHHHHHHLLllllLEEEE-LLLL--------lLHHHHHHHHHHL-LEEEELhhHH


DSSP  HHLlllllllhhhhhHHHHHHHHLhhHEEELLLLLLLllllhhhLLLH--HHHHHHHHLL
Query YESsrkswpyadvaaFSRVIAAHApeRIVWGTNWPHNsvretaaYPDD--ARLAELTLGW  262
ident                  |  |         |                         |   
Sbjct GRL------------PVREMADAG-vPVSIGVDGAAS-------NEAAdmISEVHMTWLA  312
DSSP  HLL------------LLLLHHHHL-lLEEELLLHHHH-------LLLLlhHHHHHHHHHH


DSSP  L----LLHHHHHHHHLHHHHHHHLLLLL--------------------------------
Query L----PDEAARHRALVENPEALFKLSPV--------------------------------  286
ident         |               |  |                                
Sbjct QrarlASIAEVIHWGTAGGARVMGLDEVgkvavgyaadiavyrlddpryfglhdpaigpv  372
DSSP  HhhllLLHHHHHHHHLHHHHHHHLLLLLlllllllllleeeeelllhhhlllllhhhhhh


DSSP  -------------------------------------------------
Query -------------------------------------------------  286
ident                                                  
Sbjct asggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  hllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 20: Query=4mupB Sbjct=2oofA Z-score=15.5

back to top
DSSP  ----------------------------------------------llllllllllllll
Query ----------------------------------------------lvrklsgtapnpaf   14
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLLEELLLL-LLLL----------------llllllllLLLL---------lllllLHH
Query PRGAVDTQMH-MYLP----------------gypalpggPGLP---------pgalpGPE   48
ident   |  |   |                                                  
Sbjct TPGLIDCHTHlIFAGsraeefelrqkgvpyaeiarkgggIISTvratraasedqlfeLAL  120
DSSP  EELEEEEEELlLLLLllhhhhhhhhhlllhhhhhhllllHHHHhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHHLLLEEEEELLhHHLL--LLHHHHHHHHHHHH----HEEEEEL---------
Query DYRRLMQWLGIDRVIITQGnAHQR--DNGNTLACVAEMGE----AAHAVVI---------   93
ident          |   | |  |       |    |      ||                    
Sbjct PRVKSLIREGVTTVEIKSG-YGLTleDELKXLRVARRLGEalpiRVKTTLLaahavppey  179
DSSP  HHHHHHHHHLEEEEEEELL-LLLLhhHHHHHHHHHHHHHHhlllEEEEEEEeellllhhh


DSSP  ---------lLLLL-lHHHHHHHHhllEEEEEEELLLLLlLLHHHHHHHHHHHHHLLLEE
Query ---------iDATT-tEKDMEKLTaagTVGARIMDLPGGaVNLSELDAVDERAHAADWMV  143
ident                     |                 |   |     |   |      |
Sbjct rddpdswvetICQEiiPAAAEAGL---ADAVDVFCEHIG-FSLAQTEQVYLAADQYGLAV  235
DSSP  lllhhhhhhhHHHLhhHHHHHLLL---LLEEEEEELLLL-LLHHHHHHHHHHHHHLLLEE


DSSP  EEELL--HHHHhhhhhHHHLLlLEEEELhHHHLllllllllhhHHHHHHHHHHLLEEEEE
Query AVQFD--GNGLldhlpRLQKIrSRWVFDhHGKFfkgirtdgpeMAALLKLIDRGNLWFKF  201
ident     |   |                  | |                              
Sbjct KGHXDqlSNLG--gstLAANF-GALSVD-HLEY---------lDPEGIQALAHRGVVATL  282
DSSP  EEEELllLLLL--hhhHHHHL-LLLEEE-ELLL---------lLHHHHHHHHHHLLEEEE


DSSP  L--LHHHLLlllllLHHHhhHHHHHHHHLhhHEEELLLLLLLLlllhhhLLLH-HHHHHH
Query A--GVYESSrkswpYADVaaFSRVIAAHApeRIVWGTNWPHNSvretaaYPDD-ARLAEL  258
ident      |                                                      
Sbjct LptAFYFLK-----ETKL-pPVVALRKAG-vPXAVSSDINPGT-----aPIVSlRXAXNX  330
DSSP  LhhHHHHLL-----LLLL-lLHHHHHHLL-lLEEELLLLLLLL-----lLLLLhHHHHHH


DSSP  HHL-LLLLHHHHHHHHLHHHHHHHL-LLLL------------------------------
Query TLG-WLPDEAARHRALVENPEALFK-LSPV------------------------------  286
ident                                                             
Sbjct ACTlFGLTPVEAXAGVTRHAARALGeQEQLgqlrvgxladflvwncghpaelsyligvdq  390
DSSP  HHHhHLLLHHHHHHHLLHHHHHHLLlLLLLlllllllllleeeellllllhhhhllllll


DSSP  -------------
Query -------------  286
ident              
Sbjct lvsrvvngeetlh  403
DSSP  eeeeeelleelll


No 21: Query=4mupB Sbjct=3k2gB Z-score=15.4

back to top
DSSP  -----------llllllllllllllllLLEELLLLLLlllllLLLLLL------------
Query -----------lvrklsgtapnpafprGAVDTQMHMYlpgypALPGGP------------   37
ident                            |      |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQ----nDCRCWWnppqeperqyla   56
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL----eELHHHLlllllhhhhhhh


DSSP  ----------------------LLLLLLLLLHHHHHHHHHhHLLLEEEEELlhhhLLLLH
Query ----------------------GLPPGALPGPEDYRRLMQwLGIDRVIITQgnahQRDNG   75
ident                                           |                 
Sbjct eapisieilselrqdpfvnkhnIALDDLDLAIAEVKQFAA-VGGRSIVDPT--crGIGRD  113
DSSP  hllllhhhhhhhhllhhhllllLEELLHHHHHHHHHHHHH-LLLLEEEELL--llLLLLL


DSSP  hhHHHHHHHH----hHEEEEEL-----------------lLLLLlHHHHHHHH---HLLE
Query ntLACVAEMG----eAAHAVVI-----------------iDATTtEKDMEKLT---AAGT  111
ident                                          |          |    |  
Sbjct --PVKLRRISaetgvQVVXGAGyylassxpetaarlsaddIADEiVAEALEGTdgtDARI  171
DSSP  --HHHHHHHHhhhllEEEELLLlllhhhllhhhhlllhhhHHHHhHHHHHLLLlllLLLL


DSSP  EEEE-EELL-lllllLHHHHHHHHHHHHHLLLEEEEELLHHHHhHHHHHHHLLL------
Query VGAR-IMDL-pggavNLSELDAVDERAHAADWMVAVQFDGNGLlDHLPRLQKIR------  163
ident      |             |               |   |         |          
Sbjct GLIGeIGVSsdftaeEEKSLRGAARAQVRTGLPLXVHLPGWFR-LAHRVLDLVEeegadl  230
DSSP  LLEEeELLLllllhhHHHHHHHHHHHHHHHLLLEEELLLLLLL-LHHHHHHHHHhllllh


DSSP  lEEEELHHHHLllllllllhHHHHHHHHHHHLlEEEEELLHHHL------lllllLLHHH
Query sRWVFDHHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAGVYES------srkswPYADV  217
ident    |  |                    |  ||     |                     |
Sbjct rHTVLCHXNPS-------hxDPVYQATLAQRG-AFLEFDXIGXDffyadqgvqcpSDDEV  282
DSSP  hHEEELLLHHH-------llLHHHHHHHHHHL-LEEEELLLLLLleelllleellLHHHH


DSSP  HHHHHHHHH-HLHHHEEELLLLlLLLL-llHHHLL---LHHHHHHHHHL-llLLHHHHHH
Query AAFSRVIAA-HAPERIVWGTNWpHNSV-reTAAYP---DDARLAELTLG-wlPDEAARHR  271
ident |      |      ||                               |     | ||   
Sbjct ARAILGLADhGYLDRILLSHDV-FVKXxltRYGGNgyaFVTKHFLPRLRrhgLDDAALET  341
DSSP  HHHHHHHHHlLLHHHEEELLLL-LLHHhlhHHLLLlllHHHHLHHHHHHhllLLHHHHHH


DSSP  HHLHHHHHHHL--llll
Query ALVENPEALFK--lspv  286
ident   | ||   |       
Sbjct LXVTNPRRVFDasiegh  358
DSSP  HHLHHHHHHHLllllll


No 22: Query=4mupB Sbjct=3pnuA Z-score=15.2

back to top
DSSP  lllllllllllLLLLlLLEELLLLLLLLlllllllllllllllLLLHHHHHHHHHhhLLL
Query lvrklsgtapnPAFPrGAVDTQMHMYLPgypalpggpglppgaLPGPEDYRRLMQwlGID   60
ident                    |   |                                    
Sbjct --enlyfqsnaMKLK-NPLDMHLHLRDN---------------QMLELIAPLSAR--DFC   40
DSSP  --lllllllllEEEE-LLEEEEELLLLH---------------HHHHHHHHHHHL--LLL


DSSP  EEEEELLHHHLLLL-HHHHHHHHHHH-------hHEEEEELLLLlLLHHHHHHHHHLlEE
Query RVIITQGNAHQRDN-GNTLACVAEMG-------eAAHAVVIIDAtTTEKDMEKLTAAgTV  112
ident    |         |     |                           ||           
Sbjct AAVIMPNLIPPLCNlEDLKAYKMRILkackdenfTPLMTLFFKN-YDEKFLYSAKDE-IF   98
DSSP  EEEELLLLLLLLLLhHHHHHHHHHHHhhhlllllEEEEEEELLL-LLHHHHHHHLLL-LL


DSSP  EEEEEL---LLLL-LLLHHH----hHHHHHHHHHLLLEEEEELL-----hHHHHHHHHHH
Query GARIMD---LPGG-AVNLSE----lDAVDERAHAADWMVAVQFD-----gNGLLDHLPRL  159
ident |                 |          |          |                   
Sbjct GIXLYPagiTTNSnGGVSSFdieylKPTLEAMSDLNIPLLVHGEtndfvmDRESNFAKIY  158
DSSP  EEEELLlllLLLLlLLLLLLlhhhhHHHHHHHHHLLLLEEELLLllllhhHLLHHHHHHH


DSSP  HLL-----LLEEEELHHHhlllllllllhhhHHHHHHHH-HLLEEEEELLHHhlLLLLL-
Query QKI-----RSRWVFDHHGkffkgirtdgpemAALLKLID-RGNLWFKFAGVYesSRKSW-  212
ident  |      |   |  |                 |  |     ||                
Sbjct EKLakhfpRLKIVMEHIT------------tKTLCELLKdYENLYATITLHHliITLDDv  206
DSSP  HHHhhhllLLLEEELLLL------------lHHHHHHHHhLLLEEEEELLHHhlLLHHHh


DSSP  ---------------llHHHHHHHHHHHHHLHHHEEELLLLLLllLLLHH--hlLLHHHH
Query ---------------pyADVAAFSRVIAAHAPERIVWGTNWPHnsVRETA--ayPDDARL  255
ident                            |    |    |                      
Sbjct iggkmnphlfckpiakrYEDKEALCELAFSGYEKVMFGSDSAP--HPKGCaagvFSAPVI  264
DSSP  hlllllhhhllllllllHHHHHHHHHHHHLLLLLEEELLLLLL--LLLLLllllLLHHHH


DSSP  HHHHHLLL---LLHHHHHHHHLHHHHHHhLLLLL--------------------------
Query AELTLGWL---PDEAARHRALVENPEALfKLSPV--------------------------  286
ident              |      |  |                                    
Sbjct LPVLAELFkqnSSEENLQKFLSDNTCKI-YDLKFkedkiltleekewqvpnvyedkynqv  323
DSSP  HHHHHHHHhhhLLHHHHHHHHLHHHHHH-HLLLLlllleeeeellleelllleellllee


DSSP  ---------------
Query ---------------  286
ident                
Sbjct vpymageilkfqlkh  338
DSSP  llllllleelleell


No 23: Query=4mupB Sbjct=4b3zD Z-score=15.1

back to top
DSSP  --------------------------------------lllllllllllLLLLLlLEELL
Query --------------------------------------lvrklsgtapnPAFPRgAVDTQ   22
ident                                                     |    |  
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrMVIPG-GIDVN   59
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeellllEEEEL-EEEEE


DSSP  LLLLlllllllllllllLLLLlLLHHHHHHHHHHHLLLEEEEELlhHHLL---LLHHHHH
Query MHMYlpgypalpggpglPPGAlPGPEDYRRLMQWLGIDRVIITQgnAHQR---DNGNTLA   79
ident                     |        |     |    |                   
Sbjct TYLQ-------------KTAA-DDFFQGTRAALVGGTTMIIDHV--VPEPgssLLTSFEK  103
DSSP  ELLL-------------LLLL-LLHHHHHHHHHHLLEEEEEEEE--LLLLlllHHHHHHH


DSSP  HHHHHH----hHEEEEELL--LLLLLHHHHHHHHH-LLEEEEEEELLLLllLLHH--HHH
Query CVAEMG----eAAHAVVII--DATTTEKDMEKLTA-AGTVGARIMDLPGgaVNLS--ELD  130
ident                 | |           | |    |                |   | 
Sbjct WHEAADtksccDYSLHVDItsWYDGVREELEVLVQdKGVNSFQVYMAYKdvYQMSdsQLY  163
DSSP  HHHHHHlllllEEEEEEELllLLLLHHHHHHHHHHlLLLLEEEEELLLLllLLLLhhHHH


DSSP  HHHHHHHHLLLEEEEELL----------------------------HHHHHHH-HHHHHL
Query AVDERAHAADWMVAVQFD----------------------------GNGLLDH-LPRLQK  161
ident               |                                             
Sbjct EAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpEELEAEAvFRAITI  223
DSSP  HHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllHHHHHHHhHHHHHH


DSSP  L---LLEEEELHhHHLLlllllllhHHHHHHHHHH-HLLEEEE-ELLH------------
Query I---RSRWVFDHhGKFFkgirtdgpEMAALLKLID-RGNLWFK-FAGV------------  204
ident                                              |              
Sbjct AgriNCPVYITK-VMSK-------sAADIIALARKkGPLVFGEpIAASlgtdgthywskn  275
DSSP  HhhhLLLEEEEE-ELLH-------hHHHHHHHHHHhLLLEEEEeLHHHhhlllhhhhlll


DSSP  ----------hHLLLLllllHHHHHHHHHHHHHLhhHEEELLLLLLllLLLHHH------
Query ----------yESSRKswpyADVAAFSRVIAAHApeRIVWGTNWPHnsVRETAA------  248
ident              |                 |      | |                   
Sbjct wakaaafvtspPLSPD----PTTPDYLTSLLACG-dLQVTGSGHCP--YSTAQKavgkdn  328
DSSP  hhhhhhlllllLLLLL----LLHHHHHHHHHHHL-lLLLLLLLLLL--LLHHHHhhhlll


DSSP  -------lllHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHLLLLL----------
Query -------ypdDARLAELTLGWL-----PDEAARHRALVENPEALFKLSPV----------  286
ident                             ||         |    | | |           
Sbjct ftlipegvngIEERMTVVWDKAvatgkMDENQFVAVTSTNAAKIFNLYPRkgriavgsda  388
DSSP  hhhlllllllLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHHLLLLLllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct dvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgr  448
DSSP  leeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllll


DSSP  -----------------------------
Query -----------------------------  286
ident                              
Sbjct fiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  llllllllhhhhhhhhhhhhhllllllll


No 24: Query=4mupB Sbjct=3griA Z-score=15.0

back to top
DSSP  ------------------------------------llllllllllllllLLLLEELLLL
Query ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
ident                                                     | ||   |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  -LLLLllllllllllllllLLLLHHHHHHHHHHHLLLEEEEELLHHHL-LLLHHHHHHHH
Query -MYLPgypalpggpglppgALPGPEDYRRLMQWLGIDRVIITQGNAHQ-RDNGNTLACVA   82
ident                         |         |   |                 |   
Sbjct lREPG------------geYKETIETGTKAAARGGFTTVCPXPNTRPVpDSVEHFEALQK  108
DSSP  lLLLL------------llLLLLHHHHHHHHHHLLEEEEEELLLLLLLlLLHHHHHHHHH


DSSP  HHH----hHEEEEELLL------LLLLhhhHHHHHHLLEEEEEEEllllLLLLHH--HHH
Query EMG----eAAHAVVIID------ATTTekdMEKLTAAGTVGARIMdlpgGAVNLS--ELD  130
ident                |                 |   |           |          
Sbjct LIDdnaqvRVLPYASITtrqlgkELVD---FPALVKEGAFAFTDD----GVGVQTasXXY  161
DSSP  HHHhhlllEELLLEELLhhhlllLLLL---HHHHHLLLLLLEEEL----LLLLLLhhHHH


DSSP  HHHHHHHHLLLEEEEELL--------------------------hHHHHhHHHHHHLL--
Query AVDERAHAADWMVAVQFD--------------------------gNGLLdHLPRLQKI--  162
ident      |                                                      
Sbjct EGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipniCESVqIARDVLLAea  221
DSSP  HHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhHHHHhHHHHHHHHhh


DSSP  -LLEEEELHHHhlllllllllHHHHHHHHHHH-HLLEEEEELLH----------------
Query -RSRWVFDHHGkffkgirtdgPEMAALLKLID-RGNLWFKFAGV----------------  204
ident         |                                                   
Sbjct aGCHYHVCHVS--------tkESVRVIRDAKRaGIHVTAEVTPHhlllteddipgnnaiy  273
DSSP  hLLLEEELLLL--------lhHHHHHHHHHHHlLLLEEEEELHHhhhllhhhlllllhhh


DSSP  --hHLLLLllllHHHHHHHHHHHHHLhhhEEELLLLLLL-llLLHH------hLLLH-HH
Query --yESSRKswpyADVAAFSRVIAAHAperIVWGTNWPHN-svRETA------aYPDD-AR  254
ident       |                          |                          
Sbjct kxnPPLRS----TEDREALLEGLLDG-tiDCIATDHAPHardEKAQpxekapfGIVGsET  328
DSSP  lllLLLLL----HHHHHHHHHHHHLL-llLEELLLLLLLlhhHHLLlllllllLLLLlLL


DSSP  HHHHHHL-----llLLHHHHHHHHLHHHHHHHLLLLL-----------------------
Query LAELTLG-----wlPDEAARHRALVENPEALFKLSPV-----------------------  286
ident    |                   |   |   | |                          
Sbjct AFPLLYThfvkngdWTLQQLVDYLTIKPCETFNLEYGtlkengyadltiidldseqeikg  388
DSSP  HHHHHHHhhlllllLLHHHHHHHHLHHHHHHLLLLLLllllllllleeeeelllleellh


DSSP  ----------------------------------
Query ----------------------------------  286
ident                                   
Sbjct edflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  hhllllllllllllleelleeeeeeelleeeeel


No 25: Query=4mupB Sbjct=3ls9A Z-score=14.9

back to top
DSSP  -----------------------------------------llllllllllllllLLLLE
Query -----------------------------------------lvrklsgtapnpafPRGAV   19
ident                                                          |  
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  ELLLLLL-------------lllllllllLLLL----------lllllLLHHHHHHHHHH
Query DTQMHMY-------------lpgypalpgGPGL----------ppgalPGPEDYRRLMQW   56
ident     | |                                                     
Sbjct NSHQHLYegamraipqlervtmaswlegvLTRSagwwrdgkfgpdvirEVARAVLLESLL  120
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhHHHHhhhhhlllllhhhhhHHHHHHHHHHHH


DSSP  HLLLEEEEELlHHHL--lllHHHHHHHHHHH---HHEEEEEL------------------
Query LGIDRVIITQgNAHQ--rdnGNTLACVAEMG---EAAHAVVI------------------   93
ident  ||  |                  |            ||                     
Sbjct GGITTVADQH-LFFPgatadSYIDATIEAATdlgIRFHAARSsmtlgkseggfcddlfve  179
DSSP  LLEEEEEEEE-LLLLlllllLHHHHHHHHHHhhlLEEEEEELlllllhhhlllllhhhll


DSSP  ---lLLLLLHHHHHHHHH-----lLEEEEEEELLLlllLLHH-HHHHHHHHHHHLLLEEE
Query ---iDATTTEKDMEKLTA-----aGTVGARIMDLPggaVNLS-ELDAVDERAHAADWMVA  144
ident                                   |           |    |   |    
Sbjct pvdrVVQHCLGLIDQYHEpepfgmVRIALGPCGVP---YDKPeLFEAFAQMAADYDVRLH  236
DSSP  lhhhHHHHHHHHHHHHLLllllllEEEEELLLLLL---LLLHhHHHHHHHHHHHHLLEEE


DSSP  EEL-LHHHH--------hHHHHHHHLLLL---EEEELhHHHLllllllllhHHHHHHHHH
Query VQF-DGNGL--------lDHLPRLQKIRS---RWVFDhHGKFfkgirtdgpEMAALLKLI  192
ident   |                    | |      |     |                     
Sbjct THFyEPLDAgmsdhlygmTPWRFLEKHGWasdRVWLA-HAVV--------pPREEIPEFA  287
DSSP  EEElLLLHHhhhhhhhllLHHHHHHHLLLlllLEEEE-ELLL--------lLHHHHHHHH


DSSP  HHLlEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLhhHEEELLLLLLLLLllhhhll
Query DRGnLWFKFA--GVYESSrkswpyadVAAFSRVIAAHApeRIVWGTNWPHNSVretaayp  250
ident | |                         |  |            ||              
Sbjct DAG-VAIAHLiaPDLRMG-------wGLAPIREYLDAG-iTVGFGTTGSASND-----gg  333
DSSP  HHL-LEEEELhhHHHHLL-------lLLLLHHHHHHLL-lEEEELLLLLLLLL-----ll


DSSP  lhHHHHHHHHL-----------llLLHHHHHHHHLHHHHHHHLLLLL-------------
Query ddARLAELTLG-----------wlPDEAARHRALVENPEALFKLSPV-------------  286
ident        |                       |                            
Sbjct nlLGDLRLAALahrpadpnepekwLSARELLRMATRGSAECLGRPDLgvleegraadiac  393
DSSP  lhHHHHHHHHHhlhhhllllhhhlLLHHHHHHHLLHHHHHHLLLLLLlllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct wrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  eelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 26: Query=4mupB Sbjct=1k6wA Z-score=14.8

back to top
DSSP  ------------------------------------llllllllllllllLLLLEELLLL
Query ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
ident                                                       |    |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  LL----------------------------lLLLLllllllllllllLLLHhHHHHHHHH
Query MY----------------------------lPGYPalpggpglppgaLPGPeDYRRLMQW   56
ident                                                             
Sbjct LDttqtagqpnwnqsgtlfegierwaerkalLTHD---------dvkQRAW-QTLKWQIA  110
DSSP  LLlllllllllllllllhhhhhhhhhllhhhLLHH---------hhhHHHH-HHHHHHHH


DSSP  HLLLEEEEELlhhHLLL-----LHHHHHHHHHHH--HHEEEEEL---------lLLLLlH
Query LGIDRVIITQgnaHQRD-----NGNTLACVAEMG--EAAHAVVI---------iDATTtE  100
ident  ||  |          |         |    |         |                 |
Sbjct NGIQHVRTHV---DVSDatltaLKAMLEVKQEVApwIDLQIVAFpqegilsypnGEALlE  167
DSSP  LLEEEEEEEE---ELLLlllhhHHHHHHHHHHHLllLEEEEEEEllllllllllHHHHhH


DSSP  HHHHHHhhllEEEEEEELLL--llllLHHHHHHHHHHHHHLLLEEEE-ELLH--HHHHhh
Query KDMEKLtaagTVGARIMDLP--ggavNLSELDAVDERAHAADWMVAV-QFDG--NGLLdh  155
ident                               |      |   |    |             
Sbjct EALRLG----ADVVGAIPHFeftreyGVESLHKTFALAQKYDRLIDVhCDEIddEQSRfv  223
DSSP  HHHHLL----LLEEEELHHHlllhhhHHHHHHHHHHHHHHHLLEEEEeELLLllLLLLhh


DSSP  HHHHHLL-----llEEEELHhHHLLLLLLllLHHHHHHHHHHHHLLEEEEEL--LHHHLL
Query LPRLQKI-----rsRWVFDHhGKFFKGIRtdGPEMAALLKLIDRGNLWFKFA--GVYESS  208
ident               |    |           |     |  |       |           
Sbjct ETVAALAhhegmgaRVTASH-TTAMHSYN--GAYTSRLFRLLKMSGINFVANplVNIHLQ  280
DSSP  HHHHHHHhhhllhhHEEEEE-LHHHHHLL--HHHHHHHHHHHHHHLLEEEELhhHHHHHL


DSSP  LLLL--llHHHHhHHHHHHHHLhhHEEELLLLLLLLLllhhhLLLH---HHHHHHHHLL-
Query RKSW--pyADVAaFSRVIAAHApeRIVWGTNWPHNSVretaaYPDD---ARLAELTLGW-  262
ident                             |                           |   
Sbjct GRFDtypkRRGItRVKEMLESG-iNVCFGHDDVFDPW----yPLGTanmLQVLHMGLHVc  335
DSSP  LLLLllllLLLLlLHHHHHHLL-lLEEELLLLLLLLL----lLLLLllhHHHHHHHHHHl


DSSP  -----lLLHHhHHHHHLHHHHHHHLLLLL-------------------------------
Query -----lPDEAaRHRALVENPEALFKLSPV-------------------------------  286
ident                          |                                  
Sbjct qlmgygQIND-GLNLITHHSARTLNLQDYgiaagnsanliilpaengfdalrrqvpvrys  394
DSSP  llllhhHHHH-HHHHHLHHHHHHLLLLLLllllllllleeeellllhhhhhhhlllllee


DSSP  -----------------------------
Query -----------------------------  286
ident                              
Sbjct vrggkviastqpaqttvyleqpeaidykr  423
DSSP  eelleeeeellllleeeellleeeellll


No 27: Query=4mupB Sbjct=1yrrB Z-score=14.8

back to top
DSSP  ------------------------------------llllllllllllllLLLLEELLLL
Query ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
ident                                                     |  | |  
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  -----LLLLLLLlllllllllllllLLHHHHHHHHHHHLLLEEEEELLhhHLLL--LHHH
Query -----MYLPGYPalpggpglppgalPGPEDYRRLMQWLGIDRVIITQGnaHQRD--NGNT   77
ident                             |         |      |       |      
Sbjct gcggvQFNDTAE---------avsvETLEIMQKANEKSGCTNYLPTLI--TTSDelMKQG  109
DSSP  eelleELLLLLL---------lllhHHHHHHHHHHHLLLEEEEEEEEL--LLLHhhHHHH


DSSP  HHHHHH----HHHH-EEEEE---lllLLLLHhHHHHHHhLLEEEEEEEllllllllHHHH
Query LACVAE----MGEA-AHAVV---iidATTTEkDMEKLTaAGTVGARIMdlpggavnLSEL  129
ident      |                    |                                 
Sbjct VRVMREylakHPNQaLGLHLegpwlnAALVD-FLCENA-DVITKVTLA-------pEMVP  160
DSSP  HHHHHHhhhhLLLLlLLEEEelllllLHHHH-HHHHLH-HHEEEEEEL-------hHHLL


DSSP  HHHHHHHHHLLLEEEEELLhhhhhhHHHHHHLL--LLEEEELHHHHllLLLLlLLHH--h
Query DAVDERAHAADWMVAVQFDgnglldHLPRLQKI--RSRWVFDHHGKffKGIRtDGPE--m  185
ident   |      |   |            |               |       |         
Sbjct AEVISKLANAGIVVSAGHS----naTLKEAKAGfrAGITFATHLYNamPYIT-GREPgla  215
DSSP  HHHHHHHHHHLLEEEELLL----llLHHHHHHHhhHLEEEELLLLLllLLLL-LLLLhhh


DSSP  HHHHHHHhhlLEEEEEL-lHHHLlllllllhhHHHHHHHHHHHLHHHEEELLLLLlllll
Query AALLKLIdrgNLWFKFA-gVYESsrkswpyadVAAFSRVIAAHAPERIVWGTNWPhnsvr  244
ident  | |                              |  |             |        
Sbjct GAILDEA---DIYCGIIadGLHV---------DYANIRNAKRLKGDKLCLVTDAT-----  258
DSSP  HHHHHLL---LLEEEEEllLLLL---------LHHHHHHHHHHHHHHEEEELLLL-----


DSSP  lhhHLLLHH-hHHHHHHL--LLLLHHHHHHHHLHHHHHHHLLLLL---------------
Query etaAYPDDA-rLAELTLG--WLPDEAARHRALVENPEALFKLSPV---------------  286
ident                 |            |     |                        
Sbjct ---SGSSLTmiEGVRNLVehCGIALDEVLRMATLYPARAIGVEKRlgtlaagkvanltaf  315
DSSP  ---LLLLLLhhHHHHHHHhhHLLLHHHHHHHHLHHHHHHLLLLLLllllllllllleeee


DSSP  -------------------
Query -------------------  286
ident                    
Sbjct tpdfkitktivngnevvtq  334
DSSP  llllleeeeeelleeeeel


No 28: Query=4mupB Sbjct=1itqA Z-score=14.8

back to top
DSSP  llllllllllLLLL-LLLLEELLLLLL-----lLLLLllllllllllLLLLlhhHHHHHH
Query lvrklsgtapNPAF-PRGAVDTQMHMY-----lPGYPalpggpglppGALPgpeDYRRLM   54
ident                     |                           |           
Sbjct ---dffrdeaERIMrDSPVIDGHNDLPwqlldmFNNRlqderanlttLAGT--hTNIPKL   55
DSSP  ---lhhhhhhHHHHlLLLEEEEEELHHhhhhhhHLLLlllhhhllllLLLL--lLLHHHH


DSSP  HHHLLLEEEEELLHH-------hllLLHHHHHHHHH--------HHHH------------
Query QWLGIDRVIITQGNA-------hqrDNGNTLACVAE--------MGEA------------   87
ident                                  |                          
Sbjct RAGFVGGQFWSVYTPcdtqnkdavrRTLEQMDVVHRmcrmypetFLYVtssagirqafre  115
DSSP  HHLLEEEEEEEELLLhhhllllhhhHHHHHHHHHHHhhhhllllEEELllhhhhhhhhhl


DSSP  ----EEEEE----LLLLLLLhhHHHHHHHLLEEEEEEELLLllllLHHH-----------
Query ----AHAVV----IIDATTTekDMEKLTAAGTVGARIMDLPggavNLSE-----------  128
ident         |     ||          |   |              |              
Sbjct gkvaSLIGVegghSIDSSLG--VLRALYQLGMRYLTLTHSC----NTPWadnwlvdtgds  169
DSSP  lleeEEEEEelhhHLLLLHH--HHHHHHHLLEEEEELLLLL----LLLLlllhhhlllll


DSSP  ----------HHHHHHHHHHLLLEEEEELlhhhHHHH-HHHHHLLLLEEEE-LHHH-hLL
Query ----------LDAVDERAHAADWMVAVQFdgngLLDH-LPRLQKIRSRWVF-DHHG-kFF  175
ident              |                           ||  |    |         
Sbjct epqsqglspfGQRVVKELNRLGVLIDLAH---vSVATmKATLQLSRAPVIFsHSSAysVC  226
DSSP  llllllllhhHHHHHHHHHHHLLEEELLL---lLHHHhHHHHHHLLLLLEElLLLLllLL


DSSP  LLlllllhhHHHHHHHHHHLLEEEEELLHH-HLLLL-LLLLHHHHHHHHHHHHH-LHHHE
Query KGirtdgpeMAALLKLIDRGNLWFKFAGVY-ESSRK-SWPYADVAAFSRVIAAH-APERI  232
ident              | |                 |         ||     |         
Sbjct AS---rrnvPDDVLRLVKQTDSLVMVNFYNnYISCTnKANLSQVADHLDHIKEVaGARAV  283
DSSP  LL---llllLHHHHHHHHHHLLEEEELLLHhHHLLLlLLLHHHHHHHHHHHHHHlLHHHE


DSSP  EELLLLLLLLLllhhhlLLHHHhHHHHHLLL----LLHHHHHHHHLHHHHHHHL------
Query VWGTNWPHNSVretaayPDDARlAELTLGWL----PDEAARHRALVENPEALFK------  282
ident   |               |           |      ||    ||  |    |       
Sbjct GFGGDFDGVPR-vpeglEDVSK-YPDLIAELlrrnWTEAEVKGALADNLLRVFEaveqas  341
DSSP  EELLLLLLLLL-lllllLLLLL-HHHHHHHHhhllLLHHHHHHHHLHHHHHHHHhhhhll


DSSP  ------------------------llll
Query ------------------------lspv  286
ident                             
Sbjct nltqapeeepipldqlggscrthygyss  369
DSSP  llllllllllllhhhlllllllllllll


No 29: Query=4mupB Sbjct=3giqA Z-score=14.7

back to top
DSSP  ----------------------------------------llllllllllllllLLLLEE
Query ----------------------------------------lvrklsgtapnpafPRGAVD   20
ident                                                         |  |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  LLLLLLllllllllllllllllllLLHH--HHHHHHHHHLLLEEEEEL------------
Query TQMHMYlpgypalpggpglppgalPGPE--DYRRLMQWLGIDRVIITQ------------   66
ident    |                             |     ||  |                
Sbjct VHGHDD------------------LMFVekPDLRWKTSQGITTVVVGNcgvsaapaplpg  102
DSSP  LLLLLL------------------LHHHhlLLLHHHHLLLEEEEEELLllllllllllll


DSSP  --lHHHL-----lllhhhHHHHHHHH-----hHEEEEELL------------------lL
Query --gNAHQ-----rdngntLACVAEMG-----eAAHAVVII------------------dA   96
ident     |              |  |            | |                      
Sbjct ntaAALAllgetplfadvPAYFAALDaqrpmiNVAALVGHanlrlaamrdpqaaptaaeQ  162
DSSP  lllHHHHhhllllllllhHHHHHHHHhlllllEEEEEEEHhhhhhhhlllllllllhhhH


DSSP  LLLHHHHHHHHHLLEEEEEEELLLLllLLHH---HHHHHHHHHHHLLLEEEEE-LLHH-H
Query TTTEKDMEKLTAAGTVGARIMDLPGgaVNLS---ELDAVDERAHAADWMVAVQ-FDGN-G  151
ident             || ||                 ||      |                |
Sbjct QAMQDMLQAALEAGAVGFSTGLAYQ-pGAVAqaaELEGLARVAAERRRLHTSHiRNEAdG  221
DSSP  HHHHHHHHHHHHHLLLEEEEELLLL-lHHHLlhhHHHHHHHHHHHLLLEEEEElLLLLlL


DSSP  HHHH-HHHHHLL---LLEEEELHhHHLL--LLLLlllHHHHHHHHHHHHL----LEEEEE
Query LLDH-LPRLQKI---RSRWVFDHhGKFF--KGIRtdgPEMAALLKLIDRG----NLWFKF  201
ident         |          |  |  |              | |                 
Sbjct VEAAvEEVLAIGrgtGCATVVSH-HKCMmpQNWG---RSRATLANIDRAReqgvEVALDI  277
DSSP  HHHHhHHHHHHHhhhLLEEEELL-LLLLlhHHLL---LHHHHHHHHHHHHhlllLEEEEE


DSSP  LLHHHL--------------------------------------------------llll
Query AGVYES--------------------------------------------------srks  211
ident      |                                                      
Sbjct YPYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapaga  337
DSSP  LLLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleee


DSSP  llLHHHHHHHHHHHHHLhhHEEELLLLlLLLLLlhhHLLLH-HHHHHHHHL------lLL
Query wpYADVAAFSRVIAAHApeRIVWGTNWpHNSVRetaAYPDD-ARLAELTLG------wLP  264
ident    |        |  |       |                         ||       | 
Sbjct iyFAMDEDEVKRIFQHP--CCMVGSDG-LPNDA---RPHPRlWGSFTRVLGryvrearLM  391
DSSP  eeELLLHHHHHHHHHLL--LEEELLLL-LLLLL---LLLLHhHHHHHHHHHhhhhhllLL


DSSP  LHHHHHHHHLHHHHHHHLLLLL--------------------------------------
Query DEAARHRALVENPEALFKLSPV--------------------------------------  286
ident             |   |                                           
Sbjct TLEQAVARMTALPARVFGFAERgvlqpgawadvvvfdpdtvadratwdeptlasvgiagv  451
DSSP  LHHHHHHHHLHHHHHHHLLLLLlllllllllleeeelllllllllllllllllllleeee


DSSP  ------------------------
Query ------------------------  286
ident                         
Sbjct lvngaevfpqppadgrpgqvlrax  475
DSSP  eelleeeellllllllllllllll


No 30: Query=4mupB Sbjct=3mtwA Z-score=14.7

back to top
DSSP  ------------------------------------------llllllllllllllLLLL
Query ------------------------------------------lvrklsgtapnpafPRGA   18
ident                                                           | 
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EELLLLLL-----------llLLLLlllllllllllLLLHHHHHHHHHhHLLLEEEEELL
Query VDTQMHMY-----------lpGYPAlpggpglppgaLPGPEDYRRLMQwLGIDRVIITQG   67
ident  |   |                                            |   |     
Sbjct IDMHVHLDslaevggynsleySDRF---------wsVVQTANAKKTLE-AGFTTVRNVGA  110
DSSP  EEEEELLLllllllhhhhhhlLHHH---------hhHHHHHHHHHHHH-LLEEEEEELLL


DSSP  hhhllLLHHHHHHHHHHH------hHEEEEEL----------------------------
Query nahqrDNGNTLACVAEMG------eAAHAVVI----------------------------   93
ident                                |                            
Sbjct -----ADYDDVGLREAIDagyvpgpRIVTAAIsfgatgghcdstffppsmdqknpfnsds  165
DSSP  -----LLLHHHHHHHHHHlllllllEEEELLLleellllllllllllhhhllllllllll


DSSP  --lLLLLlhhhHHHHHHLLEEEEEEELLL----------lllllHHHHHHHHHHHHHLLL
Query --iDATTtekdMEKLTAAGTVGARIMDLP----------ggavnLSELDAVDERAHAADW  141
ident               |   |     |                     |  ||   || |  
Sbjct pdeARKA----VRTLKKYGAQVIXICATGgvfsrgnepgqqqltYEEMKAVVDEAHMAGI  221
DSSP  hhhHHHH----HHHHHHLLLLEEEEELLLlllllllllllllllHHHHHHHHHHHHHLLL


DSSP  EEEEELLHHHHhhhHHHHHLLlleEEELhHHHLllllllllhhHHHHHHHHHHLLEEEEE
Query MVAVQFDGNGLldhLPRLQKIrsrWVFDhHGKFfkgirtdgpeMAALLKLIDRGNLWFKF  201
ident  ||    |                     |                  ||       |  
Sbjct KVAAHAHGASG--iREAVRAG--vDTIE-HASL---------vDDEGIKLAVQKGAYFSM  267
DSSP  EEEEEELLHHH--hHHHHHLL--lLEEE-ELLL---------lLHHHHHHHHHHLLEEEL


DSSP  LLHHH------------------LLLLlllLHHHHHHHHHHHHHLhhHEEELLLLLLLll
Query AGVYE------------------SSRKswpYADVAAFSRVIAAHApeRIVWGTNWPHNsv  243
ident                          |            |          | ||       
Sbjct DIYNTdytqaegkkngvlednlrKDRD--iGELQRENFRKALKAG-vKMVYGTDAGIY--  322
DSSP  LLLLHhhhhhhhhhhlllhhhhhHHHH--hHHHHHHHHHHHHHHL-lEEELLLLLLLL--


DSSP  llhhhllLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL-----------------
Query retaaypDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV-----------------  286
ident        | |                              |                   
Sbjct ----phgDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRSKDvgqvavgrygdmiavag  378
DSSP  ----lllLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLLLLllllllllllleeeell


DSSP  --------------------------
Query --------------------------  286
ident                           
Sbjct dpladvttlekpvfvmkggavvkapx  404
DSSP  lllllhhhhhllleeeelleeeelll


No 31: Query=4mupB Sbjct=1j6pA Z-score=14.5

back to top
DSSP  -----------------------------------llllllllllllllLLLLEELLLLL
Query -----------------------------------lvrklsgtapnpafPRGAVDTQMHM   25
ident                                                        |  | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  L------------lllllllllLLLL----llllllLHHHHHHHHHHHLLLEEEEELLhh
Query Y------------lpgypalpgGPGL----ppgalpGPEDYRRLMQWLGIDRVIITQGna   69
ident                        |            |           ||          
Sbjct PxtllrgvaedlsfeewlfskvLPIEdrltekxayyGTILAQXEXARHGIAGFVDXYF--  118
DSSP  HhhhhllllllllhhhhhhllhHHHHllllhhhhhhHHHHHHHHHHLLLEEEEEEEEL--


DSSP  hllllhHHHHHHHHHH---HHEEEEELL------LLLLLHhhHHHHHHL------LEEEE
Query hqrdngNTLACVAEMG---EAAHAVVII------DATTTEkdMEKLTAA------GTVGA  114
ident                      |            |    |                 || 
Sbjct ------HEEWIAKAVRdfgXRALLTRGLvdsngdDGGRLEenLKLYNEWngfegrIFVGF  172
DSSP  ------LHHHHHHHHHhhlLEEEEEEEEllllllLLLHHHhhHHHHHHHllhhhlEEEEE


DSSP  E-EELLllllLLHH-HHHHHHHHHHHLLLEEEEELLH-HHHHHHHHHHHLLL---LEEEE
Query R-IMDLpggaVNLS-ELDAVDERAHAADWMVAVQFDG-NGLLDHLPRLQKIR---SRWVF  168
ident                 |  |   |      |             |     |         
Sbjct GpHSPY----LCSEeYLKRVFDTAKSLNAPVTIHLYEtSKEEYDLEDILNIGlkeVKTIA  228
DSSP  EeLLLL----LLLHhHHHHHHHHHHHHLLLEEEEELLlLLLLLLLHHHHLLLlllLLEEE


DSSP  LhHHHLllllllllhHHHHHHHhHHHLLEEEEEL--LHHHLLllllllhHHHHhHHHHHH
Query DhHGKFfkgirtdgpEMAALLKlIDRGNLWFKFA--GVYESSrkswpyaDVAAfSRVIAA  226
ident   |                                                |        
Sbjct A-HCVH--------lPERYFGV-LKDIPFFVSHNpaSNLKLG------nGIAP-VQRXIE  271
DSSP  E-ELLL--------lLHHHHHH-HLLLLEEEEELhhHHHHLL------lLLLL-HHHHHH


DSSP  HLhhHEEELLLLLLLllllhhhlLLHH--HHHHHHHLL-------lLLHHHHHHHHLHHH
Query HApeRIVWGTNWPHNsvretaayPDDA--RLAELTLGW-------lPDEAARHRALVENP  277
ident |       ||                       |             |            
Sbjct HG-xKVTLGTDGAAS-------nNSLNlfFEXRLASLLqkaqnprnLDVNTCLKXVTYDG  323
DSSP  LL-lEEEELLLLLLL-------lLLLLhhHHHHHHHHHhhllllllLLHHHHHHHHLHHH


DSSP  HHHHLLLLL---------------------------------------------------
Query EALFKLSPV---------------------------------------------------  286
ident                                                             
Sbjct AQAXGFKSGkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfd  383
DSSP  HHHHLLLLLllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeel


DSSP  ------------------------
Query ------------------------  286
ident                         
Sbjct geyptidseevkrelariekelys  407
DSSP  lllllllhhhhhhhhhhhhhhhhl


No 32: Query=4mupB Sbjct=4c5yA Z-score=14.5

back to top
DSSP  ---------------------------------------------llllllllllllllL
Query ---------------------------------------------lvrklsgtapnpafP   15
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  LLLEELLLLLLLLLllllLLLLLL---llLLLL-LHHHHHHHHHHHLLLEEEEELLhhhl
Query RGAVDTQMHMYLPGypalPGGPGL---ppGALP-GPEDYRRLMQWLGIDRVIITQGnahq   71
ident  |  |  ||                                     |        |    
Sbjct PGLWDCHMHFGGDD-dyyNDYTSGlathpASSGaRLARGCWEALQNGYTSYRDLAG----  115
DSSP  ELEEEEEELLLLLL-lllLLLHHHhhllhHHHHhHHHHHHHHHHHLLEEEEEELLL----


DSSP  lllhHHHHHHHHHH------hHEEEE-ELLL-----------------------------
Query rdngNTLACVAEMG------eAAHAV-VIID-----------------------------   95
ident                                                             
Sbjct ----YGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifalpagevlgsygvmnprpgy  171
DSSP  ----LHHHHHHHHHlllllllEEEELlLEEEllllllllllllhhhhhhhhlllllllll


DSSP  -----------LLLLHHHHHHHHHLLEEEEEEE--LLLLL------llLHHH--HHHHHH
Query -----------ATTTEKDMEKLTAAGTVGARIM--DLPGG------avNLSE--LDAVDE  134
ident                          |      |                 |   |    |
Sbjct wgagplciadgVEEVRRAVRLQIRRGAKVIXVMasGGVMSrddnpnfaQFSPeeLKVIVE  231
DSSP  llllleeelllHHHHHHHHHHHHHHLLLLEEEEllLLLLLllllllllLLLHhhHHHHHH


DSSP  HHHHLLLEEEEELLHHHHhhhhhHHHLLLLeEEELhHHHLllllllllhhHHHHHHHHHH
Query RAHAADWMVAVQFDGNGLldhlpRLQKIRSrWVFDhHGKFfkgirtdgpeMAALLKLIDR  194
ident  |      |     |           |         |                   |   
Sbjct EAARQNRIVSAHVHGKAG---imAAIKAGC-KSLE-HVSY---------aDEEVWELMKE  277
DSSP  HHHHLLLLEEEEELLHHH---hhHHHHHLL-LEEE-ELLL---------lLHHHHHHHHH


DSSP  LLEEEEEL--LHHH--------------lLLLLllLHHHHHHHHHHHHHLhhHEEELLLL
Query GNLWFKFA--GVYE--------------sSRKSwpYADVAAFSRVIAAHApeRIVWGTNW  238
ident                                                      |  ||  
Sbjct KGILYVATrsVIEIflasngeglvkeswaKLQA-lADSHLKAYQGAIKAG-vTIALGTDT  335
DSSP  HLLEEELLhhHHHHhhhhllllllllhhhLLLH-hHHHHHHHHHHHHHLL-lLEELLLLL


DSSP  LllllllhhhlllHHHHHHHHHL--LLLLHHHHHHHHLHHHHHHHL--LLLL--------
Query PhnsvretaaypdDARLAELTLG--WLPDEAARHRALVENPEALFK--LSPV--------  286
ident                 |                  |   |                    
Sbjct A---------pggPTALELQFAVerGGMTPLEAIKAATANAPLSVGpqAPLTgqlregye  386
DSSP  L---------lllLLHHHHHHHHhlLLLLHHHHHHHHLLLHHHHHHhhLLLLllllllll


DSSP  --------------------------------------------------
Query --------------------------------------------------  286
ident                                                   
Sbjct advialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 33: Query=4mupB Sbjct=4cqbA Z-score=14.4

back to top
DSSP  -------------------------------------llllllllllllllLLLLEELLL
Query -------------------------------------lvrklsgtapnpafPRGAVDTQM   23
ident                                                      | ||   
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  LLL--------------lllllllllLLLL--------lllllLLHHHHHHHHHHHLLLE
Query HMY--------------lpgypalpgGPGL--------ppgalPGPEDYRRLMQWLGIDR   61
ident ||                                                      |   
Sbjct HMDksftstgerlpkfwsrpytrdaaIEDGlkyyknatheeikRHVIEHAHMQVLHGTLY  120
DSSP  LHHhllllllllllllllllllhhhhHHHHhhhhhhllhhhhhHHHHHHHHHHHHLLEEE


DSSP  EEEELLhhhlLLLHHHHHHHHHHH-----hHEEEEELL------lLLLLhHHHHHHHHLL
Query VIITQGnahqRDNGNTLACVAEMG-----eAAHAVVII------dATTTeKDMEKLTAAG  110
ident                  |                |                   |    |
Sbjct TRTHVDvdsvAKTKAVEAVLEAKEelkdliDIQVVAFAqsgffvdLESE-SLIRKSLDMG  179
DSSP  EEEEEEllllLLLHHHHHHHHHHHhlllllEEEEEEELlllllllLLHH-HHHHHHHHHL


DSSP  EEEEEEELL-llllllHHHHHHHHHHHHHLLLEEEEEL-LHHH-HHHH-HHHHHLL----
Query TVGARIMDL-pggavnLSELDAVDERAHAADWMVAVQF-DGNG-LLDH-LPRLQKI----  162
ident        |           ||     |   |        |             ||     
Sbjct CDLVGGVDPatrennvEGSLDLCFKLAKEYDVDIDYHIhDIGTvGVYSiNRLAQKTieng  239
DSSP  LLEEELLLLllllllhHHHHHHHHHHHHHLLLEEEEEElLLHHhHHHHhHHHHHHHhhll


DSSP  -llEEEELhHHHLllLLLLlLHHHHHhHHHHHHLLEEEEELLHHhlllllllLHHHhhHH
Query -rsRWVFDhHGKFfkGIRTdGPEMAAlLKLIDRGNLWFKFAGVYessrkswpYADVaaFS  221
ident    |     |               |   |       |                      
Sbjct ykgRVTTS-HAWCfaDAPS-EWLDEA-IPLYKDSGMKFVTCFSS-------tPPTM--PV  287
DSSP  lllLEEEE-ELLHhhHLLH-HHHHHH-HHHHHHHLLEEEEELLL-------lLLLL--LH


DSSP  HHHHHHLHhHEEELLLLLLLLLllhhhLLLH---HHHHHHHHL-----lllLHHHHHHHH
Query RVIAAHAPeRIVWGTNWPHNSVretaaYPDD---ARLAELTLG-----wlpDEAARHRAL  273
ident                                      |             |        
Sbjct IKLLEAGI-NLGCASDNIRDFW----vPFGNgdmVQGALIETQrlelktnrDLGLIWKMI  342
DSSP  HHHHHLLL-EEEEELLLLLLLL----lLLLLllhHHHHHHHHHhhllllhhHHHHHHHHH


DSSP  LHHHHHHHLLLLL-----------------------------------------------
Query VENPEALFKLSPV-----------------------------------------------  286
ident                                                             
Sbjct TSEGARVLGIEKNygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  LHHHHHHHLLHHHlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 34: Query=4mupB Sbjct=2qpxA Z-score=14.4

back to top
DSSP  llllllllllLLLLLllLEELLLLLLLLLllllllllllLLLL-----------------
Query lvrklsgtapNPAFPrgAVDTQMHMYLPGypalpggpglPPGA-----------------   43
ident               |    |   |    |                               
Sbjct --gxddlsefVDQVP--LLDHHCHFLIDG---kvpnrddRLAQvsteadkdypladtknr   53
DSSP  --lllllhhhHHHLL--EEEEEELLLLLL---llllhhhHHHHhlllllllllhhhhlll


DSSP  --------------------------lllhHHHHHHHHHHLLLEEEEELLHHHllllhhh
Query --------------------------lpgpEDYRRLMQWLGIDRVIITQGNAHqrdngnt   77
ident                                   |           |  |          
Sbjct layhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFVP----ddp  109
DSSP  hhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLLL----lll


DSSP  hHHHHHHH----hHEEEEELL-----------------llLLLHhHHHHHHHLLEEEEEE
Query lACVAEMG----eAAHAVVII-----------------daTTTEkDMEKLTAAGTVGARI  116
ident                 |                            |     | | ||   
Sbjct iLDLDQTAelvgiPVKAIYRLethaedfxlehdnfaawwqAFSN-DVKQAKAHGFVGFXS  168
DSSP  lLLHHHHHhhhllLEEEEEEHhhhhhhhhlllllhhhhhhHHHH-HHHLLLLLLLLLEEE


DSSP  ELLLL------------------------------lllLHHHHHHHHHHHHHLLLEEEEE
Query MDLPG------------------------------gavNLSELDAVDERAHAADWMVAVQ  146
ident                                           |  |     | |      
Sbjct IAAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFH  228
DSSP  LHHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEE


DSSP  LL---------hHHHHHHHHHHHLL---LLEEEELHhHHLLlllllllhhhhhHHHHHHH
Query FD---------gNGLLDHLPRLQKI---RSRWVFDHhGKFFkgirtdgpemaaLLKLIDR  194
ident                |     |          |  |                        
Sbjct VGygdadtdxylGNPLLXRDYLKAFtkkGLKVVLLH-CYPY--------hreaGYLASVF  279
DSSP  ELlllllllhhhLLHHHHHHHHHHHhhhLLLEEEEE-LLLL--------hhhhHHHHHHL


DSSP  LLEEEEELLH-HHLLlllLLLHHHHHHHHHHhhHLHHHEEELLLLLllllllhhhllLHH
Query GNLWFKFAGV-YESSrksWPYADVAAFSRVIaaHAPERIVWGTNWPhnsvretaaypDDA  253
ident  || |                  |             ||                    |
Sbjct PNLYFDISLLdNLGP---SGASRVFNEAVEL--APYTRILFASDAS----typexygLAA  330
DSSP  LLEEEELLLHhHHLH---HHHHHHHHHHLLL--LLHHHEELLLLLL----llhhhhhHHH


DSSP  HHHHHHHLLLL----------LHHHHHHHHLHHHHHHHLLLLL---
Query RLAELTLGWLP----------DEAARHRALVENPEALFKLSPV---  286
ident |     |                |            |         
Sbjct RQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQERElrv  376
DSSP  HHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLHHHhll


No 35: Query=4mupB Sbjct=3gg7A Z-score=14.3

back to top
DSSP  llllllllllllllllLLEELLLLLLlllllllllllllllllLLLHHHHHHHHHhhLLL
Query lvrklsgtapnpafprGAVDTQMHMYlpgypalpggpglppgaLPGPEDYRRLMQwlGID   60
ident                    |   |                          |         
Sbjct ----------------SLIDFHVHLD---------------lyPDPVAVARACEE--RQL   27
DSSP  ----------------LLEEEEELHH---------------hlLLHHHHHHHHHH--LLL


DSSP  EEEEELLhhHLLLLHHHHHHHHHhHHHEEEEEL----------llLLLLHhHHHHHhhll
Query RVIITQGnaHQRDNGNTLACVAEmGEAAHAVVI----------idATTTEkDMEKLtaag  110
ident  |              |||  |                                      
Sbjct TVLSVTT--TPAAWRGTLALAAG-RPHVWTALGfhpevvseraadLPWFD-RYLPE----   79
DSSP  EEEELLL--LHHHHHHHHHHHLL-LLLEEELLLllhhhllllhhhLHHHH-HHHHH----


DSSP  EEEEE-EELLL------llllLHHHHHHHHHHHHHL-LLEEEEELLhHHHHHHHHHHHLL
Query TVGAR-IMDLP------ggavNLSELDAVDERAHAA-DWMVAVQFDgNGLLDHLPRLQKI  162
ident |                              |                     |  |   
Sbjct TRFVGeVGLDGspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR-RAESEVLNCLEAN  138
DSSP  LLEEEeEELLLlhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL-LLHHHHHHHHHHL


DSSP  --LLEEEELHhHHLLlllllllHHHHHHHHHHhhllEEEEELLHhhllllllLLHHHHHH
Query --RSRWVFDHhGKFFkgirtdgPEMAALLKLIdrgnLWFKFAGVyessrkswPYADVAAF  220
ident                        |      |      ||                  || 
Sbjct prSGTPILHW-YSGS------vTELRRAISLG----CWFSVGPT------mvRTQKGAAL  181
DSSP  hhHEEEEEEL-LLLL------hHHHHHHHHLL----LEEEELHH------hhLLHHHHHH


DSSP  HHHHhhhLHHHEEELLLLLLLLLllhHHLL---lHHHHH-HHHHLLLLL--HHHHHHHhL
Query SRVIaahAPERIVWGTNWPHNSVretAAYP---dDARLA-ELTLGWLPD--EAARHRAlV  274
ident  |        |    |  |               |     |                   
Sbjct IRSM---PRDRVLTETDGPFLEL---DGQAalpwDVKSVvEGLSKIWQIpaSEVERIV-K  234
DSSP  HHHL---LHHHEEELLLLLLLEE---LLEEllhhHHHHHhHHHHHHHLLlhHHHHHHH-H


DSSP  HHHHHHHLllll
Query ENPEALFKlspv  286
ident ||   |      
Sbjct ENVSRLLG---t  243
DSSP  HHHHHHHH---l


No 36: Query=4mupB Sbjct=3nqbA Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  --llllllllllllllLLLLEELLLLLLlllllllllllllllllLLLHHHHHHHHHHHL
Query --lvrklsgtapnpafPRGAVDTQMHMYlpgypalpggpglppgaLPGPEDYRRLMQWLG   58
ident                   |  ||  |                      |  |       |
Sbjct srrdaaqvidaggayvSPGLIDTHXHIE---------------ssXITPAAYAAAVVARG  105
DSSP  lllleeeeeelllleeEELEEEEEELHH---------------hhLLLHHHHHHHHHLLL


DSSP  LLEEEEELLHHHL-lLLHHHHHHHHHHH---hHEEEEELLL-------------lLLLHh
Query IDRVIITQGNAHQ-rDNGNTLACVAEMG---eAAHAVVIID-------------aTTTEk  101
ident                                  |                          
Sbjct VTTIVWDPHEFGNvhGVDGVRWAAKAIEnlplRAILLAPSCvpsapglerggadfDAAI-  164
DSSP  EEEEEELLHHHHHhhLHHHHHHHHHHHLllllEEEEEELLLllllllllllllllLHHH-


DSSP  HHHHHHHLLEEEE-EEELlllllllHHHH-------HHHHHHHHHLLLEEEEELLHhHHH
Query DMEKLTAAGTVGA-RIMDlpggavnLSEL-------DAVDERAHAADWMVAVQFDGnGLL  153
ident     |      |   |                            ||   |     |    
Sbjct LADLLSWPEIGGIaEIXN-------XRGVierdprxSGIVQAGLAAEKLVCGHARG-LKN  216
DSSP  HHHHHLLLLEEEEeEELL-------HHHHhlllhhhHHHHHHHHHHLLEEEELLLL-LLH


DSSP  HHHHHHHLLLleEEELhhHHLLlllllllhHHHHHHHHHhhllEEEEELLHHhlllllll
Query DHLPRLQKIRsrWVFDhhGKFFkgirtdgpEMAALLKLIdrgnLWFKFAGVYessrkswp  213
ident   |                              | |       |     |          
Sbjct ADLNAFXAAG-vSSDH--ELVS------geDLXAKLRAG----LTIELRGSH--------  255
DSSP  HHHHHHHHLL-lLEEL--LLLL------hhHHHHHHHLL----LEEEEELLL--------


DSSP  lhHHHHHHHHHHH---HLHHHEEELLLLlLLLLllhhhLLLH--HHHHHHHHLLlLLHHH
Query yaDVAAFSRVIAA---HAPERIVWGTNWpHNSVretaaYPDD--ARLAELTLGWlPDEAA  268
ident                 | |      |                                  
Sbjct -dHLLPEFVAALNtlgHLPQTVTLCTDD-VFPD---dlLQGGglDDVVRRLVRYgLKPEW  310
DSSP  -hHHHHHHHHHHHhhlLLLLLEEEELLL-LLHH---hhHHLLlhHHHHHHHHHLlLLHHH


DSSP  HHHHHLHHHHHHHLLLLL------------------------------------------
Query RHRALVENPEALFKLSPV------------------------------------------  286
ident   ||   |       |                                            
Sbjct ALRAATLNAAQRLGRSDLgliaagrradivvfedlngfsarhvlasgravaeggrxlvdi  370
DSSP  HHHHHLHHHHHHHLLLLLlllllllllleeeellllllleeeeeelleeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh


DSSP  -------------------------------------
Query -------------------------------------  286
ident                                      
Sbjct kacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhlllllllllleelllleeelllleeellleeel


No 37: Query=4mupB Sbjct=3mkvA Z-score=14.0

back to top
DSSP  -----------------------------------------llllllllllllllLLLLE
Query -----------------------------------------lvrklsgtapnpafPRGAV   19
ident                                                          |  
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  ELLLLLLlllllllllLLLL---lLLLL--LLHHHHHHHHHhHLLLEEEEELLhhhllll
Query DTQMHMYlpgypalpgGPGL---pPGAL--PGPEDYRRLMQwLGIDRVIITQGnahqrdn   74
ident |   |            |                  |      |   |    |       
Sbjct DLHVHVV----aiefnLPRVatlpNVLVtlRAVPIMRAMLR-RGFTTVRDAGG-------  108
DSSP  EEEELLL----lllllHHHHllllHHHHhhHHHHHHHHHHH-LLEEEEEELLL-------


DSSP  hhHHHHHHHHH------hHEEEEEL-----------------------------------
Query gnTLACVAEMG------eAAHAVVI-----------------------------------   93
ident                                                             
Sbjct -aGYPFKQAVEsglvegpRLFVSGRalsqtgghadprarsdymppdspcgccvrvgalgr  167
DSSP  -lLHHHHHHHHlllllllEEEELLLeeellllllllllllllllllllllllllllllee


DSSP  ------lLLLLlHHHHHHHhhllEEEEEEELLL--------llllLHHH--HHHHHHHHH
Query ------iDATTtEKDMEKLtaagTVGARIMDLP--------ggavNLSE--LDAVDERAH  137
ident                             ||                 ||    |    | 
Sbjct vadgvdeVRRAvREELQMG----ADQIXIMASGgvasptdpvgvfGYSEdeIRAIVAEAQ  223
DSSP  elllhhhHHHHhHHHHHHL----LLLEEEELLLllllllllllllLLLHhhHHHHHHHHH


DSSP  HLLLEEEEELLHHHHhhhHHHHHLLlleEEELhHHHLllllllllhHHHHHHHHHHHLlE
Query AADWMVAVQFDGNGLldhLPRLQKIrsrWVFDhHGKFfkgirtdgpEMAALLKLIDRGnL  197
ident      |                           ||                      |  
Sbjct GRGTYVLAHAYTPAA--iARAVRCG--vRTIE-HGNL--------iDDETARLVAEHG-A  269
DSSP  LLLLLEEEEELLHHH--hHHHHHLL--lLEEE-ELLL--------lLHHHHHHHHHHL-L


DSSP  EEEEL--LHHH----------------LLLLlllLHHHHHHHHHHHHHLhhHEEELLLLl
Query WFKFA--GVYE----------------SSRKswpYADVAAFSRVIAAHApeRIVWGTNWp  239
ident                                                        ||   
Sbjct YVVPTlvTYDAlasegekyglppesiaKIAD--vHGAGLHSIEIMKRAG-vKMGFGTDL-  325
DSSP  EEELLhhHHHHhhhhlllllllhhhhlLHHH--hHLLHHHHHHHHHHHL-lLLLLLLLL-


DSSP  LLLLllhhhlLLHHhHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL-------------
Query HNSVretaayPDDArLAELTLGWLPDEAARHRALVENPEALFKLSPV-------------  286
ident                     |      |                                
Sbjct LGEA-----qRLQS-DEFRILAEVLSPAEVIASATIVSAEVLGMQDKlgrivpgahadvl  379
DSSP  LHHH-----hHHLL-HHHHHHHLLLLHHHHHHHLLHHHHHHLLLLLLlllllllllllee


DSSP  -----------------------------------
Query -----------------------------------  286
ident                                    
Sbjct vvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  eellllllllllllllllllleeeelleeeeelll


No 38: Query=4mupB Sbjct=3e74A Z-score=13.9

back to top
DSSP  -------------------------------------lllllllllllLLLLlLLEELLL
Query -------------------------------------lvrklsgtapnPAFPrGAVDTQM   23
ident                                                    | | ||   
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSP-GXVDAHT   59
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEE-LEEEEEE


DSSP  LLllllllllllllllllllllLHHHHHHHHHHHLLLEEEEELLH-HHLL----LLHHHH
Query HMylpgypalpggpglppgalpGPEDYRRLMQWLGIDRVIITQGN-AHQR----DNGNTL   78
ident |                     | |   |     ||   |    |               
Sbjct HI--------------------GYETGTRAAAKGGITTXIEXPLNqLPATvdraSIELKF   99
DSSP  LL--------------------LHHHHHHHHHHLLEEEEEELLLLlLLLLllhhHHHHHH


DSSP  -hhhhhhhhHEEEEELLLLLLLHhHHHHHHHLLEEEEEEELlllllLLHH--HHHHHHHH
Query -acvaemgeAAHAVVIIDATTTEkDMEKLTAAGTVGARIMDlpggaVNLS--ELDAVDER  135
ident           |                 |   | ||                        
Sbjct daakgkltiDAAQLGGLVSYNID-RLHELDEVGVVGFXCFV-----RDVNdwQFFKGAQK  153
DSSP  hhhllllllEEEELEELLLLLLL-LHHHHHHHLLLLEEEEL-----LLLLhhHHHHHHHH


DSSP  HHHLLLEEEEELL----------------------------hHHHHHH-HHHHHLL---L
Query AHAADWMVAVQFD----------------------------gNGLLDH-LPRLQKI---R  163
ident        | |                                          |       
Sbjct LGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvFTEVEAiRRVLYLAkvaG  213
DSSP  HHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhHHHHHHhHHHHHHHhhhL


DSSP  LEEEELHHHhlllllllllHHHHHHHHHHH-HLLEEEEELLHH-hlLLLLL---------
Query SRWVFDHHGkffkgirtdgPEMAALLKLID-RGNLWFKFAGVY-esSRKSW---------  212
ident  |    |                                   |                 
Sbjct CRLHVCHVS--------spEGVEEVTRARQeGQDITCESCPHYfvlDTDQFeeigtlakc  265
DSSP  LLEEELLLL--------lhHHHHHHHHHHHlLLLEEEEELLHHhhlLHHHHhhhlhhhll


DSSP  ----llHHHHHHHHHHHHHLHhHEEELLLLLLlLLLLHH--------hLLLH-HHHHHHH
Query ----pyADVAAFSRVIAAHAPeRIVWGTNWPHnSVRETA--------aYPDD-ARLAELT  259
ident                                     |                       
Sbjct sppirdLENQKGXWEKLFNGE-IDCLVSDHSP-CPPEXKagnixkawgGIAGlQSCXDVX  323
DSSP  llllllHHHHHHHHHHHHLLL-LLEELLLLLL-LLLLLLlllllllllLLLLhHHHHHHH


DSSP  HLLL-----LLHHHHHHHHLHHHHHHHLLLLL----------------------------
Query LGWL-----PDEAARHRALVENPEALFKLSPV----------------------------  286
ident                      |    | |                               
Sbjct FDEAvqkrgXSLPXFGKLXATNAADIFGLQQKgriapgkdadfvfiqpnssyvltnddle  383
DSSP  HHHHlllllLLHHHHHHHHLHHHHHHLLLLLLlllllllllleeeeelllleellhhhll


DSSP  ----------------------------------------------
Query ----------------------------------------------  286
ident                                               
Sbjct yrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  llllllllllleelleeeeeeelleeeeelllllllllllleelll


No 39: Query=4mupB Sbjct=4dziC Z-score=13.9

back to top
DSSP  llllllllllLLLLllLLEELLLLLLLL-LLLL---------------------------
Query lvrklsgtapNPAFprGAVDTQMHMYLP-GYPA---------------------------   32
ident                    |   | | |                                
Sbjct ----------ALNY--RVIDVDNHYYEPlDSFTrhldkkfkrrgvqmlsdgkrtwavigd   48
DSSP  ----------LLLL--LEEEEEEELLLLlLLLLllllhhhlllleeeeelllleeeeell


DSSP  -lLLLL--LLLLL--------------------------------LLLL--HHHHHHHHH
Query -lPGGP--GLPPG--------------------------------ALPG--PEDYRRLMQ   55
ident                                                           | 
Sbjct rvNHFIpnPTFDPiivpgcldllfrgeipdgvdpaslmkverladHPEYqnRDARIAVMD  108
DSSP  eeLLLLllLLLLLeelllllhhhhhllllllllhhhllleelhhhLHHHllHHHHHHHHH


DSSP  HHLLLEEEEElLHHHL------------------lLLHHHHHHHH--hhHHHEEEEELLL
Query WLGIDRVIITqGNAHQ------------------rDNGNTLACVA--emGEAAHAVVIID   95
ident    |                                |                 |  |  
Sbjct EQDIETAFML-PTFGCgveealkhdieatmasvhaFNLWLDEDWGfdrpDHRIIAAPIVS  167
DSSP  HHLEEEEEEE-LLHHHhhhhhllllhhhhhhhhhhHHHHHHHHLLllllLLLEEELLLLL


DSSP  L----LLLHhHHHHHHHLLEEEEEEElllllllLHHH-------------hHHHHHHHHH
Query A----TTTEkDMEKLTAAGTVGARIMdlpggavNLSE-------------lDAVDERAHA  138
ident         |       | |                                | |  |   
Sbjct LadptRAVE-EVDFVLARGAKLVLVR-------PAPVpglvkprslgdrshDPVWARLAE  219
DSSP  LllhhHHHH-HHHHHHHLLLLLEELL-------LLLLlllllllllllhhhHHHHHHHHH


DSSP  LLLEEEEEL------------------------LHHHHHHHHHHHHL-------lLLEEE
Query ADWMVAVQF------------------------DGNGLLDHLPRLQK-------iRSRWV  167
ident |   |                            |     |                   |
Sbjct AGVPVGFHLsdsgylhiaaawggakdpldqvllDDRAIHDTMASMIVhgvftrhpKLKAV  279
DSSP  HLLLEEEELlllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHHHllhhhhllLLLEE


DSSP  ELH-HHHLllllllllhhHHHH------------------HHHHHhLLEEEEEllhhhll
Query FDH-HGKFfkgirtdgpeMAAL------------------LKLIDrGNLWFKFagvyess  208
ident        |                                       | |          
Sbjct SIEnGSYF---------vHRLIkrlkkaantqpqyfpedpVEQLR-NNVWIAP-------  322
DSSP  EELlLLLH---------hHHHHhhhhhhhhhlhhhllllhHHHHH-HHEEELL-------


DSSP  llllllhhhHHHHHHHHHH-LHHHEEELLLLLLLLlllhhhlLLHHhHHHHHHLLlLLHH
Query rkswpyadvAAFSRVIAAH-APERIVWGTNWPHNSvretaayPDDArLAELTLGWlPDEA  267
ident                 |       |  |  |||                   |     | 
Sbjct -------yyEDDLPELARViGVDKILFGSDWPHGE-----glASPV-SFTAELKG-FSES  368
DSSP  -------llLLLHHHHHHHhLHHHLLLLLLLLLLL-----llLLHH-HHHHHHLL-LLHH


DSSP  HHHHHHLHHHHHHHL-llll
Query ARHRALVENPEALFK-lspv  286
ident         |   |       
Sbjct DIRKIMRDNALDLLGvqvgs  388
DSSP  HHHHHHLHHHHHHHLlllll


No 40: Query=4mupB Sbjct=1a4mA Z-score=13.8

back to top
DSSP  lllllllllLLLLLLllLEELLLLLL--------------------------------ll
Query lvrklsgtaPNPAFPrgAVDTQMHMY--------------------------------lp   28
ident          |    |   |    |                                    
Sbjct --------tPAFNKP--KVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmd   50
DSSP  --------lLLLLLL--EEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlll


DSSP  llllllllLLLLLLLL-----------lLHHHHHHHHHHHLLLEEEEELLhhHLLL----
Query gypalpggPGLPPGAL-----------pGPEDYRRLMQWLGIDRVIITQGnaHQRD----   73
ident                                         |   |               
Sbjct kplslpgfLAKFDYYMpviagcreaikrIAYEFVEMKAKEGVVYVEVRYS--PHLLansk  108
DSSP  llllhhhhHLLHHHHHhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEEL--LHHHllll


DSSP  ---------------lHHHHHHHHHHH-------hHEEEEELL-------LLLLlhhHHH
Query ---------------nGNTLACVAEMG-------eAAHAVVII-------DATTtekDME  104
ident                                                             
Sbjct vdpmpwnqtegdvtpdDVVDLVNQGLQegeqafgiKVRSILCCmrhqpswSLEV-leLCK  167
DSSP  llllhhhlllllllhhHHHHHHHHHHHhhhhhhllEEEEEEEEelllhhhHHHH-hhHHH


DSSP  HHHHLLEEEEEEE-LLLLlllLHHH--HHHHHHHHHHLLLEEEEELLH-HHHHhHHHH-H
Query KLTAAGTVGARIM-DLPGgavNLSE--LDAVDERAHAADWMVAVQFDG-NGLLdHLPR-L  159
ident |      |      |                 | |        |                
Sbjct KYNQKTVVAMDLAgDETI-egSSLFpgHVEAYEGAVKNGIHRTVHAGEvGSPE-VVREaV  225
DSSP  HLLLLLEEEEEEElLLLL-llHHHLhhHHHHHHHHHHHLLEEEEEELLlLLHH-HHHHhH


DSSP  HLLLLeEEELHhHHLLlllllllHHHHHHHHHHHHLlEEEEEL--LHHH--LLLLllllH
Query QKIRSrWVFDHhGKFFkgirtdgPEMAALLKLIDRGnLWFKFA--GVYE--SSRKswpyA  215
ident           | |             |    |       |       |            
Sbjct DILKT-ERVGH-GYHT------iEDEALYNRLLKEN-MHFEVCpwSSYLtgAWDP----K  272
DSSP  HLLLL-LEEEE-LHHH------hHLHHHHHHHHHLL-LEEEELhhHHHHllLLLL----L


DSSP  HHHhHHHHHHHHLHhHEEELLLLLLLllllhhhLLLH-HHHHHHH-hLLLLLHHHHHHHH
Query DVAaFSRVIAAHAPeRIVWGTNWPHNsvretaaYPDD-ARLAELT-lGWLPDEAARHRAL  273
ident                     |  |                    |       |    |  
Sbjct TTH-AVVRFKNDKA-NYSLNTDDPLI-------FKSTlDTDYQMTkkDMGFTEEEFKRLN  323
DSSP  LLL-HHHHHHHLLL-LEEELLLLLLL-------LLLLhHHHHHHHhhLLLLLHHHHHHHH


DSSP  lHHHHHHHL-----LLLL---------
Query vENPEALFK-----LSPV---------  286
ident   |                        
Sbjct -INAAKSSFlpeeeKKELlerlyreyq  349
DSSP  -HHHHHLLLllhhhHHHHhhhhhhhll


No 41: Query=4mupB Sbjct=3icjA Z-score=13.6

back to top
DSSP  --------------------------------------------llllllllllllllLL
Query --------------------------------------------lvrklsgtapnpafPR   16
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LLEELLLLLL--------------------------------------------------
Query GAVDTQMHMY--------------------------------------------------   26
ident    |   |                                                    
Sbjct AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  --------------------------------------------------llllLLLLll
Query --------------------------------------------------lpgyPALPgg   36
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiINEK--  178
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhHHHL--


DSSP  llllllllLLHHHHHHHHHHHLLLEEEEELLhhhlllLHHHHHHHHH------HHHHEEE
Query pglppgalPGPEDYRRLMQWLGIDRVIITQGnahqrdNGNTLACVAE------MGEAAHA   90
ident            |        ||   |               |    |            |
Sbjct iltvkdykHYIESAQEHLLSLGVHSVGFMSV------GEKALKALFEleregrLKMNVFA  232
DSSP  lllhhhhhHHHHHHHHHHHHLLEEEEEEEEE------LHHHHHHHHHhhhlllLLLEEEE


DSSP  EELLL-lLLLH-HHHHhHHHL---LEEEEEEELLL--------------------lllLL
Query VVIID-aTTTE-KDMEkLTAA---GTVGARIMDLP--------------------ggaVN  125
ident           |                |                              | 
Sbjct YLSPEllDKLEeLNLG-KFEGrrlRIWGVXLFVDGslgartallsepytdnpttsgelVM  291
DSSP  EELHHhhHHHHhHLLL-LEELlleEEEEEEEELLLlllllllllllllllllllllllLL


DSSP  HH-HHHHHHHHHHHLLLEEEEELLHHHHHHH-HHHHHLLLLEEEELhHHHLllllllllh
Query LS-ELDAVDERAHAADWMVAVQFDGNGLLDH-LPRLQKIRSRWVFDhHGKFfkgirtdgp  183
ident    |   | |||      |||   |    |  |              |            
Sbjct NKdEIVEVIERAKPLGLDVAVHAIGDKAVDVaLDAFEEAEFSGRIE-HASL--------v  342
DSSP  LHhHHHHHHHHHLLLLLEEEEEELLHHHHHHhHHHHHHHLLLLEEE-ELLL--------l


DSSP  HHHHhHHHHHHLLEEEEEL-LHHHlLLLL------lllHHHHhHHHHHHHHLhhHEEELL
Query EMAAlLKLIDRGNLWFKFA-GVYEsSRKS------wpyADVAaFSRVIAAHApeRIVWGT  236
ident      |  |                                                  |
Sbjct RDDQ-LERIKELKVRISAQpHFIVsDWWIvnrvgeeraKWAY-RLKTLSSIT--KLGFST  398
DSSP  LHHH-HHHHHHHLLEEEELlLHHHhLLLHhhhhhhhhhHHLL-LHHHHHHHL--LEEELL


DSSP  LLLLlllllhhhlLLHH-HHHHHHHL--------LLLLHHHHHHHHLHHHHHHHLLLLL-
Query NWPHnsvretaayPDDA-RLAELTLG--------WLPDEAARHRALVENPEALFKLSPV-  286
ident   |                                                         
Sbjct DSPI---------EPADpWVSIDAAVnryvvdpgERVSREEALHLYTHGSAQVTLAEDLg  449
DSSP  LLLL---------LLLLhHHHHHHHHhlllllhhHLLLHHHHHHHLLHHHHHHLLLLLLl


DSSP  -------------------
Query -------------------  286
ident                    
Sbjct klergfraeyiildrdplk  468
DSSP  llllllllleeeellllll


No 42: Query=4mupB Sbjct=1a5kC Z-score=13.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---------------------------------------------------lllllllll
Query ---------------------------------------------------lvrklsgta    9
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  lllllLLLLEELLLLLlllllllllllllllllllLLHHhHHHHHHHHLLLEEEEEL--l
Query pnpafPRGAVDTQMHMylpgypalpggpglppgalPGPEdYRRLMQWLGIDRVIITQ--g   67
ident        |  ||  |                      |          |           
Sbjct egkivTAGGIDTHIHW-------------------ICPQ-QAEEALVSGVTTMVGGGtgp  160
DSSP  llleeEELEEEEEEEL-------------------LLLL-HHHHHHHHLEEEEEEELlll


DSSP  HHHL------LLLHHHHHHHHHHH---hHEEEEELL-LLLLLhhHHHHHHHLLEEEEEEE
Query NAHQ------RDNGNTLACVAEMG---eAAHAVVII-DATTTekDMEKLTAAGTVGARIM  117
ident  |                                                |||  |  | 
Sbjct AAGThattctPGPWYISRMLQAADslpvNIGLLGKGnVSQPD--ALREQVAAGVIGLEIH  218
DSSP  LHHHhhllllLHHHHHHHHHHHHLllllEEEEEEELlLLLHH--HHHHHHHHLLLEEEEE


DSSP  LlllLLLLHH-HHHHHHHHHHHLLLEEEEELLHHH-hhHHHHHHHLL-LLEEEELHHHHL
Query DlpgGAVNLS-ELDAVDERAHAADWMVAVQFDGNG-llDHLPRLQKI-RSRWVFDHHGKF  174
ident              |     |   |  ||   |           |  |        |    
Sbjct E---DWGATPaAIDCALTVADEMDIQVALHSDTLNesgFVEDTLAAIgGRTIHTFHTEGA  275
DSSP  H---HHLLLHhHHHHHHHHHHHHLLEEEEELLLLLlllLHHHHHHHHlLLLEEELLLLLL


DSSP  llllllllhhhhhhhHHHHHLLEEEEELLHH----hlLLLLL------------------
Query fkgirtdgpemaallKLIDRGNLWFKFAGVY----esSRKSW------------------  212
ident                      |                                      
Sbjct ------ggghapdiiTACAHPNILPSSTNPTlpytlnTIDEHldmlmvchhldpdiaedv  329
DSSP  ------lllllllhhHHHHLLLEEEEEEHHHllllllHHHHHhhhhhhhhllllllhhhh


DSSP  ------llHHHHHHHHHHHHHLHhHEEELLLLLLLllllhhhlllHHHHHHHHHLLL---
Query ------pyADVAAFSRVIAAHAPeRIVWGTNWPHNsvretaaypdDARLAELTLGWL---  263
ident             |   |                                   |       
Sbjct afaesrirRETIAAEDVLHDLGA-FSLTSSDSQAM--------grVGEVILRTWQVAhrm  380
DSSP  hlllllllHHHHHHHHHHHHLLL-LLEEELLLLLL--------llLLLHHHHHHHHHhhh


DSSP  ----------------lLHHHHHHHHLHHHHHHHLLLLL---------------------
Query ----------------pDEAARHRALVENPEALFKLSPV---------------------  286
ident                             ||                              
Sbjct kvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAHEvgsievgkladlvvwspaffg  440
DSSP  hhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLLLllllllllllleeeelhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct vkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangv  500
DSSP  lllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct aerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpma  560
DSSP  hhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllllllll


DSSP  ------
Query ------  286
ident       
Sbjct qryflf  566
DSSP  llllll


No 43: Query=4mupB Sbjct=2imrA Z-score=13.4

back to top
DSSP  ----------------------------------------llllllllllLLLLlLLLEE
Query ----------------------------------------lvrklsgtapNPAFpRGAVD   20
ident                                                           | 
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragAVIA-PPPVN   59
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellLEEL-LLLLE


DSSP  LLLLLLlllllllLLLLL-------------lLLLLL---LLHHHHHHHHHHhLLLEEEE
Query TQMHMYlpgypalPGGPG-------------lPPGAL---PGPEDYRRLMQWlGIDRVII   64
ident    |                                            |    |   |  
Sbjct AHTHLD-----msAYEFQalpyfqwipevvirGRHLRgvaAAQAGADTLTRL-GAGGVGD  113
DSSP  EEEELL-----llHHHHHhlhhhhllhhhhhhHLLLLhhhHHHHHHHHHHHL-LLLLEEE


DSSP  ELLhhhllLLHHHHHHHHHHHHHEEEEELL----------LLLLLHHHHHHHHHLL----
Query TQGnahqrDNGNTLACVAEMGEAAHAVVII----------DATTTEKDMEKLTAAG----  110
ident               |  |                               |          
Sbjct IVW-----APEVMDALLAREDLSGTLYFEVlnpfpdkadeVFAAARTHLERWRRLErpgl  168
DSSP  EEL-----LHHHHHHHHLLLLLLEEEEEEEllllhhhhhhHHHHHHHHHHHHHLLLllle


DSSP  EEEEEEELlllllLLHH-HHHHHHHHHHHLLLEEEEELL--HHHH---------------
Query TVGARIMDlpggaVNLS-ELDAVDERAHAADWMVAVQFD--GNGL---------------  152
ident   |                       |                 |               
Sbjct RLGLSPHT---pfTVSHrLMRLLSDYAAGEGLPLQIHVAehPTELemfrtgggplwdnrm  225
DSSP  EEEEEELL---llLLLHhHHHHHHHHHHHHLLLLEEEELllHHHHhhhhhlllllhhhll


DSSP  -------------------HHHHHHHHL---LLLEEEELhHHHLllllllllhHHHHHHH
Query -------------------LDHLPRLQK---IRSRWVFDhHGKFfkgirtdgpEMAALLK  190
ident                    |     |        |     |                   
Sbjct palyphtlaevigrepgpdLTPVRYLDElgvLAARPTLV-HMVN--------vTPDDIAR  276
DSSP  hhhllllhhhhhlllllllLLHHHHHHHhllHHHLLEEE-ELLL--------lLHHHHHH


DSSP  HHHHLlEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLhhHEEELLLlLLLLlllhhh
Query LIDRGnLWFKFA--GVYESSrkswpyadVAAFSRVIAAHApeRIVWGTNwPHNSvretaa  248
ident     |                               ||        ||     |      
Sbjct VARAG-CAVVTCprSNHHLE-------cGTFDWPAFAAAG-vEVALGTD-SVAS----ge  322
DSSP  HHHHL-LLEEELhhHHHHLL-------lLLLLHHHHHHLL-lLEEELLL-LHHH----hl


DSSP  lllHHHHHHHHHLLL--LLHHHHHHHHLHHHHHHHlLLLL-------------------
Query ypdDARLAELTLGWL--PDEAARHRALVENPEALFkLSPV-------------------  286
ident                   |     || |          |                    
Sbjct tlnVREEVTFARQLYpgLDPRVLVRAAVKGGQRVV-GTPFlrrgetwqegfrwelsrdl  380
DSSP  lllLHHHHHHHHHHLllLLHHHHHHHHHHHHHHHH-LLLLllllllllhhhlhhhllll


No 44: Query=4mupB Sbjct=1v77A Z-score=13.1

back to top
DSSP  lllllllllllllllLLLEELLLLLlllllllllllllllllllllHHHHHHHHHhhLLL
Query lvrklsgtapnpafpRGAVDTQMHMylpgypalpggpglppgalpgPEDYRRLMQwlGID   60
ident                                                | |         |
Sbjct ---------------VKFIEMDIRD---------------------KEAYELAKE--WFD   22
DSSP  ---------------LLLEEEEELL---------------------HHHHHHHHH--HLL


DSSP  EEEEELLH--hhLLLL-HHHHHHHHhhhhheEEEElllllllhhhhhhhhhlleeeeEEE
Query RVIITQGN--ahQRDN-GNTLACVAemgeaaHAVViidatttekdmekltaagtvgaRIM  117
ident  |                                                          
Sbjct EVVVSIKFneevDKEKlREARKEYG------KVAI----------------------LLS   54
DSSP  EEEEEEEEllllLHHHhHHHHHHHL------LEEE----------------------EEE


DSSP  LllllllLHHH-HHHHHHHHHhlLLEEEEELLhhHHHHHHhhHHLLllEEEELhHHHLLL
Query DlpggavNLSE-LDAVDERAHaaDWMVAVQFDgnGLLDHLprLQKIrsRWVFDhHGKFFK  176
ident                             |      |        |               
Sbjct N------PKPSlVRDTVQKFK--SYLIYVESN--DLRVIRysIEKG--VDAII-SPWVNR  101
DSSP  L------LLHHhHHHHHHHLL--LLEEEEELL--LHHHHHhhHHLL--LLEEE-LLLLLL


DSSP  LLllllhhHHHHHHHHHHLLEEEEEL-LHHHlLLLLllLHHHHHHHHHHHHHLH---HHE
Query GIrtdgpeMAALLKLIDRGNLWFKFA-GVYEsSRKSwpYADVAAFSRVIAAHAP---ERI  232
ident            | ||    |    |       |      |    |             | 
Sbjct KD---pgiDHVLAKLMVKKNVALGFSlRPLLySNPY-eRANLLRFMMKAWKLVEkykVRR  157
DSSP  LL---lllLHHHHHHHHHHLLEEEEElHHHHhLLHH-hHHHHHHHHHHHHHHHHhhlLLE


DSSP  EELLLLLLlllllhhhlLLHH--HHHHHHHL-LLLLHHHHHHHHLHHHHHHHLllll
Query VWGTNWPHnsvretaayPDDA--RLAELTLG-WLPDEAARHRALVENPEALFKlspv  286
ident                   |    |                       ||   |    
Sbjct FLTSSAQE--------kWDVRypRDLISLGVvIGMEIPQAKASISMYPEIILK----  202
DSSP  EEELLLLL--------hHHLLlhHHHHHHHHhLLLLHHHHHHLLLHHHHHHHL----


No 45: Query=4mupB Sbjct=3iacA Z-score=13.1

back to top
DSSP  ------------lllllllllllLLLLllLEELLL-LLLLlllllllllllllllllLLH
Query ------------lvrklsgtapnPAFPrgAVDTQM-HMYLpgypalpggpglppgalPGP   47
ident                           |    |                            
Sbjct atfxtedfllkndiartlyhkyaAPXP--IYDFHChLSPQ-----------------EIA   41
DSSP  llllllllllllhhhhhhhhhllLLLL--EEELLLlLLHH-----------------HHH


DSSP  HH----------------------------------------------------------
Query ED----------------------------------------------------------   49
ident  |                                                          
Sbjct DDrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnply  101
DSSP  HLlllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhh


DSSP  ----------------------------------------HHHHHHHHLLLEEEEELlhh
Query ----------------------------------------YRRLMQWLGIDRVIITQgna   69
ident                                          |   |      |  |    
Sbjct hwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTD---  158
DSSP  hhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLL---


DSSP  hLLLLHhhHHHHHHHH------hHEEEEELL-----------------------------
Query hQRDNGntLACVAEMG------eAAHAVVII-----------------------------   94
ident         |                                                   
Sbjct -DPIDS--LEYHRQIAaddsidiEVAPSWRPdkvfkieldgfvdylrkleaaadvsitrf  215
DSSP  -LLLLL--LHHHHHHHhllllllEEELLLLLhhhhllllllhhhhhhhhhhhhllllllh


DSSP  --lLLLLHHHHHHHHHLLEEEEEEELLL-----------------------------lll
Query --dATTTEKDMEKLTAAGTVGARIMDLP-----------------------------gga  123
ident                | |                                          
Sbjct ddlRQALTRRLDHFAACGCRASDHGIETlrfapvpddaqldailgkrlagetlseleiaq  275
DSSP  hhhHHHHHHHHHHHHHLLLLEEEEEELLllllllllhhhhhhhhhhhhllllllhhhhhh


DSSP  llHHHHHHHHHHHHHLLLEEEEELL------------------------hHHHHHHHHHH
Query vnLSELDAVDERAHAADWMVAVQFD------------------------gNGLLDHLPRL  159
ident      |        |  |                                |        |
Sbjct ftTAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnNISWALSRLL  335
DSSP  hhHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleelllLLHHHHHHHH


DSSP  HLL-----LLEEEELhhHHLLLllllllhHHHHHHHHHHH-------LLEEEEEllHHHL
Query QKI-----RSRWVFDhhGKFFKgirtdgpEMAALLKLIDR-------GNLWFKFagVYES  207
ident                                  |   |         |   |        
Sbjct DSXdvtneLPKTILY--CLNPR-------DNEVLATXIGNfqgpgiaGKVQFGS-gWWFN  385
DSSP  HHHhllllLLEEEEE--ELLHH-------HHHHHHHHHHHlllllllLLEEELL-lLHHH


DSSP  llllllLHHHHHHHHHHHH---HLHHHEEELLLLLLlllllhhhllLHHHHHHHHHLLL-
Query srkswpYADVAAFSRVIAA---HAPERIVWGTNWPHnsvretaaypDDARLAELTLGWL-  263
ident         |                      |                    |     | 
Sbjct -----dQKDGXLRQLEQLSqxgLLSQFVGXLTDSRS---------fLSYTRHEYFRRILc  431
DSSP  -----lLHHHHHHHHHHHHhhlLHHHLLLLLLLLLL---------lLLLHHHHHHHHHHh


DSSP  -----------------lLHHHHHHHHLHHHHHHHLllll
Query -----------------pDEAARHRALVENPEALFKlspv  286
ident                              |    |     
Sbjct nllgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT--ik  469
DSSP  hhhhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL--ll


No 46: Query=4mupB Sbjct=1j5sA Z-score=13.0

back to top
DSSP  -----------lllllllllllLLLLllLEELLL-LLLLlllllllllllllllllLLHH
Query -----------lvrklsgtapnPAFPrgAVDTQM-HMYLpgypalpggpglppgalPGPE   48
ident                          |   ||                            |
Sbjct hmflgedylltnraavrlfnevKDLP--IVDPHNhLDAK-----------------DIVE   41
DSSP  llllllllllllhhhhhhhhhhLLLL--EEELLLlLLHH-----------------HHHH


DSSP  H-----------------------------------------------------------
Query D-----------------------------------------------------------   49
ident                                                             
Sbjct Nkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyew  101
DSSP  Llllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhh


DSSP  -----------------------------------HHHHHHHHLLLEEEEELlhhhLLLL
Query -----------------------------------YRRLMQWLGIDRVIITQgnahQRDN   74
ident                                       |           |         
Sbjct ihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEILCTTD----DPVS  157
DSSP  hhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL----LLLL


DSSP  HhhHHHHHHHH-----hHEEEEELL-------------------------------lLLL
Query GntLACVAEMG-----eAAHAVVII-------------------------------dATT   98
ident    |                                                        
Sbjct T--LEHHRKAKeavegvTILPTWRPdramnvdkegwreyvekmgerygedtstldgfLNA  215
DSSP  L--LHHHHHHHhhllllEEELLLLLhhhhllllllhhhhhhhhhhhhllllllhhhhHHH


DSSP  LHHHHHHHHHLLEEEEEEELL----------------------------llllllHHHHH
Query TEKDMEKLTAAGTVGARIMDL----------------------------pggavnLSELD  130
ident   |  |     | |      |                                       
Sbjct LWKSHEHFKEHGCVASDHALLepsvyyvdenraravhekafsgekltqdeindykAFMMV  275
DSSP  HHHHHHHHHLLLLLEEEEEELllllllllhhhhhhhhhhhlllllllhhhhhhhhHHHHH


DSSP  HHHHHHHHLLLEEEEELL------------------------hHHHHHHHH-HHHLL--L
Query AVDERAHAADWMVAVQFD------------------------gNGLLDHLP-RLQKI--R  163
ident           |                                      |   |      
Sbjct QFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnfLRIAEGLRyFLNEFdgK  335
DSSP  HHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllLLHHHHHHhHHHHLllL


DSSP  LEEEELhhHHLLLllllllhHHHHHHHHHH-HLLEEEEEllHHHLlllllLLHHHHHHHH
Query SRWVFDhhGKFFKgirtdgpEMAALLKLID-RGNLWFKFagVYESsrkswPYADVAAFSR  222
ident    |                             |                          
Sbjct LKIVLY--VLDPT-------HLPTISTIARaFPNVYVGA-pWWFN----dSPFGMEMHLK  381
DSSP  LLEEEE--ELLHH-------HHHHHHHHHHhLLLEEELL-lLLLL----lLHHHHHHHHH


DSSP  HHHH--HLHHHEEELLLLLLlllllhhhllLHHHHHHHHHLLL----------------l
Query VIAA--HAPERIVWGTNWPHnsvretaaypDDARLAELTLGWL----------------p  264
ident   |            |                    |     |                 
Sbjct YLASvdLLYNLAGMVTDSRK--------llSFGSRTEMFRRVLsnvvgemvekgqipike  433
DSSP  HHHLllLHHHLLLLLLLLLL--------llHHHHHHHHHHHHHhhhhhhhhhlllllhhh


DSSP  LHHHHHHHHLHHHHHHHLllll
Query DEAARHRALVENPEALFKlspv  286
ident             | |||     
Sbjct ARELVKHVSYDGPKALFF----  451
DSSP  HHHHHHHHHLHHHHHHHL----


No 47: Query=4mupB Sbjct=4rdvB Z-score=12.7

back to top
DSSP  ---------------------------------llllllllllllllLLLLEELLLLLL-
Query ---------------------------------lvrklsgtapnpafPRGAVDTQMHMY-   26
ident                                                  |      |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh


DSSP  -----------------------------lLLLLllllllllllllLLLHHHHHHHHHhH
Query -----------------------------lPGYPalpggpglppgaLPGPEDYRRLMQwL   57
ident                                                     |       
Sbjct ramaglaevagnpndsfwtwrelmyrmvarLSPE---------qieVIACQLYIEMLK-A  110
DSSP  hhhlllllllllllllhhhhhhhhhhhhllLLHH---------hhhHHHHHHHHHHHH-H


DSSP  LLLEEEEELLhHHLL--------LLHHHHHHHHHHH---HHEEEEELL------------
Query GIDRVIITQGnAHQR--------DNGNTLACVAEMG---EAAHAVVII------------   94
ident |   |       |               |                               
Sbjct GYTAVAEFHY-VHHDldgrsyadPAELSLRISRAASaagIGLTLLPVLyshagfggqpas  169
DSSP  LEEEEEEEEL-LLLLllllllllLLHHHHHHHHHHHhhlLEEEEEELLlleeellleell


DSSP  --------LLLLlHHHHHHHHHLL-----EEEEE-EELLllllLLHH-HHHHHH-HHHHh
Query --------DATTtEKDMEKLTAAG-----TVGAR-IMDLpggaVNLS-ELDAVD-ERAHa  138
ident                    | |         |                    |       
Sbjct egqrrfinGSEAyLELLQRLRAPLeaaghSLGLCfHSLR----AVTPqQIATVLaAGHD-  224
DSSP  hhhlllllLHHHhHHHHHHHHHHHhhhllEELEEeLLLL----LLLHhHHHHHHlLLLL-


DSSP  lLLEEEEELLH--------------hHHHHHHHHHHllllEEEELhHHHLllllllllhH
Query aDWMVAVQFDG--------------nGLLDHLPRLQkirsRWVFDhHGKFfkgirtdgpE  184
ident  |  |                      |            ||    |             
Sbjct -DLPVHIHIAEqqkevddcqawsgrrPLQWLYENVA-vdqRWCLV-HATH--------aD  273
DSSP  -LLLEEEEELLlhhhhhhhhhhhlllHHHHHHHHLL-lllLEEEE-ELLL--------lL


DSSP  HHHHHHHHHHLlEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLHhHEEELLLLLLll
Query MAALLKLIDRGnLWFKFA--GVYESSrkswpyadVAAFSRVIAAHAPeRIVWGTNWPHns  242
ident  |        |                                |    |   |       
Sbjct PAEVAAMARSG-AVAGLClsTEANLG-------dGIFPATDFLAQGG-RLGIGSDSHV--  322
DSSP  HHHHHHHHHHL-LEEEELhhHHHHLL-------lLLLLHHHHHHLLL-EEEELLLLLL--


DSSP  lllhhhlllHHHHHHHHHL-----------LLLL------HHHHHHHHLHHHHHHHLLLL
Query vretaaypdDARLAELTLG-----------WLPD------EAARHRALVENPEALFKLSP  285
ident                  |             |              |             
Sbjct -------slSVVEELRWLEygqrlrdrkrnRLYRddqpmiGRTLYDAALAGGAQALGQPI  375
DSSP  -------llLHHHHHHHHHhhhhhhhllllLLLLlllllhHHHHHHHHHHHHHHHHLLLL


DSSP  L-----------------------------------------------------------
Query V-----------------------------------------------------------  286
ident                                                             
Sbjct Gslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhag  435
DSSP  Lllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllll


DSSP  ----------------
Query ----------------  286
ident                 
Sbjct eersarafvqvlgell  451
DSSP  hhhhhhhhhhhhhhhl


No 48: Query=4mupB Sbjct=3qy6A Z-score=12.7

back to top
DSSP  lllllllllllllllllLEELLL-LLLLlllllllllllllllLLLLHHHHHHHHHHHLL
Query lvrklsgtapnpafprgAVDTQM-HMYLpgypalpggpglppgALPGPEDYRRLMQWLGI   59
ident                    |                                |     ||
Sbjct -----------------MIDIHChILPA---------mddgagDSADSIEMARAAVRQGI   34
DSSP  -----------------LEELLLlLLLL---------llllllLHHHHHHHHHHHHHLLL


DSSP  LEEEEELLH---hHLLLLHHHHHHHHHHH---------hHEEEEElllllllhhhhhhhh
Query DRVIITQGN---aHQRDNGNTLACVAEMG---------eAAHAVViidatttekdmeklt  107
ident    | |                                                      
Sbjct RTIIATPHHnngvYKNEPAAVREAADQLNkrlikediplHVLPGQ---------------   79
DSSP  LEEELLLEEllllLLLLHHHHHHHHHHHHhhhhhlllllEEELLL---------------


DSSP  hlleeeeEEELlllllllHHHHHHHHHH----hhhlLLEEEEELLHHHHHHH-HHHHHLL
Query aagtvgaRIMDlpggavnLSELDAVDER----ahaaDWMVAVQFDGNGLLDH-LPRLQKI  162
ident         |           |                      |                
Sbjct -------EIRI-------YGEVEQDLAKrqllslndTKYILIEFPFDHVPRYaEQLFYDL  125
DSSP  -------EEEL-------LLLHHHHHHLlllllhhhLLEEEEELLLLLLLLLhHHHHHHH


DSSP  L---LEEEELHHHHLLLLLLlllhHHHHHHHHHHHLlEEEEELLHHhlllllLLLHHHHH
Query R---SRWVFDHHGKFFKGIRtdgpEMAALLKLIDRGnLWFKFAGVYessrksWPYADVAA  219
ident        |  |                 |  |   |                       |
Sbjct QlkgYIPVIAHPERNREIRE----NPSLLYHLVEKG-AASQITSGS---lagIFGKQLKA  177
DSSP  HhllLEEEEELHHHLHHHHH----LLHHHHHHHHLL-LEEEEEHHH---hllLLLHHHHH


DSSP  HHHHHHHHLhhHEEELLLLLLlllllhhhlLLHHhHHHHHHLLL---LLHHHHHHHHlHH
Query FSRVIAAHApeRIVWGTNWPHnsvretaayPDDArLAELTLGWL---PDEAARHRALvEN  276
ident ||                                      |  |              ||
Sbjct FSLRLVEAN-lIHFVASDAHN--------vKTRNfHTQEALYVLekeFGSELPYMLT-EN  227
DSSP  HHHHHHHLL-lLLEEELLLLL--------lLLLLlLHHHHHHHHhhhHLLHHHHHHH-HH


DSSP  HHHHHLLL----------ll
Query PEALFKLS----------pv  286
ident  | |                
Sbjct AELLLRNQtifrqppqpvkr  247
DSSP  HHHHHLLLllllllllllll


No 49: Query=4mupB Sbjct=2uz9A Z-score=12.6

back to top
DSSP  -----------------------------------------------------lllllll
Query -----------------------------------------------------lvrklsg    7
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  lllllllLLLLEELLLLLL-----------lllllllllLLLLL------llllLLHHHH
Query tapnpafPRGAVDTQMHMY-----------lpgypalpgGPGLP------pgalPGPEDY   50
ident          | |||  |                                           
Sbjct lshheffMPGLVDTHIHASqysfagssidlpllewltkyTFPAEhrfqnidfaeEVYTRV  120
DSSP  llllleeEELEEEEEEEHHhhhhllllllllhhhhhhhlHHHHHhhhhlhhhhhHHHHHH


DSSP  HHHHHHHLLLEEEEELLhhhlLLLHHHHHHHHHHH---HHEEEEELL-------------
Query RRLMQWLGIDRVIITQGnahqRDNGNTLACVAEMG---EAAHAVVII-------------   94
ident  |     |                   |            |                   
Sbjct VRRTLKNGTTTACYFAT----IHTDSSLLLADITDkfgQRAFVGKVCmdlndtfpeyket  176
DSSP  HHHHHHLLEEEEEEELL----LLHHHHHHHHHHHHhhlLEEEEELEElllllllllllll


DSSP  ---LLLLlHHHHHHHHHL-----LEEEEEEELLllllLLHH-HHHHHHHHHHHLLLEEEE
Query ---DATTtEKDMEKLTAA-----GTVGARIMDLpggaVNLS-ELDAVDERAHAADWMVAV  145
ident         |                       |                 |   |     
Sbjct teeSIKEtERFVSEMLQKnysrvKPIVTPRFSL----SCSEtLMGELGNIAKTRDLHIQS  232
DSSP  hhhHHHHhHHHHHHHHHHlllleEEEEEELLHH----HLLHhHHHHHHHHHHHHLLEEEE


DSSP  EL-----LHHH-------hHHHHHHHHLLLL---EEEELHHHhlllllllllhhHHHHHH
Query QF-----DGNG-------lLDHLPRLQKIRS---RWVFDHHGkffkgirtdgpeMAALLK  190
ident                            |        |  |               |  | 
Sbjct HIsenrdEVEAvknlypsyKNYTSVYDKNNLltnKTVMAHGC----------ylSAEELN  282
DSSP  EElllhhHHHHhhhhllllLLHHHHHHHLLLlllLEEEEELL----------llLHHHHH


DSSP  HHHHLLEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLhhHEEELLLLLLlllllhhh
Query LIDRGNLWFKFA--GVYESSrkswpyadVAAFSRVIAAHApeRIVWGTNWPHnsvretaa  248
ident                    |                  |    |  ||            
Sbjct VFHERGASIAHCpnSNLSLS-------sGFLNVLEVLKHE-vKIGLGTDVAG--------  326
DSSP  HHHHHLLEEEELhhHHHHLL-------lLLLLHHHHHHLL-lEEEELLLLLL--------


DSSP  lLLHH--HHHHHHHLLL------------LLHHHHHHHHLHHHHH-HHLLLLL-------
Query yPDDA--RLAELTLGWL------------PDEAARHRALVENPEA-LFKLSPV-------  286
ident                                     |         |             
Sbjct gYSYSmlDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQaLGLDGEIgnfevgk  386
DSSP  lLLLLhhHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHhLLLLLLLlllllll


DSSP  ----------------------------------------------------------
Query ----------------------------------------------------------  286
ident                                                           
Sbjct efdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  llleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 50: Query=4mupB Sbjct=3au2A Z-score=10.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------lllllllllllLLLLllLEELLLLLLlllllllllllll
Query ---------------------lvrklsgtapnPAFPrgAVDTQMHMYlpgypalpggpgl   39
ident                                         | | |               
Sbjct yaalglpwippplredqgeveaalegrlpkllELPQ-vKGDLQVHST-------------  346
DSSP  hhhlllllllhhhlllllhhhhhhllllllllLHHH-lLEEEEELLL-------------


DSSP  llllLLLHHHHHHHHHHHLLLEEEEELLH-------HHLL-LLHHHHHHHHHHHH-----
Query ppgaLPGPEDYRRLMQWLGIDRVIITQGN-------AHQR-DNGNTLACVAEMGE-----   86
ident         |         |      |                            |     
Sbjct ysdgQNTLEELWEAAKTMGYRYLAVTDHSpavrvagGPSPeEALKRVGEIRRFNEthgpp  406
DSSP  llllLLLHHHHHHHHHHHLLLEEEEEEELhhhhlllLLLHhHHHHHHHHHHHHHHhhlll


DSSP  HEEEEelllllllhhhhhhhhhlleeeEEEELlllllllHHHHhhHHHHHHhlllEEEEE
Query AAHAVviidatttekdmekltaagtvgARIMDlpggavnLSELdaVDERAHaadwMVAVQ  146
ident    |                       |                  |         | | 
Sbjct YLLAG----------------------AEVDI----hpdGTLD-yPDWVLR-eldLVLVS  438
DSSP  EEEEE----------------------EEEEL----lllLLLL-lLHHHHL-lllEEEEE


DSSP  LL------hhHHHHHHHHHHLLLLEEEELHhHHLL-----LLLLlllHHHHHHHHHHHHL
Query FD------gnGLLDHLPRLQKIRSRWVFDHhGKFF-----KGIRtdgPEMAALLKLIDRG  195
ident                |          |  |            |        |        
Sbjct VHsrfnlpkaDQTKRLLKALENPFVHVLAH-PTARllgrrAPIE---ADWEAVFQKAKEK  494
DSSP  LLllllllhhHHHHHHHHHHLLLLLLEELL-LLLLlllllLLLL---LLHHHHHHHHHHH


DSSP  LEEEEEL-LHHHllllllllhhHHHHHHHHHHHLhhHEEELLLLLLlllllhhhlLLHHh
Query NLWFKFA-GVYEssrkswpyadVAAFSRVIAAHApeRIVWGTNWPHnsvretaayPDDAr  254
ident                            |         |   |                  
Sbjct GVAVEIDgYYDR-------mdlPDDLARMAYGMG-lWISLSTDAHQ--------tDHLR-  537
DSSP  LLEEEEElLLLL-------lllLHHHHHHHHHLL-lLEEEELLLLL--------hHHHH-


DSSP  HHHHHHLLL---LLHHHhhHHHLH---hHHHHHL-llll
Query LAELTLGWL---PDEAArhRALVE---nPEALFK-lspv  286
ident   ||  |                          |     
Sbjct FMELAVGTAqraWIGPE-rVLNTLdyedLLSWLKarrgv  575
DSSP  HHHHHHHHHhhlLLLLL-lLHHHLlhhhHHHHHHlllll


No 51: Query=4mupB Sbjct=2a3lA Z-score=10.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------lllllllllllLLLLlLLEELLLLLL-------
Query ---------------------------lvrklsgtapnPAFPrGAVDTQMHMY-------   26
ident                                              |||  |         
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNV-RKVDTHVHHSacmnqkh  179
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLL-LEEEEEEELLllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   26
ident                                                             
Sbjct llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll


DSSP  ---------------lllLLLLllllllllllLLLHHHHHHHHHHHLLlEEEEELlhhHL
Query ---------------lpgYPALpggpglppgaLPGPEDYRRLMQWLGIdRVIITQgnaHQ   71
ident                                          |                  
Sbjct fnlkynpcgqsrlreiflKQDN--liqgrflgEITKQVFSDLEASKYQ-MAEYRI---SI  293
DSSP  lhhhhllllllhhhhhhlLLLL--llllllhhHHHHHHHHHHLLLLLE-EEEEEE---EL


DSSP  LL--------lhhhhhhhhHHHHHEEEEEL-------------------lLLLL---LHH
Query RD--------ngntlacvaEMGEAAHAVVI-------------------iDATT---TEK  101
ident                       |                                     
Sbjct YGrkmsewdqlaswivnndLYSENVVWLIQlprlyniykdmgivtsfqniLDNIfipLFE  353
DSSP  LLllllhhhhhhhhhhlllLLLLLEEEEEEeellhhhhlllllllllhhhHHHHllhHHH


DSSP  H---------hHHHHhLLEEEEEEELL--------------------lllllLHHHHHHH
Query D---------mEKLTaAGTVGARIMDL--------------------pggavNLSELDAV  132
ident                    ||    |                                  
Sbjct AtvdpdshpqlHVFL-KQVVGFDLVDDeskperrptkhmptpaqwtnafnpaFSYYVYYC  412
DSSP  HhhlhhhllllHHHH-LLEEEEEEELLlllllllllllllllllllllllllHHHHHHHH


DSSP  HHHHHHL----------LLEEEEELLHHHHHHHHHHHHLLlleEEELhHHHLllllllll
Query DERAHAA----------DWMVAVQFDGNGLLDHLPRLQKIrsrWVFDhHGKFfkgirtdg  182
ident                             |  |||              ||          
Sbjct YANLYVLnklreskgmtTITLRPHSGEAGDIDHLAATFLT--cHSIA-HGIN------lr  463
DSSP  HHHHHHHhhhhllllllLLEELLLLLLLLLLHHHHHHHHH--lLLLL-LLHH------hh


DSSP  HHHHHHHHHHHHLlEEEEEL--LHHHLLLLlllLHHHhhHHHHHHHHLhhHEEELLLLLL
Query PEMAALLKLIDRGnLWFKFA--GVYESSRKswpYADVaaFSRVIAAHApeRIVWGTNWPH  240
ident                                  |        |            |  | 
Sbjct KSPVLQYLYYLAQ-IGLAMSplSNNSLFLD---YHRN--PFPVFFLRG-lNVSLSTDDPL  516
DSSP  HLHHHHHHHHHHL-LLEEELhhHHLLLLLL---LLLL--LHHHHHHLL-lLEEELLLLHH


DSSP  LLlllhhhLLLH--HHHHHHHHL-LLLLHHHHHHHHLhHHHHHHLLLLL-----------
Query NSvretaaYPDD--ARLAELTLG-WLPDEAARHRALVeNPEALFKLSPV-----------  286
ident                         |             |       |             
Sbjct QI-----hLTKEplVEEYSIAASvWKLSACDLCEIAR-NSVYQSGFSHAlkshwigkdyy  570
DSSP  HH-----lLLLLhhHHHHHHHHHhHLLLHHHHHHHHH-HHHHHLLLLHHhhhhhllllll


DSSP  ----------------------------------------------
Query ----------------------------------------------  286
ident                                               
Sbjct krgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=4mupB Sbjct=3ooqA Z-score=10.3

back to top
DSSP  ------------------------------------llllllllllllllLLLLEELLLL
Query ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
ident                                                     | ||   |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  LL------lLLLL---LLLL--llllllllLLLH-HHHHHHHHHHLLLEEEEELLHH---
Query MY------lPGYP---ALPG--gpglppgaLPGP-EDYRRLMQWLGIDRVIITQGNA---   69
ident            |                     |           |   | |  | |   
Sbjct IGlfeegvgYYYSdgnEATDpvtphvkaldGFNPqDPAIERALAGGVTSVXIVPGSAnpv  120
DSSP  LLlllllllHHHLlllLLLLlllllllhhhHLLLlLHHHHHHHLLLEEEEEELLLLLlle


DSSP  --hllllhhhhhhHHHHHHheeeeelllllllhhhhhhhhhlLEEEEEEELLLLL-----
Query --hqrdngntlacVAEMGEaahavviidatttekdmekltaaGTVGARIMDLPGG-----  122
ident              | |                             |              
Sbjct ggqgsvikfrsiiVEECIV----------------------kDPAGLKXAFGENPkrvyg  158
DSSP  eeeeeeeelllllHHHHEE----------------------eEEEEEEEELLHHHhhhhh


DSSP  ---------llLHHHHH------------------------------hHHHHHHHLLLEE
Query ---------avNLSELD------------------------------aVDERAHAADWMV  143
ident                                                 | |         
Sbjct erkqtpstrxgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxeVGEXVLRKKIPA  218
DSSP  hlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhHHHHHHLLLLLE


DSSP  EEELLHHHH-HHHHHHHH-LLLLeEEELHhHHLLlllllllhhHHHHHHHHHHLlEEEEE
Query AVQFDGNGL-LDHLPRLQ-KIRSrWVFDHhGKFFkgirtdgpeMAALLKLIDRGnLWFKF  201
ident           |              |  | |                  |          
Sbjct RXHAHRADDiLTAIRIAEeFGFN-LVIEH-GTEA---------YKISKVLAEKK-IPVVV  266
DSSP  EEEELLHHHhHHHHHHHHhHLLL-EEEEE-LLLH---------HHHHHHHHHHL-LLEEE


DSSP  LLHHHLLLlllllhHHHHHHHHHHHHLhhHEEELLLLLLlllllhhhllLHHHHHHHHhL
Query AGVYESSRkswpyaDVAAFSRVIAAHApeRIVWGTNWPHnsvretaaypDDARLAELTlG  261
ident                               |      |                |     
Sbjct GPLLTFRTklelkdLTXETIAKLLKDG-vLIALXCDHPV------ipleFATVQAATAxR  319
DSSP  LLLLLLLLlhhhllLLLLHHHHHHHLL-lLEEELLLLLL------llhhHHHHHHHHHhH


DSSP  LLLLHHHHHHHHLHHHHHHHLLLLL-----------------------------------
Query WLPDEAARHRALVENPEALFKLSPV-----------------------------------  286
ident     |      |  ||     |                                      
Sbjct YGAKEEDLLKILTVNPAKILGLEDRigsiepgkdadlvvwsghpfdxksvvervyidgve  379
DSSP  HLLLHHHHHHLLLHHHHHHLLLLLLllllllllllleeeelllllllllleeeeeellee


DSSP  -----
Query -----  286
ident      
Sbjct vfrre  384
DSSP  eeell


No 53: Query=4mupB Sbjct=3dcpA Z-score=9.8

back to top
DSSP  llllllllllllllllLLEELLLLLLlllllllllllLLLLllLLLHHHHHHHHHHHLLL
Query lvrklsgtapnpafprGAVDTQMHMYlpgypalpggpGLPPgaLPGPEDYRRLMQWLGID   60
ident                    |   |                       |        |  |
Sbjct ----------------XKRDGHTHTE---------fcPHGT--HDDVEEXVLKAIELDFD   33
DSSP  ----------------LLEEEEELLL---------llLLLL--LLLHHHHHHHHHHLLLL


DSSP  EEEEELL--------------------HHHLL-LLHHHHHHHHHHHH------HEEEEel
Query RVIITQG--------------------NAHQR-DNGNTLACVAEMGE------AAHAVvi   93
ident    |                             |                     |    
Sbjct EYSIVEHaplssefxkntagdkeavttASXAXsDLPYYFKKXNHIKKkyasdlLIHIG--   91
DSSP  EEEEEEEllllhhhhhllllllhhhhlLLLLHhHHHHHHHHHHHHHHhlllllEEEEE--


DSSP  llllllhhhhhhhhhlleeeEEEELllllllLHHHHHHHHHHHhHLLL----eEEEELL-
Query idatttekdmekltaagtvgARIMDlpggavNLSELDAVDERAhAADW----mVAVQFD-  148
ident                                     |                       
Sbjct --------------------FEVDY------LIGYEDFTRDFL-NEYGpqtddGVLSLHf  124
DSSP  --------------------EEEEL------LLLLHHHHHHHH-HHHHhhlleEEEELLe


DSSP  --------------------------------hHHHHHHHHHHHLLL---LEEEELHhHH
Query --------------------------------gNGLLDHLPRLQKIR---SRWVFDHhGK  173
ident                                    |                    |   
Sbjct legqggfrsidfsaedynegivqfyggfeqaqlAYLEGVKQSIEADLglfKPRRXGH-IS  183
DSSP  eeelleeeellllhhhhhhhlhhhhllhhhhhhHHHHHHHHHHHLLLlllLLLEELL-LL


DSSP  LLL-------------llllLLHHHHHHHHHHHHLlEEEEELLHHHllLLLLllhhHHHH
Query FFK-------------girtDGPEMAALLKLIDRGnLWFKFAGVYEssRKSWpyadVAAF  220
ident                            |     |      |                   
Sbjct LCQkfqqffgedtsdfseevXEKFRVILALVKKRD-YELDFNTAGLfkPLCGetypPKKI  242
DSSP  HHHllhhhhlllhhhllhhhHHHHHHHHHHHHHHL-LEEEEELHHHhlLLLLllllLHHH


DSSP  HHHHHHHLHhHEEELLLLLllllllhhhlllHHHHHHHHHLLLLlhhhhhhhhlhhhhhh
Query SRVIAAHAPeRIVWGTNWPhnsvretaaypdDARLAELTLGWLPdeaarhralvenpeal  280
ident             | |                  |        |                 
Sbjct VTLASELQI-PFVYGSDSH--------gvqdIGRGYSTYCQKLE----------------  277
DSSP  HHHHHHLLL-LEEEELLLL--------lhhhLLLLHHHHHHHLL----------------


DSSP  hlllll
Query fklspv  286
ident       
Sbjct ------  277
DSSP  ------


No 54: Query=4mupB Sbjct=1m65A Z-score=9.0

back to top
DSSP  llllllllllllllllLLEELLLLLLllllllllllLLLLlllLLLHHHHHHHHHHHLLL
Query lvrklsgtapnpafprGAVDTQMHMYlpgypalpggPGLPpgaLPGPEDYRRLMQWLGID   60
ident                   ||  ||                        ||       || 
Sbjct ----------------YPVDLHMHTV---------aSTHA---YSTLSDYIAQAKQKGIK   32
DSSP  ----------------LLEELLLLLL---------lLLLL---LLLHHHHHHHHHHHLLL


DSSP  EEEEELLH-----HHLLLL-HHHHHhhHHHHH---HEEEE---elllllllhhhHHHHHH
Query RVIITQGN-----AHQRDN-GNTLAcvAEMGE---AAHAV---viidatttekdMEKLTA  108
ident    ||        |       |                                  |   
Sbjct LFAITDHGpdmedAPHHWHfINMRI--WPRVVdgvGILRGieaniknvdgeidcSGKMFD   90
DSSP  EEEEEEELlllllLLLLHHhHHHHH--LLLEElleEEEEEeeeellllllllllLHHHHH


DSSP  LlEEEEeeellllllllhhhhhhhhhhhhhllleeEEELL--------hhHHHHHHHHHh
Query AgTVGArimdlpggavnlseldavderahaadwmvAVQFD--------gnGLLDHLPRLq  160
ident                                       |                     
Sbjct S-LDLI-----------------------------IAGFHepvfaphdkaTNTQAMIATi  120
DSSP  H-LLEE-----------------------------EEELLllllllllhhHHHHHHHHHh


DSSP  LLLLEEEELHHHHlLLLLllllhHHHHHHHHHHHLLEEEE-ELLHhhllllllllhhhhh
Query KIRSRWVFDHHGKfFKGIrtdgpEMAALLKLIDRGNLWFK-FAGVyessrkswpyadvaa  219
ident          | |   |          |                                 
Sbjct ASGNVHIISHPGN-PKYE----iDVKAVAEAAAKHQVALEiNNSS---------------  160
DSSP  HLLLLLEELLLLL-LLLL----lLHHHHHHHHHHHLLEEEeELLL---------------


DSSP  HHHHHHHHLH---hHEEELLLLLLlllllhhhlllhhhHHHHHHLLL--LLHHHhhHHHL
Query FSRVIAAHAP---eRIVWGTNWPHnsvretaaypddarLAELTLGWL--PDEAArhRALV  274
ident   |  ||           |                     |  |  |   |        |
Sbjct NCREVAAAVRdaggWVALGSDSHT---------aftmgEFEECLKILdaVDFPPerILNV  211
DSSP  LHHHHHHHHHhhllLEEEELLLLL---------hhhllLLHHHHHHHhhLLLLHhhLHHH


DSSP  H--HHHHHHL---------llll
Query E--NPEALFK---------lspv  286
ident                        
Sbjct SprRLLNFLEsrgmapiaefadl  234
DSSP  LhhHHHHHHHhllllllhhhlll


No 55: Query=4mupB Sbjct=3f2bA Z-score=8.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ---------------------------------lllllLLLLLLLLlLLLLEELLLLLLl
Query ---------------------------------lvrklSGTAPNPAfPRGAVDTQMHMYl   27
ident                                             |      |    |   
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanERQDTAPE-GEKRVELHLHTP-  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllLLLLLLLL-LLLLLLLLLLLL-


DSSP  lllllllllLLLLlllLLLHHHHHHHHHHHLLLEEEEELLHhhlllLHHHHHHHHHHH--
Query pgypalpggPGLPpgaLPGPEDYRRLMQWLGIDRVIITQGNahqrdNGNTLACVAEMG--   85
ident                               |      |                      
Sbjct -------msQMDA---VTSVTKLIEQAKKWGHPAIAVTDHA-----VVQSFPEAYSAAkk  163
DSSP  -------llLLLL---LLLHHHHHHHHHHLLLLLEEELLLL-----LLLLHHHHHHHHhh


DSSP  --HHEEEEElllllllhhhhhhhhhlleeeeEEEL-------------------------
Query --EAAHAVViidatttekdmekltaagtvgaRIMD-------------------------  118
ident                                                             
Sbjct hgMKVIYGL----------------------EANIvddpfhvtllaqnetglknlfklvs  201
DSSP  hlLLEEEEE----------------------EEEEellleeeeeeellhhhhhhhhhhhh


DSSP  ------lllLLLLhhHHHHHHHHHhhLLLEeeeellhhhhhhhhhhhhlllleEEELH--
Query ------lpgGAVNlsELDAVDERAhaADWMvavqfdgnglldhlprlqkirsrWVFDH--  170
ident                                                             
Sbjct lshiqyfhrVPRI--PRSVLVKHR--DGLL-----------------------VGSGCdk  234
DSSP  hhhllllllLLLE--EHHHHHHLL--LLEE-----------------------EELLLll


DSSP  -hHHLLlllllllhhhhhHHHHHHHlLEEEEELLHHHLLLL-lllLHHHHHHHHHHHHHL
Query -hGKFFkgirtdgpemaaLLKLIDRgNLWFKFAGVYESSRK-swpYADVAAFSRVIAAHA  228
ident                                                      | | |  
Sbjct geLFDN------------VEDIARF-YDFLEVHPPDVYKPLyvkdEEMIKNIIRSIVALG  281
DSSP  llLLLL------------LLLLHHH-LLLEEELLHHHHLLLllllHHHHHHHHHHHHHHH


DSSP  H---HHEEELLLLLL---lLLLL----------------hHHLL---lhHHHHHHHHLLL
Query P---ERIVWGTNWPH---nSVRE----------------tAAYP---ddARLAELTLGWL  263
ident        |   |                                               |
Sbjct EkldIPVVATGNVHYlnpeDKIYrkilihsqgganplnrhELPDvyfrtTNEMLDCFSFL  341
DSSP  HhllLLEEELLLLLLllhhHHHHhhhhhhllhhhllllllLLLLlllllHHHHHHHHHHH


DSSP  lLHHHHHHHHLHHHHHH-HLLL--------------------------------------
Query pDEAARHRALVENPEAL-FKLS--------------------------------------  284
ident           | |                                               
Sbjct -GPEKAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeiremsyrrakeiygdplp  400
DSSP  -HHHHHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct klveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitev  460
DSSP  hhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct nplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdk  520
DSSP  llllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct vpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrg  580
DSSP  llleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct aeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsi  640
DSSP  hhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct hdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnv  700
DSSP  llllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct gtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevi  760
DSSP  llllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct gcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikym  820
DSSP  llhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct fpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeina  880
DSSP  llhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  284
ident                                                             
Sbjct kgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglg  940
DSSP  lhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllll


DSSP  ----------------------------------------------------ll
Query ----------------------------------------------------pv  286
ident                                                       
Sbjct tnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=4mupB Sbjct=1bksA Z-score=7.4

back to top
DSSP  lllllllllllllllllleeLLLLLLLllllllllllllllllLLLHHHHHHHHHHHlll
Query lvrklsgtapnpafprgavdTQMHMYLpgypalpggpglppgaLPGPEDYRRLMQWLgid   60
ident                                                     |       
Sbjct -meryenlfaqlndrregafVPFVTLG------------dpgiEQSLKIIDTLIDAG--a   45
DSSP  -lhhhhhhhhhhhhlllleeEEEEELL------------lllhHHHHHHHHHHHHLL--l


DSSP  EEEEELLHH-------------------hllLLHHHHHHHHHHHHH----eEEEEL---l
Query RVIITQGNA-------------------hqrDNGNTLACVAEMGEA----aHAVVI---i   94
ident                                         |   |               
Sbjct DALELGVPFsdpladgptiqnanlrafaagvTPAQCFEMLALIREKhptipIGLLMyanl  105
DSSP  LLEEEELLLlllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHlllllEEEEElhhh


DSSP  LLLLL-HHHHHHHHHLLEEEEEEElllllLLLHHHHHHHHHHHHHLLLEEEEELLHHHHH
Query DATTT-EKDMEKLTAAGTVGARIMdlpggAVNLSELDAVDERAHAADWMVAVQFDGNGLL  153
ident                 |             |   |       |             |   
Sbjct VFNNGiDAFYARCEQVGVDSVLVA-----DVPVEESAPFRQAALRHNIAPIFICPPNADD  160
DSSP  HHLLLhHHHHHHHHHHLLLEEEEL-----LLLHHHLHHHHHHHHHLLLEEEEEELLLLLH


DSSP  HHHHHHHLLllEEEELHHhhllLLLLLllHHHHHHHHHHhhllEEEEELLHHhlllllLL
Query DHLPRLQKIrsRWVFDHHgkffKGIRTdgPEMAALLKLIdrgnLWFKFAGVYessrksWP  213
ident | |        |                      |                        |
Sbjct DLLRQVASY-gRGYTYLL----ALPLH--HLIEKLKEYH---aAPALQGFGI-----sSP  205
DSSP  HHHHHHHHH-lLLLEEEL----LLLHH--HHHHHHHHHL---lLLEEELLLL-----lLH


DSSP  LHhhHHHHHHHhhhlhhhEEELLLLLLLLL--LLHH--------hllLHHHHHHHHHlll
Query YAdvAAFSRVIaahaperIVWGTNWPHNSV--RETA--------aypDDARLAELTLgwl  263
ident      |  |                          |                        
Sbjct EQ-vSAAVRAG------aAGAISGSAIVKIieKNLAspkqmlaelrsFVSAMKAASR---  255
DSSP  HH-hHHHHHHL------lLEEEELLHHHHHhhHLLLlhhhhhhhhhhHHHHHHHLLL---


DSSP  llhhhhhhhhlhhhhhhhlllll
Query pdeaarhralvenpealfklspv  286
ident                        
Sbjct -----------------------  255
DSSP  -----------------------


No 57: Query=4mupB Sbjct=3e38A Z-score=6.6

back to top
DSSP  llllllllLLLL----llLLLLEELLLLLLlllllllllllllllllLLLHhHHHHHHHH
Query lvrklsgtAPNP----afPRGAVDTQMHMYlpgypalpggpglppgaLPGPeDYRRLMQW   56
ident                        |   |                                
Sbjct ---aqrrnEIQVpdldgyTTLKCDFHXHSV------------fsdglVWPT-VRVDEAYR   44
DSSP  ---lllllLLLLllllllEEEEEELLLLLL------------lllllLLHH-HHHHHHHH


DSSP  HLLLEEEEELL--HHHL------LLLHHHHHHHHHHH---hHEEEEElllllllhhhhhh
Query LGIDRVIITQG--NAHQ------RDNGNTLACVAEMG---eAAHAVViidatttekdmek  105
ident  | |    |                |     |                            
Sbjct DGLDAISLTEHieYRPHkqdvvsDHNRSFDLCREQAEklgiLLIKGS-------------   91
DSSP  LLLLEELLEEEllLLLLllllllLLLHHHHHHHHHHHhhllEELLEE-------------


DSSP  hhhlleeeeEEELL------------llllllHHHHHHHHHHHHHLLLEeeeellhhhhh
Query ltaagtvgaRIMDL------------pggavnLSELDAVDERAHAADWMvavqfdgngll  153
ident           |                               |                 
Sbjct ---------EITRAxapghfnaiflsdsnpleQKDYKDAFREAKKQGAF-----------  131
DSSP  ---------EEELLlllleeeeelllllhhhlLLLHHHHHHHHHHLLLE-----------


DSSP  hhhhhhhlllleEEELHHHH---LLLLLLlllhHHHHHHHHHHHL-LEEEE-ELLHHhll
Query dhlprlqkirsrWVFDHHGK---FFKGIRtdgpEMAALLKLIDRG-NLWFK-FAGVYess  208
ident                 | |                     |   |         |     
Sbjct ------------XFWNHPGWdsqQPDTTK----WWPEHTALYQEGcXHGIEvANGHL---  172
DSSP  ------------EEELLLLLlllLLLLLL----LLHHHHHHHHLLlLLEEEeEELLE---


DSSP  llllllhhhHHHHHHHHHHLHHHEEELLLLLLlllllhhHLLL----hHHHHhhhhllll
Query rkswpyadvAAFSRVIAAHAPERIVWGTNWPHnsvretaAYPD----dARLAeltlgwlp  264
ident                                                             
Sbjct --------yXPEAIQWCLDKNLTXIGTSDIHQ-----piQTDYdfekgEHRT--------  211
DSSP  --------eLLHHHHHHHHHLLEEEEELLLLL-----lhHHHLlhhhlLLLL--------


DSSP  lhhhhhhhHLHHhhhhhlLLLL--------------------------------------
Query deaarhraLVENpealfkLSPV--------------------------------------  286
ident                   |                                         
Sbjct -------xTFVF-akersLQGIrealdnrrtaayfhelligredllrpffekcvkieevs  263
DSSP  -------eEEEE-ellllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  286
ident                                                             
Sbjct rneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
DSSP  eelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeee


DSSP  -------------------
Query -------------------  286
ident                    
Sbjct evtnfivapdkglkytisl  342
DSSP  eeeeeeeelleeeeeeeel


No 58: Query=4mupB Sbjct=2yb1A Z-score=6.3

back to top
DSSP  lllllllllllllllllLEELLLLLLllllllllllllllllllLLHHHHHHHHhhhlLL
Query lvrklsgtapnpafprgAVDTQMHMYlpgypalpggpglppgalPGPEDYRRLMqwlgID   60
ident                    |   |                                    
Sbjct ----------------aNIDLHFHSR---------tsdgaltptEVIDRAAARA----PA   31
DSSP  ----------------lLEELLLLLL---------lllllllhhHHHHHHHLLL----LL


DSSP  EEEEELLHhhlllLHHHHHHHHHHH---HHEEEEElllllllhhhhhhhhhlleeeeEEE
Query RVIITQGNahqrdNGNTLACVAEMG---EAAHAVViidatttekdmekltaagtvgaRIM  117
ident     |         |      |            |                         
Sbjct LLALTDHD----cTGGLAEAAAAAArrgIPFLNGV----------------------EVS   65
DSSP  EEEELLLL----lLLLHHHHHHHHHhllLLEEEEE----------------------EEE


DSSP  L-----------------------------------------------------------
Query D-----------------------------------------------------------  118
ident                                                             
Sbjct Vswgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwc  125
DSSP  Eeelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlll


DSSP  ------------------------------------lllllllHHHHHHHHHHHHHLLLE
Query ------------------------------------lpggavnLSELDAVDERAHAADWM  142
ident                                               |         |  |
Sbjct dnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqWASLEDAVGWIVGAGGM  185
DSSP  llhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllLLLHHHHHHHHHHLLLE


DSSP  eeeellhhhhhhhhhhhhlllleEEELHHHHLllLLLLllHHHHHHHHHHHH-lLEEEE-
Query vavqfdgnglldhlprlqkirsrWVFDHHGKFfkGIRTdgPEMAALLKLIDR-gNLWFK-  200
ident                         |  | |               |              
Sbjct -----------------------AVIAHPGRY--DMGR--TLIERLILDFQAagGQGIEv  218
DSSP  -----------------------EEELLHHHL--LLLH--HHHHHHHHHHHHllLLEEEe


DSSP  ELLHhhllllllllhhHHHHHHHHHHHLH---HHEEELLLLLLLLLllhhhlllhhhhhh
Query FAGVyessrkswpyadVAAFSRVIAAHAP---ERIVWGTNWPHNSVretaaypddarlae  257
ident   |                     | ||         |                      
Sbjct ASGS-----------hSLDDMHKFALHADrhgLYASSGSDFHAPGE----------dvgh  257
DSSP  EELL-----------lLHHHHHHHHHHHHhhlLEEEEELLLLLLLL----------llll


DSSP  hHHLLlllHHHHhhhhlHHHHHhhLLLL--------l
Query lTLGWlpdEAARhralvENPEAlfKLSP--------v  286
ident            |                         
Sbjct tEDLP---PICR-----PIWRE--LEARilrpadaen  284
DSSP  lLLLL---LLLL-----LHHHH--LHHHlllllhhhl


No 59: Query=4mupB Sbjct=2anuA Z-score=5.7

back to top
DSSP  llllllllllllllLLLLEELLLLLLlllllllllllllllllLLLH---HHHHHHHhhh
Query lvrklsgtapnpafPRGAVDTQMHMYlpgypalpggpglppgaLPGP---EDYRRLMqwl   57
ident                    |   |                   ||               
Sbjct -------------tEWLLCDFHVHTN------------xsdghLPLGevvDLFGKHG---   32
DSSP  -------------lEEEEEEEEELLL------------lllllLLHHhhhHHHHHLL---


DSSP  lLLEEEEELLH-----------------HHLL-----LLHHHHHHHHHHH----HHEEEE
Query gIDRVIITQGN-----------------AHQR-----DNGNTLACVAEMG----EAAHAV   91
ident   | | ||                    |                               
Sbjct -VDVVSITDHIvdrrtleqrkrngeplgAITEdkfqdYLKRLWREQKRAWeeygXILIPG   91
DSSP  -LLEEEEEEEEelhhhhhhhhhllllllLLLLllhhhHHHHHHHHHHHHHhhhlLEEEEE


DSSP  elllllllhhhhhhhhhlleeeeEEELLL-----------lllLLHHHHHHHHHHHHHLL
Query viidatttekdmekltaagtvgaRIMDLP-----------ggaVNLSELDAVDERAHAAD  140
ident                         |                            |      
Sbjct ----------------------vEITNNTdlyhivavdvkeyvDPSLPVEEIVEKLKEQN  129
DSSP  ----------------------eEEEELLlleeeeeellllllLLLLLHHHHHHHHHHLL


DSSP  LEeeeellhhhhhhhhhhhhlllleEEELhHHHL-LLLLllllhhhHHHHHHHhHLLEEE
Query WMvavqfdgnglldhlprlqkirsrWVFDhHGKF-FKGIrtdgpemAALLKLIdRGNLWF  199
ident                               |               |             
Sbjct AL-----------------------VIAA-HPDRkKLSW----ylwANXERFK-DTFDAW  160
DSSP  LE-----------------------EEEL-LLLLlLLLL----hhhHLLLLLL-LLLLEE


DSSP  E-ELLHHhllllllllhhhhhhHHHHHHHLHhHEEELLLLLLlllllhhhlLLHHhhhhh
Query K-FAGVYessrkswpyadvaafSRVIAAHAPeRIVWGTNWPHnsvretaayPDDArlael  258
ident                                 | |                         
Sbjct EiANRDD--------------lFNSVGVKKY-RYVANSDFHE--------lWHVY-----  192
DSSP  EeEELLE--------------eLHHHHHLLL-LEEEELLLLL--------hHHHL-----


DSSP  hhlllllhhhhhhHHLHhhhhhhlLLLL-----------------
Query tlgwlpdeaarhrALVEnpealfkLSPV-----------------  286
ident               ||                             
Sbjct ----------swkTLVK---seknIEAIkeairkntdvaiylxrk  224
DSSP  ----------leeEEEE---elllHHHHhhhhhhllleeeeelll