Results: dupa

Query: 4hk5D

MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4hk5-D 68.9  0.0  380   380  100 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   2:  4ofc-A 36.3  2.6  316   335   23 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   3:  4qrn-A 35.4  2.7  316   352   20 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   4:  2dvt-A 34.4  2.8  304   325   24 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   5:  2gwg-A 27.7  3.2  289   329   17 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   6:  4dzi-C 26.3  3.5  303   388   17 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
   7:  3cjp-A 22.4  2.5  225   262   23 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   8:  4dlf-A 21.8  2.7  240   287   15 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   9:  2ffi-A 20.6  2.8  237   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  10:  3irs-A 20.2  3.1  241   281   17 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  11:  4mup-B 19.2  3.3  243   286   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  12:  1gkp-A 16.9  3.3  261   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  4b3z-D 16.6  3.2  260   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  14:  1yrr-B 16.0  3.1  224   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  15:  2y1h-B 15.9  3.1  221   265   14 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  16:  2qpx-A 15.8  3.7  238   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  17:  1itq-A 15.6  3.4  238   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  18:  3gg7-A 15.5  3.5  215   243   13 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  19:  4cqb-A 15.5  4.4  244   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  20:  2paj-A 15.4  3.4  222   421   13 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  21:  2vun-A 15.3  3.4  229   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  22:  1onx-A 14.9  3.1  230   390   14 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  23:  3nqb-A 14.7  3.5  225   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  24:  3giq-A 14.7  3.6  239   475   14 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  25:  3gri-A 14.4  3.7  240   422    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  26:  3pnu-A 14.3  3.1  223   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  27:  3ls9-A 14.3  3.7  236   453   11 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  28:  1k6w-A 14.2  4.2  246   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  29:  1a4m-A 14.2  4.3  241   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  30:  2ob3-A 14.1  3.6  228   329   12 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  31:  1bf6-A 14.1  3.6  233   291    9 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  32:  3e74-A 14.1  3.4  236   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  33:  1j6p-A 14.0  3.5  230   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  34:  2ogj-A 13.9  3.7  234   379   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  35:  3mkv-A 13.8  3.6  214   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  36:  3mtw-A 13.6  3.4  216   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  37:  3icj-A 13.4  3.7  230   468   14 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  38:  3k2g-B 13.4  3.6  243   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  39:  2oof-A 13.4  4.5  235   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  40:  4c5y-A 13.3  3.8  217   436   17 PDB  MOLECULE: OCHRATOXINASE;                                             
  41:  2vc5-A 12.8  4.1  224   314   10 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  42:  2imr-A 12.7  4.0  227   380   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  43:  4rdv-B 12.6  3.5  229   451   14 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  44:  2uz9-A 12.1  3.8  220   444   10 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  45:  3iac-A 11.9  4.2  237   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  46:  1j5s-A 11.9  4.2  234   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  47:  1a5k-C 11.6  3.3  211   566   10 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  48:  3qy6-A 10.9  3.4  188   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  2a3l-A 10.5  3.9  235   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  50:  1v77-A 10.1  3.3  167   202    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  3ooq-A  9.8  3.6  188   384   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  52:  3au2-A  9.6  3.7  185   575   16 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  1m65-A  8.7  3.6  172   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3dcp-A  8.2  3.8  180   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  8.0  3.6  159   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2anu-A  6.7  3.3  145   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  57:  2yb1-A  6.0  3.8  148   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  1bks-A  5.8  3.9  160   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  59:  3e38-A  5.7  3.8  151   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4hk5D Sbjct=4hk5D Z-score=68.9

back to top
DSSP  LLLLEEEEEEELLHHHHHHHHLLLLLLEEEEELLEEEEEEELLHHHHHHHHHHHHLLLLL
Query TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAK   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAK   60
DSSP  LLLLEEEEEEELLHHHHHHHHLLLLLLEEEEELLEEEEEEELLHHHHHHHHHHHHLLLLL


DSSP  LLLEELLHHHLLHHHHHHHHHHLLLLEEEEEELLLLLLLLLLLLHHHHHHHHHHHHHHHH
Query LPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMC  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMC  120
DSSP  LLLEELLHHHLLHHHHHHHHHHLLLLEEEEEELLLLLLLLLLLLHHHHHHHHHHHHHHHH


DSSP  HLLLLLEEEEEELLLLLLHHHHHHHHHHHHLLLLEEEEEELLLLLLLLLLLHHHHHHHHH
Query AQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEA  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEA  180
DSSP  HLLLLLEEEEEELLLLLLHHHHHHHHHHHHLLLLEEEEEELLLLLLLLLLLHHHHHHHHH


DSSP  HHHLLLEEEELLLLLLLHHHHLLLHHHLLLHHHHHLHHHHHHHHHHHHHHHLLHHHHLLL
Query VADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRN  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRN  240
DSSP  HHHLLLEEEELLLLLLLHHHHLLLHHHLLLHHHHHLHHHHHHHHHHHHHHHLLHHHHLLL


DSSP  LLEEEHHHHLLHHHHHHHHHHHHHLLHHHHHLLLLLLLLLLHHHHHHHLEEEELLLLLHH
Query LQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEV  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEV  300
DSSP  LLEEEHHHHLLHHHHHHHHHHHHHLLHHHHHLLLLLLLLLLHHHHHHHLEEEELLLLLHH


DSSP  HHHHHHHHHLHHHEELLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHL
Query GLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMG  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMG  360
DSSP  HHHHHHHHHLHHHEELLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHL


DSSP  HHHHHHLLLHHHHHHHHHHL
Query LNAVRVLSLKAELEHHHHHH  380
ident ||||||||||||||||||||
Sbjct LNAVRVLSLKAELEHHHHHH  380
DSSP  HHHHHHLLLHHHHHHHHHHL


No 2: Query=4hk5D Sbjct=4ofcA Z-score=36.3

back to top
DSSP  lllLEEEEEEELLHHhhHHHHL----lLLLLEEEEEllEEEEEEEllhhhhhhhhhhhhl
Query tpvVVDIHTHMYPPSyiAMLEK----rQTIPLVRTFpqADEPRLIllsselaaldaalad   56
ident      ||| |  |        |                  |  |                
Sbjct --mKIDIHSHILPKE--WPDLKkrfgyGGWVQLQHH-sKGEAKLL---------------   40
DSSP  --lLEEEEEELLLLL--LLLHHhhhllLLLEEEEEE-eLLEEEEE---------------


DSSP  llllLLLEELLHHHLLHHHHHHHHHHLLLLEEEEEELLL-LLLLLLLLLHHHHHHHHHHH
Query paakLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANP-WFDFLAPDEAPGIADAVNAE  115
ident        |               ||  |  |   |           |          |  
Sbjct -kdgKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVmFSYWAKPEDTLNLCQLLNND   99
DSSP  -ellEEEEEEEHHHLLHHHHHHHHHHHLLLEEEEELLHHhHLLLLLHHHHHHHHHHHHHH


DSSP  HHHHHHLLLLLEEEEEELLLLLlHHHHHHHHHHHHLLLLEEEEEELLLLLLLLLLLHHHH
Query FSDMCAQHVGRLFFFAALPLSApVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLL  175
ident           |      ||  |         ||        |   ||      |    | 
Sbjct LASTVVSYPRRFVGLGTLPMQA-PELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELF  158
DSSP  HHHHHHHLLLLEEEEELLLLLL-HHHHHHHHHHHHHLLLLLEEEEELEELLEELLLHHHH


DSSP  HHHHHHHHLLLEEEELLLLLLLHHHHlllhhhLLLHHHHHLHHHHHHHHHHHHHHHLLHH
Query PVFEAVADAKLLVFLHPHYGLPNEVYgprseeYGHVLPLALGFPMETTIAVARMYMAGVF  235
ident ||  |    |   | ||                   ||   | | |||||   | | |||
Sbjct PVYAAAERLKCSLFVHPWDMQMDGRM------AKYWLPWLVGMPAETTIAICSMIMGGVF  212
DSSP  HHHHHHHHHLLEEEEELLLLLLLHHH------HLLLHHHHLHHHHHHHHHHHHHHLLLHH


DSSP  HHLLLLLEEEHHHHLLHHHHHHHHHHHHHLLHHHhhlllllllLLLHHHHHHhLEEEELL
Query DHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLvktgkvpkdRRTIWTVLKeQIYLDAV  295
ident      |    || ||  ||  |||         |                |    | || 
Sbjct EKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDL----caqdnPMNPKKYLG-SFYTDAL  267
DSSP  HHLLLLLEEELHHHLLHHHHHHHHHHHHHHLHHH----hllllLLLHHHHLL-LLEEELL


DSSP  LLLHHHHHHHHHHHLHHHEELLLLLLLLlllllllllllhHHHHhHHHHHHHHLLLLHHH
Query IYSEVGLQAAIASSGADRLMFGTDHPFFppieedvqgpwdSSRLnAQAVIKAVGEGSSDA  355
ident       |       | |    ||| ||                                 
Sbjct VHDPLSLKLLTDVIGKDKVILGTDYPFP----------lgELEP-GKLIESMEEFDEETK  316
DSSP  LLLHHHHHHHHHHHLLLLEELLLLLLLL----------llLLLL-LHHHHHLLLLLHHHH


DSSP  HHHHLHHHHHHL-LLHHHHhhhhhhl
Query AAVMGLNAVRVL-SLKAELehhhhhh  380
ident       ||   |              
Sbjct NKLKAGNALAFLgLERKQF-------  335
DSSP  HHHHLHHHHHHHlLLHHHL-------


No 3: Query=4hk5D Sbjct=4qrnA Z-score=35.4

back to top
DSSP  ------------LLLLEEEEEEELLHHHHHHHHLL---LLLLeeeeelleeeEEEEllhh
Query ------------TPVVVDIHTHMYPPSYIAMLEKR---QTIPlvrtfpqadePRLIllss   45
ident                             |          |                    
Sbjct smtqdlktggeqGYLRIATEEAFATREIIDVYLRMirdGTAD---kgmvslwGFYA----   53
DSSP  llllllllllllLLLLEEEEEEELLHHHHHHHHHHhhhLLLL---hhhhhhhHHHH----


DSSP  hhhhhhhhhhlllllLLLEE--LLHHHLLH-HHHHHHHHHLLLLEEEEEELLLLLLLL-L
Query elaaldaaladpaakLPGRP--LSTHFASL-AQKMHFMDTNGIRVSVISLANPWFDFL-A  101
ident                   |          |       ||  ||      |  |    |  
Sbjct -------------qsPSERAtqILERLLDLgERRIADMDATGIDKAILALTSPGVQPLhD  100
DSSP  -------------hlLLHHHhhHHHHHHLLlHHHHHHHHHLLLLEEEEEELLLLLLLLlL


DSSP  LLLHHHHHHHHHHHHHHHHHLLLLLEEEEEELLLLLlHHHHHHHHHHHHLLLLEEEEEEL
Query PDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSApVDAVKASIERVKNLKYCRGIILG  161
ident  |||   |   |    | |     |                   | |        ||   
Sbjct LDEARTLATRANDTLADACQKYPDRFIGMGTVAPQD-PEWSAREIHRGARELGFKGIQIN  159
DSSP  HHHHHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLL-HHHHHHHHHHHHHLLLLLLEEEL


DSSP  LLLLLLLLLLHHHHHHHHHHHHLLLEEEELLLLL---LLHHHHLllhhhllLHHHHHLHH
Query TSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYG---LPNEVYGprseeygHVLPLALGF  218
ident     |  ||     | | |          ||                           ||
Sbjct SHTQGRYLDEEFFDPIFRALVEVDQPLYIHPATSpdsMIDPMLE------aGLDGAIFGF  213
DSSP  LLLLLLLLLLHHHHHHHHHHHHHLLLEEELLLLLlllLLHHHHH------hLLLLLLLHH


DSSP  HHHHHHHHHHHHHLLHHHHLLLLLEEEHHHHLLHHHHHHHHHHHHHLL--HHHHhLLLLL
Query PMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHD--GHLVkTGKVP  276
ident   ||     |    | ||    ||    | |  ||    |                   |
Sbjct GVETGMHLLRLITIGIFDKYPSLQIMVGHMGEALPYWLYRLDYMHQAGvrSQRY-ERMKP  272
DSSP  HHHHHHHHHHHHHHLHHHHLLLLLEEELHHHHLHHHHHHHHHHHHHHHhhLLLL-LLLLL


DSSP  llLLLHHHHHHHLEEEELL-LLLHHHHHHHHHHHLHHHEELLLLLLLLLllllllllLLH
Query kdRRTIWTVLKEQIYLDAV-IYSEVGLQAAIASSGADRLMFGTDHPFFPpieedvqgPWD  335
ident     ||   ||            |          | || |   | |             |
Sbjct -lKKTIEGYLKSNVLVTNSgVAWEPAIKFCQQVMGEDRVMYAMDYPYQY--------VAD  323
DSSP  -lLLLHHHHHHHLEEEELLlLLLHHHHHHHHHHHLHHHEELLLLLLLLL--------LHH


DSSP  HHHHHHHhhhHHHLllLHHHHHHHLHHHHHHLLLhhhhhhhhhhl
Query SSRLNAQaviKAVGegSSDAAAVMGLNAVRVLSLkaelehhhhhh  380
ident   |                       ||     |           
Sbjct EVRAMDA---MDMS--AQTKKKFFQTNAEKWFKL-----------  352
DSSP  HHHHHHL---LLLL--HHHHHHHHLHHHHHHLLL-----------


No 4: Query=4hk5D Sbjct=2dvtA Z-score=34.4

back to top
DSSP  lLLLEEEEEEELLHHHHHhhhlllllLEEEeellEEEEEeellhhhhhhhhhhhhlllll
Query tPVVVDIHTHMYPPSYIAmlekrqtiPLVRtfpqADEPRlillsselaaldaaladpaak   60
ident     |    |   |                                              
Sbjct mQGKVALEEHFAIPETLQ--------DSAG--fvPGDYW---------------------   29
DSSP  lLLEEEEEEEELLHHHHH--------HHLL--llLLLHH---------------------


DSSP  llleELLHHHLLH-HHHHHHHHHLLLLEEEEEELLLLLLLL-LLLLHHHHHHHHHHHHHH
Query lpgrPLSTHFASL-AQKMHFMDTNGIRVSVISLANPWFDFL-APDEAPGIADAVNAEFSD  118
ident      |              ||  ||     ||  |          |  ||   |     
Sbjct ---kELQHRLLDIqDTRLKLMDAHGIETMILSLNAPAVQAIpDRRKAIEIARRANDVLAE   86
DSSP  ---hHHHHHHHLLlLHHHHHHHHLLEEEEEEEELLLHHHHLlLHHHHHHHHHHHHHHHHH


DSSP  HHHLLLLLEEEEEELLLLLlHHHHHHHHHHHHLLLLEEEEEELLLL------lLLLLLLH
Query MCAQHVGRLFFFAALPLSApVDAVKASIERVKNLKYCRGIILGTSG------lGKGLDDP  172
ident  ||    |   ||||||    ||      |  |     |                  | |
Sbjct ECAKRPDRFLAFAALPLQD-PDAATEELQRCVNDLGFVGALVNGFSqegdgqtPLYYDLP  145
DSSP  HHHHLLLLEEEEELLLLLL-HHHHHHHHHHHHHLLLLLEEEEELLLlllllllLLLLLLH


DSSP  HHHHHHHHHHHLLLEEEELLLLLL--LHHHHLLlhhhlLLHHH-HHLHHHHHHHHHHHHH
Query HLLPVFEAVADAKLLVFLHPHYGL--PNEVYGPrseeyGHVLP-LALGFPMETTIAVARM  229
ident    |    |        |||   |      |          |      |  ||     | 
Sbjct QYRPFWGEVEKLDVPFYLHPRNPLpqDSRIYDG-----HPWLLgPTWAFAQETAVHALRL  200
DSSP  HHHHHHHHHHHHLLLEEEELLLLLhhHLHHHLL-----LHHHLhHHLHHHHHHHHHHHHH


DSSP  HHLLHHHHLLLLLEEEHHHHLLHHHHHHHHHHHhhLLHHHhhlLLLL-llLLLHHHHHHH
Query YMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCivHDGHLvktGKVP-kdRRTIWTVLKE  288
ident    | ||    |   | | |  ||    ||                     |       |
Sbjct MASGLFDEHPRLNIILGHMGEGLPYMMWRIDHR--NAWVK---LPPRypaKRRFMDYFNE  255
DSSP  HHLLHHHHLLLLLEEELHHHLLHHHHHHHHHHL--LLLLL---LLLLlllLLLHHHHHHH


DSSP  LEEEELL-LLLHHHHHHHHHHHLHHHEELLLLLLLLLlllllllllLHHHHHHHHhhHHH
Query QIYLDAV-IYSEVGLQAAIASSGADRLMFGTDHPFFPpieedvqgpWDSSRLNAQavIKA  347
ident               |  ||   ||||  | || ||              |          
Sbjct NFHITTSgNFRTQTLIDAILEIGADRILFSTDWPFEN--------iDHASDWFNA--TSI  305
DSSP  HEEEELLlLLLHHHHHHHHLLLLHHHEELLLLLLLLL--------hHHHHHHHHH--LLL


DSSP  HlllLHHHHHHHLHHHHHHLLLHhhhhhhhhhl
Query VgegSSDAAAVMGLNAVRVLSLKaelehhhhhh  380
ident       |       || |   |           
Sbjct A---EADRVKIGRTNARRLFKLD----------  325
DSSP  L---HHHHHHHHLHHHHHHLLLL----------


No 5: Query=4hk5D Sbjct=2gwgA Z-score=27.7

back to top
DSSP  llLLEEEEEE-ELLH-HHHHHHHL-LLLLleeeeelleeeeeeellhhhhhhhhhhhhll
Query tpVVVDIHTH-MYPP-SYIAMLEK-RQTIplvrtfpqadeprlillsselaaldaaladp   57
ident      ||| |    |             |                               
Sbjct --XIIDIHGHyTTAPkALEDWRNRqIAGI------------------------kdpsvxp   34
DSSP  --LLEEEEEElLLLLhHHHHHHHHhHHHH------------------------hlhhhll


DSSP  lllllleellhhhlLHHH-HHHHHHHLLLLEEEEEELLlllllLLLLLHHHHHHHHHHHH
Query aaklpgrplsthfaSLAQ-KMHFMDTNGIRVSVISLANpwfdfLAPDEAPGIADAVNAEF  116
ident               |            |    | |                 |   |   
Sbjct kvselkisddelqaSIIEnQLKKXQERGSDLTVFSPRA-----GDFNVSSTWAAICNELC   89
DSSP  lhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEELLL-----LLHHHHHHHHHHHHHHH


DSSP  HHHHHLLLLLEEEEEELLLL--LLHHHHHHHHHHHHLLLLEEEEEELLLL-----lLLLL
Query SDMCAQHVGRLFFFAALPLS--APVDAVKASIERVKNLKYCRGIILGTSG-----lGKGL  169
ident               | || |            |          | |             |
Sbjct YRVSQLFPDNFIGAAXLPQSpgVDPKTCIPELEKCVKEYGFVAINLNPDPsgghwtSPPL  149
DSSP  HHHHHHLLLLEEEEEELLLLllLLHHHHHHHHHHHHHLLLLLEEEELLLLllllllLLLL


DSSP  LLHHHHHHHHHHHHLLLEEEELLLllllhhhhlllhhhlllhhHHHLhHHHHHHHHHHHH
Query DDPHLLPVFEAVADAKLLVFLHPHyglpnevygprseeyghvlPLALgFPMETTIAVARM  229
ident  |    |  |           |                       |       | |    
Sbjct TDRIWYPIYEKXVELEIPAXIHVS-------------------TGAH-YLNADTTAFXQC  189
DSSP  LLHHHHHHHHHHHHHLLLEEELLL-------------------LLLH-HHHHHHHHHHHH


DSSP  HHLLHHHHLLLLLEEEHHHHLLHHHHHHHHHHHHHLLhhhhhllllllLLLLHHHHHHHL
Query YMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDghlvktgkvpkDRRTIWTVLKEQ  289
ident      |     |     | ||  |   ||                               
Sbjct VAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEX-----------KKPLLEDHVLNN  238
DSSP  HHLLHHHHLLLLLEEELHHHLLLHHHHHHHHHHHHHL-----------LLLLHHHHLLLL


DSSP  EEEELLLLLHHHHHHHHHHHLHHHEELLLLLLL-LLLLLLlllllLHHHhhHHHHHHHHH
Query IYLDAVIYSEVGLQAAIASSGADRLMFGTDHPF-FPPIEEdvqgpWDSSrlNAQAVIKAV  348
ident |  |   |   |          |   |          |                      
Sbjct IFFDTCVYHQPGIDLLNTVIPVDNVLFASEXIGaVRGIDP-rtgfYYDD--TKRYIEAST  295
DSSP  EEEELLLLLHHHHHHHHHHLLHHHEELLLLLLLlLLLEEL-llleELLL--LHHHHHHLL


DSSP  LLLLHHHHHHHLHHHHHHLL-LHHHHHHHHHHL-
Query GEGSSDAAAVMGLNAVRVLS-LKAELEHHHHHH-  380
ident              || ||   | | |        
Sbjct ILTPEEKQQIYEGNARRVYPrLDAALKAKGKLEh  329
DSSP  LLLHHHHHHHHLHHHHHHLHhHHHHHHHHHHHLl


No 6: Query=4hk5D Sbjct=4dziC Z-score=26.3

back to top
DSSP  --LLLLEEEEEEELLH-HHHH------------------hhHLLL-----LLLEEEeell
Query --TPVVVDIHTHMYPP-SYIA------------------mlEKRQ-----TIPLVRtfpq   34
ident      | |   | | |                                            
Sbjct alNYRVIDVDNHYYEPlDSFTrhldkkfkrrgvqmlsdgkrTWAVigdrvNHFIPN----   56
DSSP  llLLLEEEEEEELLLLlLLLLllllhhhlllleeeeellllEEEEelleeLLLLLL----


DSSP  eeeeeeellhhhhhhhhhhhhllllllllEELL---------------------------
Query adeprlillsselaaldaaladpaaklpgRPLS---------------------------   67
ident                               |                             
Sbjct --------------------------ptfDPIIvpgcldllfrgeipdgvdpaslmkver   90
DSSP  --------------------------lllLLEElllllhhhhhllllllllhhhllleel


DSSP  ----HHHLLHHHHHHHHHHLLLLEEEEEEL--LLLLLLL--LLLLHHHHHHHHHHHHHHH
Query ----THFASLAQKMHFMDTNGIRVSVISLA--NPWFDFL--APDEAPGIADAVNAEFSDM  119
ident                 ||   |                |            | |      
Sbjct ladhPEYQNRDARIAVMDEQDIETAFMLPTfgCGVEEALkhDIEATMASVHAFNLWLDED  150
DSSP  hhhlHHHLLHHHHHHHHHHHLEEEEEEELLhhHHHHHHLllLHHHHHHHHHHHHHHHHHH


DSSP  HH--LLLLLEEEEEELLLLlLHHHHHHHHHHHHLLLlEEEEEELLLLLL-----LLLLLH
Query CA--QHVGRLFFFAALPLSaPVDAVKASIERVKNLKyCRGIILGTSGLG-----KGLDDP  172
ident         |        |             |                        | | 
Sbjct WGfdRPDHRIIAAPIVSLA-DPTRAVEEVDFVLARG-AKLVLVRPAPVPglvkpRSLGDR  208
DSSP  LLllLLLLLEEELLLLLLL-LHHHHHHHHHHHHHLL-LLLEELLLLLLLlllllLLLLLH


DSSP  HHHHHHHHHHHLLLEEEELLL-LLLL--HHHHLllHHHLL-LHHHhhlHHHHHHHHHHHH
Query HLLPVFEAVADAKLLVFLHPH-YGLP--NEVYGprSEEYG-HVLPlalGFPMETTIAVAR  228
ident    ||    | |   |  |    |        |                         | 
Sbjct SHDPVWARLAEAGVPVGFHLSdSGYLhiAAAWG--GAKDPlDQVL---LDDRAIHDTMAS  263
DSSP  HHHHHHHHHHHHLLLEEEELLlLLLHhhHHHLL--LLLLHhHHHH---HLLHHHHHHHHH


DSSP  HHHLLHHHHLLLLLEEEH-HHHLLHHHHHHHHHHHHHLLhhhhhllllLLLLLLHHHHHH
Query MYMAGVFDHVRNLQMLLA-HSGGTLPFLAGRIESCIVHDghlvktgkvPKDRRTIWTVLK  287
ident |   |||     |              |  |                           | 
Sbjct MIVHGVFTRHPKLKAVSIeNGSYFVHRLIKRLKKAANTQ--------pQYFPEDPVEQLR  315
DSSP  HHHLLHHHHLLLLLEEEElLLLLHHHHHHHHHHHHHHHL--------hHHLLLLHHHHHH


DSSP  HLEEEElLLLLhHHHHHHHHHHLHHHEELLLLLLLLLlllllllllLHHHHHHHHHhHHH
Query EQIYLDaVIYSeVGLQAAIASSGADRLMFGTDHPFFPpieedvqgpWDSSRLNAQAvIKA  347
ident          |    |       | |   || | |              |         | 
Sbjct NNVWIA-PYYE-DDLPELARVIGVDKILFGSDWPHGE--------gLASPVSFTAE-LKG  364
DSSP  HHEEEL-LLLL-LLHHHHHHHHLHHHLLLLLLLLLLL--------lLLLHHHHHHH-HLL


DSSP  HLllLHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query VGegSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident      ||    |  ||   |             
Sbjct FS--ESDIRKIMRDNALDLLG-------vqvgs  388
DSSP  LL--HHHHHHHHLHHHHHHHL-------lllll


No 7: Query=4hk5D Sbjct=3cjpA Z-score=22.4

back to top
DSSP  llLLEEEEEEEllhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tpVVVDIHTHMyppsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident      | |||                                                  
Sbjct --LIIDGHTHV-------------------------------------------------    9
DSSP  --LLEEEEEEL-------------------------------------------------


DSSP  llleellhhHLLHHHHHHHHHHLLLLEEEEEEL------------------------lll
Query lpgrplsthFASLAQKMHFMDTNGIRVSVISLA------------------------npw   96
ident                    ||  |                                    
Sbjct ---------ILPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngk   60
DSSP  ---------LLLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlll


DSSP  LLLLllllhHHHHHHHHHHHHHHHHLLLLLEEEEEELLLLLLHHHHHHHHHH-HHLLLlE
Query FDFLapdeaPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIER-VKNLKyC  155
ident                   |          |   |   |           ||    | |  
Sbjct TNSM-----IDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSENDTNSYIEEnIVNNK-L  114
DSSP  LLLL-----HHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLLHHHHHHHHHHhLLLLL-L


DSSP  EEEE-ELLLlllLLLLLhhHHHHHHHHH-HLLLEEEELLlllllhhhhlllhhhlllhhh
Query RGII-LGTSglgKGLDDphLLPVFEAVA-DAKLLVFLHPhyglpnevygprseeyghvlp  213
ident  ||  |             | | |        |    |                      
Sbjct VGIGeLTPA--sGQIKS--LKPIFKYSMdSGSLPIWIHA---------------------  149
DSSP  LEEEeELLL--lLLHHH--HHHHHHHHHhLLLLLEEELL---------------------


DSSP  hhlhhHHHH-HHHHHHHHhlLHHHHLLLLLEEEHHHHLLHHHHhhhhhhhhhllhhhhhl
Query lalgfPMET-TIAVARMYmaGVFDHVRNLQMLLAHSGGTLPFLagriescivhdghlvkt  272
ident                                 | | ||                      
Sbjct -----FNPLvLQDIKEIA--ELCKAFPKVPVILGHMGGSNWMT-----------------  185
DSSP  -----LLLLlHHHHHHHH--HHHHHLLLLLEEEHHHHHHHHHH-----------------


DSSP  lllllllllhhHHHH--HLEEEELL-LLLHHHHHHHHHHhLHHHEELLLLLLLLllllll
Query gkvpkdrrtiwTVLK--EQIYLDAV-IYSEVGLQAAIASsGADRLMFGTDHPFFppieed  329
ident               |     |||     |   |   |         |||| ||       
Sbjct ---------avELAKeiQNLYLDTSaYFSTFVLKIVINE-LPLKCIFGTDMPFG------  229
DSSP  ---------hhHHHHhlLLEEEELLlLLLHHHHHHHHHH-LLLLEELLLLLLLL------


DSSP  lllllhHHHHHHHHHHHHHLlLLHHHHHHHLHHHHHHLLLhhhhhhhhhhl
Query vqgpwdSSRLNAQAVIKAVGeGSSDAAAVMGLNAVRVLSLkaelehhhhhh  380
ident          |   |  |     |  | || | |  | |             
Sbjct ------DLQLSIEAIKKMSN-DSYVANAVLGDNISRLLNI-----------  262
DSSP  ------LHHHHHHHHHHHLL-LHHHHHHHHLHHHHHHHLL-----------


No 8: Query=4hk5D Sbjct=4dlfA Z-score=21.8

back to top
DSSP  lLLLEEEEEEELLHhhHHHHhlllllleeeeelleeeeeeELLHhhhhhhhhhhhlllll
Query tPVVVDIHTHMYPPsyIAMLekrqtiplvrtfpqadeprlILLSselaaldaaladpaak   60
ident      | | |       |                                          
Sbjct -ALRIDSHQHFWRY--RAAD-------------------yPWIG----------------   22
DSSP  -LLLEEEEELLLLL--LHHH-------------------lLLLL----------------


DSSP  lLLEE--LLHHhlLHHHHHHHHHHLLLLEEEEEElLLLLlllllllhhhhhHHHHHHHHH
Query lPGRP--LSTHfaSLAQKMHFMDTNGIRVSVISLaNPWFdflapdeapgiaDAVNAEFSD  118
ident   |                  |       |                         |    
Sbjct -AGMGvlARDY--LPDALHPLMHAQALGASIAVQ-ARAG------------RDETAFLLE   66
DSSP  -LLLHhhLLLL--LHHHHHHHHHHLLLLEEEEEL-LLLL------------HHHHHHHHH


DSSP  HHHLlLLLE-EEEEELLLlllHHHHHHHHHHHhLLLLEEEEEELL---llllLLLLLHHH
Query MCAQhVGRL-FFFAALPLsapVDAVKASIERVkNLKYCRGIILGT---sglgKGLDDPHL  174
ident        |         |                    ||               ||   
Sbjct LACD-EARIaAVVGWEDL--rAPQLAERVAEW-RGTKLRGFRHQLqdeadvrAFVDDADF  122
DSSP  HHLL-LLLEeEEEELLLL--lLLLHHHHHHLL-LLLLEEEEEELHhhlllhhHHHHLHHH


DSSP  HHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhhHHHHHHHHHhlLH
Query LPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfpmeTTIAVARMYmaGV  234
ident                                                             
Sbjct ARGVAWLQANDYVYDVLV-----------------------------FERQLPDVQ--AF  151
DSSP  HHHHHHHHHLLLEEEELL-----------------------------LHHHHHHHH--HH


DSSP  HHHLLLLLEEEHHHHLL-------------hHHHHhhhhhhhhllhhhhhllllllllll
Query FDHVRNLQMLLAHSGGT-------------lPFLAgriescivhdghlvktgkvpkdrrt  281
ident           | | |                   |                         
Sbjct CARHDAHWLVLDHAGKPalaefdrddtalarWRAA-------------------------  186
DSSP  HHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHH-------------------------


DSSP  hHHHHH-HLEEEELLLL-----------------LHHHHHHHHHHHLHHHEELLLLLLLL
Query iWTVLK-EQIYLDAVIY-----------------SEVGLQAAIASSGADRLMFGTDHPFF  323
ident                                    |  | ||    |  ||||| | |  
Sbjct lRELAAlPHVVCKLSGLvteadwrrglrasdlrhIEQCLDAALDAFGPQRLMFGSDWPVC  246
DSSP  hHHHHLlLLEEEEELLLlllllllllllhhhhhhHHHHHHHHHHHHLHHHEEELLLLLHH


DSSP  LLLllllllLLHHHHHHHHHHHHHHLllLHHHHHHHLHHHHHHLLLHhhhhhhhhhl
Query PPIeedvqgPWDSSRLNAQAVIKAVGegSSDAAAVMGLNAVRVLSLKaelehhhhhh  380
ident                |                 |  |  | |   |           
Sbjct LLA----asYDEVASLVERWAESRLS--AAERSALWGGTAARCYALP----------  287
DSSP  HHL----llHHHHHHHHHHHHHHHLL--HHHHHHHLLHHHHHHLLLL----------


No 9: Query=4hk5D Sbjct=2ffiA Z-score=20.6

back to top
DSSP  -LLLLEEEEEEELLHHHHHHHHllllLLEEeeelleeeeeeellhhhhhhhhhhhhllll
Query -TPVVVDIHTHMYPPSYIAMLEkrqtIPLVrtfpqadeprlillsselaaldaaladpaa   59
ident       | | |                                                 
Sbjct lHLTAIDSHAHVFSRGLNLASQ---rRYAP------------------------------   27
DSSP  lLLLLEELLLLLLLHHHHHHLL---lLLLL------------------------------


DSSP  lllleeLLHHhlLHHHHHHHHHHLLLLEEEEEELLLLLlllllllhhhhhhhHHHHHHHH
Query klpgrpLSTHfaSLAQKMHFMDTNGIRVSVISLANPWFdflapdeapgiadaVNAEFSDM  119
ident              |          |    |                       |      
Sbjct ------NYDA--PLGDYLGQLRAHGFSHGVLVQPSFLG-------------tDNRYLLSA   66
DSSP  ------LLLL--LHHHHHHHHHHLLLLEELLLLLHHHL-------------lLLHHHHHH


DSSP  HHLLLLLEEEEEELLLlllhhhHHHHhHHHHLL--LLEEEEEELLllLLLL-LLLHHHHH
Query CAQHVGRLFFFAALPLsapvdaVKASiERVKNL--KYCRGIILGTsgLGKG-LDDPHLLP  176
ident      | |     |                        ||  |         |      |
Sbjct LQTVPGQLRGVVXLER------DVEQ-ATLAEXarLGVRGVRLNLxgQDXPdLTGAQWRP  119
DSSP  HHHLLLLLLLLLLLLL------LLLH-HHHHHHhlLLLLEEELLLllLLLLlLLLLLLHH


DSSP  HHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhhHHHHHHHHHHlLHHH
Query VFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfpmeTTIAVARMYMaGVFD  236
ident   |        | ||                                             
Sbjct LLERIGEQGWHVELHR-----------------------------QVADIPVLVR-ALQP  149
DSSP  HHHHHHHHLLEEEELL-----------------------------LLLLHHHHHH-HHLL


DSSP  hlLLLLEEEHHHHLL---------HHHHHhhhhhhhhllhhhhhllllllllllHHHHhH
Query hvRNLQMLLAHSGGT---------LPFLAgriescivhdghlvktgkvpkdrrtIWTVlK  287
ident     |     | |                                               
Sbjct --YGLDIVIDHFGRPdarrglgqpGFAEL------------------------lTLSG-R  182
DSSP  --LLLLEEELHHHLLlllllllllLHHHH------------------------lLLLL-L


DSSP  HLEEEELLLL-------------LHHHHHHHHHHHLHHHEELLLLLLL--LLLLllllll
Query EQIYLDAVIY-------------SEVGLQAAIASSGADRLMFGTDHPF--FPPIeedvqg  332
ident                            | |  |  || ||  | | |             
Sbjct GKVWVKVSGIyrlqgspeenlafARQALCALEAHYGAERLXWGSDWPHtqHESE----vs  238
DSSP  LLEEEEEELHhhllllhhhhhhhHHHHHHHHHHHLLHHHEEEELLLLLllLLLL----ll


DSSP  LLHHHHHHHHHhhhHHLLllHHHHHHHLHHHHHHLLLHHhhhhhhhhl
Query PWDSSRLNAQAvikAVGEgsSDAAAVMGLNAVRVLSLKAelehhhhhh  380
ident                         |     |                 
Sbjct FGSAVEQFEAL---GCSA--QLRQALLLDTARALFGFEL--------e  273
DSSP  HHHHHHHHHHH---LLLH--HHHHHHHLHHHHHHLLLLL--------l


No 10: Query=4hk5D Sbjct=3irsA Z-score=20.2

back to top
DSSP  lLLLEEEEEEEL---LHHH--HHHHhlllllleeeeelleeeeeeellhhhhhhhhhhhh
Query tPVVVDIHTHMY---PPSY--IAMLekrqtiplvrtfpqadeprlillsselaaldaala   55
ident      |                                                      
Sbjct -LKIIDFRLRPPamgFLNAriYTRP-----------------------------------   24
DSSP  -LLLEELLLLLLlhhHHHLhhHHLH-----------------------------------


DSSP  llllllLLEE---------LLHHH--LLHHHHHHHHHHLLLLEEEEEElllLLLLLllll
Query dpaaklPGRP---------LSTHF--ASLAQKMHFMDTNGIRVSVISLanpWFDFLapde  104
ident         |                  ||      |   ||   |               
Sbjct ------DIRNrftrqlgfePAPSAeeKSLELMFEEMAAAGIEQGVCVG---RNSSV----   71
DSSP  ------HHHHhhhhhhlllLLHHHhhLLHHHHHHHHHHLLLLEEEEEL---LEELL----


DSSP  hhhhhhhHHHHHHHHHHLLLLLEEEEEELLLlLLHHHHHHHHHHHHLLLlEEEEEELLL-
Query apgiadaVNAEFSDMCAQHVGRLFFFAALPLsAPVDAVKASIERVKNLKyCRGIILGTS-  163
ident         ||                      |      |       |   |   |    
Sbjct ---lgsvSNADVAAVAKAYPDKFHPVGSIEA-ATRKEAMAQMQEILDLG-IRIVNLEPGv  126
DSSP  ---leelLHHHHHHHHHHLLLLEEEEEELLL-LLHHHHHHHHHHHHHLL-LLLEEELHHh


DSSP  -lLLLLLLLHHHHHHHHHHHHLLLEEEEL---LLLLLlhhhhlllhhhlllhhhhhlhhh
Query -gLGKGLDDPHLLPVFEAVADAKLLVFLH---PHYGLpnevygprseeyghvlplalgfp  219
ident        ||  | |      |    |                                  
Sbjct waTPMHVDDRRLYPLYAFCEDNGIPVIMMtggNAGPD-----------------------  163
DSSP  llLLLLLLLHHHHHHHHHHHHLLLLEEEElllLLLLL-----------------------


DSSP  HHHHHhHHHHHhlLHHHHLLLLLEEEHHHHLLHHHHHhhhhhhhhllhhhhhllllllll
Query METTIaVARMYmaGVFDHVRNLQMLLAHSGGTLPFLAgriescivhdghlvktgkvpkdr  279
ident    |          |      |     |                                
Sbjct ITYTN-PEHID--RVLGDFPDLTVVSSHGNWPWVQEI----------------------i  198
DSSP  HHHHL-HHHHH--HHHHHLLLLLEEEEHHHLLLHHHH----------------------h


DSSP  llHHHHhhHLEEEELL--LLLH---HHHHHHHHhHLHHHEELLLLLLLLLlllllllllL
Query rtIWTVlkEQIYLDAV--IYSE---VGLQAAIAsSGADRLMFGTDHPFFPpieedvqgpW  334
ident            ||      |          |     |||  |||  |  |          
Sbjct hvAFRR--PNLYLSPDmyLYNLpghADFIQAANsFLADRMLFGTAYPMCP--------lK  248
DSSP  hhHHHL--LLEEEELHhhHLLLllhHHHHHHHLlHHHHLLLLLLLLLLLL--------hH


DSSP  HHHHHHHHhhHHHHlllLHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query DSSRLNAQavIKAVgegSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident                            || | |             
Sbjct EYTEWFLT--LPIK---PDAMEKILHGNAERLLA--------qagr  281
DSSP  HHHHHHHL--LLLL---HHHHHHHHLHHHHHHHH--------hlll


No 11: Query=4hk5D Sbjct=4mupB Z-score=19.2

back to top
DSSP  --------------LLLLEEEEEEELLHHHHHHHhllllLLEEeeelleeeeeeellhhh
Query --------------TPVVVDIHTHMYPPSYIAMLekrqtIPLVrtfpqadeprlillsse   46
ident                   ||   ||| | | |                            
Sbjct lvrklsgtapnpafPRGAVDTQMHMYLPGYPALP-----GGPG-----------------   38
DSSP  llllllllllllllLLLLEELLLLLLLLLLLLLL-----LLLL-----------------


DSSP  hhhhhhhhhllllllllEELLHHhlLHHHHHHHHHHLLLLEEEEEELLLLLLllllllhh
Query laaldaaladpaaklpgRPLSTHfaSLAQKMHFMDTNGIRVSVISLANPWFDflapdeap  106
ident                   |              |   ||    |   |            
Sbjct ----------------lPPGALP--GPEDYRRLMQWLGIDRVIITQGNAHQR--------   72
DSSP  ----------------lLLLLLL--LHHHHHHHHHHHLLLEEEEELLHHHLL--------


DSSP  hhhhhHHHHHHHHHHLLLLLEEEEEELLLlllhhHHHH-HHHHHHLlLLEEEEEELL---
Query giadaVNAEFSDMCAQHVGRLFFFAALPLsapvdAVKA-SIERVKNlKYCRGIILGT---  162
ident       |       |                          |         |        
Sbjct -----DNGNTLACVAEMGEAAHAVVIIDA-----TTTEkDMEKLTA-AGTVGARIMDlpg  121
DSSP  -----LLHHHHHHHHHHHHHEEEEELLLL-----LLLHhHHHHHHH-LLEEEEEEELlll


DSSP  ---LLLLlllllhhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhh
Query ---SGLGkglddphLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfp  219
ident               |  | |    |   |                               
Sbjct gavNLSE-------LDAVDERAHAADWMVAVQF---------------------------  147
DSSP  lllLHHH-------HHHHHHHHHHLLLEEEEEL---------------------------


DSSP  hhHHHHHHHHHhlLHHHHLlLLLEEEHHHHLL-hhHHHHHHhhhhhllhhhhhlllllll
Query meTTIAVARMYmaGVFDHVrNLQMLLAHSGGT-lpFLAGRIescivhdghlvktgkvpkd  278
ident                            | |                              
Sbjct --DGNGLLDHL--PRLQKI-RSRWVFDHHGKFfkgIRTDGP------------------e  184
DSSP  --LHHHHHHHH--HHHHLL-LLEEEELHHHHLlllLLLLLH------------------h


DSSP  llLHHHHHH-HLEEEELLLL------------LHHHHHHHHHHhLHHHEELLLLLLL-LL
Query rrTIWTVLK-EQIYLDAVIY------------SEVGLQAAIASsGADRLMFGTDHPF-FP  324
ident                                          |     |   ||  |    
Sbjct maALLKLIDrGNLWFKFAGVyessrkswpyadVAAFSRVIAAH-APERIVWGTNWPHnSV  243
DSSP  hhHHHHHHHhLLEEEEELLHhhllllllllhhHHHHHHHHHHH-LHHHEEELLLLLLlLL


DSSP  LLLLLLlllLHHHHHHHHHHHhHHLLlLHHHHHHHLHHHHHHLLLHHhhhhhhhhl
Query PIEEDVqgpWDSSRLNAQAVIkAVGEgSSDAAAVMGLNAVRVLSLKAelehhhhhh  380
ident           |  ||                      |      |           
Sbjct RETAAY---PDDARLAELTLG-WLPD-EAARHRALVENPEALFKLSP--------v  286
DSSP  LLHHHL---LLHHHHHHHHHL-LLLL-HHHHHHHHLHHHHHHHLLLL--------l


No 12: Query=4hk5D Sbjct=1gkpA Z-score=16.9

back to top
DSSP  --------------------------------------------------LLLLEEEEEE
Query --------------------------------------------------TPVVVDIHTH   10
ident                                                    |   | | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  ELLHhhhhhhhlllllLEEEeelleeeeeeellhhhhhhhhhhhhlllllllleeLLHHh
Query MYPPsyiamlekrqtiPLVRtfpqadeprlillsselaaldaaladpaaklpgrpLSTHf   70
ident  | |                                                        
Sbjct IYLP------------FMAT-----------------------------------FAKD-   72
DSSP  LLLE------------ELLE-----------------------------------ELLL-


DSSP  lLHHHHHHHHHHLLLLEEEEEElllLLLLLllllhhhHHHHHHHHHHHHHHLL-llLEEE
Query aSLAQKMHFMDTNGIRVSVISLanpWFDFLapdeapgIADAVNAEFSDMCAQH-vgRLFF  129
ident              |                        |                    |
Sbjct -THETGSKAALMGGTTTYIEMC--cPSRND-------DALEGYQLWKSKAEGNsycDYTF  122
DSSP  -LHHHHHHHHHHLLEEEEEEEE--lLLLLL-------LHHHHHHHHHHHHLLLlllEEEE


DSSP  EEELLLlllHHHHHHHHHHHHLLLlEEEEEELL-----LLLLllllLHHHHHHHHHHHHL
Query FAALPLsapVDAVKASIERVKNLKyCRGIILGT-----SGLGkgldDPHLLPVFEAVADA  184
ident   |                                    |      |             
Sbjct HMAVSK--fDEKTEGQLREIVADG-ISSFXIFLsyknfFGVD----DGEMYQTLRLAKEL  175
DSSP  EEELLL--lLLLHHHHHHHHHHLL-LLEEEEEElllllLLLL----HHHHHHHHHHHHHH


DSSP  LLEEEELLLL---LLLH-HHHL-LLHHHLL-LHHHhhlHHHHHHHHHHHHHHhlLHHHHL
Query KLLVFLHPHY---GLPN-EVYG-PRSEEYG-HVLPlalGFPMETTIAVARMYmaGVFDHV  238
ident    |  |                        |                ||          
Sbjct GVIVTAHCENaelVGRLqQKLLsEGKTGPEwHEPS---RPEAVEAEGTARFA--TFLETT  230
DSSP  LLEEEEEELLhhhHHHHhHHHHhLLLLLHHhLLLL---LLHHHHHHHHHHHH--HHHHHH


DSSP  LlLLEEEHHHHL-LHHHhhhhhhhhhhllhhhhhllllllllllhHHHHH--HLEEEELL
Query RnLQMLLAHSGG-TLPFlagriescivhdghlvktgkvpkdrrtiWTVLK--EQIYLDAV  295
ident         |                                             ||   |
Sbjct G-ATGYVVHLSCkPALD--------------------------aaMAAKArgVPIYIESV  263
DSSP  L-LEEEELLLLLhHHHH--------------------------hhHHHHHllLLEEEEEE


DSSP  --LLLH---------------------------HHHHHHHhhhLHHHEELLLLLL-----
Query --IYSE---------------------------VGLQAAIassGADRLMFGTDHP-----  321
ident                                    |  |           ||||      
Sbjct ipHFLLdktyaerggveamkyimspplrdkrnqKVLWDAL--aQGFIDTVGTDHCpfdte  321
DSSP  hhHHHLlhhhhhllhhhhhlllllllllllhhhHHHHHHH--hLLLLLEEELLLLlllhh


DSSP  --------------LLLLllllllllLHHHHHHHHHHH--HHHLllLHHHHHHHLHHHHH
Query --------------FFPPieedvqgpWDSSRLNAQAVI--KAVGegSSDAAAVMGLNAVR  365
ident                 |          |   |                         |  
Sbjct qkllgkeaftaipnGIPA-------iEDRVNLLYTYGVsrGRLD--IHRFVDAASTKAAK  372
DSSP  hhhhhlllhhhlllLLLL-------lLLHHHHHHHHHLllLLLL--HHHHHHHHLHHHHH


DSSP  HLLLHHHH-----HHHH-------------------------------------------
Query VLSLKAEL-----EHHH-------------------------------------------  377
ident    |                                                        
Sbjct LFGLFPRKgtiavGSDAdlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrg  432
DSSP  HLLLLLLLlllllLLLLleeeeelllleellhhhllllllllllllleelleeeeeeell


DSSP  -----------------------hhl
Query -----------------------hhh  380
ident                           
Sbjct kvavrdgqfvgekgwgkllrrepmyf  458
DSSP  eeeeelleelllllllllllllllll


No 13: Query=4hk5D Sbjct=4b3zD Z-score=16.6

back to top
DSSP  ---------------------------------------------------LLLLEEEEE
Query ---------------------------------------------------TPVVVDIHT    9
ident                                                     |   |  |
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE


DSSP  EELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleeLLHH
Query HMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpLSTH   69
ident                                                             
Sbjct YLQK----------------------------------------------------TAAD   68
DSSP  LLLL----------------------------------------------------LLLL


DSSP  hlLHHHHHHHHHHLLLLEEEEEElllLLLLLllllhhHHHHHHHHHHHHHHHLL-llLEE
Query faSLAQKMHFMDTNGIRVSVISLanpWFDFLapdeapGIADAVNAEFSDMCAQH-vgRLF  128
ident      |        |                                             
Sbjct --DFFQGTRAALVGGTTMIIDHV---VPEPG------SSLLTSFEKWHEAADTKsccDYS  117
DSSP  --LHHHHHHHHHHLLEEEEEEEE---LLLLL------LLHHHHHHHHHHHHHLLlllEEE


DSSP  EEEELLLLLLhhHHHHHHHHHHLLLLEEEEEELL-----LLLLllllLHHHHHHHHHHHH
Query FFAALPLSAPvdAVKASIERVKNLKYCRGIILGT-----SGLGkgldDPHLLPVFEAVAD  183
ident              |    |     |                      |  |   |     
Sbjct LHVDITSWYD--GVREELEVLVQDKGVNSFQVYMaykdvYQMS----DSQLYEAFTFLKG  171
DSSP  EEEELLLLLL--LHHHHHHHHHHLLLLLEEEEELlllllLLLL----HHHHHHHHHHHHH


DSSP  LLLEEEELLLL--LLLH--HHHL-LLHHHLL-LHHHhhlHHHHHHHHHHHHHHhlLHHHH
Query AKLLVFLHPHY--GLPN--EVYG-PRSEEYG-HVLPlalGFPMETTIAVARMYmaGVFDH  237
ident        |                        | |            || |         
Sbjct LGAVILVHAENgdLIAQeqKRILeMGITGPEgHALS---RPEELEAEAVFRAI--TIAGR  226
DSSP  HLLEEEEELLLhhHHHHhhHHHHhLLLLLLHhHHHH---LLHHHHHHHHHHHH--HHHHH


DSSP  LLlLLEEEHHHHL-LHHHHhhhhhhhhhllhhhhhlllllllllLHHHHhhHLEEEEL--
Query VRnLQMLLAHSGG-TLPFLagriescivhdghlvktgkvpkdrrTIWTVlkEQIYLDA--  294
ident                                                             
Sbjct IN-CPVYITKVMSkSAADI-----------------------iaLARKK-gPLVFGEPia  261
DSSP  HL-LLEEEEEELLhHHHHH-----------------------hhHHHHH-lLLEEEEElh


DSSP  LLLL------------------------------HHHHHHHHHHHlhhHEELLLLLL---
Query VIYS------------------------------EVGLQAAIASSgadRLMFGTDHP---  321
ident                                                     |  |    
Sbjct ASLGtdgthywsknwakaaafvtspplspdpttpDYLTSLLACGD---LQVTGSGHCpys  318
DSSP  HHHHlllhhhhlllhhhhhhllllllllllllhhHHHHHHHHHLL---LLLLLLLLLlll


DSSP  ----------------LLLLllllllllLHHHHHHHHHHH--HHHLllLHHHHHHHLHHH
Query ----------------FFPPieedvqgpWDSSRLNAQAVI--KAVGegSSDAAAVMGLNA  363
ident                                                      ||   ||
Sbjct taqkavgkdnftlipeGVNG-------iEERMTVVWDKAVatGKMD--ENQFVAVTSTNA  369
DSSP  hhhhhhhlllhhhlllLLLL-------lLLHHHHHHHHHLllLLLL--HHHHHHHHLHHH


DSSP  HHHLLLHHHH-----HHHH-----------------------------------------
Query VRVLSLKAEL-----EHHH-----------------------------------------  377
ident      |                                                      
Sbjct AKIFNLYPRKgriavGSDAdvviwdpdklktitakshksaveynifegmechgsplvvis  429
DSSP  HHHHLLLLLLlllllLLLLleeeeeeeeeeelllllllllllllllllleeeeeeeeeee


DSSP  ---------------------------------------------hhl
Query ---------------------------------------------hhh  380
ident                                                 
Sbjct qgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  lleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll


No 14: Query=4hk5D Sbjct=1yrrB Z-score=16.0

back to top
DSSP  --------------------------------------------------LLLLEEEEEE
Query --------------------------------------------------TPVVVDIHTH   10
ident                                                    |   |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  ------ELLHHHHhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllle
Query ------MYPPSYIamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgr   64
ident                                                             
Sbjct gcggvqFNDTAEA-----------------------------------------------   73
DSSP  eelleeLLLLLLL-----------------------------------------------


DSSP  ellhhhLLHHHHHHHHHHLLLLEEEEEElllLLLLlllllhHHHHHHHHHHHHHHHHLLL
Query plsthfASLAQKMHFMDTNGIRVSVISLanpWFDFlapdeaPGIADAVNAEFSDMCAQHV  124
ident         |          |       |                            | | 
Sbjct ---vsvETLEIMQKANEKSGCTNYLPTL---ITTS------DELMKQGVRVMREYLAKHP  121
DSSP  ---llhHHHHHHHHHHHLLLEEEEEEEE---LLLL------HHHHHHHHHHHHHHHHHLL


DSSP  LLEEE-EEELLLlllhHHHHHHHHHHHLLllEEEEEELLLLLllllllhhHHHHHHHHHH
Query GRLFF-FAALPLsapvDAVKASIERVKNLkyCRGIILGTSGLgkglddphLLPVFEAVAD  183
ident           |      |                  |                |    | 
Sbjct NQALGlHLEGPW--lnAALVDFLCENADV--ITKVTLAPEMV--------PAEVISKLAN  169
DSSP  LLLLLeEEELLL--llLHHHHHHHHLHHH--EEEEEELHHHL--------LHHHHHHHHH


DSSP  LLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhhhhHHHHHHHhlLHHHHLllLLE
Query AKLLVFLHPhyglpnevygprseeyghvlplalgfpmettIAVARMYmaGVFDHVrnLQM  243
ident |   |                                    |                  
Sbjct AGIVVSAGH------------------------------sNATLKEA--KAGFRA--GIT  195
DSSP  HLLEEEELL------------------------------lLLLHHHH--HHHHHH--LEE


DSSP  EEHHHHLlhhhHHHHHHhhhhllhhhhhllllllllllhhhHHHHlEEEELLLLL----H
Query LLAHSGGtlpfLAGRIEscivhdghlvktgkvpkdrrtiwtVLKEqIYLDAVIYS----E  299
ident    |            |                             ||            
Sbjct FATHLYN-ampYITGRE----------------pglagailDEAD-IYCGIIADGlhvdY  237
DSSP  EELLLLL-lllLLLLLL----------------lhhhhhhhHLLL-LEEEEELLLllllH


DSSP  HHHHHHHHHHLhHHEELLLLLLLLlllllllllllHHHH-HHHHHHH-HHHLLlLHHHHH
Query VGLQAAIASSGaDRLMFGTDHPFFppieedvqgpwDSSR-LNAQAVI-KAVGEgSSDAAA  357
ident      |    | | |   ||                                        
Sbjct ANIRNAKRLKG-DKLCLVTDATSG----------sSLTMiEGVRNLVeHCGIA-LDEVLR  285
DSSP  HHHHHHHHHHH-HHEEEELLLLLL----------lLLLHhHHHHHHHhHHLLL-HHHHHH


DSSP  HHLHHHHHHLLLHHHH-----HHHH---------------------hhl
Query VMGLNAVRVLSLKAEL-----EHHH---------------------hhh  380
ident    |   |       |                                 
Sbjct MATLYPARAIGVEKRLgtlaaGKVAnltaftpdfkitktivngnevvtq  334
DSSP  HHLHHHHHHLLLLLLLlllllLLLLleeeellllleeeeeelleeeeel


No 15: Query=4hk5D Sbjct=2y1hB Z-score=15.9

back to top
DSSP  LLLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident     || | |                                                  
Sbjct GVGLVDCHCHLSA-----------------------------------------------   13
DSSP  LLLEEEEEELLLL-----------------------------------------------


DSSP  llleellHHHL-LHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHHHHHHHH
Query lpgrplsTHFA-SLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVNAEFSDM  119
ident          |   |               |                              
Sbjct -------PDFDrDLDDVLEKAKKANVVALVAVA---------------eHSGEFEKIMQL   51
DSSP  -------HHHLlLHHHHHHHHHHLLEEEEEELL---------------lLHHHHHHHHHH


DSSP  HHLLLLLEEEEEEL---------lLLLL-HHHHHHHHHHHHLLllEEEE-EELLL-----
Query CAQHVGRLFFFAAL---------pLSAP-VDAVKASIERVKNLkyCRGI-ILGTS-----  163
ident      |                        |     ||  |       |   |       
Sbjct SERYNGFVLPCLGVhpvqgldqrsVTLKdLDVALPIIENYKDR--LLAIgEVGLDfsprf  109
DSSP  HHHLLLLEEEEELLlleelllleeLLHHhHHHHHHHHHHHLLL--LLEEeEEEEElllll


DSSP  -----llLLLLllHHHHHHHHHHHHLLLEEEELllllllhhhhlllhhhlllhhhhhlhh
Query -----glGKGLddPHLLPVFEAVADAKLLVFLHphyglpnevygprseeyghvlplalgf  218
ident                |           | |  |                           
Sbjct agtgeqkEEQR--QVLIRQIQLAKRLNLPVNVH---------------------------  140
DSSP  lllhhhhHHHH--HHHHHHHHHHHHHLLLEEEE---------------------------


DSSP  hhhHHHHHHHHHhlLHHHHLLLLLEEEHHhHLLHHHHhhhhhhhhhllhhhhhlllllll
Query pmeTTIAVARMYmaGVFDHVRNLQMLLAHsGGTLPFLagriescivhdghlvktgkvpkd  278
ident       |                  ||       |                         
Sbjct ---SRSAGRPTI--NLLQEQGAEKVLLHA-FDGRPSV-----------------------  171
DSSP  ---EELLHHHHH--HHHHHLLLLLEEEEL-LLLLHHH-----------------------


DSSP  lllhHHHHHHLEEEELLLLL------HHHHHHHhhhhLHHHEELLLLLLL-LLLLlllll
Query rrtiWTVLKEQIYLDAVIYS------EVGLQAAiassGADRLMFGTDHPF-FPPIeedvq  331
ident                                              || |   |       
Sbjct ---aMEGVRAGYFFSIPPSIirsgqkQKLVKQL----PLTSICLETDSPAlGPEK--qvr  222
DSSP  ---hHHHHHLLLEEEELHHHhllhhhHHHHHHL----LHHHEEELLLLLLlLLLL--lll


DSSP  lllhhHHHHHHHHHHHH-LLLLHHHHHHhLHHHHHHLL-LHHHHhhhhhhl
Query gpwdsSRLNAQAVIKAV-GEGSSDAAAVmGLNAVRVLS-LKAELehhhhhh  380
ident          |                     ||      |   |       
Sbjct nepwnISISAEYIAQVKgISVEEVIEVT-TQNALKLFPkLRHLL-------  265
DSSP  llhhhHHHHHHHHHHHHlLLHHHHHHHH-HHHHHHHLLlHHHHL-------


No 16: Query=4hk5D Sbjct=2qpxA Z-score=15.8

back to top
DSSP  ----------LLLLEEEEEEELLHhhhhhhhlllllleeeeellEEEEEE----elLHHH
Query ----------TPVVVDIHTHMYPPsyiamlekrqtiplvrtfpqADEPRL----ilLSSE   46
ident                | | |                                        
Sbjct gxddlsefvdQVPLLDHHCHFLID-----------------gkvPNRDDRlaqvstEADK   43
DSSP  lllllhhhhhHLLEEEEEELLLLL-----------------lllLLHHHHhhhhllLLLL


DSSP  HHHHhhhhhllllLLLL----------------------eellhhhllhHHHHHHHHHLL
Query LAALdaaladpaaKLPG----------------------rplsthfaslAQKMHFMDTNG   84
ident    |                                                        
Sbjct DYPL---------ADTKnrlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFH   94
DSSP  LLLH---------HHHLllhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLL


DSSP  LLEEEEEELLllllllllllhhhhhhhhhhhhhHHHHLLL----LLEEEEEEL--LLLL-
Query IRVSVISLANpwfdflapdeapgiadavnaefsDMCAQHV----GRLFFFAAL--PLSA-  137
ident      |                               |              |       
Sbjct FKELLIDTGF-----------------vpddpiLDLDQTAelvgIPVKAIYRLetHAEDf  137
DSSP  EEEEEEELLL-----------------llllllLLHHHHHhhhlLLEEEEEEHhhHHHHh


DSSP  ---------LHHHHHHHHHHHHLLLlEEEEEELL--------------------------
Query ---------PVDAVKASIERVKNLKyCRGIILGT--------------------------  162
ident             |        |      |                               
Sbjct xlehdnfaaWWQAFSNDVKQAKAHG-FVGFXSIAayrvglhlepvnvieaaagfdtwkhs  196
DSSP  hlllllhhhHHHHHHHHHHLLLLLL-LLLEEELHhhhlllllllllhhhhhhhhhhhhhh


DSSP  --llLLLLllLHHH-HHHHHHHHHLLLEEEELL-lLLLLhhhhlllhhhlllhhhhhlhh
Query --sgLGKGldDPHL-LPVFEAVADAKLLVFLHP-hYGLPnevygprseeyghvlplalgf  218
ident     |            |             |                            
Sbjct gekrLTSKplIDYXlYHVAPFIIAQDXPLQFHVgyGDAD-------------------td  237
DSSP  llllLLLHhhHHHHhHHHHHHHHHHLLLEEEEEllLLLL-------------------ll


DSSP  hHHHHhhHHHHHhlLHHHHL--LLLLEEEHHhHLLHHHHhhhhhhhhhllhhhhhlllll
Query pMETTiaVARMYmaGVFDHV--RNLQMLLAHsGGTLPFLagriescivhdghlvktgkvp  276
ident                         |   | |                             
Sbjct xYLGN--PLLXR--DYLKAFtkKGLKVVLLH-CYPYHRE---------------------  271
DSSP  hHHLL--HHHHH--HHHHHHhhHLLLEEEEE-LLLLHHH---------------------


DSSP  lllllhhHHHH--HLEEEELL-------llLHHHHHHHHHHHLHHHEELLLLLLLLLLll
Query kdrrtiwTVLK--EQIYLDAV-------iySEVGLQAAIASSGADRLMFGTDHPFFPPie  327
ident                 | |                  |       |  |  |    |   
Sbjct -----agYLASvfPNLYFDISlldnlgpsgASRVFNEAVELAPYTRILFASDASTYPE--  324
DSSP  -----hhHHHHhlLLEEEELLlhhhhlhhhHHHHHHHHLLLLLHHHEELLLLLLLLHH--


DSSP  llllllLHHHHHHHHHHHHHHL--------lLLHHHHHHHLHHHHHHLLLHHHHHhhhhh
Query edvqgpWDSSRLNAQAVIKAVG--------eGSSDAAAVMGLNAVRVLSLKAELEhhhhh  379
ident           |   ||                     |              ||      
Sbjct ----xyGLAARQFKQALVAHFNqlpfvdlaqKKAWINAICWQTSAKLYHQERELR-----  375
DSSP  ----hhHHHHHHHHHHHHHHHHllllllhhhHHHHHHHHHLHHHHHHLLLHHHHL-----


DSSP  l
Query h  380
ident  
Sbjct v  376
DSSP  l


No 17: Query=4hk5D Sbjct=1itqA Z-score=15.6

back to top
DSSP  ------------LLLLEEEEEEE-LLHHHHHHhhlllllleeeeelleeeeeeellhhhh
Query ------------TPVVVDIHTHM-YPPSYIAMlekrqtiplvrtfpqadeprlillssel   47
ident                | | |                                        
Sbjct dffrdeaerimrDSPVIDGHNDLpWQLLDMFN----------------------------   32
DSSP  lhhhhhhhhhhlLLLEEEEEELHhHHHHHHHL----------------------------


DSSP  hhhhhhhhlllllllleeLLHHhllhhHHHHHHHHLLLLEEEEEELllLLLLLLLLLHHH
Query aaldaaladpaaklpgrpLSTHfaslaQKMHFMDTNGIRVSVISLAnpWFDFLAPDEAPG  107
ident                   |                        |             |  
Sbjct ------nrlqderanlttLAGT----hTNIPKLRAGFVGGQFWSVY--TPCDTQNKDAVR   80
DSSP  ------lllllhhhllllLLLL----lLLHHHHHHLLEEEEEEEEL--LLHHHLLLLHHH


DSSP  HHHHHHHHHHHHHH----LLLL----------------LEEEEEE--LLLLllhhHHHHH
Query IADAVNAEFSDMCA----QHVG----------------RLFFFAA--LPLSapvdAVKAS  145
ident            ||                                               
Sbjct RTLEQMDVVHRMCRmypeTFLYvtssagirqafregkvASLIGVEggHSID----SSLGV  136
DSSP  HHHHHHHHHHHHHHhlllLEEElllhhhhhhhhhllleEEEEEEElhHHLL----LLHHH


DSSP  HHHHHLLLlEEEEEE-LLLLLLLLL--------------LLHH-HHHHHHHHHHLLLEEE
Query IERVKNLKyCRGIIL-GTSGLGKGL--------------DDPH-LLPVFEAVADAKLLVF  189
ident       |   |   |                                |         |  
Sbjct LRALYQLG-MRYLTLtHSCNTPWADnwlvdtgdsepqsqGLSPfGQRVVKELNRLGVLID  195
DSSP  HHHHHHLL-EEEEELlLLLLLLLLLlhhhllllllllllLLLHhHHHHHHHHHHHLLEEE


DSSP  ELLlllllhhhhlllhhhlllhhhhhlhhhhhhhhHHHHHHhlLHHHHLlLLLEEE-HHH
Query LHPhyglpnevygprseeyghvlplalgfpmettiAVARMYmaGVFDHVrNLQMLL-AHS  248
ident |                                                          |
Sbjct LAH--------------------------------VSVATM-kATLQLS-RAPVIFsHSS  221
DSSP  LLL--------------------------------LLHHHH-hHHHHHL-LLLLEElLLL


DSSP  H--------LLHHhhhhhhhhhhhllhhhhhlllllllllLHHHHHHHL-EEEELL----
Query G--------GTLPflagriescivhdghlvktgkvpkdrrTIWTVLKEQ-IYLDAV----  295
ident                                               |             
Sbjct AysvcasrrNVPD---------------------------DVLRLVKQTdSLVMVNfynn  254
DSSP  LllllllllLLLH---------------------------HHHHHHHHHlLEEEELllhh


DSSP  ----------llLHHHHHHHHHHHLHHHEELLLLLL-LLLLllllllLLLH---HHHHHH
Query ----------iySEVGLQAAIASSGADRLMFGTDHP-FFPPieedvqGPWD---SSRLNA  341
ident                 |       ||    || |                          
Sbjct yisctnkanlsqVADHLDHIKEVAGARAVGFGGDFDgVPRV-----pEGLEdvsKYPDLI  309
DSSP  hhlllllllhhhHHHHHHHHHHHLLHHHEEELLLLLlLLLL-----lLLLLlllLHHHHH


DSSP  HHHH-HHHLllLHHHHHHHLHHHHHHLL----------------------lhhhhhhhhh
Query QAVI-KAVGegSSDAAAVMGLNAVRVLS----------------------lkaelehhhh  378
ident                      |  ||                                  
Sbjct AELLrRNWT--EAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygy  367
DSSP  HHHHhLLLL--HHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllll


DSSP  hl
Query hh  380
ident   
Sbjct ss  369
DSSP  ll


No 18: Query=4hk5D Sbjct=3gg7A Z-score=15.5

back to top
DSSP  llLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tpVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident      | | |                                                  
Sbjct --SLIDFHVHLDL-----------------------------------------------   11
DSSP  --LLEEEEELHHH-----------------------------------------------


DSSP  llleellhhHLLHHHHHHHHHHLLLlEEEEEEllllllllllllhhhhhhHHHHHHHHHH
Query lpgrplsthFASLAQKMHFMDTNGIrVSVISLanpwfdflapdeapgiadAVNAEFSDMC  120
ident                                                   |         
Sbjct ---------YPDPVAVARACEERQL-TVLSVT---------------ttpAAWRGTLALA   46
DSSP  ---------LLLHHHHHHHHHHLLL-EEEELL---------------llhHHHHHHHHHH


DSSP  HLLlLLEEEEEEL---LLLLLHHHHhHHHHHHHLLllEEEEE-ELLL------lLLLLll
Query AQHvGRLFFFAAL---PLSAPVDAVkASIERVKNLkyCRGII-LGTS------gLGKGld  170
ident |                 |           |       |     |               
Sbjct AGR-PHVWTALGFhpeVVSERAADL-PWFDRYLPE--TRFVGeVGLDgspslrgTWTQ--  100
DSSP  LLL-LLEEELLLLlhhHLLLLHHHL-HHHHHHHHH--LLEEEeEELLllhhhhhHHHH--


DSSP  LHHH-HHHHHHHHHL-LLEEEELllllllhhhhlllhhhlllhhhhhlhhhhhHHHHHHH
Query DPHL-LPVFEAVADA-KLLVFLHphyglpnevygprseeyghvlplalgfpmeTTIAVAR  228
ident              |        |                                 |   
Sbjct QFAVfQHILRRCEDHgGRILSIH------------------------------SRRAESE  130
DSSP  HHHHhHHHHHHHHHLlLEEEEEE------------------------------LLLLHHH


DSSP  HHhlLHHHHLLLL-LEEEHHhHLLHhHHHHhhhhhhhllhhhhhllllllllllhHHHHH
Query MYmaGVFDHVRNL-QMLLAHsGGTLpFLAGriescivhdghlvktgkvpkdrrtiWTVLK  287
ident                  |                                          
Sbjct VL--NCLEANPRSgTPILHW-YSGS-VTEL-------------------------RRAIS  161
DSSP  HH--HHHHHLHHHeEEEEEL-LLLL-HHHH-------------------------HHHHH


DSSP  HLEEEELL--LLLHHHHHHHHHHHLHHHEELLLLLLL-LLLLllllllllhHHHHHHHHH
Query EQIYLDAV--IYSEVGLQAAIASSGADRLMFGTDHPF-FPPIeedvqgpwdSSRLNAQAV  344
ident                   | | |   ||    || ||                       
Sbjct LGCWFSVGptMVRTQKGAALIRSMPRDRVLTETDGPFlELDG---qaalpwDVKSVVEGL  218
DSSP  LLLEEEELhhHHLLHHHHHHHHHLLHHHEEELLLLLLlEELL---eellhhHHHHHHHHH


DSSP  HHHH-LLLLHHHHHHhLHHHHHHLLlhhhhhhhhhhl
Query IKAV-GEGSSDAAAVmGLNAVRVLSlkaelehhhhhh  380
ident  |      |     |   |  | |             
Sbjct SKIWqIPASEVERIV-KENVSRLLG-----------t  243
DSSP  HHHHlLLHHHHHHHH-HHHHHHHHH-----------l


No 19: Query=4hk5D Sbjct=4cqbA Z-score=15.5

back to top
DSSP  ---------------------------------------------------LLLLEEEEE
Query ---------------------------------------------------TPVVVDIHT    9
ident                                                     |  || ||
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  EELL-----------------------hhHHHHHHLllllleeeeelleeeeeeellhhh
Query HMYP-----------------------psYIAMLEKrqtiplvrtfpqadeprlillsse   46
ident ||                                                          
Sbjct HMDKsftstgerlpkfwsrpytrdaaiedGLKYYKN------------------------   96
DSSP  LHHHllllllllllllllllllhhhhhhhHHHHHHH------------------------


DSSP  hhhhhhhhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllHH
Query laaldaaladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeAP  106
ident                                |     |                      
Sbjct -----------------atheeikRHVIEHAHMQVLHGTLYTRTHV----------dvDS  129
DSSP  -----------------llhhhhhHHHHHHHHHHHHLLEEEEEEEE----------elLL


DSSP  HHHHHHHHHHHHHHHLLL--LLEEEEEEL---LLLLLhhHHHHHHHHHHLLLlEEEEEEL
Query GIADAVNAEFSDMCAQHV--GRLFFFAAL---PLSAPvdAVKASIERVKNLKyCRGIILG  161
ident                           |                 |        |      
Sbjct VAKTKAVEAVLEAKEELKdlIDIQVVAFAqsgFFVDL--ESESLIRKSLDMG-CDLVGGV  186
DSSP  LLLLHHHHHHHHHHHHLLllLEEEEEEELlllLLLLL--LHHHHHHHHHHHL-LLEEELL


DSSP  LL--LLLLlllLHHH-HHHHHHHHHLLLEEEELLLllllhhhhlllhhhlllhhhhhlhH
Query TS--GLGKgldDPHL-LPVFEAVADAKLLVFLHPHyglpnevygprseeyghvlplalgF  218
ident                    |            | |                         
Sbjct DPatRENN---VEGSlDLCFKLAKEYDVDIDYHIH------------------------D  219
DSSP  LLllLLLL---HHHHhHHHHHHHHHLLLEEEEEEL------------------------L


DSSP  HHH-HHHHHHHHHhlLHHHHLLLL-LEEEHHhHLLH----hhHHHHhhhhhhllhhhhhl
Query PME-TTIAVARMYmaGVFDHVRNL-QMLLAHsGGTL----pfLAGRiescivhdghlvkt  272
ident           |                   |                             
Sbjct IGTvGVYSINRLA--QKTIENGYKgRVTTSH-AWCFadapseWLDE--------------  262
DSSP  LHHhHHHHHHHHH--HHHHHLLLLlLEEEEE-LLHHhhllhhHHHH--------------


DSSP  lllllllllHHHHHH-HLEEEELL--LLLHHH-HHHHHHHHLhhHEELLLLLL---LLLL
Query gkvpkdrrtIWTVLK-EQIYLDAV--IYSEVG-LQAAIASSGadRLMFGTDHP---FFPP  325
ident               |                              |    |       | 
Sbjct ---------AIPLYKdSGMKFVTCfsSTPPTMpVIKLLEAGI--NLGCASDNIrdfWVPF  311
DSSP  ---------HHHHHHhHLLEEEEEllLLLLLLlHHHHHHLLL--EEEEELLLLlllLLLL


DSSP  lllllllllhhHHHHHHHHH-HHHL---lLLHHHHHHHLHHHHHHLLLHHHH--------
Query ieedvqgpwdsSRLNAQAVI-KAVG---eGSSDAAAVMGLNAVRVLSLKAEL--------  373
ident                |                           |||              
Sbjct -------gngdMVQGALIETqRLELktnrDLGLIWKMITSEGARVLGIEKNYgievgkka  364
DSSP  -------llllHHHHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHHLLHHHLllllllll


DSSP  ----------------------hhHHHHL---------
Query ----------------------ehHHHHH---------  380
ident                                       
Sbjct dlvvlnslspqwaiidqakrlcviKNGRIivkdeviva  402
DSSP  leeeellllhhhhhhhllleeeeeELLEEeeelleell


No 20: Query=4hk5D Sbjct=2pajA Z-score=15.4

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------T    1
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLLEEEEEEEL-----lhhhHHHHhlllllleeeeelleeeeeeellhhhhhhhhhhhhl
Query PVVVDIHTHMY-----ppsyIAMLekrqtiplvrtfpqadeprlillsselaaldaalad   56
ident |  |  | |            |                                      
Sbjct PAWVNTHHHLFqsllkgepfRALF------------------------------------   84
DSSP  ELEELLLLLHHhhhllllllHHHL------------------------------------


DSSP  llllllleellhhhLLHHHHHHHHHHLLLLEEEEEELlllllllllllHHHHhhHHHHHH
Query paaklpgrplsthfASLAQKMHFMDTNGIRVSVISLAnpwfdflapdeAPGIadAVNAEF  116
ident                            |                     ||      |  
Sbjct --------derrfrLAARIGLIELARSGCATVADHNY---------vyYPGMpfDSSAIL  127
DSSP  --------lhhhhhHHHHHHHHHHHLLLEEEEEELLL---------llLLLLllLHHHHH


DSSP  HHHHHLLLLLEEEEEELLL--------------LLLHHHHHHHHHHHHLLL--------L
Query SDMCAQHVGRLFFFAALPL--------------SAPVDAVKASIERVKNLK--------Y  154
ident          |                           ||  | |||              
Sbjct FEEAEKLGLRFVLLRGGATqtrqleadlptalrPETLDAYVADIERLAARYhdaspramR  187
DSSP  HHHHHHLLLEEEEEELLLLllllllllllhhhlLLLHHHHHHHHHHHHHHLllllllllE


DSSP  EEEEEE--LLLLLLllllLHHHHHHHHHHHHLLLEEEELLLllllhhhhlllhhhlllhh
Query CRGIIL--GTSGLGkgldDPHLLPVFEAVADAKLLVFLHPHyglpnevygprseeyghvl  212
ident                                  |    |                     
Sbjct RVVMAPttVLYSIS----PREMRETAAVARRLGLRMHSHLS-------------------  224
DSSP  EEEELLllLLLLLL----HHHHHHHHHHHHHLLLEEEEELL-------------------


DSSP  hhhlhhhhhhhHHHHHHhhLLHHhhllllLEEEHHhHLLHhhhhhhhhhhhhllhhhhhl
Query plalgfpmettIAVARMymAGVFdhvrnlQMLLAHsGGTLpflagriescivhdghlvkt  272
ident              ||                  ||                         
Sbjct ---------gkSPVAFC--GEHD--wlgsDVWYAH-LVKV--------------------  250
DSSP  ---------llLHHHHH--HHLL--llllLEEEEL-LLLL--------------------


DSSP  llllllllLHHHHHH-HLEEEELLLL--lhhHHHHHHHHHLhhHEELLLLLLLLllllll
Query gkvpkdrrTIWTVLK-EQIYLDAVIY--sevGLQAAIASSGadRLMFGTDHPFFppieed  329
ident              |                                 | |          
Sbjct ------daDEIALLAqTGTGVAHCPQsngrlPVREMADAGV--PVSIGVDGAAS------  296
DSSP  ------lhHHHHHHHhHLLEEEELHHhhhllLLLLHHHHLL--LEEELLLHHHH------


DSSP  llllLHHH--HHHHHHHHHHHL---LLLHHHHHHHLHHHHHHLLLHH-------------
Query vqgpWDSS--RLNAQAVIKAVG---EGSSDAAAVMGLNAVRVLSLKA-------------  371
ident                    |                    ||  |               
Sbjct ----NEAAdmISEVHMTWLAQRarlASIAEVIHWGTAGGARVMGLDEvgkvavgyaadia  352
DSSP  ----LLLLlhHHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHLLLLlllllllllllee


DSSP  -----------------------------hhhhHHHH-----------------------
Query -----------------------------elehHHHH-----------------------  379
ident                                                             
Sbjct vyrlddpryfglhdpaigpvasggrpsvmalfsAGKRvvvddliegvdikelggearrvv  412
DSSP  eeelllhhhlllllhhhhhhhllllleeeeeeeLLEEeeellllllllhhhhhhhhhhhh


DSSP  --------l
Query --------h  380
ident          
Sbjct rellrevvv  421
DSSP  hhhhhhhhl


No 21: Query=4hk5D Sbjct=2vunA Z-score=15.3

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------TP    2
ident                                                           ||
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllll
Query VVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklp   62
ident    | | |                                                    
Sbjct GLLDTHVHVSG-----------------------------------------------gd   73
DSSP  LEEEEEELLLL-----------------------------------------------ll


DSSP  leeLLHHhllhHHHHHHHHHLLLLEEEE-EELLllllllllllHHHHHHHHHHHHHHHHH
Query grpLSTHfaslAQKMHFMDTNGIRVSVI-SLANpwfdflapdeAPGIADAVNAEFSDMCA  121
ident                      |                           |     |    
Sbjct yapRQKT----MDFISSALHGGVTTMISaGSPH----fpgrpkDAAGTKALAITLSKSYY  125
DSSP  eehHHLE----ELHHHHHHLLLEEEEEElLLLL----llllllLHHHHHHHHHHHHHHHH


DSSP  LLL---LLEEE-EEELLLLllhhHHHHHHHHHHLLLlEEEEEELLlllllLLLLhhHHHH
Query QHV---GRLFF-FAALPLSapvdAVKASIERVKNLKyCRGIILGTsglgkGLDDphLLPV  177
ident                |                |                    |    | 
Sbjct NARpagVKVHGgAVILEKG----LTEEDFIEMKKEG-VWIVGEVGlgtikNPED--AAPM  178
DSSP  HLLhhhLEEELlEELLLLL----LLHHHHHHHHHLL-LLEEEEELlllllLHHH--HHHH


DSSP  HHHHHHLLLEEEELL-lLLLLHhhhlllhhhlllhhhhhlhhhHHHHHHHHHHhhllhhh
Query FEAVADAKLLVFLHP-hYGLPNevygprseeyghvlplalgfpMETTIAVARMymagvfd  236
ident  |        |  |      |                        |   |          
Sbjct VEWAHKHGFKVQMHTggTSIPG-------------------ssTVTADDVIKT-------  212
DSSP  HHHHHHLLLEEEEELllLLLLL-------------------llLLLHHHHHHH-------


DSSP  hlllLLEEEHHHHL---LHHHHHHhhhhhhhllhhhhhllllllllllhHHHHhhlEEEE
Query hvrnLQMLLAHSGG---TLPFLAGriescivhdghlvktgkvpkdrrtiWTVLkeqIYLD  293
ident           |  |                                              
Sbjct ----KPDVVSHINGgptAISVQEV---------------------drimDETD---FAME  244
DSSP  ----LLLEEELLLLlllLLLHHHH---------------------hhhhHHLL---LEEE


DSSP  LL-lLLHHHHHHHHHHH----LHHHEELLLLLLLLLllllllllLLHHHHHHHHHHHHH-
Query AV-iYSEVGLQAAIASS----GADRLMFGTDHPFFPpieedvqgPWDSSRLNAQAVIKA-  347
ident  |                      |  || | |                  |        
Sbjct IVqcGNPKIADYVARRAaekgQLGRVIFGNDAPSGT------glIPLGILRNMCQIASMs  298
DSSP  EEllLLHHHHHHHHHHHhhhlLHHHEEEELLLLLLL------llLLLHHHHHHHHHHHHl


DSSP  -HLLLlhHHHHHHLHHHHHHLLLH------HHHH--------------------------
Query -VGEGssDAAAVMGLNAVRVLSLK------AELE--------------------------  374
ident         |      |   |  |                                     
Sbjct dIDPE--VAVCMATGNSTAVYGLNtgviapGKEAdliimdtplgsvaedamgaiaagdip  356
DSSP  lLLHH--HHHHHHLHHHHHHHLLLllllllLLLLleeeeelllllllllhhhhhhhllll


DSSP  -----hHHHHL------------------
Query -----hHHHHH------------------  380
ident                              
Sbjct gisvvlIDGEAvvtksrntppakraakil  385
DSSP  eeeeeeELLEEeellllllllllllleel


No 22: Query=4hk5D Sbjct=1onxA Z-score=14.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  LLLLEEEEEEELlhhhhhhhhllllLLEEeeelleeeEEEEllhhhhhhhhhhhhlllll
Query TPVVVDIHTHMYppsyiamlekrqtIPLVrtfpqadePRLIllsselaaldaaladpaak   60
ident  |   | | |                           |                      
Sbjct CPGFIDQHVHLI----------gggGEAG--------PTTR-------------------   83
DSSP  EELEEEEEELLL----------lllLLLL--------HHHL-------------------


DSSP  llleellhhHLLHhhHHHHHHHLLLLEEEEEELLLLLlllllllhhhhhhhHHHHHHHHH
Query lpgrplsthFASLaqKMHFMDTNGIRVSVISLANPWFdflapdeapgiadaVNAEFSDMC  120
ident                        |    |  |                            
Sbjct ---------TPEV--ALSRLTEAGVTSVVGLLGTDSI------------srHPESLLAKT  120
DSSP  ---------LLLL--LHHHHHHLLEEEEEELLLLLLL------------llLHHHHHHHH


DSSP  HLLL---LLEEEEEE--LLLLllhhhhhHHHHHHH-LLLLEEEEEELL----LLLLllll
Query AQHV---GRLFFFAA--LPLSapvdavkASIERVK-NLKYCRGIILGT----SGLGkgld  170
ident                     |        | |          |         |       
Sbjct RALNeegISAWMLTGayHVPS---rtitGSVEKDVaIIDRVIGVXCAIsdhrSAAP----  173
DSSP  HHHHhhlLEEEEEEEllLLLL---llllLLHHHHHhHLLLEEEEEEEEllllLLLL----


DSSP  LHHH-HHHHHHHHHLL------LEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhh
Query DPHL-LPVFEAVADAK------LLVFLHPhyglpnevygprseeyghvlplalgFPMEtt  223
ident |                          |                                
Sbjct DVYHlANMAAESRVGGllggkpGVTVFHM-------------------------GDSK--  206
DSSP  LHHHhHHHHHHHHHHHhhhlllLEEEEEE-------------------------LLLL--


DSSP  HHHHHHHhlLHHH-HLLLL-LEEEHHHHLL--HHHHhhhhhhhhhllhhhhhllllllll
Query IAVARMYmaGVFD-HVRNL-QMLLAHSGGT--LPFLagriescivhdghlvktgkvpkdr  279
ident  |    |               |  |      |                           
Sbjct KALQPIY--DLLEnCDVPIsKLLPTHVNRNvpLFEQ------------------------  240
DSSP  LLLHHHH--HHHHlLLLLHhHEEEELHHHLhhHHHH------------------------


DSSP  llhhHHHHHLEEEELLL------LLHHHHHHHHHH-HLHHHEELLLLLLLLL----llll
Query rtiwTVLKEQIYLDAVI------YSEVGLQAAIAS-SGADRLMFGTDHPFFP----piee  328
ident              |             |   |        |     |             
Sbjct --alEFARKGGTIDITSsidepvAPAEGIARAVQAgIPLARVTLSSDGNGSQpffddegn  298
DSSP  --hhHHHHLLLLEEEELllllllLHHHHHHHHHHLlLLHHHEEEELLLLLEEeeelllll


DSSP  llllllhHHHHHHHHHHHHH----LLLLhHHHHHHLHHHHHHLLLHH----hhHHHH---
Query dvqgpwdSSRLNAQAVIKAV----GEGSsDAAAVMGLNAVRVLSLKA----elEHHH---  377
ident                |   |       | ||           | |               
Sbjct lthigvaGFETLLETVQVLVkdydFSIS-DALRPLTSSVAGFLNLTGkgeilpGNDAdll  357
DSSP  eeeeeelLLHHHHHHHHHHHhhhlLLHH-HHHHHHLHHHHHHLLLLLllllllLLLLlee


DSSP  ------------------------------hhl
Query ------------------------------hhh  380
ident                                  
Sbjct vmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  eellllleeeeeelleeeeelleelllllllll


No 23: Query=4hk5D Sbjct=3nqbA Z-score=14.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ----------------LLLLEEEEEEELlhhhhhhhhlllllleeeeelleeeeeeellh
Query ----------------TPVVVDIHTHMYppsyiamlekrqtiplvrtfpqadeprlills   44
ident                  |   | | |                                  
Sbjct srrdaaqvidaggayvSPGLIDTHXHIE--------------------------------   88
DSSP  lllleeeeeelllleeEELEEEEEELHH--------------------------------


DSSP  hhhhhhhhhhhlllllllleellhHHLLHHHHHHHHHHLLLLEEEEEELLLLLlllllll
Query selaaldaaladpaaklpgrplstHFASLAQKMHFMDTNGIRVSVISLANPWFdflapde  104
ident                              |         |    |               
Sbjct -----------------------sSXITPAAYAAAVVARGVTTIVWDPHEFGN-------  118
DSSP  -----------------------hHLLLHHHHHHHHHLLLEEEEEELLHHHHH-------


DSSP  hhhHHHHHHHHHHHHHHLLLlLEEEEEE-LLLL------llhhHHHHHHHHHHLLLLEEE
Query apgIADAVNAEFSDMCAQHVgRLFFFAA-LPLS------apvdAVKASIERVKNLKYCRG  157
ident                      |    |     |             |            |
Sbjct --vHGVDGVRWAAKAIENLPlRAILLAPsCVPSapglerggadFDAAILADLLSWPEIGG  176
DSSP  --hHLHHHHHHHHHHHLLLLlEEEEEELlLLLLllllllllllLLHHHHHHHHLLLLEEE


DSSP  EE-ELLLlllLLLLLHH--HHHHHHHHHHLLLEEEELllllllhhhhlllhhhlllhhhh
Query II-LGTSglgKGLDDPH--LLPVFEAVADAKLLVFLHphyglpnevygprseeyghvlpl  214
ident |          |             |   |  ||  |                       
Sbjct IAeIXNX---RGVIERDprXSGIVQAGLAAEKLVCGH-----------------------  210
DSSP  EEeELLH---HHHHLLLhhHHHHHHHHHHHLLEEEEL-----------------------


DSSP  hlhhhhhHHHH-hHHHHhlLHHHhlllLLEEEHhhHLLHHHhhhhhhhhhhllhhhhhll
Query algfpmeTTIA-vARMYmaGVFDhvrnLQMLLAhsGGTLPFlagriescivhdghlvktg  273
ident              |                                              
Sbjct -------ARGLknADLN--AFXA---aGVSSDH--ELVSGE-------------------  237
DSSP  -------LLLLlhHHHH--HHHH---lLLLEEL--LLLLHH-------------------


DSSP  llllllllhHHHHHHLEEEELLL---lLHHHHHHHHH--hhLHHHEELLLLLlLLLLlll
Query kvpkdrrtiWTVLKEQIYLDAVI---ySEVGLQAAIA--ssGADRLMFGTDHpFFPPiee  328
ident             |                    ||              ||   ||    
Sbjct -------dlXAKLRAGLTIELRGshdhLLPEFVAALNtlghLPQTVTLCTDD-VFPD---  286
DSSP  -------hhHHHHHLLLEEEEELllhhHHHHHHHHHHhhllLLLLEEEELLL-LLHH---


DSSP  llllLLHHH-HHHHHHHHH-HHLLllHHHHHHHLHHHHHHLLLHH------hHHHH----
Query dvqgPWDSS-RLNAQAVIK-AVGEgsSDAAAVMGLNAVRVLSLKA------eLEHH----  376
ident                             |     |||   |                   
Sbjct --dlLQGGGlDDVVRRLVRyGLKP--EWALRAATLNAAQRLGRSDlgliaagRRADivvf  342
DSSP  --hhHHLLLhHHHHHHHHHlLLLH--HHHHHHHLHHHHHHHLLLLlllllllLLLLeeee


DSSP  -------------HHHL-------------------------------------------
Query -------------HHHH-------------------------------------------  380
ident                                                             
Sbjct edlngfsarhvlaSGRAvaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvr  402
DSSP  llllllleeeeeeLLEEeeelleelllllllllhhhllllllllllhhhhllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  380
ident                                                             
Sbjct latidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwnga  462
DSSP  eeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  380
ident                                                             
Sbjct fattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdap  522
DSSP  eeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  380
ident                                                             
Sbjct leevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxes  582
DSSP  hhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeell


DSSP  -----
Query -----  380
ident      
Sbjct pviev  587
DSSP  leeel


No 24: Query=4hk5D Sbjct=3giqA Z-score=14.7

back to top
DSSP  ------------------------------------------------------LLLLEE
Query ------------------------------------------------------TPVVVD    6
ident                                                        |   |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  EEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleel
Query IHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpl   66
ident  | |                                                        
Sbjct VHGHDDL-----------------------------------------------------   67
DSSP  LLLLLLL-----------------------------------------------------


DSSP  lhHHLLHHHhHHHHHHLLLLEEEEEeLLLL-lllLLLLL--------hhhhhhHHHHHHH
Query stHFASLAQkMHFMDTNGIRVSVISlANPW-fdfLAPDE--------apgiadAVNAEFS  117
ident    |             ||   |             |                |      
Sbjct --MFVEKPD-LRWKTSQGITTVVVGnCGVSaapaPLPGNtaaalallgetplfADVPAYF  124
DSSP  --HHHHLLL-LHHHHLLLEEEEEELlLLLLllllLLLLLllhhhhhhllllllLLHHHHH


DSSP  HHHHL--lllLEEEEEEL--LLLL------------LHHHHHHHHHHHHLLLlEEEEEEL
Query DMCAQ--hvgRLFFFAAL--PLSA------------PVDAVKASIERVKNLKyCRGIILG  161
ident                        |               |               |   |
Sbjct AALDAqrpmiNVAALVGHanLRLAamrdpqaaptaaEQQAMQDMLQAALEAG-AVGFSTG  183
DSSP  HHHHHlllllEEEEEEEHhhHHHHhlllllllllhhHHHHHHHHHHHHHHHL-LLEEEEE


DSSP  L----LLLLllllLHHH-HHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhl
Query T----SGLGkgldDPHL-LPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplal  216
ident                          |    |   |                         
Sbjct LayqpGAVA----QAAElEGLARVAAERRRLHTSHI------------------------  215
DSSP  LllllHHHL----LHHHhHHHHHHHHHLLLEEEEEL------------------------


DSSP  HHHH-HHHHHHHHHHhlLHHHHLlLLLEEEHhHHLL-------hHHHHhhhhhhhhllhh
Query GFPM-ETTIAVARMYmaGVFDHVrNLQMLLAhSGGT-------lPFLAgriescivhdgh  268
ident          ||                                                 
Sbjct RNEAdGVEAAVEEVL--AIGRGT-GCATVVS-HHKCmmpqnwgrSRAT------------  259
DSSP  LLLLlLHHHHHHHHH--HHHHHH-LLEEEEL-LLLLllhhhlllHHHH------------


DSSP  hhhlllllllllLHHHHHH--HLEEEELLLLL----------------------------
Query lvktgkvpkdrrTIWTVLK--EQIYLDAVIYS----------------------------  298
ident              |           ||   |                             
Sbjct ----------laNIDRAREqgVEVALDIYPYPgsstiliperaetiddiritwstphpec  309
DSSP  ----------hhHHHHHHHllLLEEEEELLLLeeeeellhhhllllllleeeeelllhhh


DSSP  ----------------------------------HHHHHHHHHHhlhHHEELLLLLLLLL
Query ----------------------------------EVGLQAAIASsgaDRLMFGTDHPFFP  324
ident                                   |               | | |     
Sbjct sgeyladiaarwgcdkttaarrlapagaiyfamdEDEVKRIFQH---PCCMVGSDGLPND  366
DSSP  llllhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHHHHHHL---LLEEELLLLLLLL


DSSP  LLlllllllLHHHHHHHHHHH-HHHL----LLLHHHHHHHLHHHHHHLLLHHH---hhHH
Query PIeedvqgpWDSSRLNAQAVI-KAVG----EGSSDAAAVMGLNAVRVLSLKAE---leHH  376
ident                    |    |          | | |     ||             
Sbjct AR------pHPRLWGSFTRVLgRYVRearlMTLEQAVARMTALPARVFGFAERgvlqpGA  420
DSSP  LL------lLLHHHHHHHHHHhHHHHhlllLLHHHHHHHHLHHHHHHHLLLLLlllllLL


DSSP  HH---------------------------------------------------hl
Query HH---------------------------------------------------hh  380
ident                                                        
Sbjct WAdvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  LLleeeelllllllllllllllllllleeeeeelleeeellllllllllllllll


No 25: Query=4hk5D Sbjct=3griA Z-score=14.4

back to top
DSSP  --------------------------------------------------LLLLEEEEEE
Query --------------------------------------------------TPVVVDIHTH   10
ident                                                    |  || | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  -ELLHhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleeLLHH
Query -MYPPsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpLSTH   69
ident    |                                                        
Sbjct lREPG---------------------------------------------------GEYK   69
DSSP  lLLLL---------------------------------------------------LLLL


DSSP  HlLHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhHHHHHHHHHHHHHL-LLLLEE
Query FaSLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiADAVNAEFSDMCAQ-HVGRLF  128
ident               |                                          |  
Sbjct E-TIETGTKAAARGGFTTVCPXPN---------trpvpdSVEHFEALQKLIDDnAQVRVL  119
DSSP  L-LHHHHHHHHHHLLEEEEEELLL---------llllllLHHHHHHHHHHHHHhLLLEEL


DSSP  EEEEL----LLLLlhhhhHHHHHHHHLLLlEEEEEEL-lLLLLllllLHHHHHHHHHHHH
Query FFAAL----PLSApvdavKASIERVKNLKyCRGIILG-tSGLGkgldDPHLLPVFEAVAD  183
ident   |                                                       | 
Sbjct PYASIttrqLGKE-----LVDFPALVKEG-AFAFTDDgvGVQT----ASXXYEGXIEAAK  169
DSSP  LLEELlhhhLLLL-----LLLHHHHHLLL-LLLEEELllLLLL----HHHHHHHHHHHHH


DSSP  LLLEEEELLLL--LLLHhhhlllhhhllLHHH---------hHLHHhHHHHHHHHHHHhl
Query AKLLVFLHPHY--GLPNevygprseeygHVLP---------lALGFpMETTIAVARMYma  232
ident        |                                              ||    
Sbjct VNKAIVAHCEDnsLIYG----------gAXHEgkrskelgipGIPN-ICESVQIARDV--  216
DSSP  HLLLEEELLLLhhHLLL----------lLEELlhhhhhhlllEELL-HHHHHHHHHHH--


DSSP  LHHHHLlLLLEEEHhHHLL--HHHHhhhhhhhhhllhhhhhllllllllllhHHHH--hH
Query GVFDHVrNLQMLLAhSGGT--LPFLagriescivhdghlvktgkvpkdrrtiWTVL--kE  288
ident                   |                                         
Sbjct LLAEAA-GCHYHVC-HVSTkeSVRV--------------------------iRDAKragI  248
DSSP  HHHHHH-LLLEEEL-LLLLhhHHHH--------------------------hHHHHhllL


DSSP  LEEEELL-LLLH--------------------------hHHHHHHHHHlhhHEELLLLLL
Query QIYLDAV-IYSE--------------------------vGLQAAIASSgadRLMFGTDHP  321
ident                                         |               ||| 
Sbjct HVTAEVTpHHLLlteddipgnnaiykxnpplrstedreaLLEGLLDGT---IDCIATDHA  305
DSSP  LEEEEELhHHHHllhhhlllllhhhllllllllhhhhhhHHHHHHLLL---LLEELLLLL


DSSP  LlLLLLLL------lllllhHHHHHHHHHHHHHL----LLLHHHHHHHLHHHHHHLLLH-
Query FfPPIEED------vqgpwdSSRLNAQAVIKAVG----EGSSDAAAVMGLNAVRVLSLK-  370
ident       |              |                                   |  
Sbjct P-HARDEKaqpxekapfgivGSETAFPLLYTHFVkngdWTLQQLVDYLTIKPCETFNLEy  364
DSSP  L-LLHHHHllllllllllllLLLLHHHHHHHHHLllllLLHHHHHHHHLHHHHHHLLLLl


DSSP  -hhhhHHHH-----------------------------------------------hl
Query -aeleHHHH-----------------------------------------------hh  380
ident                                                           
Sbjct gtlkeNGYAdltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  lllllLLLLleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel


No 26: Query=4hk5D Sbjct=3pnuA Z-score=14.3

back to top
DSSP  -----------LLLLEEEEEEELLHhhhhhhhlllllleeeeelleeeeeeellhhhhhh
Query -----------TPVVVDIHTHMYPPsyiamlekrqtiplvrtfpqadeprlillsselaa   49
ident                 | | |                                       
Sbjct enlyfqsnamkLKNPLDMHLHLRDN-----------------------------------   25
DSSP  llllllllleeEELLEEEEELLLLH-----------------------------------


DSSP  hhhhhhlllllllleellhhhLLHHHHHHHHHhlLLLEEEEEELlllllllllllhhhhH
Query ldaaladpaaklpgrplsthfASLAQKMHFMDtnGIRVSVISLAnpwfdflapdeapgiA  109
ident                                        ||                   
Sbjct --------------------qMLELIAPLSAR--DFCAAVIMPN---------lipplcN   54
DSSP  --------------------hHHHHHHHHHHL--LLLEEEELLL---------llllllL


DSSP  HHHHHHHHHHHHL----llLLEEEEEELLLlllhhHHHHHHHHHHLLllEEEEEELLL--
Query DAVNAEFSDMCAQ----hvGRLFFFAALPLsapvdAVKASIERVKNLkyCRGIILGTS--  163
ident                                             |      || |     
Sbjct LEDLKAYKMRILKackdenFTPLMTLFFKN-----YDEKFLYSAKDE--IFGIXLYPAgi  107
DSSP  HHHHHHHHHHHHHhhllllLEEEEEEELLL-----LLHHHHHHHLLL--LLEEEELLLll


DSSP  ------LLLLllLLHH-HHHHHHHHHHLLLEEEELLLLLLLhhhhlllhhhlllhhhhhl
Query ------GLGKglDDPH-LLPVFEAVADAKLLVFLHPHYGLPnevygprseeyghvlplal  216
ident       |      |   | |  ||  |       |                         
Sbjct ttnsngGVSS--FDIEyLKPTLEAMSDLNIPLLVHGETNDF-------------------  146
DSSP  llllllLLLL--LLHHhHHHHHHHHHHLLLLEEELLLLLLL-------------------


DSSP  hhhHHHHHHHHHHHhlLHHHHLLLLLEEEHHHHL-LHHHhhhhhhhhhhllhhhhhllll
Query gfpMETTIAVARMYmaGVFDHVRNLQMLLAHSGG-TLPFlagriescivhdghlvktgkv  275
ident                     |   |     |    ||                       
Sbjct -vmDRESNFAKIYE--KLAKHFPRLKIVMEHITTkTLCE---------------------  182
DSSP  -hhHLLHHHHHHHH--HHHHHLLLLLEEELLLLLhHHHH---------------------


DSSP  llllllHHHHhhHLEEEELL-LLLH---------------------------HHHHHHHh
Query pkdrrtIWTVlkEQIYLDAV-IYSE---------------------------VGLQAAIa  307
ident             |  |                                      |     
Sbjct -----lLKDY--ENLYATITlHHLIitlddviggkmnphlfckpiakryedkEALCELA-  234
DSSP  -----hHHHL--LLEEEEELlHHHLllhhhhhlllllhhhllllllllhhhhHHHHHHH-


DSSP  hhlHHHEELLLLLL--------LLLLllllllllLHHHHHHHHHHHHHhLLLLhHHHHHH
Query ssgADRLMFGTDHP--------FFPPieedvqgpWDSSRLNAQAVIKAvGEGSsDAAAVM  359
ident        ||| |                             |                  
Sbjct fsgYEKVMFGSDSAphpkgcaaGVFS-------aPVILPVLAELFKQN-SSEE-NLQKFL  285
DSSP  hllLLLEEELLLLLllllllllLLLL-------hHHHHHHHHHHHHHH-LLHH-HHHHHH


DSSP  LHHHHHHLLLHhhHHHH----------------------------------hhhl
Query GLNAVRVLSLKaeLEHH----------------------------------hhhh  380
ident   |      ||                                            
Sbjct SDNTCKIYDLK--FKEDkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  LHHHHHHHLLL--LLLLleeeeellleelllleelllleellllllleelleell


No 27: Query=4hk5D Sbjct=3ls9A Z-score=14.3

back to top
DSSP  -------------------------------------------------------LLLLE
Query -------------------------------------------------------TPVVV    5
ident                                                         |   
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  EEEEEEL-----------------lhhhHHHHhlllllLEEEeelleeeeeeellhhhhh
Query DIHTHMY-----------------ppsyIAMLekrqtiPLVRtfpqadeprlillssela   48
ident   | | |                                                     
Sbjct NSHQHLYegamraipqlervtmaswlegVLTR-----sAGWW------------------   97
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhHHHH-----hHHHH------------------


DSSP  hhhhhhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEElllLLLLLlllLHHHh
Query aldaaladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLanpWFDFLapdEAPGi  108
ident                                    ||           |           
Sbjct -----------rdgkfgpdvirEVARAVLLESLLGGITTVADQH---LFFPG---ATAD-  139
DSSP  -----------hlllllhhhhhHHHHHHHHHHHHLLEEEEEEEE---LLLLL---LLLL-


DSSP  hhHHHHHHHHHHHLLLLLEEEEEELLL-------------LLLHHHHHHHHHHHHLLL--
Query adAVNAEFSDMCAQHVGRLFFFAALPL-------------SAPVDAVKASIERVKNLK--  153
ident                  |                        ||| |             
Sbjct --SYIDATIEAATDLGIRFHAARSSMTlgkseggfcddlfVEPVDRVVQHCLGLIDQYhe  197
DSSP  --LHHHHHHHHHHHHLLEEEEEELLLLllhhhlllllhhhLLLHHHHHHHHHHHHHHHll


DSSP  ------LEEEEEE-LLLLLlllllLHHH-HHHHHHHHHLLLEEEELLlllllhhhhlllh
Query ------YCRGIIL-GTSGLgkgldDPHL-LPVFEAVADAKLLVFLHPhyglpnevygprs  205
ident               |          | |        ||       |              
Sbjct pepfgmVRIALGPcGVPYD-----KPELfEAFAQMAADYDVRLHTHF-------------  239
DSSP  llllllEEEEELLlLLLLL-----LHHHhHHHHHHHHHHLLEEEEEE-------------


DSSP  hhlllhhhhhlhHHHH--------hhHHHHHHHhLLHHhhllllLEEEHhHHLLhhHHHH
Query eeyghvlplalgFPME--------ttIAVARMYmAGVFdhvrnlQMLLAhSGGTlpFLAG  257
ident              |                                 ||           
Sbjct -----------yEPLDagmsdhlygmTPWRFLE-KHGW---asdRVWLA-HAVV--PPRE  281
DSSP  -----------lLLLHhhhhhhhhllLHHHHHH-HLLL---lllLEEEE-ELLL--LLHH


DSSP  hhhhhhhllhhhhhllllllllllHHHHHH-HLEEEELLLL-------lhhHHHHHHHHH
Query riescivhdghlvktgkvpkdrrtIWTVLK-EQIYLDAVIY-------sevGLQAAIASS  309
ident                                        |                    
Sbjct ------------------------EIPEFAdAGVAIAHLIApdlrmgwglaPIREYLDAG  317
DSSP  ------------------------HHHHHHhHLLEEEELHHhhhhllllllLHHHHHHLL


DSSP  LhhHEELLLLLL-LLLLlllllllllhHHHHHHHHHHH------------HHLLllHHHH
Query GadRLMFGTDHP-FFPPieedvqgpwdSSRLNAQAVIK------------AVGEgsSDAA  356
ident       |||                                                   
Sbjct I--TVGFGTTGSaSNDG---------gNLLGDLRLAALahrpadpnepekWLSA--RELL  364
DSSP  L--EEEELLLLLlLLLL---------lLHHHHHHHHHHhlhhhllllhhhLLLH--HHHH


DSSP  HHHLHHHHH-HLLLH-------HHHH----------------------------------
Query AVMGLNAVR-VLSLK-------AELE----------------------------------  374
ident                                                             
Sbjct RMATRGSAEcLGRPDlgvleegRAADiacwrldgvdrvgvhdpaiglimtglsdraslvv  424
DSSP  HHLLHHHHHhLLLLLlllllllLLLLeeeeelllhhhlllllhhhhhhhlllllllleee


DSSP  -HHHH----------------------hl
Query -HHHH----------------------hh  380
ident                              
Sbjct vNGQVlvenerpvladlerivanttalip  453
DSSP  eLLEEeeelleellllhhhhhhhhhhhll


No 28: Query=4hk5D Sbjct=1k6wA Z-score=14.2

back to top
DSSP  --------------------------------------------------LLLLEEEEEE
Query --------------------------------------------------TPVVVDIHTH   10
ident                                                    |  |  | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  ELLhhhhhhhhlllllleeeeelleeEEEE---ELLHhhhhhhhhhhhlllllllLEEL-
Query MYPpsyiamlekrqtiplvrtfpqadEPRL---ILLSselaaldaaladpaaklpGRPL-   66
ident                                   |                     |   
Sbjct LDT-----------------tqtagqPNWNqsgTLFE----------------giERWAe   87
DSSP  LLL-----------------llllllLLLLlllLHHH----------------hhHHHHl


DSSP  -------lhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllHHHHhHHHHHHHHHH
Query -------sthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeAPGIaDAVNAEFSDM  119
ident                |       |||                                  
Sbjct rkallthddvkQRAWQTLKWQIANGIQHVRTHV----------dvSDAT-LTALKAMLEV  136
DSSP  lhhhllhhhhhHHHHHHHHHHHHLLEEEEEEEE----------elLLLL-LHHHHHHHHH


DSSP  HHLLL--LLEEEEEEL---LLLLLhhHHHHHHHHHHLLLlEEEEEELL-LLLL-LLLLLh
Query CAQHV--GRLFFFAAL---PLSAPvdAVKASIERVKNLKyCRGIILGT-SGLG-KGLDDp  172
ident          |   |      || |     |  |    |                      
Sbjct KQEVApwIDLQIVAFPqegILSYP--NGEALLEEALRLG-ADVVGAIPhFEFTrEYGVE-  192
DSSP  HHHHLllLEEEEEEELlllLLLLL--LHHHHHHHHHHLL-LLEEEELHhHLLLhHHHHH-


DSSP  hHHHHHHHHHHLLLEEEELllllllhhhhlllhhhlllhhhhhlhHHHH-hHHHHHHHhh
Query hLLPVFEAVADAKLLVFLHphyglpnevygprseeyghvlplalgFPME-tTIAVARMym  231
ident  |   |        |   |                                   |     
Sbjct sLHKTFALAQKYDRLIDVH------------------------cdEIDDeqSRFVETV--  226
DSSP  hHHHHHHHHHHHLLEEEEE------------------------elLLLLllLLHHHHH--


DSSP  lLHHHHlLLLL--EEEHHhHLLHHHHhHHHHhhhhllhhhhhlllllllllLHHHHHH-H
Query aGVFDHvRNLQ--MLLAHsGGTLPFLaGRIEscivhdghlvktgkvpkdrrTIWTVLK-E  288
ident      |           |         |                            ||  
Sbjct aALAHH-EGMGarVTASH-TTAMHSYnGAYT-------------------sRLFRLLKmS  265
DSSP  hHHHHH-HLLHhhEEEEE-LHHHHHLlHHHH-------------------hHHHHHHHhH


DSSP  LEEEELLLL----------------lhhHHHHHHHHHLhhHEELLLLLL---LLLLllll
Query QIYLDAVIY----------------sevGLQAAIASSGadRLMFGTDHP---FFPPieed  329
ident  |   |                             |       || |       |     
Sbjct GINFVANPLvnihlqgrfdtypkrrgitRVKEMLESGI--NVCFGHDDVfdpWYPL----  319
DSSP  LLEEEELHHhhhhhllllllllllllllLHHHHHHLLL--LEEELLLLLlllLLLL----


DSSP  llllLHHH-HHHHHHHH--HHHL---LLLHhHHHHHLHHHHHHLLLHH------------
Query vqgpWDSS-RLNAQAVI--KAVG---EGSSdAAAVMGLNAVRVLSLKA------------  371
ident                                          | | |              
Sbjct ----GTANmLQVLHMGLhvCQLMgygQIND-GLNLITHHSARTLNLQDygiaagnsanli  374
DSSP  ----LLLLhHHHHHHHHhhLLLLlhhHHHH-HHHHHLHHHHHHLLLLLllllllllllee


DSSP  -----------------hhhhHHHHL-----------------------
Query -----------------elehHHHHH-----------------------  380
ident                                                  
Sbjct ilpaengfdalrrqvpvrysvRGGKViastqpaqttvyleqpeaidykr  423
DSSP  eellllhhhhhhhllllleeeELLEEeeellllleeeellleeeellll


No 29: Query=4hk5D Sbjct=1a4mA Z-score=14.2

back to top
DSSP  ----LLLLEEEEEEEL---lhhhhhhhHLLLllleEEEEllEEEEeeellhhhhhhhhhh
Query ----TPVVVDIHTHMY---ppsyiamlEKRQtiplVRTFpqADEPrlillsselaaldaa   53
ident         |  | |              |                               
Sbjct tpafNKPKVELHVHLDgaikpetilyfGKKR--giALPA--DTVE---------------   41
DSSP  llllLLLEEEEEEEHHhlllhhhhhhhHHHH--llLLLL--LLHH---------------


DSSP  hhllllllLLEE------------------------llhhhLLHHHHHHHHHHLLLLEEE
Query ladpaaklPGRP------------------------lsthfASLAQKMHFMDTNGIRVSV   89
ident                                                       |     
Sbjct -----elrNIIGmdkplslpgflakfdyympviagcreaikRIAYEFVEMKAKEGVVYVE   96
DSSP  -----hhhHHHLllllllhhhhhllhhhhhhhhlllhhhhhHHHHHHHHHHHHLLEEEEE


DSSP  EEE--lllllllLLLLL-----hhHHHHHHHHHHHHHHHLLL----LLEEEEEELllLLL
Query ISL--anpwfdfLAPDE-----apGIADAVNAEFSDMCAQHV----GRLFFFAALplSAP  138
ident               |            | |                             |
Sbjct VRYsphllanskVDPMPwnqtegdVTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrHQP  156
DSSP  EEEllhhhllllLLLLHhhlllllLLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEelLLH


DSSP  HhHHHHHHHHHHLL--LLEEEEEELLL-lllLLLLLHHHHHHHHHHHHLLLEEEELLlll
Query VdAVKASIERVKNL--KYCRGIILGTS-glgKGLDDPHLLPVFEAVADAKLLVFLHPhyg  195
ident         |  |    |      |            |      |           |    
Sbjct S-WSLEVLELCKKYnqKTVVAMDLAGDetieGSSLFPGHVEAYEGAVKNGIHRTVHA---  212
DSSP  H-HHHHHHHHHHHLllLLEEEEEEELLllllLHHHLHHHHHHHHHHHHHLLEEEEEE---


DSSP  llhhhhlllhhhlllhhhhhlhHHHHhHHHHHHHHhllhhhhlllLLEEEHHhHLLHhHH
Query lpnevygprseeyghvlplalgFPMEtTIAVARMYmagvfdhvrnLQMLLAHsGGTLpFL  255
ident                               |                    | |      
Sbjct ---------------------gEVGS-PEVVREAV-------dilKTERVGH-GYHT-IE  241
DSSP  ---------------------lLLLL-HHHHHHHH-------hllLLLEEEE-LHHH-HH


DSSP  HHHhhhhhhllhhhhhllllllllllHHHHHHHlEEEELLLL-----------lhHHHHH
Query AGRiescivhdghlvktgkvpkdrrtIWTVLKEqIYLDAVIY-----------seVGLQA  304
ident                               |||                           
Sbjct DEA----------------------lYNRLLKEnMHFEVCPWssyltgawdpkttHAVVR  279
DSSP  LHH----------------------hHHHHHHLlLEEEELHHhhhhlllllllllLHHHH


DSSP  HHHHHLhhHEELLLLLLLLLLlllllllllHHHHHHHHHHH-HHHLLlLHHHHHHhLHHH
Query AIASSGadRLMFGTDHPFFPPieedvqgpwDSSRLNAQAVI-KAVGEgSSDAAAVmGLNA  363
ident              || |                    |                    ||
Sbjct FKNDKA--NYSLNTDDPLIFK---------STLDTDYQMTKkDMGFT-EEEFKRL-NINA  326
DSSP  HHHLLL--LEEELLLLLLLLL---------LLHHHHHHHHHhLLLLL-HHHHHHH-HHHH


DSSP  HHH-LLLHHHHHH-----hhhhl
Query VRV-LSLKAELEH-----hhhhh  380
ident          |             
Sbjct AKSsFLPEEEKKEllerlyreyq  349
DSSP  HHLlLLLHHHHHHhhhhhhhhll


No 30: Query=4hk5D Sbjct=2ob3A Z-score=14.1

back to top
DSSP  -------------llLLEEEEEE-ELLH-HHHHHHHlllllleeeeelleeeeeeellhh
Query -------------tpVVVDIHTH-MYPP-SYIAMLEkrqtiplvrtfpqadeprlillss   45
ident                     | |                                     
Sbjct drintvrgpitiseaGFTLTHEHiCGSSaGFLRAWP------------------------   36
DSSP  lleeelleeelhhhhLLEEEEELlEELLlLHHHHLH------------------------


DSSP  hhhhhhhhhhlllllllleellhhhlLHHHHHHHHHHLL---LLEEEEEEllllllllll
Query elaaldaaladpaaklpgrplsthfaSLAQKMHFMDTNG---IRVSVISLanpwfdflap  102
ident                                            |  |             
Sbjct ------------------effgsrkaLAEKAVRGLRRARaagVRTIVDVS----------   68
DSSP  ------------------hhhllhhhHHHHHHHHHHHHHhllLLEEEELL----------


DSSP  llhhhhHHHHhhHHHHHHHLLL----LLEEEEEEL------lLLLL-HHHHHHHHHHHHL
Query deapgiADAVnaEFSDMCAQHV----GRLFFFAAL------pLSAP-VDAVKASIERVKN  151
ident        |          |               |            |        |   
Sbjct -----tFDIG--RDVSLLAEVSraadVHIVAATGLwfdpplsMRLRsVEELTQFFLREIQ  121
DSSP  -----lHHHL--LLHHHHHHHHhhhlLEEELEEELlllllhhHHLLlHHHHHHHHHHHHH


DSSP  ------lLLEEEEEELLLllllLLLL--HHHHHH-HHHHHHLLLEEEELLlllllhhhhl
Query ------lKYCRGIILGTSglgkGLDD--PHLLPV-FEAVADAKLLVFLHPhyglpnevyg  202
ident             |   |              |     |       |  |           
Sbjct ygiedtgIRAGIIXVATT---gKATPfqELVLKAaARASLATGVPVTTHT----------  168
DSSP  lllllllLLLLEEEEELL---lLLLHhhHHHHHHhHHHHHHHLLLEEEEL----------


DSSP  llhhhlllhhhhhlhHHHHhhHHHHHHHhlLHHHHLLLL--LEEEHHHHLLHHHHHhhhh
Query prseeyghvlplalgFPMEttIAVARMYmaGVFDHVRNL--QMLLAHSGGTLPFLAgrie  260
ident                                 |             ||  |         
Sbjct ---------------AASQ--RDGEQQA--AIFESEGLSpsRVCIGHSDDTDDLSY----  205
DSSP  ---------------LHHH--LHHHHHH--HHHHHLLLLhhHEEELLHHHLLLHHH----


DSSP  hhhhllhhhhhllllllllllhHHHHHHLEEEELLLL-----------------------
Query scivhdghlvktgkvpkdrrtiWTVLKEQIYLDAVIY-----------------------  297
ident                                                             
Sbjct ---------------------lTALAARGYLIGLDHIpysaiglednasasallgirswq  244
DSSP  ---------------------hHHHHHLLLEEEELLLllllllllllhhhhhhhllllhh


DSSP  -LHHHHHHHHHHHLHHHEELLLLLL------------lLLLLlllllllLHHHHHHH-HH
Query -SEVGLQAAIASSGADRLMFGTDHP------------fFPPIeedvqgpWDSSRLNA-QA  343
ident        | |            |                           |         
Sbjct tRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdvMDRV------nPDGMAFIPlRV  298
DSSP  hHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhhHHHH------lLLHHHHHHhLH


DSSP  HHHHHL--lLLHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query VIKAVG--eGSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident               |     |  | ||            
Sbjct IPFLREkgvPQETLAGITVTNPARFLS--------ptlr  329
DSSP  HHHHHHlllLHHHHHHHHLHHHHHHHL--------llll


No 31: Query=4hk5D Sbjct=1bf6A Z-score=14.1

back to top
DSSP  ---lLLLEEEEEEELLhhHHHHHHLllllleeeeelleeeeeeellhhhhhhhhhhhhll
Query ---tPVVVDIHTHMYPpsYIAMLEKrqtiplvrtfpqadeprlillsselaaldaaladp   57
ident           | |                                               
Sbjct sfdpTGYTLAHEHLHI--DLSGFKN-----------------------------------   23
DSSP  llllLLEEEEEELLLE--ELHHHHL-----------------------------------


DSSP  llllllEELLhhHLLHHHHHHHHHHLL---LLEEEEEEllllllllllllhhhhHHHHhh
Query aaklpgRPLSthFASLAQKMHFMDTNG---IRVSVISLanpwfdflapdeapgiADAVna  114
ident                 |     |        |                            
Sbjct ------NVDC-rLDQYAFICQEMNDLMtrgVRNVIEMT---------------nRYMG--   59
DSSP  ------LHHH-eELLHHHHHHHHHHHHhllEEEEEELL---------------lHHHL--


DSSP  HHHHHHHLLL----LLEEEEEEL--------lLLLL-HHHHHHHHHHHHLL------LLE
Query EFSDMCAQHV----GRLFFFAAL--------pLSAP-VDAVKASIERVKNL------KYC  155
ident                                      |                      
Sbjct RNAQFMLDVMretgINVVACTGYyqdaffpehVATRsVQELAQEMVDEIEQgidgteLKA  119
DSSP  LLHHHHHHHHhhhlLEEEEEELLllhhhlllhHHHLlHHHHHHHHHHHHHLllllllLLE


DSSP  EEEE-ELLLllllLLLL--HHHHHHHHHHHH-LLLEEEELLlllllhhhhlllhhhlllh
Query RGII-LGTSglgkGLDD--PHLLPVFEAVAD-AKLLVFLHPhyglpnevygprseeyghv  211
ident   |   |||                              |                    
Sbjct GIIAeIGTS--egKITPleEKVFIAAALAHNqTGRPISTHT-------------------  158
DSSP  EEEEeEELL--llLLLHhhHHHHHHHHHHHHhHLLLEEEEL-------------------


DSSP  hhhhlhhhhHHHHHHHHHHhlLHHHHLLLL--LEEEHHHHLLhHHHHhhhhhhhhllhhh
Query lplalgfpmETTIAVARMYmaGVFDHVRNL--QMLLAHSGGTlPFLAgriescivhdghl  269
ident                                      |                      
Sbjct ---------SFSTMGLEQL--ALLQAHGVDlsRVTVGHCDLKdNLDN-------------  194
DSSP  ---------HHHLLHHHHH--HHHHHLLLLhhHEEELLLLLLlLHHH-------------


DSSP  hhllllllllllhHHHHHHLEEEELL----------llLHHHHHHHHHhhLHHHEELLLL
Query vktgkvpkdrrtiWTVLKEQIYLDAV----------iySEVGLQAAIAssGADRLMFGTD  319
ident                      |                    | |        | |   |
Sbjct ------------iLKMIDLGAYVQFDtigknsyypdekRIAMLHALRDrgLLNRVMLSMD  242
DSSP  ------------hHHHHHLLLEEEELlllllllllhhhHHHHHHHHHHllLHHHEEELLL


DSSP  LLL--LLLLlllLLLLL-HHHH-HHHHHHH-HHHLllLHHHHHHHLHHHHHHLLlhhhhh
Query HPF--FPPIeedVQGPW-DSSR-LNAQAVI-KAVGegSSDAAAVMGLNAVRVLSlkaele  374
ident               |   |                    |       |            
Sbjct ITRrsHLKA---NGGYGyDYLLtTFIPQLRqSGFS--QADVDVMLRENPSQFFQ------  291
DSSP  LLLhhHLHH---HLLLLlLHHHhLHHHHHHhLLLL--HHHHHHHHLHHHHHHLL------


DSSP  hhhhhl
Query hhhhhh  380
ident       
Sbjct ------  291
DSSP  ------


No 32: Query=4hk5D Sbjct=3e74A Z-score=14.1

back to top
DSSP  --------------------------------------------------LLLLEEEEEE
Query --------------------------------------------------TPVVVDIHTH   10
ident                                                    |  || |||
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL


DSSP  Ellhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleellhhh
Query Myppsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrplsthf   70
ident                                                             
Sbjct I-----------------------------------------------------------   61
DSSP  L-----------------------------------------------------------


DSSP  lLHHHHHHHHHHLLLLEEEEEELLllllllllllhhhhHHHHHHHHHHhhHLLL-lLEEE
Query aSLAQKMHFMDTNGIRVSVISLANpwfdflapdeapgiADAVNAEFSDmcAQHV-gRLFF  129
ident              ||        |                |      |            
Sbjct -GYETGTRAAAKGGITTXIEXPLN--------qlpatvDRASIELKFDaaKGKLtiDAAQ  112
DSSP  -LHHHHHHHHHHLLEEEEEELLLL--------llllllLHHHHHHHHHhhLLLLllEEEE


DSSP  EEELLLLllhhhHHHHHHHHHLLLlEEEEEELL-LLLLlllllHHHHHHHHHHHHLLLEE
Query FAALPLSapvdaVKASIERVKNLKyCRGIILGT-SGLGkglddPHLLPVFEAVADAKLLV  188
ident    |                       |                               |
Sbjct LGGLVSY-----NIDRLHELDEVG-VVGFXCFVrDVND-----WQFFKGAQKLGELGQPV  161
DSSP  LEELLLL-----LLLLHHHHHHHL-LLLEEEELlLLLH-----HHHHHHHHHHHHHLLLE


DSSP  EELLLLL--LLHHHHL--LLHHHLL--LHHHHhlhhHHHHHHHHHHHHhlLHHHHLlLLL
Query FLHPHYG--LPNEVYG--PRSEEYG--HVLPLalgfPMETTIAVARMYmaGVFDHVrNLQ  242
ident   |                         |             |  |              
Sbjct LVHCENAliCDELGEEakREGRVTAhdYVASR---pVFTEVEAIRRVL--YLAKVA-GCR  215
DSSP  EEELLLHhhHHHHHHHhhHHLLLLHhhHHHLL---lHHHHHHHHHHHH--HHHHHH-LLL


DSSP  EEEHHHHL-LHHHhhhhhhhhhhllhhhhhllllllllllhHHHH--hHLEEEELL-LLL
Query MLLAHSGG-TLPFlagriescivhdghlvktgkvpkdrrtiWTVL--kEQIYLDAV-IYS  298
ident     |                                             |       | 
Sbjct LHVCHVSSpEGVE--------------------------evTRARqegQDITCESCpHYF  249
DSSP  EEELLLLLhHHHH--------------------------hhHHHHhllLLEEEEELlHHH


DSSP  H--------------------------HHHHHHHHHHlhhHEELLLLLL-----------
Query E--------------------------VGLQAAIASSgadRLMFGTDHP-----------  321
ident                                               ||            
Sbjct VldtdqfeeigtlakcsppirdlenqkGXWEKLFNGE---IDCLVSDHSpcppexkagni  306
DSSP  HllhhhhhhhlhhhllllllllhhhhhHHHHHHHLLL---LLEELLLLLlllllllllll


DSSP  -----LLLLlllllllllhHHHHHHHhhHHHH---LLLLHHHHHHHLHHHHHHLLLHH--
Query -----FFPPieedvqgpwdSSRLNAQavIKAV---GEGSSDAAAVMGLNAVRVLSLKA--  371
ident                    |          ||   |            ||     |    
Sbjct xkawgGIAG--------lqSCXDVXF--DEAVqkrGXSLPXFGKLXATNAADIFGLQQkg  356
DSSP  lllllLLLL--------hhHHHHHHH--HHHLlllLLLHHHHHHHHLHHHHHHLLLLLll


DSSP  --hhHHHH----------------------------------------------------
Query --elEHHH----------------------------------------------------  377
ident                                                             
Sbjct riapGKDAdfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqg  416
DSSP  llllLLLLleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellll


DSSP  ----------hhl
Query ----------hhh  380
ident              
Sbjct fpvapkgqfilkh  429
DSSP  lllllllleelll


No 33: Query=4hk5D Sbjct=1j6pA Z-score=14.0

back to top
DSSP  -------------------------------------------------LLLLEEEEEEE
Query -------------------------------------------------TPVVVDIHTHM   11
ident                                                   |     ||| 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  LlhhhhhhhhlllllleeeeelleeeeeEELLhhhhhhhhhhhhlllllllLEEL-----
Query YppsyiamlekrqtiplvrtfpqadeprLILLsselaaldaaladpaaklpGRPL-----   66
ident                               |                       |     
Sbjct P-------------xtllrgvaedlsfeEWLF-------------------SKVLpiedr   88
DSSP  H-------------hhhhllllllllhhHHHH-------------------LLHHhhhll


DSSP  ---lhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhhhhHHHHHHHHHHLL
Query ---sthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiadaVNAEFSDMCAQH  123
ident                     ||   |                                  
Sbjct ltekxayYGTILAQXEXARHGIAGFVDXY------------------fHEEWIAKAVRDF  130
DSSP  llhhhhhHHHHHHHHHHHLLLEEEEEEEE------------------lLHHHHHHHHHHH


DSSP  LLLEEEEEELLLL-LLHHHHHHHHHHHHLLL------LEEEEEE-LLLLLLllllLHHHH
Query VGRLFFFAALPLS-APVDAVKASIERVKNLK------YCRGIIL-GTSGLGkgldDPHLL  175
ident   |      |  |               |           |                 | 
Sbjct GXRALLTRGLVDSnGDDGGRLEENLKLYNEWngfegrIFVGFGPhSPYLCS----EEYLK  186
DSSP  LLEEEEEEEELLLlLLLLLHHHHHHHHHHHHllhhhlEEEEEEElLLLLLL----HHHHH


DSSP  HHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhHHHHHHHhhllHH
Query PVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgFPMEtTIAVARMymagVF  235
ident  ||         |  |                                            
Sbjct RVFDTAKSLNAPVTIHL------------------------yETSK-EEYDLED----IL  217
DSSP  HHHHHHHHHLLLEEEEE------------------------lLLLL-LLLLLHH----HH


DSSP  HHL-LLLLEEEHHhHLLHHHHHhhhhhhhhllhhhhhllllllllllHHHHHHHLEEEEL
Query DHV-RNLQMLLAHsGGTLPFLAgriescivhdghlvktgkvpkdrrtIWTVLKEQIYLDA  294
ident            ||    ||                                         
Sbjct NIGlKEVKTIAAH-CVHLPERY-------------------------FGVLKDIPFFVSH  251
DSSP  LLLlLLLLEEEEE-LLLLLHHH-------------------------HHHHLLLLEEEEE


DSSP  LLL-------lhhHHHHHHHHHLhhHEELLLLLLLLLllllllllllhhHHHHHHHHHH-
Query VIY-------sevGLQAAIASSGadRLMFGTDHPFFPpieedvqgpwdsSRLNAQAVIK-  346
ident                |  |          |||                            
Sbjct NPAsnlklgngiaPVQRXIEHGX--KVTLGTDGAASN--------nslnLFFEXRLASLl  301
DSSP  LHHhhhhllllllLHHHHHHLLL--EEEELLLLLLLL--------llllHHHHHHHHHHh


DSSP  -------HHLLllHHHHHHHLHHHHHHLLLH-----hhHHHH------------------
Query -------AVGEgsSDAAAVMGLNAVRVLSLK-----aeLEHH------------------  376
ident                               |                             
Sbjct qkaqnprNLDV--NTCLKXVTYDGAQAXGFKsgkieegWNADlvvidldlpexfpvqnik  359
DSSP  hhlllllLLLH--HHHHHHHLHHHHHHHLLLlllllllLLLLeeeeelllhhhllhhhhh


DSSP  ----------------HHHL----------------------------
Query ----------------HHHH----------------------------  380
ident                                                 
Sbjct nhlvhafsgevfatxvAGKWiyfdgeyptidseevkrelariekelys  407
DSSP  hhhhhllllllleeeeLLEEeeellllllllhhhhhhhhhhhhhhhhl


No 34: Query=4hk5D Sbjct=2ogjA Z-score=13.9

back to top
DSSP  ------------------------------------------------------LLLLEE
Query ------------------------------------------------------TPVVVD    6
ident                                                        |  ||
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE


DSSP  EEEEELLHHHHhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleel
Query IHTHMYPPSYIamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpl   66
ident  | |                                                        
Sbjct LHVHIWHGGTD-------------------------------------------------   71
DSSP  EEELLLLLLLL-------------------------------------------------


DSSP  lhhHLLHhhHHHHHHHLLLLEEEEEELlllllllllllhhhhHHHHHHHHHH-HHHLLLL
Query sthFASLaqKMHFMDTNGIRVSVISLAnpwfdflapdeapgiADAVNAEFSD-MCAQHVG  125
ident                  |    |                     |    |          
Sbjct ---ISIR--PSECGAERGVTTLVDAGS--------------aGEANFHGFREyIIEPSRE  112
DSSP  ---LLLL--HHHLLHHHLEEEEEEELL--------------lLLLLHHHHHHhLLLLLLL


DSSP  LEEEEEELL------------LLLLHhHHHHHHH-HHHLL-LLEEEEEELL---LLLLLL
Query RLFFFAALP------------LSAPVdAVKASIE-RVKNL-KYCRGIILGT---SGLGKG  168
ident |   |  |             |          |            |             |
Sbjct RIKAFLNLGsiglvacnrvpeLRDIKdIDLDRILeCYAENsEHIVGLXVRAshvITGSWG  172
DSSP  EEEEEEELLllllllllllllLLLHHhLLHHHHHhHHHLLlLLEEEEEEEElhhHHLLLL


DSSP  LLlhhhHHHHHHHHHLLLEEEELLLLLllhhhhlllhhhlllhhhhhlhhhhhhhhHHHH
Query LDdphlLPVFEAVADAKLLVFLHPHYGlpnevygprseeyghvlplalgfpmettiAVAR  228
ident                 |     |                                     
Sbjct VT--pvKLGKKIAKILKVPXXVHVGEP---------------------------paLYDE  203
DSSP  LH--hhHHHHHHHHHHLLLEEEEELLL---------------------------llLHHH


DSSP  HHhlLHHHhlllLLEEEHHHHLL----HHHHHHHHhhhhhllhhhhhlllllllllLHHH
Query MYmaGVFDhvrnLQMLLAHSGGT----LPFLAGRIescivhdghlvktgkvpkdrrTIWT  284
ident                   |                                         
Sbjct VL--EILG----PGDVVTHCFNGksgsSIXEDEDL-------------------fnLAER  238
DSSP  HH--HHLL----LLLEEELLLLLllllLLLLLHHH-------------------hhHHHH


DSSP  HhhHLEEEELLL----LLHHHHHHHH-HHHLhhHEELLLLLL--LLLLllllllllLHHH
Query VlkEQIYLDAVI----YSEVGLQAAI-ASSGadRLMFGTDHP--FFPPieedvqgpWDSS  337
ident    | | ||        |     |||            ||                    
Sbjct C--EGIRLDIGHggasFSFKVAEAAIaRGLL--PFSISTDLHghSXNF--------PVWD  286
DSSP  L--LLLEEELLLllllLLHHHHHHHHhLLLL--LLLLLLLLLllLLLL--------LLLL


DSSP  -HHHHHHHHHHHLLlLHHHHHHHLHHHHHHLLLHhhHHHHHHH-----------------
Query -RLNAQAVIKAVGEgSSDAAAVMGLNAVRVLSLKaeLEHHHHH-----------------  379
ident                          |   |  |    |                      
Sbjct lATTXSKLLSVDXP-FENVVEAVTRNPASVIRLD--XENRLDVgqradftvfdlvdadle  343
DSSP  hHHHHHHHHHLLLL-HHHHHHLLLHHHHHHLLLL--LLLLLLLlllleeeeeeeeeeeee


DSSP  -----------------------------------l
Query -----------------------------------h  380
ident                                     
Sbjct atdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eellllleeeeeeeeeeeeeeelleeeellllllll


No 35: Query=4hk5D Sbjct=3mkvA Z-score=13.8

back to top
DSSP  -------------------------------------------------------LLLLE
Query -------------------------------------------------------TPVVV    5
ident                                                         |   
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEEEEL-----lHHHHHHHhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query DIHTHMY-----pPSYIAMLekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident | | |        |                                              
Sbjct DLHVHVVaiefnlPRVATLP----------------------------------------   80
DSSP  EEEELLLlllllhHHHLLLL----------------------------------------


DSSP  llleellhhhlLHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhhhhhhhhHHHHH
Query lpgrplsthfaSLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiadavnaeFSDMC  120
ident                 |  |   |                                    
Sbjct -----nvlvtlRAVPIMRAMLRRGFTTVRDAGG---------------------aGYPFK  114
DSSP  -----hhhhhhHHHHHHHHHHHLLEEEEEELLL---------------------lLHHHH


DSSP  HLLL------lLEEEEE-ELLLL--------------------------------LLHHH
Query AQHV------gRLFFFA-ALPLS--------------------------------APVDA  141
ident            |||    ||                                     || 
Sbjct QAVEsglvegpRLFVSGrALSQTgghadprarsdymppdspcgccvrvgalgrvaDGVDE  174
DSSP  HHHHlllllllEEEELLlEEELLlllllllllllllllllllllllllllleeelLLHHH


DSSP  HHHHHHHHHLLLlEEEEEELL--------------LLLLlllllhhHHHHHHHHHHLLLE
Query VKASIERVKNLKyCRGIILGT--------------SGLGkglddphLLPVFEAVADAKLL  187
ident |               |                                           
Sbjct VRRAVREELQMG-ADQIXIMAsggvasptdpvgvfGYSE-----deIRAIVAEAQGRGTY  228
DSSP  HHHHHHHHHHHL-LLLEEEELllllllllllllllLLLH-----hhHHHHHHHHHLLLLL


DSSP  EEELLlllllhhhhlllhhhlllhhhhhlhhhhHHHHHHHHHhhllhhhhlllLLEEEHH
Query VFLHPhyglpnevygprseeyghvlplalgfpmETTIAVARMymagvfdhvrnLQMLLAH  247
ident |  |                              |  | ||                  |
Sbjct VLAHA----------------------------YTPAAIARA--------vrcGVRTIEH  252
DSSP  EEEEE----------------------------LLHHHHHHH--------hhlLLLEEEE


DSSP  hHLLHHHHHhhhhhhhhllhhhhhllllllllllhhHHHH-HLEEEELLLL---------
Query sGGTLPFLAgriescivhdghlvktgkvpkdrrtiwTVLK-EQIYLDAVIY---------  297
ident  |                                          |               
Sbjct -GNLIDDET--------------------------aRLVAeHGAYVVPTLVtydalaseg  285
DSSP  -LLLLLHHH--------------------------hHHHHhHLLEEELLHHhhhhhhhhl


DSSP  -------------------LHHHHHHHHHHHLhhHEELLLLLLLLLlllllllllLHHHH
Query -------------------SEVGLQAAIASSGadRLMFGTDHPFFPpieedvqgpWDSSR  338
ident                                      ||||                   
Sbjct ekyglppesiakiadvhgaGLHSIEIMKRAGV--KMGFGTDLLGEA---------QRLQS  334
DSSP  llllllhhhhllhhhhhllHHHHHHHHHHHLL--LLLLLLLLLHHH---------HHHLL


DSSP  HHHHHHHHHHLllLHHHHHHHLHHHHHHLLLHHHH-----HHHH----------------
Query LNAQAVIKAVGegSSDAAAVMGLNAVRVLSLKAEL-----EHHH----------------  377
ident                   |        ||     |       |                 
Sbjct DEFRILAEVLS--PAEVIASATIVSAEVLGMQDKLgrivpGAHAdvlvvdgnplksvdcl  392
DSSP  HHHHHHHLLLL--HHHHHHHLLHHHHHHLLLLLLLlllllLLLLleeeelllllllllll


DSSP  -------------------hhl
Query -------------------hhh  380
ident                       
Sbjct lgqgehiplvmkdgrlfvnele  414
DSSP  lllllllleeeelleeeeelll


No 36: Query=4hk5D Sbjct=3mtwA Z-score=13.6

back to top
DSSP  --------------------------------------------------------LLLL
Query --------------------------------------------------------TPVV    4
ident                                                          |  
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEEEELLhhhhhhhhlllllleeeeelleeEEEEEllhhhhhhhhhhhhlllllllle
Query VDIHTHMYPpsyiamlekrqtiplvrtfpqadEPRLIllsselaaldaaladpaaklpgr   64
ident  | | |                                                      
Sbjct IDMHVHLDS------------------laevgGYNSL---------------------ey   81
DSSP  EEEEELLLL------------------lllllHHHHH---------------------hl


DSSP  ellhhhLLHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhhhhHHHHHHHHHHLLL
Query plsthfASLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiadaVNAEFSDMCAQHV  124
ident                    |        |                               
Sbjct sdrfwsVVQTANAKKTLEAGFTTVRNVGA------------------ADYDDVGLREAID  123
DSSP  lhhhhhHHHHHHHHHHHHLLEEEEEELLL------------------LLLHHHHHHHHHH


DSSP  ------lLEEEE-EELL---------------------LLLLHHHHHHHHHHHHLLLlEE
Query ------gRLFFF-AALP---------------------LSAPVDAVKASIERVKNLKyCR  156
ident        |                               |   |         |      
Sbjct agyvpgpRIVTAaISFGatgghcdstffppsmdqknpfNSDSPDEARKAVRTLKKYG-AQ  182
DSSP  lllllllEEEELlLLEEllllllllllllhhhllllllLLLLHHHHHHHHHHHHHLL-LL


DSSP  EEEELLL---------llllLLLLHhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhh
Query GIILGTS---------glgkGLDDPhLLPVFEAVADAKLLVFLHPhyglpnevygprsee  207
ident  |                   |       |      |   |  |                
Sbjct VIXICATggvfsrgnepgqqQLTYEeMKAVVDEAHMAGIKVAAHA---------------  227
DSSP  EEEEELLlllllllllllllLLLHHhHHHHHHHHHHLLLEEEEEE---------------


DSSP  lllhhhhhlhhhhHHHHHHHHhhhllhhhhlllLLEEEHhHHLLhHHHHhhhhhhhhllh
Query yghvlplalgfpmETTIAVARmymagvfdhvrnLQMLLAhSGGTlPFLAgriescivhdg  267
ident                                                             
Sbjct -------------HGASGIRE--------avraGVDTIE-HASL-VDDE-----------  253
DSSP  -------------LLHHHHHH--------hhhlLLLEEE-ELLL-LLHH-----------


DSSP  hhhhllllllllllHHHHHH-HLEEEELLLL----------------------------l
Query hlvktgkvpkdrrtIWTVLK-EQIYLDAVIY----------------------------s  298
ident                         |    ||                             
Sbjct --------------GIKLAVqKGAYFSMDIYntdytqaegkkngvlednlrkdrdigelq  299
DSSP  --------------HHHHHHhHLLEEELLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhh


DSSP  HHHHHHHH-HHHLhhhEELLLLLLLLLllllllllllhHHHHHHHHHHH-HHLLllHHHH
Query EVGLQAAI-ASSGadrLMFGTDHPFFPpieedvqgpwdSSRLNAQAVIK-AVGEgsSDAA  356
ident       |  |         |||    |                               | 
Sbjct RENFRKALkAGVK---MVYGTDAGIYP---------hgDNAKQFAVMVRyGATP--LQAI  345
DSSP  HHHHHHHHhHLLE---EELLLLLLLLL---------llLHHHHHHHHHHlLLLH--HHHH


DSSP  HHHLHHHHHHLLLHHHH-----HHHH------------------------------hhl
Query AVMGLNAVRVLSLKAEL-----EHHH------------------------------hhh  380
ident     | |   |                                                
Sbjct QSATLTAAEALGRSKDVgqvavGRYGdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  HHLLHHHHHHHLLLLLLlllllLLLLleeeelllllllhhhhhllleeeelleeeelll


No 37: Query=4hk5D Sbjct=3icjA Z-score=13.4

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------TP    2
ident                                                            |
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LLEEEEEEEL--------lhhhhhhhhlllllleeeeelleEEEE---------------
Query VVVDIHTHMY--------ppsyiamlekrqtiplvrtfpqaDEPR---------------   39
ident    | | |                                                    
Sbjct AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriIFGFgwdqdelgrwptred  120
DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhllllllEEEEeelhhhhlllllhhh


DSSP  --------eellhHHHHH-------------hhhhHHLLLLLLLL--------------e
Query --------lillsSELAA-------------ldaaLADPAAKLPG--------------r   64
ident                  |                                          
Sbjct ldvidrpvflyrrCFHVAvmnskmidllnlkpskdFDESTGIVREraleesrkiinekil  180
DSSP  hlllllleeeeelLLLEEeelhhhhhhhlllllllEELLLLEEEHhhhhhhhhhhhhlll


DSSP  ellhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHHHHHHHHH--hL
Query plsthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVNAEFSDMC--aQ  122
ident                    |                                        
Sbjct tvkdykHYIESAQEHLLSLGVHSVGFMS---------------vGEKALKALFELEregR  225
DSSP  lhhhhhHHHHHHHHHHHHLLEEEEEEEE---------------eLHHHHHHHHHHHhllL


DSSP  LLLLEEEEEELLllllhhhHHHH--hHHHHLLL---LEEEEEELLL--------------
Query HVGRLFFFAALPlsapvdaVKAS--iERVKNLK---YCRGIILGTS--------------  163
ident      |                       |         |  |                 
Sbjct LKMNVFAYLSPE------lLDKLeelNLGKFEGrrlRIWGVXLFVDgslgartallsepy  279
DSSP  LLLEEEEEELHH------hHHHHhhhLLLLEELlleEEEEEEEELLllllllllllllll


DSSP  -------llLLLLLLHhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhl
Query -------glGKGLDDPhLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplal  216
ident               |     | |      | |  |                         
Sbjct tdnpttsgeLVMNKDE-IVEVIERAKPLGLDVAVHA------------------------  314
DSSP  lllllllllLLLLHHH-HHHHHHHHLLLLLEEEEEE------------------------


DSSP  hhhhHHHHHHHHHHhlLHHHHLLlLLEEEHHhHLLHhhhHHHHhhhhhllhhhhhlllll
Query gfpmETTIAVARMYmaGVFDHVRnLQMLLAHsGGTLpflAGRIescivhdghlvktgkvp  276
ident         ||        |           |                             
Sbjct ----IGDKAVDVAL--DAFEEAE-FSGRIEH-ASLV---RDDQ-----------------  346
DSSP  ----LLHHHHHHHH--HHHHHHL-LLLEEEE-LLLL---LHHH-----------------


DSSP  lllllhHHHHH-HLEEEELLLL------------------lhhHHHHHHHHHlhhHEELL
Query kdrrtiWTVLK-EQIYLDAVIY------------------sevGLQAAIASSgadRLMFG  317
ident           |       |                         |           | | 
Sbjct ------LERIKeLKVRISAQPHfivsdwwivnrvgeerakwayRLKTLSSIT---KLGFS  397
DSSP  ------HHHHHhHLLEEEELLLhhhhlllhhhhhhhhhhhhllLHHHHHHHL---LEEEL


DSSP  LLLLLLLllllllllllhHHHHHHHHHHH--------HHLLllHHHHHHHLHHHHH-HLL
Query TDHPFFPpieedvqgpwdSSRLNAQAVIK--------AVGEgsSDAAAVMGLNAVR-VLS  368
ident || |  |                  |            |      |            | 
Sbjct TDSPIEP----------aDPWVSIDAAVNryvvdpgeRVSR--EEALHLYTHGSAQvTLA  445
DSSP  LLLLLLL----------lLHHHHHHHHHHlllllhhhLLLH--HHHHHHLLHHHHHhLLL


DSSP  LH---hhhHHHH--------hhl
Query LK---aelEHHH--------hhh  380
ident                        
Sbjct EDlgklerGFRAeyiildrdplk  468
DSSP  LLllllllLLLLleeeellllll


No 38: Query=4hk5D Sbjct=3k2gB Z-score=13.4

back to top
DSSP  -------------------------llLLEEEEEEELLHhhhhhhhlllllLEEEeelle
Query -------------------------tpVVVDIHTHMYPPsyiamlekrqtiPLVRtfpqa   35
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQND----------crCWWN-----   45
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEE----------lhHHLL-----


DSSP  eeeeeellhhhhhHHHHhhhLLLLLLL------------------LEELLHhHLLHHHHH
Query deprlillsselaALDAalaDPAAKLP------------------GRPLSThFASLAQKM   77
ident                          |                             |    
Sbjct -------------PPQE---PERQYLAeapisieilselrqdpfvNKHNIA-LDDLDLAI   88
DSSP  -------------LLLL---HHHHHHHhllllhhhhhhhhllhhhLLLLLE-ELLHHHHH


DSSP  HHHHHLL---LLEEEEEElllLLLLlllllhhhhhhhhhhHHHHHHHLLL----LLEEEE
Query HFMDTNG---IRVSVISLanpWFDFlapdeapgiadavnaEFSDMCAQHV----GRLFFF  130
ident            |  |                                             
Sbjct AEVKQFAavgGRSIVDPT---CRGI--------------gRDPVKLRRISaetgVQVVXG  131
DSSP  HHHHHHHhllLLEEEELL---LLLL--------------lLLHHHHHHHHhhhlLEEEEL


DSSP  EEL---------lllLLHHHHHHHHHHHHLLL------lEEEEE-ELLL--LLLLLLllh
Query AAL---------plsAPVDAVKASIERVKNLK------yCRGII-LGTS--GLGKGLddp  172
ident |                 |     |                 |   | |           
Sbjct AGYylassxpetaarLSADDIADEIVAEALEGtdgtdarIGLIGeIGVSsdFTAEEE--k  189
DSSP  LLLllhhhllhhhhlLLHHHHHHHHHHHHHLLlllllllLLLEEeELLLllLLHHHH--h


DSSP  hHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhhHHHHHHHhl
Query hLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgFPMEttIAVARMYma  232
ident  |     |     |    |                                    |    
Sbjct sLRGAARAQVRTGLPLXVHL-------------------------PGWF--RLAHRVL--  220
DSSP  hHHHHHHHHHHHLLLEEELL-------------------------LLLL--LLHHHHH--


DSSP  LHHHHLLLL--LEEEHHhHLLHHHHHHhhhhhhhllhhhhhllllllllllhHHHHHHLE
Query GVFDHVRNL--QMLLAHsGGTLPFLAGriescivhdghlvktgkvpkdrrtiWTVLKEQI  290
ident               | |                                    |      
Sbjct DLVEEEGADlrHTVLCH-XNPSHXDPV-----------------------yqATLAQRGA  256
DSSP  HHHHHLLLLhhHEEELL-LHHHLLLHH-----------------------hhHHHHHHLL


DSSP  EEELL------------------llLHHHHHHHHHHhLHHHEELLLLLL--LLLLlllLL
Query YLDAV------------------iySEVGLQAAIASsGADRLMFGTDHP--FFPPieeDV  330
ident  |                                     ||     |             
Sbjct FLEFDxigxdffyadqgvqcpsddeVARAILGLADHgYLDRILLSHDVFvkXXLT---RY  313
DSSP  EEEELlllllleelllleelllhhhHHHHHHHHHHLlLHHHEEELLLLLlhHHLH---HH


DSSP  LLLL-HHHH-HHHHHHH-HHHLllLHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query QGPW-DSSR-LNAQAVI-KAVGegSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident  |                                |  ||              
Sbjct GGNGyAFVTkHFLPRLRrHGLD--DAALETLXVTNPRRVFD------asiegh  358
DSSP  LLLLlLHHHhLHHHHHHhLLLL--HHHHHHHHLHHHHHHHL------llllll


No 39: Query=4hk5D Sbjct=2oofA Z-score=13.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLLEEEEEE-ELLHhhhhhhhlllllleEEEE--LLEE-----eeeEELLhhhhhhhhh
Query TPVVVDIHTH-MYPPsyiamlekrqtiplVRTF--PQAD-----eprLILLsselaalda   52
ident ||   | |||                                                  
Sbjct TPGLIDCHTHlIFAG----------sraeEFELrqKGVPyaeiarkgGGII---------  101
DSSP  EELEEEEEELlLLLL----------llhhHHHHhhHLLLhhhhhhllLLHH---------


DSSP  hhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEEllLLLLllllllHHHHHHHH
Query aladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLanPWFDflapdeAPGIADAV  112
ident                                |     |                      
Sbjct ---stvratraasedqlfELALPRVKSLIREGVTTVEIKS--GYGL------TLEDELKX  150
DSSP  ---hhhhhhhhllhhhhhHHHHHHHHHHHHHLEEEEEEEL--LLLL------LHHHHHHH


DSSP  HHHHHHHHHLLLLLEEEEEEL----------lllLLHHHHH-HHHHHHHLLLlEEEEEEL
Query NAEFSDMCAQHVGRLFFFAAL----------plsAPVDAVK-ASIERVKNLKyCRGIILG  161
ident              |                      |       |               
Sbjct LRVARRLGEALPIRVKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGlADAVDVF  210
DSSP  HHHHHHHHHHLLLEEEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLlLLEEEEE


DSSP  LLllllLLLLhhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHH
Query TSglgkGLDDphLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgFPME  221
ident        |       |  |     | |  |                              
Sbjct CEhigfSLAQ--TEQVYLAADQYGLAVKGHX-------------------------DQLS  243
DSSP  ELllllLHHH--HHHHHHHHHHLLLEEEEEE-------------------------LLLL


DSSP  hHHHHhhhhhllhhhhlLLLLEEEHHhHLLHHHhhhhhhhhhhllhhhhhlllllllllL
Query tTIAVarmymagvfdhvRNLQMLLAHsGGTLPFlagriescivhdghlvktgkvpkdrrT  281
ident                          |    |                             
Sbjct -NLGG-------stlaaNFGALSVDH-LEYLDP--------------------------E  268
DSSP  -LLLH-------hhhhhHLLLLEEEE-LLLLLH--------------------------H


DSSP  HHHHHHHL-EEEELLLL--------lhhHHHHHHHHHLhhHEELLLLLL---LLLLllll
Query IWTVLKEQ-IYLDAVIY--------sevGLQAAIASSGadRLMFGTDHP---FFPPieed  329
ident     |                          |              |             
Sbjct GIQALAHRgVVATLLPTafyflketklpPVVALRKAGV--PXAVSSDINpgtAPIV----  322
DSSP  HHHHHHHHlLEEEELHHhhhhlllllllLHHHHHHLLL--LEEELLLLLlllLLLL----


DSSP  lllllhHHHHHHHHHHH--HHLLllHHHHHHHLHHHHH-HLLLHH------hHHHH----
Query vqgpwdSSRLNAQAVIK--AVGEgsSDAAAVMGLNAVR-VLSLKA------eLEHH----  376
ident       | |                  | |     | |                      
Sbjct ------SLRXAXNXACTlfGLTP--VEAXAGVTRHAARaLGEQEQlgqlrvgXLADflvw  374
DSSP  ------LHHHHHHHHHHhhLLLH--HHHHHHLLHHHHHhLLLLLLlllllllLLLLeeee


DSSP  ----------------------HHHL---
Query ----------------------HHHH---  380
ident                              
Sbjct ncghpaelsyligvdqlvsrvvNGEEtlh  403
DSSP  llllllhhhhlllllleeeeeeLLEElll


No 40: Query=4hk5D Sbjct=4c5yA Z-score=13.3

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------T    1
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  LLLEEEEEEELLHhhHHHHHllllLLEEeeelleeeeeeellhhhhhhhhhhhhllllll
Query PVVVDIHTHMYPPsyIAMLEkrqtIPLVrtfpqadeprlillsselaaldaaladpaakl   61
ident |   | | |                                                   
Sbjct PGLWDCHMHFGGD--DDYYN----DYTS--------------------------------   82
DSSP  ELEEEEEELLLLL--LLLLL----LLHH--------------------------------


DSSP  lleellHHHL-LHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhhhhhhhHHHHHH
Query pgrplsTHFA-SLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiadavnaEFSDMC  120
ident             ||        ||                                    
Sbjct glathpASSGaRLARGCWEALQNGYTSYRDLAG---------------------YGCEVA  121
DSSP  hhhllhHHHHhHHHHHHHHHHHLLEEEEEELLL---------------------LHHHHH


DSSP  HLLL------lLEEEE-EELLLL------------------------------------L
Query AQHV------gRLFFF-AALPLS------------------------------------A  137
ident                  |||                                        
Sbjct KAINdgtivgpNVYSSgAALSQTaghgdifalpagevlgsygvmnprpgywgagplciaD  181
DSSP  HHHHlllllllEEEELlLEEELLllllllllllhhhhhhhhlllllllllllllleeelL


DSSP  LHHHHHHHHHHHHLLLlEEEEEELLL--------llllLLLLHHH-HHHHHHHHHLLLEE
Query PVDAVKASIERVKNLKyCRGIILGTS--------glgkGLDDPHL-LPVFEAVADAKLLV  188
ident  |  |               |    |                |       |  |     |
Sbjct GVEEVRRAVRLQIRRG-AKVIXVMASggvmsrddnpnfAQFSPEElKVIVEEAARQNRIV  240
DSSP  LHHHHHHHHHHHHHHL-LLLEEEELLllllllllllllLLLLHHHhHHHHHHHHHLLLLE


DSSP  EELLlllllhhhhlllhhhlllhhhhhlhhhhHHHHHHHHhhhllhhhhlllLLEEEHHh
Query FLHPhyglpnevygprseeyghvlplalgfpmETTIAVARmymagvfdhvrnLQMLLAHs  248
ident   |                                                     | | 
Sbjct SAHV----------------------------HGKAGIMA--------aikaGCKSLEH-  263
DSSP  EEEE----------------------------LLHHHHHH--------hhhhLLLEEEE-


DSSP  HLLHHHHHhhhhhhhhllhhhhhllllllllllhHHHHH-HLEEEELLLL----------
Query GGTLPFLAgriescivhdghlvktgkvpkdrrtiWTVLK-EQIYLDAVIY----------  297
ident                                   |   |   |   |             
Sbjct VSYADEEV--------------------------WELMKeKGILYVATRSvieiflasng  297
DSSP  LLLLLHHH--------------------------HHHHHhHLLEEELLHHhhhhhhhhll


DSSP  -----------------lhHHHHHHHHHHLhhHEELLLLLLlllllllllllllhHHHHH
Query -----------------seVGLQAAIASSGadRLMFGTDHPffppieedvqgpwdSSRLN  340
ident                       | ||          |||                   | 
Sbjct eglvkeswaklqaladshlKAYQGAIKAGV--TIALGTDTA-----------pggPTALE  344
DSSP  llllllhhhlllhhhhhhhHHHHHHHHLLL--LEELLLLLL-----------lllLLHHH


DSSP  HHHHHH--HHLLllHHHHHHHLHHHHHHL--LLHH-------------------------
Query AQAVIK--AVGEgsSDAAAVMGLNAVRVL--SLKA-------------------------  371
ident  |              |      ||                                   
Sbjct LQFAVErgGMTP--LEAIKAATANAPLSVgpQAPLtgqlregyeadvialeenpledikv  402
DSSP  HHHHHHllLLLH--HHHHHHHLLLHHHHHhhHLLLllllllllllleeeelllllllhhh


DSSP  --------hhhhHHHH-----------------l
Query --------elehHHHH-----------------h  380
ident                                   
Sbjct fqepkavthvwkGGKLfkgpgigpwgedarnpfl  436
DSSP  hhlhhheeeeeeLLEEeellllllllllllllll


No 41: Query=4hk5D Sbjct=2vc5A Z-score=12.8

back to top
DSSP  --------------llLLEEEEEE-ELLHhHHHHHHLLLllleeeeelleeeeeeellhh
Query --------------tpVVVDIHTH-MYPPsYIAMLEKRQtiplvrtfpqadeprlillss   45
ident                     || |                                    
Sbjct mriplvgkdsieskdiGFTLIHEHlRVFS-EAVRQQWPH---------------------   38
DSSP  llllllllllllhhhlLLEELLLLlLLLL-HHHHHHLHH---------------------


DSSP  hhhhhhhhhhlllllllleellhhhlLHHHHHHHHHHLL---LLEEEEEELLLLllllll
Query elaaldaaladpaaklpgrplsthfaSLAQKMHFMDTNG---IRVSVISLANPWfdflap  102
ident                                               |             
Sbjct --------------------lynedeEFRNAVNEVKRAMqfgVKTIVDPTVMGL------   72
DSSP  --------------------hllhhhHHHHHHHHHHHHHhllLLEEEELLLLLL------


DSSP  llhhhhhhhhhhHHHHHHHLLL----LLEEEEEEL--------lllLLHH-HHHHHHHHH
Query deapgiadavnaEFSDMCAQHV----GRLFFFAAL--------plsAPVD-AVKASIERV  149
ident                      |      |                               
Sbjct -----------gRDIRFMEKVVkatgINLVAGTGIyiyidlpfyflNRSIdEIADLFIHD  121
DSSP  -----------lLLHHHHHHHHhlllLEEEELEELlllllllhhhlLLLHhHHHHHHHHH


DSSP  HLL------LLEEEEEELLLllLLLLlLHHHH---HHHHHHHH-LLLEEEELLlllllhh
Query KNL------KYCRGIILGTSglGKGLdDPHLL---PVFEAVAD-AKLLVFLHPhyglpne  199
ident                         |                    |     |        
Sbjct IKEgiqgtlNKAGFVXIAAD--EPGI-TKDVEkviRAAAIANKeTKVPIITHS-------  171
DSSP  HHLllllllLLLLLEEEELL--LLLL-LHHHHhhhHHHHHHHHhHLLLEEEEL-------


DSSP  hhlllhhhlllhhhhhlhHHHHhhHHHHHHhhlLHHHHLLLL--LEEEHHHHLLhHHHHh
Query vygprseeyghvlplalgFPMEttIAVARMymaGVFDHVRNL--QMLLAHSGGTlPFLAg  257
ident                                               |  | | |      
Sbjct ------------------NAHN--NTGLEQ--qRILTEEGVDpgKILIGHLGDTdNIDY-  208
DSSP  ------------------LLLL--LHHHHH--hHHHHHLLLLhhHEEELLHHHLlLHHH-


DSSP  hhhhhhhllhhhhhllllllllllhHHHHHHLEEEELL----------llLHHHHHHHHH
Query riescivhdghlvktgkvpkdrrtiWTVLKEQIYLDAV----------iySEVGLQAAIA  307
ident                                                           | 
Sbjct ------------------------iKKIADKGSFIGLDrygldlflpvdkRNETTLRLIK  244
DSSP  ------------------------hHHHHHLLLEEEELlllllllllhhhHHHHHHHHHH


DSSP  HHLHHHEELLLLLL---------lllLLLLllllllhHHHHHH-HHHHHHHL--lLLHHH
Query SSGADRLMFGTDHP---------ffpPIEEdvqgpwdSSRLNA-QAVIKAVG--eGSSDA  355
ident     |  |   |                         |  |                   
Sbjct DGYSDKIMISHDYCctidwgtakpeyKPKL---aprwSITLIFeDTIPFLKRngvNEEVI  301
DSSP  LLLLLLEEELLLLLlllllllllhhhHHHH---llllLLLHHHhLHHHHHHLlllLHHHH


DSSP  HHHHLHHHHHHLLlhhhhhhhhhhl
Query AAVMGLNAVRVLSlkaelehhhhhh  380
ident |     |     |            
Sbjct ATIFKENPKKFFS------------  314
DSSP  HHHHLHHHHHHLL------------


No 42: Query=4hk5D Sbjct=2imrA Z-score=12.7

back to top
DSSP  -----------------------------------------------------LLLLEEE
Query -----------------------------------------------------TPVVVDI    7
ident                                                       |  |  
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleeLLLLLEE


DSSP  EEEELlhhhhhhhhlllllleeeeelleeeeeeeLLHHHhhhhhhhhhlllllllLEELL
Query HTHMYppsyiamlekrqtiplvrtfpqadeprliLLSSElaaldaaladpaaklpGRPLS   67
ident |||                                                         
Sbjct HTHLD-------------------msayefqalpYFQWI-------------pevVIRGR   88
DSSP  EEELL-------------------llhhhhhhlhHHHLL-------------hhhHHHHL


DSSP  HHHL--LHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHHHHHHHhhHLLLl
Query THFA--SLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVNAEFSDmcAQHVg  125
ident                   |                        |  |             
Sbjct HLRGvaAAQAGADTLTRLGAGGVGDIV---------------wAPEVMDALLA--REDL-  130
DSSP  LLLHhhHHHHHHHHHHHLLLLLEEEEE---------------lLHHHHHHHHL--LLLL-


DSSP  LEEEEEELLL------lLLHHHHHHHHHHHHLLL---LEEEEEE-LLLLLLllllLHHHH
Query RLFFFAALPL------sAPVDAVKASIERVKNLK---YCRGIIL-GTSGLGkgldDPHLL  175
ident                      |     ||   |       |                   
Sbjct SGTLYFEVLNpfpdkadEVFAAARTHLERWRRLErpgLRLGLSPhTPFTVS----HRLMR  186
DSSP  LEEEEEEELLllhhhhhHHHHHHHHHHHHHHLLLlllEEEEEEElLLLLLL----HHHHH


DSSP  HHHHHHHHLLLEEEELL-------------lllLLHHHHlllhhhlllhhhhhlhhhhhh
Query PVFEAVADAKLLVFLHP-------------hygLPNEVYgprseeyghvlplalgfpmet  222
ident       |   |    |                 |                          
Sbjct LLSDYAAGEGLPLQIHVaehptelemfrtgggpLWDNRM--palyphtlaevigrepgpd  244
DSSP  HHHHHHHHHLLLLEEEElllhhhhhhhhhllllLHHHLL--hhhllllhhhhhlllllll


DSSP  hHHHHHHHhLLHHhhllLLLEEEHhHHLLhhHHHHhhhhhhhllhhhhhllllllllllH
Query tIAVARMYmAGVFdhvrNLQMLLAhSGGTlpFLAGriescivhdghlvktgkvpkdrrtI  282
ident    |                  |                                     
Sbjct lTPVRYLD-ELGV---lAARPTLV-HMVN--VTPD------------------------D  273
DSSP  lLHHHHHH-HHLL---hHHLLEEE-ELLL--LLHH------------------------H


DSSP  HHHHH-HLEEEELLLL-------lhhHHHHHHHHHLhhHEELLLLLLLLlllllllllll
Query WTVLK-EQIYLDAVIY-------sevGLQAAIASSGadRLMFGTDHPFFppieedvqgpw  334
ident                              |  |         |||               
Sbjct IARVArAGCAVVTCPRsnhhlecgtfDWPAFAAAGV--EVALGTDSVAS--------get  323
DSSP  HHHHHhHLLLEEELHHhhhhllllllLHHHHHHLLL--LEEELLLLHHH--------hll


DSSP  hhHHHHHHHHHHHHL-lLLHHHHHHHLHHHHHHLLlhhhHHHH--------------hhh
Query dsSRLNAQAVIKAVG-eGSSDAAAVMGLNAVRVLSlkaeLEHH--------------hhh  379
ident    |                           ||                           
Sbjct lnVREEVTFARQLYPglDPRVLVRAAVKGGQRVVG----TPFLrrgetwqegfrwelsrd  379
DSSP  llLHHHHHHHHHHLLllLHHHHHHHHHHHHHHHHL----LLLLlllllllhhhlhhhlll


DSSP  l
Query h  380
ident  
Sbjct l  380
DSSP  l


No 43: Query=4hk5D Sbjct=4rdvB Z-score=12.6

back to top
DSSP  -----------------------------------------------LLLLEEEEEEEL-
Query -----------------------------------------------TPVVVDIHTHMY-   12
ident                                                 |     | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh


DSSP  -----------------------lhhhHHHHhlllllleeeeelleeeeeeellhhhhhh
Query -----------------------ppsyIAMLekrqtiplvrtfpqadeprlillsselaa   49
ident                             | |                             
Sbjct ramaglaevagnpndsfwtwrelmyrmVARL-----------------------------   91
DSSP  hhhlllllllllllllhhhhhhhhhhhHLLL-----------------------------


DSSP  hhhhhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEELlllllllllLLHHHHH
Query ldaaladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLAnpwfdflapDEAPGIA  109
ident                          |    |   |                         
Sbjct ---------------speqieVIACQLYIEMLKAGYTAVAEFHY---vhhdldGRSYADP  133
DSSP  ---------------lhhhhhHHHHHHHHHHHHHLEEEEEEEEL---llllllLLLLLLL


DSSP  HHHHHHHHHHHHLLLLLEEEEEELLL----------------LLLHHHHHHHHHHHHLLL
Query DAVNAEFSDMCAQHVGRLFFFAALPL----------------SAPVDAVKASIERVKNLK  153
ident        |         |     |                       |      |     
Sbjct AELSLRISRAASAAGIGLTLLPVLYShagfggqpasegqrrfINGSEAYLELLQRLRAPL  193
DSSP  LHHHHHHHHHHHHHLLEEEEEELLLLeeellleellhhhlllLLLHHHHHHHHHHHHHHH


DSSP  ----LEEEEEE-LLLLLLllllLHHHHHHHHHhHHLLLEEEELLlllllhhhhlllhhhl
Query ----YCRGIIL-GTSGLGkgldDPHLLPVFEAvADAKLLVFLHPhyglpnevygprseey  208
ident        |                    |  |     | |  |                 
Sbjct eaagHSLGLCFhSLRAVT----PQQIATVLAA-GHDDLPVHIHI----------------  232
DSSP  hhhlLEELEEElLLLLLL----HHHHHHHHLL-LLLLLLEEEEE----------------


DSSP  llhhhhhlhHHHH----------hhHHHHHHHhLLHHhhllllLEEEHhHHLLhHHHHhh
Query ghvlplalgFPME----------ttIAVARMYmAGVFdhvrnlQMLLAhSGGTlPFLAgr  258
ident                                |   |          |          |  
Sbjct ---------AEQQkevddcqawsgrRPLQWLY-ENVA---vdqRWCLV-HATH-ADPA--  275
DSSP  ---------LLLHhhhhhhhhhhllLHHHHHH-HHLL---lllLEEEE-ELLL-LLHH--


DSSP  hhhhhhllhhhhhllllllllllhHHHHHHLEEEELLLL-------lhhHHHHHHHHHLh
Query iescivhdghlvktgkvpkdrrtiWTVLKEQIYLDAVIY-------sevGLQAAIASSGa  311
ident                                                        |  | 
Sbjct ----------------------evAAMARSGAVAGLCLSteanlgdgifPATDFLAQGG-  312
DSSP  ----------------------hhHHHHHHLLEEEELHHhhhhllllllLHHHHHHLLL-


DSSP  hHEELLLLLLLLlllllllllllhHHHHHHHHHHHH----------------hLLLLhHH
Query dRLMFGTDHPFFppieedvqgpwdSSRLNAQAVIKA----------------vGEGSsDA  355
ident  ||  | |                |                              |    
Sbjct -RLGIGSDSHVS-----------lSVVEELRWLEYGqrlrdrkrnrlyrddqpMIGR-TL  359
DSSP  -EEEELLLLLLL-----------lLHHHHHHHHHHHhhhhhllllllllllllLHHH-HH


DSSP  HHHHLHHHHHH-LLLH-----HHHH-----------------------------------
Query AAVMGLNAVRV-LSLK-----AELE-----------------------------------  374
ident                                                             
Sbjct YDAALAGGAQAlGQPIgslavGRRAdllvldgndpylasaegdallnrwlfaggdrqvrd  419
DSSP  HHHHHHHHHHHhLLLLlllllLLLLleeeellllhhhhllllhhhhhhhhhhllhhheee


DSSP  --hHHHH------------------------l
Query --hHHHH------------------------h  380
ident                                 
Sbjct vmvAGRWvvrdgrhageersarafvqvlgell  451
DSSP  eeeLLEEeelllllllhhhhhhhhhhhhhhhl


No 44: Query=4hk5D Sbjct=2uz9A Z-score=12.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  -------LLLLEEEEEEEL------------------------lhHHHHHHhllllllee
Query -------TPVVVDIHTHMY------------------------ppSYIAMLekrqtiplv   29
ident         |  || | |                                           
Sbjct lshheffMPGLVDTHIHASqysfagssidlpllewltkytfpaehRFQNID---------  111
DSSP  llllleeEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhHHHLHH---------


DSSP  eeelleeeeeeellhhhhhhhhhhhhlllllllleellhhhLLHHHHHHHHhhllLLEEE
Query rtfpqadeprlillsselaaldaaladpaaklpgrplsthfASLAQKMHFMdtngIRVSV   89
ident                                                             
Sbjct ----------------------------------faeevytRVVRRTLKNG----TTTAC  133
DSSP  ----------------------------------hhhhhhhHHHHHHHHLL----EEEEE


DSSP  EEEllllllllllllhhhhHHHHHHHHHHHHHLLLlLEEEEEELLLL---------LLHH
Query ISLanpwfdflapdeapgiADAVNAEFSDMCAQHVgRLFFFAALPLS---------APVD  140
ident                             |          |                    
Sbjct YFA--------------tiHTDSSLLLADITDKFG-QRAFVGKVCMDlndtfpeykETTE  178
DSSP  EEL--------------llLHHHHHHHHHHHHHHL-LEEEEELEELLlllllllllLLHH


DSSP  HHHHHHHHHHLLL-------LEEEEE-ELLLLLlllllLHHH-HHHHHHHHHLLLEEEEL
Query AVKASIERVKNLK-------YCRGII-LGTSGLgkgldDPHL-LPVFEAVADAKLLVFLH  191
ident       ||                                 |            |    |
Sbjct ESIKETERFVSEMlqknysrVKPIVTpRFSLSC-----SETLmGELGNIAKTRDLHIQSH  233
DSSP  HHHHHHHHHHHHHhhhllllEEEEEEeLLHHHL-----LHHHhHHHHHHHHHHLLEEEEE


DSSP  LlllllhhhhlllhhhlllhhhhHLHH-------hhhhhHHHHHHhhllhHHHL-lllLE
Query PhyglpnevygprseeyghvlplALGF-------pmettIAVARMymagvFDHV-rnlQM  243
ident                                                             
Sbjct I--------------------seNRDEveavknlypsykNYTSVY-----DKNNlltnKT  268
DSSP  E--------------------llLHHHhhhhhhhlllllLHHHHH-----HHLLllllLE


DSSP  EEHHhHLLHHHHhhhhhhhhhllhhhhhllllllllllHHHHHH-HLEEEELLLL-----
Query LLAHsGGTLPFLagriescivhdghlvktgkvpkdrrtIWTVLK-EQIYLDAVIY-----  297
ident   || |  |                                |                  
Sbjct VMAH-GCYLSAE--------------------------ELNVFHeRGASIAHCPNsnlsl  301
DSSP  EEEE-LLLLLHH--------------------------HHHHHHhHLLEEEELHHhhhhl


DSSP  --lhhHHHHHHHHHLhhHEELLLLLLLLLllllllllllhHHHHHHHHHHH---------
Query --sevGLQAAIASSGadRLMFGTDHPFFPpieedvqgpwdSSRLNAQAVIK---------  346
ident                      |||                     |  |           
Sbjct ssgflNVLEVLKHEV--KIGLGTDVAGGY------sysmlDAIRRAVMVSNillinkvne  353
DSSP  lllllLHHHHHHLLL--EEEELLLLLLLL------lllhhHHHHHHHHHHHhhhhlllll


DSSP  -HHLLllHHHHHHHLHHHHH-HLLLH-------HHHH-----------------------
Query -AVGEgsSDAAAVMGLNAVR-VLSLK-------AELE-----------------------  374
ident                |                                            
Sbjct kSLTL--KEVFRLATLGGSQaLGLDGeignfevGKEFdailinpkasdspidlfygdffg  411
DSSP  lLLLH--HHHHHHHLHHHHHhLLLLLlllllllLLLLleeeelllllllllllllhhhhl


DSSP  -----------------------hHHHH----l
Query -----------------------hHHHH----h  380
ident                                  
Sbjct diseaviqkflylgddrnieevyvGGKQvvpfs  444
DSSP  llllhhhhhhhhhllhhheeeeeeLLEEeelll


No 45: Query=4hk5D Sbjct=3iacA Z-score=11.9

back to top
DSSP  ------------------------LLLLEEEEEEELLhhhhhhhhlllllleeeeellee
Query ------------------------TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqad   36
ident                              | | |  |                       
Sbjct atfxtedfllkndiartlyhkyaaPXPIYDFHCHLSP-----------------------   37
DSSP  llllllllllllhhhhhhhhhlllLLLEEELLLLLLH-----------------------


DSSP  eeeeellhhhhhhhhhhhhlllllllleellhhhLLHH----------------------
Query eprlillsselaaldaaladpaaklpgrplsthfASLA----------------------   74
ident                                      |                      
Sbjct ----------------------------------QEIAddrrfdnlgqiwlegdhykwra   63
DSSP  ----------------------------------HHHHhllllllhhhhhhllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   74
ident                                                             
Sbjct lrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdt  123
DSSP  hhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhh


DSSP  -----------------HHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHhHHHH
Query -----------------QKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVnAEFS  117
ident                             |                            |  
Sbjct aesiwtqcneklatpafSARGIXQQXNVRXVGTTD---------------dPIDS-LEYH  167
DSSP  hhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL---------------lLLLL-LHHH


DSSP  HHHHL---LLLLEEEEEELLLL---------------------------lLHHHHHHHHH
Query DMCAQ---HVGRLFFFAALPLS---------------------------aPVDAVKASIE  147
ident    |                                                 |      
Sbjct RQIAAddsIDIEVAPSWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLD  227
DSSP  HHHHHlllLLLEEELLLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHH


DSSP  HHHLLlLEEEEEELLLlllLLLL------------------------------LHHH-HH
Query RVKNLkYCRGIILGTSglgKGLD------------------------------DPHL-LP  176
ident        ||    |                                              
Sbjct HFAAC-GCRASDHGIE---TLRFapvpddaqldailgkrlagetlseleiaqfTTAVlVW  283
DSSP  HHHHL-LLLEEEEEEL---LLLLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHhHH


DSSP  HHHHHHHLLLEEEELLLLLLLHhhHLLLHHHL--lLHHHhHLHHhhhhhHHHHHHHhlLH
Query VFEAVADAKLLVFLHPHYGLPNevYGPRSEEY--gHVLPlALGFpmettIAVARMYmaGV  234
ident      |       ||      |                    |                 
Sbjct LGRQYAARGWVXQLHIGAIRNN--NTRXFRLLgpdTGFD-SIGD----nNISWALS--RL  334
DSSP  HHHHHHHHLLEEEEEELEELLL--LHHHHHHHlllLLLL-EELL----lLLHHHHH--HH


DSSP  HHHLL----LLLEEEHhhhLLHHHHhhhhhhhhhllhhhhhllllllllllHHHHH----
Query FDHVR----NLQMLLAhsgGTLPFLagriescivhdghlvktgkvpkdrrtIWTVL----  286
ident  |            |                                    |        
Sbjct LDSXDvtneLPKTILYclnPRDNEV----------------------latxIGNFQgpgi  372
DSSP  HHHHHllllLLEEEEEellHHHHHH----------------------hhhhHHHLLllll


DSSP  hHLEEEELLL-------lLHHHHHHHHH-HHLHHHEELLLLLLLlllllllllLLLHHHH
Query kEQIYLDAVI-------ySEVGLQAAIA-SSGADRLMFGTDHPFfppieedvqGPWDSSR  338
ident                       |                ||                   
Sbjct aGKVQFGSGWwfndqkdgXLRQLEQLSQxGLLSQFVGXLTDSRS--------fLSYTRHE  424
DSSP  lLLEEELLLLhhhllhhhHHHHHHHHHHhLLHHHLLLLLLLLLL--------lLLLHHHH


DSSP  HHHHHHHHHHL-------------lLLHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query LNAQAVIKAVG-------------eGSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident           |               |         || |               
Sbjct YFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT----------ik  469
DSSP  HHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL----------ll


No 46: Query=4hk5D Sbjct=1j5sA Z-score=11.9

back to top
DSSP  -----------------------LLLLEEEEEEELLH--------------------hhh
Query -----------------------TPVVVDIHTHMYPP--------------------syi   17
ident                            || | |                           
Sbjct hmflgedylltnraavrlfnevkDLPIVDPHNHLDAKdivenkpwndiwevegatdhyvw   60
DSSP  llllllllllllhhhhhhhhhhlLLLEEELLLLLLHHhhhhllllllhhhhhllllhhhh


DSSP  hhhhlllllleeEEELLEEeeeeellhhhhhhhhhhhhlllLLLL---------------
Query amlekrqtiplvRTFPQADeprlillsselaaldaaladpaAKLP---------------   62
ident              |                             |                
Sbjct elmrrcgvseeyITGSRSN------------------kekwLALAkvfprfvgnptyewi  102
DSSP  hhhhhllllhhhLLLLLLH------------------hhhhHHHHhhhhhhlllhhhhhh


DSSP  ---------------------leellhhhllhhHHHHHHHHLLLLEEEEEElllllllll
Query ---------------------grplsthfaslaQKMHFMDTNGIRVSVISLanpwfdfla  101
ident                                                             
Sbjct hldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTD---------  153
DSSP  hhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLL---------


DSSP  lllhhhhHHHHHHHhHHHHHLLL--LLEEEEEELLLL-----------------------
Query pdeapgiADAVNAEfSDMCAQHV--GRLFFFAALPLS-----------------------  136
ident              |        |                                     
Sbjct -------DPVSTLEhHRKAKEAVegVTILPTWRPDRAmnvdkegwreyvekmgerygedt  206
DSSP  -------LLLLLLHhHHHHHHHLllLEEELLLLLHHHhllllllhhhhhhhhhhhhllll


DSSP  ----lLHHHHHHHHHHHHLLlLEEEEEELLLlllLLLL----------------------
Query ----aPVDAVKASIERVKNLkYCRGIILGTSglgKGLD----------------------  170
ident         |   | |  |    |                                     
Sbjct stldgFLNALWKSHEHFKEH-GCVASDHALL---EPSVyyvdenraravhekafsgeklt  262
DSSP  llhhhHHHHHHHHHHHHHLL-LLLEEEEEEL---LLLLllllhhhhhhhhhhhlllllll


DSSP  --------LHHHHHHHHHHHHLLLEEEELLLLLLLHHHHLllhhhlllhhHHHLhhhhhh
Query --------DPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGprseeyghvlPLALgfpmet  222
ident                            ||                               
Sbjct qdeindykAFMMVQFGKMNQETNWVTQLHIGALRDYRDSLfktlgpdsggDIST----nf  318
DSSP  hhhhhhhhHHHHHHHHHHHHHHLLEEEEEELEELLLLHHHhhhlllllllLEEL----ll


DSSP  hHHHHHHHhlLHHHHLL-LLLEEEHhhhLLHHHHhhhhhhhhhllhhhhhllllllllll
Query tIAVARMYmaGVFDHVR-NLQMLLAhsgGTLPFLagriescivhdghlvktgkvpkdrrt  281
ident                    |   |     |                              
Sbjct lRIAEGLR--YFLNEFDgKLKIVLYvldPTHLPT----------------------isti  354
DSSP  lLHHHHHH--HHHHHLLlLLLEEEEellHHHHHH----------------------hhhh


DSSP  HHHHhhHLEEEELL-------lLLHHHHHHHHHHHLHHHE-ELLLLLLLlllllllllll
Query IWTVlkEQIYLDAV-------iYSEVGLQAAIASSGADRL-MFGTDHPFfppieedvqgp  333
ident          |  |           |  |           |    ||              
Sbjct ARAF--PNVYVGAPwwfndspfGMEMHLKYLASVDLLYNLaGMVTDSRK-------llsf  405
DSSP  HHHL--LLEEELLLllllllhhHHHHHHHHHHLLLLHHHLlLLLLLLLL-------llhh


DSSP  LHHHHHHHHHHHHHHL-----------lLLHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query WDSSRLNAQAVIKAVG-----------eGSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident               ||                   |                      
Sbjct GSRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF------------  451
DSSP  HHHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL------------


No 47: Query=4hk5D Sbjct=1a5kC Z-score=11.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -----LLLLEEEEEEELlhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhh
Query -----TPVVVDIHTHMYppsyiamlekrqtiplvrtfpqadeprlillsselaaldaala   55
ident      |    | | |                                             
Sbjct egkivTAGGIDTHIHWI-------------------------------------------  137
DSSP  llleeEELEEEEEEELL-------------------------------------------


DSSP  lllllllleellhhhllHHHHHHHHHHLLLLEEEEEE------LLLLllllllllhhhhH
Query dpaaklpgrplsthfasLAQKMHFMDTNGIRVSVISL------ANPWfdflapdeapgiA  109
ident                    |        |    |                          
Sbjct -----------------CPQQAEEALVSGVTTMVGGGtgpaagTHAT--------tctpG  172
DSSP  -----------------LLLHHHHHHHHLEEEEEEELllllhhHHHL--------llllH


DSSP  HHHHHHHHHHHHLLLLLEEEEEELLLlllhhhHHHHHHHHHLLLlEEEEEELLLLLllLL
Query DAVNAEFSDMCAQHVGRLFFFAALPLsapvdaVKASIERVKNLKyCRGIILGTSGLgkGL  169
ident                                                |            
Sbjct PWYISRMLQAADSLPVNIGLLGKGNV-----sQPDALREQVAAG-VIGLEIHEDWG--AT  224
DSSP  HHHHHHHHHHHLLLLLEEEEEEELLL-----lLHHHHHHHHHHL-LLEEEEEHHHL--LL


DSSP  LLhhhHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhHHHH---hH
Query DDphlLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfpmETTI---aV  226
ident                   | ||                              |      |
Sbjct PA-aiDCALTVADEMDIQVALHS----------------------------DTLNesgfV  255
DSSP  HH-hhHHHHHHHHHHLLEEEEEL----------------------------LLLLllllH


DSSP  HHHHhlLHHHhllLLLEEEHHHHL-------LHHHhhhhhhhhhhllhhhhhllllllll
Query ARMYmaGVFDhvrNLQMLLAHSGG-------TLPFlagriescivhdghlvktgkvpkdr  279
ident                     |  |                                    
Sbjct EDTL--AAIG---GRTIHTFHTEGaggghapDIIT-------------------------  285
DSSP  HHHH--HHHL---LLLEEELLLLLlllllllLHHH-------------------------


DSSP  llhhhhHHHLEEEELL--LLLH--------------------------------------
Query rtiwtvLKEQIYLDAV--IYSE--------------------------------------  299
ident           |                                                 
Sbjct ----acAHPNILPSSTnpTLPYtlntidehldmlmvchhldpdiaedvafaesrirreti  341
DSSP  ----hhHLLLEEEEEEhhHLLLlllhhhhhhhhhhhhhllllllhhhhhlllllllhhhh


DSSP  -HHHHHHHHhhlHHHEELLLLLLLLlllllllllllhHHHHHHHHHHHH-----------
Query -VGLQAAIAssgADRLMFGTDHPFFppieedvqgpwdSSRLNAQAVIKA-----------  347
ident                     |                   |    |              
Sbjct aAEDVLHDL---GAFSLTSSDSQAM--------grvgEVILRTWQVAHRmkvqrgalaee  390
DSSP  hHHHHHHHL---LLLLEEELLLLLL--------llllLHHHHHHHHHHHhhhhhllllll


DSSP  ----hllLLHHHHHHHLHHHHHHLLLHHHH-------------------------hhHHH
Query ----vgeGSSDAAAVMGLNAVRVLSLKAEL-------------------------ehHHH  378
ident              |    |         |                               
Sbjct tgdndnfRVKRYIAKYTINPALTHGIAHEVgsievgkladlvvwspaffgvkpatviKGG  450
DSSP  lllllhhHHHHHHHLLLHHHHHHLLLLLLLlllllllllleeeelhhhlllllleeeELL


DSSP  HL----------------------------------------------------------
Query HH----------------------------------------------------------  380
ident                                                             
Sbjct MIaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsai  510
DSSP  EEeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhlllllee


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  380
ident                                                         
Sbjct avvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  eellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 48: Query=4hk5D Sbjct=3qy6A Z-score=10.9

back to top
DSSP  lllLEEEEEEELLHhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tpvVVDIHTHMYPPsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident      ||| |  |                                               
Sbjct ---MIDIHCHILPA----------------------------------------------   11
DSSP  ---LEELLLLLLLL----------------------------------------------


DSSP  llleellhHHLL--HHHHHHHHHHLLLLEEEEEELllLLLLLllllhhhHHHHHHHHHHH
Query lpgrplstHFAS--LAQKMHFMDTNGIRVSVISLAnpWFDFLapdeapgIADAVNAEFSD  118
ident            |             |||                        ||      
Sbjct ----mddgAGDSadSIEMARAAVRQGIRTIIATPH--HNNGV----yknEPAAVREAADQ   61
DSSP  ----llllLLLHhhHHHHHHHHHHLLLLEEELLLE--ELLLL----lllLHHHHHHHHHH


DSSP  HHHLLL-----lLEEEEeellllllhhhhhhhhhhhhlllleeeEEELLLLLllllllhh
Query MCAQHV-----gRLFFFaalplsapvdavkasiervknlkycrgIILGTSGLgkglddph  173
ident                                                   |         
Sbjct LNKRLIkediplHVLPG---------------------------QEIRIYGE--------   86
DSSP  HHHHHHhlllllEEELL---------------------------LEEELLLL--------


DSSP  HHHHHHH----hhhlLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhhhHHHHH
Query LLPVFEA----vadaKLLVFLHPhyglpnevygprseeyghvlplalgFPMEttiAVARM  229
ident                                                             
Sbjct VEQDLAKrqllslndTKYILIEF-------------------------PFDH---VPRYA  118
DSSP  HHHHHHLlllllhhhLLEEEEEL-------------------------LLLL---LLLLH


DSSP  HhlLHHHHLL--LLLEEEHHHHLL--hhHHHHhhhhhhhllhhhhhllllllllllhhHH
Query YmaGVFDHVR--NLQMLLAHSGGT--lpFLAGriescivhdghlvktgkvpkdrrtiwTV  285
ident      |            ||                                        
Sbjct E--QLFYDLQlkGYIPVIAHPERNreirENPS-----------------------llyHL  153
DSSP  H--HHHHHHHhlLLEEEEELHHHLhhhhHLLH-----------------------hhhHH


DSSP  HHHLEEEELL--LLLH-------HHHHHHH-HHHLhhhEELLLLLLLLLLlllllllllh
Query LKEQIYLDAV--IYSE-------VGLQAAI-ASSGadrLMFGTDHPFFPPieedvqgpwd  335
ident                                |           |                
Sbjct VEKGAASQITsgSLAGifgkqlkAFSLRLVeANLI---HFVASDAHNVKT-------rnf  203
DSSP  HHLLLEEEEEhhHHLLlllhhhhHHHHHHHhLLLL---LEEELLLLLLLL-------lll


DSSP  HHHHHHHHHHHHHLLllHHHHHHhLHHHHHHLL--lhhhhhhhhhhl
Query SSRLNAQAVIKAVGEgsSDAAAVmGLNAVRVLS--lkaelehhhhhh  380
ident           |  |            ||   |               
Sbjct HTQEALYVLEKEFGS--ELPYML-TENAELLLRnqtifrqppqpvkr  247
DSSP  LHHHHHHHHHHHHLL--HHHHHH-HHHHHHHHLllllllllllllll


No 49: Query=4hk5D Sbjct=2a3lA Z-score=10.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------------------LLLLEEEEEEEL--------
Query ----------------------------------------TPVVVDIHTHMY--------   12
ident                                             || | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfyNVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllLLLEEEEEEELLllllhhhh


DSSP  -------------lhhhhhhhhlllllleeeeELLE---EEEE-------------eELL
Query -------------ppsyiamlekrqtiplvrtFPQA---DEPR-------------lILL   43
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesLDLTgydLNVDlldvhadkstfhrfDKF  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhHLLLlllLLLLllllllllllllllLLL


DSSP  HhhhhhhhhhhhllllLLLL---------eellhhhLLHHHHHHHHHHLLLLEEEEEEll
Query SselaaldaaladpaaKLPG---------rplsthfASLAQKMHFMDTNGIRVSVISLan   94
ident                                         |                   
Sbjct N-------lkynpcgqSRLReiflkqdnliqgrflgEITKQVFSDLEASKYQMAEYRI--  291
DSSP  H-------hhhlllllLHHHhhhlllllllllllhhHHHHHHHHHHLLLLLEEEEEEE--


DSSP  llLLLLllllHHHHHHHHHHHHhhhhHLLLlLEEEEEEL--------------lllLLHH
Query pwFDFLapdeAPGIADAVNAEFsdmcAQHVgRLFFFAAL--------------plsAPVD  140
ident                |                      |                    |
Sbjct -sIYGR----KMSEWDQLASWIvnndLYSE-NVVWLIQLprlyniykdmgivtsfqNILD  345
DSSP  -eLLLL----LLLHHHHHHHHHhlllLLLL-LEEEEEEEellhhhhlllllllllhHHHH


DSSP  HHHHHHH-----------hhhLLLLEEEEEELL--------------------lllLLLL
Query AVKASIE-----------rvkNLKYCRGIILGT--------------------sglGKGL  169
ident                       ||   |  |                             
Sbjct NIFIPLFeatvdpdshpqlhvFLKQVVGFDLVDdeskperrptkhmptpaqwtnafNPAF  405
DSSP  HHLLHHHhhhhlhhhllllhhHHLLEEEEEEELlllllllllllllllllllllllLLLH


DSSP  LLhhHHHHHHHHHHL----------LLEEEELllllllhhhhlllhhhlllhhhhhlhhh
Query DDphLLPVFEAVADA----------KLLVFLHphyglpnevygprseeyghvlplalgfp  219
ident                                |                            
Sbjct SY-yVYYCYANLYVLnklreskgmtTITLRPH----------------------------  436
DSSP  HH-hHHHHHHHHHHHhhhhllllllLLEELLL----------------------------


DSSP  hhHHHHhHHHHHlLHHHhlllLLEEEHHhHLLHhHHHHhhhhhhhllhhhhhllllllll
Query meTTIAvARMYMaGVFDhvrnLQMLLAHsGGTLpFLAGriescivhdghlvktgkvpkdr  279
ident                |          || |  |                           
Sbjct sgEAGD-IDHLA-ATFL----TCHSIAH-GINL-RKSP----------------------  466
DSSP  llLLLL-LHHHH-HHHH----HLLLLLL-LHHH-HHLH----------------------


DSSP  lLHHHHHH-HLEEEELLLL---------lhHHHHHHHHHHLhhHEELLLLLL-LLLLlll
Query rTIWTVLK-EQIYLDAVIY---------seVGLQAAIASSGadRLMFGTDHP-FFPPiee  328
ident           || |                                  || |        
Sbjct -VLQYLYYlAQIGLAMSPLsnnslfldyhrNPFPVFFLRGL--NVSLSTDDPlQIHL---  520
DSSP  -HHHHHHHhHLLLEEELHHhhlllllllllLLHHHHHHLLL--LEEELLLLHhHHLL---


DSSP  llllLLHHHHHHHHHHHH-HHLLlLHHHHHHHlHHHHHH-LLLHHHHHH-----------
Query dvqgPWDSSRLNAQAVIK-AVGEgSSDAAAVMgLNAVRV-LSLKAELEH-----------  375
ident                           |       | |       |   |           
Sbjct ----TKEPLVEEYSIAASvWKLS-ACDLCEIA-RNSVYQsGFSHALKSHwigkdyykrgp  574
DSSP  ----LLLHHHHHHHHHHHhHLLL-HHHHHHHH-HHHHHHlLLLHHHHHHhlllllllllh


DSSP  -------------------------------------hhhhl
Query -------------------------------------hhhhh  380
ident                                           
Sbjct dgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 50: Query=4hk5D Sbjct=1v77A Z-score=10.1

back to top
DSSP  lLLLEEEEEEEllhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tPVVVDIHTHMyppsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident                                                             
Sbjct -VKFIEMDIRD-------------------------------------------------   10
DSSP  -LLLEEEEELL-------------------------------------------------


DSSP  llleellhhhllhhHHHHHHHHlLLLEEEEEELllLLLLlllllhhhhHHHHHHHHHHHH
Query lpgrplsthfaslaQKMHFMDTnGIRVSVISLAnpWFDFlapdeapgiADAVNAEFSDMC  120
ident                             | |                       |     
Sbjct -------------kEAYELAKE-WFDEVVVSIK--FNEE--------vDKEKLREARKEY   46
DSSP  -------------hHHHHHHHH-HLLEEEEEEE--ELLL--------lLHHHHHHHHHHH


DSSP  hllllleEEEEellllllhhhhhhhhhhhhlllleeeeEELLLllllLLLLhhhHHHHHH
Query aqhvgrlFFFAalplsapvdavkasiervknlkycrgiILGTSglgkGLDDphlLPVFEA  180
ident                                        |                    
Sbjct ------gKVAI---------------------------LLSNP----KPSL--vRDTVQK   67
DSSP  ------lLEEE---------------------------EEELL----LHHH--hHHHHHH


DSSP  HhhLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhHHHHHHHHhhhllhhhhlll
Query VadAKLLVFLHPhyglpnevygprseeyghvlplalgfpmETTIAVARmymagvfdhvrn  240
ident       |                                                     
Sbjct F--KSYLIYVES----------------------------NDLRVIRY--------siek   89
DSSP  L--LLLEEEEEL----------------------------LLHHHHHH--------hhhl


DSSP  LLEEEHhHHLL-----HHHHHhhhhhhhhllhhhhhllllllllllHHHHHH-HLEEEEL
Query LQMLLAhSGGT-----LPFLAgriescivhdghlvktgkvpkdrrtIWTVLK-EQIYLDA  294
ident        |                                                 |  
Sbjct GVDAII-SPWVnrkdpGIDHV-------------------------LAKLMVkKNVALGF  123
DSSP  LLLEEE-LLLLlllllLLLHH-------------------------HHHHHHhHLLEEEE


DSSP  LL------------llHHHHHHHHHHHL--hhHEELLLLLLLLLllllllllllHHHH--
Query VI------------ysEVGLQAAIASSG--adRLMFGTDHPFFPpieedvqgpwDSSR--  338
ident                       |         |                     |     
Sbjct SLrpllysnpyeranlLRFMMKAWKLVEkykvRRFLTSSAQEKW----------DVRYpr  173
DSSP  ELhhhhhllhhhhhhhHHHHHHHHHHHHhhllLEEEELLLLLHH----------HLLLhh


DSSP  HHHHHHHH-HHLLllHHHHHHHLHHHHHHLLlhhhhhhhhhhl
Query LNAQAVIK-AVGEgsSDAAAVMGLNAVRVLSlkaelehhhhhh  380
ident                  | |         |             
Sbjct DLISLGVViGMEI--PQAKASISMYPEIILK------------  202
DSSP  HHHHHHHHlLLLH--HHHHHLLLHHHHHHHL------------


No 51: Query=4hk5D Sbjct=3ooqA Z-score=9.8

back to top
DSSP  --------------------------------------------------LLLLEEEEEE
Query --------------------------------------------------TPVVVDIHTH   10
ident                                                    |  || | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  E------llHHHHhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllle
Query M------ypPSYIamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgr   64
ident            |                                                
Sbjct IglfeegvgYYYS-----------------------------------dgneatdpvtph   85
DSSP  LllllllllHHHL-----------------------------------llllllllllll


DSSP  ellhhHLLH-HHHHHHHHHLLLLEEEEEELLLLllllllllhhhhhhhhhhhhhhhhhll
Query plsthFASL-AQKMHFMDTNGIRVSVISLANPWfdflapdeapgiadavnaefsdmcaqh  123
ident                     |     |                                 
Sbjct vkaldGFNPqDPAIERALAGGVTSVXIVPGSAN---------------------------  118
DSSP  llhhhHLLLlLHHHHHHHLLLEEEEEELLLLLL---------------------------


DSSP  llleeeeeellllllhhhhhhhhhhhhllLLEEEEEELLL---------------llLLL
Query vgrlfffaalplsapvdavkasiervknlKYCRGIILGTS---------------glGKG  168
ident                              |   |                          
Sbjct --------pvggqgsvikfrsiiveecivKDPAGLKXAFGenpkrvygerkqtpstrXGT  170
DSSP  --------leeeeeeeeelllllhhhheeEEEEEEEEELLhhhhhhhhhlllllllhHHH


DSSP  LLL-HHHH---------------------------hhHHHHHHLLLEEEELLlllllhhh
Query LDD-PHLL---------------------------pvFEAVADAKLLVFLHPhyglpnev  200
ident                                       | |   |     |         
Sbjct AGViRDYFtkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHA--------  222
DSSP  HHHhHHHHhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEE--------


DSSP  hlllhhhlllhhhhhlhhhhHHHHHHHHHHhlLHHHHLLlLLEEEHHhHLLHHHHHhhhh
Query ygprseeyghvlplalgfpmETTIAVARMYmaGVFDHVRnLQMLLAHsGGTLPFLAgrie  260
ident                                               | |           
Sbjct --------------------HRADDILTAI--RIAEEFG-FNLVIEH-GTEAYKIS----  254
DSSP  --------------------LLHHHHHHHH--HHHHHHL-LLEEEEE-LLLHHHHH----


DSSP  hhhhllhhhhhllllllllllhhHHHH-HLEEEELLLL------------LHHHHHHHHH
Query scivhdghlvktgkvpkdrrtiwTVLK-EQIYLDAVIY------------SEVGLQAAIA  307
ident                         ||    |                             
Sbjct -----------------------KVLAeKKIPVVVGPLltfrtklelkdlTXETIAKLLK  291
DSSP  -----------------------HHHHhHLLLEEELLLllllllhhhlllLLLHHHHHHH


DSSP  HHLhhHEELLLLLLLLlllllllllllhHHHHHHHHHH-HHHLllLHHHHHHHLHHHHHH
Query SSGadRLMFGTDHPFFppieedvqgpwdSSRLNAQAVI-KAVGegSSDAAAVMGLNAVRV  366
ident            |||                   |             |       |    
Sbjct DGV--LIALXCDHPVI---------pleFATVQAATAXrYGAK--EEDLLKILTVNPAKI  338
DSSP  LLL--LEEELLLLLLL---------lhhHHHHHHHHHHhHLLL--HHHHHHLLLHHHHHH


DSSP  LLLHHHH-----HHHH---------------------------hhl
Query LSLKAEL-----EHHH---------------------------hhh  380
ident | |                                           
Sbjct LGLEDRIgsiepGKDAdlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  LLLLLLLlllllLLLLleeeelllllllllleeeeeelleeeeell


No 52: Query=4hk5D Sbjct=3au2A Z-score=9.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------------------LLLLEEEEEEELLhhhhhhhhlllll
Query ----------------------------------TPVVVDIHTHMYPpsyiamlekrqti   26
ident                                     |  |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTY-------------  347
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLL-------------


DSSP  leeeeelleeeeeeellhhhhhhhhhhhhlllllllleellhhHLLHHHHHHHHHHLLLL
Query plvrtfpqadeprlillsselaaldaaladpaaklpgrplsthFASLAQKMHFMDTNGIR   86
ident                                               |        | | |
Sbjct ----------------------------------------sdgQNTLEELWEAAKTMGYR  367
DSSP  ----------------------------------------lllLLLHHHHHHHHHHHLLL


DSSP  EEEEEELL-LLLLLLllllHHHHHHHHHHHHHHHHHLLLL-LEEEEeellllllhhhhhh
Query VSVISLAN-PWFDFLapdeAPGIADAVNAEFSDMCAQHVG-RLFFFaalplsapvdavka  144
ident                     |  |     |       |    |                 
Sbjct YLAVTDHSpAVRVAG--gpSPEEALKRVGEIRRFNETHGPpYLLAG--------------  411
DSSP  EEEEEEELhHHHLLL--llLHHHHHHHHHHHHHHHHHHLLlEEEEE--------------


DSSP  hhhhhhlllleeeEEELLLlllLLLLlhhhhhhHHHHhhlllEEEELLLLLLLhhhhlll
Query siervknlkycrgIILGTSglgKGLDdphllpvFEAVadaklLVFLHPHYGLPnevygpr  204
ident                                     |     ||    |           
Sbjct -------------AEVDIH---PDGT----ldyPDWVlreldLVLVSVHSRFN-------  444
DSSP  -------------EEEELL---LLLL----lllLHHHhllllEEEEELLLLLL-------


DSSP  hhhlllhhhhhlhhhhhhHHHHHHHhhllhhhhllLLLEEEHHHHL----------lhHH
Query seeyghvlplalgfpmetTIAVARMymagvfdhvrNLQMLLAHSGG----------tlPF  254
ident                   |                     |||                 
Sbjct ------------lpkadqTKRLLKA-------lenPFVHVLAHPTArllgrrapieadWE  485
DSSP  ------------llhhhhHHHHHHH-------hllLLLLEELLLLLllllllllllllHH


DSSP  HHhhhhhhhhllhhhhhllllllllllhhHHHH-HLEEEELL------LLLHHHHHHHHH
Query LAgriescivhdghlvktgkvpkdrrtiwTVLK-EQIYLDAV------IYSEVGLQAAIA  307
ident                                 |                        |  
Sbjct AV--------------------------fQKAKeKGVAVEIDgyydrmDLPDDLARMAYG  519
DSSP  HH--------------------------hHHHHhHLLEEEEEllllllLLLHHHHHHHHH


DSSP  HHLhhHEELLLLLLLLLlllllllllLHHHHHHHHHHHHHHllllhHHHHHHLHH-hHHH
Query SSGadRLMFGTDHPFFPpieedvqgpWDSSRLNAQAVIKAVgegssDAAAVMGLN-aVRV  366
ident           ||                   |       |          |         
Sbjct MGL--WISLSTDAHQTD--------hLRFMELAVGTAQRAW----iGPERVLNTLdyEDL  565
DSSP  LLL--LEEEELLLLLHH--------hHHHHHHHHHHHHHLL----lLLLLLHHHLlhHHH


DSSP  LLlhhhhhhhhhhl
Query LSlkaelehhhhhh  380
ident ||            
Sbjct LS----wlkarrgv  575
DSSP  HH----hhhlllll


No 53: Query=4hk5D Sbjct=1m65A Z-score=8.7

back to top
DSSP  llLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tpVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident     || | |                                                  
Sbjct --YPVDLHMHTVA-----------------------------------------------   11
DSSP  --LLEELLLLLLL-----------------------------------------------


DSSP  llleellhhHLLHHHHHHHHHHLLLLEEEEEELLlLLLLLllllhhhhHHHHHHHHHHhh
Query lpgrplsthFASLAQKMHFMDTNGIRVSVISLANpWFDFLapdeapgiADAVNAEFSDmc  120
ident             |          ||    |                              
Sbjct -----sthaYSTLSDYIAQAKQKGIKLFAITDHG-PDMED------apHHWHFINMRI--   57
DSSP  -----llllLLLHHHHHHHHHHHLLLEEEEEEEL-LLLLL------llLLHHHHHHHH--


DSSP  HLLL---lLEEEEEellllllhhhhhhhHHHHHLLllEEEEeelllllllllllhhhhhh
Query AQHV---gRLFFFAalplsapvdavkasIERVKNLkyCRGIilgtsglgkglddphllpv  177
ident    |                                    |                   
Sbjct WPRVvdgvGILRGI-eaniknvdgeidcSGKMFDS--LDLI-------------------   95
DSSP  LLLEelleEEEEEE-eeellllllllllLHHHHHH--LLEE-------------------


DSSP  hhhhhhllleeEELLL---LLLLhhhhlllhhhlllhhhhhlhhhhHHHHHHHHhhhllh
Query feavadakllvFLHPH---YGLPnevygprseeyghvlplalgfpmETTIAVARmymagv  234
ident                |                                | |         
Sbjct -----------IAGFHepvFAPH--------------------dkaTNTQAMIA------  118
DSSP  -----------EEELLlllLLLL--------------------lhhHHHHHHHH------


DSSP  hhhllLLLE-EEHHH----hlLHHHHhhhhhhhhhllhhhhhllllllllllhhhHHHHL
Query fdhvrNLQM-LLAHS----ggTLPFLagriescivhdghlvktgkvpkdrrtiwtVLKEQ  289
ident              |                                              
Sbjct --tiaSGNVhIISHPgnpkyeIDVKA--------------------------vaeAAAKH  150
DSSP  --hhhLLLLlEELLLllllllLLHHH--------------------------hhhHHHHH


DSSP  -EEEELL--llLHHHHHHHHHHHLhhHEELLLLLLLllllllllllllhHHHHHHHHHHH
Query -IYLDAV--iySEVGLQAAIASSGadRLMFGTDHPFfppieedvqgpwdSSRLNAQAVIK  346
ident    |             |     |      | |                           
Sbjct qVALEINnssnCREVAAAVRDAGG--WVALGSDSHT--------aftmgEFEECLKILDA  200
DSSP  lLEEEEEllllHHHHHHHHHHHLL--LEEEELLLLL--------hhhllLLHHHHHHHHH


DSSP  HHllllhHHHHHHLH---HHHHHLL-----lHHHHHHHhhhl
Query AVgegssDAAAVMGL---NAVRVLS-----lKAELEHHhhhh  380
ident                        |        ||        
Sbjct VD----fPPERILNVsprRLLNFLEsrgmapIAEFADL----  234
DSSP  LL----lLHHHLHHHlhhHHHHHHHhlllllLHHHLLL----


No 54: Query=4hk5D Sbjct=3dcpA Z-score=8.2

back to top
DSSP  llLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tpVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident      | |||                                                  
Sbjct --XKRDGHTHTEF-----------------------------------------------   11
DSSP  --LLEEEEELLLL-----------------------------------------------


DSSP  llleeLLHHhlLHHHHHHHHHHLLLLEEEEEELllLLLLL--------------llllHH
Query lpgrpLSTHfaSLAQKMHFMDTNGIRVSVISLAnpWFDFL--------------apdeAP  106
ident                              |                            | 
Sbjct --cphGTHD--DVEEXVLKAIELDFDEYSIVEH--APLSSefxkntagdkeavttasxAX   65
DSSP  --lllLLLL--LHHHHHHHHHHLLLLEEEEEEE--LLLLHhhhhllllllhhhhllllLH


DSSP  HHHHHHHHHHHHHHHL-LLLL-EEEEeellllllhhhhhhhhhhhhlllleeeEEELLLl
Query GIADAVNAEFSDMCAQ-HVGR-LFFFaalplsapvdavkasiervknlkycrgIILGTSg  164
ident                                                             
Sbjct SDLPYYFKKXNHIKKKyASDLlIHIG---------------------------FEVDYL-   97
DSSP  HHHHHHHHHHHHHHHHlLLLLeEEEE---------------------------EEEELL-


DSSP  lLLLLllHHHHHHHHHHHHllLEEEELLLLLLL------------------HHHHLLlhh
Query lGKGLddPHLLPVFEAVADakLLVFLHPHYGLP------------------NEVYGPrse  206
ident                          |  |                         ||    
Sbjct -IGYE--DFTRDFLNEYGPqtDDGVLSLHFLEGqggfrsidfsaedynegiVQFYGG---  151
DSSP  -LLLH--HHHHHHHHHHHHhlLEEEEELLEEEElleeeellllhhhhhhhlHHHHLL---


DSSP  hlllhhhhhlhhHHHHHHHHHHHHhllhhhhlLLLL-EEEHHH-----------------
Query eyghvlplalgfPMETTIAVARMYmagvfdhvRNLQ-MLLAHS-----------------  248
ident                                          |                  
Sbjct ----feqaqlayLEGVKQSIEADL--------GLFKpRRXGHIslcqkfqqffgedtsdf  199
DSSP  ----hhhhhhhhHHHHHHHHHLLL--------LLLLlLEELLLlhhhllhhhhlllhhhl


DSSP  -------hllHHHHhhhhhhhhhllhhhhhllllllllllhHHHHhhlEEEELL------
Query -------ggtLPFLagriescivhdghlvktgkvpkdrrtiWTVLkeqIYLDAV------  295
ident              |                                    ||        
Sbjct seevxekfrvILAL--------------------------vKKRD---YELDFNtaglfk  230
DSSP  lhhhhhhhhhHHHH--------------------------hHHHL---LEEEEElhhhhl


DSSP  ------LLLHHHHHHHHHHHLhhHEELLLLLLllllllllllllLHHHHHHHHHHHhhhl
Query ------IYSEVGLQAAIASSGadRLMFGTDHPffppieedvqgpWDSSRLNAQAVIkavg  349
ident                |           | |                      |       
Sbjct plcgetYPPKKIVTLASELQI--PFVYGSDSH-------gvqdiGRGYSTYCQKLE----  277
DSSP  llllllLLLHHHHHHHHHLLL--LEEEELLLL-------lhhhlLLLHHHHHHHLL----


DSSP  lllhhhhhhhlhhhhhhlllhhhhhhhhhhl
Query egssdaaavmglnavrvlslkaelehhhhhh  380
ident                                
Sbjct -------------------------------  277
DSSP  -------------------------------


No 55: Query=4hk5D Sbjct=3f2bA Z-score=8.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ----------------------------------------------LLLLEEEEEEELLh
Query ----------------------------------------------TPVVVDIHTHMYPp   14
ident                                                   |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPM-  119
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLL-


DSSP  hhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleellhhHLLHH
Query syiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrplsthFASLA   74
ident                                                          |  
Sbjct --------------------------------------------------sqmdaVTSVT  129
DSSP  --------------------------------------------------lllllLLLHH


DSSP  HHHHHHHHLLLLEEEEEELLllllllllllhhhhhhhhHHHHHHHHHLLL----LLEEEE
Query QKMHFMDTNGIRVSVISLANpwfdflapdeapgiadavNAEFSDMCAQHV----GRLFFF  130
ident          |                                                  
Sbjct KLIEQAKKWGHPAIAVTDHA------------------VVQSFPEAYSAAkkhgMKVIYG  171
DSSP  HHHHHHHHLLLLLEEELLLL------------------LLLLHHHHHHHHhhhlLLEEEE


DSSP  EellllllhhhhhhhhhhhhlllleeeeEELLL---------------------------
Query AalplsapvdavkasiervknlkycrgiILGTS---------------------------  163
ident                                                             
Sbjct L---------------------------EANIVddpfhvtllaqnetglknlfklvslsh  204
DSSP  E---------------------------EEEEEllleeeeeeellhhhhhhhhhhhhhhh


DSSP  -lLLLLlllhhhHHHHHHHhhLLLEEeelllllllhhhhlllhhhlllhhhhhlhhhhhh
Query -gLGKGlddphlLPVFEAVadAKLLVflhphyglpnevygprseeyghvlplalgfpmet  222
ident                        |||                                  
Sbjct iqYFHRvpriprSVLVKHR--DGLLV----------------------------------  228
DSSP  llLLLLllleehHHHHHLL--LLEEE----------------------------------


DSSP  hhhhhhhhhllhhhhllllleEEHH---hHLLHhhhhhhhhhhhhllhhhhhllllllll
Query tiavarmymagvfdhvrnlqmLLAH---sGGTLpflagriescivhdghlvktgkvpkdr  279
ident                                                             
Sbjct ---------------------GSGCdkgeLFDN---------------------------  240
DSSP  ---------------------ELLLllllLLLL---------------------------


DSSP  llHHHHhHHLE-EEELLLL-------------LHHHHHHHHHHHL--hhHEELLLLLLLL
Query rtIWTVlKEQI-YLDAVIY-------------SEVGLQAAIASSG--adRLMFGTDHPFF  323
ident              |                           |                  
Sbjct --VEDI-ARFYdFLEVHPPdvykplyvkdeemIKNIIRSIVALGEkldiPVVATGNVHYL  297
DSSP  --LLLL-HHHLlLEEELLHhhhlllllllhhhHHHHHHHHHHHHHhlllLEEELLLLLLL


DSSP  LLL--------------------llllllllhhhHHHHHHHHhHHLLllHHHHHHHLHHH
Query PPI--------------------eedvqgpwdssRLNAQAVIkAVGEgsSDAAAVMGLNA  363
ident  |                                           |     |      | 
Sbjct NPEdkiyrkilihsqgganplnrhelpdvyfrttNEMLDCFS-FLGP--EKAKEIVVDNT  354
DSSP  LHHhhhhhhhhhhllhhhlllllllllllllllhHHHHHHHH-HHHH--HHHHHHHLHHH


DSSP  HHHL-LLHH---------------------------------------------------
Query VRVL-SLKA---------------------------------------------------  371
ident                                                             
Sbjct QKIAsLIGDvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksi  414
DSSP  HHHHhLLLLlllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct ighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckh  474
DSSP  hhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct seffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqp  534
DSSP  eeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct rahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvk  594
DSSP  hhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct rttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghdd  654
DSSP  eeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct ptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvr  714
DSSP  hhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct qmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrg  774
DSSP  hhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct lepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmav  834
DSSP  llhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct riayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakeksllt  894
DSSP  hhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  371
ident                                                             
Sbjct vlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareeg  954
DSSP  hhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhll


DSSP  -------------------------------hhhhhhhhl
Query -------------------------------elehhhhhh  380
ident                                         
Sbjct eflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  llllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=4hk5D Sbjct=2anuA Z-score=6.7

back to top
DSSP  -LLLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhllll
Query -TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaa   59
ident       | | |                                                 
Sbjct tEWLLCDFHVHTNX----------------------------------------------   14
DSSP  lEEEEEEEEELLLL----------------------------------------------


DSSP  lllleellhhHLLHHHHHHHHHHLLLLEEEEEELllLLLL-----------lllllHHHH
Query klpgrplsthFASLAQKMHFMDTNGIRVSVISLAnpWFDF-----------lapdeAPGI  108
ident              |          |  |  |       |                     
Sbjct -------sdgHLPLGEVVDLFGKHGVDVVSITDH--IVDRrtleqrkrngeplgaiTEDK   65
DSSP  -------lllLLLHHHHHHHHHHLLLLEEEEEEE--EELHhhhhhhhhllllllllLLLL


DSSP  HHHHHHHHHHHHHLLL----LLEEEEEellllllhhhhhhhhhhhhlllleeeeEELLLL
Query ADAVNAEFSDMCAQHV----GRLFFFAalplsapvdavkasiervknlkycrgiILGTSG  164
ident                       |                                     
Sbjct FQDYLKRLWREQKRAWeeygXILIPGV---------------------------EITNNT   98
DSSP  HHHHHHHHHHHHHHHHhhhlLEEEEEE---------------------------EEEELL


DSSP  L----------llllllhhhHHHHHHHHHLLLEEeelllllllhhhhlllhhhlllhhhh
Query L----------gkglddphlLPVFEAVADAKLLVflhphyglpnevygprseeyghvlpl  214
ident                         |       ||                          
Sbjct DlyhivavdvkeyvdpslpvEEIVEKLKEQNALV--------------------------  132
DSSP  LleeeeeelllllllllllhHHHHHHHHHLLLEE--------------------------


DSSP  hlhhhhhhhhhhhhhhhllhhhhllllleEEHHhhllhhhhhhhhhhhhhllhhhhhlll
Query algfpmettiavarmymagvfdhvrnlqmLLAHsggtlpflagriescivhdghlvktgk  274
ident                                ||                           
Sbjct -----------------------------IAAH----------------------pdrkk  141
DSSP  -----------------------------EELL----------------------lllll


DSSP  lllllllHHHHHHHL-EEEE-LLLLLHhhHHHHHHHHLhhHEELLLLLLLLLllllllll
Query vpkdrrtIWTVLKEQ-IYLD-AVIYSEvgLQAAIASSGadRLMFGTDHPFFPpieedvqg  332
ident             |        |                  |     |             
Sbjct lswylwaNXERFKDTfDAWEiANRDDL--FNSVGVKKY--RYVANSDFHELW--------  189
DSSP  lllhhhhLLLLLLLLlLEEEeEELLEE--LHHHHHLLL--LEEEELLLLLHH--------


DSSP  llhHHHHHhhhhhhhhllllhhhhhhHLHH-----hhHHLL---lhhhhhhhhhhl
Query pwdSSRLNaqavikavgegssdaaavMGLN-----avRVLS---lkaelehhhhhh  380
ident                             |                           
Sbjct ---HVYSW------------------KTLVkseknieAIKEairkntdvaiylxrk  224
DSSP  ---HHLLE------------------EEEEeelllhhHHHHhhhhllleeeeelll


No 57: Query=4hk5D Sbjct=2yb1A Z-score=6.0

back to top
DSSP  lllLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll
Query tpvVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
ident      | | |                                                  
Sbjct --aNIDLHFHSRT-----------------------------------------------   11
DSSP  --lLEELLLLLLL-----------------------------------------------


DSSP  llleellhhHLLHHHHHHHHHHLLLLEEEEEELLllllllllllhhhhhhhhHHHHHHHH
Query lpgrplsthFASLAQKMHFMDTNGIRVSVISLANpwfdflapdeapgiadavNAEFSDMC  120
ident                                                             
Sbjct ------sdgALTPTEVIDRAAARAPALLALTDHD-----------------cTGGLAEAA   48
DSSP  ------lllLLLHHHHHHHHHLLLLLEEEELLLL-----------------lLLLHHHHH


DSSP  HLLL---LLEEEEEellllllhhhhhhhhhhhhlllleeeeEELLL--------------
Query AQHV---GRLFFFAalplsapvdavkasiervknlkycrgiILGTS--------------  163
ident |                                            |              
Sbjct AAAArrgIPFLNGV---------------------------EVSVSwgrhtvhivglgid   81
DSSP  HHHHhllLLEEEEE---------------------------EEEEEelleeeeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  163
ident                                                             
Sbjct paepalaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlv  141
DSSP  lllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhh


DSSP  -----------------------llLLLLLlhhhhhhHHHHHHLLLEEeelllllllhhh
Query -----------------------glGKGLDdphllpvFEAVADAKLLVflhphyglpnev  200
ident                                            |                
Sbjct dsgavkdmrtvfrkyltpgkpgyvsHQWAS---ledaVGWIVGAGGMA------------  186
DSSP  hllllllhhhhhhhlllllllllllLLLLL---hhhhHHHHHHLLLEE------------


DSSP  hlllhhhlllhhhhhlhhhhhhhhhhhhhhhllhhhhllllleEEHHhHLLHhHHHHhhh
Query ygprseeyghvlplalgfpmettiavarmymagvfdhvrnlqmLLAHsGGTLpFLAGrie  260
ident                                              ||  |          
Sbjct -------------------------------------------VIAH-PGRYdMGRT---  199
DSSP  -------------------------------------------EELL-HHHLlLLHH---


DSSP  hhhhllhhhhhlllllllllLHHHHHHHL-----EEEE-LLLL-LHHHHHHHHHHHL--h
Query scivhdghlvktgkvpkdrrTIWTVLKEQ-----IYLD-AVIY-SEVGLQAAIASSG--a  311
ident                      |                 |    |               
Sbjct --------------------LIERLILDFqaaggQGIEvASGShSLDDMHKFALHADrhg  239
DSSP  --------------------HHHHHHHHHhhlllLEEEeEELLlLHHHHHHHHHHHHhhl


DSSP  HHEELLLLLLLLLLlllllllllhhhhhhHHHHhhhhllllhhhhhhhlhHHHHHLLLhh
Query DRLMFGTDHPFFPPieedvqgpwdssrlnAQAVikavgegssdaaavmglNAVRVLSLka  371
ident      | |                                             | |    
Sbjct LYASSGSDFHAPGE-----------dvghTEDL------------ppicrPIWRELEA-r  275
DSSP  LEEEEELLLLLLLL-----------llllLLLL------------lllllLHHHHLHH-h


DSSP  hhhhHHHHL
Query elehHHHHH  380
ident          
Sbjct ilrpADAEN  284
DSSP  llllLHHHL


No 58: Query=4hk5D Sbjct=1bksA Z-score=5.8

back to top
DSSP  -------------LLLLEeeeeeellhhhhhhhhlllllleeeeelleeeeeeellhhhh
Query -------------TPVVVdihthmyppsyiamlekrqtiplvrtfpqadeprlillssel   47
ident                                                             
Sbjct meryenlfaqlndRREGA------------------------------------------   18
DSSP  lhhhhhhhhhhhhLLLLE------------------------------------------


DSSP  hhhhhhhhlllllllleellhhhllhhhhhhhhhhlllleEEEEEllllllllllllHHH
Query aaldaaladpaaklpgrplsthfaslaqkmhfmdtngirvSVISLanpwfdflapdeAPG  107
ident                                          |                  
Sbjct ----------------------------------------FVPFV----------tlGDP   28
DSSP  ----------------------------------------EEEEE----------elLLL


DSSP  HHHHHHHHHHHHHHLLlllEEEEEELLL--------------------lLLHHHHHHHHH
Query IADAVNAEFSDMCAQHvgrLFFFAALPL--------------------sAPVDAVKASIE  147
ident                           |                                 
Sbjct GIEQSLKIIDTLIDAG--aDALELGVPFsdpladgptiqnanlrafaagVTPAQCFEMLA   86
DSSP  LHHHHHHHHHHHHHLL--lLLEEEELLLlllllllhhhhhhhhhhhhhlLLHHHHHHHHH


DSSP  HHHLLL--leEEEEELLLLllllLLLHHHHHHHHHHHH-LLLEEEELLlllllhhhhlll
Query RVKNLK--ycRGIILGTSGlgkgLDDPHLLPVFEAVAD-AKLLVFLHPhyglpnevygpr  204
ident            |                               |                
Sbjct LIREKHptipIGLLMYANL----VFNNGIDAFYARCEQvGVDSVLVAD------------  130
DSSP  HHHHHLllllEEEEELHHH----HHLLLHHHHHHHHHHhLLLEEEELL------------


DSSP  hhhlllhhhhhlhhhhhhhhHHHHHHhlLHHHHLL--LLLEEEHH---hhlLHHHhhhhh
Query seeyghvlplalgfpmettiAVARMYmaGVFDHVR--NLQMLLAH---sggTLPFlagri  259
ident                      |               |              |       
Sbjct -------------------vPVEESA--PFRQAALrhNIAPIFICppnaddDLLR-----  164
DSSP  -------------------lLHHHLH--HHHHHHHhlLLEEEEEElllllhHHHH-----


DSSP  hhhhhllhhhhhllllllllllhhhhHHHLE-EEELL-llLHHHHHHHHHHHLhhHEEL-
Query escivhdghlvktgkvpkdrrtiwtvLKEQI-YLDAV-iySEVGLQAAIASSGadRLMF-  316
ident                                 |                           
Sbjct ------------------------qvASYGRgYTYLLalpLHHLIEKLKEYHA--APALq  198
DSSP  ------------------------hhHHHLLlLEEELlllHHHHHHHHHHHLL--LLEEe


DSSP  LLLLLlllllllllllLLHHHHHHHHHhhhhhllllhhhhHHHL----------------
Query GTDHPffppieedvqgPWDSSRLNAQAvikavgegssdaaAVMG----------------  360
ident |                         |                |                
Sbjct GFGIS-----------SPEQVSAAVRA-------------GAAGaisgsaivkiieknla  234
DSSP  LLLLL-----------LHHHHHHHHHH-------------LLLEeeellhhhhhhhhlll


DSSP  -hhhhhhlllhhhhhhhhhhl
Query -lnavrvlslkaelehhhhhh  380
ident                      
Sbjct spkqmlaelrsfvsamkaasr  255
DSSP  lhhhhhhhhhhhhhhhhhlll


No 59: Query=4hk5D Sbjct=3e38A Z-score=5.7

back to top
DSSP  ---------------LLLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhh
Query ---------------TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillss   45
ident                |    | | |                                   
Sbjct aqrrneiqvpdldgyTTLKCDFHXHSVF--------------------------------   28
DSSP  lllllllllllllllEEEEEELLLLLLL--------------------------------


DSSP  hhhhhhhhhhlllllllleellhhHLLHHHHHHHHHHLLLLEEEEEELlLLLLllllllh
Query elaaldaaladpaaklpgrplsthFASLAQKMHFMDTNGIRVSVISLAnPWFDflapdea  105
ident                                       |                     
Sbjct ---------------------sdgLVWPTVRVDEAYRDGLDAISLTEHiEYRP------h   61
DSSP  ---------------------lllLLLHHHHHHHHHHLLLLEELLEEElLLLL------l


DSSP  hhhhHHHHHHHHHHHHLLL----LLEEEEeellllllhhhhhhhhhhhhlllleeeEEEL
Query pgiaDAVNAEFSDMCAQHV----GRLFFFaalplsapvdavkasiervknlkycrgIILG  161
ident             | |          |                                  
Sbjct kqdvVSDHNRSFDLCREQAeklgILLIKG---------------------------SEIT   94
DSSP  llllLLLLLHHHHHHHHHHhhhlLEELLE---------------------------EEEE


DSSP  LL-----------llllllllHHHHHHHHHHHHLLLEeeelllllllhhhhlllhhhlll
Query TS-----------glgkglddPHLLPVFEAVADAKLLvflhphyglpnevygprseeygh  210
ident                            |                                
Sbjct RAxapghfnaiflsdsnpleqKDYKDAFREAKKQGAF-----------------------  131
DSSP  LLlllleeeeelllllhhhllLLHHHHHHHHHHLLLE-----------------------


DSSP  hhhhhlhhhhhhhhhhhhhhhllhhhhlllllEEEHHhHLLH-----hHHHHhhhhhhhl
Query vlplalgfpmettiavarmymagvfdhvrnlqMLLAHsGGTL-----pFLAGriescivh  265
ident                                     |  |                    
Sbjct --------------------------------XFWNH-PGWDsqqpdtTKWW--------  150
DSSP  --------------------------------EEELL-LLLLllllllLLLL--------


DSSP  lhhhhhlllllllllLHHHH---hhhLEEEE-LLLLlhhHHHHHHHHHL--hHHEELLLL
Query dghlvktgkvpkdrrTIWTV---lkeQIYLD-AVIYsevGLQAAIASSG--aDRLMFGTD  319
ident                   |             |          ||              |
Sbjct ---------------PEHTAlyqegcXHGIEvANGH--lYXPEAIQWCLdknLTXIGTSD  193
DSSP  ---------------HHHHHhhhlllLLEEEeEELL--eELLHHHHHHHhhlLEEEEELL


DSSP  LLL----LLLLLLllllllHHHH-------------------------hhHHHHH-----
Query HPF----FPPIEEdvqgpwDSSR-------------------------lnAQAVI-----  345
ident            |                                          |     
Sbjct IHQpiqtDYDFEK-----gEHRTxtfvfakerslqgirealdnrrtaayfHELLIgredl  248
DSSP  LLLlhhhHLLHHH-----lLLLLeeeeeellllhhhhhhhhhllleeeeeLLEEEllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  345
ident                                                             
Sbjct lrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytv  308
DSSP  hhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeee


DSSP  ------------------HHHLlllhhhhhhhlhhhhhhlllhhhhhhhhhhl
Query ------------------KAVGegssdaaavmglnavrvlslkaelehhhhhh  380
ident                                                      
Sbjct rigfkqgikggdvnfevtNFIV-------------------apdkglkytisl  342
DSSP  eeeellllllleeeeeeeEEEE-------------------elleeeeeeeel