Results: dupa

Query: 4dziC

MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4dzi-C 71.5  0.0  388   388  100 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
   2:  4ofc-A 29.0  3.4  314   335   22 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   3:  2dvt-A 27.8  2.9  294   325   21 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   4:  4qrn-A 27.4  3.2  305   352   17 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   5:  4hk5-D 26.3  3.5  303   380   17 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   6:  2gwg-A 21.5  3.5  269   329   17 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   7:  3irs-A 17.5  3.6  245   281   19 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   8:  3cjp-A 16.8  3.0  221   262   14 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   9:  1gkp-A 16.4  3.4  248   458   11 PDB  MOLECULE: HYDANTOINASE;                                              
  10:  4dlf-A 16.0  3.2  227   287   15 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  11:  1itq-A 15.5  3.5  237   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  12:  4b3z-D 15.4  3.8  251   477   10 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  13:  2ffi-A 15.1  3.5  225   273   20 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  14:  4mup-B 13.9  3.3  219   286   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  15:  3gri-A 13.7  3.7  229   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  16:  3e74-A 13.7  3.7  230   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  17:  3pnu-A 13.6  3.3  215   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  18:  2qpx-A 13.6  4.0  231   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  19:  2vun-A 13.5  3.5  214   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  20:  4cqb-A 13.3  4.1  233   402    9 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  21:  1yrr-B 13.3  3.0  204   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  22:  3giq-A 13.1  3.5  216   475   11 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  23:  2y1h-B 12.9  3.8  207   265   11 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  24:  3k2g-B 12.9  3.9  224   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  25:  3ls9-A 12.8  3.8  221   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  26:  3mtw-A 12.7  3.3  202   404   15 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  27:  1k6w-A 12.7  4.4  233   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  28:  2ob3-A 12.6  3.3  208   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  29:  1bf6-A 12.6  3.4  209   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  2paj-A 12.6  3.5  208   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  31:  2imr-A 12.5  3.6  216   380   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  32:  1onx-A 12.5  3.5  221   390   14 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  33:  2vc5-A 12.3  3.6  213   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  34:  1j6p-A 12.3  3.8  217   407   10 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  35:  3gg7-A 12.3  3.8  208   243   16 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  3mkv-A 12.2  3.9  209   414   13 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  37:  1a4m-A 12.2  4.1  222   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  38:  2oof-A 12.1  3.9  214   403   13 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  39:  4c5y-A 12.0  3.4  202   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  40:  3nqb-A 12.0  3.6  205   587   12 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  41:  2uz9-A 11.5  3.7  213   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  42:  2ogj-A 11.5  3.7  213   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  43:  3icj-A 11.1  4.4  209   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  44:  1a5k-C 10.6  3.3  195   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  1j5s-A 10.5  4.6  229   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  46:  3iac-A 10.4  4.4  234   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  47:  4rdv-B 10.0  4.0  207   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  48:  3ooq-A  9.1  3.3  176   384   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  3qy6-A  8.1  3.4  173   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  3au2-A  8.0  4.1  177   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  51:  1v77-A  7.9  3.4  161   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  52:  2a3l-A  7.6  4.3  229   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  53:  3f2b-A  7.1  3.5  160   994    6 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  3dcp-A  7.0  3.6  174   277    7 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  1m65-A  5.7  3.7  160   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  5.3  4.1  166   255   11 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  3.7  3.9  139   224    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  3.7  3.7  135   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  3.2  4.1  127   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4dziC Sbjct=4dziC Z-score=71.5

back to top
DSSP  LLLLLEEEEEEELLLLLLLLLLLLLHHHLLLLEEEEELLLLEEEEELLEELLLLLLLLLL
Query ALNYRVIDVDNHYYEPLDSFTRHLDKKFKRRGVQMLSDGKRTWAVIGDRVNHFIPNPTFD   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ALNYRVIDVDNHYYEPLDSFTRHLDKKFKRRGVQMLSDGKRTWAVIGDRVNHFIPNPTFD   60
DSSP  LLLLLEEEEEEELLLLLLLLLLLLLHHHLLLLEEEEELLLLEEEEELLEELLLLLLLLLL


DSSP  LEELLLLLHHHHHLLLLLLLLHHHLLLEELHHHLHHHLLHHHHHHHHHHHLEEEEEEELL
Query PIIVPGCLDLLFRGEIPDGVDPASLMKVERLADHPEYQNRDARIAVMDEQDIETAFMLPT  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PIIVPGCLDLLFRGEIPDGVDPASLMKVERLADHPEYQNRDARIAVMDEQDIETAFMLPT  120
DSSP  LEELLLLLHHHHHLLLLLLLLHHHLLLEELHHHLHHHLLHHHHHHHHHHHLEEEEEEELL


DSSP  HHHHHHHHLLLLHHHHHHHHHHHHHHHHHHLLLLLLLLLEEELLLLLLLLHHHHHHHHHH
Query FGCGVEEALKHDIEATMASVHAFNLWLDEDWGFDRPDHRIIAAPIVSLADPTRAVEEVDF  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FGCGVEEALKHDIEATMASVHAFNLWLDEDWGFDRPDHRIIAAPIVSLADPTRAVEEVDF  180
DSSP  HHHHHHHHLLLLHHHHHHHHHHHHHHHHHHLLLLLLLLLEEELLLLLLLLHHHHHHHHHH


DSSP  HHHLLLLLEELLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEELLLLLLHHHHHHL
Query VLARGAKLVLVRPAPVPGLVKPRSLGDRSHDPVWARLAEAGVPVGFHLSDSGYLHIAAAW  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VLARGAKLVLVRPAPVPGLVKPRSLGDRSHDPVWARLAEAGVPVGFHLSDSGYLHIAAAW  240
DSSP  HHHLLLLLEELLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEELLLLLLHHHHHHL


DSSP  LLLLLHHHHHHHLLHHHHHHHHHHHHLLHHHHLLLLLEEEELLLLLHHHHHHHHHHHHHH
Query GGAKDPLDQVLLDDRAIHDTMASMIVHGVFTRHPKLKAVSIENGSYFVHRLIKRLKKAAN  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GGAKDPLDQVLLDDRAIHDTMASMIVHGVFTRHPKLKAVSIENGSYFVHRLIKRLKKAAN  300
DSSP  LLLLLHHHHHHHLLHHHHHHHHHHHHLLHHHHLLLLLEEEELLLLLHHHHHHHHHHHHHH


DSSP  HLHHHLLLLHHHHHHHHEEELLLLLLLHHHHHHHHLHHHLLLLLLLLLLLLLLLHHHHHH
Query TQPQYFPEDPVEQLRNNVWIAPYYEDDLPELARVIGVDKILFGSDWPHGEGLASPVSFTA  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TQPQYFPEDPVEQLRNNVWIAPYYEDDLPELARVIGVDKILFGSDWPHGEGLASPVSFTA  360
DSSP  HLHHHLLLLHHHHHHHHEEELLLLLLLHHHHHHHHLHHHLLLLLLLLLLLLLLLHHHHHH


DSSP  HHLLLLHHHHHHHHLHHHHHHHLLLLLL
Query ELKGFSESDIRKIMRDNALDLLGVQVGS  388
ident ||||||||||||||||||||||||||||
Sbjct ELKGFSESDIRKIMRDNALDLLGVQVGS  388
DSSP  HHLLLLHHHHHHHHLHHHHHHHLLLLLL


No 2: Query=4dziC Sbjct=4ofcA Z-score=29.0

back to top
DSSP  llllLEEEEEEELLLLLLlllLLLLHHH-LLLLEEEEELLL-leEEEElLEELlLLLLll
Query alnyRVIDVDNHYYEPLDsftRHLDKKF-KRRGVQMLSDGK-rtWAVIgDRVNhFIPNpt   58
ident       ||   |           | | |     ||     |        |    |     
Sbjct ----MKIDIHSHILPKEW---PDLKKRFgYGGWVQLQHHSKgeaKLLK-DGKV-FRVV--   49
DSSP  ----LLEEEEEELLLLLL---LLHHHHHlLLLLEEEEEEELleeEEEE-LLEE-EEEE--


DSSP  llleelllllhhhhhllllllllhhhllleelhhhLHHHLLHHHHHHHHHHHLEEEEEEE
Query fdpiivpgcldllfrgeipdgvdpaslmkverladHPEYQNRDARIAVMDEQDIETAFML  118
ident                                             ||  ||          
Sbjct -----------------------------------RENCWDPEVRIREMDQKGVTVQALS   74
DSSP  -----------------------------------EHHHLLHHHHHHHHHHHLLLEEEEE


DSSP  LLhhHHHHhhLLLL-HHHHHHHHHHHHHHHHHHLLllLLLLLEEELLLLLLLLHHHHHHH
Query PTfgCGVEeaLKHD-IEATMASVHAFNLWLDEDWGfdRPDHRIIAAPIVSLADPTRAVEE  177
ident                 | |       |  |           |           |  || |
Sbjct TV--PVMF--SYWAkPEDTLNLCQLLNNDLASTVV--SYPRRFVGLGTLPMQAPELAVKE  128
DSSP  LL--HHHH--LLLLlHHHHHHHHHHHHHHHHHHHH--HLLLLEEEEELLLLLLHHHHHHH


DSSP  HHHHHH-LLLLLEELLLLLLlllllLLLLLLHHHHHHHHHHHHHLLLEEEELllLLLHhh
Query VDFVLA-RGAKLVLVRPAPVpglvkPRSLGDRSHDPVWARLAEAGVPVGFHLsdSGYLhi  236
ident         |   |               |      || |           |         
Sbjct MERCVKeLGFPGVQIGTHVN-----EWDLNAQELFPVYAAAERLKCSLFVHP--WDMQ--  179
DSSP  HHHHHHlLLLLEEEEELEEL-----LEELLLHHHHHHHHHHHHHLLEEEEEL--LLLL--


DSSP  HHHLlllLLHHHH-HHHLLHHHHHHHHHHHHLLHHHHLLLLLEEEeLLLL-LHHHHhHHH
Query AAAWggaKDPLDQ-VLLDDRAIHDTMASMIVHGVFTRHPKLKAVSiENGS-YFVHRlIKR  294
ident                            |||  |||   ||||      |   |      |
Sbjct MDGR--mAKYWLPwLVGMPAETTIAICSMIMGGVFEKFPKLKVCF-AHGGgAFPFT-VGR  235
DSSP  LLHH--hHLLLHHhHLHHHHHHHHHHHHHHLLLHHHHLLLLLEEE-LHHHlLHHHH-HHH


DSSP  HHHHHHHLHHHL----LLLHHHHHHHhEEEL-LLLL-LLHHHHHHHHLHHHLLLLLLLLL
Query LKKAANTQPQYF----PEDPVEQLRNnVWIA-PYYE-DDLPELARVIGVDKILFGSDWPH  348
ident         |       |  |   |               |  |  ||| ||   | | | 
Sbjct ISHGFSMRPDLCaqdnPMNPKKYLGS-FYTDaLVHDpLSLKLLTDVIGKDKVILGTDYPF  294
DSSP  HHHHHHHLHHHHllllLLLHHHHLLL-LEEElLLLLhHHHHHHHHHHLLLLEELLLLLLL


DSSP  LLLLLLHHHHHHHHLLLLHHHHHHHHLHHHHHHHL-lllll
Query GEGLASPVSFTAELKGFSESDIRKIMRDNALDLLG-vqvgs  388
ident   |   |         | |    |    |||  ||      
Sbjct PLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGlerkqf  335
DSSP  LLLLLLLLHHHHHLLLLLHHHHHHHHLHHHHHHHLllhhhl


No 3: Query=4dziC Sbjct=2dvtA Z-score=27.8

back to top
DSSP  lllLLEEEEEEELLLLLllllllllhhhlllleeeeelllleeeeelleelLLLLL---l
Query alnYRVIDVDNHYYEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnHFIPN---p   57
ident            |   |                                            
Sbjct --mQGKVALEEHFAIPE--------------------------------tlQDSAGfvpg   26
DSSP  --lLLEEEEEEEELLHH--------------------------------hhHHHLLllll


DSSP  lLLLEElllllhhhhhllllllllhhhllleelhhhlHHHLLHHH-HHHHHHHHLEEEEE
Query tFDPIIvpgcldllfrgeipdgvdpaslmkverladhPEYQNRDA-RIAVMDEQDIETAF  116
ident                                               |   ||   |||  
Sbjct dYWKEL------------------------------qHRLLDIQDtRLKLMDAHGIETMI   56
DSSP  lHHHHH------------------------------hHHHHLLLLhHHHHHHHLLEEEEE


DSSP  EELLhhHHHHHHLLlLHHHHHHHHHHHHHHHHHHLLllLLLLLEEELLLLLLLLHHHHHH
Query MLPTfgCGVEEALKhDIEATMASVHAFNLWLDEDWGfdRPDHRIIAAPIVSLADPTRAVE  176
ident            |   |           |  | |         |  |     | ||  | |
Sbjct LSLN--APAVQAIP-DRRKAIEIARRANDVLAEECA--KRPDRFLAFAALPLQDPDAATE  111
DSSP  EEEL--LLHHHHLL-LHHHHHHHHHHHHHHHHHHHH--HLLLLEEEEELLLLLLHHHHHH


DSSP  HHHHHHH-LLLLLEELLLLlLLLLL--LLLLLLLHHHHHHHHHHHHHLLLEEEELLlLLL
Query EVDFVLA-RGAKLVLVRPApVPGLV--KPRSLGDRSHDPVWARLAEAGVPVGFHLSdSGY  233
ident |        |    ||            |         | |       ||   |      
Sbjct ELQRCVNdLGFVGALVNGF-SQEGDgqTPLYYDLPQYRPFWGEVEKLDVPFYLHPR-NPL  169
DSSP  HHHHHHHlLLLLEEEEELL-LLLLLllLLLLLLLHHHHHHHHHHHHHLLLEEEELL-LLL


DSSP  H-HHHHHLllllLHHHHH---hHLLHHHHHHHHHHHHLLHHHHLLLLLEEEELlLLLHHH
Query L-HIAAAWggakDPLDQV---lLDDRAIHDTMASMIVHGVFTRHPKLKAVSIEnGSYFVH  289
ident                                       | |  || |             
Sbjct PqDSRIYD----GHPWLLgptwAFAQETAVHALRLMASGLFDEHPRLNIILGH-MGEGLP  224
DSSP  HhHLHHHL----LLHHHLhhhlHHHHHHHHHHHHHHHLLHHHHLLLLLEEELH-HHLLHH


DSSP  HHHHHHHH---hhhHLHHHL-LLLHHHHHHHHEEELL--LLLL-LHHHHHHHHLHHHLLL
Query RLIKRLKK---aanTQPQYF-PEDPVEQLRNNVWIAP--YYED-DLPELARVIGVDKILF  342
ident     |           | |            |  |          |      || | |||
Sbjct YMMWRIDHrnawvkLPPRYPaKRRFMDYFNENFHITTsgNFRTqTLIDAILEIGADRILF  284
DSSP  HHHHHHHHllllllLLLLLLlLLLHHHHHHHHEEEELllLLLHhHHHHHHLLLLHHHEEL


DSSP  LLLLLLlLLLLLHHH-HHHHhlLLLHHHHHHHHLHHHHHHHLlllll
Query GSDWPHgEGLASPVS-FTAElkGFSESDIRKIMRDNALDLLGvqvgs  388
ident   |||  |        | |      | |  || | ||  |       
Sbjct STDWPF-ENIDHASDwFNAT--SIAEADRVKIGRTNARRLFK---ld  325
DSSP  LLLLLL-LLHHHHHHhHHHL--LLLHHHHHHHHLHHHHHHLL---ll


No 4: Query=4dziC Sbjct=4qrnA Z-score=27.4

back to top
DSSP  ----------LLLLLEEEEEEELLLlLLLLlllllhhhlllleeeeelllleeEEEL-LE
Query ----------ALNYRVIDVDNHYYEpLDSFtrhldkkfkrrgvqmlsdgkrtwAVIG-DR   49
ident              |  |                                         | 
Sbjct smtqdlktggEQGYLRIATEEAFAT-REII--------------------dvyLRMIrDG   39
DSSP  llllllllllLLLLLLEEEEEEELL-HHHH--------------------hhhHHHHhHL


DSSP  EL-----LLLLL-LLLLL--EELLlllhhhhhllllllllhhhllleelhhhlHHHLL-H
Query VN-----HFIPN-PTFDP--IIVPgcldllfrgeipdgvdpaslmkverladhPEYQN-R  100
ident                                                             
Sbjct TAdkgmvSLWGFyAQSPSerATQI----------------------------lERLLDlG   71
DSSP  LLlhhhhHHHHHhHHLLLhhHHHH----------------------------hHHHHLlL


DSSP  HHHHHHHHHHLEEEEEEELLhhHHHHHHLlLLHHHHHHHHHHHHHHHHHHlllLLLL-LL
Query DARIAVMDEQDIETAFMLPTfgCGVEEALkHDIEATMASVHAFNLWLDEDwgfDRPD-HR  159
ident   ||| ||   |  |    |        | ||           |  |            |
Sbjct ERRIADMDATGIDKAILALT--SPGVQPL-HDLDEARTLATRANDTLADA---CQKYpDR  125
DSSP  HHHHHHHHHLLLLEEEEEEL--LLLLLLL-LLHHHHHHHHHHHHHHHHHH---HHHLlLL


DSSP  EEELLLLLLLLHHHHHHHHHHHHH-LLLLLEELLLLLllllllLLLLLLHHHHHHHHHHH
Query IIAAPIVSLADPTRAVEEVDFVLA-RGAKLVLVRPAPvpglvkPRSLGDRSHDPVWARLA  218
ident  |    |   ||     |        | |               | |     ||    | 
Sbjct FIGMGTVAPQDPEWSAREIHRGAReLGFKGIQINSHT-----qGRYLDEEFFDPIFRALV  180
DSSP  EEELLLLLLLLHHHHHHHHHHHHHlLLLLLEEELLLL-----lLLLLLLHHHHHHHHHHH


DSSP  HHLLLEEEELLlLLLH-HHHHhlllllLHHHH--hHHLLHHHHHHHHHHHHLLHHHHLLL
Query EAGVPVGFHLSdSGYL-HIAAawggakDPLDQ--vLLDDRAIHDTMASMIVHGVFTRHPK  275
ident |   |   |         |                              |  | |   | 
Sbjct EVDQPLYIHPA-TSPDsMIDP----mlEAGLDgaiFGFGVETGMHLLRLITIGIFDKYPS  235
DSSP  HHLLLEEELLL-LLLLlLLHH----hhHHLLLlllLHHHHHHHHHHHHHHHHLHHHHLLL


DSSP  LLEEEeLLLL-LHHHHHHHHHHHHHHHLH-------HHLLLLHHHHHHHHEEELL--LLL
Query LKAVSiENGS-YFVHRLIKRLKKAANTQP-------QYFPEDPVEQLRNNVWIAP--YYE  325
ident |               |                             |  ||         
Sbjct LQIMV-GHMGeALPYWLYRLDYMHQAGVRsqryermKPLKKTIEGYLKSNVLVTNsgVAW  294
DSSP  LLEEE-LHHHhLHHHHHHHHHHHHHHHHHlllllllLLLLLLHHHHHHHLEEEELllLLL


DSSP  L-LHHHHHHHHLHHHLLLLLLLLLllLLLL-hHHHHHHHLlLLHHHHHHHHLHHHHHHHL
Query D-DLPELARVIGVDKILFGSDWPHgeGLAS-pVSFTAELKgFSESDIRKIMRDNALDLLG  383
ident          | | |      | |         |         |     |    ||     
Sbjct EpAIKFCQQVMGEDRVMYAMDYPY--QYVAdeVRAMDAMD-MSAQTKKKFFQTNAEKWFK  351
DSSP  HhHHHHHHHHHLHHHEELLLLLLL--LLLHhhHHHHHLLL-LLHHHHHHHHLHHHHHHLL


DSSP  lllll
Query vqvgs  388
ident      
Sbjct ----l  352
DSSP  ----l


No 5: Query=4dziC Sbjct=4hk5D Z-score=26.3

back to top
DSSP  llLLLEEEEEEELLLLlLLLLllllhhhlllleeeeellllEEEEelleeLLLLLL----
Query alNYRVIDVDNHYYEPlDSFTrhldkkfkrrgvqmlsdgkrTWAVigdrvNHFIPN----   56
ident      | |   | | |                                            
Sbjct --TPVVVDIHTHMYPP-SYIA------------------mlEKRQ-----TIPLVRtfpq   34
DSSP  --LLLLEEEEEEELLH-HHHH------------------hhHLLL-----LLLEEEeell


DSSP  --------------------------lllLLEElllllhhhhhllllllllhhhllleel
Query --------------------------ptfDPIIvpgcldllfrgeipdgvdpaslmkver   90
ident                               |                             
Sbjct adeprlillsselaaldaaladpaaklpgRPLS---------------------------   67
DSSP  eeeeeeellhhhhhhhhhhhhllllllllEELL---------------------------


DSSP  hhhlHHHLLHHHHHHHHHHHLEEEEEEELLhhHHHHHHLllLHHHHHHHHHHHHHHHHHH
Query ladhPEYQNRDARIAVMDEQDIETAFMLPTfgCGVEEALkhDIEATMASVHAFNLWLDED  150
ident                 ||   |                |            | |      
Sbjct ----THFASLAQKMHFMDTNGIRVSVISLA--NPWFDFL--APDEAPGIADAVNAEFSDM  119
DSSP  ----HHHLLHHHHHHHHHHLLLLEEEEEEL--LLLLLLL--LLLLHHHHHHHHHHHHHHH


DSSP  LLllLLLLLEEELLLLLLL-LHHHHHHHHHHHHHLL-LLLEELLLLLLLlllllLLLLLH
Query WGfdRPDHRIIAAPIVSLA-DPTRAVEEVDFVLARG-AKLVLVRPAPVPglvkpRSLGDR  208
ident         |        |             |                        | | 
Sbjct CA--QHVGRLFFFAALPLSaPVDAVKASIERVKNLKyCRGIILGTSGLG-----KGLDDP  172
DSSP  HH--LLLLLEEEEEELLLLlLHHHHHHHHHHHHLLLlEEEEEELLLLLL-----LLLLLH


DSSP  HHHHHHHHHHHHLLLEEEELLlLLLHhhHHHLL--LLLLHhHHHH---HLLHHHHHHHHH
Query SHDPVWARLAEAGVPVGFHLSdSGYLhiAAAWG--GAKDPlDQVL---LDDRAIHDTMAS  263
ident    ||    | |   |  |    |        |                         | 
Sbjct HLLPVFEAVADAKLLVFLHPH-YGLP--NEVYGprSEEYG-HVLPlalGFPMETTIAVAR  228
DSSP  HHHHHHHHHHHLLLEEEELLL-LLLL--HHHHLllHHHLL-LHHHhhlHHHHHHHHHHHH


DSSP  HHHLLHHHHLLLLLEEEElLLLLHHHHHHHHHHHHHHHL--------hHHLLLLHHHHHH
Query MIVHGVFTRHPKLKAVSIeNGSYFVHRLIKRLKKAANTQ--------pQYFPEDPVEQLR  315
ident |   |||     |              |  |                           | 
Sbjct MYMAGVFDHVRNLQMLLA-HSGGTLPFLAGRIESCIVHDghlvktgkvPKDRRTIWTVLK  287
DSSP  HHHLLHHHHLLLLLEEEH-HHHLLHHHHHHHHHHHHHLLhhhhhllllLLLLLLHHHHHH


DSSP  HHEEEL-LLLL-LLHHHHHHHHLHHHLLLLLLLLLLL--------lLLLHHHHHHH-HLL
Query NNVWIA-PYYE-DDLPELARVIGVDKILFGSDWPHGE--------gLASPVSFTAE-LKG  364
ident          |    |       | |   || | |              |         | 
Sbjct EQIYLDaVIYSeVGLQAAIASSGADRLMFGTDHPFFPpieedvqgpWDSSRLNAQAvIKA  347
DSSP  HLEEEElLLLLhHHHHHHHHHHLHHHEELLLLLLLLLlllllllllLHHHHHHHHHhHHH


DSSP  LL--HHHHHHHHLHHHHHHHL-------lllll
Query FS--ESDIRKIMRDNALDLLG-------vqvgs  388
ident      ||    |  ||   |             
Sbjct VGegSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  HLllLHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 6: Query=4dziC Sbjct=2gwgA Z-score=21.5

back to top
DSSP  llllLEEEEEEELL-LLLLLllllllhhhlllLEEEeelllleeeeELLEElllllllll
Query alnyRVIDVDNHYY-EPLDSftrhldkkfkrrGVQMlsdgkrtwavIGDRVnhfipnptf   59
ident       ||   ||   |                                           
Sbjct ----XIIDIHGHYTtAPKAL----------edWRNR----------QIAGI---------   27
DSSP  ----LLEEEEEELLlLLHHH----------hhHHHH----------HHHHH---------


DSSP  lleelllllhhhhhllllllllhhhllleelhhhlhhhlLHHH-HHHHHHHHLEEEEEEE
Query dpiivpgcldllfrgeipdgvdpaslmkverladhpeyqNRDA-RIAVMDEQDIETAFML  118
ident                                                   |         
Sbjct ------------------kdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVFS   69
DSSP  ------------------hlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEE


DSSP  LLHhhhhhhhllLLHHHHHHHHHHHHHHHHHHLLllLLLLLEEELLLLLLL---LHHHHH
Query PTFgcgveealkHDIEATMASVHAFNLWLDEDWGfdRPDHRIIAAPIVSLA---DPTRAV  175
ident |            |           |                | |         ||    
Sbjct PRA---------GDFNVSSTWAAICNELCYRVSQ--LFPDNFIGAAXLPQSpgvDPKTCI  118
DSSP  LLL---------LLHHHHHHHHHHHHHHHHHHHH--HLLLLEEEEEELLLLlllLHHHHH


DSSP  HHHHHHHHL-LLLLEELLlLLLL-lllLLLLLLLHHHHHHHHHHHHHLLLEEEELLllll
Query EEVDFVLAR-GAKLVLVRpAPVP-glvKPRSLGDRSHDPVWARLAEAGVPVGFHLSdsgy  233
ident  |        |                    | ||   |      |   |   | |    
Sbjct PELEKCVKEyGFVAINLN-PDPSgghwTSPPLTDRIWYPIYEKXVELEIPAXIHVS----  173
DSSP  HHHHHHHHLlLLLEEEEL-LLLLllllLLLLLLLHHHHHHHHHHHHHLLLEEELLL----


DSSP  hhhhhhllllllhhhhHHHL-LHHHHHHHHHHHHLLHHHHLLLLLEEEElLLLLHHHHHH
Query lhiaaawggakdpldqVLLD-DRAIHDTMASMIVHGVFTRHPKLKAVSIeNGSYFVHRLI  292
ident                        |             |   | || |    |   |    
Sbjct ----------------TGAHyLNADTTAFXQCVAGDLFKDFPELKFVIP-HGGGAVPYHW  216
DSSP  ----------------LLLHhHHHHHHHHHHHHHLLHHHHLLLLLEEEL-HHHLLLHHHH


DSSP  HHHHHHHHHLHhhllLLHHHHHHHHEEEL-LLLL-LLHHHHHHHHLHHHLLLLLLLLLLL
Query KRLKKAANTQPqyfpEDPVEQLRNNVWIA-PYYE-DDLPELARVIGVDKILFGSDWPHGE  350
ident  |    |                ||       |       |  || ||  || |      
Sbjct GRFRGLAQEXK---kPLLEDHVLNNIFFDtCVYHqPGIDLLNTVIPVDNVLFASEXIGAV  273
DSSP  HHHHHHHHHLL---lLLHHHHLLLLEEEElLLLLhHHHHHHHHHLLHHHEELLLLLLLLL


DSSP  ---------lLLLHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL---------llll
Query ---------gLASPVSFTAELKGFSESDIRKIMRDNALDLLGV---------qvgs  388
ident                                |   ||                   
Sbjct rgidprtgfyYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRldaalkakgkleh  329
DSSP  lleelllleeLLLLHHHHHHLLLLLHHHHHHHHLHHHHHHLHHhhhhhhhhhhhll


No 7: Query=4dziC Sbjct=3irsA Z-score=17.5

back to top
DSSP  lllLLEEEEEEEL----LLLLllllllllhhhlllleeeeelllleeeeelleellllll
Query alnYRVIDVDNHY----YEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipn   56
ident       ||                                                    
Sbjct ---LKIIDFRLRPpamgFLNA-------------------------------------ri   20
DSSP  ---LLLEELLLLLllhhHHHL-------------------------------------hh


DSSP  lLLLLEEL-lLLLHHHhhllllllllhhhllleelhHHLHHhllhHHHHHHHHHHLEEEE
Query pTFDPIIV-pGCLDLLfrgeipdgvdpaslmkverlADHPEyqnrDARIAVMDEQDIETA  115
ident  |   |                                             |    ||  
Sbjct yTRPDIRNrfTRQLGF--------------epapsaEEKSL----ELMFEEMAAAGIEQG   62
DSSP  hHLHHHHHhhHHHHLL--------------lllhhhHHLLH----HHHHHHHHHLLLLEE


DSSP  EEELlhHHHHHHhllllhhhhhhhhhhHHHHHHHHLLllLLLLLEEELLLLLLLLHHHHH
Query FMLPtfGCGVEEalkhdieatmasvhaFNLWLDEDWGfdRPDHRIIAAPIVSLADPTRAV  175
ident                             |                        |    | 
Sbjct VCVG--RNSSVL------------gsvSNADVAAVAK--AYPDKFHPVGSIEAATRKEAM  106
DSSP  EEEL--LEELLL------------eelLHHHHHHHHH--HLLLLEEEEEELLLLLHHHHH


DSSP  HHHHHHHHLLLLLEELLLLLLLLlllLLLLLLHHHHHHHHHHHHHLLLEEEE--LLLLLL
Query EEVDFVLARGAKLVLVRPAPVPGlvkPRSLGDRSHDPVWARLAEAGVPVGFH--LSDSGY  233
ident       |  |   |   |        |    ||   |  |     | ||           
Sbjct AQMQEILDLGIRIVNLEPGVWAT---PMHVDDRRLYPLYAFCEDNGIPVIMMtgGNAGPD  163
DSSP  HHHHHHHHLLLLLEEELHHHLLL---LLLLLLHHHHHHHHHHHHLLLLEEEEllLLLLLL


DSSP  hhhhhhllllllhhhhhhhllHHHHhhHHHHHhlLHHHHLLLLLEEEELLLLLHHHHHHh
Query lhiaaawggakdpldqvllddRAIHdtMASMIvhGVFTRHPKLKAVSIENGSYFVHRLIk  293
ident                                    |    | |  ||       |   | 
Sbjct --------------------iTYTN--PEHID--RVLGDFPDLTVVSSHGNWPWVQEII-  198
DSSP  --------------------hHHHL--HHHHH--HHHHHLLLLLEEEEHHHLLLHHHHH-


DSSP  hhhhhhhhlhhhllllHHHHhhHHEEELL---LLLL----LHHHHHHHHLHHHLLLLLLL
Query rlkkaantqpqyfpedPVEQlrNNVWIAP---YYED----DLPELARVIGVDKILFGSDW  346
ident                        |    |    |      |    |     |  |||   
Sbjct --------------hvAFRR--PNLYLSPdmyLYNLpghaDFIQAANSFLADRMLFGTAY  242
DSSP  --------------hhHHHL--LLEEEELhhhHLLLllhhHHHHHHLLHHHHLLLLLLLL


DSSP  LlllLLLL---HHHHHHHhlLLLHHHHHHHHLHHHHHHHLLllll
Query PhgeGLAS---PVSFTAElkGFSESDIRKIMRDNALDLLGVqvgs  388
ident |             |             ||   ||  ||      
Sbjct P---MCPLkeyTEWFLTL--PIKPDAMEKILHGNAERLLAQ-agr  281
DSSP  L---LLLHhhhHHHHHLL--LLLHHHHHHHHLHHHHHHHHH-lll


No 8: Query=4dziC Sbjct=3cjpA Z-score=16.8

back to top
DSSP  llllLEEEEEEELllllllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alnyRVIDVDNHYyepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident       ||   |                                                
Sbjct ----LIIDGHTHV-----------------------------------------------    9
DSSP  ----LLEEEEEEL-----------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEEEEEEELL
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIETAFMLPT  120
ident                                            |  |||          |
Sbjct ------------------------------------ILPVEKHIKIMDEAGVDKTILFST   33
DSSP  ------------------------------------LLLHHHHHHHHHHHLLLEEEEELL


DSSP  HH-----------------------hHHHHhllllhhhHHHHHHHHHHHHHHHLLllLLL
Query FG-----------------------cGVEEalkhdieaTMASVHAFNLWLDEDWGfdRPD  157
ident                                                  |          
Sbjct SIhpetavnlrdvkkemkklndvvngKTNS--------MIDVRRNSIKELTNVIQ--AYP   83
DSSP  LLlhhhlllhhhhhhhhhhhhhhhllLLLL--------LHHHHHHHHHHHHHHHH--HLL


DSSP  LLEEELLLLLLLL-HHHHHHHHHH-HHHLLLLLEE-LLLLLlllllllLLLLLhhHHHHH
Query HRIIAAPIVSLAD-PTRAVEEVDF-VLARGAKLVL-VRPAPvpglvkpRSLGDrsHDPVW  214
ident  |      |                             ||                 |  
Sbjct SRYVGFGNVPVGLsENDTNSYIEEnIVNNKLVGIGeLTPAS-------GQIKS--LKPIF  134
DSSP  LLEEEEELLLLLLlHHHHHHHHHHhLLLLLLLEEEeELLLL-------LLHHH--HHHHH


DSSP  HHHHH-HLLLEEEEllllllhhhhhhllllllhhhhhhhlLHHHHHHHHHHHhlLHHHHL
Query ARLAE-AGVPVGFHlsdsgylhiaaawggakdpldqvlldDRAIHDTMASMIvhGVFTRH  273
ident          |   |                                              
Sbjct KYSMDsGSLPIWIH------------------------afNPLVLQDIKEIA--ELCKAF  168
DSSP  HHHHHlLLLLEEEL------------------------llLLLLHHHHHHHH--HHHHHL


DSSP  LLLLEEEElLLLL-HHHHhhhhhhhhhhhlhhhllllhhHHHH--HHEEELL-LLLL--L
Query PKLKAVSIeNGSY-FVHRlikrlkkaantqpqyfpedpvEQLR--NNVWIAP-YYED--D  327
ident ||                                     |      |       |     
Sbjct PKVPVILG-HMGGsNWMT-------------------avELAKeiQNLYLDTsAYFStfV  208
DSSP  LLLLEEEH-HHHHhHHHH-------------------hhHHHHhlLLEEEELlLLLLhhH


DSSP  HHHHHHHhLHHHLLLLLLLLLllLLLL-HHHH-HHHHllLLHHHHHHHHLHHHHHHHLll
Query LPELARViGVDKILFGSDWPHgeGLAS-PVSF-TAELkgFSESDIRKIMRDNALDLLGvq  385
ident |          |  || | |   |                          ||   ||   
Sbjct LKIVINE-LPLKCIFGTDMPF--GDLQlSIEAiKKMS--NDSYVANAVLGDNISRLLN--  261
DSSP  HHHHHHH-LLLLEELLLLLLL--LLHHhHHHHhHHHL--LLHHHHHHHHLHHHHHHHL--


DSSP  lll
Query vgs  388
ident    
Sbjct --i  262
DSSP  --l


No 9: Query=4dziC Sbjct=1gkpA Z-score=16.4

back to top
DSSP  ------------------------------------------------LLLLLEEEEEEE
Query ------------------------------------------------ALNYRVIDVDNH   12
ident                                                       ||   |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkYVFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeellllEEEELEEEEEEL


DSSP  LLLLlllllllllhhhlllleeeeelllleeeeelleelllLLLLlllleelllllhhhh
Query YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfIPNPtfdpiivpgcldllf   72
ident  | |                                                        
Sbjct IYLP-------------------------------------FMAT---------------   68
DSSP  LLLE-------------------------------------ELLE---------------


DSSP  hllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllll
Query rgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIETAFMLPtfgcgveealkhd  132
ident                                          |                  
Sbjct ----------------------faKDTHETGSKAALMGGTTTYIEMC-------------   93
DSSP  ----------------------elLLLHHHHHHHHHHLLEEEEEEEE-------------


DSSP  hhhHHHHHHHHHHHHHHHLLlllllLLEEELLLLLLLLhHHHHHHHHHHHHLLLLLEELL
Query ieaTMASVHAFNLWLDEDWGfdrpdHRIIAAPIVSLADpTRAVEEVDFVLARGAKLVLVR  192
ident                                  ||  |            | |       
Sbjct cpsRNDDALEGYQLWKSKAE-gnsyCDYTFHMAVSKFD-EKTEGQLREIVADGISSFXIF  151
DSSP  lllLLLLHHHHHHHHHHHHL-llllLEEEEEEELLLLL-LLHHHHHHHHHHLLLLEEEEE


DSSP  LLLLLlllllllllLHHHHHHHHHHHHHLLLEEEEllLLLL-HHHHHHLLL---LLLHHH
Query PAPVPglvkprslgDRSHDPVWARLAEAGVPVGFHlsDSGY-LHIAAAWGG---AKDPLD  248
ident               |           | || |  |                         
Sbjct LSYKN----ffgvdDGEMYQTLRLAKELGVIVTAHceNAELvGRLQQKLLSegkTGPEWH  207
DSSP  ELLLL----lllllHHHHHHHHHHHHHHLLEEEEEelLHHHhHHHHHHHHHlllLLHHHL


DSSP  HHHHLLHHHHHHHHHHHhlLHHHHLLlLLEEEELLLLL-HHHHHHHhhhhhhhhlhhhll
Query QVLLDDRAIHDTMASMIvhGVFTRHPkLKAVSIENGSY-FVHRLIKrlkkaantqpqyfp  307
ident              |                                              
Sbjct EPSRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCKpALDAAMA--------------  250
DSSP  LLLLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLHhHHHHHHH--------------


DSSP  llhHHHHhhHEEELL---LLLL----------------------------LHHHHHhhhL
Query edpVEQLrnNVWIAP---YYED----------------------------DLPELArviG  336
ident             |                                      |        
Sbjct -akARGV--PIYIESvipHFLLdktyaerggveamkyimspplrdkrnqkVLWDAL--aQ  305
DSSP  -hhHLLL--LEEEEEehhHHHLlhhhhhllhhhhhlllllllllllhhhhHHHHHH--hL


DSSP  HHHLLLLLLLLL------------------LLLL-lLHHHHH-HHHL---LLLHHHHHHH
Query VDKILFGSDWPH------------------GEGL-aSPVSFT-AELK---GFSESDIRKI  373
ident       | |                     |       |                     
Sbjct GFIDTVGTDHCPfdteqkllgkeaftaipnGIPAieDRVNLLyTYGVsrgRLDIHRFVDA  365
DSSP  LLLLEEELLLLLllhhhhhhhlllhhhlllLLLLllLHHHHHhHHHLlllLLLHHHHHHH


DSSP  HLHHHHHHHL--------------------------------------------------
Query MRDNALDLLG--------------------------------------------------  383
ident     |  | |                                                  
Sbjct ASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrp  425
DSSP  HLHHHHHHLLllllllllllllllleeeeelllleellhhhllllllllllllleellee


DSSP  ----------------------------lllll
Query ----------------------------vqvgs  388
ident                                  
Sbjct svvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  eeeeelleeeeelleelllllllllllllllll


No 10: Query=4dziC Sbjct=4dlfA Z-score=16.0

back to top
DSSP  lllLLEEEEEEELLLLLllllllllhhhlllleeeeelllleeeeelleelLLLLLlllL
Query alnYRVIDVDNHYYEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnHFIPNptfD   60
ident       ||   |                                         |      
Sbjct ---ALRIDSHQHFWRYR------------------------------aadyPWIGA--gM   25
DSSP  ---LLLEEEEELLLLLL------------------------------hhhlLLLLL--lL


DSSP  LEElllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELL
Query PIIvpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPT  120
ident                                         ||    |  |          
Sbjct GVL-------------------------------ardYLPDALHPLMHAQALGASIAVQA   54
DSSP  HHH-------------------------------lllLLHHHHHHHHHHLLLLEEEEELL


DSSP  HHhhhhhhllllhhhhhhhHHHHHHHHHHHLlllLLLLLE-EELLLLLLLlHHHHHHHHH
Query FGcgveealkhdieatmasVHAFNLWLDEDWgfdRPDHRI-IAAPIVSLAdPTRAVEEVD  179
ident                           | |         ||        |       | | 
Sbjct RA-----------------GRDETAFLLELA---CDEARIaAVVGWEDLR-APQLAERVA   93
DSSP  LL-----------------LHHHHHHHHHHH---LLLLLEeEEEELLLLL-LLLHHHHHH


DSSP  HhHHLL-LLLEELLLLllllllllLLLLLHHHHHHHHHHHHHLLLEEEELlllllhhhhh
Query FvLARG-AKLVLVRPApvpglvkpRSLGDRSHDPVWARLAEAGVPVGFHLsdsgylhiaa  238
ident                             |       | |                     
Sbjct E-WRGTkLRGFRHQLQ--deadvrAFVDDADFARGVAWLQANDYVYDVLV----------  140
DSSP  L-LLLLlEEEEEELHH--hlllhhHHHHLHHHHHHHHHHHHLLLEEEELL----------


DSSP  hllllllhhhhhhhLLHHhHHHHHHHHhllhhHHLLLLLEEEEL-LLLL-----------
Query awggakdpldqvllDDRAiHDTMASMIvhgvfTRHPKLKAVSIE-NGSY-----------  286
ident                 |                ||     |                   
Sbjct --------------FERQ-LPDVQAFC-----ARHDAHWLVLDHaGKPAlaefdrddtal  180
DSSP  --------------LHHH-HHHHHHHH-----HHLLLLLEEEHHhHLLLhhhllllllhh


DSSP  -hHHHHHhhhhhhhhhlhhhllllHHHHhhHHEEELL-------------------lLLL
Query -fVHRLIkrlkkaantqpqyfpedPVEQlrNNVWIAP-------------------yYED  326
ident                                 |                         | 
Sbjct arWRAAL---------------reLAAL--PHVVCKLsglvteadwrrglrasdlrhIEQ  223
DSSP  hhHHHHH---------------hhHHLL--LLEEEEEllllllllllllllhhhhhhHHH


DSSP  LHHHHHHHHLHHHLLLLLLLLLLL---lLLLHHH-HHHHHL-LLLHHHHHHHHLHHHHHH
Query DLPELARVIGVDKILFGSDWPHGE---gLASPVS-FTAELK-GFSESDIRKIMRDNALDL  381
ident  |       |     ||||||            |          |           |   
Sbjct CLDAALDAFGPQRLMFGSDWPVCLlaasYDEVASlVERWAEsRLSAAERSALWGGTAARC  283
DSSP  HHHHHHHHHLHHHEEELLLLLHHHhlllHHHHHHhHHHHHHhHLLHHHHHHHLLHHHHHH


DSSP  HLlllll
Query LGvqvgs  388
ident        
Sbjct YA---lp  287
DSSP  LL---ll


No 11: Query=4dziC Sbjct=1itqA Z-score=15.5

back to top
DSSP  -------LLLL---LEEEEEEEL--LLLLllllllllhhhlllleeeeelllleeeeell
Query -------ALNY---RVIDVDNHY--YEPLdsftrhldkkfkrrgvqmlsdgkrtwavigd   48
ident                |||  |                                       
Sbjct dffrdeaERIMrdsPVIDGHNDLpwQLLD-------------------------------   29
DSSP  lhhhhhhHHHHlllLEEEEEELHhhHHHH-------------------------------


DSSP  eellllllLLLLleelllllhhhhhllllllllhhhllleELHH--HLHHHllhhhHHHH
Query rvnhfipnPTFDpiivpgcldllfrgeipdgvdpaslmkvERLA--DHPEYqnrdaRIAV  106
ident                                         ||               |  
Sbjct ------mfNNRL--------------------------qdERANltTLAGT---htNIPK   54
DSSP  ------hhLLLL--------------------------llHHHLllLLLLL---llLHHH


DSSP  HHHHLEEEEEEELlhHHHHHhhllllhhhHHHHHHHHHHHHHHHLL-------llLLLL-
Query MDEQDIETAFMLPtfGCGVEealkhdieaTMASVHAFNLWLDEDWG-------fdRPDH-  158
ident          |                            |                     
Sbjct LRAGFVGGQFWSV--YTPCD--------tQNKDAVRRTLEQMDVVHrmcrmypetFLYVt  104
DSSP  HHHLLEEEEEEEE--LLLHH--------hLLLLHHHHHHHHHHHHHhhhhhllllEEELl


DSSP  --------------LEEELL----LLLLllhhhHHHHHHHHHHLLLLLEELLL-LLLLL-
Query --------------RIIAAP----IVSLadptrAVEEVDFVLARGAKLVLVRP-APVPG-  198
ident                                             |            |  
Sbjct ssagirqafregkvASLIGVegghSIDS-----SLGVLRALYQLGMRYLTLTHsCNTPWa  159
DSSP  lhhhhhhhhhllleEEEEEEelhhHLLL-----LHHHHHHHHHLLEEEEELLLlLLLLLl


DSSP  ---------lllLLLLLLHHHHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhh
Query ---------lvkPRSLGDRSHDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldq  249
ident                        |   |   ||                           
Sbjct dnwlvdtgdsepQSQGLSPFGQRVVKELNRLGVLIDLAH---------------------  198
DSSP  llhhhlllllllLLLLLLHHHHHHHHHHHHHLLEEELLL---------------------


DSSP  hhhllhhhhhHHHHHHhlLHHHHLlLLLEEEELLLLL--------HHHHHhhhhhhhhhh
Query vllddraihdTMASMIvhGVFTRHpKLKAVSIENGSY--------FVHRLikrlkkaant  301
ident             | |                     |                       
Sbjct ---------vSVATMK--ATLQLS-RAPVIFSHSSAYsvcasrrnVPDDV----------  236
DSSP  ---------lLHHHHH--HHHHHL-LLLLEELLLLLLllllllllLLHHH----------


DSSP  lhhhllllhhHHHHHH-EEELLL----------------LLLLHHHHHHHHLHHHLLLLL
Query qpqyfpedpvEQLRNN-VWIAPY----------------YEDDLPELARVIGVDKILFGS  344
ident                                          | |     | |     || 
Sbjct ---------lRLVKQTdSLVMVNfynnyisctnkanlsqVADHLDHIKEVAGARAVGFGG  287
DSSP  ---------hHHHHHHlLEEEELllhhhhlllllllhhhHHHHHHHHHHHLLHHHEEELL


DSSP  LLL-LLLL---LLLH---HHHHHHHL--LLLHHHHHHHHLHHHHHHHLL-----------
Query DWP-HGEG---LASP---VSFTAELK--GFSESDIRKIMRDNALDLLGV-----------  384
ident |          |          |||      |        || |                
Sbjct DFDgVPRVpegLEDVskyPDLIAELLrrNWTEAEVKGALADNLLRVFEAveqasnltqap  347
DSSP  LLLlLLLLlllLLLLllhHHHHHHHHhlLLLHHHHHHHHLHHHHHHHHHhhhllllllll


DSSP  ------------------llll
Query ------------------qvgs  388
ident                       
Sbjct eeepipldqlggscrthygyss  369
DSSP  llllllhhhlllllllllllll


No 12: Query=4dziC Sbjct=4b3zD Z-score=15.4

back to top
DSSP  -------------------------------------------------LLLLLEEEEEE
Query -------------------------------------------------ALNYRVIDVDN   11
ident                                                        |||  
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrMVIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeellllEEEELEEEEEE


DSSP  ELLLllllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhh
Query HYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldll   71
ident                                                             
Sbjct YLQK--------------------------------------------------------   64
DSSP  LLLL--------------------------------------------------------


DSSP  hhllllllllhhhllleelhhHLHHhlLHHHHHHHHHHHLEEEEEEELlhhhhhhhhlll
Query frgeipdgvdpaslmkverlaDHPEyqNRDARIAVMDEQDIETAFMLPtfgcgveealkh  131
ident                                                             
Sbjct ---------------------TAAD--DFFQGTRAALVGGTTMIIDHV------------   89
DSSP  ---------------------LLLL--LHHHHHHHHHHLLEEEEEEEE------------


DSSP  lhhHHHHHHHHHHHHHHHHLllllllLLEEELLLLLLLLhHHHHHHHHHHHH-LLLLLEE
Query dieATMASVHAFNLWLDEDWgfdrpdHRIIAAPIVSLADpTRAVEEVDFVLA-RGAKLVL  190
ident        |         |                          ||        |     
Sbjct -vpEPGSSLLTSFEKWHEAA-dtkscCDYSLHVDITSWY-DGVREELEVLVQdKGVNSFQ  146
DSSP  -llLLLLLHHHHHHHHHHHH-hllllLEEEEEEELLLLL-LLHHHHHHHHHHlLLLLEEE


DSSP  LLL-----LLLLlllllllllLHHHHHHHHHHHHHLLLEEEELLLLL-LHHHHHHLLL--
Query VRP-----APVPglvkprslgDRSHDPVWARLAEAGVPVGFHLSDSG-YLHIAAAWGG--  242
ident |                    |         |   |     |                  
Sbjct VYMaykdvYQMS---------DSQLYEAFTFLKGLGAVILVHAENGDlIAQEQKRILEmg  197
DSSP  EELlllllLLLL---------HHHHHHHHHHHHHHLLEEEEELLLHHhHHHHHHHHHHll


DSSP  -LLLHHHHHHHLLHHHHHHHHHHHhlLHHHHLLlLLEEEELLLL-LHHHHHHHhhhhhhh
Query -AKDPLDQVLLDDRAIHDTMASMIvhGVFTRHPkLKAVSIENGS-YFVHRLIKrlkkaan  300
ident                        |      |            |                
Sbjct iTGPEGHALSRPEELEAEAVFRAI--TIAGRIN-CPVYITKVMSkSAADIIAL-------  247
DSSP  lLLLHHHHHHLLHHHHHHHHHHHH--HHHHHHL-LLEEEEEELLhHHHHHHHH-------


DSSP  hlhhhllllHHHHhhhHEEELL---LLLL-------------------------------
Query tqpqyfpedPVEQlrnNVWIAP---YYED-------------------------------  326
ident                  |   |                                      
Sbjct -------arKKGP---LVFGEPiaaSLGTdgthywsknwakaaafvtspplspdpttpdy  297
DSSP  -------hhHHLL---LEEEEElhhHHHLllhhhhlllhhhhhhllllllllllllhhhh


DSSP  LHHHHHHHHlhhHLLLLLLLLL------------------LLLL-lLHHH-HHHHHL---
Query DLPELARVIgvdKILFGSDWPH------------------GEGL-aSPVS-FTAELK---  363
ident     ||          ||                      |                   
Sbjct LTSLLACGD---LQVTGSGHCPystaqkavgkdnftlipeGVNGieERMTvVWDKAVatg  354
DSSP  HHHHHHHLL---LLLLLLLLLLllhhhhhhhlllhhhlllLLLLllLHHHhHHHHHLlll


DSSP  LLLHHHHHHHHLHHHHHHHL----------------------------------------
Query GFSESDIRKIMRDNALDLLG----------------------------------------  383
ident    |         ||                                             
Sbjct KMDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitakshksaveyni  414
DSSP  LLLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeellllllllllllll


DSSP  --------------------------------------------LLLL------------
Query --------------------------------------------VQVG------------  387
ident                                                             
Sbjct fegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehLYQRvkirnkvfglqg  474
DSSP  lllleeeeeeeeeeelleeeeelleellllllllllllllllhhHHHHhhhhhhhlllll


DSSP  --l
Query --s  388
ident    
Sbjct vsr  477
DSSP  lll


No 13: Query=4dziC Sbjct=2ffiA Z-score=15.1

back to top
DSSP  lllLLEEEEEEELLLLLLlllllllhhhlllleeeeellllEEEEelleeLLLLllLLLL
Query alnYRVIDVDNHYYEPLDsftrhldkkfkrrgvqmlsdgkrTWAVigdrvNHFIpnPTFD   60
ident       ||   |                                            |  |
Sbjct -lhLTAIDSHAHVFSRGL----------------------nLASQ-----RRYA--PNYD   30
DSSP  -llLLLEELLLLLLLHHH----------------------hHHLL-----LLLL--LLLL


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHhHHHHHHHHHLEEEEEEE-L
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdARIAVMDEQDIETAFML-P  119
ident                                                            |
Sbjct ------------------------------------APLG-DYLGQLRAHGFSHGVLVqP   53
DSSP  ------------------------------------LLHH-HHHHHHHHLLLLEELLLlL


DSSP  LHHHhhhhhllllhhhhhhhhhhHHHHHHHHLLllLLLLLEEELLLLLLllhhhHHHHhH
Query TFGCgveealkhdieatmasvhaFNLWLDEDWGfdRPDHRIIAAPIVSLadptrAVEEvD  179
ident  |                      |  |                           ||   
Sbjct SFLG------------------tDNRYLLSALQ--TVPGQLRGVVXLER-----DVEQ-A   87
DSSP  HHHL------------------lLLHHHHHHHH--HLLLLLLLLLLLLL-----LLLH-H


DSSP  HHHHLL---LLLEELLL--LLLLllllllLLLLHHHHHHHHHHHHHLLLEEEELlllllh
Query FVLARG---AKLVLVRP--APVPglvkprSLGDRSHDPVWARLAEAGVPVGFHLsdsgyl  234
ident             |         |       |      |   |  | |  |  |       
Sbjct TLAEXArlgVRGVRLNLxgQDXP------DLTGAQWRPLLERIGEQGWHVELHR------  135
DSSP  HHHHHHlllLLEEELLLllLLLL------LLLLLLLHHHHHHHHHHLLEEEELL------


DSSP  hhhhhllllllhhhhhhhLLHHHHHHHHHHhhLLHHhhlllLLEEEELlLLLH-------
Query hiaaawggakdpldqvllDDRAIHDTMASMivHGVFtrhpkLKAVSIEnGSYF-------  287
ident                       |                  |  |               
Sbjct ------------------QVADIPVLVRAL--QPYG-----LDIVIDH-FGRPdarrglg  169
DSSP  ------------------LLLLHHHHHHHH--LLLL-----LLEEELH-HHLLlllllll


DSSP  ------HHHHHhhhhhhhhhlhhhllllhhhhHHHHEEELLL---------------LLL
Query ------VHRLIkrlkkaantqpqyfpedpveqLRNNVWIAPY---------------YED  326
ident          |                       |  ||                      
Sbjct qpgfaeLLTLS---------------------GRGKVWVKVSgiyrlqgspeenlafARQ  208
DSSP  lllhhhHLLLL---------------------LLLLEEEEEElhhhllllhhhhhhhHHH


DSSP  LHHHHHHHHLHHHLLLLLLLLLL-----LLLLLHH-HHHHHHllLLHHHHHHHHLHHHHH
Query DLPELARVIGVDKILFGSDWPHG-----EGLASPV-SFTAELkgFSESDIRKIMRDNALD  380
ident  |  |    |      ||||||          | |  | |     |         | |  
Sbjct ALCALEAHYGAERLXWGSDWPHTqheseVSFGSAVeQFEALG--CSAQLRQALLLDTARA  266
DSSP  HHHHHHHHLLHHHEEEELLLLLLlllllLLHHHHHhHHHHHL--LLHHHHHHHHLHHHHH


DSSP  HHLlllll
Query LLGvqvgs  388
ident | |     
Sbjct LFG-fele  273
DSSP  HLL-llll


No 14: Query=4dziC Sbjct=4mupB Z-score=13.9

back to top
DSSP  ----------LLLL--LEEEEEEELLLLlLLLLllllhhhlllleeeeelllleeeeell
Query ----------ALNY--RVIDVDNHYYEPlDSFTrhldkkfkrrgvqmlsdgkrtwavigd   48
ident                    |   | | |                                
Sbjct lvrklsgtapNPAFprGAVDTQMHMYLP-GYPA---------------------------   32
DSSP  llllllllllLLLLllLLEELLLLLLLL-LLLL---------------------------


DSSP  eeLLLLllLLLLLeelllllhhhhhllllllllhhhllleelhhhLHHHllHHHHHHHHH
Query rvNHFIpnPTFDPiivpgcldllfrgeipdgvdpaslmkverladHPEYqnRDARIAVMD  108
ident                                                           | 
Sbjct -lPGGP--GLPPG--------------------------------ALPG--PEDYRRLMQ   55
DSSP  -lLLLL--LLLLL--------------------------------LLLL--HHHHHHHHH


DSSP  HHLEEEEEEE-LLHHHhhhhhllllhhhhhhhhhhHHHHHHHHLLllllLLLEEELLLLL
Query EQDIETAFML-PTFGCgveealkhdieatmasvhaFNLWLDEDWGfdrpDHRIIAAPIVS  167
ident    |                                |                 |  |  
Sbjct WLGIDRVIITqGNAHQ------------------rDNGNTLACVA--emGEAAHAVVIID   95
DSSP  HHLLLEEEEElLHHHL------------------lLLHHHHHHHH--hhHHHEEEEELLL


DSSP  LllhhHHHH-HHHHHHHLLLLLEELL-------LLLLlllllllllllhhhHHHHHHHHH
Query LadptRAVE-EVDFVLARGAKLVLVR-------PAPVpglvkprslgdrshDPVWARLAE  219
ident         |       | |                                | |  |   
Sbjct A----TTTEkDMEKLTAAGTVGARIMdlpggavNLSE-------------lDAVDERAHA  138
DSSP  L----LLLHhHHHHHHHLLEEEEEEElllllllLHHH-------------hHHHHHHHHH


DSSP  HLLLEEEELlllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHHHllhhhhllLLLEE
Query AGVPVGFHLsdsgylhiaaawggakdpldqvllDDRAIHDTMASMIVhgvftrhpKLKAV  279
ident |   |                            |     |                   |
Sbjct ADWMVAVQF------------------------DGNGLLDHLPRLQK-------iRSRWV  167
DSSP  LLLEEEEEL------------------------LHHHHHHHHHHHHL-------lLLEEE


DSSP  EELlLLLH---------hHHHHhhhhhhhhhlhhhllllhHHHHH-HHEEELL-------
Query SIEnGSYF---------vHRLIkrlkkaantqpqyfpedpVEQLR-NNVWIAP-------  322
ident        |                                       | |          
Sbjct FDH-HGKFfkgirtdgpeMAAL------------------LKLIDrGNLWFKFagvyess  208
DSSP  ELH-HHHLllllllllhhHHHH------------------HHHHHhLLEEEEEllhhhll


DSSP  -------llLLLHHHHHHHhLHHHLLLLLLLLLLL-----llLLHH-HHHHHHLL-LLHH
Query -------yyEDDLPELARViGVDKILFGSDWPHGE-----glASPV-SFTAELKG-FSES  368
ident                 |       |  |  |||                   |     | 
Sbjct rkswpyadvAAFSRVIAAH-APERIVWGTNWPHNSvretaayPDDArLAELTLGWlPDEA  267
DSSP  llllllhhhHHHHHHHHHH-LHHHEEELLLLLLLLlllhhhlLLHHhHHHHHHLLlLLHH


DSSP  HHHHHHLHHHHHHHLlllll
Query DIRKIMRDNALDLLGvqvgs  388
ident         |   |       
Sbjct ARHRALVENPEALFK-lspv  286
DSSP  HHHHHHLHHHHHHHL-llll


No 15: Query=4dziC Sbjct=3griA Z-score=13.7

back to top
DSSP  ------------------------------------------------LLLLLEEEEEEE
Query ------------------------------------------------ALNYRVIDVDNH   12
ident                                                        ||  |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghFVSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeellllEEEELEEEEEEL


DSSP  -LLLLlllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhh
Query -YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldll   71
ident                                                             
Sbjct lREPG-------------------------------------------------------   65
DSSP  lLLLL-------------------------------------------------------


DSSP  hhllllllllhhhllleelhhhLHHHllHHHHHHHHHHHLEEEEEEELLHHhhhhhhlll
Query frgeipdgvdpaslmkverladHPEYqnRDARIAVMDEQDIETAFMLPTFGcgveealkh  131
ident                         |                 |    |            
Sbjct --------------------geYKET--IETGTKAAARGGFTTVCPXPNTR---------   94
DSSP  --------------------llLLLL--HHHHHHHHHHLLEEEEEELLLLL---------


DSSP  lhhhhhhhHHHHHHHHHHHLllllllLLEEELLLLL---LLLHhhhHHHHHHHHHLLLLL
Query dieatmasVHAFNLWLDEDWgfdrpdHRIIAAPIVS---LADPtraVEEVDFVLARGAKL  188
ident                |           |           |                ||  
Sbjct ----pvpdSVEHFEALQKLI-ddnaqVRVLPYASITtrqLGKE---LVDFPALVKEGAFA  146
DSSP  ----llllLHHHHHHHHHHH-hhhllLEELLLEELLhhhLLLL---LLLHHHHHLLLLLL


DSSP  EELLlLLLLlllllllllLHHH-HHHHHHHHHHLLLEEEELllLLLHHHHhhllllllhh
Query VLVRpAPVPglvkprslgDRSH-DPVWARLAEAGVPVGFHLsdSGYLHIAaawggakdpl  247
ident        |            |         |        |                    
Sbjct FTDDgVGVQ---------TASXxYEGXIEAAKVNKAIVAHCedNSLIYGG----------  187
DSSP  EEELlLLLL---------LHHHhHHHHHHHHHHLLLEEELLllHHHLLLL----------


DSSP  HHHH-----------HLLHHHHHHHHHHHhlLHHHHLLlLLEEEElLLLL--HHHHHHHh
Query DQVL-----------LDDRAIHDTMASMIvhGVFTRHPkLKAVSIeNGSY--FVHRLIKr  294
ident                          |                      |    |      
Sbjct AXHEgkrskelgipgIPNICESVQIARDV--LLAEAAG-CHYHVC-HVSTkeSVRVIRD-  242
DSSP  LEELlhhhhhhllleELLHHHHHHHHHHH--HHHHHHL-LLEEEL-LLLLhhHHHHHHH-


DSSP  hhhhhhhlhhhllllhHHHHhhHEEELLL-LLLL--------------------------
Query lkkaantqpqyfpedpVEQLrnNVWIAPY-YEDD--------------------------  327
ident                        |                                    
Sbjct --------------akRAGI--HVTAEVTpHHLLlteddipgnnaiykxnpplrstedre  286
DSSP  --------------hhHLLL--LEEEEELhHHHHllhhhlllllhhhllllllllhhhhh


DSSP  -HHHH-HHHHlhhHLLLLLLLLL---------------LLLL-lLHHHHH-HHHL---LL
Query -LPEL-ARVIgvdKILFGSDWPH---------------GEGL-aSPVSFT-AELK---GF  365
ident  | |               |                  |                     
Sbjct aLLEGlLDGT---IDCIATDHAPhardekaqpxekapfGIVGseTAFPLLyTHFVkngDW  343
DSSP  hHHHHhHLLL---LLEELLLLLLllhhhhlllllllllLLLLllLHHHHHhHHHLlllLL


DSSP  LHHHHHHHHLHHHHHHHL------------------------------------------
Query SESDIRKIMRDNALDLLG------------------------------------------  383
ident                                                             
Sbjct TLQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigy  403
DSSP  LHHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhlllllllllllll


DSSP  --------------lllll
Query --------------vqvgs  388
ident                    
Sbjct kvygnpiltxvegevkfeg  422
DSSP  eelleeeeeeelleeeeel


No 16: Query=4dziC Sbjct=3e74A Z-score=13.7

back to top
DSSP  ------------------------------------------------LLLLLEEEEEEE
Query ------------------------------------------------ALNYRVIDVDNH   12
ident                                                        |   |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEELEEEEEEL


DSSP  Lllllllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhhh
Query Yyepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllf   72
ident                                                             
Sbjct I-----------------------------------------------------------   61
DSSP  L-----------------------------------------------------------


DSSP  hllllllllhhhllleelhhhlhhhlLHHHHHHHHHHHLEEEEEEELLHHhhhhhhllll
Query rgeipdgvdpaslmkverladhpeyqNRDARIAVMDEQDIETAFMLPTFGcgveealkhd  132
ident                                        | |    |             
Sbjct --------------------------GYETGTRAAAKGGITTXIEXPLNQ----------   85
DSSP  --------------------------LHHHHHHHHHHLLEEEEEELLLLL----------


DSSP  hhhhhhhHHHHHHHHHHHLlllllllLEEELLLLLLLlhhhHHHHHHHHHHLLLLLEELL
Query ieatmasVHAFNLWLDEDWgfdrpdhRIIAAPIVSLAdptrAVEEVDFVLARGAKLVLVR  192
ident          |                                          |       
Sbjct --lpatvDRASIELKFDAA-kgkltiDAAQLGGLVSY----NIDRLHELDEVGVVGFXCF  138
DSSP  --lllllLHHHHHHHHHHH-llllllEEEELEELLLL----LLLLHHHHHHHLLLLEEEE


DSSP  LlllllllllllllLHHH-HHHHHHHHHHLLLEEEELLLLLL-HHHHHHLLL---lLLHH
Query PapvpglvkprslgDRSH-DPVWARLAEAGVPVGFHLSDSGY-LHIAAAWGG---aKDPL  247
ident                          | | | ||  |                        
Sbjct V----------rdvNDWQfFKGAQKLGELGQPVLVHCENALIcDELGEEAKRegrvTAHD  188
DSSP  L----------lllLHHHhHHHHHHHHHHLLLEEEELLLHHHhHHHHHHHHHhlllLHHH


DSSP  HHHHHLLHHHHHHHHHHHHlLHHHHLllLLEEEELLLLL-HHHHHHhhhhhhhhhlhhhl
Query DQVLLDDRAIHDTMASMIVhGVFTRHpkLKAVSIENGSY-FVHRLIkrlkkaantqpqyf  306
ident                                      |   |                  
Sbjct YVASRPVFTEVEAIRRVLY-LAKVAG--CRLHVCHVSSPeGVEEVT--------------  231
DSSP  HHHLLLHHHHHHHHHHHHH-HHHHHL--LLEEELLLLLHhHHHHHH--------------


DSSP  lllHHHHhhhHEEELLLLLL-----------------------------LHHHHHHHHlh
Query pedPVEQlrnNVWIAPYYED-----------------------------DLPELARVIgv  337
ident       |                                              |      
Sbjct rarQEGQ---DITCESCPHYfvldtdqfeeigtlakcsppirdlenqkgXWEKLFNGE--  286
DSSP  hhhHLLL---LEEEEELLHHhhllhhhhhhhlhhhllllllllhhhhhhHHHHHHLLL--


DSSP  hHLLLLLLLLL---------------LLLL-LLHH-HHHHHHL---LLLHHHHHHHHLHH
Query dKILFGSDWPH---------------GEGL-ASPV-SFTAELK---GFSESDIRKIMRDN  377
ident       ||                  |     |       |     | |     |    |
Sbjct -IDCLVSDHSPcppexkagnixkawgGIAGlQSCXdVXFDEAVqkrGXSLPXFGKLXATN  345
DSSP  -LLEELLLLLLlllllllllllllllLLLLhHHHHhHHHHHHLlllLLLHHHHHHHHLHH


DSSP  HHHHHL------------------------------------------------------
Query ALDLLG------------------------------------------------------  383
ident | |  |                                                      
Sbjct AADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktil  405
DSSP  HHHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeee


DSSP  -------------------lllll
Query -------------------vqvgs  388
ident                         
Sbjct rgdviydieqgfpvapkgqfilkh  429
DSSP  lleeeeelllllllllllleelll


No 17: Query=4dziC Sbjct=3pnuA Z-score=13.6

back to top
DSSP  ---------LLLLLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleel
Query ---------ALNYRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvn   51
ident                 |   |                                       
Sbjct enlyfqsnaMKLKNPLDMHLHLRD------------------------------------   24
DSSP  lllllllllEEEELLEEEEELLLL------------------------------------


DSSP  lllllllllleelllllhhhhhllllllllhhhllleelhhhLHHHllhHHHHHHHHHhL
Query hfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladHPEYqnrDARIAVMDEqD  111
ident                                                            |
Sbjct ------------------------------------------NQML---ELIAPLSAR-D   38
DSSP  ------------------------------------------HHHH---HHHHHHHHL-L


DSSP  EEEEEEELLHHhhhhhhllllhhhhhhhhhhHHHHHHHHL-----lllllLLLEEELLLL
Query IETAFMLPTFGcgveealkhdieatmasvhaFNLWLDEDW-----gfdrpDHRIIAAPIV  166
ident    |   |                           |                        
Sbjct FCAAVIMPNLI----------------pplcNLEDLKAYKmrilkackdeNFTPLMTLFF   82
DSSP  LLEEEELLLLL----------------llllLHHHHHHHHhhhhhhhlllLLEEEEEEEL


DSSP  LLllhhhHHHHHHHHHhLLLLLEELLL---------LLLLlllllllLLLHHHHHHHHHH
Query SLadptrAVEEVDFVLaRGAKLVLVRP---------APVPglvkprsLGDRSHDPVWARL  217
ident                           |                           |     
Sbjct KN----yDEKFLYSAK-DEIFGIXLYPagittnsngGVSS-------FDIEYLKPTLEAM  130
DSSP  LL----lLHHHHHHHL-LLLLEEEELLlllllllllLLLL-------LLHHHHHHHHHHH


DSSP  HHHLLLEEEELllLLLHhhhhhllllllhhhhHHHLLHHHHHHHHHHHhLLHHhhllLLL
Query AEAGVPVGFHLsdSGYLhiaaawggakdpldqVLLDDRAIHDTMASMIvHGVFtrhpKLK  277
ident      |   |                      |                         ||
Sbjct SDLNIPLLVHG-eTNDF---------------VMDRESNFAKIYEKLA-KHFP----RLK  169
DSSP  HHLLLLEEELL-lLLLL---------------HHHLLHHHHHHHHHHH-HHLL----LLL


DSSP  EEEElLLLL-HHHHHhhhhhhhhhhlhhhllllhHHHHhhHEEELLLLLL----------
Query AVSIeNGSY-FVHRLikrlkkaantqpqyfpedpVEQLrnNVWIAPYYED----------  326
ident  |            |                         |                   
Sbjct IVME-HITTkTLCEL------------------lKDYE--NLYATITLHHliitlddvig  208
DSSP  EEEL-LLLLhHHHHH------------------hHHLL--LEEEEELLHHhlllhhhhhl


DSSP  --------------------LHHHHHhhhlHHHLLLLLLLLL-------LLLL-LLHH-H
Query --------------------DLPELArvigVDKILFGSDWPH-------GEGL-ASPV-S  357
ident                      | |||      |  ||||          |          
Sbjct gkmnphlfckpiakryedkeALCELA-fsgYEKVMFGSDSAPhpkgcaaGVFSaPVILpV  267
DSSP  llllhhhllllllllhhhhhHHHHHH-hllLLLEEELLLLLLlllllllLLLLhHHHHhH


DSSP  HHHHHL-LLLHHHHHHHHLHHHHHHHL---------------------------------
Query FTAELK-GFSESDIRKIMRDNALDLLG---------------------------------  383
ident      |   ||    |   ||                                       
Sbjct LAELFKqNSSEENLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpym  327
DSSP  HHHHHHhHLLHHHHHHHHLHHHHHHHLllllllleeeeellleelllleelllleellll


DSSP  ------lllll
Query ------vqvgs  388
ident            
Sbjct ageilkfqlkh  338
DSSP  llleelleell


No 18: Query=4dziC Sbjct=2qpxA Z-score=13.6

back to top
DSSP  --------LLLLLEEEEEEELLLLlllllllllhhhlllleeeeelllleeeeelleell
Query --------ALNYRVIDVDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnh   52
ident                |   |                                        
Sbjct gxddlsefVDQVPLLDHHCHFLID------------------------------------   24
DSSP  lllllhhhHHHLLEEEEEELLLLL------------------------------------


DSSP  lllllllLLEEL-lLLLHhhhhllllllLLHHHLL-------------------leeLHH
Query fipnptfDPIIV-pGCLDllfrgeipdgVDPASLM-------------------kveRLA   92
ident                                |                           |
Sbjct --gkvpnRDDRLaqVSTE------adkdYPLADTKnrlayhgflalakefaldannpLAA   76
DSSP  --lllllHHHHHhhHLLL------llllLLHHHHLllhhhhhhhhhhhhhlllllllLLL


DSSP  HlhhhllhHHHHHHHHHHLEEEEEE-ELLHhhhhhhhllllhhhhhhhhhhhhhhhhHHL
Query DhpeyqnrDARIAVMDEQDIETAFM-LPTFgcgveealkhdieatmasvhafnlwldEDW  151
ident                                                           | 
Sbjct X-ndpgyaTYNHRIFGHFHFKELLIdTGFV----------------------pddpiLDL  113
DSSP  L-lhhhhhHHHHHHHHHLLEEEEEEeLLLL----------------------lllllLLH


DSSP  L--lllllLLEEELLLLL-------------llLHHHHHHHHHHHHHLLLLLEELL-LLL
Query G--fdrpdHRIIAAPIVS-------------laDPTRAVEEVDFVLARGAKLVLVR-PAP  195
ident             |                            |    | |           
Sbjct DqtaelvgIPVKAIYRLEthaedfxlehdnfaaWWQAFSNDVKQAKAHGFVGFXSIaAYR  173
DSSP  HhhhhhhlLLEEEEEEHHhhhhhhhlllllhhhHHHHHHHHHHLLLLLLLLLEEELhHHH


DSSP  L----------lLLLL--------------LLLLlLHHHHHHHHHHHHHLLLEEEEL---
Query V----------pGLVK--------------PRSLgDRSHDPVWARLAEAGVPVGFHL---  228
ident |                                  |     |         |  ||    
Sbjct VglhlepvnvieAAAGfdtwkhsgekrltsKPLI-DYXLYHVAPFIIAQDXPLQFHVgyg  232
DSSP  LllllllllhhhHHHHhhhhhhhlllllllHHHH-HHHHHHHHHHHHHHLLLEEEEElll


DSSP  -lLLLLhhhhhhllllllhhhhhhhllHHHHhhHHHHHhlLHHHHL--LLLLEEEELLL-
Query -sDSGYlhiaaawggakdpldqvllddRAIHdtMASMIvhGVFTRH--PKLKAVSIENG-  284
ident   |                                               || |      
Sbjct daDTDX---------------------YLGN--PLLXR--DYLKAFtkKGLKVVLLHCYp  267
DSSP  llLLLH---------------------HHLL--HHHHH--HHHHHHhhHLLLEEEEELLl


DSSP  -LLHHhhhhhhhhhhhhhlhhhllllhHHHHhhHEEELLL---------LLLLHHHHHHH
Query -SYFVhrlikrlkkaantqpqyfpedpVEQLrnNVWIAPY---------YEDDLPELARV  334
ident                                  |                     |    
Sbjct yHREA------------------gylaSVFP--NLYFDISlldnlgpsgASRVFNEAVEL  307
DSSP  lHHHH------------------hhhhHHLL--LEEEELLlhhhhlhhhHHHHHHHHLLL


DSSP  HLHHHLLLLLLLLL-llLLLLHHH-HHHHHLLL-----------LHHHHHHHHLHHHHHH
Query IGVDKILFGSDWPH-geGLASPVS-FTAELKGF-----------SESDIRKIMRDNALDL  381
ident      ||| ||              |   |                  |  |       |
Sbjct APYTRILFASDASTypeXYGLAARqFKQALVAHfnqlpfvdlaqKKAWINAICWQTSAKL  367
DSSP  LLHHHEELLLLLLLlhhHHHHHHHhHHHHHHHHhhllllllhhhHHHHHHHHHLHHHHHH


DSSP  HL--lllll
Query LG--vqvgs  388
ident          
Sbjct YHqerelrv  376
DSSP  LLlhhhhll


No 19: Query=4dziC Sbjct=2vunA Z-score=13.5

back to top
DSSP  --------------------------------------------------------LLLL
Query --------------------------------------------------------ALNY    4
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagsTVTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeellllEEEE


DSSP  LEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllllleel
Query RVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiiv   64
ident    |   |                                                    
Sbjct GLLDTHVHVSG-------------------------------------------------   71
DSSP  LEEEEEELLLL-------------------------------------------------


DSSP  llllhhhhhllllllllhhhllleelhhHLHHhllhhhHHHHHHHHLEEEEEEE-LLHHH
Query pgcldllfrgeipdgvdpaslmkverlaDHPEyqnrdaRIAVMDEQDIETAFML-PTFGC  123
ident                                        |         |          
Sbjct ---------------------gdyaprqKTMD------FISSALHGGVTTMISAgSPHFP  104
DSSP  ---------------------lleehhhLEEL------HHHHHHLLLEEEEEELlLLLLL


DSSP  HHhhhllllhhhHHHHHHHHHHHHHHHLL-llllLLLEEE-LLLLlLLLHhhHHHHHHHH
Query GVeealkhdieaTMASVHAFNLWLDEDWG-fdrpDHRIIA-APIVsLADPtrAVEEVDFV  181
ident |             |   |    |                 | |          |     
Sbjct GR--------pkDAAGTKALAITLSKSYYnarpaGVKVHGgAVIL-EKGL--TEEDFIEM  153
DSSP  LL--------llLHHHHHHHHHHHHHHHHhllhhHLEEELlEELL-LLLL--LHHHHHHH


DSSP  HHLLLLLE-ELLLllllllllllLLLLhhhHHHHHHHHHHLLLEEEELllLLLHHhhhhl
Query LARGAKLV-LVRPapvpglvkprSLGDrshDPVWARLAEAGVPVGFHLsdSGYLHiaaaw  240
ident    |   |  |               |    |        |  |  |             
Sbjct KKEGVWIVgEVGL------gtikNPED--aAPMVEWAHKHGFKVQMHTggTSIPG-----  200
DSSP  HHLLLLEEeEELL------llllLHHH--hHHHHHHHHHLLLEEEEELllLLLLL-----


DSSP  lllllhhhhhhhllHHHHHHHHHHhhllhhhhllllLEEEELLL-------llHHHHHhh
Query ggakdpldqvllddRAIHDTMASMivhgvftrhpklKAVSIENG-------syFVHRLik  293
ident                   |                   |               | |   
Sbjct ------------ssTVTADDVIKT-----------kPDVVSHINggptaisvqEVDRI--  235
DSSP  ------------llLLLHHHHHHH-----------lLLEEELLLlllllllhhHHHHH--


DSSP  hhhhhhhhlhhhllllhhHHHHhhEEELL---LLLL----LHHHHHHHHLHHHLLLLLLL
Query rlkkaantqpqyfpedpvEQLRnnVWIAP---YYED----DLPELARVIGVDKILFGSDW  346
ident                                              |         || | 
Sbjct -----------------mDETD--FAMEIvqcGNPKiadyVARRAAEKGQLGRVIFGNDA  276
DSSP  -----------------hHHLL--LEEEEellLLHHhhhhHHHHHHHHLLHHHEEEELLL


DSSP  LLLL-lLLLH-HHHHHHHL---LLLHHHHHHHHLHHHHHHHLLL----------------
Query PHGE-gLASP-VSFTAELK---GFSESDIRKIMRDNALDLLGVQ----------------  385
ident | |                                |     |                  
Sbjct PSGTglIPLGiLRNMCQIAsmsDIDPEVAVCMATGNSTAVYGLNtgviapgkeadliimd  336
DSSP  LLLLllLLLHhHHHHHHHHhhlLLLHHHHHHHHLHHHHHHHLLLllllllllllleeeee


DSSP  ----------------------------------------------lll
Query ----------------------------------------------vgs  388
ident                                                  
Sbjct tplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  lllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 20: Query=4dziC Sbjct=4cqbA Z-score=13.3

back to top
DSSP  -------------------------------------------------LLLLLEEEEEE
Query -------------------------------------------------ALNYRVIDVDN   11
ident                                                         |   
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnLVSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllLEEELEEEEEE


DSSP  ELLLllllllllllhhhlllleeeeelllleeeeelleellllllllLLLEelllllhhh
Query HYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptFDPIivpgcldll   71
ident |                                                           
Sbjct HMDK-----------------------------------------sfTSTG---------   70
DSSP  LHHH-----------------------------------------llLLLL---------


DSSP  hhllllllllhhhlLLEEL--------------------hhhlhhhLLHHHHHHHHHHHL
Query frgeipdgvdpaslMKVER--------------------ladhpeyQNRDARIAVMDEQD  111
ident                                                             
Sbjct -------------eRLPKFwsrpytrdaaiedglkyyknatheeikRHVIEHAHMQVLHG  117
DSSP  -------------lLLLLLllllllhhhhhhhhhhhhhhllhhhhhHHHHHHHHHHHHLL


DSSP  EEEEEEELlhhhhhhhhllllhhhhhhhHHHHHHHHHHHLL-lLLLLL---LEEELLLL-
Query IETAFMLPtfgcgveealkhdieatmasVHAFNLWLDEDWG-fDRPDH---RIIAAPIV-  166
ident                                      |              |       
Sbjct TLYTRTHV------------------dvDSVAKTKAVEAVLeaKEELKdliDIQVVAFAq  159
DSSP  EEEEEEEE------------------elLLLLLLHHHHHHHhhHHHLLlllEEEEEEELl


DSSP  -LLLLHHHHHHHHHHHHHLLLLLEELLL--LLLLllllllLLLLhhhHHHHHHHHHHLLL
Query -SLADPTRAVEEVDFVLARGAKLVLVRP--APVPglvkprSLGDrshDPVWARLAEAGVP  223
ident                 |  |  ||                       |       |  | 
Sbjct sGFFVDLESESLIRKSLDMGCDLVGGVDpaTREN------NVEG-slDLCFKLAKEYDVD  212
DSSP  lLLLLLLLHHHHHHHHHHHLLLEEELLLllLLLL------LHHH-hhHHHHHHHHHLLLE


DSSP  EEEELLllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHHhlLHHHHLLL-lLEEEEL
Query VGFHLSdsgylhiaaawggakdpldqvllDDRAIHDTMASMIvhGVFTRHPK-lKAVSIE  282
ident    |                                                        
Sbjct IDYHIH----------------------dIGTVGVYSINRLA--QKTIENGYkgRVTTSH  248
DSSP  EEEEEL----------------------lLHHHHHHHHHHHH--HHHHHLLLllLEEEEE


DSSP  llLLHH----HHHHHHHhhhhhhlhhhllllhHHHHH-HHEEELL---LLLL--LHHHHH
Query ngSYFV----HRLIKRLkkaantqpqyfpedpVEQLR-NNVWIAP---YYED--DLPELA  332
ident                                                           | 
Sbjct --AWCFadapSEWLDEA---------------IPLYKdSGMKFVTcfsSTPPtmPVIKLL  291
DSSP  --LLHHhhllHHHHHHH---------------HHHHHhHLLEEEEellLLLLllLHHHHH


DSSP  HHHLhhHLLLLLLLL----LLLLLlLHHHHH-HHHL------lLLHHHHHHHHLHHHHHH
Query RVIGvdKILFGSDWP----HGEGLaSPVSFT-AELK------gFSESDIRKIMRDNALDL  381
ident            ||         |    |     |              | |         
Sbjct EAGI--NLGCASDNIrdfwVPFGNgDMVQGAlIETQrlelktnRDLGLIWKMITSEGARV  349
DSSP  HLLL--EEEEELLLLllllLLLLLlLHHHHHhHHHHhhllllhHHHHHHHHHHLHHHHHH


DSSP  HL----------------------------------------------lllll
Query LG----------------------------------------------vqvgs  388
ident ||                                                   
Sbjct LGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  HLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 21: Query=4dziC Sbjct=1yrrB Z-score=13.3

back to top
DSSP  ------------------------------------------------LLLLLEEEEEEE
Query ------------------------------------------------ALNYRVIDVDNH   12
ident                                                  |    |||   
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaILSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeellllEEEELEEEEEEL


DSSP  ------LLLLLLlllllllhhhlllleeeeelllleeeeelleellllllllllleelll
Query ------YYEPLDsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpg   66
ident                                                             
Sbjct gcggvqFNDTAE------------------------------------------------   72
DSSP  eelleeLLLLLL------------------------------------------------


DSSP  llhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELLhhhhhh
Query cldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPTfgcgve  126
ident                                                             
Sbjct ---------------------------avsvETLEIMQKANEKSGCTNYLPTLI------   99
DSSP  ---------------------------lllhHHHHHHHHHHHLLLEEEEEEEEL------


DSSP  hhllllhhhhhhHHHHHHHHHHHHLL--lllLLLLE-EELLLLLLllhHHHHHHHHHHHh
Query ealkhdieatmaSVHAFNLWLDEDWG--fdrPDHRI-IAAPIVSLadpTRAVEEVDFVLa  183
ident                                                    |        
Sbjct -----------tTSDELMKQGVRVMReylakHPNQAlGLHLEGPW-lnAALVDFLCENA-  146
DSSP  -----------lLLHHHHHHHHHHHHhhhhhLLLLLlLEEEELLL-llLHHHHHHHHLH-


DSSP  LLLLLEELLLLLLlllllllllllhhHHHHHHHHHHHLLLEEEELlllllhhhhhhllll
Query RGAKLVLVRPAPVpglvkprslgdrsHDPVWARLAEAGVPVGFHLsdsgylhiaaawgga  243
ident      |   |  |                |   || ||  |                   
Sbjct DVITKVTLAPEMV-------------PAEVISKLANAGIVVSAGH---------------  178
DSSP  HHEEEEEELHHHL-------------LHHHHHHHHHHLLEEEELL---------------


DSSP  llhhhhhhhllhHHHHhHHHHHhlLHHHhlllLLEEEELLLllhhhhhHHHHhhhhhhlh
Query kdpldqvllddrAIHDtMASMIvhGVFTrhpkLKAVSIENGsyfvhrlIKRLkkaantqp  303
ident                           |                       |         
Sbjct ------------SNAT-LKEAK--AGFR---aGITFATHLY-nampyiTGRE--------  211
DSSP  ------------LLLL-HHHHH--HHHH---hLEEEELLLL-llllllLLLL--------


DSSP  hhllllhhhHHHHhEEELLL----LLLL--HHHHHHHHLhHHLLLLLLLlLLLLlLLHH-
Query qyfpedpveQLRNnVWIAPY----YEDD--LPELARVIGvDKILFGSDWpHGEGlASPV-  356
ident                           |        |  | ||     |            
Sbjct -pglagailDEAD-IYCGIIadglHVDYanIRNAKRLKG-DKLCLVTDA-TSGS-SLTMi  266
DSSP  -lhhhhhhhHLLL-LEEEEEllllLLLHhhHHHHHHHHH-HHEEEELLL-LLLL-LLLHh


DSSP  HHHHHHL---LLLHHHHHHHHLHHHHHHHL------------------------------
Query SFTAELK---GFSESDIRKIMRDNALDLLG------------------------------  383
ident      |    |                  |                              
Sbjct EGVRNLVehcGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
DSSP  HHHHHHHhhhLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee


DSSP  ---lllll
Query ---vqvgs  388
ident         
Sbjct ngnevvtq  334
DSSP  lleeeeel


No 22: Query=4dziC Sbjct=3giqA Z-score=13.1

back to top
DSSP  ----------------------------------------------------LLLLLEEE
Query ----------------------------------------------------ALNYRVID    8
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkIVAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeellllEEEELEEE


DSSP  EEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllllleelllll
Query VDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcl   68
ident |  |                                                        
Sbjct VHGHDDL-----------------------------------------------------   67
DSSP  LLLLLLL-----------------------------------------------------


DSSP  hhhhhllllllllhhhllleelhhhlhHHLLHHHhHHHHHHHLEEEEEEE----------
Query dllfrgeipdgvdpaslmkverladhpEYQNRDArIAVMDEQDIETAFML----------  118
ident                                          | | |              
Sbjct ---------------------------MFVEKPD-LRWKTSQGITTVVVGncgvsaapap   99
DSSP  ---------------------------HHHHLLL-LHHHHLLLEEEEEELllllllllll


DSSP  ----llHHHHhhhhllllhhhhhhhhhhHHHHHHHHLlllllLLLEEELLLL--LLLL--
Query ----ptFGCGveealkhdieatmasvhaFNLWLDEDWgfdrpDHRIIAAPIV--SLAD--  170
ident                                                |            
Sbjct lpgntaAALA---------llgetplfaDVPAYFAALdaqrpMINVAALVGHanLRLAam  150
DSSP  llllllHHHH---------hhlllllllLHHHHHHHHhhlllLLEEEEEEEHhhHHHHhl


DSSP  -----------HHHHHHHHHHHHHLLLLLEELLL----LLLLlllllllllLHHH-HHHH
Query -----------PTRAVEEVDFVLARGAKLVLVRP----APVPglvkprslgDRSH-DPVW  214
ident                       |  ||             |                   
Sbjct rdpqaaptaaeQQAMQDMLQAALEAGAVGFSTGLayqpGAVA---------QAAElEGLA  201
DSSP  llllllllhhhHHHHHHHHHHHHHHLLLEEEEELllllHHHL---------LHHHhHHHH


DSSP  HHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhLLHHhHHHHHHHHhlLHHHHLL
Query ARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllDDRAiHDTMASMIvhGVFTRHP  274
ident    ||       |                          |                    
Sbjct RVAAERRRLHTSH---------------------irneADGV-EAAVEEVL--AIGRGTG  237
DSSP  HHHHHLLLEEEEE---------------------llllLLLH-HHHHHHHH--HHHHHHL


DSSP  lLLEEEELlLLLH-------HHHHHhhhhhhhhhlhhhllllhHHHH--hHHEEELLLLL
Query kLKAVSIEnGSYF-------VHRLIkrlkkaantqpqyfpedpVEQL--rNNVWIAPYYE  325
ident     |                                               |    |  
Sbjct -CATVVSH-HKCMmpqnwgrSRATL---------------aniDRAReqgVEVALDIYPY  280
DSSP  -LEEEELL-LLLLlhhhlllHHHHH---------------hhhHHHHhllLLEEEEELLL


DSSP  L-----------------------------------------------------------
Query D-----------------------------------------------------------  326
ident                                                             
Sbjct Pgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyf  340
DSSP  Leeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeee


DSSP  -----LHHHHHhhhLHHHLLLLLLLLL----LLLL-LLHHH-HHHHHL----LLLHHHHH
Query -----DLPELArviGVDKILFGSDWPH----GEGL-ASPVS-FTAELK----GFSESDIR  371
ident                      |||                                    
Sbjct amdedEVKRIF---QHPCCMVGSDGLPndarPHPRlWGSFTrVLGRYVrearLMTLEQAV  397
DSSP  lllhhHHHHHH---HLLLEEELLLLLLllllLLLHhHHHHHhHHHHHHhhllLLLHHHHH


DSSP  HHHLHHHHHHHL------------------------------------------------
Query KIMRDNALDLLG------------------------------------------------  383
ident   |        |                                                
Sbjct ARMTALPARVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngae  457
DSSP  HHHLHHHHHHHLlllllllllllllleeeelllllllllllllllllllleeeeeellee


DSSP  -------------lllll
Query -------------vqvgs  388
ident                   
Sbjct vfpqppadgrpgqvlrax  475
DSSP  eellllllllllllllll


No 23: Query=4dziC Sbjct=2y1hB Z-score=12.9

back to top
DSSP  llLLLEEEEEEELLLLlllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alNYRVIDVDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident        |   |   |                                            
Sbjct --GVGLVDCHCHLSAP--------------------------------------------   14
DSSP  --LLLEEEEEELLLLH--------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhHLHHhllhHHHHHHHHHHLEEEEEEELl
Query piivpgcldllfrgeipdgvdpaslmkverlaDHPEyqnrDARIAVMDEQDIETAFMLPt  120
ident                                 |       |                   
Sbjct ------------------------------dfDRDL----DDVLEKAKKANVVALVAVA-   39
DSSP  ------------------------------hhLLLH----HHHHHHHHHLLEEEEEELL-


DSSP  hhhhhhhhllllhhhhhhhHHHHHHHHHHHlllLLLL-LLEEELLLLL--------lLLH
Query fgcgveealkhdieatmasVHAFNLWLDEDwgfDRPD-HRIIAAPIVS--------lADP  171
ident                                               |             
Sbjct ------------------eHSGEFEKIMQL---SERYnGFVLPCLGVHpvqgldqrsVTL   78
DSSP  ------------------lLHHHHHHHHHH---HHHLlLLEEEEELLLleelllleeLLH


DSSP  HHHHHHHHHHHHL--LLLLE-ELLLL---llllLLLL--LLLLlhhhhHHHHHHHHHLLL
Query TRAVEEVDFVLAR--GAKLV-LVRPA---pvpgLVKP--RSLGdrshdPVWARLAEAGVP  223
ident                       |                                    |
Sbjct KDLDVALPIIENYkdRLLAIgEVGLDfsprfagTGEQkeEQRQ--vliRQIQLAKRLNLP  136
DSSP  HHHHHHHHHHHHHllLLLEEeEEEEElllllllLHHHhhHHHH--hhhHHHHHHHHHLLL


DSSP  EEEELlllllhhhhhhllllllhhhhhhhlLHHHHHHHHHHHhLLHHhhlllLLEEEELL
Query VGFHLsdsgylhiaaawggakdpldqvlldDRAIHDTMASMIvHGVFtrhpkLKAVSIEN  283
ident |  |                            |   |                |      
Sbjct VNVHS-------------------------RSAGRPTINLLQ-EQGA-----EKVLLHAF  165
DSSP  EEEEE-------------------------ELLHHHHHHHHH-HLLL-----LLEEEELL


DSSP  LLL--HHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEELL--------lLLLLHHHHHh
Query GSY--FVHRlikrlkkaantqpqyfpedpveqLRNNVWIAP--------yYEDDLPELAr  333
ident                                  |                       |  
Sbjct DGRpsVAME----------------------gVRAGYFFSIppsiirsgqKQKLVKQLP-  202
DSSP  LLLhhHHHH----------------------hHHLLLEEEElhhhhllhhHHHHHHHLL-


DSSP  hhlHHHLLLLLLLLllLLLL---------LHHHHHHHH-LLLLH---HHHHHHhLHHHHH
Query vigVDKILFGSDWPhgEGLA---------SPVSFTAEL-KGFSE---SDIRKImRDNALD  380
ident       |    | |                                   |      ||| 
Sbjct ---LTSICLETDSP--ALGPekqvrnepwNISISAEYIaQVKGIsveEVIEVT-TQNALK  256
DSSP  ---HHHEEELLLLL--LLLLlllllllhhHHHHHHHHHhHHHLLlhhHHHHHH-HHHHHH


DSSP  HHLL-llll
Query LLGV-qvgs  388
ident |        
Sbjct LFPKlrhll  265
DSSP  HLLLhhhhl


No 24: Query=4dziC Sbjct=3k2gB Z-score=12.9

back to top
DSSP  -----------------------llllLEEEEEEE-LLLLlllllllllhhhlllleeee
Query -----------------------alnyRVIDVDNH-YYEPldsftrhldkkfkrrgvqml   36
ident                                   |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDC--------------------   40
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEEL--------------------


DSSP  elllleeeeelleellLLLLllllleelllllhhhhhllllllLLHHHLLL----EELHh
Query sdgkrtwavigdrvnhFIPNptfdpiivpgcldllfrgeipdgVDPASLMK----VERLa   92
ident                    |                            |           
Sbjct ---------------rCWWN------ppqeperqylaeapisiEILSELRQdpfvNKHN-   78
DSSP  ---------------hHHLL------llllhhhhhhhhllllhHHHHHHHLlhhhLLLL-


DSSP  hlhhHLLHHHHHHHHHHHL---EEEEEEELlhhhhhhhhllllhhhhhhhhhhhhhhHHH
Query dhpeYQNRDARIAVMDEQD---IETAFMLPtfgcgveealkhdieatmasvhafnlwLDE  149
ident         |  ||                                               
Sbjct --iaLDDLDLAIAEVKQFAavgGRSIVDPT---------------------crgigrDPV  115
DSSP  --leELLHHHHHHHHHHHHhllLLEEEELL---------------------llllllLHH


DSSP  HLL--llllLLLEEELLLL----------llLLHHHHHHHHHHHHH-------LLLLLEE
Query DWG--fdrpDHRIIAAPIV----------slADPTRAVEEVDFVLA-------RGAKLVL  190
ident                                        |                 |  
Sbjct KLRrisaetGVQVVXGAGYylassxpetaarLSADDIADEIVAEALegtdgtdARIGLIG  175
DSSP  HHHhhhhhhLLEEEELLLLllhhhllhhhhlLLHHHHHHHHHHHHHlllllllLLLLLEE


DSSP  -LLLL--LLLLlllllllllhhHHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhh
Query -VRPA--PVPGlvkprslgdrsHDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpl  247
ident                                  | |   ||                   
Sbjct eIGVSsdFTAE-------eeksLRGAARAQVRTGLPLXVHL-------------------  209
DSSP  eELLLllLLHH-------hhhhHHHHHHHHHHHLLLEEELL-------------------


DSSP  hhhhhLLHHhhHHHHHHHhLLHHHHLLLL-LEEEElLLLLH--HHHHhhhhhhhhhhlhh
Query dqvllDDRAihDTMASMIvHGVFTRHPKL-KAVSIeNGSYF--VHRLikrlkkaantqpq  304
ident                      |      |   |                           
Sbjct -----PGWF--RLAHRVL-DLVEEEGADLrHTVLC-HXNPShxDPVY-------------  247
DSSP  -----LLLL--LLHHHHH-HHHHHLLLLHhHEEEL-LLHHHllLHHH-------------


DSSP  hllllhhHHHHHHEEELL-----------------lLLLL---HHHHHHHHLHHHLLLLL
Query yfpedpvEQLRNNVWIAP-----------------yYEDD---LPELARVIGVDKILFGS  344
ident                                               ||     | ||   
Sbjct -----qaTLAQRGAFLEFdxigxdffyadqgvqcpsDDEVaraILGLADHGYLDRILLSH  302
DSSP  -----hhHHHHHLLEEEEllllllleelllleelllHHHHhhhHHHHHHLLLHHHEEELL


DSSP  LLLL--------LLLLLLHH-HHHHHHL--LLLHHHHHHHHLHHHHHHHLLL-lll
Query DWPH--------GEGLASPV-SFTAELK--GFSESDIRKIMRDNALDLLGVQ-vgs  388
ident |           | | |     |   |   |            |            
Sbjct DVFVkxxltrygGNGYAFVTkHFLPRLRrhGLDDAALETLXVTNPRRVFDASiegh  358
DSSP  LLLLhhhlhhhlLLLLLHHHhLHHHHHHhlLLLHHHHHHHHLHHHHHHHLLLllll


No 25: Query=4dziC Sbjct=3ls9A Z-score=12.8

back to top
DSSP  -----------------------------------------------------LLLLLEE
Query -----------------------------------------------------ALNYRVI    7
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmIALPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleEEEELEE


DSSP  EEEEELLlllllllllllhhhlllleeeeelllleeeeelleelLLLLLLLllleellll
Query DVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnHFIPNPTfdpiivpgc   67
ident     | |                                                     
Sbjct NSHQHLY--------------egamraipqlervtmaswlegvlTRSAGWW---------   97
DSSP  EEEELHH--------------hhhhlllhhhllllhhhhhhhhhHHHHHHH---------


DSSP  lhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhh
Query ldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgvee  127
ident                                   |         | |             
Sbjct -------------------rdgkfgpdvirEVARAVLLESLLGGITTVADQH--------  130
DSSP  -------------------hlllllhhhhhHHHHHHHHHHHHLLEEEEEEEE--------


DSSP  hllllhhHHHHHhhHHHHHHHHHLLllllLLLEEELLLLLL--------------LLHHH
Query alkhdieATMASvhAFNLWLDEDWGfdrpDHRIIAAPIVSL--------------ADPTR  173
ident           |          |         |  ||                       |
Sbjct ---lffpGATAD--SYIDATIEAAT--dlGIRFHAARSSMTlgkseggfcddlfvEPVDR  183
DSSP  ---llllLLLLL--LHHHHHHHHHH--hhLLEEEEEELLLLllhhhlllllhhhlLLHHH


DSSP  HHHHHHHHHHLL---------LLLEELLLLLLllllllllllLHHH-HHHHHHHHHHLLL
Query AVEEVDFVLARG---------AKLVLVRPAPVpglvkprslgDRSH-DPVWARLAEAGVP  223
ident  |                            |                       |   | 
Sbjct VVQHCLGLIDQYhepepfgmvRIALGPCGVPY---------dKPELfEAFAQMAADYDVR  234
DSSP  HHHHHHHHHHHHlllllllleEEEELLLLLLL---------lLHHHhHHHHHHHHHHLLE


DSSP  EEEEllllllhhhhhhllllllhhhhhhhLLHH-------hhHHHHHHHhLLHHhhllll
Query VGFHlsdsgylhiaaawggakdpldqvllDDRA-------ihDTMASMIvHGVFtrhpkl  276
ident    |                            |                           
Sbjct LHTH----------------------fyePLDAgmsdhlygmTPWRFLE-KHGW---asd  268
DSSP  EEEE----------------------ellLLHHhhhhhhhllLHHHHHH-HLLL---lll


DSSP  LEEEELlLLLHHHHHHhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL---------LL
Query KAVSIEnGSYFVHRLIkrlkkaantqpqyfpedpvEQLR-NNVWIAPYY---------ED  326
ident                |                          | ||              
Sbjct RVWLAH-AVVPPREEI-------------------PEFAdAGVAIAHLIapdlrmgwgLA  308
DSSP  LEEEEE-LLLLLHHHH-------------------HHHHhHLLEEEELHhhhhhllllLL


DSSP  LHHHHHHHHLhhHLLLLLLLLLlLLLL-LHHHHH-HHHL------------LLLHHHHHH
Query DLPELARVIGvdKILFGSDWPHgEGLA-SPVSFT-AELK------------GFSESDIRK  372
ident    |           ||                                    |      
Sbjct PIREYLDAGI--TVGFGTTGSA-SNDGgNLLGDLrLAALahrpadpnepekWLSARELLR  365
DSSP  LHHHHHHLLL--EEEELLLLLL-LLLLlLHHHHHhHHHHhlhhhllllhhhLLLHHHHHH


DSSP  HHLHHHHH-HHLLL----------------------------------------------
Query IMRDNALD-LLGVQ----------------------------------------------  385
ident          |                                                  
Sbjct MATRGSAEcLGRPDlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvv  425
DSSP  HLLHHHHHhLLLLLllllllllllleeeeelllhhhlllllhhhhhhhlllllllleeee


DSSP  -------------------------lll
Query -------------------------vgs  388
ident                             
Sbjct ngqvlvenerpvladlerivanttalip  453
DSSP  lleeeeelleellllhhhhhhhhhhhll


No 26: Query=4dziC Sbjct=3mtwA Z-score=12.7

back to top
DSSP  ------------------------------------------------------llLLLE
Query ------------------------------------------------------alNYRV    6
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellLLLLLLLLLeelll
Query IDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhFIPNPTFDPiivpg   66
ident ||   |                                           |          
Sbjct IDMHVHLDS---------------------------------laevGGYNSLEYS-----   82
DSSP  EEEEELLLL---------------------------------llllLHHHHHHLL-----


DSSP  llhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhh
Query cldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgve  126
ident                                    |      |    |            
Sbjct --------------------------drfwsVVQTANAKKTLEAGFTTVRNVG-------  109
DSSP  --------------------------hhhhhHHHHHHHHHHHHLLEEEEEELL-------


DSSP  hhllllhhhhhhhhhhhhhhHHHHLL-lLLLL-------lLEEEL-LLLL----------
Query ealkhdieatmasvhafnlwLDEDWG-fDRPD-------hRIIAA-PIVS----------  167
ident                      | |                ||  |               
Sbjct -------------------aADYDDVglREAIdagyvpgpRIVTAaISFGatgghcdstf  150
DSSP  -------------------lLLLHHHhhHHHHhlllllllEEEELlLLEEllllllllll


DSSP  ------------LLLHHHHHHHHHHHHHLLLLLEELLLLL-----llllllllLLLLhhh
Query ------------LADPTRAVEEVDFVLARGAKLVLVRPAP-----vpglvkprSLGDrsh  210
ident                |  |   |      ||                             
Sbjct fppsmdqknpfnSDSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqqqLTYE-em  209
DSSP  llhhhlllllllLLLHHHHHHHHHHHHHLLLLEEEEELLLlllllllllllllLLHH-hh


DSSP  HHHHHHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhllhHHHHHHHHHhhllhh
Query DPVWARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllddrAIHDTMASMivhgvf  270
ident   |      ||  |  |                                           
Sbjct KAVVDEAHMAGIKVAAH---------------------------aHGASGIREA------  236
DSSP  HHHHHHHHHLLLEEEEE---------------------------eLLHHHHHHH------


DSSP  hhlllLLEEEELLLlLHHHHHhhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL-----
Query trhpkLKAVSIENGsYFVHRLikrlkkaantqpqyfpedpvEQLR-NNVWIAPYY-----  324
ident                                                             
Sbjct --vraGVDTIEHAS-LVDDEG-------------------iKLAVqKGAYFSMDIyntdy  274
DSSP  --hhlLLLEEEELL-LLLHHH-------------------hHHHHhHLLEEELLLllhhh


DSSP  -------------------------LLLHHHHHHHHLhhHLLLLLLLLLLllllLHHHHH
Query -------------------------EDDLPELARVIGvdKILFGSDWPHGeglaSPVSFT  359
ident                                        |   | |              
Sbjct tqaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAGIY-phgDNAKQF  331
DSSP  hhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLLLL-lllLHHHHH


DSSP  HHHL--LLLHHHHHHHHLHHHHHHHL----------------------------------
Query AELK--GFSESDIRKIMRDNALDLLG----------------------------------  383
ident |     |             |   ||                                  
Sbjct AVMVryGATPLQAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpv  391
DSSP  HHHHhlLLLHHHHHHHLLHHHHHHHLllllllllllllllleeeelllllllhhhhhlll


DSSP  --------lllll
Query --------vqvgs  388
ident              
Sbjct fvmkggavvkapx  404
DSSP  eeeelleeeelll


No 27: Query=4dziC Sbjct=1k6wA Z-score=12.7

back to top
DSSP  ------------------------------------------------LLLLLEEEEEEE
Query ------------------------------------------------ALNYRVIDVDNH   12
ident                                                            |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqgLVIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeellllEEELLEEEEEEL


DSSP  LLLllllllllllhhhlllleeeeelllLEEEeelleeLLLLLLL-LLLLeelllllhhh
Query YYEpldsftrhldkkfkrrgvqmlsdgkRTWAvigdrvNHFIPNP-TFDPiivpgcldll   71
ident                               |          |                  
Sbjct LDT-------------------tqtagqPNWN-qsgtlFEGIERWaERKA----------   90
DSSP  LLL-------------------llllllLLLL-llllhHHHHHHHhLLHH----------


DSSP  hhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhlll
Query frgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkh  131
ident                           |             |                   
Sbjct ------------------llthddvkQRAWQTLKWQIANGIQHVRTHV------------  120
DSSP  ------------------hllhhhhhHHHHHHHHHHHHLLEEEEEEEE------------


DSSP  lhhhhhhhHHHHhHHHHHHLL-lLLLLL---LEEELLLL---LLLLhhHHHHhhHHHHHL
Query dieatmasVHAFnLWLDEDWG-fDRPDH---RIIAAPIV---SLADptRAVEevDFVLAR  184
ident           |  |                             |             |  
Sbjct ------dvSDAT-LTALKAMLevKQEVApwiDLQIVAFPqegILSY-pNGEAllEEALRL  172
DSSP  ------elLLLL-LHHHHHHHhhHHHHLlllEEEEEEELlllLLLL-lLHHHhhHHHHHL


DSSP  LLLLEELLLLLLLLlllLLLLLLhhhHHHHHHHHHHLLLEEEEllllllhhhhhhlllll
Query GAKLVLVRPAPVPGlvkPRSLGDrshDPVWARLAEAGVPVGFHlsdsgylhiaaawggak  244
ident ||  |   |                     |           |                 
Sbjct GADVVGAIPHFEFT---REYGVE-slHKTFALAQKYDRLIDVH-----------------  211
DSSP  LLLEEEELHHHLLL---HHHHHH-hhHHHHHHHHHHLLEEEEE-----------------


DSSP  lhhhhhhHLLHHhhHHHHHHHhlLHHHHLLL-lLEEEElLLLLH---hhHHHHHHhhhhh
Query dpldqvlLDDRAihDTMASMIvhGVFTRHPK-lKAVSIeNGSYF---vhRLIKRLkkaan  300
ident         |                                            ||     
Sbjct ---cdeiDDEQS--RFVETVA--ALAHHEGMgaRVTAS-HTTAMhsyngAYTSRL-----  258
DSSP  ---elllLLLLL--LHHHHHH--HHHHHHLLhhHEEEE-ELHHHhhllhHHHHHH-----


DSSP  hlhhhllllhHHHHH-HHEEELL------------------llLLLHHHHHHHHLhhHLL
Query tqpqyfpedpVEQLR-NNVWIAP------------------yyEDDLPELARVIGvdKIL  341
ident              |                                  |           
Sbjct ----------FRLLKmSGINFVAnplvnihlqgrfdtypkrrgITRVKEMLESGI--NVC  306
DSSP  ----------HHHHHhHLLEEEElhhhhhhhllllllllllllLLLHHHHHHLLL--LEE


DSSP  LLLLLL----LLLLllLHHHH-HHHH---LLLL---HHHHHHHHLHHHHHHHLLL-----
Query FGSDWP----HGEGlaSPVSF-TAEL---KGFS---ESDIRKIMRDNALDLLGVQ-----  385
ident || |         |           |            |            |  |     
Sbjct FGHDDVfdpwYPLGtaNMLQVlHMGLhvcQLMGygqINDGLNLITHHSARTLNLQdygia  366
DSSP  ELLLLLllllLLLLllLHHHHhHHHHhhlLLLLhhhHHHHHHHHLHHHHHHLLLLlllll


DSSP  ------------------------------------------------------lll
Query ------------------------------------------------------vgs  388
ident                                                          
Sbjct agnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  lllllleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeellll


No 28: Query=4dziC Sbjct=2ob3A Z-score=12.6

back to top
DSSP  -----------llllLEEEEEEE-LLLLllLLLLLllhhhlllleeeeelllleeeeell
Query -----------alnyRVIDVDNH-YYEPldSFTRHldkkfkrrgvqmlsdgkrtwavigd   48
ident                       |                                     
Sbjct drintvrgpitiseaGFTLTHEHiCGSS--AGFLR-------------------------   33
DSSP  lleeelleeelhhhhLLEEEEELlEELL--LLHHH-------------------------


DSSP  eellllllllllleelllllhhhhhllllllllhhhllleeLHHHlhhhlLHHHHHHHHH
Query rvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkveRLADhpeyqNRDARIAVMD  108
ident                                                             
Sbjct -------------------------------------awpeFFGS--rkaLAEKAVRGLR   54
DSSP  -------------------------------------hlhhHHLL--hhhHHHHHHHHHH


DSSP  HHL---EEEEEEELlhhhhhhhhllllhhhhhhhhhhhhhHHHHHLL--llllLLLEEEL
Query EQD---IETAFMLPtfgcgveealkhdieatmasvhafnlWLDEDWG--fdrpDHRIIAA  163
ident         |                                            |  | ||
Sbjct RARaagVRTIVDVS---------------------tfdigRDVSLLAevsraaDVHIVAA   93
DSSP  HHHhllLLEEEELL---------------------lhhhlLLHHHHHhhhhhhLLEEELE


DSSP  LLL--------llLLHHHHHHHHHHHHH-------LLLLLEELLLL--LLLLllllllll
Query PIV--------slADPTRAVEEVDFVLA-------RGAKLVLVRPA--PVPGlvkprslg  206
ident                                      |    |       |         
Sbjct TGLwfdpplsmrlRSVEELTQFFLREIQygiedtgIRAGIIXVATTgkATPF-------q  146
DSSP  EELlllllhhhhlLLHHHHHHHHHHHHHlllllllLLLLEEEEELLllLLHH-------h


DSSP  lhhhHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhhhhhlLHHHhhHHHHHHh
Query drshDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldqvlldDRAIhdTMASMIv  266
ident               ||||  |                                       
Sbjct elvlKAAARASLATGVPVTTHT------------------------aASQR--DGEQQA-  179
DSSP  hhhhHHHHHHHHHHLLLEEEEL------------------------lHHHL--HHHHHH-


DSSP  LLHHHHLLL-lLEEEELLLLLHHHHHhhhhhhhhhhlhhhllllhhhhHHHHEEELL---
Query HGVFTRHPK-lKAVSIENGSYFVHRLikrlkkaantqpqyfpedpveqLRNNVWIAP---  322
ident                                                       |     
Sbjct AIFESEGLSpsRVCIGHSDDTDDLSY------------------ltalAARGYLIGLdhi  221
DSSP  HHHHHLLLLhhHEEELLHHHLLLHHH------------------hhhhHHLLLEEEElll


DSSP  ------------------------LLLLlHHHHHHHHLHHHLLLLLLLL-----------
Query ------------------------YYEDdLPELARVIGVDKILFGSDWP-----------  347
ident                                 |        ||   ||            
Sbjct pysaiglednasasallgirswqtRALL-IKALIDQGYMKQILVSNDWTfgfssyvtnim  280
DSSP  llllllllllhhhhhhhllllhhhHHHH-HHHHHHLLLHHHEEELLLLLleellllllhh


DSSP  ------llllLLLHH-HHHHHHL--LLLHHHHHHHHLHHHHHHHLLLlll
Query ------hgegLASPV-SFTAELK--GFSESDIRKIMRDNALDLLGVQvgs  388
ident            |         |   |        |   |    |      
Sbjct dvmdrvnpdgMAFIPlRVIPFLRekGVPQETLAGITVTNPARFLSPT-lr  329
DSSP  hhhhhhlllhHHHHHhLHHHHHHhlLLLHHHHHHHHLHHHHHHHLLL-ll


No 29: Query=4dziC Sbjct=1bf6A Z-score=12.6

back to top
DSSP  -lllLLEEEEEEE-LLLLLLlllllllhhhlllleeeeelllleeeeelleelllLLLLL
Query -alnYRVIDVDNH-YYEPLDsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfIPNPT   58
ident             |                                            |  
Sbjct sfdpTGYTLAHEHlHIDLSG-----------------------------------FKNNV   25
DSSP  llllLLEEEEEELlLEELHH-----------------------------------HHLLH


DSSP  LlleelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHL---EEEE
Query FdpiivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQD---IETA  115
ident                                                 |           
Sbjct D-----------------------------------crLDQYAFICQEMNDLMtrgVRNV   50
DSSP  H-----------------------------------heELLHHHHHHHHHHHHhllEEEE


DSSP  EEELlhhhhhhhhllllhhhhhhhhhhhhhHHHHHLL--llllLLLEEELLLL-------
Query FMLPtfgcgveealkhdieatmasvhafnlWLDEDWG--fdrpDHRIIAAPIV-------  166
ident                                                 |           
Sbjct IEMT---------------------nrymgRNAQFMLdvmretGINVVACTGYyqdaffp   89
DSSP  EELL---------------------lhhhlLLHHHHHhhhhhhLLEEEEEELLllhhhll


DSSP  ---llLLHHHHHHHHHHHHHL-------LLLLE-ELLL---LLLLlllllLLLLlhhhHH
Query ---slADPTRAVEEVDFVLAR-------GAKLV-LVRP---APVPglvkpRSLGdrshDP  212
ident              |               |              |               
Sbjct ehvatRSVQELAQEMVDEIEQgidgtelKAGIIaEIGTsegKITP-----LEEK--vfIA  142
DSSP  lhhhhLLHHHHHHHHHHHHHLlllllllLEEEEeEEELlllLLLH-----HHHH--hhHH


DSSP  HHHHHHHHLLLEEEELLllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHhhllhHHH
Query VWARLAEAGVPVGFHLSdsgylhiaaawggakdpldqvllDDRAIHDTMASMivhgvFTR  272
ident         | |   | |                                |          
Sbjct AALAHNQTGRPISTHTS-----------------------FSTMGLEQLALL-----QAH  174
DSSP  HHHHHHHHLLLEEEELH-----------------------HHLLHHHHHHHH-----HHL


DSSP  LLL-lLEEEELLL----lLHHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEELL-----
Query HPK-lKAVSIENG----sYFVHRlikrlkkaantqpqyfpedpveqLRNNVWIAP-----  322
ident                                                             
Sbjct GVDlsRVTVGHCDlkdnlDNILK----------------------mIDLGAYVQFdtigk  212
DSSP  LLLhhHEEELLLLllllhHHHHH----------------------hHHLLLEEEElllll


DSSP  -------lLLLLHHHHHHHHLHHHLLLLLLLL--------llllLLLHH-HHHHHHL--L
Query -------yYEDDLPELARVIGVDKILFGSDWP--------hgegLASPV-SFTAELK--G  364
ident             |  |             |                     |   |   |
Sbjct nsyypdekRIAMLHALRDRGLLNRVMLSMDITrrshlkanggygYDYLLtTFIPQLRqsG  272
DSSP  lllllhhhHHHHHHHHHHLLLHHHEEELLLLLlhhhlhhhllllLLHHHhLHHHHHHhlL


DSSP  LLHHHHHHHHLHHHHHHHLlllll
Query FSESDIRKIMRDNALDLLGvqvgs  388
ident ||  |     | |           
Sbjct FSQADVDVMLRENPSQFFQ-----  291
DSSP  LLHHHHHHHHLHHHHHHLL-----


No 30: Query=4dziC Sbjct=2pajA Z-score=12.6

back to top
DSSP  ---------------------------------------------------------llL
Query ---------------------------------------------------------alN    3
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLEEEEEEELL--------lLLLLLLllllhhhlllleeeeelllleeeeelleelllll
Query YRVIDVDNHYY--------ePLDSFTrhldkkfkrrgvqmlsdgkrtwavigdrvnhfip   55
ident         |                                                   
Sbjct PAWVNTHHHLFqsllkgepfRALFDE----------------------------------   86
DSSP  ELEELLLLLHHhhhllllllHHHLLH----------------------------------


DSSP  lllllleelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEE
Query nptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETA  115
ident                                                           | 
Sbjct --------------------------------------rrfrLAARIGLIELARSGCATV  108
DSSP  --------------------------------------hhhhHHHHHHHHHHHLLLEEEE


DSSP  EEELLHHhhhhhhllllhhhHHHHhhhhhhHHHHHLL--llllLLLEEELLLLLLL----
Query FMLPTFGcgveealkhdieaTMASvhafnlWLDEDWG--fdrpDHRIIAAPIVSLA----  169
ident                                              |              
Sbjct ADHNYVY-------------YPGM----pfDSSAILFeeaeklGLRFVLLRGGATQtrql  151
DSSP  EELLLLL-------------LLLL----llLHHHHHHhhhhhlLLEEEEEELLLLLllll


DSSP  -----------LHHHHHHHHHHHHHLLL---------LLEEL-LLLLLllllllllllLH
Query -----------DPTRAVEEVDFVLARGA---------KLVLV-RPAPVpglvkprslgDR  208
ident                 |       ||                                 |
Sbjct eadlptalrpeTLDAYVADIERLAARYHdaspramrrVVMAPtTVLYS--------isPR  203
DSSP  lllllhhhlllLHHHHHHHHHHHHHHLLllllllleeEEELLlLLLLL--------llHH


DSSP  HHHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhhhhhllhhhhHHHHHHHhLL
Query SHDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldqvllddraihDTMASMIvHG  268
ident       |     |     ||                                 |      
Sbjct EMRETAAVARRLGLRMHSHL---------------------------sgkSPVAFCG-EH  235
DSSP  HHHHHHHHHHHLLLEEEEEL---------------------------lllLHHHHHH-HL


DSSP  HHhhllllLEEEElLLLLHhHHHHhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL---
Query VFtrhpklKAVSIeNGSYFvHRLIkrlkkaantqpqyfpedpvEQLR-NNVWIAPYY---  324
ident                                              |       |      
Sbjct DW---lgsDVWYA-HLVKV-DADE------------------iALLAqTGTGVAHCPqsn  272
DSSP  LL---lllLEEEE-LLLLL-LHHH------------------hHHHHhHLLEEEELHhhh


DSSP  -llLHHHHHHHHLhhHLLLLLLLLLlLLLL-LHHHH-HHHHLL-----LLHHHHHHHHLH
Query -edDLPELARVIGvdKILFGSDWPHgEGLA-SPVSF-TAELKG-----FSESDIRKIMRD  376
ident       | |          | |       |    |              |          
Sbjct grlPVREMADAGV--PVSIGVDGAA-SNEAaDMISEvHMTWLAqrarlASIAEVIHWGTA  329
DSSP  hllLLLLHHHHLL--LEEELLLHHH-HLLLlLHHHHhHHHHHHhhhllLLHHHHHHHHLH


DSSP  HHHHHHL-----------------------------------------------------
Query NALDLLG-----------------------------------------------------  383
ident       |                                                     
Sbjct GGARVMGldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkr  389
DSSP  HHHHHHLlllllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeellee


DSSP  ---------------------------lllll
Query ---------------------------vqvgs  388
ident                                 
Sbjct vvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeellllllllhhhhhhhhhhhhhhhhhhhhl


No 31: Query=4dziC Sbjct=2imrA Z-score=12.5

back to top
DSSP  ---------------------------------------------------LLLLLEEEE
Query ---------------------------------------------------ALNYRVIDV    9
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaVIAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelllEELLLLLEE


DSSP  EEE-LLLLlllllllllhhhlllleeeeelllleeeeelleellllllllllLEELllll
Query DNH-YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdPIIVpgcl   68
ident   |                                                  |      
Sbjct HTHlDMSA-----------------------------yefqalpyfqwipevVIRG----   87
DSSP  EEElLLLH-----------------------------hhhhhlhhhhllhhhHHHH----


DSSP  hhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhh
Query dllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveea  128
ident                                  |                          
Sbjct -----------------------rhlrgvAAAQAGADTLTRLGAGGVGDIV---------  115
DSSP  -----------------------llllhhHHHHHHHHHHHHLLLLLEEEEE---------


DSSP  llllhhhhhhhhhhhHHHHHHHLLllLLLLLEEELLLLLLL---LHHHHHHHHHHHHHLL
Query lkhdieatmasvhafNLWLDEDWGfdRPDHRIIAAPIVSLA---DPTRAVEEVDFVLARG  185
ident                           | |        |                  | | 
Sbjct --------------wAPEVMDALL-aREDLSGTLYFEVLNPfpdKADEVFAAARTHLERW  160
DSSP  --------------lLHHHHHHHH-lLLLLLEEEEEEELLLlhhHHHHHHHHHHHHHHHH


DSSP  --------LLLEELLLLLLllllllllllLHHH-HHHHHHHHHHLLLEEEELlllllhhh
Query --------AKLVLVRPAPVpglvkprslgDRSH-DPVWARLAEAGVPVGFHLsdsgylhi  236
ident                                          |  | |   |         
Sbjct rrlerpglRLGLSPHTPFT---------vSHRLmRLLSDYAAGEGLPLQIHV--------  203
DSSP  hlllllleEEEEEELLLLL---------lLHHHhHHHHHHHHHHLLLLEEEE--------


DSSP  hhhllllllhhhhhhHLLH--------------------------------hhhHHHHHH
Query aaawggakdpldqvlLDDR--------------------------------aihDTMASM  264
ident                                                             
Sbjct ------------aehPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYL  251
DSSP  ------------lllHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHH


DSSP  HHLLHHHhlllLLEEEELLLlLHHHHHhhhhhhhhhhlhhhllllhhHHHH-HHEEELLL
Query IVHGVFTrhpkLKAVSIENGsYFVHRLikrlkkaantqpqyfpedpvEQLR-NNVWIAPY  323
ident    ||                                                       
Sbjct DELGVLA----ARPTLVHMV-NVTPDD-------------------iARVArAGCAVVTC  287
DSSP  HHHLLHH----HLLEEEELL-LLLHHH-------------------hHHHHhHLLLEEEL


DSSP  L---------LLLHHHHHHHHLhhHLLLLLLLLLlLLLL-LHHHHH-HHHL---LLLHHH
Query Y---------EDDLPELARVIGvdKILFGSDWPHgEGLA-SPVSFT-AELK---GFSESD  369
ident             | |  |          | |     |                 |     
Sbjct PrsnhhlecgTFDWPAFAAAGV--EVALGTDSVA-SGETlNVREEVtFARQlypGLDPRV  344
DSSP  HhhhhhllllLLLHHHHHHLLL--LEEELLLLHH-HHLLlLLHHHHhHHHHhllLLLHHH


DSSP  HHHHHLHHHHHHHL-----------------lllll
Query IRKIMRDNALDLLG-----------------vqvgs  388
ident              |                      
Sbjct LVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  HHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 32: Query=4dziC Sbjct=1onxA Z-score=12.5

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------AL    2
ident                                                            |
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqIL   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllEE


DSSP  LLLEEEEEEE--LLLLlllllllllhhhlllleeeeelllleeeeelleelllLLLLLLl
Query NYRVIDVDNH--YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfIPNPTFd   60
ident     ||   |                                              ||  
Sbjct CPGFIDQHVHliGGGG-------------------------------------EAGPTT-   82
DSSP  EELEEEEEELllLLLL-------------------------------------LLLHHH-


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHhhHHHHHHHHLEEEEEEELL
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdaRIAVMDEQDIETAFMLPT  120
ident                                                 |        |  
Sbjct -----------------------------------rTPEV--ALSRLTEAGVTSVVGLLG  105
DSSP  -----------------------------------lLLLL--LHHHHHHLLEEEEEELLL


DSSP  HHHHHhhhllllhhhhhhhhhhHHHHHHHHLlllLLLL----LEEELLL--LLLLlhhhh
Query FGCGVeealkhdieatmasvhaFNLWLDEDWgfdRPDH----RIIAAPI--VSLAdptra  174
ident                           |       |                         
Sbjct TDSIS----------------rHPESLLAKT---RALNeegiSAWMLTGayHVPS--rti  144
DSSP  LLLLL----------------lLHHHHHHHH---HHHHhhllEEEEEEEllLLLL--lll


DSSP  hHHHHHH-HHLL-LLLEELLL----LLLLlllllllllLHHH-HHHHHHHHHH------L
Query vEEVDFV-LARG-AKLVLVRP----APVPglvkprslgDRSH-DPVWARLAEA------G  221
ident    |            |           |         |  |     |            
Sbjct tGSVEKDvAIIDrVIGVXCAIsdhrSAAP---------DVYHlANMAAESRVGgllggkP  195
DSSP  lLLHHHHhHHLLlEEEEEEEEllllLLLL---------LHHHhHHHHHHHHHHhhhhllL


DSSP  LLEEEELlllllhhhhhhllllllhhhhhhhLLHHhhHHHHHHHhlLHHH-HLLLL-LEE
Query VPVGFHLsdsgylhiaaawggakdpldqvllDDRAihDTMASMIvhGVFT-RHPKL-KAV  279
ident     ||                          |                        |  
Sbjct GVTVFHM------------------------GDSK--KALQPIY--DLLEnCDVPIsKLL  227
DSSP  LEEEEEE------------------------LLLL--LLLHHHH--HHHHlLLLLHhHEE


DSSP  EElLLLL---HHHHhhhhhhhhhhhlhhhllllhhhHHHH-HEEELLLL------LLLH-
Query SIeNGSY---FVHRlikrlkkaantqpqyfpedpveQLRN-NVWIAPYY------EDDL-  328
ident                                             |               
Sbjct PT-HVNRnvpLFEQ--------------------alEFARkGGTIDITSsidepvAPAEg  266
DSSP  EE-LHHHlhhHHHH--------------------hhHHHHlLLLEEEELllllllLHHHh


DSSP  -HHHHHH-HLHHHLLLLLLLLL---------------LLLLLLHHHHHHHHL---LLLHH
Query -PELARV-IGVDKILFGSDWPH---------------GEGLASPVSFTAELK---GFSES  368
ident         |        ||                    |          |     || |
Sbjct iARAVQAgIPLARVTLSSDGNGsqpffddegnlthigVAGFETLLETVQVLVkdyDFSIS  326
DSSP  hHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeeELLLHHHHHHHHHHHhhhLLLHH


DSSP  HHHHHHLHHHHHHHL--------------------------------------------l
Query DIRKIMRDNALDLLG--------------------------------------------v  384
ident |            |                                              
Sbjct DALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgt  386
DSSP  HHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeelleeeeelleelllll


DSSP  llll
Query qvgs  388
ident     
Sbjct fetd  390
DSSP  llll


No 33: Query=4dziC Sbjct=2vc5A Z-score=12.3

back to top
DSSP  ------------llllLEEEEEEELLLLllLLLLlllhhhllllEEEEelllleeeeell
Query ------------alnyRVIDVDNHYYEPldSFTRhldkkfkrrgVQMLsdgkrtwavigd   48
ident                        |      |              |              
Sbjct mriplvgkdsieskdiGFTLIHEHLRVF--SEAV---------rQQWP------------   37
DSSP  llllllllllllhhhlLLEELLLLLLLL--LHHH---------hHHLH------------


DSSP  eellllllllllleelllllhhhhhllllllllhhhllleeLHHH-LHHHllhHHHHHHH
Query rvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkveRLAD-HPEYqnrDARIAVM  107
ident                                                             
Sbjct --------------------------------------hlyNEDEeFRNA---VNEVKRA   56
DSSP  --------------------------------------hhlLHHHhHHHH---HHHHHHH


DSSP  HHHLEEEEEEELlhhhhhhhhllllhhhhhhhhhhhhhHHHHHLL--llllLLLEEELLL
Query DEQDIETAFMLPtfgcgveealkhdieatmasvhafnlWLDEDWG--fdrpDHRIIAAPI  165
ident       |                                                 |   
Sbjct MQFGVKTIVDPT---------------------vmglgRDIRFMEkvvkatGINLVAGTG   95
DSSP  HHLLLLEEEELL---------------------lllllLLHHHHHhhhhllLLEEEELEE


DSSP  L----------lllLHHHHHHHHHHHHH-------LLLLLEELLL---LLLLlllllLLL
Query V----------slaDPTRAVEEVDFVLA-------RGAKLVLVRP---APVPglvkpRSL  205
ident                                      |  |                   
Sbjct IyiyidlpfyflnrSIDEIADLFIHDIKegiqgtlNKAGFVXIAAdepGITK-----DVE  150
DSSP  LlllllllhhhlllLHHHHHHHHHHHHHlllllllLLLLLEEEELlllLLLH-----HHH


DSSP  LlhhhHHHHHHHHHHLLLEEEELLllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHh
Query GdrshDPVWARLAEAGVPVGFHLSdsgylhiaaawggakdpldqvllDDRAIHDTMASMi  265
ident              |  ||   |                                      
Sbjct K--viRAAAIANKETKVPIITHSN----------------------aHNNTGLEQQRIL-  185
DSSP  H--hhHHHHHHHHHHLLLEEEELL----------------------lLLLHHHHHHHHH-


DSSP  hllhHHHLLL-lLEEEELLL----lLHHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEE
Query vhgvFTRHPK-lKAVSIENG----sYFVHRlikrlkkaantqpqyfpedpveqLRNNVWI  320
ident             |      |                                       |
Sbjct ----TEEGVDpgKILIGHLGdtdniDYIKK----------------------iADKGSFI  219
DSSP  ----HHLLLLhhHEEELLHHhlllhHHHHH----------------------hHHLLLEE


DSSP  LL------------lLLLLHHHHHHHHLHHHLLLLLLLL-----------------lLLL
Query AP------------yYEDDLPELARVIGVDKILFGSDWP-----------------hGEG  351
ident                       |      |||    |                       
Sbjct GLdrygldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctidwgtakpeykpklapRWS  279
DSSP  EEllllllllllhhhHHHHHHHHHHLLLLLLEEELLLLLlllllllllhhhhhhhllLLL


DSSP  LlLHHH--HHHHHL--LLLHHHHHHHHLHHHHHHHLlllll
Query LaSPVS--FTAELK--GFSESDIRKIMRDNALDLLGvqvgs  388
ident             ||  |  |  |  |   |           
Sbjct I-TLIFedTIPFLKrnGVNEEVIATIFKENPKKFFS-----  314
DSSP  L-LHHHhlHHHHHHllLLLHHHHHHHHLHHHHHHLL-----


No 34: Query=4dziC Sbjct=1j6pA Z-score=12.3

back to top
DSSP  -----------------------------------------------llLLLEEEEEEEL
Query -----------------------------------------------alNYRVIDVDNHY   13
ident                                                           | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  LlllllllllllhhhlllleeeeelllleeeeelleeLLLLLL-LLLLleelllllhhhh
Query YepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvNHFIPN-PTFDpiivpgcldllf   72
ident                                          |                  
Sbjct P------------------xtllrgvaedlsfeewlfSKVLPIeDRLT------------   90
DSSP  H------------------hhhhllllllllhhhhhhLLHHHHhLLLL------------


DSSP  hllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllll
Query rgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhd  132
ident                                        |                    
Sbjct --------------------ekxayYGTILAQXEXARHGIAGFVDXY-------------  117
DSSP  --------------------hhhhhHHHHHHHHHHHLLLEEEEEEEE-------------


DSSP  hhhhhhhhhhhhhHHHHHLLlLLLL-LLEEELLLLLL--LLHHHHHHHHHHHHHLLL---
Query ieatmasvhafnlWLDEDWGfDRPD-HRIIAAPIVSL--ADPTRAVEEVDFVLARGA---  186
ident                       |    |            |     ||            
Sbjct ------------fHEEWIAKaVRDFgXRALLTRGLVDsnGDDGGRLEENLKLYNEWNgfe  165
DSSP  ------------lLHHHHHHhHHHHlLEEEEEEEELLllLLLLLHHHHHHHHHHHHLlhh


DSSP  ----LLEELLLLLLlllllllLLLLhhhHHHHHHHHHHLLLEEEELlllllhhhhhhlll
Query ----KLVLVRPAPVpglvkprSLGDrshDPVWARLAEAGVPVGFHLsdsgylhiaaawgg  242
ident                      |        |         ||  ||              
Sbjct grifVGFGPHSPYL------cSEEY--lKRVFDTAKSLNAPVTIHL--------------  203
DSSP  hleeEEEEELLLLL------lLHHH--hHHHHHHHHHHLLLEEEEE--------------


DSSP  lllhhhhhhHLLHHhhhhHHHHHhLLHHhhlLLLLEEEELlLLLHHHHHHhhhhhhhhhl
Query akdpldqvlLDDRAihdtMASMIvHGVFtrhPKLKAVSIEnGSYFVHRLIkrlkkaantq  302
ident                                   |            |            
Sbjct ------yetSKEEY---dLEDIL-NIGL---KEVKTIAAH-CVHLPERYF----------  239
DSSP  ------lllLLLLL---lLHHHH-LLLL---LLLLEEEEE-LLLLLHHHH----------


DSSP  hhhllllhhHHHH-HHEEELLLL---------LLLHHHHHHHHLhhHLLLLLLLLLlLLL
Query pqyfpedpvEQLR-NNVWIAPYY---------EDDLPELARVIGvdKILFGSDWPHgEGL  352
ident            |                                  |   | |       
Sbjct ---------GVLKdIPFFVSHNPasnlklgngIAPVQRXIEHGX--KVTLGTDGAA-SNN  287
DSSP  ---------HHHLlLLEEEEELHhhhhhllllLLLHHHHHHLLL--EEEELLLLLL-LLL


DSSP  L-LHHHH-HHHHL--------LLLHHHHHHHHLHHHHHHHL-------------------
Query A-SPVSF-TAELK--------GFSESDIRKIMRDNALDLLG-------------------  383
ident                              |          |                   
Sbjct SlNLFFExRLASLlqkaqnprNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidl  347
DSSP  LlLHHHHhHHHHHhhhlllllLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeel


DSSP  -------------------------------------------------------lllll
Query -------------------------------------------------------vqvgs  388
ident                                                             
Sbjct dlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  llhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 35: Query=4dziC Sbjct=3gg7A Z-score=12.3

back to top
DSSP  llllLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alnyRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident       ||   |                                                
Sbjct ----SLIDFHVHLDL---------------------------------------------   11
DSSP  ----LLEEEEELHHH---------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEeEEEEELl
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIeTAFMLPt  120
ident                                     |    |      |    |      
Sbjct ------------------------------------YPDPVAVARACEERQL-TVLSVT-   33
DSSP  ------------------------------------LLLHHHHHHHHHHLLL-EEEELL-


DSSP  hhhhhhhhllllhhhhhhhHHHHHHHHHHHLlllLLLLLEEELLLLL----llLHHHHhH
Query fgcgveealkhdieatmasVHAFNLWLDEDWgfdRPDHRIIAAPIVS----laDPTRAvE  176
ident                      |                    |                 
Sbjct ------------------tTPAAWRGTLALA---AGRPHVWTALGFHpevvseRAADL-P   71
DSSP  ------------------lLHHHHHHHHHHH---LLLLLEEELLLLLhhhlllLHHHL-H


DSSP  HHHHHHHlLLLLEE-LLLLllllllLLLLllLHHH-HHHHHHHHHH-LLLEEEEllllll
Query EVDFVLArGAKLVL-VRPApvpglvKPRSlgDRSH-DPVWARLAEA-GVPVGFHlsdsgy  233
ident   |  |      |  |                         |     |     |      
Sbjct WFDRYLP-ETRFVGeVGLDgspslrGTWT-qQFAVfQHILRRCEDHgGRILSIH------  123
DSSP  HHHHHHH-HLLEEEeEELLllhhhhHHHH-hHHHHhHHHHHHHHHLlLEEEEEE------


DSSP  hhhhhhllllllhhhhhhhllhhHHHHHHHHHhlLHHHHLLLL-LEEEELLllLHHHHHh
Query lhiaaawggakdpldqvllddraIHDTMASMIvhGVFTRHPKL-KAVSIENgsYFVHRLi  292
ident                                         |                   
Sbjct -----------------------SRRAESEVL--NCLEANPRSgTPILHWY--SGSVTE-  155
DSSP  -----------------------LLLLHHHHH--HHHHHLHHHeEEEEELL--LLLHHH-


DSSP  hhhhhhhhhlhhhllllhhHHHH-HHEEELLLLLL----LHHHHHHHHLHHHLLLLLLLL
Query krlkkaantqpqyfpedpvEQLR-NNVWIAPYYED----DLPELARVIGVDKILFGSDWP  347
ident                            |               | |    |  |   | |
Sbjct ------------------lRRAIsLGCWFSVGPTMvrtqKGAALIRSMPRDRVLTETDGP  197
DSSP  ------------------hHHHHhLLLEEEELHHHhllhHHHHHHHHLLHHHEEELLLLL


DSSP  L-----LLLL-lLHHHHHHHH-LLLLH---HHHHHHhLHHHHHHHLLllll
Query H-----GEGL-aSPVSFTAEL-KGFSE---SDIRKImRDNALDLLGVqvgs  388
ident          |     |    | |          |     |   |||     
Sbjct FleldgQAALpwDVKSVVEGLsKIWQIpasEVERIV-KENVSRLLGT----  243
DSSP  LleellEELLhhHHHHHHHHHhHHHLLlhhHHHHHH-HHHHHHHHHL----


No 36: Query=4dziC Sbjct=3mkvA Z-score=12.2

back to top
DSSP  -----------------------------------------------------llLLLEE
Query -----------------------------------------------------alNYRVI    7
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEEELLlllllllllllhhhlllleeeeelllleeeeelleellLLLL-LLLLleelll
Query DVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhFIPN-PTFDpiivpg   66
ident |   |                                          |   |        
Sbjct DLHVHVV----------------------------------aiefNLPRvATLP------   80
DSSP  EEEELLL----------------------------------llllLHHHhLLLL------


DSSP  llhhhhhllllllllhhhllleeLHHH-LHHHllhhHHHHHHHHHLEEEEEEELLhhhhh
Query cldllfrgeipdgvdpaslmkveRLAD-HPEYqnrdARIAVMDEQDIETAFMLPTfgcgv  125
ident                                          |      |           
Sbjct -----------------------NVLVtLRAV----PIMRAMLRRGFTTVRDAGG-----  108
DSSP  -----------------------HHHHhHHHH----HHHHHHHHLLEEEEEELLL-----


DSSP  hhhllllhhhhhhhhhhhhhhHHHHlllLLLL-------lLEEEL-LLLL----------
Query eealkhdieatmasvhafnlwLDEDwgfDRPD-------hRIIAA-PIVS----------  167
ident                                         |        |          
Sbjct --------------------aGYPF---KQAVesglvegpRLFVSgRALSqtgghadpra  145
DSSP  --------------------lLHHH---HHHHhlllllllEEEELlLEEEllllllllll


DSSP  -----------------------LLLHHHHHHHHHHHHHLLLLLEELLLLL---llllll
Query -----------------------LADPTRAVEEVDFVLARGAKLVLVRPAP---vpglvk  201
ident                                  |   |  ||                  
Sbjct rsdymppdspcgccvrvgalgrvADGVDEVRRAVREELQMGADQIXIMASGgvasptdpv  205
DSSP  lllllllllllllllllllleeeLLLHHHHHHHHHHHHHHLLLLEEEELLLlllllllll


DSSP  llllLLHHH-HHHHHHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhllhHHHHH
Query prslGDRSH-DPVWARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllddrAIHDT  260
ident               |     |  |  |                                 
Sbjct gvfgYSEDEiRAIVAEAQGRGTYVLAH---------------------------aYTPAA  238
DSSP  llllLLHHHhHHHHHHHHLLLLLEEEE---------------------------eLLHHH


DSSP  HHHHHHllhhhhlllLLEEEELLLlLHHHHHhhhhhhhhhhlhhhllllhhHHHH-HHEE
Query MASMIVhgvftrhpkLKAVSIENGsYFVHRLikrlkkaantqpqyfpedpvEQLR-NNVW  319
ident  |                                                          
Sbjct IARAVR--------cGVRTIEHGN-LIDDET-------------------aRLVAeHGAY  270
DSSP  HHHHHH--------lLLLEEEELL-LLLHHH-------------------hHHHHhHLLE


DSSP  ELLLL------------------------------LLLHHHHHHHHLhhHLLLLLLLLLL
Query IAPYY------------------------------EDDLPELARVIGvdKILFGSDWPHG  349
ident   |                                        |     |  || |    
Sbjct VVPTLvtydalasegekyglppesiakiadvhgagLHSIEIMKRAGV--KMGFGTDLLGE  328
DSSP  EELLHhhhhhhhhhlllllllhhhhllhhhhhllhHHHHHHHHHHLL--LLLLLLLLLHH


DSSP  LLlLLHHHHHHHH-LLLLHHHHHHHHLHHHHHHHL-------------------------
Query EGlASPVSFTAEL-KGFSESDIRKIMRDNALDLLG-------------------------  383
ident             |    |               ||                         
Sbjct AQ-RLQSDEFRILaEVLSPAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplk  387
DSSP  HH-HHLLHHHHHHhLLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllll


DSSP  ----------------------lllll
Query ----------------------vqvgs  388
ident                            
Sbjct svdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllleeeelleeeeelll


No 37: Query=4dziC Sbjct=1a4mA Z-score=12.2

back to top
DSSP  --LLLLLEEEEEEELL--------------------------------------------
Query --ALNYRVIDVDNHYY--------------------------------------------   14
ident   | |        |                                              
Sbjct tpAFNKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
DSSP  llLLLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl


DSSP  -----lLLLLLLLlllhhhlllleeeeelllleeeeelleellllllllllleelllllh
Query -----ePLDSFTRhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcld   69
ident       |     |                                               
Sbjct kfdyymPVIAGCR-----------------------------------------------   73
DSSP  lhhhhhHHHLLLH-----------------------------------------------


DSSP  hhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhl
Query llfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveeal  129
ident                                                             
Sbjct ------------------------eaikRIAYEFVEMKAKEGVVYVEVRY----------   99
DSSP  ------------------------hhhhHHHHHHHHHHHHLLEEEEEEEE----------


DSSP  lllhhhhhhhHHHH------------------HHHHHHHLL------llllLLLEEELLL
Query khdieatmasVHAF------------------NLWLDEDWG------fdrpDHRIIAAPI  165
ident            |                                                
Sbjct ---------sPHLLanskvdpmpwnqtegdvtPDDVVDLVNqglqegeqafGIKVRSILC  150
DSSP  ---------lLHHHllllllllhhhlllllllHHHHHHHHHhhhhhhhhhhLLEEEEEEE


DSSP  LLLLLHHHHHHHHHHHHHLL---LLLEELL-LLLLlllllLLLLlLHHH-HHHHHHHHHH
Query VSLADPTRAVEEVDFVLARG---AKLVLVR-PAPVpglvkPRSLgDRSH-DPVWARLAEA  220
ident      |    |                               |                 
Sbjct CMRHQPSWSLEVLELCKKYNqktVVAMDLAgDETI-----EGSS-LFPGhVEAYEGAVKN  204
DSSP  EELLLHHHHHHHHHHHHHLLlllEEEEEEElLLLL-----LLHH-HLHHhHHHHHHHHHH


DSSP  LLLEEEEllllllhhhhhhllllllhhhhhhhlLHHHHHHHHHHHhLLHHhhlllllEEE
Query GVPVGFHlsdsgylhiaaawggakdpldqvlldDRAIHDTMASMIvHGVFtrhpklkAVS  280
ident |     |                                                     
Sbjct GIHRTVH------------------------agEVGSPEVVREAV-DILK------tERV  233
DSSP  LLEEEEE------------------------elLLLLHHHHHHHH-HLLL------lLEE


DSSP  ElLLLLHHhHHHHhhhhhhhhlhhhllllHHHHHH-HHEEELLLL-------------lL
Query IeNGSYFVhRLIKrlkkaantqpqyfpedPVEQLR-NNVWIAPYY-------------eD  326
ident    |                             |   |                      
Sbjct G-HGYHTI-EDEA----------------LYNRLLkENMHFEVCPwssyltgawdpkttH  275
DSSP  E-ELHHHH-HLHH----------------HHHHHHhLLLEEEELHhhhhhlllllllllL


DSSP  LHHHHHHHHLhhHLLLLLLLLLLLllLLHHHHHHHHL---LLLHHHHHHHhLHHHHHH-H
Query DLPELARVIGvdKILFGSDWPHGEglASPVSFTAELK---GFSESDIRKImRDNALDL-L  382
ident                   | |               |   || |         ||     
Sbjct AVVRFKNDKA--NYSLNTDDPLIF-kSTLDTDYQMTKkdmGFTEEEFKRL-NINAAKSsF  331
DSSP  HHHHHHHLLL--LEEELLLLLLLL-lLLHHHHHHHHHhllLLLHHHHHHH-HHHHHHLlL


DSSP  LLLL------------ll
Query GVQV------------gs  388
ident                   
Sbjct LPEEekkellerlyreyq  349
DSSP  LLHHhhhhhhhhhhhhll


No 38: Query=4dziC Sbjct=2oofA Z-score=12.1

back to top
DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------al    2
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLEEEEEEE-LLLL-----------------------------LLLLLLlllhhhllll
Query NYRVIDVDNH-YYEP-----------------------------LDSFTRhldkkfkrrg   32
ident     ||   |                                                  
Sbjct TPGLIDCHTHlIFAGsraeefelrqkgvpyaeiarkgggiistvRATRAA----------  110
DSSP  EELEEEEEELlLLLLllhhhhhhhhhlllhhhhhhllllhhhhhHHHHHL----------


DSSP  eeeeelllleeeeelleellllllllllleelllllhhhhhllllllllhhhllleelhh
Query vqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverla   92
ident                                                             
Sbjct -----------------------------------------------------------s  111
DSSP  -----------------------------------------------------------l


DSSP  hlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhHHHHHHHHHHHHLL
Query dhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdieatmaSVHAFNLWLDEDWG  152
ident           |          |                              |       
Sbjct edqlfELALPRVKSLIREGVTTVEIKS----------------gygLTLEDELKXLRVAR  155
DSSP  hhhhhHHHHHHHHHHHHHLEEEEEEEL----------------lllLLHHHHHHHHHHHH


DSSP  -lLLLL-LLEEELLLLL-----------lLLHHHHH-HHHHHHHH-LLLLLEELLLLLll
Query -fDRPD-HRIIAAPIVS-----------lADPTRAV-EEVDFVLA-RGAKLVLVRPAPvp  197
ident         |                            |          |  | |      
Sbjct rlGEALpIRVKTTLLAAhavppeyrddpdSWVETICqEIIPAAAEaGLADAVDVFCEH--  213
DSSP  hhHHHLlLEEEEEEEEEllllhhhlllhhHHHHHHHhLHHHHHHHlLLLLEEEEEELL--


DSSP  llllllLLLLhhhHHHHHHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhLLHHh
Query glvkprSLGDrshDPVWARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllDDRAi  257
ident                |       |  |  |                              
Sbjct ----igFSLA-qtEQVYLAADQYGLAVKGH----------------------xdqLSNL-  245
DSSP  ----llLLHH-hhHHHHHHHHHLLLEEEEE----------------------ellLLLL-


DSSP  hHHHHHhhhllhhhhlLLLLEEEElLLLLHHHHHhhhhhhhhhhlhhhllllhhHHHH-H
Query hDTMASmivhgvftrhPKLKAVSIeNGSYFVHRLikrlkkaantqpqyfpedpvEQLR-N  316
ident                             |                           |   
Sbjct -GGSTL--------aaNFGALSVD-HLEYLDPEG-------------------iQALAhR  276
DSSP  -LHHHH--------hhHLLLLEEE-ELLLLLHHH-------------------hHHHHhH


DSSP  HEEELLLL----------LLLHHHHHHHHLhhHLLLLLLLLLLLL-LLLHHHH-HHHHL-
Query NVWIAPYY----------EDDLPELARVIGvdKILFGSDWPHGEG-LASPVSF-TAELK-  363
ident  |                      |            ||   |     |           
Sbjct GVVATLLPtafyflketkLPPVVALRKAGV--PXAVSSDINPGTApIVSLRXAxNXACTl  334
DSSP  LLEEEELHhhhhhlllllLLLHHHHHHLLL--LEEELLLLLLLLLlLLLHHHHhHHHHHh


DSSP  -LLLHHHHHHHHLHHHHHHHL---------------------------------------
Query -GFSESDIRKIMRDNALDLLG---------------------------------------  383
ident  |             |   ||                                       
Sbjct fGLTPVEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsyligvdqlvsr  394
DSSP  hLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlllllleeee


DSSP  ----lllll
Query ----vqvgs  388
ident          
Sbjct vvngeetlh  403
DSSP  eelleelll


No 39: Query=4dziC Sbjct=4c5yA Z-score=12.0

back to top
DSSP  ---------------------------------------------------------llL
Query ---------------------------------------------------------alN    3
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  LLEEEEEEE-LLLL------LLLLLLLllhhhlllleeeeelllleeeeelleellllll
Query YRVIDVDNH-YYEP------LDSFTRHldkkfkrrgvqmlsdgkrtwavigdrvnhfipn   56
ident     |   |                 |                                 
Sbjct PGLWDCHMHfGGDDdyyndyTSGLATH---------------------------------   87
DSSP  ELEEEEEELlLLLLllllllHHHHHLL---------------------------------


DSSP  llllleelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEE
Query ptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAF  116
ident                                                             
Sbjct ------------------------------------passgARLARGCWEALQNGYTSYR  111
DSSP  ------------------------------------hhhhhHHHHHHHHHHHHLLEEEEE


DSSP  EELlhhhhhhhhllllhhhhhhhhhhhhhhhhhHLLL--LLLL-------lLEEEL-LLL
Query MLPtfgcgveealkhdieatmasvhafnlwldeDWGF--DRPD-------hRIIAA-PIV  166
ident  |                                 |                        
Sbjct DLA------------------------------GYGCevAKAIndgtivgpNVYSSgAAL  141
DSSP  ELL------------------------------LLHHhhHHHHhlllllllEEEELlLEE


DSSP  L-------------------------------------LLLHHHHHHHHHHHHHLLLLLE
Query S-------------------------------------LADPTRAVEEVDFVLARGAKLV  189
ident |                                               |     ||||  
Sbjct SqtaghgdifalpagevlgsygvmnprpgywgagplciADGVEEVRRAVRLQIRRGAKVI  201
DSSP  EllllllllllllhhhhhhhhlllllllllllllleeeLLLHHHHHHHHHHHHHHLLLLE


DSSP  ELLLLL---llllllllllLLHHH-HHHHHHHHHHLLLEEEEllllllhhhhhhllllll
Query LVRPAP---vpglvkprslGDRSH-DPVWARLAEAGVPVGFHlsdsgylhiaaawggakd  245
ident  |                              |     |  |                  
Sbjct XVMASGgvmsrddnpnfaqFSPEElKVIVEEAARQNRIVSAH------------------  243
DSSP  EEELLLlllllllllllllLLHHHhHHHHHHHHHLLLLEEEE------------------


DSSP  hhhhhhhllhHHHHHHHHHHHllhhhhlllLLEEEEllLLLHHHHHHhhhhhhhhhlhhh
Query pldqvllddrAIHDTMASMIVhgvftrhpkLKAVSIenGSYFVHRLIkrlkkaantqpqy  305
ident                    |                                        
Sbjct ---------vHGKAGIMAAIK--------aGCKSLE--HVSYADEEV-------------  271
DSSP  ---------eLLHHHHHHHHH--------hLLLEEE--ELLLLLHHH-------------


DSSP  llllhhHHHH-HHEEELLLL-----------------------------LLLHHHHHHHH
Query fpedpvEQLR-NNVWIAPYY-----------------------------EDDLPELARVI  335
ident       |                                                     
Sbjct -----wELMKeKGILYVATRsvieiflasngeglvkeswaklqaladshLKAYQGAIKAG  326
DSSP  -----hHHHHhHLLEEELLHhhhhhhhhhllllllllhhhlllhhhhhhHHHHHHHHHLL


DSSP  LhhHLLLLLLLLlllllLLHHHHHHHHL---LLLHHHHHHHHLHHHHHHHLL--------
Query GvdKILFGSDWPhgeglASPVSFTAELK---GFSESDIRKIMRDNALDLLGV--------  384
ident     |  | |                     |       |    ||    |         
Sbjct V--TIALGTDTA---pgGPTALELQFAVergGMTPLEAIKAATANAPLSVGPqapltgql  381
DSSP  L--LEELLLLLL---llLLLHHHHHHHHhllLLLHHHHHHHHLLLHHHHHHHhlllllll


DSSP  ---------------------------------------------------llll
Query ---------------------------------------------------qvgs  388
ident                                                        
Sbjct regyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  llllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 40: Query=4dziC Sbjct=3nqbA Z-score=12.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  --------------LLLLLEEEEEEELLlllllllllllhhhlllleeeeelllleeeee
Query --------------ALNYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavi   46
ident                     ||   |                                  
Sbjct srrdaaqvidaggaYVSPGLIDTHXHIE--------------------------------   88
DSSP  lllleeeeeellllEEEELEEEEEELHH--------------------------------


DSSP  lleellllllllllleelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHH
Query gdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAV  106
ident                                                        |  | 
Sbjct ------------------------------------------------ssXITPAAYAAA  100
DSSP  ------------------------------------------------hhLLLHHHHHHH


DSSP  HHHHLEEEEEEELLHHhhhhhhllllhhhhhhHHHHHHHHHHHHLlllLLLL-LEEELLL
Query MDEQDIETAFMLPTFGcgveealkhdieatmaSVHAFNLWLDEDWgfdRPDH-RIIAAPI  165
ident        |    |                          |             | |    
Sbjct VVARGVTTIVWDPHEF-------------gnvHGVDGVRWAAKAI---ENLPlRAILLAP  144
DSSP  HHLLLEEEEEELLHHH-------------hhhHLHHHHHHHHHHH---LLLLlEEEEEEL


DSSP  LL--------lllhhHHHHHHHHHHHLL-LLLEELLLLLlllllllLLLL-LHHH-HHHH
Query VS--------ladptRAVEEVDFVLARG-AKLVLVRPAPvpglvkpRSLG-DRSH-DPVW  214
ident                         |                     |             
Sbjct SCvpsapglerggadFDAAILADLLSWPeIGGIAEIXNX-------RGVIeRDPRxSGIV  197
DSSP  LLlllllllllllllLLHHHHHHHHLLLlEEEEEEELLH-------HHHHlLLHHhHHHH


DSSP  HHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhllhHHHH---hHHHHhhLLHHh
Query ARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllddrAIHD---tMASMivHGVFt  271
ident      |   |  |                            |                  
Sbjct QAGLAAEKLVCGH----------------------------ARGLknadLNAF--XAAG-  226
DSSP  HHHHHHLLEEEEL----------------------------LLLLlhhhHHHH--HHLL-


DSSP  hlllllEEEElLLLL--HHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEELL---LLLL
Query rhpklkAVSIeNGSY--FVHRlikrlkkaantqpqyfpedpveqLRNNVWIAP---YYED  326
ident                                             ||    |         
Sbjct -----vSSDH-ELVSgeDLXA----------------------kLRAGLTIELrgsHDHL  258
DSSP  -----lLEEL-LLLLhhHHHH----------------------hHHLLLEEEEellLHHH


DSSP  --LHHHHHH--hhLHHHLLLLLLLLLL---lllLLHHHH-HHHHL-LLLHHHHHHHHLHH
Query --DLPELAR--viGVDKILFGSDWPHG---eglASPVSF-TAELK-GFSESDIRKIMRDN  377
ident                       |                       |            |
Sbjct lpEFVAALNtlghLPQTVTLCTDDVFPddllqgGGLDDVvRRLVRyGLKPEWALRAATLN  318
DSSP  hhHHHHHHHhhllLLLLEEEELLLLLHhhhhhlLLHHHHhHHHHHlLLLHHHHHHHHLHH


DSSP  HHHHHLLL----------------------------------------------------
Query ALDLLGVQ----------------------------------------------------  385
ident |   ||                                                      
Sbjct AAQRLGRSdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvl  378
DSSP  HHHHHLLLlllllllllllleeeellllllleeeeeelleeeeelleelllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  385
ident                                                             
Sbjct kgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvt  438
DSSP  llllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  385
ident                                                             
Sbjct hrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggx  498
DSSP  llllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  385
ident                                                             
Sbjct avasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatl  558
DSSP  eeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhllll


DSSP  --------------------------lll
Query --------------------------vgs  388
ident                              
Sbjct acnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllleelllleeelllleeellleeel


No 41: Query=4dziC Sbjct=2uz9A Z-score=11.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  -----lllLLEEEEEEELL-----------------------LLLLLLLLlllhhhllll
Query -----alnYRVIDVDNHYY-----------------------EPLDSFTRhldkkfkrrg   32
ident             |   |                                           
Sbjct lshheffmPGLVDTHIHASqysfagssidlpllewltkytfpAEHRFQNI----------  110
DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhhhlhhhHHHHHHLH----------


DSSP  eeeeelllleeeeelleellllllllllleelllllhhhhhllllllllhhhllleelhh
Query vqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverla   92
ident                                                             
Sbjct ------------------------------------------------------------  110
DSSP  ------------------------------------------------------------


DSSP  hlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhhhhhHHHHHHHhLL
Query dhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdieatmasvhaFNLWLDEdWG  152
ident                      ||                                     
Sbjct -dfaeEVYTRVVRRTLKNGTTTACYFA---------------------tiHTDSSLL-LA  147
DSSP  -hhhhHHHHHHHHHHHHLLEEEEEEEL---------------------llLHHHHHH-HH


DSSP  LL-LLLLL-EEELLLLLLL---------LHHHHHHHHHHHHHLL--------LLLEELLL
Query FD-RPDHR-IIAAPIVSLA---------DPTRAVEEVDFVLARG--------AKLVLVRP  193
ident                                    |                   |  | 
Sbjct DItDKFGQrAFVGKVCMDLndtfpeykeTTEESIKETERFVSEMlqknysrvKPIVTPRF  207
DSSP  HHhHHHLLeEEEELEELLLlllllllllLHHHHHHHHHHHHHHHhhhlllleEEEEEELL


DSSP  LLLllllllllllLHHH-HHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhhhhH
Query APVpglvkprslgDRSH-DPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldqvlL  252
ident                                   |                         
Sbjct SLS---------cSETLmGELGNIAKTRDLHIQSHI--------------------senR  238
DSSP  HHH---------lLHHHhHHHHHHHHHHLLEEEEEE--------------------lllH


DSSP  LLH--------hhhHHHHHHHHLlhhhhllllLEEEELlLLLHHHHHhhhhhhhhhhlhh
Query DDR--------aihDTMASMIVHgvftrhpklKAVSIEnGSYFVHRLikrlkkaantqpq  304
ident |                               | |    | |                  
Sbjct DEVeavknlypsykNYTSVYDKN----nlltnKTVMAH-GCYLSAEE-------------  280
DSSP  HHHhhhhhhlllllLHHHHHHHL----lllllLEEEEE-LLLLLHHH-------------


DSSP  hllllhhHHHH-HHEEELLLL---------LLLHHHHHHHHLhhHLLLLLLLLllLLLL-
Query yfpedpvEQLR-NNVWIAPYY---------EDDLPELARVIGvdKILFGSDWPhgEGLA-  353
ident                 ||                 |        ||  | |     |   
Sbjct ------lNVFHeRGASIAHCPnsnlslssgFLNVLEVLKHEV--KIGLGTDVA--GGYSy  330
DSSP  ------hHHHHhHLLEEEELHhhhhhllllLLLHHHHHHLLL--EEEELLLLL--LLLLl


DSSP  LHHHH-HHHHL-------------LLLHHHHHHHHLHHHHH-HHLLL-------------
Query SPVSF-TAELK-------------GFSESDIRKIMRDNALD-LLGVQ-------------  385
ident |                                         |                 
Sbjct SMLDAiRRAVMvsnillinkvnekSLTLKEVFRLATLGGSQaLGLDGeignfevgkefda  390
DSSP  LHHHHhHHHHHhhhhhhhllllllLLLHHHHHHHHLHHHHHhLLLLLlllllllllllle


DSSP  ---------------------------------------------------lll
Query ---------------------------------------------------vgs  388
ident                                                       
Sbjct ilinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  eeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 42: Query=4dziC Sbjct=2ogjA Z-score=11.5

back to top
DSSP  ----------------------------------------------------LLLLLEEE
Query ----------------------------------------------------ALNYRVID    8
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaaFISPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeellllEEEELEEE


DSSP  EEEELLLLlllllllllhhhlllleeeeelllleeeeelleellllllllllleelllll
Query VDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcl   68
ident    |                                                        
Sbjct LHVHIWHG----------------------------------------------------   68
DSSP  EEELLLLL----------------------------------------------------


DSSP  hhhhhllllllllhhhllleelhhhlhhhllhhhHHHH-HHHHLEEEEEEELLhhhhhhh
Query dllfrgeipdgvdpaslmkverladhpeyqnrdaRIAV-MDEQDIETAFMLPTfgcgvee  127
ident                                   |      |    |             
Sbjct ----------------------------gtdisiRPSEcGAERGVTTLVDAGS-------   93
DSSP  ----------------------------llllllLHHHlLHHHLEEEEEEELL-------


DSSP  hllllhhhhhhhHHHHHHHHHHHLLllllLLLEEELLLLL------------LLLHH-HH
Query alkhdieatmasVHAFNLWLDEDWGfdrpDHRIIAAPIVS------------LADPT-RA  174
ident               |      |         || |                 | |     
Sbjct -----------aGEANFHGFREYII-epsRERIKAFLNLGsiglvacnrvpeLRDIKdID  141
DSSP  -----------lLLLLHHHHHHHLL-lllLLEEEEEEELLllllllllllllLLLHHhLL


DSSP  HHHHHHHHHLL---LLLEELLLL--LLLLllllLLLLlhhhHHHHHHHHHHLLLEEEEll
Query VEEVDFVLARG---AKLVLVRPA--PVPGlvkpRSLGdrshDPVWARLAEAGVPVGFHls  229
ident         |          ||                               ||   |  
Sbjct LDRILECYAENsehIVGLXVRAShvITGS----WGVT--pvKLGKKIAKILKVPXXVH--  193
DSSP  HHHHHHHHHLLlllEEEEEEEELhhHHLL----LLLH--hhHHHHHHHHHHLLLEEEE--


DSSP  llllhhhhhhllllllhhhhhhhllhHHHH--HHHHHHhlLHHHhllllLEEEELLLLL-
Query dsgylhiaaawggakdpldqvllddrAIHD--TMASMIvhGVFTrhpklKAVSIENGSY-  286
ident                                                    |        
Sbjct --------------------------VGEPpaLYDEVL--EILG----pGDVVTHCFNGk  221
DSSP  --------------------------ELLLllLHHHHH--HHLL----lLLEEELLLLLl


DSSP  ---HHHHhHHHHhhhhhhlhhhllllHHHHHhHHEEELL-----LLLLL-HHHHH-HHHL
Query ---FVHRlIKRLkkaantqpqyfpedPVEQLrNNVWIAP-----YYEDD-LPELA-RVIG  336
ident            |                |                           |   
Sbjct sgsSIXE-DEDL------------fnLAERC-EGIRLDIghggaSFSFKvAEAAIaRGLL  267
DSSP  lllLLLL-LHHH------------hhHHHHL-LLLEEELlllllLLLHHhHHHHHhLLLL


DSSP  hhHLLLLLLLLLLLL---LLLHHHHHHHHL--LLLHHHHHHHHLHHHHHHHL--------
Query vdKILFGSDWPHGEG---LASPVSFTAELK--GFSESDIRKIMRDNALDLLG--------  383
ident         |                   |                |              
Sbjct --PFSISTDLHGHSXnfpVWDLATTXSKLLsvDXPFENVVEAVTRNPASVIRldxenrld  325
DSSP  --LLLLLLLLLLLLLlllLLLHHHHHHHHHhlLLLHHHHHHLLLHHHHHHLLllllllll


DSSP  -------------------------------------------------lllll
Query -------------------------------------------------vqvgs  388
ident                                                       
Sbjct vgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 43: Query=4dziC Sbjct=3icjA Z-score=11.1

back to top
DSSP  --------------------------------------------------------llLL
Query --------------------------------------------------------alNY    4
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LEEEEEEELLLllllllllllhhhlllleeeeeLLLLEEEeelleelllllllLLLL---
Query RVIDVDNHYYEpldsftrhldkkfkrrgvqmlsDGKRTWAvigdrvnhfipnpTFDP---   61
ident    |   |  |                        |                        
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelverVKKGRGR-----------iiFGFGwdq  109
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhHHLLLLL-----------leEEEEelh


DSSP  -----------------------------------------eelllllhhhhhlllllll
Query -----------------------------------------iivpgcldllfrgeipdgv   80
ident                                                             
Sbjct delgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivrerale  169
DSSP  hhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhh


DSSP  lhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhhh
Query dpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdieatmasv  140
ident                                                             
Sbjct esrkiinekiltvkdykHYIESAQEHLLSLGVHSVGFMS---------------------  208
DSSP  hhhhhhhhllllhhhhhHHHHHHHHHHHHLLEEEEEEEE---------------------


DSSP  hhhHHHHHHHLL----lllLLLLEEELLLLLlllhhhhhhHHHHH-----HHLL-----L
Query hafNLWLDEDWG----fdrPDHRIIAAPIVSladptraveEVDFV-----LARG-----A  186
ident                          |                |                 
Sbjct --vGEKALKALFeleregrLKMNVFAYLSPE---------LLDKLeelnlGKFEgrrlrI  257
DSSP  --eLHHHHHHHHhhhhlllLLLEEEEEELHH---------HHHHHhhhllLLEEllleeE


DSSP  LLEELLLL----------------llllllllLLLLLHhHHHHHHHHHHHLLLEEEElll
Query KLVLVRPA----------------pvpglvkpRSLGDRsHDPVWARLAEAGVPVGFHlsd  230
ident   |                                 |     |  |    |  |  |   
Sbjct WGVXLFVDgslgartallsepytdnpttsgelVMNKDE-IVEVIERAKPLGLDVAVH---  313
DSSP  EEEEEELLllllllllllllllllllllllllLLLHHH-HHHHHHHHLLLLLEEEEE---


DSSP  lllhhhhhhllllllhhhhhhhllhHHHHHHHHHHhlLHHHHLLlLLEEEELLLlLHHHH
Query sgylhiaaawggakdpldqvllddrAIHDTMASMIvhGVFTRHPkLKAVSIENGsYFVHR  290
ident                                        |                    
Sbjct ------------------------aIGDKAVDVAL--DAFEEAE-FSGRIEHAS-LVRDD  345
DSSP  ------------------------eLLHHHHHHHH--HHHHHHL-LLLEEEELL-LLLHH


DSSP  HHhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL--------------------lLLHH
Query LIkrlkkaantqpqyfpedpvEQLR-NNVWIAPYY--------------------eDDLP  329
ident                      |      | |                           | 
Sbjct QL-------------------ERIKeLKVRISAQPhfivsdwwivnrvgeerakwaYRLK  386
DSSP  HH-------------------HHHHhHLLEEEELLlhhhhlllhhhhhhhhhhhhlLLHH


DSSP  HHHHHHlhhHLLLLLLLLLllLLLLHHHHHHHHL---------LLLHHHHHHHHLHHHHH
Query ELARVIgvdKILFGSDWPHgeGLASPVSFTAELK---------GFSESDIRKIMRDNALD  380
ident  |       |  |  | |     | |                   |              
Sbjct TLSSIT---KLGFSTDSPI--EPADPWVSIDAAVnryvvdpgeRVSREEALHLYTHGSAQ  441
DSSP  HHHHHL---LEEELLLLLL--LLLLHHHHHHHHHhlllllhhhLLLHHHHHHHLLHHHHH


DSSP  -HHLL------------------llll
Query -LLGV------------------qvgs  388
ident   |                        
Sbjct vTLAEdlgklergfraeyiildrdplk  468
DSSP  hLLLLlllllllllllleeeellllll


No 44: Query=4dziC Sbjct=1a5kC Z-score=10.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ---llLLLEEEEEEELLlllllllllllhhhlllleeeeelllleeeeelleelllllll
Query ---alNYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnp   57
ident          ||   |                                             
Sbjct egkivTAGGIDTHIHWI-------------------------------------------  137
DSSP  llleeEELEEEEEEELL-------------------------------------------


DSSP  lllleelllllhhhhhllllllllhhhllleelhhhlhhhllHHHHHHHHHHHLEEEEEE
Query tfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyqnRDARIAVMDEQDIETAFM  117
ident                                                         |   
Sbjct ------------------------------------------CPQQAEEALVSGVTTMVG  155
DSSP  ------------------------------------------LLLHHHHHHHHLEEEEEE


DSSP  EL------LHHHhhhhhllllhhhhhhhhhhHHHHHHHHLLllLLLL--LEEELLLLLLL
Query LP------TFGCgveealkhdieatmasvhaFNLWLDEDWGfdRPDH--RIIAAPIVSLA  169
ident         |                         |               |         
Sbjct GGtgpaagTHAT----------------tctPGPWYISRMLqaADSLpvNIGLLGKGNVS  199
DSSP  ELllllhhHHHL----------------lllLHHHHHHHHHhhHLLLllEEEEEEELLLL


DSSP  lhhhHHHHHHHHHHLLLLLEELLL---LLLLllllllllllhhhHHHHHHHHHHLLLEEE
Query dptrAVEEVDFVLARGAKLVLVRP---APVPglvkprslgdrshDPVWARLAEAGVPVGF  226
ident              | |           |                |       |    |  
Sbjct ----QPDALREQVAAGVIGLEIHEdwgATPA-----------aiDCALTVADEMDIQVAL  244
DSSP  ----LHHHHHHHHHHLLLEEEEEHhhlLLHH-----------hhHHHHHHHHHHLLEEEE


DSSP  EllllllhhhhhhllllllhhhhhhhllhHHHH---hHHHHHhLLHHHhlllLLEEEELL
Query HlsdsgylhiaaawggakdpldqvllddrAIHD---tMASMIvHGVFTrhpkLKAVSIEN  283
ident |                                                           
Sbjct H---------------------------sDTLNesgfVEDTL-AAIGG----RTIHTFHT  272
DSSP  E---------------------------lLLLLllllHHHHH-HHHLL----LLEEELLL


DSSP  LL-------LHHHhhhhhhhhhhhhlhhhllllhhhhHHHHEEELL---LLLL-------
Query GS-------YFVHrlikrlkkaantqpqyfpedpveqLRNNVWIAP---YYED-------  326
ident                                         |                   
Sbjct EGaggghapDIIT----------------------acAHPNILPSStnpTLPYtlntide  310
DSSP  LLlllllllLHHH----------------------hhHLLLEEEEEehhHLLLlllhhhh


DSSP  ---------------------------------LHHHHHHhhlHHHLLLLLLLLLlLLLL
Query ---------------------------------DLPELARvigVDKILFGSDWPHgEGLA  353
ident                                                |  ||     |  
Sbjct hldmlmvchhldpdiaedvafaesrirretiaaEDVLHDL---GAFSLTSSDSQA-MGRV  366
DSSP  hhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHHL---LLLLEEELLLLL-LLLL


DSSP  -LHHHHH-HHHLL-----------------lLHHHHHHHHLHHHHHHHL-----------
Query -SPVSFT-AELKG-----------------fSESDIRKIMRDNALDLLG-----------  383
ident       |                                   |     |           
Sbjct gEVILRTwQVAHRmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGiahevgsievg  426
DSSP  lLHHHHHhHHHHHhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  383
ident                                                             
Sbjct kladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhc  486
DSSP  lllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  383
ident                                                             
Sbjct rltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdg  546
DSSP  leeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeell


DSSP  ---------------lllll
Query ---------------vqvgs  388
ident                     
Sbjct elitsepadvlpmaqryflf  566
DSSP  eellllllllllllllllll


No 45: Query=4dziC Sbjct=1j5sA Z-score=10.5

back to top
DSSP  ---------------------LLLLLEEEEEEELLLLlllllllllhhhlllleeeeell
Query ---------------------ALNYRVIDVDNHYYEPldsftrhldkkfkrrgvqmlsdg   39
ident                             |  ||                           
Sbjct hmflgedylltnraavrlfneVKDLPIVDPHNHLDAK-----------------------   37
DSSP  llllllllllllhhhhhhhhhHLLLLEEELLLLLLHH-----------------------


DSSP  lleeeeelleellllllllllLEEL-----------------------------------
Query krtwavigdrvnhfipnptfdPIIV-----------------------------------   64
ident                                                             
Sbjct ------divenkpwndiweveGATDhyvwelmrrcgvseeyitgsrsnkekwlalakvfp   91
DSSP  ------hhhhllllllhhhhhLLLLhhhhhhhhhllllhhhllllllhhhhhhhhhhhhh


DSSP  -lllLHHH--------hhllllLLLLhhhllleelhhhlhhhllhhHHHHHHHHHLEEEE
Query -pgcLDLL--------frgeipDGVDpaslmkverladhpeyqnrdARIAVMDEQDIETA  115
ident                                                          |  
Sbjct rfvgNPTYewihldlwrrfnikKVIS--eetaeeiweetkkklpemTPQKLLRDMKVEIL  149
DSSP  hhllLHHHhhhhhhhhhhllllLLLL--hhhhhhhhhhhhhhllllLHHHHHHHLLEEEE


DSSP  EEEllhhhhhhhhllllhhhhhhhHHHHHhhhHHHLL---llllLLLEEELLLLL-----
Query FMLptfgcgveealkhdieatmasVHAFNlwlDEDWG---fdrpDHRIIAAPIVS-----  167
ident                                  |             |            
Sbjct CTT--------------------dDPVST---LEHHRkakeaveGVTILPTWRPDramnv  186
DSSP  ELL--------------------lLLLLL---LHHHHhhhhhllLLEEELLLLLHhhhll


DSSP  -----------------------llLHHHHHHHHHHHHHLLLLLEELLLLL---------
Query -----------------------laDPTRAVEEVDFVLARGAKLVLVRPAP---------  195
ident                                         |                   
Sbjct dkegwreyvekmgerygedtstldgFLNALWKSHEHFKEHGCVASDHALLEpsvyyvden  246
DSSP  llllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHLLLLLEEEEEELLlllllllhh


DSSP  -------------lllLLLLLlllLHHHHHHHHHHHHHLLLEEEELLLlLLHHhhHHLL-
Query -------------vpgLVKPRslgDRSHDPVWARLAEAGVPVGFHLSDsGYLHiaAAWG-  241
ident                                     |       |               
Sbjct raravhekafsgekltQDEINdykAFMMVQFGKMNQETNWVTQLHIGA-LRDY--RDSLf  303
DSSP  hhhhhhhhhlllllllHHHHHhhhHHHHHHHHHHHHHHLLEEEEEELE-ELLL--LHHHh


DSSP  ---llllhhhHHHHllHHHHHHHHHHHhLLHHhhlLLLLEEEE---lllLLHHHHHhhhh
Query ---gakdpldQVLLddRAIHDTMASMIvHGVFtrhPKLKAVSI---engSYFVHRLikrl  295
ident                   |                 ||| |                   
Sbjct ktlgpdsggdISTN-fLRIAEGLRYFL-NEFD---GKLKIVLYvldpthLPTISTI----  354
DSSP  hhllllllllEELL-lLLHHHHHHHHH-HHLL---LLLLEEEEellhhhHHHHHHH----


DSSP  hhhhhhlhhhllllhHHHHhhHEEELLL---------LLLLHHHHHHHHLHHHL-LLLLL
Query kkaantqpqyfpedpVEQLrnNVWIAPY---------YEDDLPELARVIGVDKI-LFGSD  345
ident                      ||               |  |  || |           |
Sbjct --------------aRAFP--NVYVGAPwwfndspfgMEMHLKYLASVDLLYNLaGMVTD  398
DSSP  --------------hHHLL--LEEELLLllllllhhhHHHHHHHHHLLLLHHHLlLLLLL


DSSP  LLLlllllLHHH-HHHH-HLLL-------------LHHHHHHHHLHHHHHHHLlllll
Query WPHgeglaSPVS-FTAE-LKGF-------------SESDIRKIMRDNALDLLGvqvgs  388
ident         |    |                               |    |       
Sbjct SRKllsfgSRTEmFRRVlSNVVgemvekgqipikeARELVKHVSYDGPKALFF-----  451
DSSP  LLLllhhhHHHHhHHHHhHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL-----


No 46: Query=4dziC Sbjct=3iacA Z-score=10.4

back to top
DSSP  ----------------------lLLLLEEEEEEELLlllllllllllhhhlllleeeeel
Query ----------------------aLNYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsd   38
ident                              |   |                          
Sbjct atfxtedfllkndiartlyhkyaAPXPIYDFHCHLS------------------------   36
DSSP  llllllllllllhhhhhhhhhllLLLLEEELLLLLL------------------------


DSSP  llleeeeelleelllllllLLLL--EELLLLLhhhhhlllllllLHHH------------
Query gkrtwavigdrvnhfipnpTFDP--IIVPGCLdllfrgeipdgvDPAS------------   84
ident                                                             
Sbjct --------pqeiaddrrfdNLGQiwLEGDHYK---------wraLRSAgvdeslitgket   79
DSSP  --------hhhhhhlllllLHHHhhHLLLLHH---------hhhHHHLlllhhhllllll


DSSP  --------------------------------------------llleelhhhlhhhllh
Query --------------------------------------------lmkverladhpeyqnr  100
ident                                                             
Sbjct sdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpa  139
DSSP  lhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhh


DSSP  hHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhhhhhhHHHHhHHLL----lllL
Query dARIAVMDEQDIETAFMLPtfgcgveealkhdieatmasvhafNLWLdEDWG----fdrP  156
ident                                               | |           
Sbjct fSARGIXQQXNVRXVGTTD----------------------dpIDSL-EYHRqiaaddsI  176
DSSP  hLHHHHHHHLLEEEEELLL----------------------llLLLL-HHHHhhhhlllL


DSSP  LLLEEELLLL--LLLL--------------------------HHHHHHHHHHHHHLLLLL
Query DHRIIAAPIV--SLAD--------------------------PTRAVEEVDFVLARGAKL  188
ident |                                                 |   | |   
Sbjct DIEVAPSWRPdkVFKIeldgfvdylrkleaaadvsitrfddlRQALTRRLDHFAACGCRA  236
DSSP  LLEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHLLLLE


DSSP  EELLLLL-----------------------lllllLLLLllLHHHHHHHHHHHHHLLLEE
Query VLVRPAP-----------------------vpglvKPRSlgDRSHDPVWARLAEAGVPVG  225
ident                                                     |  |    
Sbjct SDHGIETlrfapvpddaqldailgkrlagetlselEIAQftTAVLVWLGRQYAARGWVXQ  296
DSSP  EEEEELLllllllllhhhhhhhhhhhhllllllhhHHHHhhHHHHHHHHHHHHHHLLEEE


DSSP  EELLLlLLHHhhhhlllLLLH-----hhhhhhLLHHhHHHHHHHHHlLHHHHLLLLLEEE
Query FHLSDsGYLHiaaawggAKDP-----ldqvllDDRAiHDTMASMIVhGVFTRHPKLKAVS  280
ident  |                              |                       |   
Sbjct LHIGA-IRNN----ntrXFRLlgpdtgfdsigDNNI-SWALSRLLD-SXDVTNELPKTIL  349
DSSP  EEELE-ELLL----lhhHHHHhllllllleelLLLL-HHHHHHHHH-HHHLLLLLLEEEE


DSSP  EllllLHHHHHhhhhhhhhhhlhhhllllhHHHH----hHHEEELLL--------LLLL-
Query IengsYFVHRLikrlkkaantqpqyfpedpVEQL----rNNVWIAPY--------YEDD-  327
ident           |                              |                  
Sbjct YclnpRDNEVL---------------atxiGNFQgpgiaGKVQFGSGwwfndqkdGXLRq  394
DSSP  EellhHHHHHH---------------hhhhHHLLlllllLLEEELLLlhhhllhhHHHHh


DSSP  HHHHHHHHLH-HHLLLLLLLLLlllLLLHHH-HHHHHLLL----------------LHHH
Query LPELARVIGV-DKILFGSDWPHgegLASPVS-FTAELKGF----------------SESD  369
ident |  |              |             |   |                       
Sbjct LEQLSQXGLLsQFVGXLTDSRS-flSYTRHEyFRRILCNLlgqwaqdgeipddeaxLSRX  453
DSSP  HHHHHHHLLHhHLLLLLLLLLL-llLLHHHHhHHHHHHHHhhhhhhlllllllhhhHHHH


DSSP  HHHHHLHHHHHHHLLLlll
Query IRKIMRDNALDLLGVQvgs  388
ident    |   ||          
Sbjct VQDICFNNAQRYFTIK---  469
DSSP  HHHHHLHHHHHHLLLL---


No 47: Query=4dziC Sbjct=4rdvB Z-score=10.0

back to top
DSSP  ---------------------------------------------llLLLEEEEEEELLl
Query ---------------------------------------------alNYRVIDVDNHYYe   15
ident                                                         |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-


DSSP  llllllllllhhhlllleeeeelllleeeeelleeLLLLL-LLLLLLEelllllhhhhhl
Query pldsftrhldkkfkrrgvqmlsdgkrtwavigdrvNHFIP-NPTFDPIivpgcldllfrg   74
ident                                                             
Sbjct ----------------qramaglaevagnpndsfwTWRELmYRMVARL------------   91
DSSP  ----------------hhhhlllllllllllllhhHHHHHhHHHHLLL------------


DSSP  lllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhh
Query eipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdie  134
ident                                 |                           
Sbjct -----------------speqieVIACQLYIEMLKAGYTAVAEFH-----------yvhh  123
DSSP  -----------------lhhhhhHHHHHHHHHHHHHLEEEEEEEE-----------llll


DSSP  hhhhhhhhhhHHHHHHLL--llllLLLEEELLLLLL-----------------LLHHHHH
Query atmasvhafnLWLDEDWG--fdrpDHRIIAAPIVSL-----------------ADPTRAV  175
ident             |                  |                            
Sbjct dldgrsyadpAELSLRISraasaaGIGLTLLPVLYShagfggqpasegqrrfiNGSEAYL  183
DSSP  llllllllllLHHHHHHHhhhhhhLLEEEEEELLLLeeellleellhhhllllLLHHHHH


DSSP  HHHHHHHHLL-----LLLEELLLLLLllllllllLLLHhHHHHH-HHHHhhLLLEEEEL-
Query EEVDFVLARG-----AKLVLVRPAPVpglvkprsLGDRsHDPVW-ARLAeaGVPVGFHL-  228
ident |      |                                  |  |       ||  |  
Sbjct ELLQRLRAPLeaaghSLGLCFHSLRA-------vTPQQ-IATVLaAGHD--DLPVHIHIa  233
DSSP  HHHHHHHHHHhhhllEELEEELLLLL-------lLHHH-HHHHHlLLLL--LLLEEEEEl


DSSP  ----lllLLHHHhhhllllllhhhhhhhllHHHHHHHHHHHhllhhhhllllLEEEELLL
Query ----sdsGYLHIaaawggakdpldqvllddRAIHDTMASMIvhgvftrhpklKAVSIENG  284
ident                               |                             
Sbjct eqqkevdDCQAW---------------sgrRPLQWLYENVA--------vdqRWCLVHAT  270
DSSP  llhhhhhHHHHH---------------hllLHHHHHHHHLL--------lllLEEEEELL


DSSP  lLHHHHHhhhhhhhhhhlhhhllllhhhhHHHHEEELL---------llLLLHHHHHHHH
Query sYFVHRLikrlkkaantqpqyfpedpveqLRNNVWIAP---------yyEDDLPELARVI  335
ident                               |                             
Sbjct -HADPAE------------------vaamARSGAVAGLclsteanlgdgIFPATDFLAQG  311
DSSP  -LLLHHH------------------hhhhHHHLLEEEElhhhhhhllllLLLHHHHHHLL


DSSP  LhhHLLLLLLLLLlllLLLHHHHH-HHHLL-----------------lLHHHHHHHHLHH
Query GvdKILFGSDWPHgegLASPVSFT-AELKG-----------------fSESDIRKIMRDN  377
ident |      |||        | |        |                              
Sbjct G--RLGIGSDSHV---SLSVVEELrWLEYGqrlrdrkrnrlyrddqpmIGRTLYDAALAG  366
DSSP  L--EEEELLLLLL---LLLHHHHHhHHHHHhhhhhlllllllllllllHHHHHHHHHHHH


DSSP  HHHHHL------------------------------------------------------
Query ALDLLG------------------------------------------------------  383
ident     ||                                                      
Sbjct GAQALGqpigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrw  426
DSSP  HHHHHLllllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeellee


DSSP  --------------------lllll
Query --------------------vqvgs  388
ident                          
Sbjct vvrdgrhageersarafvqvlgell  451
DSSP  eelllllllhhhhhhhhhhhhhhhl


No 48: Query=4dziC Sbjct=3ooqA Z-score=9.1

back to top
DSSP  ------------------------------------------------llLLLEEEEEEE
Query ------------------------------------------------alNYRVIDVDNH   12
ident                                                        |   |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  LllllllllllllhhhlllleeeeelllleeeeelleelllllllLLLLEelllllhhhh
Query YyepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnpTFDPIivpgcldllf   72
ident                                                             
Sbjct I-------------------------------------glfeegvGYYYS----------   73
DSSP  L-------------------------------------lllllllLHHHL----------


DSSP  hllllllllhhhllleelhhhlhhhLLHHH-HHHHHHHHLEEEEEEELLhhHHHHhhlll
Query rgeipdgvdpaslmkverladhpeyQNRDA-RIAVMDEQDIETAFMLPTfgCGVEealkh  131
ident                           |     |              |            
Sbjct -------dgneatdpvtphvkaldgFNPQDpAIERALAGGVTSVXIVPG--SANP-----  119
DSSP  -------llllllllllllllhhhhLLLLLhHHHHHHLLLEEEEEELLL--LLLL-----


DSSP  lhhhhhhhhhhhhhhhhhhllllLLLLleeellllllllhhhhhhhhhhhhhlLLLLEEL
Query dieatmasvhafnlwldedwgfdRPDHriiaapivsladptraveevdfvlarGAKLVLV  191
ident                                                             
Sbjct --------vggqgsvikfrsiivEECI------------------------vkDPAGLKX  147
DSSP  --------eeeeeeeeelllllhHHHE------------------------eeEEEEEEE


DSSP  LL--------------------LLLLlllllllllLHHHH--------------------
Query RP--------------------APVPglvkprslgDRSHD--------------------  211
ident                                                             
Sbjct AFgenpkrvygerkqtpstrxgTAGV-----irdyFTKVKnyxkkkelaqkegkeftetd  202
DSSP  ELlhhhhhhhhhlllllllhhhHHHH-----hhhhHHHHHhhhhhhhhhhhlllllllll


DSSP  ------HHHHHHHhhlLLEEEELlllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHH
Query ------PVWARLAeagVPVGFHLsdsgylhiaaawggakdpldqvllDDRAIHDTMASMI  265
ident           |      |   |                             |        
Sbjct lkxevgEXVLRKK---IPARXHA-----------------------hRADDILTAIRIAE  236
DSSP  hhhhhhHHHHLLL---LLEEEEE-----------------------lLHHHHHHHHHHHH


DSSP  hLLHHhhllllLEEEELLLlLHHHHhhhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL
Query vHGVFtrhpklKAVSIENGsYFVHRlikrlkkaantqpqyfpedpvEQLR-NNVWIAPYY  324
ident     |        |                                  |           
Sbjct -EFGF------NLVIEHGT-EAYKI--------------------sKVLAeKKIPVVVGP  268
DSSP  -HHLL------LEEEEELL-LHHHH--------------------hHHHHhHLLLEEELL


DSSP  -------------LLLH-HHHHHHHLhhHLLLLLLLLlllLLLL--HHHHHHHHL--LLL
Query -------------EDDL-PELARVIGvdKILFGSDWPhgeGLAS--PVSFTAELK--GFS  366
ident                     |        |    | |              |     |  
Sbjct lltfrtklelkdlTXETiAKLLKDGV--LIALXCDHP---VIPLefATVQAATAXryGAK  323
DSSP  lllllllhhhlllLLLHhHHHHHLLL--LEEELLLLL---LLLHhhHHHHHHHHHhhLLL


DSSP  HHHHHHHHLHHHHHHHL---------------------------------------llll
Query ESDIRKIMRDNALDLLG---------------------------------------vqvg  387
ident | |  ||   |    ||                                           
Sbjct EEDLLKILTVNPAKILGledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrr  383
DSSP  HHHHHHLLLHHHHHHLLllllllllllllllleeeelllllllllleeeeeelleeeeel


DSSP  l
Query s  388
ident  
Sbjct e  384
DSSP  l


No 49: Query=4dziC Sbjct=3qy6A Z-score=8.1

back to top
DSSP  lllllEEEEEEE-LLLLlllllllllhhhlllleeeeelllleeeeelleelllllllll
Query alnyrVIDVDNH-YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptf   59
ident       ||   |                                                
Sbjct -----MIDIHCHiLPAM-------------------------------------------   12
DSSP  -----LEELLLLlLLLL-------------------------------------------


DSSP  lleelllllhhhhhllllllllhhhllleelhhhLHHHllhHHHHHHHHHHLEEEEEEEL
Query dpiivpgcldllfrgeipdgvdpaslmkverladHPEYqnrDARIAVMDEQDIETAFMLP  119
ident                                                   | | |    |
Sbjct ----------------------------ddgagdSADS---IEMARAAVRQGIRTIIATP   41
DSSP  ----------------------------llllllHHHH---HHHHHHHHHLLLLEEELLL


DSSP  LhhHHHHHhllllhhhhhhhhhhHHHHHHHHLL-------llllllLEEEL--lllllll
Query TfgCGVEEalkhdieatmasvhaFNLWLDEDWG-------fdrpdhRIIAA--pivslad  170
ident                              |                              
Sbjct H--HNNGV------------yknEPAAVREAADqlnkrlikediplHVLPGqeiriygev   87
DSSP  E--ELLLL------------lllLHHHHHHHHHhhhhhhhhlllllEEELLleeellllh


DSSP  hhhhHHHHhhhhhllLLLEelllllllllllllllllhhhhhhhhhhhhhLLLEEEELll
Query ptraVEEVdfvlargAKLVlvrpapvpglvkprslgdrshdpvwarlaeaGVPVGFHLsd  230
ident                  |                                          
Sbjct eqdlAKRQ------lLSLN------------------------------dTKYILIEF--  109
DSSP  hhhhHLLL------lLLHH------------------------------hLLEEEEEL--


DSSP  lllhhhhhhllllllhhhhhhhLLHHhhHHHHHHHhLLHHhhLLLLLEEEELlLLLH---
Query sgylhiaaawggakdpldqvllDDRAihDTMASMIvHGVFtrHPKLKAVSIEnGSYF---  287
ident                       |                         |           
Sbjct --------------------pfDHVP--RYAEQLF-YDLQ--LKGYIPVIAH-PERNrei  143
DSSP  --------------------llLLLL--LLHHHHH-HHHH--HLLLEEEEEL-HHHLhhh


DSSP  --hHHHHhhhhhhhhhlhhhllllhhhHHHH-HEEELLLL-----------LLLHHHHHH
Query --vHRLIkrlkkaantqpqyfpedpveQLRN-NVWIAPYY-----------EDDLPELAR  333
ident      |                      |                            |  
Sbjct renPSLL-------------------yHLVEkGAASQITSgslagifgkqlKAFSLRLVE  184
DSSP  hhlLHHH-------------------hHHHHlLLEEEEEHhhhlllllhhhHHHHHHHHH


DSSP  HHLhhHLLLLLLLLL--LLLLlLHHHHHHHH-LLLLHHHHHHHhLHHHHHH-HLLL----
Query VIGvdKILFGSDWPH--GEGLaSPVSFTAEL-KGFSESDIRKImRDNALDL-LGVQ----  385
ident           ||                  | | |           ||  |         
Sbjct ANL--IHFVASDAHNvkTRNF-HTQEALYVLeKEFGSELPYML-TENAELLlRNQTifrq  240
DSSP  LLL--LLEEELLLLLllLLLL-LHHHHHHHHhHHHLLHHHHHH-HHHHHHHhLLLLllll


DSSP  ----lll
Query ----vgs  388
ident        
Sbjct ppqpvkr  247
DSSP  lllllll


No 50: Query=4dziC Sbjct=3au2A Z-score=8.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------------------lLLLLEEEEEEELLLllllllllllhhh
Query --------------------------------aLNYRVIDVDNHYYEpldsftrhldkkf   28
ident                                  |     |   |                
Sbjct yaalglpwippplredqgeveaalegrlpklleLPQVKGDLQVHSTY-------------  347
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllHHHLLEEEEELLLL-------------


DSSP  lllleeeeelllleeeeelleellllllllllleelllllhhhhhllllllllhhhllle
Query krrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkv   88
ident                                                             
Sbjct ------------------------------------------------------------  347
DSSP  ------------------------------------------------------------


DSSP  elhhhlhhHLLHHHHHHHHHHHLEEEEEEELLHH-HHHHhhllllhhhhhhhHHHHHHHH
Query erladhpeYQNRDARIAVMDEQDIETAFMLPTFG-CGVEealkhdieatmasVHAFNLWL  147
ident                                      |                   |  
Sbjct -----sdgQNTLEELWEAAKTMGYRYLAVTDHSPaVRVA----------ggpSPEEALKR  392
DSSP  -----lllLLLHHHHHHHHHHHLLLEEEEEEELHhHHLL----------lllLHHHHHHH


DSSP  HHHLL--llLLLL-LEEELlllllllhhhhhhhhhhhhhlllllEELLLLLlllllllll
Query DEDWG--fdRPDH-RIIAApivsladptraveevdfvlargaklVLVRPAPvpglvkprs  204
ident                  |                            |   |         
Sbjct VGEIRrfneTHGPpYLLAG-------------------------AEVDIHP---------  418
DSSP  HHHHHhhhhHHLLlEEEEE-------------------------EEEELLL---------


DSSP  lllhhhhhhhhhhhhhllLEEEELLlLLLHhhhhhllllllhhHHHHHLLHHHHHHHHHH
Query lgdrshdpvwarlaeagvPVGFHLSdSGYLhiaaawggakdplDQVLLDDRAIHDTMASM  264
ident                    |      |                                 
Sbjct ---dgtldypdwvlreldLVLVSVH-SRFN-------------LPKADQTKRLLKALENP  461
DSSP  ---lllllllhhhhllllEEEEELL-LLLL-------------LLHHHHHHHHHHHHLLL


DSSP  hhllhhhhlllLLEEEELLL--------------lLHHHhhhhhhhhhhhhlhhhllllh
Query ivhgvftrhpkLKAVSIENG--------------sYFVHrlikrlkkaantqpqyfpedp  310
ident               |                                             
Sbjct -----------FVHVLAHPTarllgrrapieadweAVFQ---------------------  489
DSSP  -----------LLLEELLLLlllllllllllllhhHHHH---------------------


DSSP  hhhHHHHEEELL-------LLLL-LHHHHHHHHLhhHLLLLLLLLLlllLLLHHH-HHHH
Query veqLRNNVWIAP-------YYED-DLPELARVIGvdKILFGSDWPHgegLASPVS-FTAE  361
ident        |              |              |    |                 
Sbjct -kaKEKGVAVEIdgyydrmDLPDdLARMAYGMGL--WISLSTDAHQ-tdHLRFMElAVGT  545
DSSP  -hhHHHLLEEEEellllllLLLHhHHHHHHHLLL--LEEEELLLLL-hhHHHHHHhHHHH


DSSP  -HLLLlhhHHHH-HHLH---hHHHHHLLLlll
Query -LKGFsesDIRK-IMRD---nALDLLGVQvgs  388
ident                       |  |      
Sbjct aQRAW--iGPERvLNTLdyedLLSWLKARrgv  575
DSSP  hHHLL--lLLLLlHHHLlhhhHHHHHHLLlll


No 51: Query=4dziC Sbjct=1v77A Z-score=7.9

back to top
DSSP  lllLLEEEEEEELLlllllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alnYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident       |  |                                                  
Sbjct ---VKFIEMDIRDK----------------------------------------------   11
DSSP  ---LLLEEEEELLH----------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhhllhhhhhHHHHHHlEEEEEEELL
Query piivpgcldllfrgeipdgvdpaslmkverladhpeyqnrdariAVMDEQdIETAFMLPT  120
ident                                                 |           
Sbjct -----------------------------------------eayELAKEW-FDEVVVSIK   29
DSSP  -----------------------------------------hhhHHHHHH-LLEEEEEEE


DSSP  hhHHHHhhllllhhhhhhhHHHHHHHHHHHLllllllllEEELlllllllhhhhhhhhhh
Query fgCGVEealkhdieatmasVHAFNLWLDEDWgfdrpdhrIIAApivsladptraveevdf  180
ident      |                                    |                 
Sbjct --FNEE------------vDKEKLREARKEY--------GKVA-----------------   50
DSSP  --ELLL------------lLHHHHHHHHHHH--------LLEE-----------------


DSSP  hhhlllllEELL-LLLLlllllllllllhhhhhhHHHHhhHLLLEEEELlllllhhhhhh
Query vlargaklVLVR-PAPVpglvkprslgdrshdpvWARLaeAGVPVGFHLsdsgylhiaaa  239
ident          |   | |                                            
Sbjct --------ILLSnPKPS------------lvrdtVQKF--KSYLIYVES-----------   77
DSSP  --------EEEElLLHH------------hhhhhHHHL--LLLEEEEEL-----------


DSSP  llllllhhhhhhhllhHHHHHHHHHhhllhhhhlllLLEEEELLL----lLHHHHHHhhh
Query wggakdpldqvllddrAIHDTMASMivhgvftrhpkLKAVSIENG----sYFVHRLIkrl  295
ident                                          |                  
Sbjct ----------------NDLRVIRYS--------iekGVDAIISPWvnrkdPGIDHVL---  110
DSSP  ----------------LLHHHHHHH--------hhlLLLEEELLLlllllLLLLHHH---


DSSP  hhhhhhlhhhllllhhHHHH-HHEEELLLL--------------LLLHHHHHHHHL--hh
Query kkaantqpqyfpedpvEQLR-NNVWIAPYY--------------EDDLPELARVIG--vd  338
ident                       ||                                    
Sbjct ---------------aKLMVkKNVALGFSLrpllysnpyeranlLRFMMKAWKLVEkykv  155
DSSP  ---------------hHHHHhHLLEEEEELhhhhhllhhhhhhhHHHHHHHHHHHHhhll


DSSP  HLLLLLLLLLLLLlLLHH-HHHHHHL--LLLHHHHHHHHLHHHHHHHLlllll
Query KILFGSDWPHGEGlASPV-SFTAELK--GFSESDIRKIMRDNALDLLGvqvgs  388
ident      |                      |                 |      
Sbjct RRFLTSSAQEKWD-VRYPrDLISLGVviGMEIPQAKASISMYPEIILK-----  202
DSSP  LEEEELLLLLHHH-LLLHhHHHHHHHhlLLLHHHHHHLLLHHHHHHHL-----


No 52: Query=4dziC Sbjct=2a3lA Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------------------------------LLLLLEEEEEEELL----llll
Query --------------------------------------ALNYRVIDVDNHYY----epld   18
ident                                         | |  |   |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLLLEEEEEEELLllllhhhh


DSSP  lllllllhhhlllleeeEELL-----------------------lleeeeelLEELLLL-
Query sftrhldkkfkrrgvqmLSDG-----------------------krtwavigDRVNHFI-   54
ident                    ||                                       
Sbjct lrfiksklrkepdevviFRDGtyltlrevfesldltgydlnvdlldvhadksTFHRFDKf  240
DSSP  hhhhhhhhhllllllleEELLeeelhhhhhhhhlllllllllllllllllllLLLLLLLl


DSSP  --------LLLLLLLEelllllhhhhhllllllllhhhllleelhhhlhhhlLHHHHHHH
Query --------PNPTFDPIivpgcldllfrgeipdgvdpaslmkverladhpeyqNRDARIAV  106
ident                                                             
Sbjct nlkynpcgQSRLREIF----------------------lkqdnliqgrflgeITKQVFSD  278
DSSP  hhhhllllLLHHHHHH----------------------lllllllllllhhhHHHHHHHH


DSSP  HHHHLEEEEEEELlhhhhhhhhllllhhhHHHHhHHHHHHHHHHllllLLLLLEEELLLL
Query MDEQDIETAFMLPtfgcgveealkhdieaTMASvHAFNLWLDEDwgfdRPDHRIIAAPIV  166
ident         |                                                   
Sbjct LEASKYQMAEYRI--------------siYGRKmSEWDQLASWIvnndLYSENVVWLIQL  324
DSSP  HLLLLLEEEEEEE--------------elLLLLlLHHHHHHHHHhlllLLLLLEEEEEEE


DSSP  LLL------------LHHHHHHHHHHH---------------hhLLLLLEELL-------
Query SLA------------DPTRAVEEVDFV---------------laRGAKLVLVR-------  192
ident                                                             
Sbjct PRLyniykdmgivtsFQNILDNIFIPLfeatvdpdshpqlhvflKQVVGFDLVddeskpe  384
DSSP  ELLhhhhllllllllLHHHHHHHLLHHhhhhhlhhhllllhhhhLLEEEEEEElllllll


DSSP  --------llllllLLLLLLLLLhhhHHHHHHHHH----------hLLLEEEEllllllh
Query --------papvpgLVKPRSLGDrshDPVWARLAE----------aGVPVGFHlsdsgyl  234
ident                               | |                   |       
Sbjct rrptkhmptpaqwtNAFNPAFSY-yvYYCYANLYVlnklreskgmtTITLRPH-------  436
DSSP  llllllllllllllLLLLLLHHH-hhHHHHHHHHHhhhhhllllllLLEELLL-------


DSSP  hhhhhllllllhhhhhhhlLHHHHHHHHHHHHllhhhhlllllEEEELllLLHHHHhHHH
Query hiaaawggakdpldqvlldDRAIHDTMASMIVhgvftrhpklkAVSIEngSYFVHRlIKR  294
ident                         |  |                                
Sbjct -----------------sgEAGDIDHLAATFL---------tcHSIAH--GINLRK-SPV  467
DSSP  -----------------llLLLLLHHHHHHHH---------hlLLLLL--LHHHHH-LHH


DSSP  HhhhhhhlhhhllllhHHHHH-HHEEELLLLL-----------LLHHHHHHHHLhhHLLL
Query LkkaantqpqyfpedpVEQLR-NNVWIAPYYE-----------DDLPELARVIGvdKILF  342
ident |                          |                  |             
Sbjct L---------------QYLYYlAQIGLAMSPLsnnslfldyhrNPFPVFFLRGL--NVSL  510
DSSP  H---------------HHHHHhHLLLEEELHHhhlllllllllLLHHHHHHLLL--LEEE


DSSP  LLLLLLLLL--lLLHHHHH-HHHL--LLLHHHHHHHHlHHHHHHH------------llL
Query GSDWPHGEG--lASPVSFT-AELK--GFSESDIRKIMrDNALDLL------------gvQ  385
ident   | |          |            |  |   |   |                    
Sbjct STDDPLQIHltkEPLVEEYsIAASvwKLSACDLCEIA-RNSVYQSgfshalkshwigkdY  569
DSSP  LLLLHHHHLlllLHHHHHHhHHHHhhLLLHHHHHHHH-HHHHHHLlllhhhhhhhllllL


DSSP  LLL--------------------------------------------
Query VGS--------------------------------------------  388
ident                                                
Sbjct YKRgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  LLLlhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 53: Query=4dziC Sbjct=3f2bA Z-score=7.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------LLLL--LEEEEEEELLLl
Query ------------------------------------------ALNY--RVIDVDNHYYEp   16
ident                                                        |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdTAPEgeKRVELHLHTPM-  119
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllLLLLllLLLLLLLLLLL-


DSSP  lllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhhhhlll
Query ldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgei   76
ident                                                             
Sbjct ------------------------------------------------------------  119
DSSP  ------------------------------------------------------------


DSSP  lllllhhhllleelhhhlhhHLLHhHHHHHHHHHLEEEEEEELLHHhhhhhhllllhhhh
Query pdgvdpaslmkverladhpeYQNRdARIAVMDEQDIETAFMLPTFGcgveealkhdieat  136
ident                            |                                
Sbjct --------------sqmdavTSVT-KLIEQAKKWGHPAIAVTDHAV--------------  150
DSSP  --------------llllllLLHH-HHHHHHHHLLLLLEEELLLLL--------------


DSSP  hhhhhhhhhHHHHHLL--lllLLLLEEELlllllllhhhhhhhhhhhhhlllllEELLLL
Query masvhafnlWLDEDWG--fdrPDHRIIAApivsladptraveevdfvlargaklVLVRPA  194
ident                           |                                 
Sbjct --------vQSFPEAYsaakkHGMKVIYG-------------------------LEANIV  177
DSSP  --------lLLHHHHHhhhhhHLLLEEEE-------------------------EEEEEE


DSSP  L----------------------------LLLLllllLLLLhhhhhhHHHHhhHLLLeee
Query P----------------------------VPGLvkprSLGDrshdpvWARLaeAGVPvgf  226
ident                                                       |     
Sbjct DdpfhvtllaqnetglknlfklvslshiqYFHRvpriPRSV-----lVKHR--DGLL---  227
DSSP  LlleeeeeeellhhhhhhhhhhhhhhhllLLLLllleEHHH-----hHHLL--LLEE---


DSSP  ellllllhhhhhhllllllhhhhhhhllhhhhhhhhhhhhllhhhhlllllEEEELLlll
Query hlsdsgylhiaaawggakdpldqvllddraihdtmasmivhgvftrhpklkAVSIENgsy  286
ident                                                      |      
Sbjct ---------------------------------------------------VGSGCDkge  236
DSSP  ---------------------------------------------------EELLLLlll


DSSP  HHHHHhhhhhhhhhhlhhhllllhHHHHHHHEEELLLLL---------------lLHHHH
Query FVHRLikrlkkaantqpqyfpedpVEQLRNNVWIAPYYE---------------dDLPEL  331
ident                             |                               
Sbjct LFDNV-------------------EDIARFYDFLEVHPPdvykplyvkdeemiknIIRSI  277
DSSP  LLLLL-------------------LLLHHHLLLEEELLHhhhlllllllhhhhhhHHHHH


DSSP  HHHHL--hHHLLLLLLLLL---------------------------lLLLLLHH-HHHHH
Query ARVIG--vDKILFGSDWPH---------------------------gEGLASPV-SFTAE  361
ident                                                             
Sbjct VALGEkldIPVVATGNVHYlnpedkiyrkilihsqgganplnrhelpDVYFRTTnEMLDC  337
DSSP  HHHHHhllLLEEELLLLLLllhhhhhhhhhhhhllhhhlllllllllLLLLLLHhHHHHH


DSSP  HLLLLHHHHHHHHLHHHHHHHLL-------------------------------------
Query LKGFSESDIRKIMRDNALDLLGV-------------------------------------  384
ident            |  ||                                            
Sbjct FSFLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygd  397
DSSP  HHHHHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct plpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmtei  457
DSSP  lllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct tevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfk  517
DSSP  lllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct gdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnle  577
DSSP  lllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct lrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdf  637
DSSP  llhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeeh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct hsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqim  697
DSSP  hhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct cnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctls  757
DSSP  lllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct evigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckki  817
DSSP  hllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct kymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkriee  877
DSSP  lllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct inakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaip  937
DSSP  hhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhll


DSSP  -----------------------------------------------------llll
Query -----------------------------------------------------qvgs  388
ident                                                          
Sbjct glgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  lllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 54: Query=4dziC Sbjct=3dcpA Z-score=7.0

back to top
DSSP  llllLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllLLLL
Query alnyRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnPTFD   60
ident        |   |                                            |   
Sbjct ----XKRDGHTHTEF----------------------------------------cPHGT   16
DSSP  ----LLEEEEELLLL----------------------------------------lLLLL


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELL
Query piivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPT  120
ident                                                 | |         
Sbjct ------------------------------------hDDVEEXVLKAIELDFDEYSIVEH   40
DSSP  ------------------------------------lLLHHHHHHHHHHLLLLEEEEEEE


DSSP  hhHHHHhHLLLL-------hhhhhhhHHHHHHHHHHHLL-lLLLLL---LEEEL------
Query fgCGVEeALKHD-------ieatmasVHAFNLWLDEDWG-fDRPDH---RIIAA------  163
ident                                                   |         
Sbjct --APLS-SEFXKntagdkeavttasxAXSDLPYYFKKXNhiKKKYAsdlLIHIGfevdyl   97
DSSP  --LLLL-HHHHHllllllhhhhllllLHHHHHHHHHHHHhhHHHLLlllEEEEEeeeell


DSSP  ---lllLLLLhhhhhhhHHHHHhlLLLLeelllllllllllllllllhhhhhhhhhhhhh
Query ---pivSLADptraveeVDFVLarGAKLvlvrpapvpglvkprslgdrshdpvwarlaea  220
ident                                                             
Sbjct igyedfTRDF------lNEYGP--QTDD--------------------------------  117
DSSP  lllhhhHHHH------hHHHHH--HLLE--------------------------------


DSSP  llleEEELLllLLHHhhHHLL------lLLLH--------HHHHH--HLLHHHHHHHHHH
Query gvpvGFHLSdsGYLHiaAAWG------gAKDP--------LDQVL--LDDRAIHDTMASM  264
ident        |                                                    
Sbjct ---gVLSLH--FLEG--QGGFrsidfsaEDYNegivqfygGFEQAqlAYLEGVKQSIEAD  170
DSSP  ---eEEELL--EEEE--LLEEeellllhHHHHhhlhhhhlLHHHHhhHHHHHHHHHHHLL


DSSP  hhllhhhhlllllEEEELLL--------------------llHHHHHhhhhhhhhhhlhh
Query ivhgvftrhpklkAVSIENG--------------------syFVHRLikrlkkaantqpq  304
ident                                                             
Sbjct -------lglfkpRRXGHISlcqkfqqffgedtsdfseevxeKFRVI-------------  210
DSSP  -------llllllLEELLLLhhhllhhhhlllhhhllhhhhhHHHHH-------------


DSSP  hllllhhhHHHH-HEEELL-------------LLLLL-HHHHHHHHLhhHLLLLLLLLll
Query yfpedpveQLRN-NVWIAP-------------YYEDD-LPELARVIGvdKILFGSDWPhg  349
ident                                 |                    |||    
Sbjct ------laLVKKrDYELDFntaglfkplcgetYPPKKiVTLASELQI--PFVYGSDSHgv  262
DSSP  ------hhHHHHhLLEEEEelhhhhlllllllLLLHHhHHHHHHLLL--LEEEELLLLlh


DSSP  lllLLHHH-HHHHHLlllhhhhhhhhlhhhhhhhllllll
Query eglASPVS-FTAELKgfsesdirkimrdnaldllgvqvgs  388
ident        |     |                          
Sbjct qdiGRGYStYCQKLE-------------------------  277
DSSP  hhlLLLHHhHHHHLL-------------------------


No 55: Query=4dziC Sbjct=1m65A Z-score=5.7

back to top
DSSP  lllllEEEEEEELLLLLllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alnyrVIDVDNHYYEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident        |   |                                                
Sbjct ----yPVDLHMHTVAST-------------------------------------------   13
DSSP  ----lLEELLLLLLLLL-------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEEEEEEELl
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIETAFMLPt  120
ident                                     |      ||      |        
Sbjct ----------------------------------haYSTLSDYIAQAKQKGIKLFAITD-   38
DSSP  ----------------------------------llLLLHHHHHHHHHHHLLLEEEEEE-


DSSP  hhhhhhhhllllhhhhhhhHHHH-----HHHHHHhllllLLLL----LEEELL-LLLLLL
Query fgcgveealkhdieatmasVHAF-----NLWLDEdwgfdRPDH----RIIAAP-IVSLAD  170
ident                                         |       |           
Sbjct ------------------hGPDMedaphHWHFIN--mriWPRVvdgvGILRGIeANIKNV   78
DSSP  ------------------eLLLLlllllLHHHHH--hhhLLLEelleEEEEEEeEELLLL


DSSP  HhhhhhHHHH-HHHLLLLLEELL-lllLLLLlllLLLLLhhhhhhHHHHhhhlLLEEEE-
Query PtraveEVDF-VLARGAKLVLVR-papVPGLvkpRSLGDrshdpvWARLaeagVPVGFH-  227
ident                                                      |    | 
Sbjct D--geiDCSGkMFDSLDLIIAGFhepvFAPHdkaTNTQA-miatiASGN----VHIISHp  131
DSSP  L--lllLLLHhHHHHLLEEEEELllllLLLLlhhHHHHH-hhhhhHLLL----LLEELLl


DSSP  lLLLLlhhhhhhllllllhhhhhhhllhhhhHHHHHHHhllhhhhlLLLLEEEELL--lL
Query lSDSGylhiaaawggakdpldqvllddraihDTMASMIvhgvftrhPKLKAVSIEN--gS  285
ident                                                   |  | |    
Sbjct gNPKY-------------------------eIDVKAVA----eaaaKHQVALEINNssnC  162
DSSP  lLLLL-------------------------lLLHHHHH----hhhhHHLLEEEEELlllH


DSSP  LHHhhhhhhhhhhhhhlhhhllllhHHHHhhHEEEL--------------lLLLLlHHHH
Query YFVhrlikrlkkaantqpqyfpedpVEQLrnNVWIA--------------pYYEDdLPEL  331
ident   |                                                     |   
Sbjct REV------------------aaavRDAG--GWVALgsdshtaftmgefeeCLKI-LDAV  201
DSSP  HHH------------------hhhhHHHL--LLEEEelllllhhhllllhhHHHH-HHHL


DSSP  hhHHLHHHLLLllllllllllllhhhhhhhhllllhhhhhhHHLHHHHHHHLL-------
Query arVIGVDKILFgsdwphgeglaspvsftaelkgfsesdirkIMRDNALDLLGV-------  384
ident         ||                                     |  |         
Sbjct --DFPPERILN------------------------------VSPRRLLNFLESrgmapia  229
DSSP  --LLLHHHLHH------------------------------HLHHHHHHHHHHllllllh


DSSP  -llll
Query -qvgs  388
ident      
Sbjct efadl  234
DSSP  hhlll


No 56: Query=4dziC Sbjct=1bksA Z-score=5.3

back to top
DSSP  -----------llllleEEEEEELLLLlllllllllhhhlllleeeeelllleeeeelle
Query -----------alnyrvIDVDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdr   49
ident                    |                                        
Sbjct meryenlfaqlndrregAFVPFVTLGD---------------------------------   27
DSSP  lhhhhhhhhhhhhllllEEEEEEELLL---------------------------------


DSSP  ellllllllllleelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHhH
Query vnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMdE  109
ident                                                 |           
Sbjct --------------------------------------------pgieQSLKIIDTLI-D   42
DSSP  --------------------------------------------llhhHHHHHHHHHH-H


DSSP  HLEeEEEEELlhHHHHHH---hllllhhhhhhhhhhHHHHHHHHLLllLLLL-LEEELLL
Query QDIeTAFMLPtfGCGVEE---alkhdieatmasvhaFNLWLDEDWGfdRPDH-RIIAAPI  165
ident      |  |                                 |     |  |  |     
Sbjct AGA-DALELG-vPFSDPLadgptiqnanlrafaagvTPAQCFEMLAliREKHpTIPIGLL  100
DSSP  LLL-LLEEEE-lLLLLLLlllhhhhhhhhhhhhhllLHHHHHHHHHhhHHHLlLLLEEEE


DSSP  LLLL--LHHHHHHHHHHHHHLLLLLEELLlllllllllllLLLLhhhHHHHHHHHHHLLL
Query VSLA--DPTRAVEEVDFVLARGAKLVLVRpapvpglvkprSLGDrshDPVWARLAEAGVP  223
ident                      |   |||                    |           
Sbjct MYANlvFNNGIDAFYARCEQVGVDSVLVA---------dvPVEE--sAPFRQAALRHNIA  149
DSSP  ELHHhhHLLLHHHHHHHHHHHLLLEEEEL---------llLHHH--lHHHHHHHHHLLLE


DSSP  EEEEllllllhhhhhhllllllhhhhhhhLLHHhhHHHHHHHhllhhhhllllLEEEELL
Query VGFHlsdsgylhiaaawggakdpldqvllDDRAihDTMASMIvhgvftrhpklKAVSIEN  283
ident   |                             |  |                        
Sbjct PIFI------------------------cPPNAddDLLRQVA--------sygRGYTYLL  177
DSSP  EEEE------------------------eLLLLlhHHHHHHH--------hhlLLLEEEL


DSSP  ---llLHHHHhhhhhhhhhhhlhhhllllhHHHHhhhEEELL--------lLLLLHHHHh
Query ---gsYFVHRlikrlkkaantqpqyfpedpVEQLrnnVWIAP--------yYEDDLPELa  332
ident                                                             
Sbjct alplhHLIEK------------------lkEYHA---APALQgfgisspeqVSAAVRAG-  215
DSSP  lllhhHHHHH------------------hhHHLL---LLEEEllllllhhhHHHHHHHL-


DSSP  hhhlhhhLLLLLLL-LLLL--------------llLLHHHH-HHHHllllhhhhhhhhlh
Query rvigvdkILFGSDW-PHGE--------------glASPVSF-TAELkgfsesdirkimrd  376
ident            |                               |                
Sbjct ------aAGAISGSaIVKIieknlaspkqmlaelrSFVSAMkAASR--------------  255
DSSP  ------lLEEEELLhHHHHhhhllllhhhhhhhhhHHHHHHhHLLL--------------


DSSP  hhhhhhllllll
Query naldllgvqvgs  388
ident             
Sbjct ------------  255
DSSP  ------------


No 57: Query=4dziC Sbjct=2anuA Z-score=3.7

back to top
DSSP  llLLLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alNYRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident        |   |                                                
Sbjct -tEWLLCDFHVHTNX---------------------------------------------   14
DSSP  -lEEEEEEEEELLLL---------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLH--HHHHHHHhhhlEEEEEEE
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNR--DARIAVMdeqdIETAFML  118
ident                                           |                 
Sbjct -------------------------------sdghlPLGEvvDLFGKHG----VDVVSIT   39
DSSP  -------------------------------lllllLHHHhhHHHHHLL----LLEEEEE


DSSP  LlhhHHHH-------hhllllhhhHHHHHHHHHHHHHHhlLLLL----lLLLEEELllll
Query PtfgCGVE-------ealkhdieaTMASVHAFNLWLDEdwGFDR----pDHRIIAApivs  167
ident                         |          |       |         |      
Sbjct D--hIVDRrtleqrkrngeplgaiTEDKFQDYLKRLWR--EQKRaweeyGXILIPG----   91
DSSP  E--eEELHhhhhhhhhllllllllLLLLHHHHHHHHHH--HHHHhhhhhLLEEEEE----


DSSP  lllhhhhhhhhhhhhhlllllEELLLLL---------llllllllLLLLhhhhhhHHHHH
Query ladptraveevdfvlargaklVLVRPAP---------vpglvkprSLGDrshdpvWARLA  218
ident                      |                                    | 
Sbjct ---------------------VEITNNTdlyhivavdvkeyvdpsLPVE----eiVEKLK  126
DSSP  ---------------------EEEEELLlleeeeeelllllllllLLHH----hhHHHHH


DSSP  HHLLLeeeellllllhhhhhhllllllhhhhhhhllhhhhhhhhhhhhllhhhhlllllE
Query EAGVPvgfhlsdsgylhiaaawggakdpldqvllddraihdtmasmivhgvftrhpklkA  278
ident |                                                           
Sbjct EQNAL------------------------------------------------------V  132
DSSP  HLLLE------------------------------------------------------E


DSSP  EEELLL-----llHHHHHHhhhhhhhhhlhhhllllhhhHHHHHE-EELLL--LLLLHhH
Query VSIENG-----syFVHRLIkrlkkaantqpqyfpedpveQLRNNV-WIAPY--YEDDLpE  330
ident                                                             
Sbjct IAAHPDrkklswyLWANXE--------------------RFKDTFdAWEIAnrDDLFN-S  171
DSSP  EELLLLllllllhHHHLLL--------------------LLLLLLlEEEEEelLEELH-H


DSSP  HHHHHLhhHLLLLLLLLLLLlLLLHhhhhhhhllllhhhhhhhhlhhhHHHHL-------
Query LARVIGvdKILFGSDWPHGEgLASPvsftaelkgfsesdirkimrdnaLDLLG-------  383
ident              ||                                             
Sbjct VGVKKY--RYVANSDFHELW-HVYS------------wktlvksekniEAIKEairkntd  216
DSSP  HHHLLL--LEEEELLLLLHH-HHLL------------eeeeeeelllhHHHHHhhhhlll


DSSP  ---lllll
Query ---vqvgs  388
ident         
Sbjct vaiylxrk  224
DSSP  eeeeelll


No 58: Query=4dziC Sbjct=3e38A Z-score=3.7

back to top
DSSP  -------------llLLLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeel
Query -------------alNYRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavig   47
ident                     |   |                                   
Sbjct aqrrneiqvpdldgyTTLKCDFHXHSVF--------------------------------   28
DSSP  lllllllllllllllEEEEEELLLLLLL--------------------------------


DSSP  leellllllllllleelllllhhhhhllllllllhhhllleelhhhlhhHLLHhHHHHHH
Query drvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdARIAVM  107
ident                                                        |    
Sbjct ---------------------------------------------sdglVWPT-VRVDEA   42
DSSP  ---------------------------------------------llllLLHH-HHHHHH


DSSP  HHHLEEEEEEELLhhHHHHhhllllhhhhhhhhhHHHHHHHHHLL-llLLLL-LEEELll
Query DEQDIETAFMLPTfgCGVEealkhdieatmasvhAFNLWLDEDWG-fdRPDH-RIIAApi  165
ident                                                        |    
Sbjct YRDGLDAISLTEHieYRPH----------kqdvvSDHNRSFDLCReqaEKLGiLLIKG--   90
DSSP  HHLLLLEELLEEEllLLLL----------lllllLLLLHHHHHHHhhhHHHLlEELLE--


DSSP  lllllhhhhhhhhhhhhhllllleELLLL------lllllllllllllhhhhHHHHHHHH
Query vsladptraveevdfvlargaklvLVRPA------pvpglvkprslgdrshdPVWARLAE  219
ident                             |                               
Sbjct -----------------------sEITRAxapghfnaiflsdsnpleqkdykDAFREAKK  127
DSSP  -----------------------eEEELLlllleeeeelllllhhhllllhhHHHHHHHH


DSSP  HLLLeeeellllllhhhhhhllllllhhhhhhhllhhhhhhhhhhhhllhhhhlllllEE
Query AGVPvgfhlsdsgylhiaaawggakdpldqvllddraihdtmasmivhgvftrhpklkAV  279
ident  |                                                          
Sbjct QGAF------------------------------------------------------XF  133
DSSP  LLLE------------------------------------------------------EE


DSSP  EEllLLLH-------HHHHhhhhhhhhhhlhhhllllhHHHH--hhHEEELLL---LLLL
Query SIenGSYF-------VHRLikrlkkaantqpqyfpedpVEQL--rnNVWIAPY---YEDD  327
ident                                                  |          
Sbjct WN--HPGWdsqqpdtTKWW----------------pehTALYqegcXHGIEVAnghLYXP  175
DSSP  EL--LLLLlllllllLLLL----------------hhhHHHHhlllLLEEEEEellEELL


DSSP  hhHHHHHHL--hHHLLLLLLLLL-------llllLLHH----------------------
Query lpELARVIG--vDKILFGSDWPH-------geglASPV----------------------  356
ident   |               ||                                        
Sbjct --EAIQWCLdknLTXIGTSDIHQpiqtdydfekgEHRTxtfvfakerslqgirealdnrr  233
DSSP  --HHHHHHHhhlLEEEEELLLLLlhhhhllhhhlLLLLeeeeeellllhhhhhhhhhlll


DSSP  ---hHHHHH---------------------------------------------------
Query ---sFTAEL---------------------------------------------------  362
ident     |   |                                                   
Sbjct taayFHELLigredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllv  293
DSSP  eeeeELLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeellllllee


DSSP  ---------------------------------LLLLhhhhhhhhlhhhhhhhllllll
Query ---------------------------------KGFSesdirkimrdnaldllgvqvgs  388
ident                                                            
Sbjct yfrdxtlkphtrytvrigfkqgikggdvnfevtNFIV----------apdkglkytisl  342
DSSP  llleeeellleeeeeeeeellllllleeeeeeeEEEE----------elleeeeeeeel


No 59: Query=4dziC Sbjct=2yb1A Z-score=3.2

back to top
DSSP  lllllEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllll
Query alnyrVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
ident       ||   |                                                
Sbjct ----aNIDLHFHSRT---------------------------------------------   11
DSSP  ----lLEELLLLLLL---------------------------------------------


DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHhHHHHHHHHHLEEEEEEELL
Query piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdARIAVMDEQDIETAFMLPT  120
ident                                            |                
Sbjct --------------------------------sdgaLTPT-EVIDRAAARAPALLALTDH   38
DSSP  --------------------------------llllLLHH-HHHHHHHLLLLLEEEELLL


DSSP  HHhhhhhhllllhhhhhhhhhhhhhHHHHHLLL-LLLL-LLEEELlllllllhhhhhhhh
Query FGcgveealkhdieatmasvhafnlWLDEDWGF-DRPD-HRIIAApivsladptraveev  178
ident                                                             
Sbjct DC----------------------tGGLAEAAAaAARRgIPFLNG---------------   61
DSSP  LL----------------------lLLHHHHHHhHHHLlLLEEEE---------------


DSSP  hhhhhllllleELLLLlllllllllllllhhhhhhhhhhhhhllleeeellllllhhhhh
Query dfvlargaklvLVRPApvpglvkprslgdrshdpvwarlaeagvpvgfhlsdsgylhiaa  238
ident             |                                               
Sbjct ----------vEVSVS--------------------------------------------   67
DSSP  ----------eEEEEE--------------------------------------------


DSSP  hllllllhhhhhHHLL--------------------------------------------
Query awggakdpldqvLLDD--------------------------------------------  254
ident                                                             
Sbjct -----------wGRHTvhivglgidpaepalaaglksiregrlerarqmgasleaagiag  116
DSSP  -----------eLLEEeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllll


DSSP  -------------------------------------------------hhhhhHHHHHh
Query -------------------------------------------------raihdTMASMi  265
ident                                                             
Sbjct cfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDA-  175
DSSP  hhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllllLHHHH-


DSSP  hllhhhhlLLLL-EEEELLL---------llHHHHHHHhhhhhhhhlhhhllllhhhhhh
Query vhgvftrhPKLK-AVSIENG---------syFVHRLIKrlkkaantqpqyfpedpveqlr  315
ident              ||    |                                        
Sbjct ---vgwivGAGGmAVIAHPGrydmgrtlierLILDFQA---------------------a  211
DSSP  ---hhhhhHLLLeEEELLHHhllllhhhhhhHHHHHHH---------------------l


DSSP  hhEEELL--------lLLLLHHHHHHHHlhhHLLLLLLLLlllllllHHHHhhHHLLllh
Query nnVWIAP--------yYEDDLPELARVIgvdKILFGSDWPhgeglasPVSFtaELKGfse  367
ident     |                    |         |||                      
Sbjct ggQGIEVasgshslddMHKFALHADRHG--lYASSGSDFHapgedvgHTED--LPPI---  264
DSSP  llLEEEEeellllhhhHHHHHHHHHHHL--lEEEEELLLLlllllllLLLL--LLLL---


DSSP  hhhhhhhlhHHHHHHLL------llll
Query sdirkimrdNALDLLGV------qvgs  388
ident               |            
Sbjct -------crPIWRELEArilrpadaen  284
DSSP  -------llLHHHHLHHhlllllhhhl