Results: dupa

Query: 4dlfA

MOLECULE: AMIDOHYDROLASE 2;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4dlf-A 54.7  0.0  287   287  100 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   2:  2ffi-A 29.0  2.4  258   273   22 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
   3:  4mup-B 25.3  2.8  250   286   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   4:  4hk5-D 21.8  2.7  240   380   15 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   5:  2dvt-A 21.8  2.7  241   325   17 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   6:  3cjp-A 21.6  2.4  217   262   15 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   7:  3irs-A 21.3  2.8  234   281   14 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   8:  4qrn-A 20.9  2.9  243   352   14 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   9:  4ofc-A 20.2  2.9  235   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  10:  2gwg-A 18.3  3.0  231   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  11:  2y1h-B 17.4  3.2  225   265   10 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  12:  1gkp-A 17.4  3.2  243   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  2vun-A 17.4  2.8  216   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  14:  2qpx-A 17.2  3.0  223   376   14 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  15:  1bf6-A 17.1  3.3  238   291    9 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  16:  1itq-A 16.8  3.1  239   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  17:  2ob3-A 16.7  3.3  235   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  18:  4b3z-D 16.7  3.2  237   477   11 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  19:  2vc5-A 16.6  3.2  231   314    6 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  20:  3k2g-B 16.4  3.3  239   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  21:  1yrr-B 16.2  3.1  213   334    9 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  22:  4dzi-C 16.0  3.2  227   388   15 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  23:  3pnu-A 16.0  3.3  229   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  2paj-A 15.8  3.4  217   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  25:  1onx-A 15.8  3.1  229   390   13 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  26:  3giq-A 15.7  3.4  237   475   14 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  27:  3gg7-A 15.5  3.2  206   243   14 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  28:  2ogj-A 15.3  3.0  226   379   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  29:  2imr-A 14.8  3.5  224   380    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  30:  3icj-A 14.7  4.2  221   468   10 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  31:  1j6p-A 14.6  3.7  224   407    8 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  3nqb-A 14.4  3.2  213   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  33:  1k6w-A 14.4  4.0  237   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  34:  3mtw-A 14.4  3.7  218   404    9 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  35:  2oof-A 14.3  3.9  220   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  36:  3mkv-A 14.3  3.9  222   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  37:  4cqb-A 14.2  3.7  223   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  38:  3gri-A 14.2  3.3  228   422    7 PDB  MOLECULE: DIHYDROOROTASE;                                            
  39:  3e74-A 14.1  3.6  221   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  40:  1j5s-A 14.0  3.1  221   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  41:  3iac-A 14.0  3.0  219   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  42:  3ls9-A 13.9  3.8  223   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  43:  1a4m-A 13.7  3.9  228   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  44:  4c5y-A 13.6  4.0  222   436   10 PDB  MOLECULE: OCHRATOXINASE;                                             
  45:  1a5k-C 13.3  3.3  217   566   12 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  46:  4rdv-B 13.0  3.5  220   451   15 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  47:  3qy6-A 13.0  3.1  195   247   11 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  1v77-A 12.6  3.3  183   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  49:  2uz9-A 12.6  3.7  213   444    9 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  50:  3ooq-A 12.3  3.5  200   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  51:  3dcp-A 10.5  3.6  190   277    8 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  52:  2a3l-A 10.4  4.0  225   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  53:  3au2-A 10.2  3.7  188   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  1m65-A  8.9  3.4  165   234   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  8.4  4.2  172   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  7.5  3.6  176   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.9  3.7  147   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.9  3.6  148   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  5.8  3.7  143   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4dlfA Sbjct=4dlfA Z-score=54.7

back to top
DSSP  LLLEEEEELLLLLLHHHLLLLLLLLHHHLLLLLHHHHHHHHHHLLLLEEEEELLLLLHHH
Query ALRIDSHQHFWRYRAADYPWIGAGMGVLARDYLPDALHPLMHAQALGASIAVQARAGRDE   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ALRIDSHQHFWRYRAADYPWIGAGMGVLARDYLPDALHPLMHAQALGASIAVQARAGRDE   60
DSSP  LLLEEEEELLLLLLHHHLLLLLLLLHHHLLLLLHHHHHHHHHHLLLLEEEEELLLLLHHH


DSSP  HHHHHHHHLLLLLEEEEEELLLLLLLLHHHHHHLLLLLLEEEEEELHHHLLLHHHHHHLH
Query TAFLLELACDEARIAAVVGWEDLRAPQLAERVAEWRGTKLRGFRHQLQDEADVRAFVDDA  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TAFLLELACDEARIAAVVGWEDLRAPQLAERVAEWRGTKLRGFRHQLQDEADVRAFVDDA  120
DSSP  HHHHHHHHLLLLLEEEEEELLLLLLLLHHHHHHLLLLLLEEEEEELHHHLLLHHHHHHLH


DSSP  HHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHHLLLLLEEEHHHHLLLHHHLLLLLLHH
Query DFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHDAHWLVLDHAGKPALAEFDRDDTAL  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHDAHWLVLDHAGKPALAEFDRDDTAL  180
DSSP  HHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHHLLLLLEEEHHHHLLLHHHLLLLLLHH


DSSP  HHHHHHHHHHHLLLLEEEEELLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHLHHHEEEL
Query ARWRAALRELAALPHVVCKLSGLVTEADWRRGLRASDLRHIEQCLDAALDAFGPQRLMFG  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ARWRAALRELAALPHVVCKLSGLVTEADWRRGLRASDLRHIEQCLDAALDAFGPQRLMFG  240
DSSP  HHHHHHHHHHHLLLLEEEEELLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHLHHHEEEL


DSSP  LLLLHHHHLLLHHHHHHHHHHHHHHHLLHHHHHHHLLHHHHHHLLLL
Query SDWPVCLLAASYDEVASLVERWAESRLSAAERSALWGGTAARCYALP  287
ident |||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SDWPVCLLAASYDEVASLVERWAESRLSAAERSALWGGTAARCYALP  287
DSSP  LLLLHHHHLLLHHHHHHHHHHHHHHHLLHHHHHHHLLHHHHHHLLLL


No 2: Query=4dlfA Sbjct=2ffiA Z-score=29.0

back to top
DSSP  --LLLEEEEELLLLLL------HHHLLllllllhhhLLLLLHHHHHHHHHHLLLLEEEEE
Query --ALRIDSHQHFWRYR------AADYPwigagmgvlARDYLPDALHPLMHAQALGASIAV   52
ident      |||| |               |           |           |        |
Sbjct lhLTAIDSHAHVFSRGlnlasqRRYAP---------NYDAPLGDYLGQLRAHGFSHGVLV   51
DSSP  llLLLEELLLLLLLHHhhhhllLLLLL---------LLLLLHHHHHHHHHHLLLLEELLL


DSSP  LLL-LLHHhHHHHHHHHLL-LLLEeEEEELLLlLLLLhHHHHHLLLLLLEEEEEELHHHL
Query QAR-AGRDeTAFLLELACD-EARIaAVVGWEDlRAPQlAERVAEWRGTKLRGFRHQLQDE  110
ident |    | |    ||             |     |        ||      || |  |   
Sbjct QPSfLGTD-NRYLLSALQTvPGQL-RGVVXLE-RDVE-QATLAEXARLGVRGVRLNLXGQ  107
DSSP  LLHhHLLL-LHHHHHHHHHlLLLL-LLLLLLL-LLLL-HHHHHHHHLLLLLEEELLLLLL


DSSP  LLHhhHHHLHHHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHHLLlLLEEEHHHHLLLH
Query ADVraFVDDADFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHDaHWLVLDHAGKPAL  170
ident          |                         |              | || | |  
Sbjct DXP--DLTGAQWRPLLERIGEQGWHVELHRQVADIPVLVRALQPYG-LDIVIDHFGRPDA  164
DSSP  LLL--LLLLLLLHHHHHHHHHHLLEEEELLLLLLHHHHHHHHLLLL-LLEEELHHHLLLL


DSSP  HHllllllHHHH-HHHHHHHHHLLLLEEEEELLLLLLLLllllLLHHHHHHHHHHHHHHH
Query AEfdrddtALAR-WRAALRELAALPHVVCKLSGLVTEADwrrgLRASDLRHIEQCLDAAL  229
ident          |     | |  |     |  | ||               |    | | |  
Sbjct RR------GLGQpGFAELLTLSGRGKVWVKVSGIYRLQG----SPEENLAFARQALCALE  214
DSSP  LL------LLLLlLHHHHLLLLLLLLEEEEEELHHHLLL----LHHHHHHHHHHHHHHHH


DSSP  HHHLHHHEEELLLLLH--HHHLLLHHHHHHHHHHHHhhhLLHHHHHHHLLHHHHHHLLLL
Query DAFGPQRLMFGSDWPV--CLLAASYDEVASLVERWAesrLSAAERSALWGGTAARCYALP  287
ident    |  ||  |||||        |        |       ||  | ||   ||       
Sbjct AHYGAERLXWGSDWPHtqHESEVSFGSAVEQFEALG---CSAQLRQALLLDTARALFGFE  271
DSSP  HHLLHHHEEEELLLLLllLLLLLLHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHLLLL


DSSP  --
Query --  287
ident   
Sbjct le  273
DSSP  ll


No 3: Query=4dlfA Sbjct=4mupB Z-score=25.3

back to top
DSSP  ---------------LLLEEEEELLLLLL---hHHLLLLllllhhHLLLLLHHHHHHHHH
Query ---------------ALRIDSHQHFWRYR---aADYPWIgagmgvLARDYLPDALHPLMH   42
ident                    |   |            |              |     || 
Sbjct lvrklsgtapnpafpRGAVDTQMHMYLPGypalPGGPGL-----pPGALPGPEDYRRLMQ   55
DSSP  lllllllllllllllLLLEELLLLLLLLLllllLLLLLL-----lLLLLLLHHHHHHHHH


DSSP  HLLLLEEEEELLL-LLHHhHHHHHHHHLL-LLLEeEEEELlLLLLlLHHHHHHLLLLLLE
Query AQALGASIAVQAR-AGRDeTAFLLELACD-EARIaAVVGWeDLRApQLAERVAEWRGTKL  100
ident        |  |     ||     |             |                      
Sbjct WLGIDRVIITQGNaHQRD-NGNTLACVAEmGEAA-HAVVI-IDAT-TTEKDMEKLTAAGT  111
DSSP  HHLLLEEEEELLHhHLLL-LHHHHHHHHHhHHHE-EEEEL-LLLL-LLHHHHHHHHHLLE


DSSP  EEEEELHHHlllhhhHHHLhhHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHHLlLLLE
Query RGFRHQLQDeadvraFVDDadFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHdAHWL  160
ident  | |                          | |    |      | |             
Sbjct VGARIMDLP--ggavNLSE--LDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKI-RSRW  166
DSSP  EEEEEELLL--llllLHHH--HHHHHHHHHHLLLEEEEELLHHHHHHHHHHHHLL-LLEE


DSSP  EEHHHHLLLHhhllllllHHHH-HHHHHHHHHLLLLEEEEELLLLLLLLllllLLHHhHH
Query VLDHAGKPALaefdrddtALAR-WRAALRELAALPHVVCKLSGLVTEADwrrgLRASdLR  219
ident | || ||                  |||  |        |  |                 
Sbjct VFDHHGKFFK------giRTDGpEMAALLKLIDRGNLWFKFAGVYESSR----KSWP-YA  215
DSSP  EELHHHHLLL------llLLLLhHHHHHHHHHHHLLEEEEELLHHHLLL----LLLL-LH


DSSP  HHHHHHHHHHHHhLHHHEEELLLLLHHHH-----LLLHHHHHHHHHHHHhhHLLHhHHHH
Query HIEQCLDAALDAfGPQRLMFGSDWPVCLL-----AASYDEVASLVERWAesRLSAaERSA  274
ident               | |   |  ||                | |   |      |  |  
Sbjct DVAAFSRVIAAH-APERIVWGTNWPHNSVretaaYPDDARLAELTLGWL--PDEA-ARHR  271
DSSP  HHHHHHHHHHHH-LHHHEEELLLLLLLLLllhhhLLLHHHHHHHHHLLL--LLHH-HHHH


DSSP  HLLHHHHHHLLLL--
Query LWGGTAARCYALP--  287
ident            |   
Sbjct ALVENPEALFKLSpv  286
DSSP  HHLHHHHHHHLLLll


No 4: Query=4dlfA Sbjct=4hk5D Z-score=21.8

back to top
DSSP  -LLLEEEEELLLLL--LHHH-------------------lLLLL----------------
Query -ALRIDSHQHFWRY--RAAD-------------------yPWIG----------------   22
ident      | | |       |                                          
Sbjct tPVVVDIHTHMYPPsyIAMLekrqtiplvrtfpqadeprlILLSselaaldaaladpaak   60
DSSP  lLLLEEEEEEELLHhhHHHHhlllllleeeeelleeeeeeELLHhhhhhhhhhhhlllll


DSSP  -LLLHhhLLLL--LHHHHHHHHHHLLLLEEEEEL-LLLL------------HHHHHHHHH
Query -AGMGvlARDY--LPDALHPLMHAQALGASIAVQ-ARAG------------RDETAFLLE   66
ident   |                  |       |                         |    
Sbjct lPGRP--LSTHfaSLAQKMHFMDTNGIRVSVISLaNPWFdflapdeapgiaDAVNAEFSD  118
DSSP  lLLEE--LLHHhlLHHHHHHHHHHLLLLEEEEEElLLLLlllllllhhhhhHHHHHHHHH


DSSP  HHLL-LLLEeEEEELLLL--lLLLHHHHHHLL-LLLLEEEEEELHhhlllhhHHHHLHHH
Query LACD-EARIaAVVGWEDL--rAPQLAERVAEW-RGTKLRGFRHQLqdeadvrAFVDDADF  122
ident        |         |                    ||               ||   
Sbjct MCAQhVGRL-FFFAALPLsapVDAVKASIERVkNLKYCRGIILGT---sglgKGLDDPHL  174
DSSP  HHHLlLLLE-EEEEELLLlllHHHHHHHHHHHhLLLLEEEEEELL---llllLLLLLHHH


DSSP  HHHHHHHHHLLLEEEELL-----------------------------LHHHHHHHH--HH
Query ARGVAWLQANDYVYDVLV-----------------------------FERQLPDVQ--AF  151
ident                                                             
Sbjct LPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfpmeTTIAVARMYmaGV  234
DSSP  HHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhhHHHHHHHHHhlLH


DSSP  HHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHH-------------------------
Query CARHDAHWLVLDHAGKPalaefdrddtalarWRAA-------------------------  186
ident           | | |                   |                         
Sbjct FDHVRNLQMLLAHSGGT-------------lPFLAgriescivhdghlvktgkvpkdrrt  281
DSSP  HHHLLLLLEEEHHHHLL-------------hHHHHhhhhhhhhllhhhhhllllllllll


DSSP  hHHHHLlLLEEEEELLLlllllllllllhhhhhhHHHHHHHHHHHHLHHHEEELLLLLHH
Query lRELAAlPHVVCKLSGLvteadwrrglrasdlrhIEQCLDAALDAFGPQRLMFGSDWPVC  246
ident                                    |  | ||    |  ||||| | |  
Sbjct iWTVLK-EQIYLDAVIY-----------------SEVGLQAAIASSGADRLMFGTDHPFF  323
DSSP  hHHHHH-HLEEEELLLL-----------------LHHHHHHHHHHHLHHHEELLLLLLLL


DSSP  HHL----llHHHHHHHHHHHHHHHLL--HHHHHHHLLHHHHHHLLLL----------
Query LLA----asYDEVASLVERWAESRLS--AAERSALWGGTAARCYALP----------  287
ident                |                 |  |  | |   |           
Sbjct PPIeedvqgPWDSSRLNAQAVIKAVGegSSDAAAVMGLNAVRVLSLKaelehhhhhh  380
DSSP  LLLllllllLLHHHHHHHHHHHHHHLllLHHHHHHHLHHHHHHLLLHhhhhhhhhhl


No 5: Query=4dlfA Sbjct=2dvtA Z-score=21.8

back to top
DSSP  -lLLEEEEELLLLLLhhHLLLLLL-----LLHHHLL--LLLHHHHHHHHHHLLLLEEEEE
Query -aLRIDSHQHFWRYRaaDYPWIGA-----GMGVLAR--DYLPDALHPLMHAQALGASIAV   52
ident          ||                      |        |    || |      |  
Sbjct mqGKVALEEHFAIPE--TLQDSAGfvpgdYWKELQHrlLDIQDTRLKLMDAHGIETMILS   58
DSSP  llLEEEEEEEELLHH--HHHHHLLlllllHHHHHHHhhHLLLLHHHHHHHHLLEEEEEEE


DSSP  LLLL--------------LHHHHHHHHHHHLL-LLLEeEEEELLLL-LLLLHHHHHHLL-
Query QARA--------------GRDETAFLLELACD-EARIaAVVGWEDL-RAPQLAERVAEW-   95
ident                    |     | |       |         |       |      
Sbjct LNAPavqaipdrrkaieiARRANDVLAEECAKrPDRF-LAFAALPLqDPDAATEELQRCv  117
DSSP  ELLLhhhhlllhhhhhhhHHHHHHHHHHHHHHlLLLE-EEEELLLLlLHHHHHHHHHHHh


DSSP  LLLLEEEEEELHhHLLL----hhHHHHLHHHHHHHHHHHHLLLEEEELL-----------
Query RGTKLRGFRHQLqDEAD----vrAFVDDADFARGVAWLQANDYVYDVLV-----------  140
ident       |                   |              |                  
Sbjct NDLGFVGALVNG-FSQEgdgqtpLYYDLPQYRPFWGEVEKLDVPFYLHPrnplpqdsriy  176
DSSP  HLLLLLEEEEEL-LLLLllllllLLLLLHHHHHHHHHHHHHLLLEEEELllllhhhlhhh


DSSP  ------------LHHH-HHHHHHHHHH-----LLLLLEEEHHHHLLlhhhllllllhhhh
Query ------------FERQ-LPDVQAFCAR-----HDAHWLVLDHAGKPalaefdrddtalar  182
ident             |            |      |      | | |                
Sbjct dghpwllgptwaFAQEtAVHALRLMASglfdeHPRLNIILGHMGEG-------------l  223
DSSP  lllhhhlhhhlhHHHHhHHHHHHHHHLlhhhhLLLLLEEELHHHLL-------------h


DSSP  HHHH---------------------hHHHHLlLLEEEEELLLLllllllllllhhhhhhH
Query WRAA---------------------lRELAAlPHVVCKLSGLVteadwrrglrasdlrhI  221
ident                                        ||                   
Sbjct PYMMwridhrnawvklpprypakrrfMDYFN-ENFHITTSGNF----------------R  266
DSSP  HHHHhhhhhllllllllllllllllhHHHHH-HHEEEELLLLL----------------L


DSSP  HHHHHHHHHHHLHHHEEELLLLLHHhhllLHHHHHHHHHHHhhhHLLHHHHHHHLLHHHH
Query EQCLDAALDAFGPQRLMFGSDWPVCllaaSYDEVASLVERWaesRLSAAERSALWGGTAA  281
ident  | |  |    |  |  |  |||        |                | |       | 
Sbjct TQTLIDAILEIGADRILFSTDWPFE----NIDHASDWFNAT---SIAEADRVKIGRTNAR  319
DSSP  HHHHHHHHLLLLHHHEELLLLLLLL----LHHHHHHHHHHL---LLLHHHHHHHHLHHHH


DSSP  HHLLLL
Query RCYALP  287
ident |   | 
Sbjct RLFKLD  325
DSSP  HHLLLL


No 6: Query=4dlfA Sbjct=3cjpA Z-score=21.6

back to top
DSSP  lLLEEEEELLLlllhhhllllllllhhhlllLLHHHHHHHHHHLLLLEEEEELLL-----
Query aLRIDSHQHFWryraadypwigagmgvlardYLPDALHPLMHAQALGASIAVQAR-----   55
ident  | || | |                               |        |          
Sbjct -LIIDGHTHVI--------------------LPVEKHIKIMDEAGVDKTILFSTSihpet   39
DSSP  -LLEEEEEELL--------------------LLHHHHHHHHHHHLLLEEEEELLLllhhh


DSSP  ---------------------------lLHHHHHHHHHHHLL-LLLEeEEEELLLLLLL-
Query ---------------------------aGRDETAFLLELACD-EARIaAVVGWEDLRAP-   86
ident                              |     |         |     |        
Sbjct avnlrdvkkemkklndvvngktnsmidvRRNSIKELTNVIQAyPSRY-VGFGNVPVGLSe   98
DSSP  lllhhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHlLLLE-EEEELLLLLLLh


DSSP  -LHHHHHHL--LLLLlEEEE-EELHhhlllHHHHHHLhhHHHHHHHHHHL-LLEEEELL-
Query -QLAERVAE--WRGTkLRGF-RHQLqdeadVRAFVDDadFARGVAWLQAN-DYVYDVLV-  140
ident         |       | |                                         
Sbjct nDTNSYIEEniVNNK-LVGIgELTP-----ASGQIKS--LKPIFKYSMDSgSLPIWIHAf  150
DSSP  hHHHHHHHHhlLLLL-LLEEeEELL-----LLLLHHH--HHHHHHHHHHLlLLLEEELLl


DSSP  --LHHH-HHHHHHHHHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHHHHHHH-LLLLE
Query --FERQ-LPDVQAFCARHDAHWLVLDHAGKPalaefdrddtalarWRAALRELA-ALPHV  196
ident      |        |         | | |                      |||      
Sbjct npLVLQdIKEIAELCKAFPKVPVILGHMGGS--------------NWMTAVELAkEIQNL  196
DSSP  llLLHHhHHHHHHHHHHLLLLLEEEHHHHHH--------------HHHHHHHHHhHLLLE


DSSP  EEEELLLLllllllllllhhhhhhHHHHHHHHHHHhLHHHEEELLLLLHHhhllLHHHHH
Query VCKLSGLVteadwrrglrasdlrhIEQCLDAALDAfGPQRLMFGSDWPVCllaaSYDEVA  256
ident     |                       |        |    || | |            
Sbjct YLDTSAYF----------------STFVLKIVINE-LPLKCIFGTDMPFG----DLQLSI  235
DSSP  EEELLLLL----------------LHHHHHHHHHH-LLLLEELLLLLLLL----LHHHHH


DSSP  HHHHHHHhhhLLHHHHHHHLLHHHHHHLLLl
Query SLVERWAesrLSAAERSALWGGTAARCYALp  287
ident                  |  |    |     
Sbjct EAIKKMS---NDSYVANAVLGDNISRLLNI-  262
DSSP  HHHHHHL---LLHHHHHHHHLHHHHHHHLL-


No 7: Query=4dlfA Sbjct=3irsA Z-score=21.3

back to top
DSSP  LLLEEEEELLLLllhhHLLL-LLLLLHH-------------HLLLLLhHHHHHHHHHLLL
Query ALRIDSHQHFWRyraaDYPW-IGAGMGV-------------LARDYLpDALHPLMHAQAL   46
ident    ||                                         |       | |   
Sbjct LKIIDFRLRPPAmgflNARIyTRPDIRNrftrqlgfepapsAEEKSL-ELMFEEMAAAGI   59
DSSP  LLLEELLLLLLLhhhhHLHHhHLHHHHHhhhhhhlllllhhHHHLLH-HHHHHHHHHLLL


DSSP  LEEEEELLLL---lhHHHHHHHHHHLL-LLLEeEEEELLL-lLLLLHHHHHHL-LLLLlE
Query GASIAVQARA---grDETAFLLELACD-EARIaAVVGWED-lRAPQLAERVAE-WRGTkL  100
ident      |            |     |          ||               |       
Sbjct EQGVCVGRNSsvlgsVSNADVAAVAKAyPDKF-HPVGSIEaaTRKEAMAQMQEiLDLG-I  117
DSSP  LEEEEELLEEllleeLLHHHHHHHHHHlLLLE-EEEEELLllLHHHHHHHHHHhHHLL-L


DSSP  EEEEELHHHL--LLHHhhHHLHhHHHHHHHHHHLLLEEEELLLH--------HHHHHHHH
Query RGFRHQLQDE--ADVRafVDDAdFARGVAWLQANDYVYDVLVFE--------RQLPDVQA  150
ident |                  |        |    |                          
Sbjct RIVNLEPGVWatPMHV--DDRR-LYPLYAFCEDNGIPVIMMTGGnagpdityTNPEHIDR  174
DSSP  LLEEELHHHLllLLLL--LLHH-HHHHHHHHHHLLLLEEEELLLlllllhhhHLHHHHHH


DSSP  HHHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHHHHHHHL-LLLEEEEELLLllllll
Query FCARHDAHWLVLDHAGKPalaefdrddtalarWRAALRELAA-LPHVVCKLSGLvteadw  209
ident           |  |   |              |       |   |               
Sbjct VLGDFPDLTVVSSHGNWP--------------WVQEIIHVAFrRPNLYLSPDMY------  214
DSSP  HHHHLLLLLEEEEHHHLL--------------LHHHHHHHHHhLLLEEEELHHH------


DSSP  lllllhhhhhhHHHHHHHHHHHH---LHHHEEELLLLLHHhhllLHHHHHHHHHHHhhhH
Query rrglrasdlrhIEQCLDAALDAF---GPQRLMFGSDWPVCllaaSYDEVASLVERWaesR  266
ident                      |       |  ||   | |       |            
Sbjct ---------lyNLPGHADFIQAAnsfLADRMLFGTAYPMC----PLKEYTEWFLTL---P  258
DSSP  ---------hlLLLLHHHHHHHHllhHHHLLLLLLLLLLL----LHHHHHHHHHLL---L


DSSP  LLHHHHHHHLLHHHHHHLL--ll
Query LSAAERSALWGGTAARCYA--lp  287
ident            | | |  |    
Sbjct IKPDAMEKILHGNAERLLAqagr  281
DSSP  LLHHHHHHHHLHHHHHHHHhlll


No 8: Query=4dlfA Sbjct=4qrnA Z-score=20.9

back to top
DSSP  -------------LLLEEEEELLLLL--LHHH----------------LLLLLLL----L
Query -------------ALRIDSHQHFWRY--RAAD----------------YPWIGAG----M   25
ident               |||     |                                     
Sbjct smtqdlktggeqgYLRIATEEAFATReiIDVYlrmirdgtadkgmvslWGFYAQSpserA   60
DSSP  lllllllllllllLLLEEEEEEELLHhhHHHHhhhhhhllllhhhhhhHHHHHHLllhhH


DSSP  HHHLL--LLLHHHHHHHHHHLLLLEEEEELLLL--------------LHHHHHHHHHHHL
Query GVLAR--DYLPDALHPLMHAQALGASIAVQARA--------------GRDETAFLLELAC   69
ident          |       | |      |                           |     
Sbjct TQILErlLDLGERRIADMDATGIDKAILALTSPgvqplhdldeartlATRANDTLADACQ  120
DSSP  HHHHHhhHLLLHHHHHHHHHLLLLEEEEEELLLlllllllhhhhhhhHHHHHHHHHHHHH


DSSP  L-LLLEeEEEELLLLLL-LLHHHHHHLL-LLLLEEEEEELHhHLLLhhHHHHLHHHHHHH
Query D-EARIaAVVGWEDLRA-PQLAERVAEW-RGTKLRGFRHQLqDEADvrAFVDDADFARGV  126
ident     |     |          |       |     |               |   |    
Sbjct KyPDRF-IGMGTVAPQDpEWSAREIHRGaRELGFKGIQINS-HTQG--RYLDEEFFDPIF  176
DSSP  HlLLLE-EELLLLLLLLhHHHHHHHHHHhHLLLLLLEEELL-LLLL--LLLLLHHHHHHH


DSSP  HHHHHLLLEEEELL----------------------LHHH-HHHHHHHH-HHLL----LL
Query AWLQANDYVYDVLV----------------------FERQ-LPDVQAFC-ARHD----AH  158
ident   |   |                             |                       
Sbjct RALVEVDQPLYIHPatspdsmidpmleagldgaifgFGVEtGMHLLRLItIGIFdkypSL  236
DSSP  HHHHHHLLLEEELLllllllllhhhhhhlllllllhHHHHhHHHHHHHHhHLHHhhllLL


DSSP  LEEEHHHHLLlhhhllllllhhhhHHHH-------------------------hHHHHLl
Query WLVLDHAGKPalaefdrddtalarWRAA-------------------------lRELAAl  193
ident      | |                                                    
Sbjct QIMVGHMGEA-------------lPYWLyrldymhqagvrsqryermkplkktiEGYLK-  282
DSSP  LEEELHHHHL-------------hHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-


DSSP  LLEEEEELLLLllllllllllhhhhhhHHHHHHHHHHHHLHHHEEELLLLLHHHhlllHH
Query PHVVCKLSGLVteadwrrglrasdlrhIEQCLDAALDAFGPQRLMFGSDWPVCLlaasYD  253
ident   |    ||                   |          |  | |   | |         
Sbjct SNVLVTNSGVA----------------WEPAIKFCQQVMGEDRVMYAMDYPYQY----VA  322
DSSP  HLEEEELLLLL----------------LHHHHHHHHHHHLHHHEELLLLLLLLL----LH


DSSP  HHHHHHHHHhhhHLLHHHHHHHLLHHHHHHLLLl
Query EVASLVERWaesRLSAAERSALWGGTAARCYALp  287
ident               ||          |     | 
Sbjct DEVRAMDAM---DMSAQTKKKFFQTNAEKWFKL-  352
DSSP  HHHHHHHLL---LLLHHHHHHHHLHHHHHHLLL-


No 9: Query=4dlfA Sbjct=4ofcA Z-score=20.2

back to top
DSSP  llLEEEEELLLLLL-----------hHHLL------------lllLLLHhhLLLL--LHH
Query alRIDSHQHFWRYR-----------aADYP------------wigAGMGvlARDY--LPD   35
ident    || | |                                           |     | 
Sbjct -mKIDIHSHILPKEwpdlkkrfgyggWVQLqhhskgeakllkdgkVFRV--VRENcwDPE   57
DSSP  -lLEEEEEELLLLLlllhhhhhllllLEEEeeeelleeeeeelleEEEE--EEHHhlLHH


DSSP  HHHHHHHHLLLLEEEEELLLL--------------LHHHHHHHHHHHLL-LLLEeEEEEL
Query ALHPLMHAQALGASIAVQARA--------------GRDETAFLLELACD-EARIaAVVGW   80
ident      |                                    |         |     | 
Sbjct VRIREMDQKGVTVQALSTVPVmfsywakpedtlnlCQLLNNDLASTVVSyPRRF-VGLGT  116
DSSP  HHHHHHHHHLLLEEEEELLHHhhlllllhhhhhhhHHHHHHHHHHHHHHlLLLE-EEEEL


DSSP  LLLLL-LLHHHHHHLL-LLLLEEEEEELHhHLLLhhHHHHLHHHHHHHHHHHHLLLEEEE
Query EDLRA-PQLAERVAEW-RGTKLRGFRHQLqDEADvrAFVDDADFARGVAWLQANDYVYDV  138
ident     |                  |                        |          |
Sbjct LPMQApELAVKEMERCvKELGFPGVQIGT-HVNE--WDLNAQELFPVYAAAERLKCSLFV  173
DSSP  LLLLLhHHHHHHHHHHhHLLLLLEEEEEL-EELL--EELLLHHHHHHHHHHHHHLLEEEE


DSSP  LL-----------------------LHHHHHHHH--HHHHHLLLLLEEEHHHHLLlhhhl
Query LV-----------------------FERQLPDVQ--AFCARHDAHWLVLDHAGKPalaef  173
ident                                                   | |       
Sbjct HPwdmqmdgrmakywlpwlvgmpaeTTIAICSMImgGVFEKFPKLKVCFAHGGGA-----  228
DSSP  ELllllllhhhhlllhhhhlhhhhhHHHHHHHHHllLHHHHLLLLLEEELHHHLL-----


DSSP  lllllhhhhHHHH---------------------hHHHHLLllEEEEELLLlllllllll
Query drddtalarWRAA---------------------lRELAALphVVCKLSGLvteadwrrg  212
ident                                                             
Sbjct --------fPFTVgrishgfsmrpdlcaqdnpmnpKKYLGS--FYTDALVH---------  269
DSSP  --------hHHHHhhhhhhhhhlhhhhlllllllhHHHLLL--LEEELLLL---------


DSSP  llhhhhhhHHHHHHHHHHHHLHHHEEELLLLLHHHhlllHHHHHHHHHHHhhHHLLHHHH
Query lrasdlrhIEQCLDAALDAFGPQRLMFGSDWPVCLlaasYDEVASLVERWaeSRLSAAER  272
ident             |    |  |      | | |  |      |   | |            
Sbjct --------DPLSLKLLTDVIGKDKVILGTDYPFPL---gELEPGKLIESM--EEFDEETK  316
DSSP  --------LHHHHHHHHHHHLLLLEELLLLLLLLL---lLLLLLHHHHHL--LLLLHHHH


DSSP  HHHLLHHHHHHLLLL----
Query SALWGGTAARCYALP----  287
ident   |  | |     |     
Sbjct NKLKAGNALAFLGLErkqf  335
DSSP  HHHHLHHHHHHHLLLhhhl


No 10: Query=4dlfA Sbjct=2gwgA Z-score=18.3

back to top
DSSP  lLLEEEEEL-LLLL---LHHH-------------llllllllhhhllllLHHH-HHHHHH
Query aLRIDSHQH-FWRY---RAAD-------------ypwigagmgvlardyLPDA-LHPLMH   42
ident    || | |                                                   
Sbjct -XIIDIHGHyTTAPkalEDWRnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQ   59
DSSP  -LLEEEEEElLLLLhhhHHHHhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHH


DSSP  HLLLLEEEEELLL--------lLHHHHHHHHHHHLL-LLLEeEEEELLLL----LLLLHH
Query AQALGASIAVQAR--------aGRDETAFLLELACD-EARIaAVVGWEDL----RAPQLA   89
ident                                                             
Sbjct ERGSDLTVFSPRAgdfnvsstwAAICNELCYRVSQLfPDNF-IGAAXLPQspgvDPKTCI  118
DSSP  HHLLLEEEEELLLllhhhhhhhHHHHHHHHHHHHHHlLLLE-EEEEELLLllllLHHHHH


DSSP  HHHHLL-LLLLEEEEEELHH--HLLLhhHHHHLHHHHHHHHHHHHLLLEEEEL-------
Query ERVAEW-RGTKLRGFRHQLQ--DEADvrAFVDDADFARGVAWLQANDYVYDVL-------  139
ident                                 |                           
Sbjct PELEKCvKEYGFVAINLNPDpsGGHWtsPPLTDRIWYPIYEKXVELEIPAXIHvstgahy  178
DSSP  HHHHHHhHLLLLLEEEELLLllLLLLllLLLLLHHHHHHHHHHHHHLLLEEELlllllhh


DSSP  --LLHHHHHHHH--HHHHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHH---------
Query --VFERQLPDVQ--AFCARHDAHWLVLDHAGKPalaefdrddtalarWRAA---------  186
ident                          |  | |                             
Sbjct lnADTTAFXQCVagDLFKDFPELKFVIPHGGGA-------------vPYHWgrfrglaqe  225
DSSP  hhHHHHHHHHHHhlLHHHHLLLLLEEELHHHLL-------------lHHHHhhhhhhhhh


DSSP  --hhHHHL--LLLEEEEELLLlllllllllllhhhhhhHHHHHHHHHHHHLHHHEEELLL
Query --lrELAA--LPHVVCKLSGLvteadwrrglrasdlrhIEQCLDAALDAFGPQRLMFGSD  242
ident      |    |                                |            | | 
Sbjct xkkpLLEDhvLNNIFFDTCVY-----------------HQPGIDLLNTVIPVDNVLFASE  268
DSSP  llllLHHHhlLLLEEEELLLL-----------------LHHHHHHHHHHLLHHHEELLLL


DSSP  LLHHHHL-------LLHHhHHHHHHHHhhHHLLHHHHHHHLLHHHHHHLLLL--------
Query WPVCLLA-------ASYDeVASLVERWaeSRLSAAERSALWGGTAARCYALP--------  287
ident                  |      |      |   |      | | | |           
Sbjct XIGAVRGidprtgfYYDD-TKRYIEAS--TILTPEEKQQIYEGNARRVYPRLdaalkakg  325
DSSP  LLLLLLLeelllleELLL-LHHHHHHL--LLLLHHHHHHHHLHHHHHHLHHHhhhhhhhh


DSSP  ----
Query ----  287
ident     
Sbjct kleh  329
DSSP  hhll


No 11: Query=4dlfA Sbjct=2y1hB Z-score=17.4

back to top
DSSP  -LLLEEEEEL-LLLLlhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELLllLH
Query -ALRIDSHQH-FWRYraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQAraGR   58
ident      | | |                      |   |            |  ||      
Sbjct gVGLVDCHCHlSAPD----------------fDRDLDDVLEKAKKANVVALVAVAE--HS   42
DSSP  lLLEEEEEELlLLHH----------------hLLLHHHHHHHHHHLLEEEEEELLL--LH


DSSP  HHHHHHHHHHLL-LLLEeEEEELL------------llLLLLHHHHHHLLLLLlEEEE-E
Query DETAFLLELACD-EARIaAVVGWE------------dlRAPQLAERVAEWRGTkLRGF-R  104
ident  |      |                                             |     
Sbjct GEFEKIMQLSERyNGFV-LPCLGVhpvqgldqrsvtlkDLDVALPIIENYKDR-LLAIgE  100
DSSP  HHHHHHHHHHHHlLLLE-EEEELLlleelllleellhhHHHHHHHHHHHHLLL-LLEEeE


DSSP  ELHHHLL-------LHHHHHHlhhHHHHHHHHHHLLLEEEELLLhHHHHHHHHHHHHLLL
Query HQLQDEA-------DVRAFVDdadFARGVAWLQANDYVYDVLVFeRQLPDVQAFCARHDA  157
ident   |                       |             |                  |
Sbjct VGLDFSPrfagtgeQKEEQRQ--vLIRQIQLAKRLNLPVNVHSR-SAGRPTINLLQEQGA  157
DSSP  EEEELLLlllllhhHHHHHHH--hHHHHHHHHHHHLLLEEEEEE-LLHHHHHHHHHHLLL


DSSP  LLEEEHhHHLLlhhhllllllhhhhHHHHHHHHHLLLlEEEEELLLLllllllllllhhH
Query HWLVLDhAGKPalaefdrddtalarWRAALRELAALPhVVCKLSGLVteadwrrglrasD  217
ident     |  |                       |                            
Sbjct EKVLLH-AFDG--------------RPSVAMEGVRAG-YFFSIPPSI-----------iR  190
DSSP  LLEEEE-LLLL--------------LHHHHHHHHHLL-LEEEELHHH-----------hL


DSSP  HHHHHHHHHHHhhhhLHHHEEELLLLLHHH---HLLLHhhHHHHHHHHHHH-HLLH--HH
Query LRHIEQCLDAAldafGPQRLMFGSDWPVCL---LAASYdeVASLVERWAES-RLSA--AE  271
ident                         | |               |                 
Sbjct SGQKQKLVKQL----PLTSICLETDSPALGpekQVRNEpwNISISAEYIAQvKGISveEV  246
DSSP  LHHHHHHHHHL----LHHHEEELLLLLLLLlllLLLLLhhHHHHHHHHHHHhHLLLhhHH


DSSP  HHHHlLHHHHHH-LLLL---
Query RSALwGGTAARC-YALP---  287
ident         |      |    
Sbjct IEVT-TQNALKLfPKLRhll  265
DSSP  HHHH-HHHHHHHlLLHHhhl


No 12: Query=4dlfA Sbjct=1gkpA Z-score=17.4

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------ALRIDSHQH    9
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  L-LLLLHhhllllllllhhhLLLL-LHHHHHHHHHHLLLLEEEEELLLL----LHHHHHH
Query F-WRYRAadypwigagmgvlARDY-LPDALHPLMHAQALGASIAVQARA----GRDETAF   63
ident       |                                   |                 
Sbjct IyLPFMA-------------TFAKdTHETGSKAALMGGTTTYIEMCCPSrnddALEGYQL  107
DSSP  LlLEELL-------------EELLlLHHHHHHHHHHLLEEEEEEEELLLllllHHHHHHH


DSSP  HHHHHLLLL-LEEEEEELLLLLLLLHHHHHHL-LLLLlEEEEEELHHHLLlhhhHHHLhH
Query LLELACDEA-RIAAVVGWEDLRAPQLAERVAE-WRGTkLRGFRHQLQDEAdvraFVDDaD  121
ident     |                          |         |   |          |   
Sbjct WKSKAEGNSyCDYTFHMAVSKFDEKTEGQLREiVADG-ISSFXIFLSYKN-ffgVDDG-E  164
DSSP  HHHHHLLLLlLEEEEEEELLLLLLLHHHHHHHhHHLL-LLEEEEEELLLL-lllLLHH-H


DSSP  HHHHHHHHHHLLLEEEELLL-------------------------------HHHH-HHHH
Query FARGVAWLQANDYVYDVLVF-------------------------------ERQL-PDVQ  149
ident                                                    |        
Sbjct MYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGtARFA  224
DSSP  HHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHhHHHH


DSSP  HHHHHLLlLLEEEHHhHLLLhhhllllllhhhHHHHHHHHHHL-LLLEEEEELLLL-lLL
Query AFCARHDaHWLVLDHaGKPAlaefdrddtalaRWRAALRELAA-LPHVVCKLSGLV-tEA  207
ident  |            |                     |     |                 
Sbjct TFLETTG-ATGYVVH-LSCK------------PALDAAMAAKArGVPIYIESVIPHflLD  270
DSSP  HHHHHHL-LEEEELL-LLLH------------HHHHHHHHHHHlLLLEEEEEEHHHhhLL


DSSP  LLLLL------------llhhHHHHHHHHHHHHHHHHlhhHEEELLLLL-----------
Query DWRRG------------lrasDLRHIEQCLDAALDAFgpqRLMFGSDWP-----------  244
ident                      | |      ||    |       | |             
Sbjct KTYAErggveamkyimspplrDKRNQKVLWDALAQGF---IDTVGTDHCpfdteqkllgk  327
DSSP  HHHHHllhhhhhlllllllllLLHHHHHHHHHHHLLL---LLEEELLLLlllhhhhhhhl


DSSP  --------HHHHlllHHHHHHHHHHHHH--HHLLHHHHHHHLLHHHHHHLLLL-------
Query --------VCLLaasYDEVASLVERWAE--SRLSAAERSALWGGTAARCYALP-------  287
ident                      |         ||            ||    |        
Sbjct eaftaipnGIPA---IEDRVNLLYTYGVsrGRLDIHRFVDAASTKAAKLFGLFprkgtia  384
DSSP  llhhhlllLLLL---LLLHHHHHHHHHLllLLLLHHHHHHHHLHHHHHHLLLLlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct vgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvge  444
DSSP  lllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelll


DSSP  --------------
Query --------------  287
ident               
Sbjct kgwgkllrrepmyf  458
DSSP  llllllllllllll


No 13: Query=4dlfA Sbjct=2vunA Z-score=17.4

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------A    1
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE


DSSP  LLEEEEELLLlllhhhllllllllhhhlllLLHH-------HHHHHHHHLLLLEEEEELL
Query LRIDSHQHFWryraadypwigagmgvlardYLPD-------ALHPLMHAQALGASIAVQA   54
ident    | | |                                               |    
Sbjct GLLDTHVHVS--------------------GGDYaprqktmDFISSALHGGVTTMISAGS  100
DSSP  LEEEEEELLL--------------------LLLEehhhleeLHHHHHHLLLEEEEEELLL


DSSP  L----------lLHHHHHHHHHHHLLLL---LEEEE-EELLLllLLLHHHHHHL-LLLLl
Query R----------aGRDETAFLLELACDEA---RIAAV-VGWEDlrAPQLAERVAE-WRGTk   99
ident                    |                             |   |      
Sbjct PhfpgrpkdaagTKALAITLSKSYYNARpagVKVHGgAVILE--KGLTEEDFIEmKKEG-  157
DSSP  LllllllllhhhHHHHHHHHHHHHHHLLhhhLEEELlEELLL--LLLLHHHHHHhHHLL-


DSSP  EEEEEELHhhlllhhhHHHLhhHHHHHHHHHHLLLEEEELLLH------HHHHhhHHHHH
Query LRGFRHQLqdeadvraFVDDadFARGVAWLQANDYVYDVLVFE------RQLPdvQAFCA  153
ident                    |   |  | |                               
Sbjct VWIVGEVG---lgtikNPED--AAPMVEWAHKHGFKVQMHTGGtsipgsSTVT--ADDVI  210
DSSP  LLEEEEEL---lllllLHHH--HHHHHHHHHHLLLEEEEELLLllllllLLLL--HHHHH


DSSP  HLLlllEEEHHH-HLLLhhhllllllhhhhHHHHHHHHHLLLLEEEEELLLlllllllll
Query RHDahwLVLDHA-GKPAlaefdrddtalarWRAALRELAALPHVVCKLSGLvteadwrrg  212
ident        |  |  | |                                            
Sbjct KTK--pDVVSHInGGPT-----------aiSVQEVDRIMDETDFAMEIVQC---------  248
DSSP  HHL--lLEEELLlLLLL-----------llLHHHHHHHHHHLLLEEEEELL---------


DSSP  llhhhhhhHHHHHHHHHHHH----LHHHEEELLLLLHhhHLLLHHHHHHHHHHHHHHH--
Query lrasdlrhIEQCLDAALDAF----GPQRLMFGSDWPVclLAASYDEVASLVERWAESR--  266
ident              |             |  || | |                    |   
Sbjct -------gNPKIADYVARRAaekgQLGRVIFGNDAPS--GTGLIPLGILRNMCQIASMsd  299
DSSP  -------lLHHHHHHHHHHHhhhlLHHHEEEELLLLL--LLLLLLLHHHHHHHHHHHHll


DSSP  LLHHHHHHHLLHHHHHHLLLL---------------------------------------
Query LSAAERSALWGGTAARCYALP---------------------------------------  287
ident            |     | |                                        
Sbjct IDPEVAVCMATGNSTAVYGLNtgviapgkeadliimdtplgsvaedamgaiaagdipgis  359
DSSP  LLHHHHHHHHLHHHHHHHLLLllllllllllleeeeelllllllllhhhhhhhlllleee


DSSP  --------------------------
Query --------------------------  287
ident                           
Sbjct vvlidgeavvtksrntppakraakil  385
DSSP  eeeelleeeellllllllllllleel


No 14: Query=4dlfA Sbjct=2qpxA Z-score=17.2

back to top
DSSP  -----------lLLEEEEELLLLL---------lhhhllLLLLLLH--------------
Query -----------aLRIDSHQHFWRY---------raadypWIGAGMG--------------   26
ident                | | ||                                       
Sbjct gxddlsefvdqvPLLDHHCHFLIDgkvpnrddrlaqvstEADKDYPladtknrlayhgfl   60
DSSP  lllllhhhhhhlLEEEEEELLLLLlllllhhhhhhhhllLLLLLLLhhhhlllhhhhhhh


DSSP  ---------------hhlllllhHHHHHHHHHLLLLEEEEELLLllhhhhhhhhHHHLLL
Query ---------------vlardylpDALHPLMHAQALGASIAVQARagrdetafllELACDE   71
ident                           |                                 
Sbjct alakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGF----vpddpiLDLDQT  116
DSSP  hhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLL----llllllLLHHHH


DSSP  L----LEEEEEELLL--------------llLLLHHHHHHL-LLLLlEEEEEELHHHLLL
Query A----RIAAVVGWED--------------lrAPQLAERVAE-WRGTkLRGFRHQLQDEAD  112
ident |                                     |          ||         
Sbjct AelvgIPVKAIYRLEthaedfxlehdnfaawWQAFSNDVKQaKAHG-FVGFXSIAAYRVG  175
DSSP  HhhhlLLEEEEEEHHhhhhhhhlllllhhhhHHHHHHHHHLlLLLL-LLLEEELHHHHLL


DSSP  HHhhHHLH----------------------------HHHHHHHHHHHLLLEEEELLL---
Query VRafVDDA----------------------------DFARGVAWLQANDYVYDVLVF---  141
ident                                               | |      |    
Sbjct LH--LEPVnvieaaagfdtwkhsgekrltskplidyXLYHVAPFIIAQDXPLQFHVGygd  233
DSSP  LL--LLLLlhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHHLLLEEEEELlll


DSSP  ------hHHHHHHHHHHHHLL--LLLEEEHhHHLLlhhhllllllhhhhhhHHHHHHH-L
Query ------eRQLPDVQAFCARHD--AHWLVLDhAGKPalaefdrddtalarwrAALRELA-A  192
ident                            ||     |                     ||  
Sbjct adtdxylGNPLLXRDYLKAFTkkGLKVVLL-HCYP--------------yhREAGYLAsV  278
DSSP  llllhhhLLHHHHHHHHHHHHhhLLLEEEE-ELLL--------------lhHHHHHHHhH


DSSP  LLLEEEEELLL-LLLLlllllllhhhhHHHHHHHHHHHHHHLHHHEEELLLLLhhhhlLL
Query LPHVVCKLSGL-VTEAdwrrglrasdlRHIEQCLDAALDAFGPQRLMFGSDWPvcllaAS  251
ident  |      | |                         |       |  | ||         
Sbjct FPNLYFDISLLdNLGP-----------SGASRVFNEAVELAPYTRILFASDAS--typEX  325
DSSP  LLLEEEELLLHhHHLH-----------HHHHHHHHHHLLLLLHHHEELLLLLL--llhHH


DSSP  HHHHHHHHHHHHHHHL----------LHHHHHHHLLHHHHHHLLLL-----
Query YDEVASLVERWAESRL----------SAAERSALWGGTAARCYALP-----  287
ident |   |                       |   |    | |  |        
Sbjct YGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQErelrv  376
DSSP  HHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLHhhhll


No 15: Query=4dlfA Sbjct=1bf6A Z-score=17.1

back to top
DSSP  ----LLLEEEEELL-LLLLhHHLLllllllhhhLLLLL----HHHHHHHHHHLLLLEEEE
Query ----ALRIDSHQHF-WRYRaADYPwigagmgvlARDYL----PDALHPLMHAQALGASIA   51
ident           | |                                             | 
Sbjct sfdpTGYTLAHEHLhIDLS-GFKN-------nvDCRLDqyafICQEMNDLMTRGVRNVIE   52
DSSP  llllLLEEEEEELLlEELH-HHHL-------lhHHEELlhhhHHHHHHHHHHLLEEEEEE


DSSP  ELlllLHHHhhHHHHHHLLLL----LEEEEEELL-----------lllLLLHHHHH----
Query VQaraGRDEtaFLLELACDEA----RIAAVVGWE-----------dlrAPQLAERV----   92
ident                   |                                ||       
Sbjct MT--nRYMG--RNAQFMLDVMretgINVVACTGYyqdaffpehvatrsVQELAQEMvdei  108
DSSP  LL--lHHHL--LLHHHHHHHHhhhlLEEEEEELLllhhhlllhhhhllHHHHHHHHhhhh


DSSP  HLLL---LLLEEEEE-ELHHHlLLHHHHHHLhhHHHHHHHHHHLLLEEEELLL-HHHHHH
Query AEWR---GTKLRGFR-HQLQDeADVRAFVDDadFARGVAWLQANDYVYDVLVF-ERQLPD  147
ident          |                       |                          
Sbjct EQGIdgtELKAGIIAeIGTSE-GKITPLEEK-vFIAAALAHNQTGRPISTHTSfSTMGLE  166
DSSP  HLLLlllLLLEEEEEeEELLL-LLLLHHHHH-hHHHHHHHHHHHLLLEEEELHhHLLHHH


DSSP  HHHHHHH-LLLL-LEEEHHhHLLLHhhllllllhhhhHHHHHHHHHLLLlEEEEELLLLL
Query VQAFCAR-HDAH-WLVLDHaGKPALaefdrddtalarWRAALRELAALPhVVCKLSGLVT  205
ident   |               |                            |            
Sbjct QLALLQAhGVDLsRVTVGH-CDLKD------------NLDNILKMIDLG-AYVQFDTIGK  212
DSSP  HHHHHHHlLLLHhHEEELL-LLLLL------------LHHHHHHHHHLL-LEEEELLLLL


DSSP  LLLllllllhhHHHHHHHHHHHHHHHhLHHHEEELLLLLH-----hhhLLLHHHHH-HHH
Query EADwrrglrasDLRHIEQCLDAALDAfGPQRLMFGSDWPV-----cllAASYDEVA-SLV  259
ident                    | |  |     | |   |              ||       
Sbjct NSY-------yPDEKRIAMLHALRDRgLLNRVMLSMDITRrshlkangGYGYDYLLtTFI  265
DSSP  LLL-------lLHHHHHHHHHHHHHLlLHHHEEELLLLLLhhhlhhhlLLLLLHHHhLHH


DSSP  HHHHHHHLLHHHHHHHLLHHHHHHLLll
Query ERWAESRLSAAERSALWGGTAARCYAlp  287
ident      |  | |                 
Sbjct PQLRQSGFSQADVDVMLRENPSQFFQ--  291
DSSP  HHHHHLLLLHHHHHHHHLHHHHHHLL--


No 16: Query=4dlfA Sbjct=1itqA Z-score=16.8

back to top
DSSP  -------------LLLEEEEELLL---LLLHhhllllllllhhhlllllhhHHHHHHHHL
Query -------------ALRIDSHQHFW---RYRAadypwigagmgvlardylpdALHPLMHAQ   44
ident                 || |                                  |   | 
Sbjct dffrdeaerimrdSPVIDGHNDLPwqlLDMF--nnrlqderanlttlagthTNIPKLRAG   58
DSSP  lhhhhhhhhhhllLLEEEEEELHHhhhHHHH--llllllhhhlllllllllLLHHHHHHL


DSSP  LLLEEEEELLLL-------LHHHHHHHHHHHLLLL------------------------L
Query ALGASIAVQARA-------GRDETAFLLELACDEA------------------------R   73
ident   |                    |                                    
Sbjct FVGGQFWSVYTPcdtqnkdAVRRTLEQMDVVHRMCrmypetflyvtssagirqafregkV  118
DSSP  LEEEEEEEELLLhhhllllHHHHHHHHHHHHHHHHhhlllleeelllhhhhhhhhhlllE


DSSP  EEEEEE----LLLLllllHHHHHHLLLLLLEEEEEELHHHL--------------LLHHH
Query IAAVVG----WEDLrapqLAERVAEWRGTKLRGFRHQLQDE--------------ADVRA  115
ident             |                  |                            
Sbjct ASLIGVegghSIDS----SLGVLRALYQLGMRYLTLTHSCNtpwadnwlvdtgdsEPQSQ  174
DSSP  EEEEEEelhhHLLL----LHHHHHHHHHLLEEEEELLLLLLllllllhhhlllllLLLLL


DSSP  hHHLHHHHHHHHHHHHLLLEEEELLlhhHHHHHHHHHHHLlLLLEEEHHHHLL-LHHHll
Query fVDDADFARGVAWLQANDYVYDVLVferQLPDVQAFCARHdAHWLVLDHAGKP-ALAEfd  174
ident         | |  |       |            |             |       |   
Sbjct -GLSPFGQRVVKELNRLGVLIDLAH--vSVATMKATLQLS-RAPVIFSHSSAYsVCAS--  228
DSSP  -LLLHHHHHHHHHHHHHLLEEELLL--lLHHHHHHHHHHL-LLLLEELLLLLLlLLLL--


DSSP  llllhhhhHHHHHHHHHLLLLEEEEELLLLLL--LLLLllllhhHHHHHHHHHHHHHHHH
Query rddtalarWRAALRELAALPHVVCKLSGLVTE--ADWRrglrasDLRHIEQCLDAALDAF  232
ident                |                             |      ||      
Sbjct -----rrnVPDDVLRLVKQTDSLVMVNFYNNYisCTNK-----aNLSQVADHLDHIKEVA  278
DSSP  -----lllLLHHHHHHHHHHLLEEEELLLHHHhlLLLL-----lLHHHHHHHHHHHHHHL


DSSP  LHHHEEELLLLLHHHHL----LLHHHhHHHHHHHHH-HHLLHHHHHHHLLHHHHHHLL--
Query GPQRLMFGSDWPVCLLA----ASYDEvASLVERWAE-SRLSAAERSALWGGTAARCYA--  285
ident |     || |                                ||          |     
Sbjct GARAVGFGGDFDGVPRVpeglEDVSK-YPDLIAELLrRNWTEAEVKGALADNLLRVFEav  337
DSSP  LHHHEEELLLLLLLLLLllllLLLLL-HHHHHHHHHhLLLLHHHHHHHHLHHHHHHHHhh


DSSP  ------------------------------ll
Query ------------------------------lp  287
ident                                 
Sbjct eqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhllllllllllllllhhhlllllllllllll


No 17: Query=4dlfA Sbjct=2ob3A Z-score=16.7

back to top
DSSP  --------------lLLEEEEELLL--------llLHHHllllllllhhhlLLLL-HHHH
Query --------------aLRIDSHQHFW--------ryRAADypwigagmgvlaRDYL-PDAL   37
ident                     | |                                     
Sbjct drintvrgpitiseaGFTLTHEHICgssagflrawPEFF--------gsrkALAEkAVRG   52
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlHHHH--------llhhHHHHhHHHH


DSSP  HHHHHHLLLLEEEEELlllLHHHhhHHHHHHLLLL----LEEEEEELL---------lll
Query HPLMHAQALGASIAVQaraGRDEtaFLLELACDEA----RIAAVVGWE---------dlr   84
ident      |        |              |                              
Sbjct LRRARAAGVRTIVDVS--tFDIG--RDVSLLAEVSraadVHIVAATGLwfdpplsmrlrs  108
DSSP  HHHHHHLLLLEEEELL--lHHHL--LLHHHHHHHHhhhlLEEELEEELlllllhhhhlll


DSSP  LLLHHHHH----HLLL---LLLEEEEEELHHhlllHHHHhhLHHHHHH-HHHHHHLLLEE
Query APQLAERV----AEWR---GTKLRGFRHQLQdeadVRAFvdDADFARG-VAWLQANDYVY  136
ident    |               |                 |                |     
Sbjct VEELTQFFlreiQYGIedtGIRAGIIXVATT----GKATpfQELVLKAaARASLATGVPV  164
DSSP  HHHHHHHHhhhhHLLLlllLLLLLEEEEELL----LLLLhhHHHHHHHhHHHHHHHLLLE


DSSP  EELLLHHHHhHHHHHHHHL----LLLL-EEEHHHHLLLhhhllllllhhhhHHHHHHHHH
Query DVLVFERQLpDVQAFCARH----DAHW-LVLDHAGKPAlaefdrddtalarWRAALRELA  191
ident        |  |     |               |                      |  ||
Sbjct TTHTAASQR-DGEQQAAIFesegLSPSrVCIGHSDDTD-------------DLSYLTALA  210
DSSP  EEELLHHHL-HHHHHHHHHhhllLLHHhEEELLHHHLL-------------LHHHHHHHH


DSSP  LLLlEEEEELLLLLlLLLLLL--------llhHHHHHHHHHHHHHHHHHLHHHEEELLLL
Query ALPhVVCKLSGLVTeADWRRG--------lraSDLRHIEQCLDAALDAFGPQRLMFGSDW  243
ident |       |                                  |  |           ||
Sbjct ARG-YLIGLDHIPY-SAIGLEdnasasallgiRSWQTRALLIKALIDQGYMKQILVSNDW  268
DSSP  HLL-LEEEELLLLL-LLLLLLllhhhhhhhllLLHHHHHHHHHHHHHLLLHHHEEELLLL


DSSP  L------------hhHHLLLH--HHHHHHHHHHHHHH-LLHHHHHHHLLHHHHHHLL--l
Query P------------vcLLAASY--DEVASLVERWAESR-LSAAERSALWGGTAARCYA--l  286
ident                              |                      ||      
Sbjct TfgfssyvtnimdvmDRVNPDgmAFIPLRVIPFLREKgVPQETLAGITVTNPARFLSptl  328
DSSP  LleellllllhhhhhHHHLLLhhHHHHHLHHHHHHHLlLLHHHHHHHHLHHHHHHHLlll


DSSP  l
Query p  287
ident  
Sbjct r  329
DSSP  l


No 18: Query=4dlfA Sbjct=4b3zD Z-score=16.7

back to top
DSSP  ----------------------------------------------------LLLEEEEE
Query ----------------------------------------------------ALRIDSHQ    8
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  L-LLLLlhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELLLL----LHHHHHH
Query H-FWRYraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQARA----GRDETAF   63
ident                                           |                 
Sbjct YlQKTA-----------------ADDFFQGTRAALVGGTTMIIDHVVPEpgssLLTSFEK  103
DSSP  LlLLLL-----------------LLLHHHHHHHHHHLLEEEEEEEELLLllllHHHHHHH


DSSP  HHHHHLLL--LLEEeEEELLLLLLLLHHHHHHLL-LLLLEEEEEELHHHLLlhhhHHHLh
Query LLELACDE--ARIAaVVGWEDLRAPQLAERVAEW-RGTKLRGFRHQLQDEAdvraFVDDa  120
ident   | |                       |             |              |  
Sbjct WHEAADTKscCDYS-LHVDITSWYDGVREELEVLvQDKGVNSFQVYMAYKD-vyqMSDS-  160
DSSP  HHHHHHLLllLEEE-EEEELLLLLLLHHHHHHHHhHLLLLLEEEEELLLLL-lllLLHH-


DSSP  HHHHHHHHHHHLLLEEEELLL----------------------------HHHH-HHHHHH
Query DFARGVAWLQANDYVYDVLVF----------------------------ERQL-PDVQAF  151
ident         |     |  |                               |      |   
Sbjct QLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpEELEaEAVFRA  220
DSSP  HHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllHHHHhHHHHHH


DSSP  HHHLL--LLLEEEHHHHlllhhhllllllhhhhHHHHHHHHHLLL----LEEEEELLLL-
Query CARHD--AHWLVLDHAGkpalaefdrddtalarWRAALRELAALP----HVVCKLSGLV-  204
ident                                     |    |        |         
Sbjct ITIAGriNCPVYITKVM----------------SKSAADIIALARkkgpLVFGEPIAASl  264
DSSP  HHHHHhhLLLEEEEEEL----------------LHHHHHHHHHHHhhllLEEEEELHHHh


DSSP  -lLLLLLLL-------------llhhHHHHHHHHHHHHHHHHlhhHEEELLLLL------
Query -tEADWRRG-------------lrasDLRHIEQCLDAALDAFgpqRLMFGSDWP------  244
ident                           |                      ||         
Sbjct gtDGTHYWSknwakaaafvtspplspDPTTPDYLTSLLACGD---LQVTGSGHCpystaq  321
DSSP  hlLLHHHHLllhhhhhhlllllllllLLLHHHHHHHHHHHLL---LLLLLLLLLlllhhh


DSSP  -------------HHHHlllHHHHHHHHHHHHHH--HLLHHHHHHHLLHHHHHHLLLL--
Query -------------VCLLaasYDEVASLVERWAES--RLSAAERSALWGGTAARCYALP--  287
ident                       |    |   |            |     ||    |   
Sbjct kavgkdnftlipeGVNG---IEERMTVVWDKAVAtgKMDENQFVAVTSTNAAKIFNLYpr  378
DSSP  hhhhlllhhhlllLLLL---LLLHHHHHHHHHLLllLLLHHHHHHHHLHHHHHHHLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct kgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedg  438
DSSP  llllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeell


DSSP  ---------------------------------------
Query ---------------------------------------  287
ident                                        
Sbjct ninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  eellllllllllllllllhhhhhhhhhhhhhllllllll


No 19: Query=4dlfA Sbjct=2vc5A Z-score=16.6

back to top
DSSP  ---------------lLLEEEEELL-LLLLHHHllllllllhhhllllLHHHHHHHHHHL
Query ---------------aLRIDSHQHF-WRYRAADypwigagmgvlardyLPDALHPLMHAQ   44
ident                      | |      |                             
Sbjct mriplvgkdsieskdiGFTLIHEHLrVFSEAVR-qqwphlynedeefrNAVNEVKRAMQF   59
DSSP  llllllllllllhhhlLLEELLLLLlLLLHHHH-hhlhhhllhhhhhhHHHHHHHHHHHL


DSSP  LLLEEEEELLLLlhhHHHHhhHHHLLLL----LEEEEEELL------------llLLLLH
Query ALGASIAVQARAgrdETAFllELACDEA----RIAAVVGWE------------dlRAPQL   88
ident                                                             
Sbjct GVKTIVDPTVMG--lGRDI--RFMEKVVkatgINLVAGTGIyiyidlpfyflnrsIDEIA  115
DSSP  LLLEEEELLLLL--lLLLH--HHHHHHHhlllLEEEELEELlllllllhhhllllHHHHH


DSSP  HH---hHHLLL---LLLEEEEEELHHhlLLHH-HHHHlhHHHHHHHHHHH-LLLEEEELL
Query AE---rVAEWR---GTKLRGFRHQLQdeADVR-AFVDdaDFARGVAWLQA-NDYVYDVLV  140
ident         |       |                  |      |  |              
Sbjct DLfihdIKEGIqgtLNKAGFVXIAAD--EPGItKDVE--KVIRAAAIANKeTKVPIITHS  171
DSSP  HHhhhhHHLLLlllLLLLLLEEEELL--LLLLlHHHH--HHHHHHHHHHHhHLLLEEEEL


DSSP  LHHHHhHHHHHHHH---LLLL--LEEEHHHHLLLhhhllllllhhhhHHHHHHHHHLLLl
Query FERQLpDVQAFCAR---HDAH--WLVLDHAGKPAlaefdrddtalarWRAALRELAALPh  195
ident                             | |                        |    
Sbjct NAHNN-TGLEQQRIlteEGVDpgKILIGHLGDTD-------------NIDYIKKIADKG-  216
DSSP  LLLLL-HHHHHHHHhhhLLLLhhHEEELLHHHLL-------------LHHHHHHHHHLL-


DSSP  EEEEELLLLLLLlllllllhhHHHHHHHHHHHHHHHHLHHHEEELLLLL-----------
Query VVCKLSGLVTEAdwrrglrasDLRHIEQCLDAALDAFGPQRLMFGSDWP-----------  244
ident     |                                     |   |             
Sbjct SFIGLDRYGLDL-------flPVDKRNETTLRLIKDGYSDKIMISHDYCctidwgtakpe  269
DSSP  LEEEELLLLLLL-------llLHHHHHHHHHHHHHLLLLLLEEELLLLLlllllllllhh


DSSP  ---hhHHLLLHHHHHHHHHHHHHHH-LLHHHHHHHLLHHHHHHLLll
Query ---vcLLAASYDEVASLVERWAESR-LSAAERSALWGGTAARCYAlp  287
ident          |                                     
Sbjct ykpklAPRWSITLIFEDTIPFLKRNgVNEEVIATIFKENPKKFFS--  314
DSSP  hhhhhLLLLLLLHHHHLHHHHHHLLlLLHHHHHHHHLHHHHHHLL--


No 20: Query=4dlfA Sbjct=3k2gB Z-score=16.4

back to top
DSSP  --------------------------lLLEEEEELLLlllhhhLLLLLL-----------
Query --------------------------aLRIDSHQHFWryraadYPWIGA-----------   23
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQ----ndCRCWWNppqeperqyla   56
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL----eeLHHHLLllllhhhhhhh


DSSP  -----------------LLHHHLLLL---LHHHHHHHHHHLLLLEEEEELllLLHHhhhH
Query -----------------GMGVLARDY---LPDALHPLMHAQALGASIAVQarAGRDetaF   63
ident                              |  |      |             |      
Sbjct eapisieilselrqdpfVNKHNIALDdldLAIAEVKQFAAVGGRSIVDPT-cRGIG---R  112
DSSP  hllllhhhhhhhhllhhHLLLLLEELlhhHHHHHHHHHHHLLLLEEEELL-lLLLL---L


DSSP  HHHHHLLLL----LEEEEEELL-----------llLLLLHHHH-HHLLL------LLLEE
Query LLELACDEA----RIAAVVGWE-----------dlRAPQLAER-VAEWR------GTKLR  101
ident                                     |   |   |||             
Sbjct DPVKLRRISaetgVQVVXGAGYylassxpetaarlSADDIADEiVAEALegtdgtDARIG  172
DSSP  LHHHHHHHHhhhlLEEEELLLLllhhhllhhhhllLHHHHHHHhHHHHHllllllLLLLL


DSSP  EEE-ELHHHllLHHHHHHlhHHHHHHHHHHH-LLLEEEELLLHHHHhHHHHHHHHLL---
Query GFR-HQLQDeaDVRAFVDdaDFARGVAWLQA-NDYVYDVLVFERQLpDVQAFCARHD---  156
ident            |  |        || |  |        |                     
Sbjct LIGeIGVSS--DFTAEEE--KSLRGAARAQVrTGLPLXVHLPGWFR-LAHRVLDLVEeeg  227
DSSP  LEEeELLLL--LLLHHHH--HHHHHHHHHHHhHLLLEEELLLLLLL-LHHHHHHHHHhll


DSSP  --lLLEEEHHHHLLlhhhllllllhhhHHHHHHHHHHLLLlEEEEELLLLLLLLLLllll
Query --aHWLVLDHAGKPalaefdrddtalaRWRAALRELAALPhVVCKLSGLVTEADWRrglr  214
ident       || |                         ||                       
Sbjct adlRHTVLCHXNPS------------hXDPVYQATLAQRG-AFLEFDXIGXDFFYA--dq  272
DSSP  llhHHEEELLLHHH------------lLLHHHHHHHHHHL-LEEEELLLLLLLEEL--ll


DSSP  hhhhhHHHHHHHHHHHHH---LHHHEEELLLLLH-----hhhLLLHHHHHHHHHHHHHH-
Query asdlrHIEQCLDAALDAF---GPQRLMFGSDWPV-----cllAASYDEVASLVERWAES-  265
ident             | |         |     |  |           |  |           
Sbjct gvqcpSDDEVARAILGLAdhgYLDRILLSHDVFVkxxltrygGNGYAFVTKHFLPRLRRh  332
DSSP  leellLHHHHHHHHHHHHhllLHHHEEELLLLLLhhhlhhhlLLLLLHHHHLHHHHHHHl


DSSP  HLLHHHHHHHLLHHHHHHLL----ll
Query RLSAAERSALWGGTAARCYA----lp  287
ident  |  |    |      |         
Sbjct GLDDAALETLXVTNPRRVFDasiegh  358
DSSP  LLLHHHHHHHHLHHHHHHHLllllll


No 21: Query=4dlfA Sbjct=1yrrB Z-score=16.2

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------ALRIDSHQH    9
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL


DSSP  ------LLLLLhhhllllllllhhhllllLHHHHHHHHHHLLLLEEEEELLLLLHHHHHH
Query ------FWRYRaadypwigagmgvlardyLPDALHPLMHAQALGASIAVQARAGRDETAF   63
ident       |                                                     
Sbjct gcggvqFNDTA------------eavsveTLEIMQKANEKSGCTNYLPTLITTSDELMKQ  108
DSSP  eelleeLLLLL------------llllhhHHHHHHHHHHLLLEEEEEEEELLLLHHHHHH


DSSP  HHHHHLLL-----LLEEEEEELLLLllLLHHHHHHLLLlLLEEEEEElhhhlllhhhhHH
Query LLELACDE-----ARIAAVVGWEDLraPQLAERVAEWRgTKLRGFRHqlqdeadvrafVD  118
ident                              |     |                        
Sbjct GVRVMREYlakhpNQALGLHLEGPWlnAALVDFLCENA-DVITKVTL---------apEM  158
DSSP  HHHHHHHHhhhllLLLLLEEEELLLllLHHHHHHHHLH-HHEEEEEE---------lhHH


DSSP  LHhhHHHHHHHHHLLLEEEELLlhhhhHHHHHHHHHL-LLLLEEEHHHHLLlhhhlllll
Query DAdfARGVAWLQANDYVYDVLVferqlPDVQAFCARH-DAHWLVLDHAGKPalaefdrdd  177
ident     |     |     |                      |      |             
Sbjct VP--AEVISKLANAGIVVSAGH----sNATLKEAKAGfRAGITFATHLYNA---------  203
DSSP  LL--HHHHHHHHHHLLEEEELL----lLLLHHHHHHHhHHLEEEELLLLLL---------


DSSP  lhhhHHHH-----hHHHHHLLLLEEEEELlLLLLllllllllhhhhhhHHHHHHHHHHHH
Query talaRWRA-----aLRELAALPHVVCKLSgLVTEadwrrglrasdlrhIEQCLDAALDAF  232
ident                          |                             |    
Sbjct ---mPYITgrepglAGAILDEADIYCGIIaDGLH-------------vDYANIRNAKRLK  247
DSSP  ---lLLLLllllhhHHHHHHLLLLEEEEElLLLL-------------lLHHHHHHHHHHH


DSSP  LhHHEEELLLLLhhhHLLLHhhHHHHHHHHHHH--HLLHHHHHHHLLHHHHHHLLLL---
Query GpQRLMFGSDWPvclLAASYdeVASLVERWAES--RLSAAERSALWGGTAARCYALP---  287
ident |   |    |        |         |           |         ||        
Sbjct G-DKLCLVTDAT---SGSSL--TMIEGVRNLVEhcGIALDEVLRMATLYPARAIGVEkrl  301
DSSP  H-HHEEEELLLL---LLLLL--LHHHHHHHHHHhhLLLHHHHHHHHLHHHHHHLLLLlll


DSSP  ---------------------------------
Query ---------------------------------  287
ident                                  
Sbjct gtlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  lllllllllleeeellllleeeeeelleeeeel


No 22: Query=4dlfA Sbjct=4dziC Z-score=16.0

back to top
DSSP  ---LLLEEEEELLLLLL------------------------------hhhlLLLLL--lL
Query ---ALRIDSHQHFWRYR------------------------------aadyPWIGA--gM   25
ident       ||   |                                         |      
Sbjct alnYRVIDVDNHYYEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnHFIPNptfD   60
DSSP  lllLLEEEEEEELLLLLllllllllhhhlllleeeeelllleeeeelleelLLLLLlllL


DSSP  HHH-------------------------------lllLLHHHHHHHHHHLLLLEEEEELL
Query GVL-------------------------------ardYLPDALHPLMHAQALGASIAVQA   54
ident                                         ||    |  |          
Sbjct PIIvpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPT  120
DSSP  LEElllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELL


DSSP  LL-----------------LHHHHHHHHHHH---LLLLLEeEEEELLLLL-LLLHHHHHH
Query RA-----------------GRDETAFLLELA---CDEARIaAVVGWEDLR-APQLAERVA   93
ident                           | |         ||        |       | | 
Sbjct FGcgveealkhdieatmasVHAFNLWLDEDWgfdRPDHRI-IAAPIVSLAdPTRAVEEVD  179
DSSP  HHhhhhhhllllhhhhhhhHHHHHHHHHHHLlllLLLLLE-EELLLLLLLlHHHHHHHHH


DSSP  L-LLLLlEEEEEELHH--hlllhhHHHHLHHHHHHHHHHHHLLLEEEELL----------
Query E-WRGTkLRGFRHQLQ--deadvrAFVDDADFARGVAWLQANDYVYDVLV----------  140
ident                             |       | |                     
Sbjct FvLARG-AKLVLVRPApvpglvkpRSLGDRSHDPVWARLAEAGVPVGFHLsdsgylhiaa  238
DSSP  HhHHLL-LLLEELLLLllllllllLLLLLHHHHHHHHHHHHHLLLEEEELlllllhhhhh


DSSP  --------------LHHH-HHHHHHHH-----HHLLLLLEEEHHhHLLLhhhllllllhh
Query --------------FERQ-LPDVQAFC-----ARHDAHWLVLDHaGKPAlaefdrddtal  180
ident                 |                ||     |                   
Sbjct awggakdpldqvllDDRAiHDTMASMIvhgvfTRHPKLKAVSIE-NGSY-----------  286
DSSP  hllllllhhhhhhhLLHHhHHHHHHHHhllhhHHLLLLLEEEEL-LLLL-----------


DSSP  hhHHHHH---------------hhHHLL--LLEEEEEllllllllllllllhhhhhhHHH
Query arWRAAL---------------reLAAL--PHVVCKLsglvteadwrrglrasdlrhIEQ  223
ident                                 |                         | 
Sbjct -fVHRLIkrlkkaantqpqyfpedPVEQlrNNVWIAP-------------------yYED  326
DSSP  -hHHHHHhhhhhhhhhlhhhllllHHHHhhHHEEELL-------------------lLLL


DSSP  HHHHHHHHHLHHHEEELLLLLHHHhlllHHHHHHhHHHHHHhHLLHHHHHHHLLHHHHHH
Query CLDAALDAFGPQRLMFGSDWPVCLlaasYDEVASlVERWAEsRLSAAERSALWGGTAARC  283
ident  |       |     ||||||            |          |           |   
Sbjct DLPELARVIGVDKILFGSDWPHGE---gLASPVS-FTAELK-GFSESDIRKIMRDNALDL  381
DSSP  LHHHHHHHHLHHHLLLLLLLLLLL---lLLLHHH-HHHHHL-LLLHHHHHHHHLHHHHHH


DSSP  LL---ll
Query YA---lp  287
ident        
Sbjct LGvqvgs  388
DSSP  HLlllll


No 23: Query=4dlfA Sbjct=3pnuA Z-score=16.0

back to top
DSSP  ------------LLLEEEEELLLLLlhhhllllllllhhhlLLLLhHHHHHHHHhlLLLE
Query ------------ALRIDSHQHFWRYraadypwigagmgvlaRDYLpDALHPLMHaqALGA   48
ident                 | | |                                      |
Sbjct enlyfqsnamklKNPLDMHLHLRDN----------------QMLE-LIAPLSAR--DFCA   41
DSSP  llllllllleeeELLEEEEELLLLH----------------HHHH-HHHHHHHL--LLLE


DSSP  EEEELLL--LLHHhHHHHHHHHLLLL-------LEEEEEELLLLllllHHHHHHLLLLLl
Query SIAVQAR--AGRDeTAFLLELACDEA-------RIAAVVGWEDLrapqLAERVAEWRGTk   99
ident                  |                                          
Sbjct AVIMPNLipPLCN-LEDLKAYKMRILkackdenFTPLMTLFFKN---yDEKFLYSAKDE-   96
DSSP  EEELLLLllLLLL-HHHHHHHHHHHHhhhllllLEEEEEEELLL---lLHHHHHHHLLL-


DSSP  EEEEEELHHHL----llhhhHHHLHHHHHHHHHHHHLLLEEEELLL---------HHHHH
Query LRGFRHQLQDE----advraFVDDADFARGVAWLQANDYVYDVLVF---------ERQLP  146
ident   |                   |                   |                 
Sbjct IFGIXLYPAGIttnsnggvsSFDIEYLKPTLEAMSDLNIPLLVHGEtndfvmdreSNFAK  156
DSSP  LLEEEELLLLLlllllllllLLLHHHHHHHHHHHHHLLLLEEELLLllllhhhllHHHHH


DSSP  HHHHHHHHLLLLLEEEHHHhlllhhhllllllhhhhHHHHHHHHHLLLLEEEEELLLL-L
Query DVQAFCARHDAHWLVLDHAgkpalaefdrddtalarWRAALRELAALPHVVCKLSGLV-T  205
ident               |  |                         |                
Sbjct IYEKLAKHFPRLKIVMEHI----------------tTKTLCELLKDYENLYATITLHHlI  200
DSSP  HHHHHHHHLLLLLEEELLL----------------lLHHHHHHHHHLLLEEEEELLHHhL


DSSP  LLL-------lLLLL---lhhhhHHHHHHHHHHHhhhLHHHEEELLLLLH-----hhHLL
Query EAD-------wRRGL---rasdlRHIEQCLDAALdafGPQRLMFGSDWPV-----clLAA  250
ident               |              |       |    |||||             
Sbjct ITLddviggkmNPHLfckpiakrYEDKEALCELA-fsGYEKVMFGSDSAPhpkgcaaGVF  259
DSSP  LLHhhhhllllLHHHllllllllHHHHHHHHHHH-hlLLLLEEELLLLLLlllllllLLL


DSSP  LHHHHHHHHHHHHHHHLLHHHHHHHLLHHHHHHLLLL-----------------------
Query SYDEVASLVERWAESRLSAAERSALWGGTAARCYALP-----------------------  287
ident |                |               | |                        
Sbjct SAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKfkedkiltleekewqvpnvyedk  319
DSSP  LHHHHHHHHHHHHHHHLLHHHHHHHHLHHHHHHHLLLllllleeeeellleelllleell


DSSP  -------------------
Query -------------------  287
ident                    
Sbjct ynqvvpymageilkfqlkh  338
DSSP  lleellllllleelleell


No 24: Query=4dlfA Sbjct=2pajA Z-score=15.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  LLLEEEEELLL-------lLLHHHllllllllhhhlllLLHHHHHHHHHHLLLLEEEEEL
Query ALRIDSHQHFW-------rYRAADypwigagmgvlardYLPDALHPLMHAQALGASIAVQ   53
ident       | |           ||                                      
Sbjct PAWVNTHHHLFqsllkgepFRALF--------derrfrLAARIGLIELARSGCATVADHN  112
DSSP  ELEELLLLLHHhhhlllllLHHHL--------lhhhhhHHHHHHHHHHHLLLEEEEEELL


DSSP  LLLL----hHHHHHHHHHHLLLLLEEEEEEL----------------lllLLLLHHHHHH
Query ARAG----rDETAFLLELACDEARIAAVVGW----------------edlRAPQLAERVA   93
ident          |  | | | |                                         
Sbjct YVYYpgmpfDSSAILFEEAEKLGLRFVLLRGgatqtrqleadlptalrpeTLDAYVADIE  172
DSSP  LLLLlllllLHHHHHHHHHHHLLLEEEEEELlllllllllllllhhhlllLHHHHHHHHH


DSSP  L-LLLL--------LEEEEEE-LHHHLllhhhHHHLhhHHHHHHHHHHLLLEEEELLL-h
Query E-WRGT--------KLRGFRH-QLQDEadvraFVDDadFARGVAWLQANDYVYDVLVF-e  142
ident                                            |                
Sbjct RlAARYhdaspramRRVVMAPtTVLYS----iSPRE--MRETAAVARRLGLRMHSHLSgk  226
DSSP  HhHHHLllllllllEEEEELLlLLLLL----lLHHH--HHHHHHHHHHLLLEEEEELLll


DSSP  HHHHHHHHHHhhllllLEEEHhHHLLlhhhllllllhhhhHHHHHHHHHLLLlEEEEEL-
Query RQLPDVQAFCarhdahWLVLDhAGKPalaefdrddtalarWRAALRELAALPhVVCKLS-  201
ident                                                ||           
Sbjct SPVAFCGEHD--wlgsDVWYA-HLVK-------------vDADEIALLAQTG-TGVAHCp  269
DSSP  LHHHHHHHLL--llllLEEEE-LLLL-------------lLHHHHHHHHHHL-LEEEELh


DSSP  -LLLLLllllllllhhhhhhhhhHHHHHHHHHLhhHEEELLLLLHHHhlLLHH--HHHHH
Query -GLVTEadwrrglrasdlrhieqCLDAALDAFGpqRLMFGSDWPVCLlaASYD--EVASL  258
ident                              ||        | |          |       
Sbjct qSNGRL-----------------PVREMADAGV--PVSIGVDGAASN--EAADmiSEVHM  308
DSSP  hHHHLL-----------------LLLLHHHHLL--LEEELLLHHHHL--LLLLhhHHHHH


DSSP  HHHHHHHH-LLHHHHHHHLLHHHHHHLLLL------------------------------
Query VERWAESR-LSAAERSALWGGTAARCYALP------------------------------  287
ident        |  | ||         ||   |                               
Sbjct TWLAQRARlASIAEVIHWGTAGGARVMGLDevgkvavgyaadiavyrlddpryfglhdpa  368
DSSP  HHHHHHHLlLLHHHHHHHHLHHHHHHHLLLlllllllllllleeeeelllhhhlllllhh


DSSP  -----------------------------------------------------
Query -----------------------------------------------------  287
ident                                                      
Sbjct igpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  hhhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 25: Query=4dlfA Sbjct=1onxA Z-score=15.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  -LLLEEEEELLLlllhhhllLLLLllhhhLLLLLHHhhHHHHHHLLLLEEEEELLLLL-h
Query -ALRIDSHQHFWryraadypWIGAgmgvlARDYLPDalHPLMHAQALGASIAVQARAG-r   58
ident     || | |                    |                             
Sbjct cPGFIDQHVHLI-----gggGEAG---ptTRTPEVA--LSRLTEAGVTSVVGLLGTDSis  110
DSSP  eELEEEEEELLL-----lllLLLL---hhHLLLLLL--HHHHHHLLEEEEEELLLLLLll


DSSP  HHHHHHHHHHLLLL---LEEEEEEL--LLLLlllhHHHH--hllLLLLEEEEEELHH---
Query DETAFLLELACDEA---RIAAVVGW--EDLRapqlAERV--aewRGTKLRGFRHQLQ---  108
ident      ||            |                  |           |         
Sbjct RHPESLLAKTRALNeegISAWMLTGayHVPS-rtiTGSVekdvaIIDRVIGVXCAISdhr  169
DSSP  LLHHHHHHHHHHHHhhlLEEEEEEEllLLLL-lllLLLHhhhhhHLLLEEEEEEEELlll


DSSP  HLLLhhhHHHLhhHHHHHHHHHHLL------LEEEELLLHH--HHHHHHHHH--hHLLLL
Query DEADvraFVDDadFARGVAWLQAND------YVYDVLVFER--QLPDVQAFC--aRHDAH  158
ident   |     |     |   |             |           |               
Sbjct SAAP---DVYH--LANMAAESRVGGllggkpGVTVFHMGDSkkALQPIYDLLencDVPIS  224
DSSP  LLLL---LHHH--HHHHHHHHHHHHhhhlllLEEEEEELLLllLLHHHHHHHhllLLLHH


DSSP  LEEEHHHHLLLhhhllllllhhhHHHHHHHHHHLLLlEEEEEL-LLLLLllllllllhhh
Query WLVLDHAGKPAlaefdrddtalaRWRAALRELAALPhVVCKLS-GLVTEadwrrglrasd  217
ident  |   |                        | |                           
Sbjct KLLPTHVNRNV------------PLFEQALEFARKG-GTIDITsSIDEP-----------  260
DSSP  HEEEELHHHLH------------HHHHHHHHHHHLL-LLEEEElLLLLL-----------


DSSP  hhHHHHHHHHHHHH-HLHHHEEELLLLLH------------hhHLLLHHhHHHHHHHHHH
Query lrHIEQCLDAALDA-FGPQRLMFGSDWPV------------clLAASYDeVASLVERWAE  264
ident           |  |     |    ||                   |              
Sbjct -vAPAEGIARAVQAgIPLARVTLSSDGNGsqpffddegnlthiGVAGFE-TLLETVQVLV  318
DSSP  -lLHHHHHHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeEELLLH-HHHHHHHHHH


DSSP  --HHLLHHHHHHHLLHHHHHHLLLL-----------------------------------
Query --SRLSAAERSALWGGTAARCYALP-----------------------------------  287
ident      |            |    |                                    
Sbjct kdYDFSISDALRPLTSSVAGFLNLTgkgeilpgndadllvmtpelrieqvyargklmvkd  378
DSSP  hhHLLLHHHHHHHHLHHHHHHLLLLlllllllllllleeeellllleeeeeelleeeeel


DSSP  ------------
Query ------------  287
ident             
Sbjct gkacvkgtfetd  390
DSSP  leelllllllll


No 26: Query=4dlfA Sbjct=3giqA Z-score=15.7

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------ALRID    5
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE


DSSP  EEELLLlllhhhllllllllhhhlllLLHH--HHHHHHHHLLLLEEEEE---LLLLLHH-
Query SHQHFWryraadypwigagmgvlardYLPD--ALHPLMHAQALGASIAV---QARAGRD-   59
ident  | |                                    |              |    
Sbjct VHGHDD--------------------LMFVekPDLRWKTSQGITTVVVGncgVSAAPAPl  100
DSSP  LLLLLL--------------------LHHHhlLLLHHHHLLLEEEEEELlllLLLLLLLl


DSSP  ------------------HHHHHHHHHL--LLLLEEEEEELLL----------------l
Query ------------------ETAFLLELAC--DEARIAAVVGWED----------------l   83
ident                                     |                       
Sbjct pgntaaalallgetplfaDVPAYFAALDaqRPMINVAALVGHAnlrlaamrdpqaaptaa  160
DSSP  lllllhhhhhhlllllllLHHHHHHHHHhlLLLLEEEEEEEHHhhhhhhlllllllllhh


DSSP  lLLLHHHHHHL-LLLLlEEEEEELHHHLllhhhHHHLHHHHHHHHHHHHLLLEEEEL-LL
Query rAPQLAERVAE-WRGTkLRGFRHQLQDEadvraFVDDADFARGVAWLQANDYVYDVL-VF  141
ident                    ||   |            |                      
Sbjct eQQAMQDMLQAaLEAG-AVGFSTGLAYQ--pgaVAQAAELEGLARVAAERRRLHTSHiRN  217
DSSP  hHHHHHHHHHHhHHHL-LLEEEEELLLL--lhhHLLHHHHHHHHHHHHHLLLEEEEElLL


DSSP  HH--HHHHHHHHHHHLL--LLLEEEHHHhLLLHhhllllLLHHHHHHHHHHHHHLLL---
Query ER--QLPDVQAFCARHD--AHWLVLDHAgKPALaefdrdDTALARWRAALRELAALP---  194
ident |       |    |         |  |  |              | || |          
Sbjct EAdgVEAAVEEVLAIGRgtGCATVVSHH-KCMM------PQNWGRSRATLANIDRAReqg  270
DSSP  LLllHHHHHHHHHHHHHhhLLEEEELLL-LLLL------HHHLLLHHHHHHHHHHHHhll


DSSP  -LEEEEELlLLLL-----------------------------------------------
Query -HVVCKLSgLVTE-----------------------------------------------  206
ident   |                                                         
Sbjct vEVALDIYpYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaar  330
DSSP  lLEEEEELlLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhh


DSSP  -lllLLLLlhhhhhHHHHHHHHHHHHhlhHHEEELLLLLH--hhHLLLHHHHHHHHH-HH
Query -adwRRGLrasdlrHIEQCLDAALDAfgpQRLMFGSDWPV--clLAASYDEVASLVE-RW  262
ident                 |               | |||                  |  | 
Sbjct rlapAGAI---yfaMDEDEVKRIFQH---PCCMVGSDGLPndarPHPRLWGSFTRVLgRY  384
DSSP  hhllEEEE---eelLLHHHHHHHHHL---LLEEELLLLLLllllLLLHHHHHHHHHHhHH


DSSP  HH--HHLLHHHHHHHLLHHHHHHLLLL---------------------------------
Query AE--SRLSAAERSALWGGTAARCYALP---------------------------------  287
ident              |      ||                                      
Sbjct VReaRLMTLEQAVARMTALPARVFGFAergvlqpgawadvvvfdpdtvadratwdeptla  444
DSSP  HHhlLLLLHHHHHHHHLHHHHHHHLLLlllllllllllleeeelllllllllllllllll


DSSP  -------------------------------
Query -------------------------------  287
ident                                
Sbjct svgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  llleeeeeelleeeellllllllllllllll


No 27: Query=4dlfA Sbjct=3gg7A Z-score=15.5

back to top
DSSP  lLLEEEEELLLlllhhhllllllllhhhlLLLL--HHHHHHHHhhlllLEEEEELlLLLH
Query aLRIDSHQHFWryraadypwigagmgvlaRDYL--PDALHPLMhaqalGASIAVQaRAGR   58
ident    || | |                     |      |               |      
Sbjct -SLIDFHVHLD----------------lyPDPVavARACEERQ-----LTVLSVT-TTPA   37
DSSP  -LLEEEEELHH----------------hlLLHHhhHHHHHHLL-----LEEEELL-LLHH


DSSP  hHHHHHHHHHLLLLLEeEEEELL--------llllllHHHHHHLlllllEEEEE-ELHHH
Query dETAFLLELACDEARIaAVVGWE--------dlrapqLAERVAEwrgtkLRGFR-HQLQD  109
ident       | ||                                 |      |      |  
Sbjct -AWRGTLALAAGRPHV-WTALGFhpevvseraadlpwFDRYLPE-----TRFVGeVGLDG   90
DSSP  -HHHHHHHHHLLLLLE-EELLLLlhhhllllhhhlhhHHHHHHH-----LLEEEeEELLL


DSSP  ---LLLHHHHHHLhhHHHHHHHHHH-LLLEEEELLLhHHHHHHHHHHHHLLL-LLEEEHH
Query ---EADVRAFVDDadFARGVAWLQA-NDYVYDVLVFeRQLPDVQAFCARHDA-HWLVLDH  164
ident                |                     |    |              |  
Sbjct spsLRGTWTQQFA-vFQHILRRCEDhGGRILSIHSR-RAESEVLNCLEANPRsGTPILHW  148
DSSP  lhhHHHHHHHHHH-hHHHHHHHHHHlLLEEEEEELL-LLHHHHHHHHHHLHHhEEEEEEL


DSSP  HHLllhhhllllllhhhhHHHHHHHHHLLLlEEEEELlllllllllllllhhhhhhHHHH
Query AGKpalaefdrddtalarWRAALRELAALPhVVCKLSglvteadwrrglrasdlrhIEQC  224
ident                       ||    |                             | 
Sbjct YSG---------------SVTELRRAISLG-CWFSVG---------------ptmvRTQK  177
DSSP  LLL---------------LHHHHHHHHHLL-LEEEEL---------------hhhhLLHH


DSSP  HHHHHHHHLHHHEEELLLLLHHHH--LLLHhhHHHHHHHHHHHHLLH---HHHHHHlLHH
Query LDAALDAFGPQRLMFGSDWPVCLL--AASYdeVASLVERWAESRLSA---AERSALwGGT  279
ident   |        |     | |   |   |        |                       
Sbjct GAALIRSMPRDRVLTETDGPFLELdgQAALpwDVKSVVEGLSKIWQIpasEVERIV-KEN  236
DSSP  HHHHHHHLLHHHEEELLLLLLLEEllEELLhhHHHHHHHHHHHHHLLlhhHHHHHH-HHH


DSSP  HHHHLLll
Query AARCYAlp  287
ident   |     
Sbjct VSRLLG-t  243
DSSP  HHHHHH-l


No 28: Query=4dlfA Sbjct=2ogjA Z-score=15.3

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------ALRID    5
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE


DSSP  EEEL-LLLLlhhhllllllllhhhlllLLHHHHhhhHHHLLLLEEEEELLLLLHHhHHHH
Query SHQH-FWRYraadypwigagmgvlardYLPDALhplMHAQALGASIAVQARAGRDeTAFL   64
ident  | |                         |                              
Sbjct LHVHiWHGG--------------tdisIRPSEC---GAERGVTTLVDAGSAGEAN-FHGF  102
DSSP  EEELlLLLL--------------llllLLHHHL---LHHHLEEEEEEELLLLLLL-HHHH


DSSP  HH-HHLLLLLEEEEEELLL-----------------lLLLL-HHHHHHLLLlLLEEEEEE
Query LE-LACDEARIAAVVGWED-----------------lRAPQ-LAERVAEWRgTKLRGFRH  105
ident  |                                          |  ||       |   
Sbjct REyIIEPSRERIKAFLNLGsiglvacnrvpelrdikdIDLDrILECYAENS-EHIVGLXV  161
DSSP  HHhLLLLLLLEEEEEEELLlllllllllllllllhhhLLHHhHHHHHHLLL-LLEEEEEE


DSSP  LHH--HLLL-HHHHHHLhhHHHHHHHHHhllLEEEELLLHH--HHHHHHHHHHhlllLLE
Query QLQ--DEAD-VRAFVDDadFARGVAWLQandYVYDVLVFER--QLPDVQAFCArhdaHWL  160
ident               |           |        | | |       |            
Sbjct RAShvITGSwGVTPVKL--GKKIAKILK---VPXXVHVGEPpaLYDEVLEILG----PGD  212
DSSP  EELhhHHLLlLLHHHHH--HHHHHHHHL---LLEEEEELLLllLHHHHHHHLL----LLL


DSSP  EEHHHhLLLHhhllllllhHHHHhHHHHHHHLLLLEEEEELLLLLLLlllllllhhhhhh
Query VLDHAgKPALaefdrddtaLARWrAALRELAALPHVVCKLSGLVTEAdwrrglrasdlrh  220
ident |  |                                                        
Sbjct VVTHCfNGKS-----gssiXEDE-DLFNLAERCEGIRLDIGHGGASF-------------  253
DSSP  EEELLlLLLL-----llllLLLH-HHHHHHHHLLLLEEELLLLLLLL-------------


DSSP  HHHHHHHHH-HHHLhhHEEELLLLL-HHHHLLLHhhHHHHHHHHHHH-HLLHHHHHHHLL
Query IEQCLDAAL-DAFGpqRLMFGSDWP-VCLLAASYdeVASLVERWAES-RLSAAERSALWG  277
ident       ||              |                       |             
Sbjct SFKVAEAAIaRGLL--PFSISTDLHgHSXNFPVW--DLATTXSKLLSvDXPFENVVEAVT  309
DSSP  LHHHHHHHHhLLLL--LLLLLLLLLlLLLLLLLL--LHHHHHHHHHHlLLLHHHHHHLLL


DSSP  HHHHHHLLLL--------------------------------------------------
Query GTAARCYALP--------------------------------------------------  287
ident    |    |                                                   
Sbjct RNPASVIRLDxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaea  369
DSSP  HHHHHHLLLLllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeellee


DSSP  ----------
Query ----------  287
ident           
Sbjct iaasryipra  379
DSSP  eellllllll


No 29: Query=4dlfA Sbjct=2imrA Z-score=14.8

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------ALRIDS    6
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE


DSSP  EELLLlllhhHLLLL------LLLL--HHHLLL----LLHHHHHHHHHHlLLLEEEEELl
Query HQHFWryraaDYPWI------GAGM--GVLARD----YLPDALHPLMHAqALGASIAVQa   54
ident | |        |                                 |      |       
Sbjct HTHLD---msAYEFQalpyfqWIPEvvIRGRHLrgvaAAQAGADTLTRL-GAGGVGDIV-  115
DSSP  EEELL---llHHHHHhlhhhhLLHHhhHHHLLLlhhhHHHHHHHHHHHL-LLLLEEEEE-


DSSP  lllhhHHHHHHHHHLLL-LLEEEEEELL--------llLLLLHHHHHHL-LLLL---LEE
Query ragrdETAFLLELACDE-ARIAAVVGWE--------dlRAPQLAERVAE-WRGT---KLR  101
ident                                                    |        
Sbjct -----WAPEVMDALLAReDLSGTLYFEVlnpfpdkadeVFAAARTHLERwRRLErpgLRL  170
DSSP  -----LLHHHHHHHHLLlLLLEEEEEEEllllhhhhhhHHHHHHHHHHHhHLLLlllEEE


DSSP  EEEELHHHLllhhhHHHLhHHHHHHHHHHHLLLEEEELLL--------------------
Query GFRHQLQDEadvraFVDDaDFARGVAWLQANDYVYDVLVF--------------------  141
ident |                                     |                     
Sbjct GLSPHTPFT-----VSHR-LMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnr  224
DSSP  EEEELLLLL-----LLHH-HHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhl


DSSP  --------------------hHHHHHHH--HHHHhlllLLEEEHhHHLLlhhhllllllh
Query --------------------eRQLPDVQ--AFCArhdaHWLVLDhAGKPalaefdrddta  179
ident                                  |        |                 
Sbjct mpalyphtlaevigrepgpdlTPVRYLDelGVLA----ARPTLV-HMVN-----------  268
DSSP  lhhhllllhhhhhllllllllLHHHHHHhhLLHH----HLLEEE-ELLL-----------


DSSP  hhhHHHHHHHHHLLLlEEEEEL--LLLLLLlllllllhhhhhHHHHhHHHHHHHHLhhHE
Query larWRAALRELAALPhVVCKLS--GLVTEAdwrrglrasdlrHIEQcLDAALDAFGpqRL  237
ident            |                                     |   |      
Sbjct --vTPDDIARVARAG-CAVVTCprSNHHLE-----------cGTFD-WPAFAAAGV--EV  311
DSSP  --lLHHHHHHHHHHL-LLEEELhhHHHHLL-----------lLLLL-HHHHHHLLL--LE


DSSP  EELLLLL-HHHHlllhHHHHHHHHHHHHHHLLhHHHHHHLLHHHHHHLL-----------
Query MFGSDWP-VCLLaasyDEVASLVERWAESRLSaAERSALWGGTAARCYA-----------  285
ident   | |            |                           |              
Sbjct ALGTDSVaSGET-lnvREEVTFARQLYPGLDP-RVLVRAAVKGGQRVVGtpflrrgetwq  369
DSSP  EELLLLHhHHLL-lllHHHHHHHHHHLLLLLH-HHHHHHHHHHHHHHHLlllllllllll


DSSP  ---------ll
Query ---------lp  287
ident            
Sbjct egfrwelsrdl  380
DSSP  hhhlhhhllll


No 30: Query=4dlfA Sbjct=3icjA Z-score=14.7

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------A    1
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE


DSSP  LLEEEEELLL------LLLH----------------------------------------
Query LRIDSHQHFW------RYRA----------------------------------------   15
ident    ||| |                                                    
Sbjct AFFDSHLHLDelgmslEMVDlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHhhhhhhHLEEllllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  -----hhllllLLLLH--------------------------------------------
Query -----adypwiGAGMG--------------------------------------------   26
ident                                                             
Sbjct ldvidrpvflyRRCFHvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeeELLLLeeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  -hhllllLHHHHHHHHHHLLLLEEEEELllllhhHHHHHHHHHLL------LLLEEEEEE
Query -vlardyLPDALHPLMHAQALGASIAVQaragrdETAFLLELACD------EARIAAVVG   79
ident                                        |                    
Sbjct tvkdykhYIESAQEHLLSLGVHSVGFMS------VGEKALKALFEleregrLKMNVFAYL  234
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEE------ELHHHHHHHHHhhhlllLLLEEEEEE


DSSP  LLLlllllhHHHHH---LLLLL----LEEEEEELHHH--------------------LLL
Query WEDlrapqlAERVA---EWRGT----KLRGFRHQLQD--------------------EAD  112
ident                              |                              
Sbjct SPE-----lLDKLEelnLGKFEgrrlRIWGVXLFVDGslgartallsepytdnpttsGEL  289
DSSP  LHH-----hHHHHHhhlLLLEEllleEEEEEEEELLLllllllllllllllllllllLLL


DSSP  HhhHHHLhhHHHHHHHHHHLLLEEEELLLHHH-HHHHHHHHHHLLLlLEEEHhHHLLlhh
Query VraFVDDadFARGVAWLQANDYVYDVLVFERQ-LPDVQAFCARHDAhWLVLDhAGKPala  171
ident |    |                   |                                  
Sbjct V-mNKDE--IVEVIERAKPLGLDVAVHAIGDKaVDVALDAFEEAEF-SGRIE-HASL---  341
DSSP  L-lLHHH--HHHHHHHHLLLLLEEEEEELLHHhHHHHHHHHHHHLL-LLEEE-ELLL---


DSSP  hllllllhhhhHHHHhHHHHLLLLEEEEEL-lLLLLLLllllLLHH----hhhhhhhHHH
Query efdrddtalarWRAAlRELAALPHVVCKLS-gLVTEADwrrgLRAS----dlrhieqCLD  226
ident                  |      |                                 | 
Sbjct ----------vRDDQ-LERIKELKVRISAQphFIVSDW----WIVNrvgeerakwayRLK  386
DSSP  ----------lLHHH-HHHHHHHLLEEEELllHHHHLL----LHHHhhhhhhhhhllLHH


DSSP  HHHHHHlhhHEEELLLLLHhhhlLLHHhhHHHHHHHHHH--------HLLHHHHHHHLLH
Query AALDAFgpqRLMFGSDWPVcllaASYDevASLVERWAES--------RLSAAERSALWGG  278
ident           | |  | |        |         |          | |  |   |   
Sbjct TLSSIT---KLGFSTDSPI----EPAD--PWVSIDAAVNryvvdpgeRVSREEALHLYTH  437
DSSP  HHHHHL---LEEELLLLLL----LLLL--HHHHHHHHHHlllllhhhLLLHHHHHHHLLH


DSSP  HHHHHLLLL----------------------
Query TAARCYALP----------------------  287
ident   |                            
Sbjct GSAQVTLAEdlgklergfraeyiildrdplk  468
DSSP  HHHHHLLLLlllllllllllleeeellllll


No 31: Query=4dlfA Sbjct=1j6pA Z-score=14.6

back to top
DSSP  --------------------------------------------------LLLEEEEELL
Query --------------------------------------------------ALRIDSHQHF   10
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH


DSSP  L-------lllhhhllLLLLLL-HHHLLL------lLHHHHHHHHHHLLLLEEEeELLLl
Query W-------ryraadypWIGAGM-GVLARD------yLPDALHPLMHAQALGASIaVQARa   56
ident                 |          |                                
Sbjct PxtllrgvaedlsfeeWLFSKVlPIEDRLtekxayyGTILAQXEXARHGIAGFV-DXYF-  118
DSSP  HhhhhllllllllhhhHHHLLHhHHHLLLlhhhhhhHHHHHHHHHHLLLEEEEE-EEEL-


DSSP  lhhHHHHHHHHHLLLLLeEEEEEL---------lLLLLllhhhhHHLLLLL---LEEEEE
Query grdETAFLLELACDEARiAAVVGW---------eDLRApqlaerVAEWRGT---KLRGFR  104
ident              |     |                          || |       || 
Sbjct ---HEEWIAKAVRDFGX-RALLTRglvdsngddgGRLE-enlklYNEWNGFegrIFVGFG  173
DSSP  ---LHHHHHHHHHHHLL-EEEEEEeellllllllLHHH-hhhhhHHHHLLHhhlEEEEEE


DSSP  ELHHHLllhhhHHHLhhHHHHHHHHHHLLLEEEELL--LHHHhHHHHHHHHHL-LLLLEE
Query HQLQDEadvraFVDDadFARGVAWLQANDYVYDVLV--FERQlPDVQAFCARH-DAHWLV  161
ident                    |                        |               
Sbjct PHSPYL----cSEEY--LKRVFDTAKSLNAPVTIHLyeTSKEeYDLEDILNIGlKEVKTI  227
DSSP  ELLLLL----lLHHH--HHHHHHHHHHHLLLEEEEEllLLLLlLLLHHHHLLLlLLLLEE


DSSP  EHhHHLLlhhhllllllhhhhHHHHHHHhHLLLLEEEEEL--LLLLLLlllllllhhhhh
Query LDhAGKPalaefdrddtalarWRAALRElAALPHVVCKLS--GLVTEAdwrrglrasdlr  219
ident                                                             
Sbjct AA-HCVH-------------lPERYFGV-LKDIPFFVSHNpaSNLKLG------------  260
DSSP  EE-ELLL-------------lLHHHHHH-HLLLLEEEEELhhHHHHLL------------


DSSP  hHHHHHHHHHHHHLhhHEEELLLLLHHHhlLLHH--HHHHHHHHHHHH----HLLHHHHH
Query hIEQCLDAALDAFGpqRLMFGSDWPVCLlaASYD--EVASLVERWAES----RLSAAERS  273
ident                     | |        |        |            |      
Sbjct nGIAPVQRXIEHGX--KVTLGTDGAASN--NSLNlfFEXRLASLLQKAqnprNLDVNTCL  316
DSSP  lLLLLHHHHHHLLL--EEEELLLLLLLL--LLLLhhHHHHHHHHHHHLllllLLLHHHHH


DSSP  HHLLHHHHHHLLLL----------------------------------------------
Query ALWGGTAARCYALP----------------------------------------------  287
ident        |                                                    
Sbjct KXVTYDGAQAXGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxva  376
DSSP  HHHLHHHHHHHLLLllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeel


DSSP  -------------------------------
Query -------------------------------  287
ident                                
Sbjct gkwiyfdgeyptidseevkrelariekelys  407
DSSP  leeeeellllllllhhhhhhhhhhhhhhhhl


No 32: Query=4dlfA Sbjct=3nqbA Z-score=14.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  -----------------LLLEEEEELLLlllhhhllllllllhhhllLLLHHHHHHHHHH
Query -----------------ALRIDSHQHFWryraadypwigagmgvlarDYLPDALHPLMHA   43
ident                     || | |                        | |      |
Sbjct srrdaaqvidaggayvsPGLIDTHXHIE-----------------ssXITPAAYAAAVVA  103
DSSP  lllleeeeeelllleeeELEEEEEELHH-----------------hhLLLHHHHHHHHHL


DSSP  LLLLEEEEELLL----lLHHHHHHHHHHHLLLLLEEEEEELL--------------LLLL
Query QALGASIAVQAR----aGRDETAFLLELACDEARIAAVVGWE--------------DLRA   85
ident                  | |               |                       |
Sbjct RGVTTIVWDPHEfgnvhGVDGVRWAAKAIENLPLRAILLAPScvpsapglerggadFDAA  163
DSSP  LLEEEEEELLHHhhhhhLHHHHHHHHHHHLLLLLEEEEEELLllllllllllllllLLHH


DSSP  lLHHHHHHLlllLLEEEE-EELHhhlllhHHHH--HLHHHHHHHHHHHHLLLEEEELLLh
Query pQLAERVAEwrgTKLRGF-RHQLqdeadvRAFV--DDADFARGVAWLQANDYVYDVLVFe  142
ident   ||            |               |   |      |    |           
Sbjct -ILADLLSW---PEIGGIaEIXN------XRGVieRDPRXSGIVQAGLAAEKLVCGHAR-  212
DSSP  -HHHHHHLL---LLEEEEeEELL------HHHHhlLLHHHHHHHHHHHHHLLEEEELLL-


DSSP  HHHH-HHHHHHHHLllllEEEHhhHLLLhhhllllllhhhhhHHHHHHHHLLLlEEEEEL
Query RQLP-DVQAFCARHdahwLVLDhaGKPAlaefdrddtalarwRAALRELAALPhVVCKLS  201
ident      |  || |                                 |            | 
Sbjct GLKNaDLNAFXAAG---vSSDH--ELVS--------------GEDLXAKLRAG-LTIELR  252
DSSP  LLLHhHHHHHHHLL---lLEEL--LLLL--------------HHHHHHHHHLL-LEEEEE


DSSP  LLLllllllllllhhhhhHHHHHHHHHHH--hhLHHHEEELLLllHHHH----LLLH-HH
Query GLVteadwrrglrasdlrHIEQCLDAALD--afGPQRLMFGSDwpVCLL----AASY-DE  254
ident |                 |      |||      ||      |               | 
Sbjct GSH--------------dHLLPEFVAALNtlghLPQTVTLCTD--DVFPddllQGGGlDD  296
DSSP  LLL--------------hHHHHHHHHHHHhhllLLLLEEEELL--LLLHhhhhHLLLhHH


DSSP  HHHHHHHHhhHHLLHhHHHHHLLHHHHHHLLLL---------------------------
Query VASLVERWaeSRLSAaERSALWGGTAARCYALP---------------------------  287
ident |     |                  ||                                 
Sbjct VVRRLVRY--GLKPE-WALRAATLNAAQRLGRSdlgliaagrradivvfedlngfsarhv  353
DSSP  HHHHHHHL--LLLHH-HHHHHHLHHHHHHHLLLlllllllllllleeeellllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct lasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftq  413
DSSP  eelleeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct wgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshn  473
DSSP  eeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct ltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedl  533
DSSP  eeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhh


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  287
ident                                                       
Sbjct reavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 33: Query=4dlfA Sbjct=1k6wA Z-score=14.4

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------ALRIDSHQH    9
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LL---------------------lLLHHHllllllllhhhllllLHHHHHHHHHHLLLLE
Query FW---------------------rYRAADypwigagmgvlardyLPDALHPLMHAQALGA   48
ident                                                       |     
Sbjct LDttqtagqpnwnqsgtlfegierWAERK-----allthddvkqRAWQTLKWQIANGIQH  115
DSSP  LLlllllllllllllllhhhhhhhHHLLH-----hhllhhhhhhHHHHHHHHHHHLLEEE


DSSP  EEEELlLLLH---HHHHHHHHHHLLLL--LEEEEEELL---------LLLLllhHHHHHL
Query SIAVQaRAGR---DETAFLLELACDEA--RIAAVVGWE---------DLRApqlAERVAE   94
ident                    ||     |       |                    |    
Sbjct VRTHV-DVSDatlTALKAMLEVKQEVApwIDLQIVAFPqegilsypnGEAL--lEEALRL  172
DSSP  EEEEE-ELLLlllHHHHHHHHHHHHHLllLEEEEEEELlllllllllHHHH--hHHHHHL


DSSP  LllllEEEEEELHHHLLLHHHHHHlhhhHHHHHHHHHLLLEEEE-LLLH--HHHHHHHHH
Query WrgtkLRGFRHQLQDEADVRAFVDdadfARGVAWLQANDYVYDV-LVFE--RQLPDVQAF  151
ident                |      |         |  |  |   ||        |   |   
Sbjct G----ADVVGAIPHFEFTREYGVE--slHKTFALAQKYDRLIDVhCDEIddEQSRFVETV  226
DSSP  L----LLEEEELHHHLLLHHHHHH--hhHHHHHHHHHHLLEEEEeELLLllLLLLHHHHH


DSSP  HHH--LLLL--LEEEHHHHLLLHhhllllllHHHHHHHHhHHHHLLLLEEEEEL--LLLL
Query CAR--HDAH--WLVLDHAGKPALaefdrddtALARWRAAlRELAALPHVVCKLS--GLVT  205
ident  |   |          |                |        |                 
Sbjct AALahHEGMgaRVTASHTTAMHS-------yNGAYTSRL-FRLLKMSGINFVANplVNIH  278
DSSP  HHHhhHHLLhhHEEEEELHHHHH-------lLHHHHHHH-HHHHHHHLLEEEELhhHHHH


DSSP  LLLLLLlllHHHHhhhhhHHHHHHHHHLhhHEEELLLLL---HHHHlLLHH--HHHHHHH
Query EADWRRglrASDLrhieqCLDAALDAFGpqRLMFGSDWP---VCLLaASYD--EVASLVE  260
ident                        |         || |        |        |     
Sbjct LQGRFD-tyPKRR--gitRVKEMLESGI--NVCFGHDDVfdpWYPL-GTANmlQVLHMGL  332
DSSP  HLLLLL-llLLLL--lllLHHHHHHLLL--LEEELLLLLlllLLLL-LLLLhhHHHHHHH


DSSP  H--HHHH-hLLHHhHHHHLLHHHHHHLLLL------------------------------
Query R--WAES-rLSAAeRSALWGGTAARCYALP------------------------------  287
ident                  |     ||   |                               
Sbjct HvcQLMGygQIND-GLNLITHHSARTLNLQdygiaagnsanliilpaengfdalrrqvpv  391
DSSP  HhlLLLLhhHHHH-HHHHHLHHHHHHLLLLllllllllllleeeellllhhhhhhhllll


DSSP  --------------------------------
Query --------------------------------  287
ident                                 
Sbjct rysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  leeeelleeeeellllleeeellleeeellll


No 34: Query=4dlfA Sbjct=3mtwA Z-score=14.4

back to top
DSSP  ---------------------------------------------------------LLL
Query ---------------------------------------------------------ALR    3
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE


DSSP  EEEEELLLlllhhhllllllllhHHLL-----------llLHHHHHHHHHHLLLLEEEEE
Query IDSHQHFWryraadypwigagmgVLAR-----------dyLPDALHPLMHAQALGASIAV   52
ident || | |                                     |               |
Sbjct IDMHVHLD------------slaEVGGynsleysdrfwsvVQTANAKKTLEAGFTTVRNV  108
DSSP  EEEEELLL------------lllLLLHhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEEL


DSSP  LLlllhhHHHHHHHHHLLLL------LEEEEEEL--------------------------
Query QAragrdETAFLLELACDEA------RIAAVVGW--------------------------   80
ident  |            |                                             
Sbjct GA-----ADYDDVGLREAIDagyvpgPRIVTAAIsfgatgghcdstffppsmdqknpfns  163
DSSP  LL-----LLLHHHHHHHHHHllllllLEEEELLLleellllllllllllhhhllllllll


DSSP  ---lLLLLllHHHHHHLLllllEEEEEELHHH--------lllHHHHHHLhhhHHHHHHH
Query ---eDLRApqLAERVAEWrgtkLRGFRHQLQD--------eadVRAFVDDadfARGVAWL  129
ident       |                                                 |   
Sbjct dspdEARK-aVRTLKKYG----AQVIXICATGgvfsrgnepgqQQLTYEE--mKAVVDEA  216
DSSP  llhhHHHH-hHHHHHHLL----LLEEEEELLLlllllllllllLLLLHHH--hHHHHHHH


DSSP  HHLLLEEEELLLHHH-HHHHHHHHhhlllllEEEHhHHLLlhhhllllllhhhhHHHHHH
Query QANDYVYDVLVFERQ-LPDVQAFCarhdahwLVLDhAGKPalaefdrddtalarWRAALR  188
ident                                                             
Sbjct HMAGIKVAAHAHGASgIREAVRAG------vDTIE-HASL-------------vDDEGIK  256
DSSP  HHLLLEEEEEELLHHhHHHHHHLL------lLEEE-ELLL-------------lLHHHHH


DSSP  HHHLLLlEEEEELlLLLLLlLLLL------------llHHHHHHHHHHHHHHHHHHLhhH
Query ELAALPhVVCKLSgLVTEAdWRRG------------lrASDLRHIEQCLDAALDAFGpqR  236
ident                                                    || |     
Sbjct LAVQKG-AYFSMD-IYNTDyTQAEgkkngvlednlrkdRDIGELQRENFRKALKAGV--K  312
DSSP  HHHHHL-LEEELL-LLLHHhHHHHhhhhlllhhhhhhhHHHHHHHHHHHHHHHHHLL--E


DSSP  EEELLLLLHHHhlllHHHHHHhHHHHHHH-HLLHHHHHHHLLHHHHHHLLLL--------
Query LMFGSDWPVCLlaasYDEVASlVERWAES-RLSAAERSALWGGTAARCYALP--------  287
ident    | |             |                       |||              
Sbjct MVYGTDAGIYP----HGDNAK-QFAVMVRyGATPLQAIQSATLTAAEALGRSkdvgqvav  367
DSSP  EELLLLLLLLL----LLLHHH-HHHHHHHlLLLHHHHHHHLLHHHHHHHLLLllllllll


DSSP  -------------------------------------
Query -------------------------------------  287
ident                                      
Sbjct grygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  llllleeeelllllllhhhhhllleeeelleeeelll


No 35: Query=4dlfA Sbjct=2oofA Z-score=14.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  -LLLEEEEEL-LLLLLH------------------hhlLLLL-----lllhhhllllLHH
Query -ALRIDSHQH-FWRYRA------------------adyPWIG-----agmgvlardyLPD   35
ident     || | |                              |                |  
Sbjct tPGLIDCHTHlIFAGSRaeefelrqkgvpyaeiarkggGIIStvratraasedqlfeLAL  120
DSSP  eELEEEEEELlLLLLLLhhhhhhhhhlllhhhhhhlllLHHHhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHLLLLEEEEELLLLL--HHHHHHHHHHHLLLL---LEEEEEELLL--------
Query ALHPLMHAQALGASIAVQARAG--RDETAFLLELACDEA---RIAAVVGWED--------   82
ident                          ||   |                             
Sbjct PRVKSLIREGVTTVEIKSGYGLtlEDELKXLRVARRLGEalpIRVKTTLLAAhavppeyr  180
DSSP  HHHHHHHHHLEEEEEEELLLLLlhHHHHHHHHHHHHHHHhllLEEEEEEEEEllllhhhl


DSSP  ----lLLLLH-HHHHHL-LLLLlEEEEEELHHHLllhhhHHHLhhhHHHHHHHHHLLLEE
Query ----lRAPQL-AERVAE-WRGTkLRGFRHQLQDEadvraFVDDadfARGVAWLQANDYVY  136
ident             |                                               
Sbjct ddpdsWVETIcQEIIPAaAEAGlADAVDVFCEHI---gfSLAQ--tEQVYLAADQYGLAV  235
DSSP  llhhhHHHHHhHLHHHHhHHLLlLLEEEEEELLL---llLHHH--hHHHHHHHHHLLLEE


DSSP  EELL-LHHHhHHHHHHHHHLLllLEEEHhHHLLlhhhllllllhhhhhhhHHHHHHLL--
Query DVLV-FERQlPDVQAFCARHDahWLVLDhAGKPalaefdrddtalarwraALRELAAL--  193
ident                  |      |  |                         |      
Sbjct KGHXdQLSN-LGGSTLAANFG--ALSVD-HLEY-----------------LDPEGIQAla  274
DSSP  EEEElLLLL-LLHHHHHHHLL--LLEEE-ELLL-----------------LLHHHHHHhh


DSSP  -LLEEEEEL--LLLLLLlllllllhhhhhhHHHHHhhHHHHHL--hhHEEELLLLL--HH
Query -PHVVCKLS--GLVTEAdwrrglrasdlrhIEQCLdaALDAFG--pqRLMFGSDWP--VC  246
ident    ||  |                                |           ||      
Sbjct hRGVVATLLptAFYFLK-------------ETKLP--PVVALRkagvPXAVSSDINpgTA  319
DSSP  hHLLEEEELhhHHHHLL-------------LLLLL--LHHHHHhlllLEEELLLLLllLL


DSSP  HHlllHHHHHHHHHHHHhhHLLHHHHHHHLLHHHHHHLLL--------------------
Query LLaasYDEVASLVERWAesRLSAAERSALWGGTAARCYAL--------------------  286
ident                     |   |  |     |||                        
Sbjct PI-vsLRXAXNXACTLF--GLTPVEAXAGVTRHAARALGEqeqlgqlrvgxladflvwnc  376
DSSP  LL-llHHHHHHHHHHHH--LLLHHHHHHHLLHHHHHHLLLlllllllllllllleeeell


DSSP  --------------------------l
Query --------------------------p  287
ident                            
Sbjct ghpaelsyligvdqlvsrvvngeetlh  403
DSSP  llllhhhhlllllleeeeeelleelll


No 36: Query=4dlfA Sbjct=3mkvA Z-score=14.3

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------ALRI    4
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE


DSSP  EEEELLL---lllHHHLLllllllhhhLLLL--LHHHHHHHHHhLLLLEEEEELLlllhh
Query DSHQHFW---ryrAADYPwigagmgvlARDY--LPDALHPLMHaQALGASIAVQAragrd   59
ident | | |                                                       
Sbjct DLHVHVVaiefnlPRVAT------lpnVLVTlrAVPIMRAMLR-RGFTTVRDAGG-----  108
DSSP  EEEELLLlllllhHHHLL------llhHHHHhhHHHHHHHHHH-LLEEEEEELLL-----


DSSP  hhhhHHHHHLLLL------LEEEEE-ELLL------------------------------
Query etafLLELACDEA------RIAAVV-GWED------------------------------   82
ident                        |                                    
Sbjct ---aGYPFKQAVEsglvegPRLFVSgRALSqtgghadprarsdymppdspcgccvrvgal  165
DSSP  ---lLHHHHHHHHllllllLEEEELlLEEEllllllllllllllllllllllllllllll


DSSP  ----lLLLLHHHHHHL-LLLLlEEEEEELHHH---------LLLHhhHHHLhHHHHHHHH
Query ----lRAPQLAERVAE-WRGTkLRGFRHQLQD---------EADVraFVDDaDFARGVAW  128
ident              | |                                  |      || 
Sbjct grvadGVDEVRRAVREeLQMG-ADQIXIMASGgvasptdpvGVFG--YSED-EIRAIVAE  221
DSSP  eeellLHHHHHHHHHHhHHHL-LLLEEEELLLlllllllllLLLL--LLHH-HHHHHHHH


DSSP  HHHLLLEEEELLLhhHHHHHHHHHHHLllllEEEHhHHLLlhhhllllllhhhhHHHHHH
Query LQANDYVYDVLVFerQLPDVQAFCARHdahwLVLDhAGKPalaefdrddtalarWRAALR  188
ident  |                                   |                     |
Sbjct AQGRGTYVLAHAY--TPAAIARAVRCG---vRTIE-HGNL-------------iDDETAR  262
DSSP  HHLLLLLEEEEEL--LHHHHHHHHHLL---lLEEE-ELLL-------------lLHHHHH


DSSP  HHHLLLlEEEEELlLLLLL-LLLLL-----------llhhhhHHHHHHHHHHHHHHLhhH
Query ELAALPhVVCKLSgLVTEA-DWRRG-----------lrasdlRHIEQCLDAALDAFGpqR  236
ident   |           |||       |                             |     
Sbjct LVAEHG-AYVVPT-LVTYDaLASEGekyglppesiakiadvhGAGLHSIEIMKRAGV--K  318
DSSP  HHHHHL-LEEELL-HHHHHhHHHHLllllllhhhhllhhhhhLLHHHHHHHHHHHLL--L


DSSP  EEELLLLlhHHHL-lLHHHHHHHHHHHHHhhllHHHHHHHLLHHHHHHLLLL--------
Query LMFGSDWpvCLLA-aSYDEVASLVERWAEsrlsAAERSALWGGTAARCYALP--------  287
ident   || |      |                     ||  |      |              
Sbjct MGFGTDL--LGEAqrLQSDEFRILAEVLS----PAEVIASATIVSAEVLGMQdklgrivp  372
DSSP  LLLLLLL--LHHHhhHLLHHHHHHHLLLL----HHHHHHHLLHHHHHHLLLLllllllll


DSSP  ------------------------------------------
Query ------------------------------------------  287
ident                                           
Sbjct gahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllleeeellllllllllllllllllleeeelleeeeelll


No 37: Query=4dlfA Sbjct=4cqbA Z-score=14.2

back to top
DSSP  ----------------------------------------------------LLLEEEEE
Query ----------------------------------------------------ALRIDSHQ    8
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE


DSSP  LLLL---------------llhhhLLLLL-----lllhhhllllLHHHHHHHHHHLLLLE
Query HFWR---------------yraadYPWIG-----agmgvlardyLPDALHPLMHAQALGA   48
ident |                                                           
Sbjct HMDKsftstgerlpkfwsrpytrdAAIEDglkyyknatheeikrHVIEHAHMQVLHGTLY  120
DSSP  LHHHllllllllllllllllllhhHHHHHhhhhhhhllhhhhhhHHHHHHHHHHHLLEEE


DSSP  EEEELLLL---LHHHHHHHHHHHLLLL--LEEEEEEL--------lLLLLllhhhhHHLL
Query SIAVQARA---GRDETAFLLELACDEA--RIAAVVGW--------eDLRApqlaerVAEW   95
ident                    ||            ||                         
Sbjct TRTHVDVDsvaKTKAVEAVLEAKEELKdlIDIQVVAFaqsgffvdlESES-lirksLDMG  179
DSSP  EEEEEELLlllLLHHHHHHHHHHHHLLllLEEEEEEElllllllllLHHH-hhhhhHHHL


DSSP  llllEEEEEELHH--HLLLHHHHHHLhhHHHHHHHHHhllLEEEELL------LHHHHHH
Query rgtkLRGFRHQLQ--DEADVRAFVDDadFARGVAWLQandYVYDVLV------FERQLPD  147
ident                 |  |    |                  |                
Sbjct ----CDLVGGVDPatRENNVEGSLDL--CFKLAKEYD---VDIDYHIhdigtvGVYSINR  230
DSSP  ----LLEEELLLLllLLLLHHHHHHH--HHHHHHHLL---LEEEEEElllhhhHHHHHHH


DSSP  HHHHHHHLLL-lLEEEHHhHLLLHHhllllllHHHHHHHHHHHHHLLlLEEEEEL-LLLL
Query VQAFCARHDA-hWLVLDHaGKPALAefdrddtALARWRAALRELAALpHVVCKLS-GLVT  205
ident                  |                     |                    
Sbjct LAQKTIENGYkgRVTTSH-AWCFAD------aPSEWLDEAIPLYKDS-GMKFVTCfSSTP  282
DSSP  HHHHHHHLLLllLEEEEE-LLHHHH------lLHHHHHHHHHHHHHH-LLEEEEElLLLL


DSSP  lllllllllhhhhhhHHHHHHHHHHHHLhhHEEELLLLL-hhHHLLLH---hHHHHHHHH
Query eadwrrglrasdlrhIEQCLDAALDAFGpqRLMFGSDWP-vcLLAASY---dEVASLVER  261
ident                        | |     |   ||                 |     
Sbjct ---------------PTMPVIKLLEAGI--NLGCASDNIrdfWVPFGNgdmvQGALIETQ  325
DSSP  ---------------LLLLHHHHHHLLL--EEEEELLLLlllLLLLLLllhhHHHHHHHH


DSSP  H----hHHHLLhhHHHHHLLHHHHHHLLLL------------------------------
Query W----aESRLSaaERSALWGGTAARCYALP------------------------------  287
ident          |             ||                                   
Sbjct RlelktNRDLG--LIWKMITSEGARVLGIEknygievgkkadlvvlnslspqwaiidqak  383
DSSP  HhllllHHHHH--HHHHHHLHHHHHHHLLHhhlllllllllleeeellllhhhhhhhlll


DSSP  -------------------
Query -------------------  287
ident                    
Sbjct rlcvikngriivkdeviva  402
DSSP  eeeeeelleeeeelleell


No 38: Query=4dlfA Sbjct=3griA Z-score=14.2

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------ALRIDSHQH    9
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL


DSSP  -LLLLlhhhllllllllhhHLLLLLHHHHHHHHHHLLLLEEEEELL---LLLH-HHHHHH
Query -FWRYraadypwigagmgvLARDYLPDALHPLMHAQALGASIAVQA---RAGR-DETAFL   64
ident                                                            |
Sbjct lREPG--------------GEYKETIETGTKAAARGGFTTVCPXPNtrpVPDSvEHFEAL  106
DSSP  lLLLL--------------LLLLLLHHHHHHHHHHLLEEEEEELLLlllLLLLhHHHHHH


DSSP  HHHHLL-LLLEEEEEELLL----LLLLlhhhHHHL-LLLLlEEEEEELHHHlllhhhHHH
Query LELACD-EARIAAVVGWED----LRAPqlaeRVAE-WRGTkLRGFRHQLQDeadvraFVD  118
ident   |  |                                      |               
Sbjct QKLIDDnAQVRVLPYASITtrqlGKEL---vDFPAlVKEG-AFAFTDDGVG-----vQTA  157
DSSP  HHHHHHhLLLEELLLEELLhhhlLLLL---lLHHHhHLLL-LLLEEELLLL-----lLLH


DSSP  LhHHHHHHHHHHHLLLEEEELLL--------------------------HHHHHHHHHHH
Query DaDFARGVAWLQANDYVYDVLVF--------------------------ERQLPDVQAFC  152
ident       |                                                     
Sbjct S-XXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnICESVQIARDV  216
DSSP  H-HHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellHHHHHHHHHHH


DSSP  HHLL--LLLEEEHHHHlllhhhllllllhhhhHHHHHHHHHLLL----LEEEEELLL---
Query ARHD--AHWLVLDHAGkpalaefdrddtalarWRAALRELAALP----HVVCKLSGL---  203
ident              |                       |          ||          
Sbjct LLAEaaGCHYHVCHVS----------------TKESVRVIRDAKragiHVTAEVTPHhll  260
DSSP  HHHHhhLLLEEELLLL----------------LHHHHHHHHHHHhlllLEEEEELHHhhh


DSSP  ---llllllLLLLlhhhhhhhhHHHHHHHHHHLHH-HEEELLLLLH------------hh
Query ---vteadwRRGLrasdlrhieQCLDAALDAFGPQ-RLMFGSDWPV------------cl  247
ident                           | |             |                 
Sbjct lteddipgnNAIYkxnpplrstEDREALLEGLLDGtIDCIATDHAPhardekaqpxekap  320
DSSP  llhhhllllLHHHllllllllhHHHHHHHHHHHLLlLLEELLLLLLllhhhhllllllll


DSSP  HLLLH-HHHHHHHHHHHH--HHLLHHHHHHHLLHHHHHHLLLL-----------------
Query LAASY-DEVASLVERWAE--SRLSAAERSALWGGTAARCYALP-----------------  287
ident            |                             |                  
Sbjct FGIVGsETAFPLLYTHFVknGDWTLQQLVDYLTIKPCETFNLEygtlkengyadltiidl  380
DSSP  LLLLLlLLHHHHHHHHHLllLLLLHHHHHHHHLHHHHHHLLLLllllllllllleeeeel


DSSP  ------------------------------------------
Query ------------------------------------------  287
ident                                           
Sbjct dseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  llleellhhhllllllllllllleelleeeeeeelleeeeel


No 39: Query=4dlfA Sbjct=3e74A Z-score=14.1

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------ALRIDSHQH    9
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL


DSSP  LllllhhhllllllllhhhllllLHHHHHHHHHHLLLLEEEEELLLllhHHHH--HHHHH
Query FwryraadypwigagmgvlardyLPDALHPLMHAQALGASIAVQARagrDETA--FLLEL   67
ident                                         |                   
Sbjct I----------------------GYETGTRAAAKGGITTXIEXPLNqlpATVDraSIELK   98
DSSP  L----------------------LHHHHHHHHHHLLEEEEEELLLLlllLLLLhhHHHHH


DSSP  H-----lllLLEEeEEELLLllLLLHHhHHHL-LLLLlEEEEEELHhhlllhhhhhHLHH
Query A-----cdeARIAaVVGWEDlrAPQLAeRVAE-WRGTkLRGFRHQLqdeadvrafvDDAD  121
ident             |   |           |  |        ||               |  
Sbjct FdaakgkltIDAA-QLGGLV--SYNID-RLHElDEVG-VVGFXCFV-------rdvNDWQ  146
DSSP  HhhhlllllLEEE-ELEELL--LLLLL-LHHHhHHHL-LLLEEEEL-------lllLHHH


DSSP  HHHHHHHHHHLLLEEEELLL----------------------------HHHHHHH-HHHH
Query FARGVAWLQANDYVYDVLVF----------------------------ERQLPDV-QAFC  152
ident |  |   |        |                                           
Sbjct FFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpVFTEVEAiRRVL  206
DSSP  HHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllHHHHHHHhHHHH


DSSP  HHLL--LLLEEEHHHHlllhhhllllllhhhhHHHHHHHHHLLL----LEEEEEL-LLLL
Query ARHD--AHWLVLDHAGkpalaefdrddtalarWRAALRELAALP----HVVCKLS-GLVT  205
ident          |   |                        |            |        
Sbjct YLAKvaGCRLHVCHVS----------------SPEGVEEVTRARqegqDITCESCpHYFV  250
DSSP  HHHHhhLLLEEELLLL----------------LHHHHHHHHHHHhlllLEEEEELlHHHH


DSSP  LLL--LLLLLLH-------hHHHHHHHHHHHHHHHHlhhHEEELLLLL------------
Query EAD--WRRGLRA-------sDLRHIEQCLDAALDAFgpqRLMFGSDWP------------  244
ident                     ||                      ||              
Sbjct LDTdqFEEIGTLakcsppirDLENQKGXWEKLFNGE---IDCLVSDHSpcppexkagnix  307
DSSP  LLHhhHHHHLHHhlllllllLHHHHHHHHHHHHLLL---LLEELLLLLllllllllllll


DSSP  ----HHHHlllHHHHHHHHHHHHH--HHLLHHHHHHHLLHHHHHHLLLL-----------
Query ----VCLLaasYDEVASLVERWAE--SRLSAAERSALWGGTAARCYALP-----------  287
ident                       |      |      |    ||    |            
Sbjct kawgGIAG---LQSCXDVXFDEAVqkRGXSLPXFGKLXATNAADIFGLQqkgriapgkda  364
DSSP  llllLLLL---HHHHHHHHHHHHLllLLLLHHHHHHHHLHHHHHHLLLLlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct dfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll


DSSP  -----
Query -----  287
ident      
Sbjct filkh  429
DSSP  eelll


No 40: Query=4dlfA Sbjct=1j5sA Z-score=14.0

back to top
DSSP  ------------------------LLLEEEEELLL----lllhhhlllllllLHHHL---
Query ------------------------ALRIDSHQHFW----ryraadypwigagMGVLA---   29
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdLPIVDPHNHLDakdivenkpwndiweveGATDHyvw   60
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLLhhhhhhllllllhhhhhLLLLHhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   29
ident                                                             
Sbjct elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh


DSSP  ---------llllhhHHHHHHHHLLLLEEEEELlllLHHHhhhhHHHHLLLL-----LEE
Query ---------rdylpdALHPLMHAQALGASIAVQaraGRDEtaflLELACDEA-----RIA   75
ident                    |                        ||              
Sbjct aeeiweetkkklpemTPQKLLRDMKVEILCTTD---DPVS---tLEHHRKAKeavegVTI  174
DSSP  hhhhhhhhhhhllllLHHHHHHHLLEEEEELLL---LLLL---lLHHHHHHHhhlllLEE


DSSP  EEEELLL-----------------------------llLLLHHHHHHLLLLLLEEEEEEL
Query AVVGWED-----------------------------lrAPQLAERVAEWRGTKLRGFRHQ  106
ident       |                                  |                | 
Sbjct LPTWRPDramnvdkegwreyvekmgerygedtstldgfLNALWKSHEHFKEHGCVASDHA  234
DSSP  ELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHLLLLLEEEEE


DSSP  HHhlllHHHH---------------------------hHLHHHHHHHHHHHHLLLEEEEL
Query LQdeadVRAF---------------------------vDDADFARGVAWLQANDYVYDVL  139
ident |                                                 |    |    
Sbjct LL---ePSVYyvdenraravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLH  291
DSSP  EL---lLLLLlllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEE


DSSP  LL------------------------hHHHH-HHHHHHHHLL-LLLEEEHhhHLLLhhhl
Query VF------------------------eRQLP-DVQAFCARHD-AHWLVLDhaGKPAlaef  173
ident                                     |    |     ||           
Sbjct IGalrdyrdslfktlgpdsggdistnfLRIAeGLRYFLNEFDgKLKIVLY--VLDP----  345
DSSP  ELeellllhhhhhhlllllllleelllLLHHhHHHHHHHHLLlLLLEEEE--ELLH----


DSSP  lllllhhhHHHHHHHHHHL-LLLEEEEELlLLLLllllllllhhHHHHHHHHHHHHHHHH
Query drddtalaRWRAALRELAA-LPHVVCKLSgLVTEadwrrglrasDLRHIEQCLDAALDAF  232
ident                  |   | |                         |  |       
Sbjct --------THLPTISTIARaFPNVYVGAP-WWFN---------dSPFGMEMHLKYLASVD  387
DSSP  --------HHHHHHHHHHHhLLLEEELLL-LLLL---------lLHHHHHHHHHHHHLLL


DSSP  LHHHE-EELLLLLHhhhllLHHHHHHHHHHHHHHHL-------------LHHHHHHHLLH
Query GPQRL-MFGSDWPVcllaaSYDEVASLVERWAESRL-------------SAAERSALWGG  278
ident     |     |        |         |                              
Sbjct LLYNLaGMVTDSRK---llSFGSRTEMFRRVLSNVVgemvekgqipikeARELVKHVSYD  444
DSSP  LHHHLlLLLLLLLL---llHHHHHHHHHHHHHHHHHhhhhhlllllhhhHHHHHHHHHLH


DSSP  HHHHHLLll
Query TAARCYAlp  287
ident          
Sbjct GPKALFF--  451
DSSP  HHHHHHL--


No 41: Query=4dlfA Sbjct=3iacA Z-score=14.0

back to top
DSSP  -------------------------LLLEEEEELLL---lllhhhlllllllLHHH----
Query -------------------------ALRIDSHQHFW---ryraadypwigagMGVL----   28
ident                              | | |                          
Sbjct atfxtedfllkndiartlyhkyaapXPIYDFHCHLSpqeiaddrrfdnlgqiWLEGdhyk   60
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLLLhhhhhhllllllhhhhHHLLllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   28
ident                                                             
Sbjct wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll


DSSP  -------------lllllhhHHHHHHHHLLLLEEEEELlllLHHHhhhhHHHHLLL----
Query -------------ardylpdALHPLMHAQALGASIAVQaraGRDEtaflLELACDE----   71
ident                                                  ||         
Sbjct pdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD---DPID---sLEYHRQIaadd  174
DSSP  hhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL---LLLL---lLHHHHHHhhll


DSSP  --LLEEEEEELLL-----------------------------llLLLHHHHHHLLLLLLE
Query --ARIAAVVGWED-----------------------------lrAPQLAERVAEWRGTKL  100
ident       |     |                                  |  |         
Sbjct siDIEVAPSWRPDkvfkieldgfvdylrkleaaadvsitrfddlRQALTRRLDHFAACGC  234
DSSP  llLLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHLLL


DSSP  EEEEELHHhllLHHH----------------------------hhHLHHHHHHHHHHHHL
Query RGFRHQLQdeaDVRA----------------------------fvDDADFARGVAWLQAN  132
ident |   |        |                                 |          | 
Sbjct RASDHGIE---TLRFapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAAR  291
DSSP  LEEEEEEL---LLLLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHH


DSSP  LLEEEELLL------------------------hHHHHHHHHHHHHLL----LLLEEEHh
Query DYVYDVLVF------------------------eRQLPDVQAFCARHD----AHWLVLDh  164
ident   |                                            |         |  
Sbjct GWVXQLHIGairnnntrxfrllgpdtgfdsigdnNISWALSRLLDSXDvtneLPKTILY-  350
DSSP  LLEEEEEELeellllhhhhhhhllllllleelllLLHHHHHHHHHHHHllllLLEEEEE-


DSSP  hHLLLhhhllllllhhhHHHHHH-HHHHLLL------LEEEEEllLLLLllllllllhhH
Query aGKPAlaefdrddtalaRWRAAL-RELAALP------HVVCKLsgLVTEadwrrglrasD  217
ident                  |    |               |                     
Sbjct -CLNP------------RDNEVLaTXIGNFQgpgiagKVQFGS-gWWFN---------dQ  387
DSSP  -ELLH------------HHHHHHhHHHHHLLllllllLEEELL-lLHHH---------lL


DSSP  HHHHHHHHHHHHHHHL-HHHEEELLLLLHhhhllLHHHHHHHHHHHHHHHL---------
Query LRHIEQCLDAALDAFG-PQRLMFGSDWPVcllaaSYDEVASLVERWAESRL---------  267
ident        |          |      |                  |     |         
Sbjct KDGXLRQLEQLSQXGLlSQFVGXLTDSRS----fLSYTRHEYFRRILCNLLgqwaqdgei  443
DSSP  HHHHHHHHHHHHHHLLhHHLLLLLLLLLL----lLLLHHHHHHHHHHHHHHhhhhhllll


DSSP  ------LHHHHHHHLLHHHHHHLLll
Query ------SAAERSALWGGTAARCYAlp  287
ident                   | |     
Sbjct pddeaxLSRXVQDICFNNAQRYFTik  469
DSSP  lllhhhHHHHHHHHHLHHHHHHLLll


No 42: Query=4dlfA Sbjct=3ls9A Z-score=13.9

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------ALRI    4
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE


DSSP  EEEELLL--------------------lLLHHHLL-llllllhhhllllLHHHHHHHHHH
Query DSHQHFW--------------------rYRAADYP-wigagmgvlardyLPDALHPLMHA   43
ident  ||||                                               |       
Sbjct NSHQHLYegamraipqlervtmaswlegVLTRSAGwwrdgkfgpdvireVARAVLLESLL  120
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhHHHHHHHhhhlllllhhhhhhHHHHHHHHHHH


DSSP  LLLLEEEEELLLLL-hhhhHHHHHHHLLL---LLEEEEEEL---------------llll
Query QALGASIAVQARAG-rdetAFLLELACDE---ARIAAVVGW---------------edlr   84
ident                                                             
Sbjct GGITTVADQHLFFPgatadSYIDATIEAAtdlGIRFHAARSsmtlgkseggfcddlfvep  180
DSSP  LLEEEEEEEELLLLlllllLHHHHHHHHHhhhLLEEEEEELlllllhhhlllllhhhlll


DSSP  LLLHHHHHHL-LLLL--------LEEEEEELHHHLllhhhhhhLHHH-HHHHHHHHHLLL
Query APQLAERVAE-WRGT--------KLRGFRHQLQDEadvrafvdDADF-ARGVAWLQANDY  134
ident                                                           | 
Sbjct VDRVVQHCLGlIDQYhepepfgmVRIALGPCGVPY-------dKPELfEAFAQMAADYDV  233
DSSP  HHHHHHHHHHhHHHHllllllllEEEEELLLLLLL-------lLHHHhHHHHHHHHHHLL


DSSP  EEEELL-LHHHH--------hHHHHHHH--HLLLLLEEEHhHHLLlhhhllllllhhhhH
Query VYDVLV-FERQL--------pDVQAFCA--RHDAHWLVLDhAGKPalaefdrddtalarW  183
ident                          |            |                     
Sbjct RLHTHFyEPLDAgmsdhlygmTPWRFLEkhGWASDRVWLA-HAVV-------------pP  279
DSSP  EEEEEElLLLHHhhhhhhhllLHHHHHHhlLLLLLLEEEE-ELLL-------------lL


DSSP  HHHHHHHHLLLlEEEEEL--LLLLLLlllllllhhhhhhHHHHHHHHHHHHLhhHEEELL
Query RAALRELAALPhVVCKLS--GLVTEAdwrrglrasdlrhIEQCLDAALDAFGpqRLMFGS  241
ident |    | |    |                                  |||       || 
Sbjct REEIPEFADAG-VAIAHLiaPDLRMG------------wGLAPIREYLDAGI--TVGFGT  324
DSSP  HHHHHHHHHHL-LEEEELhhHHHHLL------------lLLLLHHHHHHLLL--EEEELL


DSSP  LLLHHHhlLLHH--HHHHHHHHHHH--------HHLLHHHHHHHLLHHHHHHLLLL----
Query DWPVCLlaASYD--EVASLVERWAE--------SRLSAAERSALWGGTAARCYALP----  287
ident                   |                ||| |         | |   |    
Sbjct TGSASN--DGGNllGDLRLAALAHRpadpnepeKWLSARELLRMATRGSAECLGRPdlgv  382
DSSP  LLLLLL--LLLLhhHHHHHHHHHLHhhllllhhHLLLHHHHHHHLLHHHHHHLLLLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct leegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladle  442
DSSP  lllllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhh


DSSP  -----------
Query -----------  287
ident            
Sbjct rivanttalip  453
DSSP  hhhhhhhhhll


No 43: Query=4dlfA Sbjct=1a4mA Z-score=13.7

back to top
DSSP  -----LLLEEEEELLL-----lLLHH-------------------------------hlL
Query -----ALRIDSHQHFW-----rYRAA-------------------------------dyP   19
ident            | |                                              
Sbjct tpafnKPKVELHVHLDgaikpeTILYfgkkrgialpadtveelrniigmdkplslpgflA   60
DSSP  lllllLLEEEEEEEHHhlllhhHHHHhhhhhllllllllhhhhhhhhlllllllhhhhhL


DSSP  LLLL---------llhhhlllLLHHHHHHHHhhllLLEEEEElLLLL-------------
Query WIGA---------gmgvlardYLPDALHPLMhaqaLGASIAVqARAG-------------   57
ident                                                             
Sbjct KFDYympviagcreaikriayEFVEMKAKEG----VVYVEVR-YSPHllanskvdpmpwn  115
DSSP  LHHHhhhhhlllhhhhhhhhhHHHHHHHHLL----EEEEEEE-ELLHhhllllllllhhh


DSSP  --------HHHHHHHHHHHLLLL----LEEEEEEL------lLLLLllhhHHHHLLLLLL
Query --------RDETAFLLELACDEA----RIAAVVGW------eDLRApqlaERVAEWRGTK   99
ident          |                                        |         
Sbjct qtegdvtpDDVVDLVNQGLQEGEqafgIKVRSILCcmrhqpsWSLE--vlELCKKYNQKT  173
DSSP  lllllllhHHHHHHHHHHHHHHHhhhlLEEEEEEEeelllhhHHHH--hhHHHHHLLLLL


DSSP  EEEEEELhHHLLLHHhHHHLHHHHHHHHHHHHLLLEEEELL-LHHHHHHHHHHHHHLLll
Query LRGFRHQlQDEADVRaFVDDADFARGVAWLQANDYVYDVLV-FERQLPDVQAFCARHDah  158
ident          ||                     |     |          |          
Sbjct VVAMDLA-GDETIEG-SSLFPGHVEAYEGAVKNGIHRTVHAgEVGSPEVVREAVDILK--  229
DSSP  EEEEEEE-LLLLLLL-HHHLHHHHHHHHHHHHHLLEEEEEElLLLLHHHHHHHHHLLL--


DSSP  lEEEHhHHLLlhhhllllllhhhhHHHH---HHHHHLLLlEEEEEL--LLLLLLllllll
Query wLVLDhAGKPalaefdrddtalarWRAA---LRELAALPhVVCKLS--GLVTEAdwrrgl  213
ident        |                          |                         
Sbjct tERVG-HGYH--------------TIEDealYNRLLKEN-MHFEVCpwSSYLTG------  267
DSSP  lLEEE-ELHH--------------HHHLhhhHHHHHHLL-LEEEELhhHHHHLL------


DSSP  lhhHHHHhHHHHHHHHHHHLhhHEEELLLllHHHHLLLH-HHHHHHHHHHHhhHLLHHHH
Query rasDLRHiEQCLDAALDAFGpqRLMFGSDwpVCLLAASY-DEVASLVERWAesRLSAAER  272
ident    |                        |    |   |  |                 | 
Sbjct -awDPKT-THAVVRFKNDKA--NYSLNTD--DPLIFKSTlDTDYQMTKKDM--GFTEEEF  319
DSSP  -llLLLL-LLHHHHHHHLLL--LEEELLL--LLLLLLLLhHHHHHHHHHLL--LLLHHHH


DSSP  HHHLlHHHHHHLLLL----------------
Query SALWgGTAARCYALP----------------  287
ident   |    ||    ||                
Sbjct KRLN-INAAKSSFLPeeekkellerlyreyq  349
DSSP  HHHH-HHHHHLLLLLhhhhhhhhhhhhhhll


No 44: Query=4dlfA Sbjct=4c5yA Z-score=13.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLLEEEEELL-LLLL-HHHLLLLllllhhhlllLLHHHHHHHHHHlLLLEEEEELLlllh
Query ALRIDSHQHF-WRYR-AADYPWIgagmgvlardYLPDALHPLMHAqALGASIAVQAragr   58
ident     | | ||        ||              |                         
Sbjct PGLWDCHMHFgGDDDyYNDYTSGlathpassgaRLARGCWEALQN-GYTSYRDLAG----  115
DSSP  ELEEEEEELLlLLLLlLLLLHHHhhllhhhhhhHHHHHHHHHHHL-LEEEEEELLL----


DSSP  hhhhHHHHHHLLL------LLEEEEEEL--------------------------------
Query detaFLLELACDE------ARIAAVVGW--------------------------------   80
ident        | |                |                                 
Sbjct ----YGCEVAKAIndgtivGPNVYSSGAalsqtaghgdifalpagevlgsygvmnprpgy  171
DSSP  ----LHHHHHHHHhlllllLLEEEELLLeeellllllllllllhhhhhhhhlllllllll


DSSP  ------LLLL-LLLHHH-hHHLLLLLlEEEEEELHHH--------lLLHHhHHHLhhHHH
Query ------EDLR-APQLAE-rVAEWRGTkLRGFRHQLQD--------eADVRaFVDDadFAR  124
ident                        |                           |        
Sbjct wgagplCIADgVEEVRRavRLQIRRG-AKVIXVMASGgvmsrddnpNFAQ-FSPE-eLKV  228
DSSP  llllleEELLlHHHHHHhhHHHHHHL-LLLEEEELLLlllllllllLLLL-LLHH-hHHH


DSSP  HHHHHHHLLLEEEELLLHHH-HHHHHHHHhhlllllEEEHhHHLLlhhhllllllhhhhH
Query GVAWLQANDYVYDVLVFERQ-LPDVQAFCarhdahwLVLDhAGKPalaefdrddtalarW  183
ident  |             |                      |                     
Sbjct IVEEAARQNRIVSAHVHGKAgIMAAIKAG------cKSLE-HVSY-------------aD  268
DSSP  HHHHHHHLLLLEEEEELLHHhHHHHHHHL------lLEEE-ELLL-------------lL


DSSP  HHHHHHHHLLlLEEEEELlLLLLL--LLLLL---------llhhhHHHHHHHHHHHHHHH
Query RAALRELAALpHVVCKLSgLVTEA--DWRRG---------lrasdLRHIEQCLDAALDAF  232
ident                               |                        |  | 
Sbjct EEVWELMKEK-GILYVAT-RSVIEifLASNGeglvkeswaklqalADSHLKAYQGAIKAG  326
DSSP  HHHHHHHHHH-LLEEELL-HHHHHhhHHHLLllllllhhhlllhhHHHHHHHHHHHHHLL


DSSP  LhhHEEELLLLLhhhhllLHHHHHHHHHHHhhhHLLHHHHHHHLLHHHHH--HLLLL---
Query GpqRLMFGSDWPvcllaaSYDEVASLVERWaesRLSAAERSALWGGTAAR--CYALP---  287
ident        | |                            |        |        |   
Sbjct V--TIALGTDTA---pggPTALELQFAVER--gGMTPLEAIKAATANAPLsvGPQAPltg  379
DSSP  L--LEELLLLLL---lllLLHHHHHHHHHL--lLLLHHHHHHHHLLLHHHhhHHHLLlll


DSSP  ---------------------------------------------------------
Query ---------------------------------------------------------  287
ident                                                          
Sbjct qlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  llllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 45: Query=4dlfA Sbjct=1a5kC Z-score=13.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ------LLLEEEEELLllllhhhllllllllhhhlllLLHHhHHHHHHHLLLLEEEEE--
Query ------ALRIDSHQHFwryraadypwigagmgvlardYLPDaLHPLMHAQALGASIAV--   52
ident       |  || | |                        |                    
Sbjct egkivtAGGIDTHIHW---------------------ICPQ-QAEEALVSGVTTMVGGgt  158
DSSP  llleeeELEEEEEEEL---------------------LLLL-HHHHHHHHLEEEEEEEll


DSSP  ---------LLLLLHHHHHHHHHHHLLLLLEEEEEELLLLLLLLHHhHHHLLLlllEEEE
Query ---------QARAGRDETAFLLELACDEARIAAVVGWEDLRAPQLAeRVAEWRgtkLRGF  103
ident              |       |  |          |      |               | 
Sbjct gpaagthatTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALrEQVAAG---VIGL  215
DSSP  lllhhhhhlLLLLHHHHHHHHHHHHLLLLLEEEEEEELLLLLHHHHhHHHHHL---LLEE


DSSP  EELHHHLllhhhHHHLhhhHHHHHHHHHLLLEEEELLLHH----HHHHHHHHHHHLlllL
Query RHQLQDEadvraFVDDadfARGVAWLQANDYVYDVLVFER----QLPDVQAFCARHdahW  159
ident                              |                 |  |         
Sbjct EIHEDWG----aTPAA--iDCALTVADEMDIQVALHSDTLnesgFVEDTLAAIGGR---T  266
DSSP  EEEHHHL----lLHHH--hHHHHHHHHHHLLEEEEELLLLllllLHHHHHHHHLLL---L


DSSP  EEEHHHHLLlhhhllllllhhhhHHHHHHhHHLLLLEEEEELLLL------lllLLLL--
Query LVLDHAGKPalaefdrddtalarWRAALReLAALPHVVCKLSGLV------teaDWRR--  211
ident     |                           | |                         
Sbjct IHTFHTEGA----------ggghAPDIIT-ACAHPNILPSSTNPTlpytlntidEHLDml  315
DSSP  EEELLLLLL----------llllLLLHHH-HHHLLLEEEEEEHHHllllllhhhHHHHhh


DSSP  ---------------lllhhhhHHHHHHHHHHH-HHHLhhhEEELLLLLHHhhllLHHHH
Query ---------------glrasdlRHIEQCLDAAL-DAFGpqrLMFGSDWPVCllaaSYDEV  255
ident                       |      |               ||           ||
Sbjct mvchhldpdiaedvafaesrirRETIAAEDVLHdLGAF---SLTSSDSQAM---gRVGEV  369
DSSP  hhhhllllllhhhhhlllllllHHHHHHHHHHHhLLLL---LEEELLLLLL---lLLLLH


DSSP  HHHHHHHHHHH----------------lLHHHHHHHLLHHHHHHLLLL------------
Query ASLVERWAESR----------------lSAAERSALWGGTAARCYALP------------  287
ident        |                          |      |                  
Sbjct ILRTWQVAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAhevgsievgkla  429
DSSP  HHHHHHHHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct dlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrlt  489
DSSP  leeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhlee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct flsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgeli  549
DSSP  eelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleel


DSSP  -----------------
Query -----------------  287
ident                  
Sbjct tsepadvlpmaqryflf  566
DSSP  lllllllllllllllll


No 46: Query=4dlfA Sbjct=4rdvB Z-score=13.0

back to top
DSSP  ------------------------------------------------LLLEEEEELLL-
Query ------------------------------------------------ALRIDSHQHFW-   11
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh


DSSP  -----------lllhhhllLLLLlLHHHLLL------lLHHHHHHHHHHLLLLEEEEELL
Query -----------ryraadypWIGAgMGVLARD------yLPDALHPLMHAQALGASIAVQA   54
ident                    |        ||            |   |      |      
Sbjct ramaglaevagnpndsfwtWRELmYRMVARLspeqievIACQLYIEMLKAGYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhHHHHhHHHHLLLlhhhhhhHHHHHHHHHHHHLEEEEEEEEL


DSSP  LLL-------hhhhHHHHHHHLLL---LLEEEEEELL-------------------LLLL
Query RAG-------rdetAFLLELACDE---ARIAAVVGWE-------------------DLRA   85
ident                  |                                          
Sbjct VHHdldgrsyadpaELSLRISRAAsaaGIGLTLLPVLyshagfggqpasegqrrfiNGSE  180
DSSP  LLLlllllllllllHHHHHHHHHHhhhLLEEEEEELLlleeellleellhhhllllLLHH


DSSP  lLHHHHHHL-LLLL----LEEEEEELHHHLllhhhHHHLhHHHHHHHHhHHLLLEEEELL
Query pQLAERVAE-WRGT----KLRGFRHQLQDEadvraFVDDaDFARGVAWlQANDYVYDVLV  140
ident     |                |                    |   |     |       
Sbjct -AYLELLQRlRAPLeaagHSLGLCFHSLRA-----VTPQ-QIATVLAA-GHDDLPVHIHI  232
DSSP  -HHHHHHHHhHHHHhhhlLEELEEELLLLL-----LLHH-HHHHHHLL-LLLLLLEEEEE


DSSP  L--------------hHHHHHHH-HHHHhllllLEEEHhHHLLlhhhllllllhhhhHHH
Query F--------------eRQLPDVQ-AFCArhdahWLVLDhAGKPalaefdrddtalarWRA  185
ident                 | |                 |                      |
Sbjct AeqqkevddcqawsgrRPLQWLYeNVAV---dqRWCLV-HATH-------------aDPA  275
DSSP  LllhhhhhhhhhhhllLHHHHHHhHLLL---llLEEEE-ELLL-------------lLHH


DSSP  HHHHHHLLLlEEEEEL--LLLLLLlllllllhhhhhhHHHHHHHHHHHHLhhHEEELLLL
Query ALRELAALPhVVCKLS--GLVTEAdwrrglrasdlrhIEQCLDAALDAFGpqRLMFGSDW  243
ident      |     |  |                              |   |  ||  ||| 
Sbjct EVAAMARSG-AVAGLClsTEANLG------------dGIFPATDFLAQGG--RLGIGSDS  320
DSSP  HHHHHHHHL-LEEEELhhHHHHLL------------lLLLLHHHHHHLLL--EEEELLLL


DSSP  LhhhhlLLHHhhHHHH-HHHH----------HHHL------LHHH-HHHHlLHHHHHHLL
Query PvcllaASYDevASLV-ERWA----------ESRL------SAAE-RSALwGGTAARCYA  285
ident        |                                        |      |    
Sbjct H-----VSLS--VVEElRWLEygqrlrdrkrNRLYrddqpmIGRTlYDAA-LAGGAQALG  372
DSSP  L-----LLLL--HHHHhHHHHhhhhhhhlllLLLLllllllHHHHhHHHH-HHHHHHHHL


DSSP  LL----------------------------------------------------------
Query LP----------------------------------------------------------  287
ident  |                                                          
Sbjct QPigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgr  432
DSSP  LLllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeellll


DSSP  -------------------
Query -------------------  287
ident                    
Sbjct hageersarafvqvlgell  451
DSSP  lllhhhhhhhhhhhhhhhl


No 47: Query=4dlfA Sbjct=3qy6A Z-score=13.0

back to top
DSSP  llLEEEEE-LLLLllhhhllllllllhhhlLLLL-HHHHHHHHHHLLLLEEEEELL----
Query alRIDSHQ-HFWRyraadypwigagmgvlaRDYL-PDALHPLMHAQALGASIAVQA----   54
ident    || |                        |             |     ||       
Sbjct --MIDIHChILPA------------mddgaGDSAdSIEMARAAVRQGIRTIIATPHhnng   46
DSSP  --LEELLLlLLLL------------lllllLLHHhHHHHHHHHHHLLLLEEELLLEelll


DSSP  ---LLLHHHHHHHHHHHLLL-----LLEEEEEellllllllhhhhhhlllllleeeEEEL
Query ---RAGRDETAFLLELACDE-----ARIAAVVgwedlrapqlaervaewrgtklrgFRHQ  106
ident                |                                            
Sbjct vykNEPAAVREAADQLNKRLikediPLHVLPG------------------------QEIR   82
DSSP  lllLLHHHHHHHHHHHHHHHhhlllLLEEELL------------------------LEEE


DSSP  HhhlllhHHHHhlhhhHHHHHH----hhhlLLEEEELLLH-HHHHHHHHHHHHLL--LLL
Query LqdeadvRAFVddadfARGVAW----lqanDYVYDVLVFE-RQLPDVQAFCARHD--AHW  159
ident           |         |                                       
Sbjct I------YGEV-----EQDLAKrqllslndTKYILIEFPFdHVPRYAEQLFYDLQlkGYI  131
DSSP  L------LLLH-----HHHHHLlllllhhhLLEEEEELLLlLLLLLHHHHHHHHHhlLLE


DSSP  EEEHHHHLLLhhhllllllHHHHhHHHHHHHHLLLlEEEEELlllllllllllLLHHHHH
Query LVLDHAGKPAlaefdrddtALARwRAALRELAALPhVVCKLSglvteadwrrgLRASDLR  219
ident  |  |                      |  |                             
Sbjct PVIAHPERNR--------eIREN-PSLLYHLVEKG-AASQIT----sgslagiFGKQLKA  177
DSSP  EEEELHHHLH--------hHHHL-LHHHHHHHHLL-LEEEEE----hhhhlllLLHHHHH


DSSP  HHHHHHHHHHhhhlhhHEEELLLLLHhHHLLLHhhHHHHHHHHHHHHLLHHHHHHHLlHH
Query HIEQCLDAALdafgpqRLMFGSDWPVcLLAASYdeVASLVERWAESRLSAAERSALWgGT  279
ident        | |           ||                     |          |    
Sbjct FSLRLVEANL------IHFVASDAHN-VKTRNF--HTQEALYVLEKEFGSELPYMLT-EN  227
DSSP  HHHHHHHLLL------LLEEELLLLL-LLLLLL--LHHHHHHHHHHHHLLHHHHHHH-HH


DSSP  HHHHLL------------ll
Query AARCYA------------lp  287
ident |                   
Sbjct AELLLRnqtifrqppqpvkr  247
DSSP  HHHHHLllllllllllllll


No 48: Query=4dlfA Sbjct=1v77A Z-score=12.6

back to top
DSSP  LLLEEEEELLllllhhhllllllllhhhlllllhhHHHHHHHHLlLLEEEEELLL---LL
Query ALRIDSHQHFwryraadypwigagmgvlardylpdALHPLMHAQaLGASIAVQAR---AG   57
ident    |                                   |                    
Sbjct VKFIEMDIRD------------------------kEAYELAKEW-FDEVVVSIKFneeVD   35
DSSP  LLLEEEEELL------------------------hHHHHHHHHH-LLEEEEEEEElllLL


DSSP  HHHHHHHHHHHllllleeEEEEllllllllhhhhhhlllllleeeeEELHHhlllhhhHH
Query RDETAFLLELAcdeariaAVVGwedlrapqlaervaewrgtklrgfRHQLQdeadvraFV  117
ident                    |                                        
Sbjct KEKLREARKEY------gKVAI------------------------LLSNP-------KP   58
DSSP  HHHHHHHHHHH------lLEEE------------------------EEELL-------LH


DSSP  HLhhhHHHHHHHHhlLLEEEELLLhhHHHHHHHHHHHLllllEEEHhHHLLLhhhlllll
Query DDadfARGVAWLQanDYVYDVLVFerQLPDVQAFCARHdahwLVLDhAGKPAlaefdrdd  177
ident         |       |   |      |                                
Sbjct SL--vRDTVQKFK--SYLIYVESN--DLRVIRYSIEKG---vDAII-SPWVN--------  100
DSSP  HH--hHHHHHHLL--LLEEEEELL--LHHHHHHHHHLL---lLEEE-LLLLL--------


DSSP  lhHHHHhhHHHH-HHLLL---LEEEEEL-LLLLLLllllllLHHHHHHHHHHHHHHHHHH
Query taLARWraALRE-LAALP---HVVCKLS-GLVTEAdwrrglRASDLRHIEQCLDAALDAF  232
ident              || |     |    |                           |    
Sbjct --RKDP--GIDHvLAKLMvkkNVALGFSlRPLLYS------NPYERANLLRFMMKAWKLV  150
DSSP  --LLLL--LLLHhHHHHHhhhLLEEEEElHHHHHL------LHHHHHHHHHHHHHHHHHH


DSSP  L--hhHEEELLLLLHhhhlLLHHhhHHHHHHHHHH-HLLHHHHHHHLLHHHHHHLLll
Query G--pqRLMFGSDWPVcllaASYDevASLVERWAES-RLSAAERSALWGGTAARCYAlp  287
ident      |    |                                 |             
Sbjct EkykvRRFLTSSAQE---kWDVR-yPRDLISLGVViGMEIPQAKASISMYPEIILK--  202
DSSP  HhhllLEEEELLLLL---hHHLL-lHHHHHHHHHHlLLLHHHHHHLLLHHHHHHHL--


No 49: Query=4dlfA Sbjct=2uz9A Z-score=12.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  --------LLLEEEEELLL------------------lllHHHLL-llllllhhhlllLL
Query --------ALRIDSHQHFW------------------ryrAADYP-wigagmgvlardYL   33
ident             | | |                                           
Sbjct lshheffmPGLVDTHIHASqysfagssidlpllewltkytFPAEHrfqnidfaeevytRV  120
DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhhhlhHHHHHhhhlhhhhhhhhhHH


DSSP  HHHHHHHHhhllLLEEEEELlLLLHHHHHHHHHHHLLLLlEEEEEEL-------------
Query PDALHPLMhaqaLGASIAVQaRAGRDETAFLLELACDEArIAAVVGW-------------   80
ident                          |    |           | ||              
Sbjct VRRTLKNG----TTTACYFA-TIHTDSSLLLADITDKFG-QRAFVGKvcmdlndtfpeyk  174
DSSP  HHHHHHLL----EEEEEEEL-LLLHHHHHHHHHHHHHHL-LEEEEELeelllllllllll


DSSP  -llllLLLH-HHHHHLLL----LLLEEEEEELHHHLllhhhHHHLhHHHHHHHHHHHLLL
Query -edlrAPQL-AERVAEWR----GTKLRGFRHQLQDEadvraFVDDaDFARGVAWLQANDY  134
ident              | |                                          | 
Sbjct etteeSIKEtERFVSEMLqknySRVKPIVTPRFSLS-----CSET-LMGELGNIAKTRDL  228
DSSP  llhhhHHHHhHHHHHHHHhhllLLEEEEEEELLHHH-----LLHH-HHHHHHHHHHHHLL


DSSP  EEEELLL----------------hHHHHHHHHHHhhlllLLEEEHhHHLLlhhhllllll
Query VYDVLVF----------------eRQLPDVQAFCarhdaHWLVLDhAGKPalaefdrddt  178
ident                                           |    |            
Sbjct HIQSHISenrdeveavknlypsykNYTSVYDKNN--lltNKTVMA-HGCY----------  275
DSSP  EEEEEELllhhhhhhhhhhlllllLHHHHHHHLL--lllLLEEEE-ELLL----------


DSSP  hhhhHHHHHHHHHLLlLEEEEEL--LLLLLLlllllllhhhhhhHHHHHHHHHHHHlhhH
Query alarWRAALRELAALpHVVCKLS--GLVTEAdwrrglrasdlrhIEQCLDAALDAFgpqR  236
ident         |                                           |       
Sbjct ---lSAEELNVFHER-GASIAHCpnSNLSLS------------sGFLNVLEVLKHE--vK  317
DSSP  ---lLHHHHHHHHHH-LLEEEELhhHHHHLL------------lLLLLHHHHHHLL--lE


DSSP  EEELLLLLHHHhlllhHHHHHHHHHHHH---------HHLLHHHHHHHLLHHHHH-HLLL
Query LMFGSDWPVCLlaasyDEVASLVERWAE---------SRLSAAERSALWGGTAAR-CYAL  286
ident    | |                                 |   |   |            
Sbjct IGLGTDVAGGY-sysmLDAIRRAVMVSNillinkvneKSLTLKEVFRLATLGGSQaLGLD  376
DSSP  EEELLLLLLLL-lllhHHHHHHHHHHHHhhhhlllllLLLLHHHHHHHHLHHHHHhLLLL


DSSP  L-----------------------------------------------------------
Query P-----------------------------------------------------------  287
ident                                                             
Sbjct Geignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvg  436
DSSP  Llllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeel


DSSP  --------
Query --------  287
ident         
Sbjct gkqvvpfs  444
DSSP  leeeelll


No 50: Query=4dlfA Sbjct=3ooqA Z-score=12.3

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------ALRIDSHQH    9
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  LLlllhhhllllllllHHHLLL------------------lLHHH-HHHHHHHLLLLEEE
Query FWryraadypwigagmGVLARD------------------yLPDA-LHPLMHAQALGASI   50
ident                                           |         |       
Sbjct IG---------lfeegVGYYYSdgneatdpvtphvkaldgfNPQDpAIERALAGGVTSVX  111
DSSP  LL---------lllllLLHHHLllllllllllllllhhhhlLLLLhHHHHHHLLLEEEEE


DSSP  EELLLL-----lhhhhhhhhhHHLLLLleeeeeellllllllhhhhhhllllLLEEEEEE
Query AVQARA-----grdetaflleLACDEAriaavvgwedlrapqlaervaewrgTKLRGFRH  105
ident  |   |                                                  |   
Sbjct IVPGSAnpvggqgsvikfrsiIVEECI------------------------vKDPAGLKX  147
DSSP  ELLLLLlleeeeeeeeellllLHHHHE------------------------eEEEEEEEE


DSSP  LHHH---------------LLLHHHHHHLhHHHHH-------------------------
Query QLQD---------------EADVRAFVDDaDFARG-------------------------  125
ident                             |  |                            
Sbjct AFGEnpkrvygerkqtpstRXGTAGVIRD-YFTKVknyxkkkelaqkegkeftetdlkxe  206
DSSP  ELLHhhhhhhhhlllllllHHHHHHHHHH-HHHHHhhhhhhhhhhhhlllllllllhhhh


DSSP  hHHHH-HLLLEEEELL-LHHHHHHHHHHHHHLLLlLEEEHhHHLLlhhhllllllhhhhH
Query vAWLQ-ANDYVYDVLV-FERQLPDVQAFCARHDAhWLVLDhAGKPalaefdrddtalarW  183
ident                                     ||    |                 
Sbjct vGEXVlRKKIPARXHAhRADDILTAIRIAEEFGF-NLVIE-HGTE--------------A  250
DSSP  hHHHHhLLLLLEEEEElLHHHHHHHHHHHHHHLL-LEEEE-ELLL--------------H


DSSP  HHHHHHHHLLLlEEEEELLLLLLLLllllllhhhhhHHHHHHHHHHHHHLhhHEEELLLL
Query RAALRELAALPhVVCKLSGLVTEADwrrglrasdlrHIEQCLDAALDAFGpqRLMFGSDW  243
ident       ||           | |                       |            | 
Sbjct YKISKVLAEKK-IPVVVGPLLTFRT-----klelkdLTXETIAKLLKDGV--LIALXCDH  302
DSSP  HHHHHHHHHHL-LLEEELLLLLLLL-----lhhhllLLLLHHHHHHHLLL--LEEELLLL


DSSP  LHHhhllLHHHHHHHHHHHHH-HHLLHhHHHHHLLHHHHHHLLLL---------------
Query PVCllaaSYDEVASLVERWAE-SRLSAaERSALWGGTAARCYALP---------------  287
ident ||                                    |    |                
Sbjct PVI----PLEFATVQAATAXRyGAKEE-DLLKILTVNPAKILGLEdrigsiepgkdadlv  357
DSSP  LLL----LHHHHHHHHHHHHHhLLLHH-HHHHLLLHHHHHHLLLLlllllllllllllee


DSSP  ---------------------------
Query ---------------------------  287
ident                            
Sbjct vwsghpfdxksvvervyidgvevfrre  384
DSSP  eelllllllllleeeeeelleeeeell


No 51: Query=4dlfA Sbjct=3dcpA Z-score=10.5

back to top
DSSP  lLLEEEEELLLLllhhhllllllllhhHLLLLLHHHHHHHHHHLLLLEEEEELLLL----
Query aLRIDSHQHFWRyraadypwigagmgvLARDYLPDALHPLMHAQALGASIAVQARA----   56
ident     | | |                                          |        
Sbjct -XKRDGHTHTEF-------------cpHGTHDDVEEXVLKAIELDFDEYSIVEHAPlsse   46
DSSP  -LLEEEEELLLL-------------llLLLLLLHHHHHHHHHHLLLLEEEEEEELLllhh


DSSP  ---------------------LHHHHHHHHHHHLLLL--LEEEEEellllllllhhhhhh
Query ---------------------GRDETAFLLELACDEA--RIAAVVgwedlrapqlaerva   93
ident                                     |                       
Sbjct fxkntagdkeavttasxaxsdLPYYFKKXNHIKKKYAsdLLIHIG---------------   91
DSSP  hhhllllllhhhhlllllhhhHHHHHHHHHHHHHHLLllLEEEEE---------------


DSSP  lllllleeeEEELHhhlllHHHHHhlHHHHHHHHHHHHlllEEEELL-------------
Query ewrgtklrgFRHQLqdeadVRAFVddADFARGVAWLQAndyVYDVLV-------------  140
ident          |                                                  
Sbjct ---------FEVDY-----LIGYE--DFTRDFLNEYGPqtdDGVLSLhflegqggfrsid  135
DSSP  ---------EEEEL-----LLLLH--HHHHHHHHHHHHhllEEEEELleeeelleeeell


DSSP  -----------------------LHHHHHHHHHHhhHLLLL-lEEEHHhHLLLH------
Query -----------------------FERQLPDVQAFcaRHDAH-wLVLDHaGKPAL------  170
ident                                                |            
Sbjct fsaedynegivqfyggfeqaqlaYLEGVKQSIEA--DLGLFkpRRXGH-ISLCQkfqqff  192
DSSP  llhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHL--LLLLLllLEELL-LLHHHllhhhh


DSSP  --HHLLLLLLHHHHHHHHHHHHHLLLlEEEEEL-LLLLlllllLLLLhhhhhhHHHHHHH
Query --AEFDRDDTALARWRAALRELAALPhVVCKLS-GLVTeadwrRGLRasdlrhIEQCLDA  227
ident      |         |  |                                         
Sbjct geDTSDFSEEVXEKFRVILALVKKRD-YELDFNtAGLF----kPLCG--etypPKKIVTL  245
DSSP  llLHHHLLHHHHHHHHHHHHHHHHHL-LEEEEElHHHH----lLLLL--llllLHHHHHH


DSSP  HHHHHLhhHEEELLLLLhhhhllLHHHHHHHHHHHHHhhllhhhhhhhllhhhhhhllll
Query ALDAFGpqRLMFGSDWPvcllaaSYDEVASLVERWAEsrlsaaersalwggtaarcyalp  287
ident |           |||              |      |                       
Sbjct ASELQI--PFVYGSDSH---gvqDIGRGYSTYCQKLE-----------------------  277
DSSP  HHHLLL--LEEEELLLL---lhhHLLLLHHHHHHHLL-----------------------


No 52: Query=4dlfA Sbjct=2a3lA Z-score=10.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------------------LLLEEEEELLL--------
Query -----------------------------------------ALRIDSHQHFW--------   11
ident                                              | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELLllllhhhh


DSSP  ---------------------------------------------------lllhhhlLL
Query ---------------------------------------------------ryraadyPW   20
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdKF  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllLL


DSSP  LL------lllhhhLLLL------------LHHHHHHHHHHLLLLEEEEELlLLLH----
Query IG------agmgvlARDY------------LPDALHPLMHAQALGASIAVQaRAGR----   58
ident                                         |                   
Sbjct NLkynpcgqsrlreIFLKqdnliqgrflgeITKQVFSDLEASKYQMAEYRI-SIYGrkms  299
DSSP  HHhhllllllhhhhHHLLlllllllllhhhHHHHHHHHHLLLLLEEEEEEE-ELLLllll


DSSP  hhhhHHHHH---hLLLLLEeEEEELL----------------llLLLLHHHHHHL-----
Query detaFLLEL---aCDEARIaAVVGWE----------------dlRAPQLAERVAE-----   94
ident                                                       |     
Sbjct ewdqLASWIvnndLYSENV-VWLIQLprlyniykdmgivtsfqnILDNIFIPLFEatvdp  358
DSSP  hhhhHHHHHhlllLLLLLE-EEEEEEellhhhhlllllllllhhHHHHHLLHHHHhhhlh


DSSP  -----LLLL--LEEEEEELH-HHLLL----------------hhHHHHLhhHHHHHHHHH
Query -----WRGT--KLRGFRHQL-QDEAD----------------vrAFVDDadFARGVAWLQ  130
ident               ||                                        | | 
Sbjct dshpqLHVFlkQVVGFDLVDdESKPErrptkhmptpaqwtnafnPAFSY-yVYYCYANLY  417
DSSP  hhlllLHHHhlLEEEEEEELlLLLLLllllllllllllllllllLLHHH-hHHHHHHHHH


DSSP  HL----------LLEEEELL-LHHHhHHHHHHHHHLllllEEEHhHHLLlhhhllllllh
Query AN----------DYVYDVLV-FERQlPDVQAFCARHdahwLVLDhAGKPalaefdrddta  179
ident                            |  |               |             
Sbjct VLnklreskgmtTITLRPHSgEAGD-IDHLAATFLT---cHSIA-HGIN-----------  461
DSSP  HHhhhhllllllLLEELLLLlLLLL-LHHHHHHHHH---lLLLL-LLHH-----------


DSSP  hhhHHHH--HHHHHLLLLEEEEELlLLLLLLllllllhhHHHHHhhHHHHHHHHHLhhHE
Query larWRAA--LRELAALPHVVCKLSgLVTEADwrrglrasDLRHIeqCLDAALDAFGpqRL  237
ident     |    |  |  |       |               |                    
Sbjct ---LRKSpvLQYLYYLAQIGLAMS-PLSNNS-----lflDYHRN--PFPVFFLRGL--NV  508
DSSP  ---HHHLhhHHHHHHHHLLLEEEL-HHHHLL-----lllLLLLL--LHHHHHHLLL--LE


DSSP  EELLLllHHHHLL-LHHHHHHHHHHHHHH-HLLHHHHHHHLlHHHHHHLLLL--------
Query MFGSDwpVCLLAA-SYDEVASLVERWAES-RLSAAERSALWgGTAARCYALP--------  287
ident     |    |                |    |||                          
Sbjct SLSTD--DPLQIHlTKEPLVEEYSIAASVwKLSACDLCEIA-RNSVYQSGFShalkshwi  565
DSSP  EELLL--LHHHHLlLLLHHHHHHHHHHHHhLLLHHHHHHHH-HHHHHHLLLLhhhhhhhl


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  287
ident                                                    
Sbjct gkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  llllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 53: Query=4dlfA Sbjct=3au2A Z-score=10.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -----------------------------------LLLEEEEELLLLllhhhllllllll
Query -----------------------------------ALRIDSHQHFWRyraadypwigagm   25
ident                                        |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTY-------------  347
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLL-------------


DSSP  hhhllLLLHHHHHHHHHHLLLLEEEEELLLL---------LHHHHHHHHHHHLLL----L
Query gvlarDYLPDALHPLMHAQALGASIAVQARA---------GRDETAFLLELACDE----A   72
ident            |                                     |          
Sbjct --sdgQNTLEELWEAAKTMGYRYLAVTDHSPavrvaggpsPEEALKRVGEIRRFNethgP  405
DSSP  --lllLLLHHHHHHHHHHHLLLEEEEEEELHhhhllllllHHHHHHHHHHHHHHHhhhlL


DSSP  LEEEEEellllllllhhhhhhlllllleeeEEELHhhlllHHHHHhlhhhhhhHHHHhhl
Query RIAAVVgwedlrapqlaervaewrgtklrgFRHQLqdeadVRAFVddadfargVAWLqan  132
ident                                                        |    
Sbjct PYLLAG------------------------AEVDI-----HPDGT-----ldyPDWVlre  431
DSSP  LEEEEE------------------------EEEEL-----LLLLL-----lllLHHHhll


DSSP  llEEEELLL-------hhHHHHHHHHHHHLllLLEEEHHHHLLLHHHLlllllhhhHHHH
Query dyVYDVLVF-------erQLPDVQAFCARHdaHWLVLDHAGKPALAEFdrddtalaRWRA  185
ident      | |          |                || |     |            | |
Sbjct ldLVLVSVHsrfnlpkadQTKRLLKALENP--FVHVLAHPTARLLGRR---apieaDWEA  486
DSSP  llEEEEELLllllllhhhHHHHHHHHHLLL--LLLEELLLLLLLLLLL---lllllLHHH


DSSP  HHHHHHLLlLEEEEELLLLLLllllllllhhhhhhHHHHHHHHHHHHLhhHEEELLLLLH
Query ALRELAALpHVVCKLSGLVTEadwrrglrasdlrhIEQCLDAALDAFGpqRLMFGSDWPV  245
ident           |     |                         |             |   
Sbjct VFQKAKEK-GVAVEIDGYYDR-----------mdlPDDLARMAYGMGL--WISLSTDAHQ  532
DSSP  HHHHHHHH-LLEEEEELLLLL-----------lllLHHHHHHHHHLLL--LEEEELLLLL


DSSP  hhhlLLHHhHHHHHHHHHHH-HLLHHHhhHHLLH---hHHHHLL---ll
Query cllaASYDeVASLVERWAES-RLSAAErsALWGG---tAARCYA---lp  287
ident             |    |            |                  
Sbjct ---tDHLR-FMELAVGTAQRaWIGPER--VLNTLdyedLLSWLKarrgv  575
DSSP  ---hHHHH-HHHHHHHHHHHlLLLLLL--LHHHLlhhhHHHHHHlllll


No 54: Query=4dlfA Sbjct=1m65A Z-score=8.9

back to top
DSSP  lLLEEEEELLLLllhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELL------
Query aLRIDSHQHFWRyraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQA------   54
ident     | | |                                                   
Sbjct -YPVDLHMHTVA--------------sthaYSTLSDYIAQAKQKGIKLFAITDHgpdmed   45
DSSP  -LLEELLLLLLL--------------llllLLLHHHHHHHHHHHLLLEEEEEEEllllll


DSSP  LLLHHHHHHHHHhhLLLL----LEEEEEellllllllhhhhHHLLllllEEEEeelhhhl
Query RAGRDETAFLLElaCDEA----RIAAVVgwedlrapqlaerVAEWrgtkLRGFrhqlqde  110
ident                        |                         |          
Sbjct APHHWHFINMRI--WPRVvdgvGILRGIeaniknvdgeidcSGKM-fdsLDLI-------   95
DSSP  LLLLHHHHHHHH--LLLEelleEEEEEEeeellllllllllLHHH-hhhLLEE-------


DSSP  llhhhhhhlhhhhhhhhhhhhllleeEELLL---------hHHHHHHHHHHHHLllLLEE
Query advrafvddadfargvawlqandyvyDVLVF---------eRQLPDVQAFCARHdaHWLV  161
ident                                                 |  |        
Sbjct --------------------------IAGFHepvfaphdkaTNTQAMIATIASG--NVHI  127
DSSP  --------------------------EEELLllllllllhhHHHHHHHHHHHLL--LLLE


DSSP  EHHHHLLLhhhllllllhhhHHHHhHHHHHLL---LLEEEEELLLLllllllllllhhhh
Query LDHAGKPAlaefdrddtalaRWRAaLRELAAL---PHVVCKLSGLVteadwrrglrasdl  218
ident   | | |                      |       |                      
Sbjct ISHPGNPK------------YEID-VKAVAEAaakHQVALEINNSS--------------  160
DSSP  ELLLLLLL------------LLLL-HHHHHHHhhhHLLEEEEELLL--------------


DSSP  hhhhhHHHHHHHHHL--hHHEEELLLLLHhhhlllhhhHHHHHHHHHHH-HLLHHHhhhH
Query rhieqCLDAALDAFG--pQRLMFGSDWPVcllaasydeVASLVERWAES-RLSAAErsaL  275
ident             |          |||                                  
Sbjct -----NCREVAAAVRdagGWVALGSDSHT----aftmgEFEECLKILDAvDFPPER---I  208
DSSP  -----LHHHHHHHHHhhlLLEEEELLLLL----hhhllLLHHHHHHHHHlLLLHHH---L


DSSP  LLH---hHHHHLL-----------ll
Query WGG---tAARCYA-----------lp  287
ident                           
Sbjct LNVsprrLLNFLEsrgmapiaefadl  234
DSSP  HHHlhhhHHHHHHhllllllhhhlll


No 55: Query=4dlfA Sbjct=3f2bA Z-score=8.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -----------------------------------------------LLLEEEEELLLll
Query -----------------------------------------------ALRIDSHQHFWry   13
ident                                                  |   | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTP--  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLL--


DSSP  lhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELLLllhhHHHHhHHHHLLLL-
Query raadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQARagrdETAFlLELACDEA-   72
ident                        |          |                   |   | 
Sbjct -----------msqmdaVTSVTKLIEQAKKWGHPAIAVTDHA----VVQS-FPEAYSAAk  162
DSSP  -----------llllllLLLHHHHHHHHHHLLLLLEEELLLL----LLLL-HHHHHHHHh


DSSP  ---LEEEEEEllllllllhhhhhhlllllleeeeEELH----------------------
Query ---RIAAVVGwedlrapqlaervaewrgtklrgfRHQL----------------------  107
ident                                                             
Sbjct khgMKVIYGL------------------------EANIvddpfhvtllaqnetglknlfk  198
DSSP  hhlLLEEEEE------------------------EEEEellleeeeeeellhhhhhhhhh


DSSP  -------hhLLLHhhhhhlhHHHHHHHHHHhlLLEEeelllhhhhhhhhhhhhhllllle
Query -------qdEADVrafvddaDFARGVAWLQanDYVYdvlvferqlpdvqafcarhdahwl  160
ident             |            |                                  
Sbjct lvslshiqyFHRV----priPRSVLVKHRD--GLLV------------------------  228
DSSP  hhhhhhlllLLLL----lleEHHHHHHLLL--LEEE------------------------


DSSP  EEHH---hHLLLhhhllllllhhhhhhhhHHHHHLLlLEEEEELLLLLLLLllllLLHHH
Query VLDH---aGKPAlaefdrddtalarwraaLRELAALpHVVCKLSGLVTEADwrrgLRASD  217
ident                                  |                     |   |
Sbjct GSGCdkgeLFDN-----------------VEDIARF-YDFLEVHPPDVYKP----LYVKD  266
DSSP  ELLLllllLLLL-----------------LLLLHHH-LLLEEELLHHHHLL----LLLLL


DSSP  HHHHHHHHHHHHHHHL--hhHEEELLLLL------------------------hhhHLLL
Query LRHIEQCLDAALDAFG--pqRLMFGSDWP------------------------vclLAAS  251
ident    |                                                    |   
Sbjct EEMIKNIIRSIVALGEkldiPVVATGNVHylnpedkiyrkilihsqgganplnrheLPDV  326
DSSP  HHHHHHHHHHHHHHHHhlllLEEELLLLLlllhhhhhhhhhhhhllhhhlllllllLLLL


DSSP  HhhhHHHHHHHHHHHLLHhHHHHHLLHHHHHH-LLLL-----------------------
Query YdevASLVERWAESRLSAaERSALWGGTAARC-YALP-----------------------  287
ident |                                                           
Sbjct YfrtTNEMLDCFSFLGPE-KAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeire  385
DSSP  LlllHHHHHHHHHHHHHH-HHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct msyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgs  445
DSSP  hhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct vgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdg  505
DSSP  hhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct hdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktayg  565
DSSP  lllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct fvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypadd  625
DSSP  hhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct tssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifss  685
DSSP  lllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct teplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgna  745
DSSP  lhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct qeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhd  805
DSSP  hhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct vpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldami  865
DSSP  llhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct kgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvid  925
DSSP  hlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  287
ident                                                             
Sbjct gnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldsl  985
DSSP  lleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllll


DSSP  ---------
Query ---------  287
ident          
Sbjct pdhnqlslf  994
DSSP  lllllllll


No 56: Query=4dlfA Sbjct=1bksA Z-score=7.5

back to top
DSSP  --------------llleEEEELL-LLLLhhhllllllllhhhllllLHHHHHHHHHHLl
Query --------------alriDSHQHF-WRYRaadypwigagmgvlardyLPDALHPLMHAQa   45
ident                                                       |  |  
Sbjct meryenlfaqlndrregaFVPFVTlGDPG---------------ieqSLKIIDTLIDAG-   44
DSSP  lhhhhhhhhhhhhlllleEEEEEElLLLL---------------hhhHHHHHHHHHHLL-


DSSP  lleeEEELLLLL--------------------hhhhHHHHHHHLL--LLLE-EEEEE-LL
Query lgasIAVQARAG--------------------rdetAFLLELACD--EARI-AAVVG-WE   81
ident                                     |   |      |            
Sbjct --adALELGVPFsdpladgptiqnanlrafaagvtpAQCFEMLALirEKHPtIPIGLlMY  102
DSSP  --llLEEEELLLlllllllhhhhhhhhhhhhhlllhHHHHHHHHHhhHHLLlLLEEEeEL


DSSP  LL--lLLLHHHHHHLLLLLLEEEEEELHhhlllhhhHHHLhhHHHHHHHHHHLLLEEEEL
Query DL--rAPQLAERVAEWRGTKLRGFRHQLqdeadvraFVDDadFARGVAWLQANDYVYDVL  139
ident              |                       |     |                
Sbjct ANlvfNNGIDAFYARCEQVGVDSVLVAD-------vPVEE--SAPFRQAALRHNIAPIFI  153
DSSP  HHhhhLLLHHHHHHHHHHHLLLEEEELL-------lLHHH--LHHHHHHHHHLLLEEEEE


DSSP  LLHHHHHHHHHHHHHLlllLEEEHHHhlllhhhllllllhhhHHHHHHHHHHLLLLEEEE
Query VFERQLPDVQAFCARHdahWLVLDHAgkpalaefdrddtalaRWRAALRELAALPHVVCK  199
ident        |     |                                    |         
Sbjct CPPNADDDLLRQVASY--gRGYTYLL--------------alPLHHLIEKLKEYHAAPAL  197
DSSP  ELLLLLHHHHHHHHHH--lLLLEEEL--------------llLHHHHHHHHHHHLLLLEE


DSSP  ELLLLLlllllllllhhhHHHHHHHHHHHhhhhlhhhEEELLLL-LHHH-----------
Query LSGLVTeadwrrglrasdLRHIEQCLDAAldafgpqrLMFGSDW-PVCL-----------  247
ident                            |             |    |             
Sbjct QGFGIS-----------sPEQVSAAVRAG-------aAGAISGSaIVKIieknlaspkqm  239
DSSP  ELLLLL-----------lHHHHHHHHHHL-------lLEEEELLhHHHHhhhllllhhhh


DSSP  ---hllLHHHHHHHHHhhhhhhllhhhhhhhllhhhhhhllll
Query ---laaSYDEVASLVErwaesrlsaaersalwggtaarcyalp  287
ident                                            
Sbjct laelrsFVSAMKAASR---------------------------  255
DSSP  hhhhhhHHHHHHHLLL---------------------------


No 57: Query=4dlfA Sbjct=2yb1A Z-score=5.9

back to top
DSSP  llLEEEEELLLlllhhhllllllllhhhlllLLHHHHHHHHhhllLLEEEEELLLllhhh
Query alRIDSHQHFWryraadypwigagmgvlardYLPDALHPLMhaqaLGASIAVQARagrde   60
ident    || | |                         |                         
Sbjct -aNIDLHFHSR-----------tsdgaltptEVIDRAAARA----PALLALTDHD----c   40
DSSP  -lLEELLLLLL-----------lllllllhhHHHHHHHLLL----LLEEEELLLL----l


DSSP  HHHHHHHHL---LLLLeEEEEellllllllhhhhhhlllllleeeEEELHH---------
Query TAFLLELAC---DEARiAAVVgwedlrapqlaervaewrgtklrgFRHQLQ---------  108
ident |  | | |                                                    
Sbjct TGGLAEAAAaaaRRGIpFLNG------------------------VEVSVSwgrhtvhiv   76
DSSP  LLLHHHHHHhhhHLLLlEEEE------------------------EEEEEEelleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  108
ident                                                             
Sbjct glgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthf  136
DSSP  eellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhh


DSSP  ----------------------------hlLLHHhhhhlhhhhhhhhhhhhllleeeell
Query ----------------------------deADVRafvddadfargvawlqandyvydvlv  140
ident                                                             
Sbjct arhlvdsgavkdmrtvfrkyltpgkpgyvsHQWA--------------------------  170
DSSP  hhhhhhllllllhhhhhhhlllllllllllLLLL--------------------------


DSSP  lhhhhhhhHHHHH-hLLLL-LEEEHHHHLLLhhhllllllHHHHHHHHHHHHHLLLLEEE
Query ferqlpdvQAFCA-rHDAH-WLVLDHAGKPAlaefdrddtALARWRAALRELAALPHVVC  198
ident                  |    |  | |                         |      
Sbjct ------slEDAVGwiVGAGgMAVIAHPGRYD--------mGRTLIERLILDFQAAGGQGI  216
DSSP  ------lhHHHHHhhHHLLlEEEELLHHHLL--------lLHHHHHHHHHHHHHLLLLEE


DSSP  EE-LLLLllllllllllhhHHHHHHHHHHHHHHHHLhhHEEELLLLLhhHHLLlhhhhhh
Query KL-SGLVteadwrrglrasDLRHIEQCLDAALDAFGpqRLMFGSDWPvcLLAAsydevas  257
ident    ||               |         |           |||               
Sbjct EVaSGSH------------SLDDMHKFALHADRHGL--YASSGSDFH-aPGED----vgh  257
DSSP  EEeELLL------------LHHHHHHHHHHHHHHLL--EEEEELLLL-lLLLL----lll


DSSP  hHHHHHhhhllhhhhhhhllHHHHHHLLLL--------
Query lVERWAesrlsaaersalwgGTAARCYALP--------  287
ident                            |          
Sbjct tEDLPP-----------icrPIWRELEARIlrpadaen  284
DSSP  lLLLLL-----------lllLHHHHLHHHLllllhhhl


No 58: Query=4dlfA Sbjct=3e38A Z-score=5.9

back to top
DSSP  ----------------LLLEEEEELLLlllhhhllllllllhhhllLLLHHHHHHHHHHL
Query ----------------ALRIDSHQHFWryraadypwigagmgvlarDYLPDALHPLMHAQ   44
ident                  |  | | |                        |          
Sbjct aqrrneiqvpdldgytTLKCDFHXHSV---------------fsdgLVWPTVRVDEAYRD   45
DSSP  llllllllllllllleEEEEELLLLLL---------------llllLLLHHHHHHHHHHL


DSSP  LLLEEEEELL--------lllHHHHhHHHHHHLLL----LLEEEEEEllllllllhhhhh
Query ALGASIAVQA--------ragRDETaFLLELACDE----ARIAAVVGwedlrapqlaerv   92
ident  | |                  |       |                             
Sbjct GLDAISLTEHieyrphkqdvvSDHN-RSFDLCREQaeklGILLIKGS-------------   91
DSSP  LLLEELLEEElllllllllllLLLL-HHHHHHHHHhhhhLLEELLEE-------------


DSSP  hlllllleeeeEELHH--------hlllhhhhhhlHHHHHHHHHHHHLLLEeeelllhhh
Query aewrgtklrgfRHQLQ--------deadvrafvddADFARGVAWLQANDYVydvlvferq  144
ident                                     |                       
Sbjct -----------EITRAxapghfnaiflsdsnpleqKDYKDAFREAKKQGAF---------  131
DSSP  -----------EEELLlllleeeeelllllhhhllLLHHHHHHHHHHLLLE---------


DSSP  hhhhhhhhhhlllllEEEHHhHLLLHhhllllllHHHHHhhHHHHhhLLLL-----EEEE
Query lpdvqafcarhdahwLVLDHaGKPALaefdrddtALARWraALRElaALPH-----VVCK  199
ident                    |                                        
Sbjct ---------------XFWNH-PGWDS-------qQPDTT--KWWPehTALYqegcxHGIE  166
DSSP  ---------------EEELL-LLLLL-------lLLLLL--LLLHhhHHHHhllllLEEE


DSSP  -ELLLlllllllllllhhhhhhhhhHHHHHHHHHL--hHHEEELLLLLH-hHHLLL---h
Query -LSGLvteadwrrglrasdlrhieqCLDAALDAFG--pQRLMFGSDWPV-cLLAAS---y  252
ident    |                         |              ||              
Sbjct vANGH-------------------lYXPEAIQWCLdknLTXIGTSDIHQpiQTDYDfekg  207
DSSP  eEELL-------------------eELLHHHHHHHhhlLEEEEELLLLLlhHHHLLhhhl


DSSP  HHHH------------------------hHHHHHH-------------------------
Query DEVA------------------------sLVERWA-------------------------  263
ident                                                             
Sbjct EHRTxtfvfakerslqgirealdnrrtaaYFHELLigredllrpffekcvkieevsrneq  267
DSSP  LLLLeeeeeellllhhhhhhhhhllleeeEELLEEellhhhhhhhhhhheeeeeeeeell


DSSP  -----------------------------------------------------------H
Query -----------------------------------------------------------E  264
ident                                                             
Sbjct gvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtN  327
DSSP  eeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeE


DSSP  HHLlhhhhhhhllhhhhhhllll
Query SRLsaaersalwggtaarcyalp  287
ident                        
Sbjct FIV--------apdkglkytisl  342
DSSP  EEE--------elleeeeeeeel


No 59: Query=4dlfA Sbjct=2anuA Z-score=5.8

back to top
DSSP  --LLLEEEEELLLLllhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELL----
Query --ALRIDSHQHFWRyraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQA----   54
ident    |  | | |                              |                  
Sbjct teWLLCDFHVHTNX---------------sdgHLPLGEVVDLFGKHGVDVVSITDHivdr   45
DSSP  leEEEEEEEELLLL---------------lllLLLHHHHHHHHHHLLLLEEEEEEEeelh


DSSP  --------------LLLH----HHHHHHHHHHLLLL----LEEEEEEllllllllhhhhh
Query --------------RAGR----DETAFLLELACDEA----RIAAVVGwedlrapqlaerv   92
ident                       |    |             |                  
Sbjct rtleqrkrngeplgAITEdkfqDYLKRLWREQKRAWeeygXILIPGV-------------   92
DSSP  hhhhhhhhllllllLLLLllhhHHHHHHHHHHHHHHhhhlLEEEEEE-------------


DSSP  hlllllleeeeEELHHHL-------llhhhhhhlhHHHHHHHHHHHLLLEEeelllhhhh
Query aewrgtklrgfRHQLQDE-------advrafvddaDFARGVAWLQANDYVYdvlvferql  145
ident                                         |  |                
Sbjct -----------EITNNTDlyhivavdvkeyvdpslPVEEIVEKLKEQNALV---------  132
DSSP  -----------EEEELLLleeeeeellllllllllLHHHHHHHHHHLLLEE---------


DSSP  hhhhhhhhhllllleEEHHhHLLLHhhllllllhhhhhhhhHHHH-hLLLL-EEEE-ELL
Query pdvqafcarhdahwlVLDHaGKPALaefdrddtalarwraaLREL-aALPH-VVCK-LSG  202
ident                   |                                         
Sbjct ---------------IAAH-PDRKK-----------lswylWANXerFKDTfDAWEiANR  165
DSSP  ---------------EELL-LLLLL-----------lllhhHHLLllLLLLlLEEEeEEL


DSSP  LLllllllllllhhhhhhhhhhHHHHHHHHLhhHEEELLLLLHhhhllLHHHHHhhhhhh
Query LVteadwrrglrasdlrhieqcLDAALDAFGpqRLMFGSDWPVcllaaSYDEVAslverw  262
ident                                  |    ||                    
Sbjct DD-------------------lFNSVGVKKY--RYVANSDFHE----lWHVYSW------  194
DSSP  LE-------------------eLHHHHHLLL--LEEEELLLLL----hHHHLLE------


DSSP  hhhhllhhhhhhhLLHH----hhHHLL-------------ll
Query aesrlsaaersalWGGT----aaRCYA-------------lp  287
ident                                           
Sbjct ------------kTLVKseknieAIKEairkntdvaiylxrk  224
DSSP  ------------eEEEEelllhhHHHHhhhhllleeeeelll