Results: dupa

Query: 4cqbA

MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4cqb-A 76.5  0.0  402   402  100 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   2:  1k6w-A 50.0  2.1  382   423   28 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   3:  2oof-A 35.4  2.7  354   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   4:  1j6p-A 34.9  2.8  351   407   16 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   5:  2paj-A 34.8  2.7  337   421   16 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   6:  3ls9-A 34.4  2.4  355   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   7:  2uz9-A 31.5  3.2  353   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   8:  3mtw-A 30.9  3.1  327   404   18 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   9:  3mkv-A 30.6  2.8  323   414   19 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  10:  4rdv-B 29.5  3.1  353   451   14 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  11:  3nqb-A 29.1  2.8  312   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  12:  1onx-A 28.3  3.5  328   390   14 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  13:  2vun-A 27.9  3.4  319   385   15 PDB  MOLECULE: ENAMIDASE;                                                 
  14:  3icj-A 27.6  2.6  311   468   17 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  15:  4c5y-A 27.5  3.1  329   436   15 PDB  MOLECULE: OCHRATOXINASE;                                             
  16:  1gkp-A 26.9  3.7  331   458   19 PDB  MOLECULE: HYDANTOINASE;                                              
  17:  2ogj-A 26.8  3.7  313   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  18:  3giq-A 26.8  3.9  335   475   16 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  19:  3gri-A 26.2  3.6  322   422   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  1yrr-B 25.4  3.5  310   334   14 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  21:  4b3z-D 25.3  3.8  327   477   16 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  22:  3ooq-A 25.1  3.3  288   384   18 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  23:  3e74-A 24.5  3.5  308   429   19 PDB  MOLECULE: ALLANTOINASE;                                              
  24:  2imr-A 21.9  4.9  290   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  25:  1a4m-A 21.5  3.2  274   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  26:  1a5k-C 19.3  3.3  303   566   19 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  27:  3k2g-B 17.8  3.9  250   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  28:  1bf6-A 17.5  3.8  236   291   10 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  29:  2ob3-A 17.5  3.9  244   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  30:  3cjp-A 17.3  3.4  218   262   15 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  31:  3gg7-A 17.2  3.5  223   243    7 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  32:  2vc5-A 17.1  4.1  247   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  2y1h-B 16.8  3.4  227   265   11 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  34:  2ffi-A 16.1  3.7  229   273   13 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  2dvt-A 15.5  4.2  234   325   10 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  36:  4hk5-D 15.5  4.4  244   380   10 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  37:  4ofc-A 15.4  4.1  230   335   10 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  38:  4qrn-A 15.1  4.3  235   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  39:  3irs-A 15.0  4.2  227   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  40:  3pnu-A 14.8  4.2  250   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  41:  4mup-B 14.4  3.8  219   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  42:  2gwg-A 14.4  4.3  245   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  43:  2a3l-A 14.3  3.5  278   616    8 PDB  MOLECULE: AMP DEAMINASE;                                             
  44:  4dlf-A 14.2  3.7  223   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  45:  1v77-A 14.0  2.8  177   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  46:  1itq-A 13.5  3.8  231   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  47:  4dzi-C 13.3  4.1  233   388    9 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  3qy6-A 12.9  3.6  200   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  2qpx-A 12.1  4.6  229   376   10 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  50:  3dcp-A 12.0  2.9  186   277   14 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  51:  1j5s-A 11.4  4.1  223   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  52:  3iac-A 10.8  3.9  227   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  53:  3au2-A 10.1  7.3  196   575    9 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  1m65-A  9.2  3.9  186   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  8.5  7.2  172   994    6 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  8.1  3.9  185   255   12 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  6.8  3.6  156   224    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  6.2  3.8  161   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  6.1  3.7  147   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4cqbA Sbjct=4cqbA Z-score=76.5

back to top
DSSP  LLLEEEEEEEEEELLLLEEEEEEEELLEEEEEELLLLLLEEEEEELLLLLEEELEEEEEE
Query SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHT   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHT   60
DSSP  LLLEEEEEEEEEELLLLEEEEEEEELLEEEEEELLLLLLEEEEEELLLLLEEELEEEEEE


DSSP  LHHHLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHLLHHHHHHHHHHHHHHHHHLLEEE
Query HMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLY  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLY  120
DSSP  LHHHLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHLLHHHHHHHHHHHHHHHHHLLEEE


DSSP  EEEEEELLLLLLLHHHHHHHHHHHHLLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHHLL
Query TRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGC  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGC  180
DSSP  EEEEEELLLLLLLHHHHHHHHHHHHLLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHHLL


DSSP  LEEELLLLLLLLLLHHHHHHHHHHHHHHLLLEEEEEELLLHHHHHHHHHHHHHHHHHLLL
Query DLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGY  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGY  240
DSSP  LEEELLLLLLLLLLHHHHHHHHHHHHHHLLLEEEEEELLLHHHHHHHHHHHHHHHHHLLL


DSSP  LLLEEEEELLHHHHLLHHHHHHHHHHHHHHLLEEEEELLLLLLLLLHHHHHHLLLEEEEE
Query KGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCA  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCA  300
DSSP  LLLEEEEELLHHHHLLHHHHHHHHHHHHHHLLEEEEELLLLLLLLLHHHHHHLLLEEEEE


DSSP  LLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHHHHLHHHHHHHLLHHHLLLLL
Query SDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEV  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEV  360
DSSP  LLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHHHHLHHHHHHHLLHHHLLLLL


DSSP  LLLLLEEEELLLLHHHHHHHLLLEEEEEELLEEEEELLEELL
Query GKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA  402
ident ||||||||||||||||||||||||||||||||||||||||||
Sbjct GKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA  402
DSSP  LLLLLEEEELLLLHHHHHHHLLLEEEEEELLEEEEELLEELL


No 2: Query=4cqbA Sbjct=1k6wA Z-score=50.0

back to top
DSSP  lllEEEEEEEEEELLLLEEEEEEEELLEEEEEELL--llllEEEEEELLLLLEEELEEEE
Query skdFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAK--iegtVKDEIDAKGNLVSPGFVDA   58
ident        | || |        |      |  | |            ||   || | ||  
Sbjct ---ALQTIINARLPGEEGLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEP   57
DSSP  ---LLLEEEEELLLLLLLEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEE


DSSP  EELHHHLLLLLLllllLLLLLLLLhHHHHHHHHHHHHHLLHHHHHHHHHHHHHHHHHLLE
Query HTHMDKSFTSTGerlpKFWSRPYTrDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGT  118
ident | | |   |                   ||         ||   |         |   | 
Sbjct HIHLDTTQTAGQ---pNWNQSGTL-FEGIERWAERKALLTHDDVKQRAWQTLKWQIANGI  113
DSSP  EELLLLLLLLLL---lLLLLLLLH-HHHHHHHHLLHHHLLHHHHHHHHHHHHHHHHHLLE


DSSP  EEEEEEEELLLLlLLHHHHHHHHHHHHLLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHH
Query LYTRTHVDVDSVaKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDM  178
ident    ||||||       |  | || | |    || | ||| | |       | |    |  
Sbjct QHVRTHVDVSDA-TLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSYPNGEALLEEALRL  172
DSSP  EEEEEEEELLLL-LLHHHHHHHHHHHHHLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHL


DSSP  LLLEEELLlLLLLLL--LHHHHHHHHHHHHHHLLLEEEEEE-LLLHHHHhHHHHHHHHHH
Query GCDLVGGVdPATREN--NVEGSLDLCFKLAKEYDVDIDYHI-HDIGTVGvYSINRLAQKT  235
ident | | ||   |           ||   | ||  ||  || |                |   
Sbjct GADVVGAI-PHFEFTreYGVESLHKTFALAQKYDRLIDVHCdEIDDEQS-RFVETVAALA  230
DSSP  LLLEEEEL-HHHLLLhhHHHHHHHHHHHHHHHHLLEEEEEElLLLLLLL-LHHHHHHHHH


DSSP  HHLLLLLLEEEEELLHHHHLLHHHHHHHHHHHHHHLLEEEEELLLL-------------L
Query IENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSST-------------P  282
ident    |   ||| ||                 | | ||  ||                    
Sbjct HHEGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNihlqgrfdtypkrR  290
DSSP  HHHLLHHHEEEEELHHHHHLLHHHHHHHHHHHHHHLLEEEELHHHHhhhllllllllllL


DSSP  LLLLHHHHHHLLLEEEEELLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHHHH
Query PTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMI  342
ident     |   || |||     |   | | | |   | |          |            |
Sbjct GITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQLMGYGQINDGLNLI  350
DSSP  LLLLHHHHHHLLLLEEELLLLLLLLLLLLLLLLHHHHHHHHHHHLLLLLHHHHHHHHHHH


DSSP  LHHHHHHHLLhHHLLLLLLLLLLEEEELLLLHHHHHHHLLLEEEEEELLEEEEELL----
Query TSEGARVLGIeKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDE----  398
ident |   || |     |||  |  | |  |       |   |         |  |        
Sbjct THHSARTLNL-QDYGIAAGNSANLIILPAENGFDALRRQVPVRYSVRGGKVIASTQpaqt  409
DSSP  LHHHHHHLLL-LLLLLLLLLLLLEEEELLLLHHHHHHHLLLLLEEEELLEEEEELLllle


DSSP  ----------eell
Query ----------viva  402
ident               
Sbjct tvyleqpeaidykr  423
DSSP  eeellleeeellll


No 3: Query=4cqbA Sbjct=2oofA Z-score=35.4

back to top
DSSP  llLEEEEEEEEEEL---------LLLEEEEEEEELLEEEEEELL--LLLLeeEEEELLLL
Query skDFDLIIRNAYLS---------EKDSVYDIGIVGDRIIKIEAK--IEGTvkDEIDAKGN   49
ident          |                     |    ||                 | || 
Sbjct -lNCERVWLNVTPAtlrsdladyGLLEPHALGVHEGRIHALVPXqdLKYP-aHWQDXKGK   58
DSSP  -lLLLEEEEEEEELlllllllllLLLLLEEEEEELLEEEEEEEHhhLLLL-lLLEELLLL


DSSP  LEEELEEEEEELHHHlLLLLllllLLLLLLL---------llhhHHHHHHHHHHHHLLHH
Query LVSPGFVDAHTHMDKsFTSTgerlPKFWSRP---------ytrdAAIEDGLKYYKNATHE  100
ident || ||  | |||      |                           |         |   
Sbjct LVTPGLIDCHTHLIF-AGSR----AEEFELRqkgvpyaeiarkgGGIISTVRATRAASED  113
DSSP  EEEELEEEEEELLLL-LLLL----HHHHHHHhhlllhhhhhhllLLHHHHHHHHHHLLHH


DSSP  HHHHHHHHHHHHHHHLLEEEEEEEE-ELLL-LLLLHHHHHHHHHHHHLllLLEEEEEEE-
Query EIKRHVIEHAHMQVLHGTLYTRTHV-DVDS-VAKTKAVEAVLEAKEELkdLIDIQVVAF-  157
ident                 |                  |         | |   |        
Sbjct QLFELALPRVKSLIREGVTTVEIKSgYGLTlEDELKXLRVARRLGEAL--PIRVKTTLLa  171
DSSP  HHHHHHHHHHHHHHHHLEEEEEEELlLLLLhHHHHHHHHHHHHHHHHL--LLEEEEEEEe


DSSP  LLLL-------LLLL-LLHH-HHHHHHHHH-LLLEEELLLLLLLLllHHHHHHHHHHHHH
Query AQSG-------FFVD-LESE-SLIRKSLDM-GCDLVGGVDPATREnnVEGSLDLCFKLAK  207
ident |                      |         | |                      | 
Sbjct AHAVppeyrddPDSWvETICqEIIPAAAEAgLADAVDVFCEHIGF--SLAQTEQVYLAAD  229
DSSP  ELLLlhhhlllHHHHhHHHHhLHHHHHHHLlLLLEEEEEELLLLL--LHHHHHHHHHHHH


DSSP  HLLLEEEEEE-LLLHHhhhHHHHHHHHHHhhlllllLEEEEELLHHhhllhhhHHHHHHH
Query EYDVDIDYHI-HDIGTvgvYSINRLAQKTiengykgRVTTSHAWCFadapsewLDEAIPL  266
ident  |      |                |               |             | |  
Sbjct QYGLAVKGHXdQLSNL---GGSTLAANFG-------ALSVDHLEYL-------DPEGIQA  272
DSSP  HLLLEEEEEElLLLLL---LHHHHHHHLL-------LLEEEELLLL-------LHHHHHH


DSSP  HHHHLLEEEEELLLL-----lLLLLHHHHHHLLLEEEEELLLLlLLLLlLLLLlHHHHHH
Query YKDSGMKFVTCFSST-----pPTMPVIKLLEAGINLGCASDNIrDFWVpFGNGdMVQGAL  321
ident     |                   ||  |  ||      ||                   
Sbjct LAHRGVVATLLPTAFyflketKLPPVVALRKAGVPXAVSSDIN-PGTA-PIVS-LRXAXN  329
DSSP  HHHHLLEEEELHHHHhhllllLLLLHHHHHHLLLLEEELLLLL-LLLL-LLLL-HHHHHH


DSSP  HHHHHHLLllhhHHHHHHHHHLHHHHHHHLLHHHL-LLLLLLLLLEEEELLLLHHHHHHH
Query IETQRLELktnrDLGLIWKMITSEGARVLGIEKNY-GIEVGKKADLVVLNSLSPQWAIID  380
ident        |             |   || ||         ||  ||  | |   |      
Sbjct XACTLFGL----TPVEAXAGVTRHAARALGEQEQLgQLRVGXLADFLVWNCGHPAELSYL  385
DSSP  HHHHHHLL----LHHHHHHHLLHHHHHHLLLLLLLlLLLLLLLLLEEEELLLLLLHHHHL


DSSP  L--LLEEEEEELLEEEEElleell
Query Q--AKRLCVIKNGRIIVKdeviva  402
ident            ||           
Sbjct IgvDQLVSRVVNGEETLH------  403
DSSP  LllLLEEEEEELLEELLL------


No 4: Query=4cqbA Sbjct=1j6pA Z-score=34.9

back to top
DSSP  lllEEEEEEEEEEL----LLLEEEEEEEELLEEEEEE-LLLLlleeeEEELLLLLEEELE
Query skdFDLIIRNAYLS----EKDSVYDIGIVGDRIIKIE-AKIEgtvkdEIDAKGNLVSPGF   55
ident       || |                 |    |                |  | || |  
Sbjct ---HHXIIGNCLILkdfsSEPFWGAVEIENGTIKRVLqGEVK----vDLDLSGKLVXPAL   53
DSSP  ---LEEEEEEEEELllllLLLEEEEEEEELLEEEEEEeLLLL----lLEELLLEEEEELE


DSSP  EEEEELHHHLLLLlllllLLLLllLLLHHHHHH-HHHHHHHHLLHHHHHHHHHHHHHHHH
Query VDAHTHMDKSFTStgerlPKFWsrPYTRDAAIE-DGLKYYKNATHEEIKRHVIEHAHMQV  114
ident    |||                              |      |        |       
Sbjct FNTHTHAPXTLLR-----GVAE--DLSFEEWLFsKVLPIEDRLTEKXAYYGTILAQXEXA  106
DSSP  EEEEELHHHHHHL-----LLLL--LLLHHHHHHlLHHHHHLLLLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEEEEElllllllhHHHHHHHHHHHLllLLEEEEEEELllLLLLLLlHHHHHHH
Query LHGTLYTRTHVDvdsvaktkAVEAVLEAKEELkdLIDIQVVAFAqsGFFVDLeSESLIRK  174
ident  ||                   |    |                                
Sbjct RHGIAGFVDXYF--------HEEWIAKAVRDF--GXRALLTRGL--VDSNGD-DGGRLEE  153
DSSP  LLLEEEEEEEEL--------LHHHHHHHHHHH--LLEEEEEEEE--LLLLLL-LLLHHHH


DSSP  HHHHL----------lLEEELLLLlLLLLlhHHHHHHHHHHHHHLLLEEEEEE-LLLHhH
Query SLDMG----------cDLVGGVDPaTRENnvEGSLDLCFKLAKEYDVDIDYHI-HDIGtV  223
ident  |                 |   |       |  |   |  ||        |        
Sbjct NLKLYnewngfegrifVGFGPHSP-YLCS--EEYLKRVFDTAKSLNAPVTIHLyETSK-E  209
DSSP  HHHHHhhhllhhhleeEEEEELLL-LLLL--HHHHHHHHHHHHHHLLLEEEEElLLLL-L


DSSP  HHHhHHHHHHHHhhllLLLLEEEEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLLL-
Query GVYsINRLAQKTiengYKGRVTTSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSSTP-  282
ident                         |                   ||          |   
Sbjct EYD-LEDILNIG---lKEVKTIAAHCVHL-------PERYFGVLKDIPFFVSHNPASNLk  258
DSSP  LLL-LHHHHLLL---lLLLLEEEEELLLL-------LHHHHHHHLLLLEEEEELHHHHHh


DSSP  ---LLLLHHHHHHLLLEEEEELLLLLlllLLLLlLLHHHHHHHHHHHHLL--LLHHHHHH
Query ---PTMPVIKLLEAGINLGCASDNIRdfwVPFGnGDMVQGALIETQRLEL--KTNRDLGL  337
ident       ||    | |       |                               | |   
Sbjct lgnGIAPVQRXIEHGXKVTLGTDGAA---SNNS-LNLFFEXRLASLLQKAqnPRNLDVNT  314
DSSP  lllLLLLHHHHHHLLLEEEELLLLLL---LLLL-LLHHHHHHHHHHHHHLllLLLLLHHH


DSSP  HHHHHLHHHHHHHLLHhHLLLLLLLLLLEEEELL---------lLHHHHHHHLL-LEEEE
Query IWKMITSEGARVLGIEkNYGIEVGKKADLVVLNS---------lSPQWAIIDQA-KRLCV  387
ident   |  |  ||   |      || |  |||||                             
Sbjct CLKXVTYDGAQAXGFK-SGKIEEGWNADLVVIDLdlpexfpvqnIKNHLVHAFSgEVFAT  373
DSSP  HHHHHLHHHHHHHLLL-LLLLLLLLLLLEEEEELllhhhllhhhHHHHHHHLLLlLLLEE


DSSP  EELLEEEEELLEELL-------------------
Query IKNGRIIVKDEVIVA-------------------  402
ident    |  |  |                        
Sbjct XVAGKWIYFDGEYPTidseevkrelariekelys  407
DSSP  EELLEEEEELLLLLLllhhhhhhhhhhhhhhhhl


No 5: Query=4cqbA Sbjct=2pajA Z-score=34.8

back to top
DSSP  lllEEEEEEEE-EELL----------LLEEEEEEEELLEEEEEElLLLLL-eEEEEELLL
Query skdFDLIIRNA-YLSE----------KDSVYDIGIVGDRIIKIEaKIEGT-vKDEIDAKG   48
ident        ||||                    || |||| |  |             ||  
Sbjct ---PSTLIRNAaAIMTggrgtaddpsRVPGPDIRIVGDTIDAIG-ALAPRpgETIVDATD   56
DSSP  ---LEEEEELLlEELLllllllllllLLLLLLEEEELLEEEEEL-LLLLLllLEEEELLL


DSSP  LLEEELEEEEEELHHHLLLLLlllllllllllllhhhhhhhhhhHHHHLLHHHHHHHHHH
Query NLVSPGFVDAHTHMDKSFTSTgerlpkfwsrpytrdaaiedglkYYKNATHEEIKRHVIE  108
ident     |  |  | |   |                                           
Sbjct CVIYPAWVNTHHHLFQSLLKG---------------------epFRALFDERRFRLAARI   95
DSSP  LEEEELEELLLLLHHHHHLLL---------------------llLHHHLLHHHHHHHHHH


DSSP  HHHHHHHLLEEEEEEEEE-LLLLLllhhhHHHHHHHHHLL-LLLEEEEEEELllLLLL--
Query HAHMQVLHGTLYTRTHVD-VDSVAktkavEAVLEAKEELK-DLIDIQVVAFAqsGFFV--  164
ident         |      |                    ||                      
Sbjct GLIELARSGCATVADHNYvYYPGM---pfDSSAILFEEAEkLGLRFVLLRGG--ATQTrq  150
DSSP  HHHHHHLLLEEEEEELLLlLLLLL---llLHHHHHHHHHHhLLLEEEEEELL--LLLLll


DSSP  ---------LLLHHHHHHHHHHHLL-------------LEEE-LLLLllLLLLhHHHHHH
Query ---------DLESESLIRKSLDMGC-------------DLVG-GVDPatRENNvEGSLDL  201
ident            |                                                
Sbjct leadlptalRPETLDAYVADIERLAaryhdaspramrrVVMApTTVL--YSIS-PREMRE  207
DSSP  llllllhhhLLLLHHHHHHHHHHHHhhllllllllleeEEELlLLLL--LLLL-HHHHHH


DSSP  HHHHHHHLLLEEEEEELllhhhhhHHHHHHHHHHhhllLLLLEEEEELLHHhhllhhhHH
Query CFKLAKEYDVDIDYHIHdigtvgvYSINRLAQKTiengYKGRVTTSHAWCFadapsewLD  261
ident     |         |                           |   |             
Sbjct TAAVARRLGLRMHSHLS-----gkSPVAFCGEHD---wLGSDVWYAHLVKV-------DA  252
DSSP  HHHHHHHLLLEEEEELL-----llLHHHHHHHLL---lLLLLEEEELLLLL-------LH


DSSP  HHHHHHHHHLLEEEEELLLLLlllLHHHHHHLLLEEEEELLLLLlllLLLLLLlHHHHHH
Query EAIPLYKDSGMKFVTCFSSTPptmPVIKLLEAGINLGCASDNIRdfwVPFGNGdMVQGAL  321
ident   | |    |     |  |     ||     ||       |             |     
Sbjct DEIALLAQTGTGVAHCPQSNG-rlPVREMADAGVPVSIGVDGAA---SNEAAD-MISEVH  307
DSSP  HHHHHHHHHLLEEEELHHHHH-llLLLLHHHHLLLEEELLLHHH---HLLLLL-HHHHHH


DSSP  HHHHHHLLLLhHHHHHHHHHHLHHHHHHHLLHHHLLLLLLLLLLEEEELL----------
Query IETQRLELKTnRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNS----------  371
ident                      |  |||| |        ||  ||  |             
Sbjct MTWLAQRARL-ASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRLddpryfglhd  366
DSSP  HHHHHHHHLL-LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEELllhhhlllll


DSSP  LLHHhHHHHL--LLEEEEEELLEEEEELLEELL-----------------------
Query LSPQwAIIDQ--AKRLCVIKNGRIIVKDEVIVA-----------------------  402
ident                      |   | |  |                         
Sbjct PAIG-PVASGgrPSVMALFSAGKRVVVDDLIEGvdikelggearrvvrellrevvv  421
DSSP  HHHH-HHHLLllLEEEEEEELLEEEEELLLLLLllhhhhhhhhhhhhhhhhhhhhl


No 6: Query=4cqbA Sbjct=3ls9A Z-score=34.4

back to top
DSSP  llleEEEEEE-EEEL-----LLLEE-EEEEEELLEEEEEELLLL-LLEEEEEELLLLLEE
Query skdfDLIIRN-AYLS-----EKDSV-YDIGIVGDRIIKIEAKIE-GTVKDEIDAKGNLVS   52
ident        ||           |      || | |  |           |   ||  |    
Sbjct ----MILIRGlTRVItfddqERELEdADILIDGPKIVAVGKDLSdRSVSRTIDGRGMIAL   56
DSSP  ----LEEEEEeEEEElllllLLEEEeEEEEEELLEEEEEELLLLlLLLLEEEELLLEEEE


DSSP  ELEEEEEELHHHLLLLllllllLLLL-LLLLHHHHHHHHHHHHH------HLLHHHHHHH
Query PGFVDAHTHMDKSFTStgerlpKFWS-RPYTRDAAIEDGLKYYK------NATHEEIKRH  105
ident ||    | |                     |     |  |                |   
Sbjct PGLINSHQHLYEGAMR------AIPQlERVTMASWLEGVLTRSAgwwrdgKFGPDVIREV  110
DSSP  ELEEEEEELHHHHHHL------LLHHhLLLLHHHHHHHHHHHHHhhhhllLLLHHHHHHH


DSSP  HHHHHHHHHHLLEEEEEEEEELLLL-lLLHHHHHHHHHHHHLllLLEEEEEEELllLLLL
Query VIEHAHMQVLHGTLYTRTHVDVDSV-aKTKAVEAVLEAKEELkdLIDIQVVAFAqsGFFV  164
ident          | |                     |  ||   |   |              
Sbjct ARAVLLESLLGGITTVADQHLFFPGatADSYIDATIEAATDL--GIRFHAARSS--MTLG  166
DSSP  HHHHHHHHHHLLEEEEEEEELLLLLllLLLHHHHHHHHHHHH--LLEEEEEELL--LLLL


DSSP  ----------LLLHHHHHHHHHHHLL-------------LEEE-LLLLllllllhhhHHH
Query ----------DLESESLIRKSLDMGC-------------DLVG-GVDPatrennvegSLD  200
ident             |                             |    |            
Sbjct kseggfcddlFVEPVDRVVQHCLGLIdqyhepepfgmvrIALGpCGVP--------yDKP  218
DSSP  hhhlllllhhHLLLHHHHHHHHHHHHhhhlllllllleeEEELlLLLL--------lLLH


DSSP  HHHHHHHHLL----LEEEEEE-LLLHHH------hhHHHHHHHHHHhhllLLLLEEEEEL
Query LCFKLAKEYD----VDIDYHI-HDIGTV------gvYSINRLAQKTiengYKGRVTTSHA  249
ident   |           |    |                     |           ||   ||
Sbjct ELFEAFAQMAadydVRLHTHFyEPLDAGmsdhlygmTPWRFLEKHG---wASDRVWLAHA  275
DSSP  HHHHHHHHHHhhhlLEEEEEElLLLHHHhhhhhhllLHHHHHHHLL---lLLLLEEEEEL


DSSP  LHHhhllhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEELLLLL
Query WCFadapsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCASDNIR  305
ident             | ||   | |                  |    | |||  |       
Sbjct VVP-------PREEIPEFADAGVAIAHLIAPDlrmgWGLAPIREYLDAGITVGFGTTGSA  328
DSSP  LLL-------LHHHHHHHHHHLLEEEELHHHHhhllLLLLLHHHHHHLLLEEEELLLLLL


DSSP  lllLLLLlLLHHHHHHHHHHHHL------lllhhHHHHHHHHHLHHHHHHHLlHHHL-LL
Query dfwVPFGnGDMVQGALIETQRLE------lktnrDLGLIWKMITSEGARVLGiEKNY-GI  358
ident       | |                                | |   |  ||        
Sbjct ---SNDG-GNLLGDLRLAALAHRpadpnepekwlSARELLRMATRGSAECLG-RPDLgVL  383
DSSP  ---LLLL-LLHHHHHHHHHHHLHhhllllhhhllLHHHHHHHLLHHHHHHLL-LLLLlLL


DSSP  LLLLLLLEEEELL---------LLHHHHHHH--LLLEEEEEELLEEEEELLEELL-----
Query EVGKKADLVVLNS---------LSPQWAIID--QAKRLCVIKNGRIIVKDEVIVA-----  402
ident | |  ||                     |          |  ||   |  |  |      
Sbjct EEGRAADIACWRLdgvdrvgvhDPAIGLIMTglSDRASLVVVNGQVLVENERPVLadler  443
DSSP  LLLLLLLEEEEELllhhhllllLHHHHHHHLllLLLLLEEEELLEEEEELLEELLllhhh


DSSP  ----------
Query ----------  402
ident           
Sbjct ivanttalip  453
DSSP  hhhhhhhhll


No 7: Query=4cqbA Sbjct=2uz9A Z-score=31.5

back to top
DSSP  llLEEEEEEeEEEL--------LLLEEEEEEEE-LLEEEEEELL-------lLLLE--eE
Query skDFDLIIRnAYLS--------EKDSVYDIGIV-GDRIIKIEAK-------iEGTV--kD   42
ident       | |             |       |      |   |          |       
Sbjct --PLAHIFR-GTFVhstwtcpmEVLRDHLLGVSdSGKIVFLEEAsqqeklakEWCFkpcE   57
DSSP  --LLLEEEE-EEEEelllllllEEEEEEEEEELlLLLEEEEEEHhhhhhhhhHHLLlhhH


DSSP  EEELL-LLLEEELEEEEEELHHHLLLLlllllLLLLllLLLHHHHHH-HHHHHHHH-LLH
Query EIDAK-GNLVSPGFVDAHTHMDKSFTStgerlPKFWsrPYTRDAAIE-DGLKYYKN-ATH   99
ident            || || | |                                        
Sbjct IRELShHEFFMPGLVDTHIHASQYSFA-----GSSI--DLPLLEWLTkYTFPAEHRfQNI  110
DSSP  EEELLlLLEEEELEEEEEEEHHHHHHL-----LLLL--LLLHHHHHHhLHHHHHHHhHLH


DSSP  HHHHHHHHHHHHHHHHLLEEEEEEEEELllllLLHHHHHHHHHHHHLllLLEEEEEEELl
Query EEIKRHVIEHAHMQVLHGTLYTRTHVDVdsvaKTKAVEAVLEAKEELkdLIDIQVVAFAq  159
ident                  ||              |                    |     
Sbjct DFAEEVYTRVVRRTLKNGTTTACYFATI----HTDSSLLLADITDKF--GQRAFVGKVC-  163
DSSP  HHHHHHHHHHHHHHHHLLEEEEEEELLL----LHHHHHHHHHHHHHH--LLEEEEELEE-


DSSP  lLLLL---------LLLHHHHHHHHHHHL--------LLEEELLLLlLLLLlhHHHHHHH
Query sGFFV---------DLESESLIRKSLDMG--------CDLVGGVDPaTRENnvEGSLDLC  202
ident                 ||                      |            |      
Sbjct -MDLNdtfpeyketTEESIKETERFVSEMlqknysrvKPIVTPRFS-LSCS--ETLMGEL  219
DSSP  -LLLLlllllllllHHHHHHHHHHHHHHHhhhlllleEEEEEELLH-HHLL--HHHHHHH


DSSP  HHHHHHLLLEEEEEEL----LLHHH------hhHHHHHHHHHHhhllLLLLEEEEELLHH
Query FKLAKEYDVDIDYHIH----DIGTV------gvYSINRLAQKTiengYKGRVTTSHAWCF  252
ident    ||  |  |  ||         |                              |    
Sbjct GNIAKTRDLHIQSHISenrdEVEAVknlypsykNYTSVYDKNN---lLTNKTVMAHGCYL  276
DSSP  HHHHHHHLLEEEEEELllhhHHHHHhhhlllllLHHHHHHHLL---lLLLLEEEEELLLL


DSSP  hhllhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEELLLLllll
Query adapsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCASDNIrdfw  308
ident          |        |     |  |          |   |      |   |      
Sbjct -------SAEELNVFHERGASIAHCPNSNlslsSGFLNVLEVLKHEVKIGLGTDVA----  325
DSSP  -------LHHHHHHHHHHLLEEEELHHHHhhllLLLLLHHHHHHLLLEEEELLLLL----


DSSP  LLLLlLLHHHHHHHHHHHHLL-------llhHHHHHHHHHHLHHHHHHHLLHHHL-LLLL
Query VPFGnGDMVQGALIETQRLEL-------ktnRDLGLIWKMITSEGARVLGIEKNY-GIEV  360
ident        |                         |       |  |   ||        ||
Sbjct GGYS-YSMLDAIRRAVMVSNIllinkvneksLTLKEVFRLATLGGSQALGLDGEIgNFEV  384
DSSP  LLLL-LLHHHHHHHHHHHHHHhhhlllllllLLHHHHHHHHLHHHHHHLLLLLLLlLLLL


DSSP  LLLLLEEEELL--------------------lLHHHHHHHLL--LEEEEEELLEEEeelL
Query GKKADLVVLNS--------------------lSPQWAIIDQA--KRLCVIKNGRIIvkdE  398
ident ||  |    |                        |             |   |       
Sbjct GKEFDAILINPkasdspidlfygdffgdiseaVIQKFLYLGDdrNIEEVYVGGKQV---V  441
DSSP  LLLLLEEEELLlllllllllllhhhhlllllhHHHHHHHHLLhhHEEEEEELLEEE---E


DSSP  EELl
Query VIVa  402
ident     
Sbjct PFS-  444
DSSP  LLL-


No 8: Query=4cqbA Sbjct=3mtwA Z-score=30.9

back to top
DSSP  llLEEEEEEEEEELL----LLEE-EEEEEELLEEEEEELL-LLLL-EEEEEELLLLLEEE
Query skDFDLIIRNAYLSE----KDSV-YDIGIVGDRIIKIEAK-IEGT-VKDEIDAKGNLVSP   53
ident           | |      |            ||  |  |           |  |    |
Sbjct --AEIKAVSAARLLDvasgKYVDnPLVIVTDGRITSIGKKgDAVPaGATAVDLPGVTLLP   58
DSSP  --LLEEEEEEEEEEEllllEEEElEEEEEELLEEEEEEELlLLLLlLLEEEEEEEEEEEE


DSSP  LEEEEEELHHhLLLLLlllllllllllllhhhhhhhhhHHHHHLLHHHHHHHHHHHHHHH
Query GFVDAHTHMDkSFTSTgerlpkfwsrpytrdaaiedglKYYKNATHEEIKRHVIEHAHMQ  113
ident |  | | | | |                                            |   
Sbjct GLIDMHVHLD-SLAEV--------------------ggYNSLEYSDRFWSVVQTANAKKT   97
DSSP  LEEEEEELLL-LLLLL--------------------lhHHHHHLLHHHHHHHHHHHHHHH


DSSP  HHLLEEEEEEEEElllllllhHHHHHHHHHHHLL----LLLEEEEE-EELLL--------
Query VLHGTLYTRTHVDvdsvaktkAVEAVLEAKEELK----DLIDIQVV-AFAQS--------  160
ident    |    |            |        |           |                 
Sbjct LEAGFTTVRNVGA--------ADYDDVGLREAIDagyvPGPRIVTAaISFGAtgghcdst  149
DSSP  HHLLEEEEEELLL--------LLLHHHHHHHHHHllllLLLEEEELlLLEELllllllll


DSSP  ------------LLLLllLHHHHHHHHHHHLLLEEELLLL-----------LLLLllHHH
Query ------------GFFVdlESESLIRKSLDMGCDLVGGVDP-----------ATREnnVEG  197
ident                   |     |     |                             
Sbjct ffppsmdqknpfNSDSpdEARKAVRTLKKYGAQVIXICATggvfsrgnepgQQQL--TYE  207
DSSP  lllhhhllllllLLLLhhHHHHHHHHHHHLLLLEEEEELLlllllllllllLLLL--LHH


DSSP  HHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHhhllllllEEEEELLHHhhllh
Query SLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTiengykgrVTTSHAWCFadaps  257
ident         |         | |     |   |                |  ||        
Sbjct EMKAVVDEAHMAGIKVAAHAH-----GASGIREAVRAG-------vDTIEHASLV-----  250
DSSP  HHHHHHHHHHHLLLEEEEEEL-----LHHHHHHHHHLL-------lLEEEELLLL-----


DSSP  hhHHHHHHHHHHHLLEEEEELLL-----------------------lLLLL--LHHHHHH
Query ewLDEAIPLYKDSGMKFVTCFSS-----------------------tPPTM--PVIKLLE  292
ident    || | |    |  |                                       | | 
Sbjct --DDEGIKLAVQKGAYFSMDIYNtdytqaegkkngvlednlrkdrdiGELQreNFRKALK  308
DSSP  --LHHHHHHHHHHLLEEELLLLLhhhhhhhhhhhlllhhhhhhhhhhHHHHhhHHHHHHH


DSSP  LLLEEEEELLLLLlllllLLLLLHHHHHHHHHHHHllllhhHHHHHHHHHLHHHHHHHLL
Query AGINLGCASDNIRdfwvpFGNGDMVQGALIETQRLelktnrDLGLIWKMITSEGARVLGI  352
ident ||       |           ||                           |   |  || 
Sbjct AGVKMVYGTDAGI-----YPHGDNAKQFAVMVRYG-----aTPLQAIQSATLTAAEALGR  358
DSSP  HLLEEELLLLLLL-----LLLLLHHHHHHHHHHLL-----lLHHHHHHHLLHHHHHHHLL


DSSP  HHHL-LLLLLLLLLEEEElLLLHHHHHHHLLLEEEEEELLEEEEELleell
Query EKNY-GIEVGKKADLVVLnSLSPQWAIIDQAKRLCVIKNGRIIVKDeviva  402
ident  |      ||   |        |        |   | | |           
Sbjct SKDVgQVAVGRYGDMIAV-AGDPLADVTTLEKPVFVMKGGAVVKAP----x  404
DSSP  LLLLlLLLLLLLLLEEEE-LLLLLLLHHHHHLLLEEEELLEEEELL----l


No 9: Query=4cqbA Sbjct=3mkvA Z-score=30.6

back to top
DSSP  llLEEEEEEEEEELL-----LLEEEEEEEELLEEEEEEL-LLLLLEEEEEELLLLLEEEL
Query skDFDLIIRNAYLSE-----KDSVYDIGIVGDRIIKIEA-KIEGTVKDEIDAKGNLVSPG   54
ident         ||  |             | |    |       |       || ||    ||
Sbjct --LTTFLFRNGALLDpdhpdLLQGFEILIEDGFIREVSDkPIKSSNAHVIDVKGKTIMPG   58
DSSP  --LLEEEEEEEEELLlllllLEEEEEEEEELLEEEEEELlLLLLLLLEEEELLLLEEEEL


DSSP  EEEEEELHHhLLLLllllllllllllllhhhhhhHHHHHHhHLLHHHHHHHHHHHHHHHH
Query FVDAHTHMDkSFTStgerlpkfwsrpytrdaaieDGLKYYkNATHEEIKRHVIEHAHMQV  114
ident   | | |                                                     
Sbjct LIDLHVHVV-AIEF--------------------NLPRVA-TLPNVLVTLRAVPIMRAML   96
DSSP  EEEEEELLL-LLLL--------------------LHHHHL-LLLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEEEEElllllllhhhhhHHHHHHHLL----LLLEEEEE-EELL----------
Query LHGTLYTRTHVDvdsvaktkaveaVLEAKEELK----DLIDIQVV-AFAQ----------  159
ident   |    |                    |              |                
Sbjct RRGFTTVRDAGG-----------aGYPFKQAVEsglvEGPRLFVSgRALSqtgghadpra  145
DSSP  HLLEEEEEELLL-----------lLHHHHHHHHllllLLLEEEELlLEEEllllllllll


DSSP  ---------------------LLLLllLLHHHHHHHHHHHLLLEEELLLL----------
Query ---------------------SGFFvdLESESLIRKSLDMGCDLVGGVDP----------  188
ident                             |     |  | || |                 
Sbjct rsdymppdspcgccvrvgalgRVADgvDEVRRAVREELQMGADQIXIMASggvasptdpv  205
DSSP  lllllllllllllllllllleEELLlhHHHHHHHHHHHHHLLLLEEEELLllllllllll


DSSP  -LLLLllHHHHHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHhhllllllEEEE
Query -ATREnnVEGSLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTiengykgrVTTS  247
ident         |         |         |           | |              |  
Sbjct gVFGY--SEDEIRAIVAEAQGRGTYVLAHAY-----TPAAIARAVRCG-------vRTIE  251
DSSP  lLLLL--LHHHHHHHHHHHHLLLLLEEEEEL-----LHHHHHHHHHLL-------lLEEE


DSSP  ELLHHhhllhhhHHHHHHHHHHHLLEEEEELLL--------------------------l
Query HAWCFadapsewLDEAIPLYKDSGMKFVTCFSS--------------------------t  281
ident |            ||   |    |   |                                
Sbjct HGNLI-------DDETARLVAEHGAYVVPTLVTydalasegekyglppesiakiadvhga  304
DSSP  ELLLL-------LHHHHHHHHHHLLEEELLHHHhhhhhhhlllllllhhhhllhhhhhll


DSSP  LLLLlHHHHHHLLLEEEEELLLLLllllLLLLLLHhHHHHHHHHHHllllhhHHHHHHHH
Query PPTMpVIKLLEAGINLGCASDNIRdfwvPFGNGDMvQGALIETQRLelktnrDLGLIWKM  341
ident            ||   |   |                   |    |              
Sbjct GLHS-IEIMKRAGVKMGFGTDLLG----EAQRLQS-DEFRILAEVL------SPAEVIAS  352
DSSP  HHHH-HHHHHHHLLLLLLLLLLLH----HHHHHLL-HHHHHHHLLL------LHHHHHHH


DSSP  HLHHHHHHHLLHHHL-LLLLLLLLLEEEELLlLHHHHHHHL----LLEEEEEELLEEEEE
Query ITSEGARVLGIEKNY-GIEVGKKADLVVLNSlSPQWAIIDQ----AKRLCVIKNGRIIVK  396
ident  |   | |||       |  |  ||  |     |                | | ||  | 
Sbjct ATIVSAEVLGMQDKLgRIVPGAHADVLVVDG-NPLKSVDCLlgqgEHIPLVMKDGRLFVN  411
DSSP  LLHHHHHHLLLLLLLlLLLLLLLLLEEEELL-LLLLLLLLLllllLLLLEEEELLEEEEE


DSSP  Lleell
Query Deviva  402
ident       
Sbjct E---le  414
DSSP  L---ll


No 10: Query=4cqbA Sbjct=4rdvB Z-score=29.5

back to top
DSSP  llleeEEEEEEEELL--LLEE-EEEEEEL-LEEEEEELLLLLLEeeEEELLlLLEEELEE
Query skdfdLIIRNAYLSE--KDSV-YDIGIVG-DRIIKIEAKIEGTVkdEIDAKgNLVSPGFV   56
ident        |                  |        |                  | ||  
Sbjct -----SAIFAERALLpeGWARnVRFEISAdGVLAEIRPDANADG--AERLG-GAVLPGMP   52
DSSP  -----LEEEEEEEEEllEEEEeEEEEELLlLLEEEEELLLLLLL--LEELL-LLEEELEE


DSSP  EEEELHHHLLLLlllllLLLLLLL---LLHHHHHHHHHHHHHHLLHHHHHHHHHHHHHHH
Query DAHTHMDKSFTStgerlPKFWSRP---YTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQ  113
ident   | |                             |           | |           
Sbjct NLHSHAFQRAMA-----GLAEVAGnpnDSFWTWRELMYRMVARLSPEQIEVIACQLYIEM  107
DSSP  EEEELHHHHHHL-----LLLLLLLlllLLHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHH


DSSP  HHLLEEEEEEEEELLLL-------lLLHHHHHHHHHHHHLllLLEEEEEEELllLLLL--
Query VLHGTLYTRTHVDVDSV-------aKTKAVEAVLEAKEELkdLIDIQVVAFAqsGFFV--  164
ident    |         |                     |       |                
Sbjct LKAGYTAVAEFHYVHHDldgrsyadPAELSLRISRAASAA--GIGLTLLPVL--YSHAgf  163
DSSP  HHHLEEEEEEEELLLLLllllllllLLHHHHHHHHHHHHH--LLEEEEEELL--LLEEel


DSSP  -----------lLLHHHHHHHHHHHL---------lLEEELLLLLlllllhhHHHHHHHH
Query -----------dLESESLIRKSLDMG---------cDLVGGVDPAtrennveGSLDLCFK  204
ident                       |                                     
Sbjct ggqpasegqrrfINGSEAYLELLQRLrapleaaghsLGLCFHSLR------aVTPQQIAT  217
DSSP  lleellhhhlllLLLHHHHHHHHHHHhhhhhhhlleELEEELLLL------lLLHHHHHH


DSSP  HHHHLL--LEEEEEELLLHHHH--------hHHHHHHHHHHHhllLLLLEEEEELLHHhh
Query LAKEYD--VDIDYHIHDIGTVG--------vYSINRLAQKTIengYKGRVTTSHAWCFad  254
ident              ||                     |           |    ||     
Sbjct VLAAGHddLPVHIHIAEQQKEVddcqawsgrRPLQWLYENVA---VDQRWCLVHATHA--  272
DSSP  HHLLLLllLLEEEEELLLHHHHhhhhhhhllLHHHHHHHHLL---LLLLEEEEELLLL--


DSSP  llhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEELLLLllllll
Query apsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCASDNIrdfwvp  310
ident                ||     | |          |    |  |  ||  ||        
Sbjct -----DPAEVAAMARSGAVAGLCLSTEanlgDGIFPATDFLAQGGRLGIGSDSH------  321
DSSP  -----LHHHHHHHHHHLLEEEELHHHHhhllLLLLLHHHHHHLLLEEEELLLLL------


DSSP  lLLLLHHHHHHHHHHHHL-----------llLHHHHHHHHHHHLHHHHHHHLLhHHLLLL
Query fGNGDMVQGALIETQRLE-----------lkTNRDLGLIWKMITSEGARVLGIeKNYGIE  359
ident       |                                       ||  ||        
Sbjct -VSLSVVEELRWLEYGQRlrdrkrnrlyrddQPMIGRTLYDAALAGGAQALGQ-PIGSLA  379
DSSP  -LLLLHHHHHHHHHHHHHhhhllllllllllLLLHHHHHHHHHHHHHHHHHLL-LLLLLL


DSSP  LLLLLLEEEELL-----------lLHHHHHH-HLLL-EEEEEELLEEEEELLEELL----
Query VGKKADLVVLNS-----------lSPQWAII-DQAK-RLCVIKNGRIIVKDEVIVA----  402
ident ||  ||| ||                              |   ||  | |         
Sbjct VGRRADLLVLDGndpylasaegdaLLNRWLFaGGDRqVRDVMVAGRWVVRDGRHAGeers  439
DSSP  LLLLLLEEEELLllhhhhllllhhHHHHHHHhLLHHhEEEEEELLEEEELLLLLLLhhhh


DSSP  ------------
Query ------------  402
ident             
Sbjct arafvqvlgell  451
DSSP  hhhhhhhhhhhl


No 11: Query=4cqbA Sbjct=3nqbA Z-score=29.1

back to top
DSSP  --------------------LLLEEEEEEEEEELL----LLEEEEEEEELLEEEEEEL-L
Query --------------------SKDFDLIIRNAYLSE----KDSVYDIGIVGDRIIKIEA-K   35
ident                        ||  |    |           ||||||  |       
Sbjct epadlnddtlraravaaargDQRFDVLITGGTLVDvvtgELRPADIGIVGALIASVHEpA   60
DSSP  llhhhllhhhhhhhhhhhhlLLLEEEEEELLEEELllllLEEELEEEEELLEEEEEELlL


DSSP  LLLLEEEEEELLLLLEEELEEEEEELHhHLLLlllllllllllllllhhhhhhhhhhhhh
Query IEGTVKDEIDAKGNLVSPGFVDAHTHMdKSFTstgerlpkfwsrpytrdaaiedglkyyk   95
ident         ||| |  ||||  | | |   |                              
Sbjct SRRDAAQVIDAGGAYVSPGLIDTHXHI-ESSX----------------------------   91
DSSP  LLLLEEEEEELLLLEEEELEEEEEELH-HHHL----------------------------


DSSP  hllhhhhhHHHHHHHHHHHHLLEEEEEEEEE--LLLLlLLHHHHHHHHHHHHLllLLEEE
Query natheeikRHVIEHAHMQVLHGTLYTRTHVD--VDSVaKTKAVEAVLEAKEELkdLIDIQ  153
ident               |   |  |                    |     | | |       
Sbjct --------ITPAAYAAAVVARGVTTIVWDPHefGNVH-GVDGVRWAAKAIENL--PLRAI  140
DSSP  --------LLHHHHHHHHHLLLEEEEEELLHhhHHHH-LHHHHHHHHHHHLLL--LLEEE


DSSP  EEEELLLLLLL-----llLHHH-HHHHHHHHL-LLEEE-LLLLllllLLHH---HHHHHH
Query VVAFAQSGFFV-----dlESES-LIRKSLDMG-CDLVG-GVDPatreNNVE---GSLDLC  202
ident   |                         |                    |          
Sbjct LLAPSCVPSAPglerggaDFDAaILADLLSWPeIGGIAeIXNX----RGVIerdPRXSGI  196
DSSP  EEELLLLLLLLlllllllLLLHhHHHHHHLLLlEEEEEeELLH----HHHHlllHHHHHH


DSSP  HHHHHHLLLEEEEEELllhhHHHH-HHHHHHHHHhhllllllEEEEELLhHHHLlhhhhh
Query FKLAKEYDVDIDYHIHdigtVGVY-SINRLAQKTiengykgrVTTSHAWcFADApsewld  261
ident              |             |                                
Sbjct VQAGLAAEKLVCGHAR----GLKNaDLNAFXAAG-------vSSDHELV-SGED----lx  240
DSSP  HHHHHHHLLEEEELLL----LLLHhHHHHHHHLL-------lLEELLLL-LHHH----hh


DSSP  hhHHHHhhhlLEEEEELLLL--LLLL--LHHHhhHLLLEEEEELLLLLLlllLLLL--LL
Query eaIPLYkdsgMKFVTCFSST--PPTM--PVIKllEAGINLGCASDNIRDfwvPFGN--GD  315
ident                  |     |                    |             | 
Sbjct akLRAG----LTIELRGSHDhlLPEFvaALNTlgHLPQTVTLCTDDVFP---DDLLqgGG  293
DSSP  hhHHLL----LEEEEELLLHhhHHHHhhHHHHhlLLLLLEEEELLLLLH---HHHHhlLL


DSSP  HHHHHHHHHHHHllllhhHHHHHHHHHLHHHHHHHLlHHHL-LLLLLLLLLEEEELLllH
Query MVQGALIETQRLelktnrDLGLIWKMITSEGARVLGiEKNY-GIEVGKKADLVVLNSlsP  374
ident                            |   |  ||       |  |  || ||      
Sbjct LDDVVRRLVRYG-----lKPEWALRAATLNAAQRLG-RSDLgLIAAGRRADIVVFED--L  345
DSSP  HHHHHHHHHHLL-----lLHHHHHHHHLHHHHHHHL-LLLLlLLLLLLLLLEEEELL--L


DSSP  HHHhhhllLEEEEEELLEEEEELLEELL--------------------------------
Query QWAiidqaKRLCVIKNGRIIVKDEVIVA--------------------------------  402
ident             |   ||                                          
Sbjct NGF-----SARHVLASGRAVAEGGRXLVdiptcdttvlkgsxklplrxandflvksqgak  400
DSSP  LLL-----LEEEEEELLEEEEELLEELLlllllllhhhllllllllllhhhhllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  402
ident                                                             
Sbjct vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  402
ident                                                             
Sbjct gafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsd  520
DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  402
ident                                                             
Sbjct apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee


DSSP  -------
Query -------  402
ident        
Sbjct espviev  587
DSSP  llleeel


No 12: Query=4cqbA Sbjct=1onxA Z-score=28.3

back to top
DSSP  ---LLLE-EEEEEEEEEL--LLLEEEEEEEELLEEEEEELLLL---LLEEEEEELLLLLE
Query ---SKDF-DLIIRNAYLS--EKDSVYDIGIVGDRIIKIEAKIE---GTVKDEIDAKGNLV   51
ident               | |   |     |       ||     |           |  |   
Sbjct midYTAAgFTLLQGAHLYapEDRGICDVLVANGKIIAVASNIPsdiVPNCTVVDLSGQIL   60
DSSP  lllLHHHlLEEEEEEEEEllLEEEEEEEEEELLEEEEEELLLLlllLLLLEEEELLLLEE


DSSP  EELEEEEEELHHHLlllllllllllllllllhhhHHHHhHHHHhhllhhhhhhHHHHhHH
Query SPGFVDAHTHMDKSftstgerlpkfwsrpytrdaAIEDgLKYYknatheeikrHVIEhAH  111
ident  ||| | | |                                                  
Sbjct CPGFIDQHVHLIGG-------------------gGEAG-PTTR---------tPEVA-LS   90
DSSP  EELEEEEEELLLLL-------------------lLLLL-HHHL---------lLLLL-HH


DSSP  HHHHLLEEEEEEEEE-lLLLLllhHHHHHHHHHHHLL-LLLEEEEEEELLLLLlllllhh
Query MQVLHGTLYTRTHVD-vDSVAktkAVEAVLEAKEELK-DLIDIQVVAFAQSGFfvdlese  169
ident      |                    |  |     |    |       |           
Sbjct RLTEAGVTSVVGLLGtdSISR---HPESLLAKTRALNeEGISAWMLTGAYHVP--srtit  145
DSSP  HHHHLLEEEEEELLLllLLLL---LHHHHHHHHHHHHhHLLEEEEEEELLLLL--lllll


DSSP  HHHHHHHHHL--LLEEELLLLLL-LLLLHHHHHHHHHHHHHHLL------LEEEEEELLl
Query SLIRKSLDMG--CDLVGGVDPAT-RENNVEGSLDLCFKLAKEYD------VDIDYHIHDi  220
ident     |          |                |                      |  | 
Sbjct GSVEKDVAIIdrVIGVXCAISDHrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGD-  204
DSSP  LLHHHHHHHLllEEEEEEEELLLlLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELL-


DSSP  HHHHhhhHHHHHHHHHHLL-LLLLEEEEELLHHHHllhhhhhhhHHHHHHhLLEEEEELL
Query GTVGvysINRLAQKTIENG-YKGRVTTSHAWCFADapsewldeaIPLYKDsGMKFVTCFS  279
ident                             |                      |       |
Sbjct SKKA---LQPIYDLLENCDvPISKLLPTHVNRNVP----lfeqaLEFARK-GGTIDITSS  256
DSSP  LLLL---LHHHHHHHHLLLlLHHHEEEELHHHLHH----hhhhhHHHHHL-LLLEEEELL


DSSP  LlLLLL----LHHHHH-HLLL--EEEEELLLLLLLL----------lLLLLLL-HHHHHH
Query StPPTM----PVIKLL-EAGI--NLGCASDNIRDFW----------vPFGNGD-MVQGAL  321
ident                             ||                              
Sbjct I-DEPVapaeGIARAVqAGIPlaRVTLSSDGNGSQPffddegnlthiGVAGFEtLLETVQ  315
DSSP  L-LLLLlhhhHHHHHHhLLLLhhHEEEELLLLLEEEeellllleeeeEELLLHhHHHHHH


DSSP  HHHhhhllLLHHHHHHHHHHHLHHHHHHHLlHHHL-LLLLLLLLLEEEELLllhhhhhhh
Query IETqrlelKTNRDLGLIWKMITSEGARVLGiEKNY-GIEVGKKADLVVLNSlspqwaiid  380
ident                      ||  |  |        |  |  ||| |            
Sbjct VLV----kDYDFSISDALRPLTSSVAGFLN-LTGKgEILPGNDADLLVMTP---------  361
DSSP  HHH----hHHLLLHHHHHHHHLHHHHHHLL-LLLLlLLLLLLLLLEEEELL---------


DSSP  LLLEEEEEELLEEEEELLEELL-------
Query QAKRLCVIKNGRIIVKDEVIVA-------  402
ident       |   |   |||            
Sbjct ELRIEQVYARGKLMVKDGKACVkgtfetd  390
DSSP  LLLEEEEEELLEEEEELLEELLlllllll


No 13: Query=4cqbA Sbjct=2vunA Z-score=27.9

back to top
DSSP  lllEEEEEEEE-EELL------LLEEEEEEEELLEEEEEEL--LLLL-LEEEEEELLLLL
Query skdFDLIIRNA-YLSE------KDSVYDIGIVGDRIIKIEA--KIEG-TVKDEIDAKGNL   50
ident       || |                  |      |  |              ||| |  
Sbjct ---SKTIIKNIgKIVSgdikspVLQADTIVVEDGLIAAIGGeeLMKDaGDATIIDAAGST   57
DSSP  ---LEEEEELLlEEELllllllEELLLEEEEELLEEEEEELhhHHLLlLLLEEEELLLLE


DSSP  EEELEEEEEELHHH---LLLLLlllllllllllllhhhhhhhhhhhhhhllhhhhhhhhh
Query VSPGFVDAHTHMDK---SFTSTgerlpkfwsrpytrdaaiedglkyyknatheeikrhvi  107
ident | ||  | | |                                                 
Sbjct VTPGLLDTHVHVSGgdyAPRQK------------------------------------tm   81
DSSP  EEELEEEEEELLLLlleEHHHL------------------------------------ee


DSSP  HHHHHHHHLLEEEEEEEEE--------lLLLLLLHHHHHHHHHHHHLLLLLEEE-EEEEL
Query EHAHMQVLHGTLYTRTHVD--------vDSVAKTKAVEAVLEAKEELKDLIDIQ-VVAFA  158
ident          |                      |  |                        
Sbjct DFISSALHGGVTTMISAGSphfpgrpkdAAGTKALAITLSKSYYNARPAGVKVHgGAVIL  141
DSSP  LHHHHHHLLLEEEEEELLLlllllllllHHHHHHHHHHHHHHHHHLLHHHLEEElLEELL


DSSP  lllllllLLHH-HHHHHHHHHLLLEE-ELLLlllLLLLHHHHHHHHHHHHHhLLLEEEEE
Query qsgffvdLESE-SLIRKSLDMGCDLV-GGVDpatRENNVEGSLDLCFKLAKeYDVDIDYH  216
ident                      |   |           | |          |        |
Sbjct ------eKGLTeEDFIEMKKEGVWIVgEVGL--gTIKNPEDAAPMVEWAHK-HGFKVQMH  192
DSSP  ------lLLLLhHHHHHHHHLLLLEEeEELL--lLLLLHHHHHHHHHHHHH-LLLEEEEE


DSSP  ELL-----lhHHHHHHHHHHHhhhhhllllllEEEEELL----HHHHLlhhHHHHHHHHH
Query IHD-----igTVGVYSINRLAqktiengykgrVTTSHAW----CFADApseWLDEAIPLY  267
ident           ||                       ||                |      
Sbjct TGGtsipgssTVTADDVIKTK----------pDVVSHINggptAISVQ---EVDRIMDET  239
DSSP  LLLlllllllLLLHHHHHHHL----------lLEEELLLllllLLLHH---HHHHHHHHL


DSSP  hhhLLEEEEELLLLLLL--LLHHHHHHLLL--EEEEELLLLlllLLLLLLLL-HHHHHHH
Query kdsGMKFVTCFSSTPPT--MPVIKLLEAGI--NLGCASDNIrdfWVPFGNGD-MVQGALI  322
ident               |           | |         |                     
Sbjct ---DFAMEIVQCGNPKIadYVARRAAEKGQlgRVIFGNDAP---SGTGLIPLgILRNMCQ  293
DSSP  ---LLEEEEELLLLHHHhhHHHHHHHHHLLhhHEEEELLLL---LLLLLLLLhHHHHHHH


DSSP  HHHHHLLllhhHHHHHHHHHLHHHHHHHLLhHHLLLLLLLLLLEEEELL-------LLHH
Query ETQRLELktnrDLGLIWKMITSEGARVLGIeKNYGIEVGKKADLVVLNS-------LSPQ  375
ident            |      | |     | |      |  || |||                
Sbjct IASMSDI----DPEVAVCMATGNSTAVYGL-NTGVIAPGKEADLIIMDTplgsvaeDAMG  348
DSSP  HHHHLLL----LHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELlllllllLHHH


DSSP  HHH-HHLLLEEEEEELLEEEEELLE---------ell
Query WAI-IDQAKRLCVIKNGRIIVKDEV---------iva  402
ident      |      |   |   |                
Sbjct AIAaGDIPGISVVLIDGEAVVTKSRntppakraakil  385
DSSP  HHHhLLLLEEEEEEELLEEEELLLLllllllllleel


No 14: Query=4cqbA Sbjct=3icjA Z-score=27.6

back to top
DSSP  lllEEEEEEEEEEL-----LLLEeEEEEEELLEEEEEEL--LLLLLE----EEEEELLLL
Query skdFDLIIRNAYLS-----EKDSvYDIGIVGDRIIKIEA--KIEGTV----KDEIDAKGN   49
ident          |          |       |   |                     || || 
Sbjct ---CMKALINGTIYtsfspVKKV-SGLVISNERVLYAGDssTALRIAelagGEIIDLKGK   56
DSSP  ---LEEEEELLEEEeeellEEEE-LEEEEELLEEEEEELhhHHHHHHhhhlLEEEELLLL


DSSP  LEEELEEEEEELHHHLLLL--LLLLL--------------------LLLL----------
Query LVSPGFVDAHTHMDKSFTS--TGERL--------------------PKFW----------   77
ident  | | | | | | |    |                             |           
Sbjct FVMPAFFDSHLHLDELGMSleMVDLRgvksmeelvervkkgrgriiFGFGwdqdelgrwp  116
DSSP  EEEELEEEEEELHHHHHHHhhLEELLllllhhhhhhhhhlllllleEEEEelhhhhllll


DSSP  ---------------LLLLL----------------------------hhhhHHHHHHHH
Query ---------------SRPYT----------------------------rdaaIEDGLKYY   94
ident                 |                                    |      
Sbjct tredldvidrpvflyRRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIIN  176
DSSP  lhhhhlllllleeeeELLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHH


DSSP  -HHLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELlllllLHHHHHHHHHH--HHLLllLE
Query -KNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVdsvakTKAVEAVLEAK--EELKdlID  151
ident  |  |    |             |                ||  |  |      ||    
Sbjct eKILTVKDYKHYIESAQEHLLSLGVHSVGFMSVG-----EKALKALFELEreGRLK--MN  229
DSSP  hLLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEEL-----HHHHHHHHHHHhlLLLL--LE


DSSP  EEEEEELlllllllllhhhHHHH-----------hhhhlLLEEELLLL------------
Query IQVVAFAqsgffvdlesesLIRK-----------sldmgCDLVGGVDP------------  188
ident                                           |                 
Sbjct VFAYLSP------------ELLDkleelnlgkfegrrlrIWGVXLFVDgslgartallse  277
DSSP  EEEEELH------------HHHHhhhhhlllleellleeEEEEEEELLllllllllllll


DSSP  ----------LLLLllHHHHHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHHHL
Query ----------ATREnnVEGSLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTIEN  238
ident                            ||    |   |       |            | 
Sbjct pytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAI-----GDKAVDVALDAFEEA  330
DSSP  llllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEEL-----LHHHHHHHHHHHHHH


DSSP  LLllLEEEEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLL---------------ll
Query GYkgRVTTSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSST---------------pp  283
ident          ||           |      |                              
Sbjct EF--SGRIEHASLV-------RDDQLERIKELKVRISAQPHFIvsdwwivnrvgeerakw  381
DSSP  LL--LLEEEELLLL-------LHHHHHHHHHHLLEEEELLLHHhhlllhhhhhhhhhhhh


DSSP  LLLHHHHHHlLLEEEEELLLLllllllLLLLLHHHHHHHHHHHH--llllhhHHHHHHHH
Query TMPVIKLLEaGINLGCASDNIrdfwvpFGNGDMVQGALIETQRL--elktnrDLGLIWKM  341
ident       |      ||   |            |          |                 
Sbjct AYRLKTLSS-ITKLGFSTDSP------IEPADPWVSIDAAVNRYvvdpgervSREEALHL  434
DSSP  LLLHHHHHH-HLLEEELLLLL------LLLLLHHHHHHHHHHLLlllhhhllLHHHHHHH


DSSP  HLHHHHHHHLlHHHL-LLLLLLLLLEEEELLlLHHHhhhhllleeeeeelleeeeellee
Query ITSEGARVLGiEKNY-GIEVGKKADLVVLNSlSPQWaiidqakrlcvikngriivkdevi  400
ident  |   | |          | |  |    |    |                          
Sbjct YTHGSAQVTL-AEDLgKLERGFRAEYIILDR-DPLK------------------------  468
DSSP  LLHHHHHHLL-LLLLlLLLLLLLLLEEEELL-LLLL------------------------


DSSP  ll
Query va  402
ident   
Sbjct --  468
DSSP  --


No 15: Query=4cqbA Sbjct=4c5yA Z-score=27.5

back to top
DSSP  LLLEEEEEEEEEEL----LLLEEEEEEEELLEEEEEEL--LLLL----LEEEEEELllLL
Query SKDFDLIIRNAYLS----EKDSVYDIGIVGDRIIKIEA--KIEG----TVKDEIDAkgNL   50
ident       ||    |     |        |    |        |                  
Sbjct DEAKVTIIYAGLLIpgdgEPLRNAALVISDKIIAFVGSeaDIPKkylrSTQSTHRV--PV   58
DSSP  LLLLEEEEEEEEELllllLLEEEEEEEEELLEEEEEEEhhHLLHhhhhHLLLEEEE--EE


DSSP  EEELEEEEEELHHHllLLLLllllllllllllhhhhhhHHHHHHHHLLHHHHHHHHHHHH
Query VSPGFVDAHTHMDKsfTSTGerlpkfwsrpytrdaaieDGLKYYKNATHEEIKRHVIEHA  110
ident   ||  | | |                                                 
Sbjct LMPGLWDCHMHFGG--DDDY-----------------yNDYTSGLATHPASSGARLARGC   99
DSSP  EEELEEEEEELLLL--LLLL-----------------lLLLHHHHHLLHHHHHHHHHHHH


DSSP  HHHHHLLEEEEEEEEelllllllhhhhHHHHHHHHLL----LLLEEEEE-EELLL-----
Query HMQVLHGTLYTRTHVdvdsvaktkaveAVLEAKEELK----DLIDIQVV-AFAQS-----  160
ident       |    |                  |                   |         
Sbjct WEALQNGYTSYRDLA-----------gYGCEVAKAINdgtiVGPNVYSSgAALSQtaghg  148
DSSP  HHHHHLLEEEEEELL-----------lLHHHHHHHHHllllLLLEEEELlLEEELlllll


DSSP  ------------------------------LLLLlLLHHHHHHHHHHHLLLEEELLLL--
Query ------------------------------GFFVdLESESLIRKSLDMGCDLVGGVDP--  188
ident                                     |     |     |           
Sbjct difalpagevlgsygvmnprpgywgagplcIADGvEEVRRAVRLQIRRGAKVIXVMASgg  208
DSSP  llllllhhhhhhhhlllllllllllllleeELLLhHHHHHHHHHHHHHLLLLEEEELLll


DSSP  ---------LLLLllHHHHHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHhhll
Query ---------ATREnnVEGSLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTieng  239
ident                    |      |         | |     |   |           
Sbjct vmsrddnpnFAQF--SPEELKVIVEEAARQNRIVSAHVH-----GKAGIMAAIKAG----  257
DSSP  lllllllllLLLL--LHHHHHHHHHHHHHLLLLEEEEEL-----LHHHHHHHHHHL----


DSSP  llllEEEEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLL------------------
Query ykgrVTTSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSST------------------  281
ident         |             |   | |  |   |   |                    
Sbjct ---cKSLEHVSYA-------DEEVWELMKEKGILYVATRSVIeiflasngeglvkeswak  307
DSSP  ---lLEEEELLLL-------LHHHHHHHHHHLLEEELLHHHHhhhhhhllllllllhhhl


DSSP  ----LLLL--LHHHHHHLLLEEEEELLLLlllllllLLLLhhHHHHHHHHHHLLllhhHH
Query ----PPTM--PVIKLLEAGINLGCASDNIrdfwvpfGNGDmvQGALIETQRLELktnrDL  335
ident                  ||       |         |             |         
Sbjct lqalADSHlkAYQGAIKAGVTIALGTDTA-----pgGPTA--LELQFAVERGGM----TP  356
DSSP  llhhHHHHhhHHHHHHHLLLLEELLLLLL-----llLLLH--HHHHHHHHLLLL----LH


DSSP  HHHHHHHLHHHHHHHL-lHHHL-LLLLLLLLLEEEELLlLHHHHHHHL---LLEEEEEEL
Query GLIWKMITSEGARVLG-iEKNY-GIEVGKKADLVVLNSlSPQWAIIDQ---AKRLCVIKN  390
ident     |  |       |           |  ||   |    |   |           | | 
Sbjct LEAIKAATANAPLSVGpqAPLTgQLREGYEADVIALEE-NPLEDIKVFqepKAVTHVWKG  415
DSSP  HHHHHHHLLLHHHHHHhhLLLLlLLLLLLLLLEEEELL-LLLLLHHHHhlhHHEEEEEEL


DSSP  LEEEEEL--lEELL-------
Query GRIIVKD--eVIVA-------  402
ident |                    
Sbjct GKLFKGPgigPWGEdarnpfl  436
DSSP  LEEEELLlllLLLLlllllll


No 16: Query=4cqbA Sbjct=1gkpA Z-score=26.9

back to top
DSSP  llleEEEEEEEEEL--LLLEEEEEEEELLEEEEEELLLL-LLEEEEEELLLLLEEELEEE
Query skdfDLIIRNAYLS--EKDSVYDIGIVGDRIIKIEAKIE-GTVKDEIDAKGNLVSPGFVD   57
ident      | | |            ||   |  |  |    |       ||| |  | ||| |
Sbjct ----PLLIKNGEIItaDSRYKADIYAEGETITRIGQNLEaPPGTEVIDATGKYVFPGFID   56
DSSP  ----LEEEELLEEEelLEEEELEEEELLLLLLEEELLLLlLLLLEEEELLLLEEEELEEE


DSSP  EEELHHHllllllllllllllllllhhhhhhHHHHHhhhllhhhhhHHHHHHHHHHHHLL
Query AHTHMDKsftstgerlpkfwsrpytrdaaieDGLKYyknatheeikRHVIEHAHMQVLHG  117
ident  | |                                                       |
Sbjct PHVHIYL------------------------PFMAT-------fakDTHETGSKAALMGG   85
DSSP  EEELLLL------------------------EELLE-------ellLLHHHHHHHHHHLL


DSSP  EEEEEEEEELL-LLLLLHHHHHHHHHHHHLLlLLEEEEEEELlLLLLllLLHHHHHHHHH
Query TLYTRTHVDVD-SVAKTKAVEAVLEAKEELKdLIDIQVVAFAqSGFFvdLESESLIRKSL  176
ident |                          |      |        | |      |   |   
Sbjct TTTYIEMCCPSrNDDALEGYQLWKSKAEGNS-YCDYTFHMAV-SKFD--EKTEGQLREIV  141
DSSP  EEEEEEEELLLlLLLHHHHHHHHHHHHLLLL-LLEEEEEEEL-LLLL--LLHHHHHHHHH


DSSP  HHLLLEEELLLllLLLL---lHHHHHHHHHHHHHHLLLEEEEEELL--------------
Query DMGCDLVGGVDpaTREN---nVEGSLDLCFKLAKEYDVDIDYHIHD--------------  219
ident   |             |      |       ||||  |    |                 
Sbjct ADGISSFXIFL--SYKNffgvDDGEMYQTLRLAKELGVIVTAHCENaelvgrlqqkllse  199
DSSP  HLLLLEEEEEE--LLLLllllLHHHHHHHHHHHHHHLLEEEEEELLhhhhhhhhhhhhhl


DSSP  ------------LHHHHHHHHHHHHHHHHHLLLllLEEEEELLhHHHLlhhhhhhHHHHH
Query ------------IGTVGVYSINRLAQKTIENGYkgRVTTSHAWcFADApsewldeAIPLY  267
ident                |      | |      |        |      |       |    
Sbjct gktgpewhepsrPEAVEAEGTARFATFLETTGA--TGYVVHLS-CKPA----ldaAMAAK  252
DSSP  llllhhhlllllLHHHHHHHHHHHHHHHHHHLL--EEEELLLL-LHHH----hhhHHHHH


DSSP  H-HHLLEEEEELLLL----------------------------LLLL--LHHHHhhllLE
Query K-DSGMKFVTCFSST----------------------------PPTM--PVIKLleagIN  296
ident                                                             
Sbjct ArGVPIYIESVIPHFlldktyaerggveamkyimspplrdkrnQKVLwdALAQG----FI  308
DSSP  HlLLLEEEEEEHHHHhllhhhhhllhhhhhlllllllllllhhHHHHhhHHHLL----LL


DSSP  EEEELLLLLL---------------LLLLlLLLL-HHHHHHHHHhhhLLLLhhHHHHHHH
Query LGCASDNIRD---------------FWVPfGNGD-MVQGALIETqrlELKTnrDLGLIWK  340
ident      |                              |                |      
Sbjct DTVGTDHCPFdteqkllgkeaftaiPNGI-PAIEdRVNLLYTYG-vsRGRL--DIHRFVD  364
DSSP  LEEELLLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH-llLLLL--LHHHHHH


DSSP  HHLHHHHHHHLLHHHL-LLLLLLLLLEEEELLL----------------lhhhhhHHLLL
Query MITSEGARVLGIEKNY-GIEVGKKADLVVLNSL----------------spqwaiIDQAK  383
ident       |   |       | ||  |||||                               
Sbjct AASTKAAKLFGLFPRKgTIAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfEIDGR  424
DSSP  HHLHHHHHHLLLLLLLlLLLLLLLLLEEEEELLlleellhhhlllllllllllllEELLE


DSSP  EEEEEELLEEEEELLEELL---------------
Query RLCVIKNGRIIVKDEVIVA---------------  402
ident    |   |   | |   |                
Sbjct PSVVTVRGKVAVRDGQFVGekgwgkllrrepmyf  458
DSSP  EEEEEELLEEEEELLEELLlllllllllllllll


No 17: Query=4cqbA Sbjct=2ogjA Z-score=26.8

back to top
DSSP  lllEEEEEEEEEEL-----LLLEEEEEEEE-LLEEEEEELLLLLLEEEEEELLlLLEEEL
Query skdFDLIIRNAYLS-----EKDSVYDIGIV-GDRIIKIEAKIEGTVKDEIDAKgNLVSPG   54
ident          |            |  || |     |                      |||
Sbjct --qAPILLTNVKPVgfgkgASQSSTDILIGgDGKIAAVGSALQAPADTQRIDA-AFISPG   57
DSSP  --lLLEEEEEEEELlllllLLLLLEEEEELlLLLEEEEELLLLLLLLEEELLL-LEEEEL


DSSP  EEEEEELHHHllllllllllllllllllhhhhhhhhhhhhhhllhhHHHHhhhHHHHH-H
Query FVDAHTHMDKsftstgerlpkfwsrpytrdaaiedglkyyknatheEIKRhviEHAHM-Q  113
ident  || | |                                                     
Sbjct WVDLHVHIWH------------------------------------GGTD-isIRPSEcG   80
DSSP  EEEEEELLLL------------------------------------LLLL-llLLHHHlL


DSSP  HHLLEEEEEE-EEELlllllLHHHHHHHH-HHHHLllLLEEEEEEELL-----------L
Query VLHGTLYTRT-HVDVdsvakTKAVEAVLE-AKEELkdLIDIQVVAFAQ-----------S  160
ident    |                        |   |       |                   
Sbjct AERGVTTLVDaGSAG-----EANFHGFREyIIEPS--RERIKAFLNLGsiglvacnrvpE  133
DSSP  HHHLEEEEEEeLLLL-----LLLHHHHHHhLLLLL--LLEEEEEEELLlllllllllllL


DSSP  LLLLLLLHHHHHHHHHHHL---LLEEELLLLLLLLL-LHHHHHHHHHHHHHHLLLEEEEE
Query GFFVDLESESLIRKSLDMG---CDLVGGVDPATREN-NVEGSLDLCFKLAKEYDVDIDYH  216
ident            |                                |  | ||   |    |
Sbjct LRDIKDIDLDRILECYAENsehIVGLXVRASHVITGsWGVTPVKLGKKIAKILKVPXXVH  193
DSSP  LLLHHHLLHHHHHHHHHLLlllEEEEEEEELHHHHLlLLLHHHHHHHHHHHHHLLLEEEE


DSSP  ELLLhhhhhhHHHHHHHHHhhlllLLLEEEEELL-----HHHHLLhHHHHHHHHHHHhhL
Query IHDIgtvgvySINRLAQKTiengyKGRVTTSHAW-----CFADAPsEWLDEAIPLYKdsG  271
ident                                |              | |          |
Sbjct VGEP----paLYDEVLEIL-----GPGDVVTHCFngksgSSIXED-EDLFNLAERCE--G  241
DSSP  ELLL----llLHHHHHHHL-----LLLLEEELLLlllllLLLLLL-HHHHHHHHHLL--L


DSSP  LEEEEELL--LLLLLLL----hHHHHhlllEEEEELLLLlLLLL-LLLLlLHHHHHHHHH
Query MKFVTCFS--STPPTMP----vIKLLeagiNLGCASDNIrDFWV-PFGNgDMVQGALIET  324
ident           |             ||          |             |         
Sbjct IRLDIGHGgaSFSFKVAeaaiaRGLL----PFSISTDLH-GHSXnFPVW-DLATTXSKLL  295
DSSP  LEEELLLLllLLLHHHHhhhhhLLLL----LLLLLLLLL-LLLLlLLLL-LHHHHHHHHH


DSSP  HHHllllhhHHHHHHHHHLHHHHHHHLLHHHLLLLLLLLLLEEEELL----------llh
Query QRLelktnrDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNS----------lsp  374
ident                   |   | |          ||  ||  |                
Sbjct SVD-----xPFENVVEAVTRNPASVIRLDXENRLDVGQRADFTVFDLvdadleatdsngd  350
DSSP  HLL-----lLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLEEEEEEEeeeeeeeelllll


DSSP  hhhhHHLLLEEEEEELLEEeEELL--eell
Query qwaiIDQAKRLCVIKNGRIiVKDE--viva  402
ident                               
Sbjct vsrlKRLFEPRYAVIGAEA-IAASryipra  379
DSSP  eeeeEEEEEEEEEEELLEE-EELLllllll


No 18: Query=4cqbA Sbjct=3giqA Z-score=26.8

back to top
DSSP  lLLEEEEEEEEEEL----LLLEEEEEEEELLEEEEEELLLLLLEEEEEELLLLLEEELEE
Query sKDFDLIIRNAYLS----EKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFV   56
ident     |  |                | |    ||  |            || |  | ||| 
Sbjct -EKLDFKITGGWIIdgtgAPRRRADLGVRDGRIAAIGELGAHPARHAWDASGKIVAPGFI   59
DSSP  -LLEEEEEELLEELllllLLLEELEEEEELLEEEEEELLLLLLEEEEEELLLLEEEELEE


DSSP  EEEELHHHLlllllllllllllllllhhhhhhhhhhhhhhllhhhhhHHHHHhHHHHHHL
Query DAHTHMDKSftstgerlpkfwsrpytrdaaiedglkyyknatheeikRHVIEhAHMQVLH  116
ident | | | |                                                     
Sbjct DVHGHDDLM-------------------------------------fVEKPD-LRWKTSQ   81
DSSP  ELLLLLLLH-------------------------------------hHHLLL-LHHHHLL


DSSP  LEEEEEEE----EELLL-----------------LLLLhhHHHHHHHHH-HLLLlLEEEE
Query GTLYTRTH----VDVDS-----------------VAKTkaVEAVLEAKE-ELKDlIDIQV  154
ident |                                       | |   |        |    
Sbjct GITTVVVGncgvSAAPAplpgntaaalallgetpLFAD--VPAYFAALDaQRPM-INVAA  138
DSSP  LEEEEEELllllLLLLLlllllllhhhhhhllllLLLL--HHHHHHHHHhLLLL-LEEEE


DSSP  EEELLLlLLLLL--------------LHHHHHHHHHHHLLLEEELLLlLLLL--LLHHHH
Query VAFAQSgFFVDL--------------ESESLIRKSLDMGCDLVGGVDpATRE--NNVEGS  198
ident                                    |  |         |           
Sbjct LVGHAN-LRLAAmrdpqaaptaaeqqAMQDMLQAALEAGAVGFSTGL-AYQPgaVAQAAE  196
DSSP  EEEHHH-HHHHHlllllllllhhhhhHHHHHHHHHHHHLLLEEEEEL-LLLLhhHLLHHH


DSSP  HHHHHHHHHHLLLEEEEEELLLHHHHHHHHHHHHHHHHHLLLllLEEEEELlhHHHL--L
Query LDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYkgRVTTSHAwcFADA--P  256
ident |      | |       ||                     |       ||          
Sbjct LEGLARVAAERRRLHTSHIRNEADGVEAAVEEVLAIGRGTGC--ATVVSHH--KCMMpqN  252
DSSP  HHHHHHHHHHLLLEEEEELLLLLLLHHHHHHHHHHHHHHHLL--EEEELLL--LLLLhhH


DSSP  HHHHHHHHHHHHHHL-----LEEEEELLL-------------------------------
Query SEWLDEAIPLYKDSG-----MKFVTCFSS-------------------------------  280
ident                                                             
Sbjct WGRSRATLANIDRAReqgveVALDIYPYPgsstiliperaetiddiritwstphpecsge  312
DSSP  LLLHHHHHHHHHHHHhllllEEEEELLLLeeeeellhhhllllllleeeeelllhhhlll


DSSP  ------------------------------lLLLL-LHHHHHhlllEEEEELLLLLLL-l
Query ------------------------------tPPTM-PVIKLLeagiNLGCASDNIRDF-w  308
ident                                                    ||       
Sbjct yladiaarwgcdkttaarrlapagaiyfamdEDEVkRIFQHP----CCMVGSDGLPNDar  368
DSSP  lhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHhHHHHLL----LEEELLLLLLLLll


DSSP  LLLLLLL-HHHHHHHHHhhhLLLLhHHHHHHHHHHLHHHHHHHLlHHHL-LLLLLLLLLE
Query VPFGNGD-MVQGALIETqrlELKTnRDLGLIWKMITSEGARVLGiEKNY-GIEVGKKADL  366
ident                     |      |       |   ||| |          |  || 
Sbjct PHPRLWGsFTRVLGRYV--rEARL-MTLEQAVARMTALPARVFG-FAERgVLQPGAWADV  424
DSSP  LLLHHHHhHHHHHHHHH--hHLLL-LLHHHHHHHHLHHHHHHHL-LLLLlLLLLLLLLLE


DSSP  EEELLllhHHHH---------hhLLLEEEEEELLEEEEEllEELL-----------
Query VVLNSlspQWAI---------idQAKRLCVIKNGRIIVKdeVIVA-----------  402
ident ||                           |  ||          |           
Sbjct VVFDP---DTVAdratwdeptlaSVGIAGVLVNGAEVFP--QPPAdgrpgqvlrax  475
DSSP  EEELL---LLLLlllllllllllLLLEEEEEELLEEEEL--LLLLlllllllllll


No 19: Query=4cqbA Sbjct=3griA Z-score=26.2

back to top
DSSP  llleEEEEEEEEELL--LLEEEEEEEELLEEEEEELLLLLL-EEEEEELLLLLEEELEEE
Query skdfDLIIRNAYLSE--KDSVYDIGIVGDRIIKIEAKIEGT-VKDEIDAKGNLVSPGFVD   57
ident        | |            || | |  |  |   ||     | |||||  |||||||
Sbjct ----XKLIKNGKVLQngELQQADILIDGKVIKQIAPAIEPSnGVDIIDAKGHFVSPGFVD   56
DSSP  ----LEEEELLEEEEllEEEELEEEEELLEEEEEELLLLLLlLLEEEELLLLEEEELEEE


DSSP  EEELHHH-lLLLLlllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHL
Query AHTHMDK-sFTSTgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLH  116
ident  | |                                                        
Sbjct VHVHLREpgGEYK----------------------------------eTIETGTKAAARG   82
DSSP  EEELLLLllLLLL----------------------------------lLHHHHHHHHHHL


DSSP  LEEEEEEEE----ELLLlllLHHHHHHHHHHHHLLlLLEEEEEEEL--LLLLLLlllhHH
Query GTLYTRTHV----DVDSvakTKAVEAVLEAKEELKdLIDIQVVAFA--QSGFFVdlesES  170
ident |              ||       ||                 |                
Sbjct GFTTVCPXPntrpVPDS---VEHFEALQKLIDDNA-QVRVLPYASIttRQLGKE----LV  134
DSSP  LEEEEEELLllllLLLL---HHHHHHHHHHHHHHL-LLEELLLEELlhHHLLLL----LL


DSSP  HHHHHHHHLLLEEELLllllLLLLHHHHHHHHHHHHHHLLLEEEEEELL-----------
Query LIRKSLDMGCDLVGGVdpatRENNVEGSLDLCFKLAKEYDVDIDYHIHD-----------  219
ident         |                          |      |  |  |           
Sbjct DFPALVKEGAFAFTDD---gVGVQTASXXYEGXIEAAKVNKAIVAHCEDnsliyggaxhe  191
DSSP  LHHHHHLLLLLLEEEL---lLLLLLHHHHHHHHHHHHHHLLLEEELLLLhhhllllleel


DSSP  ------------lHHHHHHHHHHHHHHHHHLLLllLEEEEELLHHhhllhhhHHHHHHHH
Query ------------iGTVGVYSINRLAQKTIENGYkgRVTTSHAWCFadapsewLDEAIPLY  267
ident                     | |        |        |                   
Sbjct gkrskelgipgipNICESVQIARDVLLAEAAGC--HYHVCHVSTK-----esVRVIRDAK  244
DSSP  lhhhhhhllleelLHHHHHHHHHHHHHHHHHLL--LEEELLLLLH-----hhHHHHHHHH


DSSP  H-HHLLEEEEELLLLLL-----------------------LLLHHHHHHLLLEEEEELLL
Query K-DSGMKFVTCFSSTPP-----------------------TMPVIKLLEAGINLGCASDN  303
ident                                                |  |     | | 
Sbjct RaGIHVTAEVTPHHLLLteddipgnnaiykxnpplrstedREALLEGLLDGTIDCIATDH  304
DSSP  HlLLLEEEEELHHHHHLlhhhlllllhhhllllllllhhhHHHHHHHHHLLLLLEELLLL


DSSP  LLL------------LLLLlLLLL-HHHHHHHHHhhhllLLHHHHHHHHHHHLHHHHHHH
Query IRD------------FWVPfGNGD-MVQGALIETqrlelKTNRDLGLIWKMITSEGARVL  350
ident                                             |       |       
Sbjct APHardekaqpxekaPFGI-VGSEtAFPLLYTHF---vkNGDWTLQQLVDYLTIKPCETF  360
DSSP  LLLlhhhhlllllllLLLL-LLLLlHHHHHHHHH---llLLLLLHHHHHHHHLHHHHHHL


DSSP  LLHhHLLLLLLLLLLEEEELLL----------------lhhhhhHHLLLEEEEEELLEEE
Query GIEkNYGIEVGKKADLVVLNSL----------------spqwaiIDQAKRLCVIKNGRII  394
ident   |          |||                                        |   
Sbjct NLE-YGTLKENGYADLTIIDLDseqeikgedflskadntpfigyKVYGNPILTXVEGEVK  419
DSSP  LLL-LLLLLLLLLLLEEEEELLlleellhhhlllllllllllllEELLEEEEEEELLEEE


DSSP  EELleell
Query VKDeviva  402
ident         
Sbjct FEG-----  422
DSSP  EEL-----


No 20: Query=4cqbA Sbjct=1yrrB Z-score=25.4

back to top
DSSP  llleeEEEEEEEEL---LLLEEEEEEEELLEEEEEELL--LLLLEeEEEELLLLLEEELE
Query skdfdLIIRNAYLS---EKDSVYDIGIVGDRIIKIEAK--IEGTVkDEIDAKGNLVSPGF   55
ident                  |        |    |                    |   ||||
Sbjct -----YALTQGRIFtghEFLDDHAVVIADGLIKSVCPVaeLPPEI-EQRSLNGAILSPGF   54
DSSP  -----LEEELLEEElllLEELLEEEEEELLEEEEEEEHhhLLLLL-LEEELLLLEEEELE


DSSP  EEEEELHhhLLLLllllllllllllllhhhhhhhhhhhhhHLLHhHHHHHHHHHHHHHHH
Query VDAHTHMdkSFTStgerlpkfwsrpytrdaaiedglkyykNATHeEIKRHVIEHAHMQVL  115
ident  |                                       |                  
Sbjct IDVQLNG--CGGV-----------------------qfndTAEA-VSVETLEIMQKANEK   88
DSSP  EEEEELE--ELLE-----------------------elllLLLL-LLHHHHHHHHHHHHL


DSSP  LLEEEEEEEEELL-LLLLLHHHHHHHHHHHHLLlLLEEEEEEElLLLLlllLLHHHHHHH
Query HGTLYTRTHVDVD-SVAKTKAVEAVLEAKEELKdLIDIQVVAFaQSGFfvdLESESLIRK  174
ident  |                   |    |                                 
Sbjct SGCTNYLPTLITTsDELMKQGVRVMREYLAKHP-NQALGLHLE-GPWL--nAALVDFLCE  144
DSSP  LLEEEEEEEELLLlHHHHHHHHHHHHHHHHHLL-LLLLLEEEE-LLLL--lLHHHHHHHH


DSSP  HHhHLLLEEELlLLLLllllhhHHHHHHHHHHHhLLLEEEEEELLlhhHHHHHHHHHHHH
Query SLdMGCDLVGGvDPATrennveGSLDLCFKLAKeYDVDIDYHIHDigtVGVYSINRLAQK  234
ident         |    |               |||                            
Sbjct NA-DVITKVTL-APEM------VPAEVISKLAN-AGIVVSAGHSN---ATLKEAKAGFRA  192
DSSP  LH-HHEEEEEE-LHHH------LLHHHHHHHHH-HLLEEEELLLL---LLHHHHHHHHHH


DSSP  HhhllllllEEEEELL-hhhHLLHHHH--hhHHHHHHhhLLEEEEELL--LLLLLlLHHH
Query TiengykgrVTTSHAW-cfaDAPSEWL--deAIPLYKdsGMKFVTCFS--STPPTmPVIK  289
ident              |                 ||                           
Sbjct G-------iTFATHLYnampYITGREPglagAILDEA--DIYCGIIADglHVDYA-NIRN  242
DSSP  L-------eEEELLLLllllLLLLLLLhhhhHHHHLL--LLEEEEELLllLLLHH-HHHH


DSSP  HHHLLL-EEEEELLLLllllLLLLLlLHHHHHHHHHHHHLLllhhHHHHHHHHHLHHHHH
Query LLEAGI-NLGCASDNIrdfwVPFGNgDMVQGALIETQRLELktnrDLGLIWKMITSEGAR  348
ident         |    |             |  |               |     | |   ||
Sbjct AKRLKGdKLCLVTDAT----SGSSL-TMIEGVRNLVEHCGI----ALDEVLRMATLYPAR  293
DSSP  HHHHHHhHEEEELLLL----LLLLL-LHHHHHHHHHHHHLL----LHHHHHHHHLHHHHH


DSSP  HHLLHHHL-LLLLLLLLLEEEELLllhhhhhhhLLLEEEEEELLEEEEELleell
Query VLGIEKNY-GIEVGKKADLVVLNSlspqwaiidQAKRLCVIKNGRIIVKDeviva  402
ident   | ||       || | |                |    | ||   |       
Sbjct AIGVEKRLgTLAAGKVANLTAFTP---------DFKITKTIVNGNEVVTQ-----  334
DSSP  HLLLLLLLlLLLLLLLLLEEEELL---------LLLEEEEEELLEEEEEL-----


No 21: Query=4cqbA Sbjct=4b3zD Z-score=25.3

back to top
DSSP  llleEEEEEEEEELL--LLEEEEEEEELLEEEEEELLLLLL-EEEEEELLLLLEEELEEE
Query skdfDLIIRNAYLSE--KDSVYDIGIVGDRIIKIEAKIEGT-VKDEIDAKGNLVSPGFVD   57
ident      | |              |       |  |            | | |  | ||  |
Sbjct ---dRLLIKGGRIINddQSLYADVYLEDGLIKQIGENLIVPgGVKTIEANGRMVIPGGID   57
DSSP  ---lEEEEEEEEEELllLEEEEEEEEELLEEEEEELLLLLLlLLEEEELLLLEEEELEEE


DSSP  EEELHHHlLLLLlllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLL
Query AHTHMDKsFTSTgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHG  117
ident   |   |                                                    |
Sbjct VNTYLQK-TAAD-----------------------------------DFFQGTRAALVGG   81
DSSP  EEELLLL-LLLL-----------------------------------LHHHHHHHHHHLL


DSSP  EEEEEEEEELL-LLLLLHHHHHHHHHHHHLLlLLEEEEEEELLLLlllLLLHHHHHHHHH
Query TLYTRTHVDVD-SVAKTKAVEAVLEAKEELKdLIDIQVVAFAQSGffvDLESESLIRKSL  176
ident |     ||            |   ||        |        |                
Sbjct TTMIIDHVVPEpGSSLLTSFEKWHEAADTKS-CCDYSLHVDITSW---YDGVREELEVLV  137
DSSP  EEEEEEEELLLlLLLHHHHHHHHHHHHHLLL-LLEEEEEEELLLL---LLLHHHHHHHHH


DSSP  H-HLLLEEELLLllLLLL---LHHHHHHHHHHHHHHLLLEEEEEELL-------------
Query D-MGCDLVGGVDpaTREN---NVEGSLDLCFKLAKEYDVDIDYHIHD-------------  219
ident    |                      |   |   |     |  |                
Sbjct QdKGVNSFQVYM--AYKDvyqMSDSQLYEAFTFLKGLGAVILVHAENgdliaqeqkrile  195
DSSP  HlLLLLEEEEEL--LLLLlllLLHHHHHHHHHHHHHHLLEEEEELLLhhhhhhhhhhhhh


DSSP  -------------lHHHHHHHHHHHHHHHHHLLLllLEEEEELLhHHHLlhhhhhhHHHH
Query -------------iGTVGVYSINRLAQKTIENGYkgRVTTSHAWcFADApsewldeAIPL  266
ident                        |             |          |           
Sbjct mgitgpeghalsrpEELEAEAVFRAITIAGRINC--PVYITKVM-SKSA----adiIALA  248
DSSP  llllllhhhhhhllHHHHHHHHHHHHHHHHHHLL--LEEEEEEL-LHHH----hhhHHHH


DSSP  HH-HHLLEEEEELLLL------------------------------LLLL--LHHHHhhl
Query YK-DSGMKFVTCFSST------------------------------PPTM--PVIKLlea  293
ident  |            |                               |             
Sbjct RKkGPLVFGEPIAASLgtdgthywsknwakaaafvtspplspdpttPDYLtsLLACG---  305
DSSP  HHhLLLEEEEELHHHHhlllhhhhlllhhhhhhllllllllllllhHHHHhhHHHHL---


DSSP  lLEEEEELLLLLL---------------LLLLlLLLL-HHHHHHHHHhhhllLLHHHH-H
Query gINLGCASDNIRD---------------FWVPfGNGD-MVQGALIETqrlelKTNRDL-G  336
ident        |                                             |      
Sbjct -DLQVTGSGHCPYstaqkavgkdnftliPEGV-NGIEeRMTVVWDKA----vATGKMDeN  359
DSSP  -LLLLLLLLLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH----lLLLLLLhH


DSSP  HHHHHHLHHHHHHHLLHHHL-LLLLLLLLLEEEELL-----------------llhhhhh
Query LIWKMITSEGARVLGIEKNY-GIEVGKKADLVVLNS-----------------lspqwai  378
ident           |           | ||  || |                            
Sbjct QFVAVTSTNAAKIFNLYPRKgRIAVGSDADVVIWDPdklktitakshksaveynifegme  419
DSSP  HHHHHHLHHHHHHHLLLLLLlLLLLLLLLLEEEEEEeeeeelllllllllllllllllle


DSSP  HHLLlEEEEEELLEEEEELLEELL-----------------------------------
Query IDQAkRLCVIKNGRIIVKDEVIVA-----------------------------------  402
ident       | ||  | |   |  |                                     
Sbjct CHGS-PLVVISQGKIVFEDGNINVnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  EEEE-EEEEEELLEEEEELLEELLllllllllllllllhhhhhhhhhhhhhllllllll


No 22: Query=4cqbA Sbjct=3ooqA Z-score=25.1

back to top
DSSP  llleEEEEEEEEEL---LLLEEEEEEEELLEEEEEELLLLLLEEEEEELLLLLEEELEEE
Query skdfDLIIRNAYLS---EKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVD   57
ident          ||            |         |    ||       |  |    |||||
Sbjct ----KILFKNATVFpitSRPFKGDVLVSNGKVEKVGENIEDPDAEIVDLTGKFLFPGFVD   56
DSSP  ----LEEEEEEEELlllLLLEEEEEEEELLEEEEEELLLLLLLLEEEELLLLEEEELEEE


DSSP  EEELH-HHLLLLlllllLLLLlllllhhhHHHH-hhhhhhhllhhhHHHHhhHHHHHHHH
Query AHTHM-DKSFTStgerlPKFWsrpytrdaAIED-glkyyknatheeIKRHviEHAHMQVL  115
ident || |                                                        
Sbjct AHSHIgLFEEGV-----GYYY-----sdgNEATdpvtphvkaldgfNPQD--PAIERALA  104
DSSP  EEELLlLLLLLL-----LHHH-----lllLLLLllllllllhhhhlLLLL--HHHHHHHL


DSSP  LLEEEEEEEEE--lllllllhhhhhhhHHHHHLLllleeeeeeellllllllllhhhhhh
Query HGTLYTRTHVD--vdsvaktkaveavlEAKEELKdlidiqvvafaqsgffvdleseslir  173
ident  |                            ||                            
Sbjct GGVTSVXIVPGsanpvggqgsvikfrsIIVEECI--------------------------  138
DSSP  LLEEEEEELLLlllleeeeeeeeelllLLHHHHE--------------------------


DSSP  hhhhhLLLEEELLLLlLLLL--------------LHHHHHH-------------------
Query ksldmGCDLVGGVDPaTREN--------------NVEGSLD-------------------  200
ident                                      |                      
Sbjct ---vkDPAGLKXAFG-ENPKrvygerkqtpstrxGTAGVIRdyftkvknyxkkkelaqke  194
DSSP  ---eeEEEEEEEELL-HHHHhhhhhlllllllhhHHHHHHHhhhhhhhhhhhhhhhhhhl


DSSP  -----------hhHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHHHLLLllLEEEEEL
Query -----------lcFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTIENGYkgRVTTSHA  249
ident                           | |         |        | |        | 
Sbjct gkeftetdlkxevGEXVLRKKIPARXHAH-----RADDILTAIRIAEEFGF--NLVIEHG  247
DSSP  llllllllhhhhhHHHHHLLLLLEEEEEL-----LHHHHHHHHHHHHHHLL--LEEEEEL


DSSP  LHHHHllhhhhhhHHHHHHHHLLEEEEELLL---------lLLLLLHHHHHHLLLEEEEE
Query WCFADapsewldeAIPLYKDSGMKFVTCFSS---------tPPTMPVIKLLEAGINLGCA  300
ident                          |                      |||  |      
Sbjct TEAYK--------ISKVLAEKKIPVVVGPLLtfrtklelkdLTXETIAKLLKDGVLIALX  299
DSSP  LLHHH--------HHHHHHHHLLLEEELLLLlllllhhhllLLLLHHHHHHHLLLLEEEL


DSSP  LLLLllllllLLLL-LHHHHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHHLLHHHL-LL
Query SDNIrdfwvpFGNG-DMVQGALIETqRLELktnrDLGLIWKMITSEGARVLGIEKNY-GI  358
ident  |                  |     |             |  |   |  || |     |
Sbjct CDHP------VIPLeFATVQAATAX-RYGA----KEEDLLKILTVNPAKILGLEDRIgSI  348
DSSP  LLLL------LLLHhHHHHHHHHHH-HHLL----LHHHHHHLLLHHHHHHLLLLLLLlLL


DSSP  LLLLLLLEEEELLllhhHHHHHLLLEEEEEELLEEEEELLeell
Query EVGKKADLVVLNSlspqWAIIDQAKRLCVIKNGRIIVKDEviva  402
ident | || |||||                  |   |      |    
Sbjct EPGKDADLVVWSG----HPFDXKSVVERVYIDGVEVFRRE----  384
DSSP  LLLLLLLEEEELL----LLLLLLLLEEEEEELLEEEEELL----


No 23: Query=4cqbA Sbjct=3e74A Z-score=24.5

back to top
DSSP  llLEEEEEEEEEELL--LLEEEEEEEELLEEEEEELLLLLlEEEEEELLLLLEEELEEEE
Query skDFDLIIRNAYLSE--KDSVYDIGIVGDRIIKIEAKIEGtVKDEIDAKGNLVSPGFVDA   58
ident    ||||| |          | ||   |  |  |        |   || |  |||| |||
Sbjct --SFDLIIKNGTVILenEARVVDIAVKGGKIAAIGQDLGD-AKEVXDASGLVVSPGXVDA   57
DSSP  --LEEEEEELLEEELllLEEELEEEEELLEEEEEELLLLL-EEEEEELLLLEEEELEEEE


DSSP  EELHhhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLE
Query HTHMdksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGT  118
ident |||                                                       | 
Sbjct HTHI------------------------------------------GYETGTRAAAKGGI   75
DSSP  EELL------------------------------------------LHHHHHHHHHHLLE


DSSP  EEEEEEEE--lllllLLHHHHHHHHHHHHLLlLLEEEEEEELLllllllLLHHHHHHHHH
Query LYTRTHVD--vdsvaKTKAVEAVLEAKEELKdLIDIQVVAFAQsgffvdLESESLIRKSL  176
ident                     |    |       ||                         
Sbjct TTXIEXPLnqlpatvDRASIELKFDAAKGKL-TIDAAQLGGLV------SYNIDRLHELD  128
DSSP  EEEEELLLlllllllLHHHHHHHHHHHLLLL-LLEEEELEELL------LLLLLLHHHHH


DSSP  HHLLLEEELLLlllllllHHHHHHHHHHHHHHLLLEEEEEELL-----------------
Query DMGCDLVGGVDpatrennVEGSLDLCFKLAKEYDVDIDYHIHD-----------------  219
ident   |                            |       |                    
Sbjct EVGVVGFXCFV----rdvNDWQFFKGAQKLGELGQPVLVHCENalicdelgeeakregrv  184
DSSP  HHLLLLEEEEL----lllLHHHHHHHHHHHHHHLLLEEEELLLhhhhhhhhhhhhhhlll


DSSP  ---------lHHHHHHHHHHHHHHHHHLLLllLEEEEELLhHHHLlhhhhhhHHHHHH-H
Query ---------iGTVGVYSINRLAQKTIENGYkgRVTTSHAWcFADApsewldeAIPLYK-D  269
ident               |  | |        |   |    |                      
Sbjct tahdyvasrpVFTEVEAIRRVLYLAKVAGC--RLHVCHVS-SPEG----veeVTRARQeG  237
DSSP  lhhhhhhlllHHHHHHHHHHHHHHHHHHLL--LEEELLLL-LHHH----hhhHHHHHHlL


DSSP  HLLEEEEELLLL-------------------------LLLL--LHHHHhhllLEEEEELL
Query SGMKFVTCFSST-------------------------PPTM--PVIKLleagINLGCASD  302
ident        |                                                  ||
Sbjct QDITCESCPHYFvldtdqfeeigtlakcsppirdlenQKGXweKLFNG----EIDCLVSD  293
DSSP  LLEEEEELLHHHhllhhhhhhhlhhhllllllllhhhHHHHhhHHHLL----LLLEELLL


DSSP  LLLL------------LLLLlLLLL-HHHHHHHHHhhhllLLHHHHHHHHHHHLHHHHHH
Query NIRD------------FWVPfGNGD-MVQGALIETqrlelKTNRDLGLIWKMITSEGARV  349
ident                                  |      |    |    |      |  
Sbjct HSPCppexkagnixkaWGGI-AGLQsCXDVXFDEA---vqKRGXSLPXFGKLXATNAADI  349
DSSP  LLLLllllllllllllLLLL-LLHHhHHHHHHHHH---llLLLLLHHHHHHHHLHHHHHH


DSSP  HLlHHHL-LLLLLLLLLEEEELL-----------------llhhhhhHHLLlEEEEEELL
Query LGiEKNY-GIEVGKKADLVVLNS-----------------lspqwaiIDQAkRLCVIKNG  391
ident  |       |  || || |                            |        |  |
Sbjct FG-LQQKgRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrtIGAR-ITKTILRG  407
DSSP  LL-LLLLlLLLLLLLLLEEEEELllleellhhhllllllllllllleELLE-EEEEEELL


DSSP  EEEEELL-EELL----------
Query RIIVKDE-VIVA----------  402
ident   |   |               
Sbjct DVIYDIEqGFPVapkgqfilkh  429
DSSP  EEEEELLlLLLLllllleelll


No 24: Query=4cqbA Sbjct=2imrA Z-score=21.9

back to top
DSSP  llleEEEEEeEEEL----LLLEEEeEEEELLEEEEE---eLLLL--LLEEeeeelLLLL-
Query skdfDLIIRnAYLS----EKDSVYdIGIVGDRIIKI---eAKIE--GTVKdeidaKGNL-   50
ident                             ||                              
Sbjct ---hTPRLL-TCDVlytgAQSPGG-VVVVGETVAAAghpdELRRqyPHAA---eeRAGAv   52
DSSP  ---lLEEEE-EELEeellEELLEE-EEEELLEEEEEelhhHHHHhlLLLE---eeELLLe


DSSP  EEELEEEEEELHHHllllllllllllllllLLHHHHhhhhhhhhhhllhhHHHHHHHHHH
Query VSPGFVDAHTHMDKsftstgerlpkfwsrpYTRDAAiedglkyyknatheEIKRHVIEHA  110
ident   |  | |||| |                                              |
Sbjct IAPPPVNAHTHLDM-----------sayefQALPYF-qwipevvirgrhlRGVAAAQAGA  100
DSSP  ELLLLLEEEEELLL-----------lhhhhHHLHHH-hllhhhhhhhlllLHHHHHHHHH


DSSP  HHHHHLLEEEEEEEEElllllllhHHHHHHHhHHHLLlLLEEEEEEELllLLLL---lLL
Query HMQVLHGTLYTRTHVDvdsvaktkAVEAVLEaKEELKdLIDIQVVAFAqsGFFV---dLE  167
ident       |       |         | |                                |
Sbjct DTLTRLGAGGVGDIVW--------APEVMDA-LLARE-DLSGTLYFEV--LNPFpdkaDE  148
DSSP  HHHHHLLLLLEEEEEL--------LHHHHHH-HHLLL-LLLEEEEEEE--LLLLhhhhHH


DSSP  HHHHHHHHHHHL--------lLEEELLLLlLLLLlhHHHHHHHHHHHHHLLLEEEEEE-L
Query SESLIRKSLDMG--------cDLVGGVDPaTRENnvEGSLDLCFKLAKEYDVDIDYHI-H  218
ident      |  |                   |            |    |         |   
Sbjct VFAAARTHLERWrrlerpglrLGLSPHTP-FTVS--HRLMRLLSDYAAGEGLPLQIHVaE  205
DSSP  HHHHHHHHHHHHhlllllleeEEEEELLL-LLLL--HHHHHHHHHHHHHHLLLLEEEElL


DSSP  LLHHH---------------------------------hhHHHHHHHHHHhhllLLLLEE
Query DIGTV---------------------------------gvYSINRLAQKTiengYKGRVT  245
ident                                              |           | |
Sbjct HPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDELG---vLAARPT  262
DSSP  LHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHHHL---lHHHLLE


DSSP  EEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEEL
Query TSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCAS  301
ident   |               |      |   |||  |       |        ||       
Sbjct LVHMVNV-------TPDDIARVARAGCAVVTCPRSNhhleCGTFDWPAFAAAGVEVALGT  315
DSSP  EEELLLL-------LHHHHHHHHHHLLLEEELHHHHhhllLLLLLHHHHHHLLLLEEELL


DSSP  LLLLlllLLLLlLLHHHHHHHHHHHHLLllhHHHHHHHHHHLHHHHHHHLlhhHLLLLLL
Query DNIRdfwVPFGnGDMVQGALIETQRLELktnRDLGLIWKMITSEGARVLGiekNYGIEVG  361
ident |                      |        |           | || |         |
Sbjct DSVA---SGET-LNVREEVTFARQLYPG---LDPRVLVRAAVKGGQRVVG---TPFLRRG  365
DSSP  LLHH---HHLL-LLLHHHHHHHHHHLLL---LLHHHHHHHHHHHHHHHHL---LLLLLLL


DSSP  LLL-lEEEEllllhhhhhhhlLLEEeeeelleeeeelleell
Query KKA-dLVVLnslspqwaiidqAKRLcvikngriivkdeviva  402
ident                                           
Sbjct ETWqeGFRW------------ELSR---------------dl  380
DSSP  LLLlhHHLH------------HHLL---------------ll


No 25: Query=4cqbA Sbjct=1a4mA Z-score=21.5

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                        |  | 
Sbjct -----------------------------------------------tpafNKPKVELHV   13
DSSP  -----------------------------------------------llllLLLEEEEEE


DSSP  LHHHLLLLL-----------------LLLLLLLL--lLLLLHHHHHHHHHHHHHHL--LH
Query HMDKSFTST-----------------GERLPKFW--sRPYTRDAAIEDGLKYYKNA--TH   99
ident | |                        | |        |            |        
Sbjct HLDGAIKPEtilyfgkkrgialpadtVEELRNIIgmdKPLSLPGFLAKFDYYMPVIagCR   73
DSSP  EHHHLLLHHhhhhhhhhhllllllllHHHHHHHHlllLLLLHHHHHLLHHHHHHHHllLH


DSSP  HHHHHHHHHHHHHHHHLLEEEEEEEEELLLLL-----------------LLHHHHHHHHH
Query EEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVA-----------------KTKAVEAVLEA  142
ident | |||   |   |    |  |          |                     |  |   
Sbjct EAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLAnskvdpmpwnqtegdvtPDDVVDLVNQG  133
DSSP  HHHHHHHHHHHHHHHHLLEEEEEEEELLHHHLlllllllhhhlllllllHHHHHHHHHHH


DSSP  HHHLLL--LLEEEEEEELllLLLLLLlHHHHHHHHHHHL----LLEEELLLLLLLLLLHH
Query KEELKD--LIDIQVVAFAqsGFFVDLeSESLIRKSLDMG----CDLVGGVDPATRENNVE  196
ident   |      |                                           | |    
Sbjct LQEGEQafGIKVRSILCC--MRHQPS-WSLEVLELCKKYnqktVVAMDLAGDETIEGSSL  190
DSSP  HHHHHHhhLLEEEEEEEE--ELLLHH-HHHHHHHHHHHLllllEEEEEEELLLLLLLHHH


DSSP  H-hHHHHHHHHHHLLLEEEEE-ELLLhhhHHHHHHHHHHHhhhlllllLEEEEELLHHhh
Query G-sLDLCFKLAKEYDVDIDYH-IHDIgtvGVYSINRLAQKtiengykgRVTTSHAWCFad  254
ident           |         |                                |      
Sbjct FpgHVEAYEGAVKNGIHRTVHaGEVG---SPEVVREAVDI------lkTERVGHGYHT--  239
DSSP  LhhHHHHHHHHHHHLLEEEEEeLLLL---LHHHHHHHHHL------llLLEEEELHHH--


DSSP  llhhHHHHHHHHHHHHLLEEEEELLLL--------llLLLHHHHHHLLLEEEEELLLLLl
Query apseWLDEAIPLYKDSGMKFVTCFSST--------ppTMPVIKLLEAGINLGCASDNIRd  306
ident                  | |  |  |           |  |        |     |    
Sbjct ---iEDEALYNRLLKENMHFEVCPWSSyltgawdpktTHAVVRFKNDKANYSLNTDDPL-  295
DSSP  ---hHLHHHHHHHHHLLLEEEELHHHHhhllllllllLLHHHHHHHLLLLEEELLLLLL-


DSSP  lLLLLLlllHHHHHHHHHHHHLLllhhHHHHHHHHhLHHHHHHHL----LHHH---LLLL
Query fWVPFGngdMVQGALIETQRLELktnrDLGLIWKMiTSEGARVLG----IEKN---YGIE  359
ident                                         |          |        
Sbjct -IFKST---LDTDYQMTKKDMGF----TEEEFKRL-NINAAKSSFlpeeEKKElleRLYR  346
DSSP  -LLLLL---HHHHHHHHHHLLLL----LHHHHHHH-HHHHHHLLLllhhHHHHhhhHHHH


DSSP  lllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query vgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                            
Sbjct ----------------------------------------eyq  349
DSSP  ----------------------------------------hll


No 26: Query=4cqbA Sbjct=1a5kC Z-score=19.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -LLLEEEEEEEEEEL--LLLEEEEEEEELLEEEEEeLLLL------------LLEEEEEE
Query -SKDFDLIIRNAYLS--EKDSVYDIGIVGDRIIKIeAKIE------------GTVKDEID   45
ident      ||   ||           |||    ||  |  |              |     | 
Sbjct aADCVDLVLTNALIVdhWGIVKADIGVKDGRIFAI-GKAGnpdiqpnvtipiGAATEVIA  119
DSSP  hHHLLLEEEEEEEEEelLEEEEEEEEEELLEEEEE-ELEEllllllllleelLLLLEEEE


DSSP  LLLLLEEELEEEEEELHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhh
Query AKGNLVSPGFVDAHTHMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrh  105
ident | |  |  |  | | |                                            
Sbjct AEGKIVTAGGIDTHIHWI------------------------------------------  137
DSSP  LLLLEEEELEEEEEEELL------------------------------------------


DSSP  HHHHHHHHHHLLEEEEEE------------EEELllllLLHHHHHHHHHHHHLllLLEEE
Query VIEHAHMQVLHGTLYTRT------------HVDVdsvaKTKAVEAVLEAKEELkdLIDIQ  153
ident     |      |                                  | |   |     | 
Sbjct CPQQAEEALVSGVTTMVGggtgpaagthatTCTP----GPWYISRMLQAADSL--PVNIG  191
DSSP  LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL----HHHHHHHHHHHHLLL--LLEEE


DSSP  EEEELllLLLLlllhHHHHHHHHHHLLLEEELLLllLLLLlHHHHHHHHHHHHHHLLLEE
Query VVAFAqsGFFVdlesESLIRKSLDMGCDLVGGVDpaTRENnVEGSLDLCFKLAKEYDVDI  213
ident                    |     |                    |     | | |   
Sbjct LLGKG--NVSQ----PDALREQVAAGVIGLEIHE--DWGA-TPAAIDCALTVADEMDIQV  242
DSSP  EEEEL--LLLL----HHHHHHHHHHLLLEEEEEH--HHLL-LHHHHHHHHHHHHHHLLEE


DSSP  EEEELL--lhhHHHHHhHHHHHHHhhlllllLEEEEELLHhhhllhhhhhhhhhhHHHHL
Query DYHIHD--igtVGVYSiNRLAQKTiengykgRVTTSHAWCfadapsewldeaiplYKDSG  271
ident   |                               | |                       
Sbjct ALHSDTlnesgFVEDT-LAAIGGR-------TIHTFHTEG---aggghapdiitaCAHPN  291
DSSP  EEELLLlllllLHHHH-HHHHLLL-------LEEELLLLL---llllllllhhhhHHLLL


DSSP  LEEEEELLLL---------------------------------------LLLL--LHHHH
Query MKFVTCFSST---------------------------------------PPTM--PVIKL  290
ident                                                             
Sbjct ILPSSTNPTLpytlntidehldmlmvchhldpdiaedvafaesrirretIAAEdvLHDLG  351
DSSP  EEEEEEHHHLlllllhhhhhhhhhhhhhllllllhhhhhlllllllhhhHHHHhhHHHLL


DSSP  HhlllEEEEELLLLllllLLLLLLLHHHHHHHHHHhHLLL------------LHHHHHHH
Query LeagiNLGCASDNIrdfwVPFGNGDMVQGALIETQrLELK------------TNRDLGLI  338
ident           ||           |                             |      
Sbjct A----FSLTSSDSQ----AMGRVGEVILRTWQVAH-RMKVqrgalaeetgdnDNFRVKRY  402
DSSP  L----LLEEELLLL----LLLLLLLHHHHHHHHHH-HHHHhhllllllllllLHHHHHHH


DSSP  HHHHLHHHHHHHLLHHHL-LLLLLLLLLEEEELLllhHHHHhhlLLEEEEEELLEEEEEL
Query WKMITSEGARVLGIEKNY-GIEVGKKADLVVLNSlspQWAIidqAKRLCVIKNGRIIVKD  397
ident     |   |   ||      ||||| |||||              |   ||| | |    
Sbjct IAKYTINPALTHGIAHEVgSIEVGKLADLVVWSP---AFFG---VKPATVIKGGMIAIAP  456
DSSP  HHLLLHHHHHHLLLLLLLlLLLLLLLLLEEEELH---HHLL---LLLLEEEELLEEEEEE


DSSP  ---------------LEELL----------------------------------------
Query ---------------EVIVA----------------------------------------  402
ident                                                             
Sbjct mgdinasiptpqpvhYRPMFgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgc  516
DSSP  ellllllllllllleEEELHhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellll


DSSP  --------------------------------------------------
Query --------------------------------------------------  402
ident                                                   
Sbjct rtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  llllhhhllllllllleeelllllleeelleellllllllllllllllll


No 27: Query=4cqbA Sbjct=3k2gB Z-score=17.8

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                      |    | 
Sbjct --------------------------slselspchvrsgrixtvdgpipssalGHTLXHE   34
DSSP  --------------------------llllllllllllleeeelleeeehhhlLLEELLL


DSSP  LHHH----------------lllllLLLLLLL-LLLLLLhhhhhhhhhhhhhhllhhHHH
Query HMDK----------------sftstGERLPKF-WSRPYTrdaaiedglkyyknatheEIK  103
ident |                                                           
Sbjct HLQNdcrcwwnppqeperqylaeapISIEILSeLRQDPF----------vnkhnialDDL   84
DSSP  LLLEelhhhllllllhhhhhhhhllLLHHHHHhHHLLHH----------hllllleeLLH


DSSP  HHHHHHHHHHHHLLEEEEEEEEELLlllllhHHHHHHHHHHHLllLLEEEEEEELLLllL
Query RHVIEHAHMQVLHGTLYTRTHVDVDsvaktkAVEAVLEAKEELkdLIDIQVVAFAQSgfF  163
ident    |         |                           |          |       
Sbjct DLAIAEVKQFAAVGGRSIVDPTCRG---igrDPVKLRRISAET--GVQVVXGAGYYL--A  137
DSSP  HHHHHHHHHHHHLLLLEEEELLLLL---lllLHHHHHHHHHHH--LLEEEELLLLLL--H


DSSP  LLLL----------hhHHHHHHHH-------HLLLEEE-LLLLLLLLLLHHHHHHHHHHH
Query VDLE----------seSLIRKSLD-------MGCDLVG-GVDPATRENNVEGSLDLCFKL  205
ident                   |                | |            | ||      
Sbjct SSXPetaarlsaddiaDEIVAEALegtdgtdARIGLIGeIGVSSDFTAEEEKSLRGAARA  197
DSSP  HHLLhhhhlllhhhhhHHHHHHHHlllllllLLLLLEEeELLLLLLLHHHHHHHHHHHHH


DSSP  HHHLLLEEEEEELLLHhhhhHHHHHHHHHHHHLL-LLLLEEEEELLHHHHllhhHHHHHH
Query AKEYDVDIDYHIHDIGtvgvYSINRLAQKTIENG-YKGRVTTSHAWCFADapseWLDEAI  264
ident           |             |      | |         |                
Sbjct QVRTGLPLXVHLPGWF----RLAHRVLDLVEEEGaDLRHTVLCHXNPSHX----DPVYQA  249
DSSP  HHHHLLLEEELLLLLL----LLHHHHHHHHHHLLlLHHHEEELLLHHHLL----LHHHHH


DSSP  HHHHHhLLEEEE-ELLL------------lLLLL--LHHHHHHLLL--EEEEELLLLlLL
Query PLYKDsGMKFVT-CFSS------------tPPTM--PVIKLLEAGI--NLGCASDNIrDF  307
ident  |    |                                 |   |         |     
Sbjct TLAQR-GAFLEFdXIGXdffyadqgvqcpsDDEVarAILGLADHGYldRILLSHDVF-VK  307
DSSP  HHHHH-LLEEEElLLLLlleelllleelllHHHHhhHHHHHHHLLLhhHEEELLLLL-LH


DSSP  LL-----LLLLLLHH-HHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHhLLHHHllllll
Query WV-----PFGNGDMV-QGALIETqRLELktnrDLGLIWKMITSEGARVlGIEKNygievg  361
ident          |              |  |    |             ||            
Sbjct XXltrygGNGYAFVTkHFLPRLR-RHGL----DDAALETLXVTNPRRV-FDASI------  355
DSSP  HHlhhhlLLLLLHHHhLHHHHHH-HLLL----LHHHHHHHHLHHHHHH-HLLLL------


DSSP  lllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query kkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                          
Sbjct --------------------------------------egh  358
DSSP  --------------------------------------lll


No 28: Query=4cqbA Sbjct=1bf6A Z-score=17.5

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
ident                                                      |   || 
Sbjct ------------------------------------------------sfdpTGYTLAHE   12
DSSP  ------------------------------------------------llllLLEEEEEE


DSSP  LHHHllllllllllllllllllhhhhhhhHHHH-hhhllhhhHHHHHHHHHHHHHHLLEE
Query HMDKsftstgerlpkfwsrpytrdaaiedGLKY-yknatheeIKRHVIEHAHMQVLHGTL  119
ident |                                                        |  
Sbjct HLHI------------------------dLSGFknnvdcrldQYAFICQEMNDLMTRGVR   48
DSSP  LLLE------------------------eLHHHhllhhheelLHHHHHHHHHHHHHLLEE


DSSP  EEEEEEELLlllllhHHHHhhHHHHHLLL--LLEEEEEEELLLLllLLLL--------hH
Query YTRTHVDVDsvaktkAVEAvlEAKEELKD--LIDIQVVAFAQSGffVDLE--------sE  169
ident                   |             |                           
Sbjct NVIEMTNRY-----mGRNA--QFMLDVMRetGINVVACTGYYQDafFPEHvatrsvqelA  101
DSSP  EEEELLLHH-----hLLLH--HHHHHHHHhhLLEEEEEELLLLHhhLLLHhhhllhhhhH


DSSP  HHHHHHHHH-------LLLEEE-LLLLL-LLLLLHHHHHHHHHHHHHHLLLEEEEEELLL
Query SLIRKSLDM-------GCDLVG-GVDPA-TRENNVEGSLDLCFKLAKEYDVDIDYHIHDI  220
ident                                    |                |  |    
Sbjct QEMVDEIEQgidgtelKAGIIAeIGTSEgKITPLEEKVFIAAALAHNQTGRPISTHTSFS  161
DSSP  HHHHHHHHLlllllllLEEEEEeEELLLlLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH


DSSP  hhhhhhHHHHHHHHHHHLL-LLLLEEEEELLHHHhllhhhHHHHHHHHHHHLLEEEE-EL
Query gtvgvySINRLAQKTIENG-YKGRVTTSHAWCFAdapsewLDEAIPLYKDSGMKFVT-CF  278
ident                   |    |||  |               |    | |        
Sbjct -----tMGLEQLALLQAHGvDLSRVTVGHCDLKD------NLDNILKMIDLGAYVQFdTI  210
DSSP  -----lLHHHHHHHHHHLLlLHHHEEELLLLLLL------LHHHHHHHHHLLLEEEElLL


DSSP  LL----lLLLL--LHHHHH-HLLL-EEEEELLLLlLLLLL----LLLLL-HHHHhhHHHH
Query SS----tPPTM--PVIKLL-EAGI-NLGCASDNIrDFWVP----FGNGD-MVQGalIETQ  325
ident                  |             |                |          |
Sbjct GKnsyypDEKRiaMLHALRdRGLLnRVMLSMDIT-RRSHLkangGYGYDyLLTT--FIPQ  267
DSSP  LLlllllHHHHhhHHHHHHhLLLHhHEEELLLLL-LHHHLhhhlLLLLLhHHHL--HHHH


DSSP  HHLLLlhhHHHHHHHHHLHHHHHHHLlhhhlllllllllleeeellllhhhhhhhlllee
Query RLELKtnrDLGLIWKMITSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrl  385
ident                |                                            
Sbjct LRQSG--fSQADVDVMLRENPSQFFQ----------------------------------  291
DSSP  HHHLL--lLHHHHHHHHLHHHHHHLL----------------------------------


DSSP  eeeelleeeeelleell
Query cvikngriivkdeviva  402
ident                  
Sbjct -----------------  291
DSSP  -----------------


No 29: Query=4cqbA Sbjct=2ob3A Z-score=17.5

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                      ||   | 
Sbjct --------------------------------------drintvrgpitiseaGFTLTHE   22
DSSP  --------------------------------------lleeelleeelhhhhLLEEEEE


DSSP  LHHHllllllllllllllllllhhhhhhhHHHH-HHHL----LHHHHHHHHHHHHHHHHH
Query HMDKsftstgerlpkfwsrpytrdaaiedGLKY-YKNA----THEEIKRHVIEHAHMQVL  115
ident |                                                           
Sbjct HICG------------------------sSAGFlRAWPeffgSRKALAEKAVRGLRRARA   58
DSSP  LLEE------------------------lLLLHhHHLHhhhlLHHHHHHHHHHHHHHHHH


DSSP  LLEEEEEEEEELLlllllhHHHHHHHHHHHLllLLEEEEEEELLLLllLLLL--------
Query HGTLYTRTHVDVDsvaktkAVEAVLEAKEELkdLIDIQVVAFAQSGffVDLE--------  167
ident  |          |       |    |          |             |         
Sbjct AGVRTIVDVSTFD---igrDVSLLAEVSRAA--DVHIVAATGLWFD--PPLSmrlrsvee  111
DSSP  LLLLEEEELLLHH---hllLHHHHHHHHHHH--LLEEELEEELLLL--LLHHhhlllhhh


DSSP  hHHHHHHHHH-------HLLLEEELLLLLLLLLLHHHHHHHHHHHHHHLLLEEEEEElLL
Query sESLIRKSLD-------MGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIhDI  220
ident                                    |  |           |    |    
Sbjct lTQFFLREIQygiedtgIRAGIIXVATTGKATPFQELVLKAAARASLATGVPVTTHT-AA  170
DSSP  hHHHHHHHHHlllllllLLLLEEEEELLLLLLHHHHHHHHHHHHHHHHHLLLEEEEL-LH


DSSP  HHhhhHHHHHHHHHHHHLLLL-LLEEEEELLHHHhllhhHHHHHHHHHHHhLLEEEE-EL
Query GTvgvYSINRLAQKTIENGYK-GRVTTSHAWCFAdapseWLDEAIPLYKDsGMKFVT-CF  278
ident            |      |    ||   |           |     |    |        
Sbjct SQ---RDGEQQAAIFESEGLSpSRVCIGHSDDTD-----DLSYLTALAAR-GYLIGLdHI  221
DSSP  HH---LHHHHHHHHHHHLLLLhHHEEELLHHHLL-----LHHHHHHHHHL-LLEEEElLL


DSSP  LL------------------lLLLL--LHHHHHHLLL--EEEEELLLLLLL---------
Query SS------------------tPPTM--PVIKLLEAGI--NLGCASDNIRDF---------  307
ident                        |       |   |         |    |         
Sbjct PYsaiglednasasallgirsWQTRalLIKALIDQGYmkQILVSNDWTFGFssyvtnimd  281
DSSP  LLllllllllhhhhhhhllllHHHHhhHHHHHHHLLLhhHEEELLLLLLEEllllllhhh


DSSP  ---llLLLLLL-HHHHHHHHHhhHLLLlhhHHHHHHHHHLHHHHHHHLlhhhllllllll
Query ---wvPFGNGD-MVQGALIETqrLELKtnrDLGLIWKMITSEGARVLGieknygievgkk  363
ident                         |                  || |             
Sbjct vmdrvNPDGMAfIPLRVIPFL--REKG--vPQETLAGITVTNPARFLS------------  325
DSSP  hhhhhLLLHHHhHHHLHHHHH--HHLL--lLHHHHHHHHLHHHHHHHL------------


DSSP  lleeeellllhhhhhhhllleeeeeelleeeeelleell
Query adlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                        
Sbjct -----------------------------------ptlr  329
DSSP  -----------------------------------llll


No 30: Query=4cqbA Sbjct=3cjpA Z-score=17.3

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                         | ||
Sbjct -----------------------------------------------------LIIDGHT    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LHhhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHH-HHHHHHHLLEE
Query HMdksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIE-HAHMQVLHGTL  119
ident |                                              | |       |  
Sbjct HV-----------------------------------------iLPVEkHIKIMDEAGVD   26
DSSP  EL-----------------------------------------lLLHHhHHHHHHHHLLL


DSSP  EEEEEEE-----------------------------lLLLLLLHHHHHHHHHHHHLLllL
Query YTRTHVD-----------------------------vDSVAKTKAVEAVLEAKEELKdlI  150
ident  |                                                          
Sbjct KTILFSTsihpetavnlrdvkkemkklndvvngktnsMIDVRRNSIKELTNVIQAYP--S   84
DSSP  EEEEELLlllhhhlllhhhhhhhhhhhhhhhllllllLHHHHHHHHHHHHHHHHHLL--L


DSSP  EEEEEEELllLLLL-lLLHHHHHHHHH-HHLLLEEE-LLLLLlllLLHHHhHHHHHHHHH
Query DIQVVAFAqsGFFV-dLESESLIRKSL-DMGCDLVG-GVDPAtreNNVEGsLDLCFKLAK  207
ident                     | |            |               |   ||   
Sbjct RYVGFGNV--PVGLseNDTNSYIEENIvNNKLVGIGeLTPAS---GQIKS-LKPIFKYSM  138
DSSP  LEEEEELL--LLLLlhHHHHHHHHHHLlLLLLLEEEeELLLL---LLHHH-HHHHHHHHH


DSSP  HLL-LEEEEEELLLhhHHHHHHHHHHHHHHHLLLllLEEEEE-LLHHhhllhhhhhHHHH
Query EYD-VDIDYHIHDIgtVGVYSINRLAQKTIENGYkgRVTTSH-AWCFadapsewldEAIP  265
ident       |  |           |   |           |   |               |  
Sbjct DSGsLPIWIHAFNP--LVLQDIKEIAELCKAFPK-vPVILGHmGGSN-------wmTAVE  188
DSSP  HLLlLLEEELLLLL--LLHHHHHHHHHHHHHLLL-lLEEEHHhHHHH-------hhHHHH


DSSP  HHHHHL-LEEEEEllLLLLLLLHHHHHHLL-LEEEEELLLLllllllLLLLLhhHHHHHH
Query LYKDSG-MKFVTCfsSTPPTMPVIKLLEAG-INLGCASDNIrdfwvpFGNGDmvQGALIE  323
ident | |        |       |                  |        ||           
Sbjct LAKEIQnLYLDTS--AYFSTFVLKIVINELpLKCIFGTDMP------FGDLQ--LSIEAI  238
DSSP  HHHHLLlEEEELL--LLLLHHHHHHHHHHLlLLEELLLLLL------LLLHH--HHHHHH


DSSP  HHHhllllhHHHHHHHHHHLHHHHHHHLLhhhlllllllllleeeellllhhhhhhhlll
Query TQRlelktnRDLGLIWKMITSEGARVLGIeknygievgkkadlvvlnslspqwaiidqak  383
ident           |             | | |                               
Sbjct KKM-----sNDSYVANAVLGDNISRLLNI-------------------------------  262
DSSP  HHH-----lLLHHHHHHHHLHHHHHHHLL-------------------------------


DSSP  eeeeeelleeeeelleell
Query rlcvikngriivkdeviva  402
ident                    
Sbjct -------------------  262
DSSP  -------------------


No 31: Query=4cqbA Sbjct=3gg7A Z-score=17.2

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                         | | 
Sbjct -----------------------------------------------------SLIDFHV    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LHHHLLllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEeE
Query HMDKSFtstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTlY  120
ident | |                                              |          
Sbjct HLDLYP--------------------------------------DPVAVARACEERQL-T   28
DSSP  LHHHLL--------------------------------------LHHHHHHHHHHLLL-E


DSSP  EEEEEELllllllHHHHHHHHHHHHLlllLEEEEEEELL-LLLLLLLLHHHHHHHHHHhL
Query TRTHVDVdsvaktKAVEAVLEAKEELkdlIDIQVVAFAQ-SGFFVDLESESLIRKSLDmG  179
ident               |    |                                    |   
Sbjct VLSVTTT-----pAAWRGTLALAAGR---PHVWTALGFHpEVVSERAADLPWFDRYLP-E   79
DSSP  EEELLLL-----hHHHHHHHHHHLLL---LLEEELLLLLhHHLLLLHHHLHHHHHHHH-H


DSSP  LLEEE-LLLLLL-----LLLLHHHHHHHHHHHHHHL-LLEEEEEELLlhhhhhhHHHHHH
Query CDLVG-GVDPAT-----RENNVEGSLDLCFKLAKEY-DVDIDYHIHDigtvgvySINRLA  232
ident    ||                                      |                
Sbjct TRFVGeVGLDGSpslrgTWTQQFAVFQHILRRCEDHgGRILSIHSRR-------AESEVL  132
DSSP  LLEEEeEELLLLhhhhhHHHHHHHHHHHHHHHHHHLlLEEEEEELLL-------LHHHHH


DSSP  HHHHHLLLllLEEEEELLHhhhllhhhHHHHHHHHHHHLLEEEEeLLLL--LLLL--LHH
Query QKTIENGYkgRVTTSHAWCfadapsewLDEAIPLYKDSGMKFVTcFSST--PPTM--PVI  288
ident      |                                |  |                  
Sbjct NCLEANPRsgTPILHWYSG--------SVTELRRAISLGCWFSV-GPTMvrTQKGaaLIR  183
DSSP  HHHHHLHHheEEEEELLLL--------LHHHHHHHHHLLLEEEE-LHHHhlLHHHhhHHH


DSSP  HHHhlLLEEEEELLLLlllLLLL----LLLL-HHHHHHHHHHhHLLLlhhHHHHHHHHHL
Query KLLeaGINLGCASDNIrdfWVPF----GNGD-MVQGALIETQrLELKtnrDLGLIWKMIT  343
ident              |                                              
Sbjct SMP--RDRVLTETDGP---FLELdgqaALPWdVKSVVEGLSK-IWQI---PASEVERIVK  234
DSSP  HLL--HHHEEELLLLL---LLEElleeLLHHhHHHHHHHHHH-HHLL---LHHHHHHHHH


DSSP  HHHHHhhLLHHhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query SEGARvlGIEKnygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident     |                                                      
Sbjct ENVSR--LLGT------------------------------------------------  243
DSSP  HHHHH--HHHL------------------------------------------------


No 32: Query=4cqbA Sbjct=2vc5A Z-score=17.1

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                      ||   | 
Sbjct -------------------------------------mriplvgkdsieskdiGFTLIHE   23
DSSP  -------------------------------------llllllllllllhhhlLLEELLL


DSSP  LHHHllllllllllllllllllhhhhhhHHHHHHH----HLLHHHHHHHHHHHHHHHHHL
Query HMDKsftstgerlpkfwsrpytrdaaieDGLKYYK----NATHEEIKRHVIEHAHMQVLH  116
ident |                                           |  |            
Sbjct HLRV------------------------FSEAVRQqwphLYNEDEEFRNAVNEVKRAMQF   59
DSSP  LLLL------------------------LLHHHHHhlhhHLLHHHHHHHHHHHHHHHHHL


DSSP  LEEEEEEEEELLlllllhHHHHHHHHHHHLLllLEEEEEEELLLLlLLLLL---------
Query GTLYTRTHVDVDsvaktkAVEAVLEAKEELKdlIDIQVVAFAQSGfFVDLE---------  167
ident |                                |                          
Sbjct GVKTIVDPTVMG---lgrDIRFMEKVVKATG--INLVAGTGIYIY-IDLPFyflnrside  113
DSSP  LLLEEEELLLLL---lllLHHHHHHHHHLLL--LEEEELEELLLL-LLLLHhhllllhhh


DSSP  hHHHHHHHHH-------HLLLEEELLLLLLLLLL-HHHHHHHHHHHHHHLLLEEEEEElL
Query sESLIRKSLD-------MGCDLVGGVDPATRENN-VEGSLDLCFKLAKEYDVDIDYHIhD  219
ident    |                  |            ||          ||  | |  |   
Sbjct iADLFIHDIKegiqgtlNKAGFVXIAADEPGITKdVEKVIRAAAIANKETKVPIITHS-N  172
DSSP  hHHHHHHHHHlllllllLLLLLEEEELLLLLLLHhHHHHHHHHHHHHHHHLLLEEEEL-L


DSSP  LHHhhhHHHHHHHHHHHHLL-LLLLEEEEELLHHHhllhhHHHHHHHHHHHhLLEEEE-E
Query IGTvgvYSINRLAQKTIENG-YKGRVTTSHAWCFAdapseWLDEAIPLYKDsGMKFVT-C  277
ident                  | |   |     |            |         |       
Sbjct AHN---NTGLEQQRILTEEGvDPGKILIGHLGDTD-----NIDYIKKIADK-GSFIGLdR  223
DSSP  LLL---LHHHHHHHHHHHLLlLHHHEEELLHHHLL-----LHHHHHHHHHL-LLEEEElL


DSSP  LLL----lLLLL--LHHHHHHLLL--EEEEELLLL-LLLL-----------llLLLLLhh
Query FSS----tPPTM--PVIKLLEAGI--NLGCASDNI-RDFW-----------vpFGNGDmv  317
ident                   |   |         |      |                    
Sbjct YGLdlflpVDKRneTTLRLIKDGYsdKIMISHDYCcTIDWgtakpeykpklapRWSIT--  281
DSSP  LLLlllllHHHHhhHHHHHHHLLLllLEEELLLLLlLLLLllllhhhhhhhllLLLLL--


DSSP  HHHHHHHHHhlLLLHHHHHHHHHHHLHHhHHHHLLhhhlllllllllleeeellllhhhh
Query QGALIETQRleLKTNRDLGLIWKMITSEgARVLGIeknygievgkkadlvvlnslspqwa  377
ident                     |                                       
Sbjct LIFEDTIPF-lKRNGVNEEVIATIFKEN-PKKFFS-------------------------  314
DSSP  HHHHLHHHH-hHLLLLLHHHHHHHHLHH-HHHHLL-------------------------


DSSP  hhhllleeeeeelleeeeelleell
Query iidqakrlcvikngriivkdeviva  402
ident                          
Sbjct -------------------------  314
DSSP  -------------------------


No 33: Query=4cqbA Sbjct=2y1hB Z-score=16.8

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                      | || | 
Sbjct ---------------------------------------------------GVGLVDCHC    9
DSSP  ---------------------------------------------------LLLEEEEEE


DSSP  LHHH-LLLLllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEE
Query HMDK-SFTStgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTL  119
ident |     |                                                     
Sbjct HLSApDFDR------------------------------------DLDDVLEKAKKANVV   33
DSSP  LLLLhHHLL------------------------------------LHHHHHHHHHHLLEE


DSSP  EEEEEEELlllllLHHHHHHHHHHHHLLllLEEEEEEELLLL-----lLLLLLHHHHHHH
Query YTRTHVDVdsvakTKAVEAVLEAKEELKdlIDIQVVAFAQSG-----fFVDLESESLIRK  174
ident                  |      |                        | |        
Sbjct ALVAVAEH-----SGEFEKIMQLSERYN--GFVLPCLGVHPVqgldqrSVTLKDLDVALP   86
DSSP  EEEELLLL-----HHHHHHHHHHHHHLL--LLEEEEELLLLEelllleELLHHHHHHHHH


DSSP  HHHHL---LLEE-ELLLLLL--------lLLLHHHHHHHHHHHHHHLLLEEEEEELLlhh
Query SLDMG---CDLV-GGVDPAT--------rENNVEGSLDLCFKLAKEYDVDIDYHIHDigt  222
ident                                     |     |||        |      
Sbjct IIENYkdrLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSRS---  143
DSSP  HHHHHlllLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEEL---


DSSP  hhhhHHHHHHHHHHHLLLLlLEEEEELLHhhhllhhhHHHHHHHHHHHLLEEEEELLL-l
Query vgvySINRLAQKTIENGYKgRVTTSHAWCfadapsewLDEAIPLYKDSGMKFVTCFSS-t  281
ident               | |    |                          |  |    |   
Sbjct ----AGRPTINLLQEQGAE-KVLLHAFDG--------RPSVAMEGVRAGYFFSIPPSIir  190
DSSP  ----LHHHHHHHHHHLLLL-LEEEELLLL--------LHHHHHHHHHLLLEEEELHHHhl


DSSP  LLLL--LHHHHHhllLEEEEELLLL--lllllLLLLLL-HHHHHHHHHhhHLLLlhHHHH
Query PPTM--PVIKLLeagINLGCASDNI--rdfwvPFGNGD-MVQGALIETqrLELKtnRDLG  336
ident        |  |           |                    |                
Sbjct SGQKqkLVKQLP--lTSICLETDSPalgpekqVRNEPWnISISAEYIA--QVKG--ISVE  244
DSSP  LHHHhhHHHHLL--hHHEEELLLLLlllllllLLLLHHhHHHHHHHHH--HHHL--LLHH


DSSP  HHHHhhlHHHHHHHL----LHHHlllllllllleeeellllhhhhhhhllleeeeeelle
Query LIWKmitSEGARVLG----IEKNygievgkkadlvvlnslspqwaiidqakrlcvikngr  392
ident              |                                              
Sbjct EVIE---VTTQNALKlfpkLRHL-------------------------------------  264
DSSP  HHHH---HHHHHHHHhlllHHHH-------------------------------------


DSSP  eeeelleell
Query iivkdeviva  402
ident           
Sbjct ---------l  265
DSSP  ---------l


No 34: Query=4cqbA Sbjct=2ffiA Z-score=16.1

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
ident                                                         | | 
Sbjct --------------------------------------------------lhLTAIDSHA   10
DSSP  --------------------------------------------------llLLLEELLL


DSSP  LHHhllllllllllllllllllhhhhhHHHHHHhhhllhhhhhhHHHHHHHHHHHLLEEE
Query HMDksftstgerlpkfwsrpytrdaaiEDGLKYyknatheeikrHVIEHAHMQVLHGTLY  120
ident |                               |                      ||   
Sbjct HVF--------------srglnlasqrRYAPNY---------daPLGDYLGQLRAHGFSH   47
DSSP  LLL--------------lhhhhhhlllLLLLLL---------llLHHHHHHHHHHLLLLE


DSSP  EEEEEEllllLLLHhHHHHHHHHHHLLllLEEEEEEELlllllllllHHHHhHHHHHHL-
Query TRTHVDvdsvAKTKaVEAVLEAKEELKdlIDIQVVAFAqsgffvdleSESLiRKSLDMG-  179
ident             |      | |            |                    |    
Sbjct GVLVQP--sfLGTD-NRYLLSALQTVP--GQLRGVVXL---------ERDVeQATLAEXa   93
DSSP  ELLLLL--hhHLLL-LHHHHHHHHHLL--LLLLLLLLL---------LLLLlHHHHHHHh


DSSP  ---LLEEELLLlLLLLlLHHH---hhHHHHHHHHHLLLEEEEEElllhhhHHHHHHHHHH
Query ---CDLVGGVDpATREnNVEG---slDLCFKLAKEYDVDIDYHIhdigtvGVYSINRLAQ  233
ident       |                           |       |        |  |  |  
Sbjct rlgVRGVRLNL-XGQD-XPDLtgaqwRPLLERIGEQGWHVELHR------QVADIPVLVR  145
DSSP  lllLLEEELLL-LLLL-LLLLlllllHHHHHHHHHHLLEEEELL------LLLLHHHHHH


DSSP  HHHHLLLllLEEEEEL-LHHHHLLHHH--HHHHHHHHHHHLLEEEEELLL--------lL
Query KTIENGYkgRVTTSHA-WCFADAPSEW--LDEAIPLYKDSGMKFVTCFSS--------tP  282
ident      |        |     |          |   |                        
Sbjct ALQPYGL--DIVIDHFgRPDARRGLGQpgFAELLTLSGRGKVWVKVSGIYrlqgspeenL  203
DSSP  HHLLLLL--LEEELHHhLLLLLLLLLLllHHHHLLLLLLLLEEEEEELHHhllllhhhhH


DSSP  LLL--LHHHHHHLLL--EEEEELLLLLLLLL-LLLLllhhHHHHHHHhHHLLllhhHHHH
Query PTM--PVIKLLEAGI--NLGCASDNIRDFWV-PFGNgdmvQGALIETqRLELktnrDLGL  337
ident          |        |   ||                         |         |
Sbjct AFArqALCALEAHYGaeRLXWGSDWPHTQHEsEVSF---gSAVEQFE-ALGC----SAQL  255
DSSP  HHHhhHHHHHHHHLLhhHEEEELLLLLLLLLlLLLH---hHHHHHHH-HHLL----LHHH


DSSP  HHHHHLHHHHHhHLLHHHLllllllllleeeellllhhhhhhhllleeeeeelleeeeel
Query IWKMITSEGARvLGIEKNYgievgkkadlvvlnslspqwaiidqakrlcvikngriivkd  397
ident             |                                               
Sbjct RQALLLDTARA-LFGFELE-----------------------------------------  273
DSSP  HHHHHLHHHHH-HLLLLLL-----------------------------------------


DSSP  leell
Query eviva  402
ident      
Sbjct -----  273
DSSP  -----


No 35: Query=4cqbA Sbjct=2dvtA Z-score=15.5

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                      | |    
Sbjct ---------------------------------------------------MQGKVALEE    9
DSSP  ---------------------------------------------------LLLEEEEEE


DSSP  LHHH------lllLLLLlLLLLLlllllhhhhhhhhhhhhhhllhhhhhHHHH-HHHHHH
Query HMDK------sftSTGErLPKFWsrpytrdaaiedglkyyknatheeikRHVI-EHAHMQ  113
ident |                                                           
Sbjct HFAIpetlqdsagFVPG-DYWKE---------------------lqhrlLDIQdTRLKLM   47
DSSP  EELLhhhhhhhllLLLL-LHHHH---------------------hhhhhHLLLlHHHHHH


DSSP  HHLLEEEEEEEE-----------elLLLLLLHHHHHHHHHHHHLLllLEEEEEEELllLL
Query VLHGTLYTRTHV-----------dvDSVAKTKAVEAVLEAKEELKdlIDIQVVAFAqsGF  162
ident   ||                            |     |              |      
Sbjct DAHGIETMILSLnapavqaipdrrkAIEIARRANDVLAEECAKRP--DRFLAFAAL--PL  103
DSSP  HHLLEEEEEEEElllhhhhlllhhhHHHHHHHHHHHHHHHHHHLL--LLEEEEELL--LL


DSSP  LLLLLHHHHHHHHHH-HLLLEEELLLL----llllLLHHH--hhHHHHHHHHHLLLEEEE
Query FVDLESESLIRKSLD-MGCDLVGGVDP----atreNNVEG--slDLCFKLAKEYDVDIDY  215
ident                  |                                    ||    
Sbjct QDPDAATEELQRCVNdLGFVGALVNGFsqegdgqtPLYYDlpqyRPFWGEVEKLDVPFYL  163
DSSP  LLHHHHHHHHHHHHHlLLLLEEEEELLllllllllLLLLLlhhhHHHHHHHHHHLLLEEE


DSSP  EEL----------------------LLHHhHHHHHHHHHH--HHHHLLLLlLEEEEE-LL
Query HIH----------------------DIGTvGVYSINRLAQ--KTIENGYKgRVTTSH-AW  250
ident |                                   ||       |          |   
Sbjct HPRnplpqdsriydghpwllgptwaFAQE-TAVHALRLMAsgLFDEHPRL-NIILGHmGE  221
DSSP  ELLlllhhhlhhhlllhhhlhhhlhHHHH-HHHHHHHHHHllHHHHLLLL-LEEELHhHL


DSSP  HHhhllhhHHHH-------------------HHHHHHhHLLEEEEElLLLLLLLlHHHHH
Query CFadapseWLDE-------------------AIPLYKdSGMKFVTCfSSTPPTMpVIKLL  291
ident                                             |           |   
Sbjct GL----pyMMWRidhrnawvklpprypakrrFMDYFN-ENFHITTS-GNFRTQT-LIDAI  274
DSSP  LH----hhHHHHhhhllllllllllllllllHHHHHH-HHEEEELL-LLLLHHH-HHHHH


DSSP  HLLL--EEEEELLLLllllllLLLLL-HHHHHHHHHhhhllllhhHHHHHHHHHLHHHHH
Query EAGI--NLGCASDNIrdfwvpFGNGD-MVQGALIETqrlelktnrDLGLIWKMITSEGAR  348
ident             |        | | |                         |       |
Sbjct LEIGadRILFSTDWP------FENIDhASDWFNATS--------iAEADRVKIGRTNARR  320
DSSP  LLLLhhHEELLLLLL------LLLHHhHHHHHHHLL--------lLHHHHHHHHLHHHHH


DSSP  HHLLHhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query VLGIEknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                                       
Sbjct LFKLD-------------------------------------------------  325
DSSP  HLLLL-------------------------------------------------


No 36: Query=4cqbA Sbjct=4hk5D Z-score=15.5

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                     |  || ||
Sbjct ---------------------------------------------------TPVVVDIHT    9
DSSP  ---------------------------------------------------LLLLEEEEE


DSSP  LHHHllllllllllllllllllhhhhhhhHHHHHHH------------------------
Query HMDKsftstgerlpkfwsrpytrdaaiedGLKYYKN------------------------   96
ident ||                                                          
Sbjct HMYP-----------------------psYIAMLEKrqtiplvrtfpqadeprlillsse   46
DSSP  EELL-----------------------hhHHHHHHLllllleeeeelleeeeeeellhhh


DSSP  -----------------llhhhhhHHHHHHHHHHHHLLEEEEEEEE----------elLL
Query -----------------atheeikRHVIEHAHMQVLHGTLYTRTHV----------dvDS  129
ident                                |     |                      
Sbjct laaldaaladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeAP  106
DSSP  hhhhhhhhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllHH


DSSP  LLLLHHHHHHHHHHHHLLllLEEEEEEELlllLLLLL--LHHHHHHHHHHHL-LLEEELL
Query VAKTKAVEAVLEAKEELKdlIDIQVVAFAqsgFFVDL--ESESLIRKSLDMG-CDLVGGV  186
ident                           |                 |        |      
Sbjct GIADAVNAEFSDMCAQHV--GRLFFFAAL---PLSAPvdAVKASIERVKNLKyCRGIILG  161
DSSP  HHHHHHHHHHHHHHHLLL--LLEEEEEEL---LLLLLhhHHHHHHHHHHLLLlEEEEEEL


DSSP  LLllLLLL---HHHHhHHHHHHHHHLLLEEEEEEL------------------------L
Query DPatRENN---VEGSlDLCFKLAKEYDVDIDYHIH------------------------D  219
ident                    |            | |                         
Sbjct TS--GLGKgldDPHL-LPVFEAVADAKLLVFLHPHyglpnevygprseeyghvlplalgF  218
DSSP  LL--LLLLlllLHHH-HHHHHHHHHLLLEEEELLLllllhhhhlllhhhlllhhhhhlhH


DSSP  LHHhHHHHHHHHH--HHHHHLLLLlLEEEEE-LLHHhhllhhHHHH--------------
Query IGTvGVYSINRLA--QKTIENGYKgRVTTSH-AWCFadapseWLDE--------------  262
ident           |                   |                             
Sbjct PME-TTIAVARMYmaGVFDHVRNL-QMLLAHsGGTL----pfLAGRiescivhdghlvkt  272
DSSP  HHH-HHHHHHHHHhlLHHHHLLLL-LEEEHHhHLLH----hhHHHHhhhhhhllhhhhhl


DSSP  ---------HHHHHHhHLLEEEEEllLLLLLLlHHHHHHLLL--EEEEELLLLlllLLLL
Query ---------AIPLYKdSGMKFVTCfsSTPPTMpVIKLLEAGI--NLGCASDNIrdfWVPF  311
ident               |                              |    |       | 
Sbjct gkvpkdrrtIWTVLK-EQIYLDAV--IYSEVG-LQAAIASSGadRLMFGTDHP---FFPP  325
DSSP  lllllllllHHHHHH-HLEEEELL--LLLHHH-HHHHHHHHLhhHEELLLLLL---LLLL


DSSP  -------llllHHHHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHHLLHHHLllllllll
Query -------gngdMVQGALIETqRLELktnrDLGLIWKMITSEGARVLGIEKNYgievgkka  364
ident                |                           |||              
Sbjct ieedvqgpwdsSRLNAQAVI-KAVG---eGSSDAAAVMGLNAVRVLSLKAEL--------  373
DSSP  lllllllllhhHHHHHHHHH-HHHL---lLLHHHHHHHLHHHHHHLLLHHHH--------


DSSP  leeeellllhhhhhhhllleeeeeELLEEeeelleell
Query dlvvlnslspqwaiidqakrlcviKNGRIivkdeviva  402
ident                                       
Sbjct ----------------------ehHHHHH---------  380
DSSP  ----------------------hhHHHHL---------


No 37: Query=4cqbA Sbjct=4ofcA Z-score=15.4

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
ident                                                         | | 
Sbjct -----------------------------------------------------mKIDIHS    7
DSSP  -----------------------------------------------------lLEEEEE


DSSP  LHHHllllllllllllllllllhhhhhhHHHHH--------------hhhllhhhhhHHH
Query HMDKsftstgerlpkfwsrpytrdaaieDGLKY--------------yknatheeikRHV  106
ident |                                                           
Sbjct HILP-----------kewpdlkkrfgygGWVQLqhhskgeakllkdgkvfrvvrencWDP   56
DSSP  ELLL-----------lllllhhhhhlllLLEEEeeeelleeeeeelleeeeeeehhhLLH


DSSP  HHHHHHHHHLLEEEEEEEE-----------elLLLLLLHHHHHHHHHHHHLLllLEEEEE
Query IEHAHMQVLHGTLYTRTHV-----------dvDSVAKTKAVEAVLEAKEELKdlIDIQVV  155
ident           |                                                 
Sbjct EVRIREMDQKGVTVQALSTvpvmfsywakpedTLNLCQLLNNDLASTVVSYP--RRFVGL  114
DSSP  HHHHHHHHHHLLLEEEEELlhhhhlllllhhhHHHHHHHHHHHHHHHHHHLL--LLEEEE


DSSP  EELllLLLLLLLHHHHHHHHHH-HLLLEEELLLLllLLLL---HHHHhHHHHHHHHHLLL
Query AFAqsGFFVDLESESLIRKSLD-MGCDLVGGVDPatRENN---VEGSlDLCFKLAKEYDV  211
ident                         |   |                         |     
Sbjct GTL--PMQAPELAVKEMERCVKeLGFPGVQIGTH--VNEWdlnAQEL-FPVYAAAERLKC  169
DSSP  ELL--LLLLHHHHHHHHHHHHHlLLLLEEEEELE--ELLEellLHHH-HHHHHHHHHHLL


DSSP  EEEEEEL------------------LLHHhHHHHHHHHH--HHHHHLLLllLEEEEE-LL
Query DIDYHIH------------------DIGTvGVYSINRLA--QKTIENGYkgRVTTSH-AW  250
ident     |                             |                 |   |   
Sbjct SLFVHPWdmqmdgrmakywlpwlvgMPAE-TTIAICSMImgGVFEKFPK-lKVCFAHgGG  227
DSSP  EEEEELLlllllhhhhlllhhhhlhHHHH-HHHHHHHHHllLHHHHLLL-lLEEELHhHL


DSSP  HHhhllhhHHHH-------------------HHHHHHhhLLEEEEElllLLLLlLHHHHH
Query CFadapseWLDE-------------------AIPLYKdsGMKFVTCfssTPPTmPVIKLL  291
ident  |                                                        | 
Sbjct AF----pfTVGRishgfsmrpdlcaqdnpmnPKKYLG--SFYTDAL---VHDPlSLKLLT  278
DSSP  LH----hhHHHHhhhhhhhlhhhhlllllllHHHHLL--LLEEELL---LLLHhHHHHHH


DSSP  HLLL--EEEEELLLLllllLLLLlllhhHHHHHHHhHHLLllhHHHHHHHHHHLHHHHHH
Query EAGI--NLGCASDNIrdfwVPFGngdmvQGALIETqRLELktnRDLGLIWKMITSEGARV  349
ident             |       | |               |     |     |         
Sbjct DVIGkdKVILGTDYP----FPLG---elEPGKLIE-SMEE---FDEETKNKLKAGNALAF  327
DSSP  HHHLllLEELLLLLL----LLLL---llLLLHHHH-HLLL---LLHHHHHHHHLHHHHHH


DSSP  HLLHHHlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query LGIEKNygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident || |                                                 
Sbjct LGLERK---------------------------------------------qf  335
DSSP  HLLLHH---------------------------------------------hl


No 38: Query=4cqbA Sbjct=4qrnA Z-score=15.1

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllLEEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnLVSPGFVDAHT   60
ident                                                             
Sbjct ---------------------------------------smtqdlktggEQGYLRIATEE   21
DSSP  ---------------------------------------llllllllllLLLLLLEEEEE


DSSP  LHHH-----------------llllllllLLLLLLllllhhhhhhhhhhhhhhllhhhhh
Query HMDK-----------------sftstgerLPKFWSrpytrdaaiedglkyyknatheeik  103
ident                                                             
Sbjct AFATreiidvylrmirdgtadkgmvslwgFYAQSP--------------seratqilerl   67
DSSP  EELLhhhhhhhhhhhhhllllhhhhhhhhHHHHLL--------------lhhhhhhhhhh


DSSP  HHHH-HHHHHHHHLLEEEEEEEE-----------elLLLLLLHHHHHHHHHHHHLLllLE
Query RHVI-EHAHMQVLHGTLYTRTHV-----------dvDSVAKTKAVEAVLEAKEELKdlID  151
ident               |                          | |      |         
Sbjct LDLGeRRIADMDATGIDKAILALtspgvqplhdldeARTLATRANDTLADACQKYP--DR  125
DSSP  HLLLhHHHHHHHHLLLLEEEEEEllllllllllhhhHHHHHHHHHHHHHHHHHHLL--LL


DSSP  EEEEEELllLLLLLLLHHHHHHHHHHH-LLLEEELLLLllLLLLHHH--hhHHHHHHHHH
Query IQVVAFAqsGFFVDLESESLIRKSLDM-GCDLVGGVDPatRENNVEG--slDLCFKLAKE  208
ident                 |   |       |                      |  |    |
Sbjct FIGMGTV--APQDPEWSAREIHRGARElGFKGIQINSH--TQGRYLDeeffDPIFRALVE  181
DSSP  EEELLLL--LLLLHHHHHHHHHHHHHLlLLLLEEELLL--LLLLLLLlhhhHHHHHHHHH


DSSP  LLLEEEEEEL--------------------lLHHHHHHHHHHHH--HHHHHLLLLlLEEE
Query YDVDIDYHIH--------------------dIGTVGVYSINRLA--QKTIENGYKgRVTT  246
ident  |     |                        |        ||                 
Sbjct VDQPLYIHPAtspdsmidpmleagldgaifgFGVETGMHLLRLItiGIFDKYPSL-QIMV  240
DSSP  HLLLEEELLLlllllllhhhhhhlllllllhHHHHHHHHHHHHHhhLHHHHLLLL-LEEE


DSSP  EE-LLHHhhllhhHHHH-----------------------HHHHHHHhLLEEEEElLLLL
Query SH-AWCFadapseWLDE-----------------------AIPLYKDsGMKFVTCfSSTP  282
ident  |           ||                              |              
Sbjct GHmGEAL----pyWLYRldymhqagvrsqryermkplkktIEGYLKS-NVLVTNS-GVAW  294
DSSP  LHhHHLH----hhHHHHhhhhhhhhhhlllllllllllllHHHHHHH-LEEEELL-LLLL


DSSP  LLLlHHHHHHLLL--EEEEELLLLlllllLLLLllhHHHHHHHHHHhllllhHHHHHHHH
Query PTMpVIKLLEAGI--NLGCASDNIrdfwvPFGNgdmVQGALIETQRlelktnRDLGLIWK  340
ident                    | |                                     |
Sbjct EPA-IKFCQQVMGedRVMYAMDYP-----YQYV---ADEVRAMDAM-----dMSAQTKKK  340
DSSP  HHH-HHHHHHHHLhhHEELLLLLL-----LLLL---HHHHHHHHLL-----lLLHHHHHH


DSSP  HHLHHHHHHHLLhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeellee
Query MITSEGARVLGIeknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdevi  400
ident                                                             
Sbjct FFQTNAEKWFKL------------------------------------------------  352
DSSP  HHLHHHHHHLLL------------------------------------------------


DSSP  ll
Query va  402
ident   
Sbjct --  352
DSSP  --


No 39: Query=4cqbA Sbjct=3irsA Z-score=15.0

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
ident                                                         |   
Sbjct ----------------------------------------------------LKIIDFRL    8
DSSP  ----------------------------------------------------LLLEELLL


DSSP  LHHH-----lLLLLllllLLLLlLLLLhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHH
Query HMDK-----sFTSTgerlPKFWsRPYTrdaaiedglkyyknatheeikrHVIEHAHMQVL  115
ident              |            |                                 
Sbjct RPPAmgflnaRIYT----RPDIrNRFT--------rqlgfepapsaeekSLELMFEEMAA   56
DSSP  LLLLhhhhhlHHHH----LHHHhHHHH--------hhhlllllhhhhhlLHHHHHHHHHH


DSSP  LLEEEEEEEEELllllllhHHHHHHHHHHHLLllLEEEEEEELllLLLLLLLHHHHHHHH
Query HGTLYTRTHVDVdsvaktkAVEAVLEAKEELKdlIDIQVVAFAqsGFFVDLESESLIRKS  175
ident  |                     |               |           |        
Sbjct AGIEQGVCVGRNssvlgsvSNADVAAVAKAYP--DKFHPVGSI--EAATRKEAMAQMQEI  112
DSSP  LLLLEEEEELLEellleelLHHHHHHHHHHLL--LLEEEEEEL--LLLLHHHHHHHHHHH


DSSP  HHHLLLEEELLlLLLL-LLLH--HHHHHHHHHHHHHLLLEEEEEELL----lHHHHHHhh
Query LDMGCDLVGGVdPATR-ENNV--EGSLDLCFKLAKEYDVDIDYHIHD----iGTVGVYsi  228
ident || |   |    |             |                          |      
Sbjct LDLGIRIVNLE-PGVWaTPMHvdDRRLYPLYAFCEDNGIPVIMMTGGnagpdITYTNP--  169
DSSP  HHLLLLLEEEL-HHHLlLLLLllLHHHHHHHHHHHHLLLLEEEELLLlllllHHHHLH--


DSSP  HHHHHHHHHLLLllLEEEEE-LLHHHhllhhhhhhhHHHHHHHL-LEEEEeLLLL--LLL
Query NRLAQKTIENGYkgRVTTSH-AWCFAdapsewldeaIPLYKDSG-MKFVTcFSST--PPT  284
ident                |  ||  |             |                     | 
Sbjct EHIDRVLGDFPD-lTVVSSHgNWPWV-------qeiIHVAFRRPnLYLSP-DMYLynLPG  220
DSSP  HHHHHHHHHLLL-lLEEEEHhHLLLH-------hhhHHHHHHLLlEEEEL-HHHHllLLL


DSSP  L-LHHHHHHLLL--EEEEELLLLllllllLLLLL--HHHHHHHhhhhhllllhhHHHHHH
Query M-PVIKLLEAGI--NLGCASDNIrdfwvpFGNGD--MVQGALIetqrlelktnrDLGLIW  339
ident     |                                                       
Sbjct HaDFIQAANSFLadRMLFGTAYP------MCPLKeyTEWFLTL---------piKPDAME  265
DSSP  HhHHHHHHLLHHhhLLLLLLLLL------LLLHHhhHHHHHLL---------llLHHHHH


DSSP  HHHLHHHHHhHLLHhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelle
Query KMITSEGARvLGIEknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdev  399
ident |       | |                                                 
Sbjct KILHGNAER-LLAQ----------------------------------------------  278
DSSP  HHHLHHHHH-HHHH----------------------------------------------


DSSP  ell
Query iva  402
ident    
Sbjct agr  281
DSSP  lll


No 40: Query=4cqbA Sbjct=3pnuA Z-score=14.8

back to top
DSSP  llleeeeeeeeeellLLEEeeeeeelleeeeeelllllleeeeeelLLLLEEELEEEEEE
Query skdfdliirnaylseKDSVydigivgdriikieakiegtvkdeidaKGNLVSPGFVDAHT   60
ident                                                         | | 
Sbjct ---------------ENLY-------------------------fqSNAMKLKNPLDMHL   20
DSSP  ---------------LLLL-------------------------llLLLEEEELLEEEEE


DSSP  LHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhHHHHHHHHHHHHHHlLEEE
Query HMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeIKRHVIEHAHMQVLhGTLY  120
ident |                                                |          
Sbjct HLR--------------------------------------DNQMLELIAPLSAR-DFCA   41
DSSP  LLL--------------------------------------LHHHHHHHHHHHHL-LLLE


DSSP  EEEEE----ELLLlllLHHHHHHHHHHHH-LLLL-LEEEEEEelLLLLlllllhHHHHHH
Query TRTHV----DVDSvakTKAVEAVLEAKEE-LKDL-IDIQVVAfaQSGFfvdlesESLIRK  174
ident                      |         ||                     |     
Sbjct AVIMPnlipPLCN---LEDLKAYKMRILKaCKDEnFTPLMTL--FFKN----ydEKFLYS   92
DSSP  EEELLllllLLLL---HHHHHHHHHHHHHhHLLLlLEEEEEE--ELLL----llHHHHHH


DSSP  HHHhLLLEEELLL------lllLLLLHHH-hHHHHHHHHHHLLLEEEEEEL-------LL
Query SLDmGCDLVGGVD------patRENNVEG-sLDLCFKLAKEYDVDIDYHIH-------DI  220
ident   |                            |                |           
Sbjct AKD-EIFGIXLYPagittnsngGVSSFDIeyLKPTLEAMSDLNIPLLVHGEtndfvmdRE  151
DSSP  HLL-LLLEEEELLlllllllllLLLLLLHhhHHHHHHHHHHLLLLEEELLLllllhhhLL


DSSP  HHhHHHHHHHHHHHhhhLLLLlLEEEEELLHHHhllhhhhhhHHHHHhhHLLEEEEELLL
Query GTvGVYSINRLAQKtieNGYKgRVTTSHAWCFAdapsewldeAIPLYkdSGMKFVTCFSS  280
ident           ||               |                  |             
Sbjct SN-FAKIYEKLAKH---FPRL-KIVMEHITTKT------lceLLKDY--ENLYATITLHH  198
DSSP  HH-HHHHHHHHHHH---LLLL-LEEELLLLLHH------hhhHHHHL--LLEEEEELLHH


DSSP  LLL-------------------------LLLHHHHH-hlLLEEEEELLLLLL----LLLL
Query TPP-------------------------TMPVIKLL-eaGINLGCASDNIRD----FWVP  310
ident                                   |           ||            
Sbjct LIItlddviggkmnphlfckpiakryedKEALCELAfsgYEKVMFGSDSAPHpkgcAAGV  258
DSSP  HLLlhhhhhlllllhhhllllllllhhhHHHHHHHHhllLLLEEELLLLLLLllllLLLL


DSSP  LLLLLHHHHHHHHHhhhlllLHHHHHHHHHHHLHHHHHHhLLHHHllllllLLLLEEEEL
Query FGNGDMVQGALIETqrlelkTNRDLGLIWKMITSEGARVlGIEKNygievgKKADLVVLN  370
ident |                    |       |             |       |      | 
Sbjct FSAPVILPVLAELF-----kQNSSEENLQKFLSDNTCKI-YDLKF------KEDKILTLE  306
DSSP  LLHHHHHHHHHHHH-----hHHLLHHHHHHHHLHHHHHH-HLLLL------LLLLEEEEE


DSSP  L-----------------llhhhhhHHLLLEEeeeelleeeeelleell
Query S-----------------lspqwaiIDQAKRLcvikngriivkdeviva  402
ident                                                  
Sbjct EkewqvpnvyedkynqvvpymageiLKFQLKH-----------------  338
DSSP  LlleelllleelllleellllllleELLEELL-----------------


No 41: Query=4cqbA Sbjct=4mupB Z-score=14.4

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                      | ||   
Sbjct -------------------------------------lvrklsgtapnpafPRGAVDTQM   23
DSSP  -------------------------------------llllllllllllllLLLLEELLL


DSSP  LHHhllllllllllllllllllhhhhHHHHhhhhhhllhhhhhHHHHHHHHHHHHLLEEE
Query HMDksftstgerlpkfwsrpytrdaaIEDGlkyyknatheeikRHVIEHAHMQVLHGTLY  120
ident ||                                                      |   
Sbjct HMY--------------lpgypalpgGPGL--------ppgalPGPEDYRRLMQWLGIDR   61
DSSP  LLL--------------lllllllllLLLL--------lllllLLHHHHHHHHHHHLLLE


DSSP  EEEEEEllllLLLHHHHHHHHHHHhlllllEEEEEEELlllllllLLHH-HHHHHHHHHL
Query TRTHVDvdsvAKTKAVEAVLEAKEelkdliDIQVVAFAqsgffvdLESE-SLIRKSLDMG  179
ident                  |                |                   |    |
Sbjct VIITQGnahqRDNGNTLACVAEMG-----eAAHAVVII------dATTTeKDMEKLTAAG  110
DSSP  EEEELLhhhlLLLHHHHHHHHHHH-----hHEEEEELL------lLLLLhHHHHHHHHLL


DSSP  LLEEELLLLllllllhHHHHHHHHHHHHHLLLEEEEEElLLHHhHHHHhHHHHHHHhhll
Query CDLVGGVDPatrennvEGSLDLCFKLAKEYDVDIDYHIhDIGTvGVYSiNRLAQKTieng  239
ident        |           ||     |   |        |             ||     
Sbjct TVGARIMDL-pggavnLSELDAVDERAHAADWMVAVQF-DGNG-LLDH-LPRLQKI----  162
DSSP  EEEEEEELL-llllllHHHHHHHHHHHHHLLLEEEEEL-LHHH-HHHH-HHHHHLL----


DSSP  lllLEEEE-ELLHhhHLLH-HHHHHH-HHHHHHHLLEEEEELLL-------lLLLL--LH
Query ykgRVTTS-HAWCfaDAPS-EWLDEA-IPLYKDSGMKFVTCFSS-------tPPTM--PV  287
ident    |     |               |   |       |                      
Sbjct -rsRWVFDhHGKFfkGIRTdGPEMAAlLKLIDRGNLWFKFAGVYessrkswpYADVaaFS  221
DSSP  -llEEEELhHHHLllLLLLlLHHHHHhHHHHHHLLEEEEELLHHhlllllllLHHHhhHH


DSSP  HHHHHLLL-EEEEELLLLLLLL----lLLLLllhHHHHHHHHHhhllllhhHHHHHHHHH
Query IKLLEAGI-NLGCASDNIRDFW----vPFGNgdmVQGALIETQrlelktnrDLGLIWKMI  342
ident                                      |             |        
Sbjct RVIAAHAPeRIVWGTNWPHNSVretaaYPDD---ARLAELTLG-----wlpDEAARHRAL  273
DSSP  HHHHHHLHhHEEELLLLLLLLLllhhhLLLH---HHHHHHHHL-----lllLHHHHHHHH


DSSP  LHHHHHHHLLHHHlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query TSEGARVLGIEKNygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                                             
Sbjct VENPEALFKLSPV-----------------------------------------------  286
DSSP  LHHHHHHHLLLLL-----------------------------------------------


No 42: Query=4cqbA Sbjct=2gwgA Z-score=14.4

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                         | | 
Sbjct -----------------------------------------------------XIIDIHG    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LHhHLLLlllllllllllllllhhhhhhhhhhHHHH-------------------LLHH-
Query HMdKSFTstgerlpkfwsrpytrdaaiedglkYYKN-------------------ATHE-  100
ident |                                                           
Sbjct HY-TTAP-----------------------kaLEDWrnrqiagikdpsvxpkvseLKISd   43
DSSP  EL-LLLL-----------------------hhHHHHhhhhhhhhhlhhhlllhhhLLLLh


DSSP  -HHHHHHH-HHHHHHHHLLEEEEEEEE-----elLLLLLLHHHHHHHHHHHHLLllLEEE
Query -EIKRHVI-EHAHMQVLHGTLYTRTHV-----dvDSVAKTKAVEAVLEAKEELKdlIDIQ  153
ident  |     |          |   |            |       |                
Sbjct dELQASIIeNQLKKXQERGSDLTVFSPragdfnvSSTWAAICNELCYRVSQLFP--DNFI  101
DSSP  hHHHHHHHlLHHHHHHHHLLLEEEEELllllhhhHHHHHHHHHHHHHHHHHHLL--LLEE


DSSP  EEEELllLLLL---llLHHHHHHHHHHH-LLLEEELLlLLLL----lLLHH--HHHHHHH
Query VVAFAqsGFFV---dlESESLIRKSLDM-GCDLVGGVdPATR----eNNVE--GSLDLCF  203
ident   |                    |     |        |                     
Sbjct GAAXL--PQSPgvdpkTCIPELEKCVKEyGFVAINLN-PDPSgghwtSPPLtdRIWYPIY  158
DSSP  EEEEL--LLLLlllhhHHHHHHHHHHHLlLLLEEEEL-LLLLlllllLLLLllHHHHHHH


DSSP  HHHHHLLLEEEEE------ELLLhhhHHHHHHHH--hHHHHHLLLLlLEEEEE-LLHHHH
Query KLAKEYDVDIDYH------IHDIgtvGVYSINRL--aQKTIENGYKgRVTTSH-AWCFAD  254
ident     |       |                                       |       
Sbjct EKXVELEIPAXIHvstgahYLNA---DTTAFXQCvagDLFKDFPEL-KFVIPHgGGAVPY  214
DSSP  HHHHHHLLLEEELlllllhHHHH---HHHHHHHHhhlLHHHHLLLL-LEEELHhHLLLHH


DSSP  LLHHHH--------hHHHHHHHhHLLEEEEEllLLLLLL---LHHHHHhlLLEEEEELLL
Query APSEWL--------dEAIPLYKdSGMKFVTCfsSTPPTM---PVIKLLeaGINLGCASDN  303
ident                            | ||                     |   ||  
Sbjct HWGRFRglaqexkkpLLEDHVL-NNIFFDTC--VYHQPGidlLNTVIP--VDNVLFASEX  269
DSSP  HHHHHHhhhhhllllLHHHHLL-LLEEEELL--LLLHHHhhhHHHHLL--HHHEELLLLL


DSSP  LlllLLLL-----llllhhHHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHHL----LHH
Query IrdfWVPF-----gngdmvQGALIETqRLELktnrDLGLIWKMITSEGARVLG----IEK  354
ident |                                                ||        |
Sbjct I---GAVRgidprtgfyydDTKRYIE-ASTI---lTPEEKQQIYEGNARRVYPrldaALK  322
DSSP  L---LLLLleelllleellLLHHHHH-HLLL---lLHHHHHHHHLHHHHHHLHhhhhHHH


DSSP  HlllllLLLLleeeellllhhhhhhhllleeeeeelleeeeelleell
Query NygievGKKAdlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                                 
Sbjct A---kgKLEH--------------------------------------  329
DSSP  H---hhHHLL--------------------------------------


No 43: Query=4cqbA Sbjct=2a3lA Z-score=14.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------llleeeeeeeeeellLLEEeeeeeelleeeeeelllllleeeeeel
Query --------------skdfdliirnaylseKDSVydigivgdriikieakiegtvkdeida   46
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------


DSSP  lLLLE--EELEEEEEELHHHLL--lLLLL-------------------------------
Query kGNLV--SPGFVDAHTHMDKSF--tSTGE-------------------------------   71
ident            || | |                                           
Sbjct aPHRDfyNVRKVDTHVHHSACMnqkHLLRfiksklrkepdevvifrdgtyltlrevfesl  213
DSSP  lLLLLllLLLEEEEEEELLLLLlhhHHHHhhhhhhhllllllleeelleeelhhhhhhhh


DSSP  ------LLLLLLLL---------LLLHHHHHHH--------hhhHHHH-lLHHHHHHHHH
Query ------RLPKFWSR---------PYTRDAAIED--------glkYYKN-aTHEEIKRHVI  107
ident                                                |            
Sbjct dltgydLNVDLLDVhadkstfhrFDKFNLKYNPcgqsrlreiflKQDNliQGRFLGEITK  273
DSSP  llllllLLLLLLLLlllllllllLLLLHHHHLLllllhhhhhhlLLLLllLLLLHHHHHH


DSSP  HHHHHHHHLLEEEEEEEEELLL---lLLLHHHHHH--hHHHHhllllLEEEEEEELLlLL
Query EHAHMQVLHGTLYTRTHVDVDS---vAKTKAVEAV--lEAKEelkdlIDIQVVAFAQsGF  162
ident                                                             
Sbjct QVFSDLEASKYQMAEYRISIYGrkmsEWDQLASWIvnnDLYS-----ENVVWLIQLP-RL  327
DSSP  HHHHHHLLLLLEEEEEEEELLLllllHHHHHHHHHhllLLLL-----LLEEEEEEEE-LL


DSSP  LLLL----------LHHHHHHH----------------hhHHLLLEEELL-LLLL-----
Query FVDL----------ESESLIRK----------------slDMGCDLVGGV-DPAT-----  190
ident                    |                             | |        
Sbjct YNIYkdmgivtsfqNILDNIFIplfeatvdpdshpqlhvfLKQVVGFDLVdDESKperrp  387
DSSP  HHHHlllllllllhHHHHHHLLhhhhhhhlhhhllllhhhHLLEEEEEEElLLLLlllll


DSSP  -------------lLLLHHHHHHHHHHHHHHLL----------LEEEEEELLLhhHHHHH
Query -------------rENNVEGSLDLCFKLAKEYD----------VDIDYHIHDIgtVGVYS  227
ident                         |                       |           
Sbjct tkhmptpaqwtnafNPAFSYYVYYCYANLYVLNklreskgmttITLRPHSGEA--GDIDH  445
DSSP  llllllllllllllLLLHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLLL--LLLHH


DSSP  HHHHHHHHhhllllllEEEEELLHHHhllhhHHHHHHHHHHHHLLEEEEELLLL------
Query INRLAQKTiengykgrVTTSHAWCFAdapseWLDEAIPLYKDSGMKFVTCFSST------  281
ident                     |                 ||            |       
Sbjct LAATFLTC--------HSIAHGINLR-----KSPVLQYLYYLAQIGLAMSPLSNnslfld  492
DSSP  HHHHHHHL--------LLLLLLHHHH-----HLHHHHHHHHHHLLLEEELHHHHllllll


DSSP  LLLLLHHHHHHLLLEEEEELLLLllllLLLL--LLLHHHHHHHHHHHHLLllhhHHHHHH
Query PPTMPVIKLLEAGINLGCASDNIrdfwVPFG--NGDMVQGALIETQRLELktnrDLGLIW  339
ident     |       | |     |                |    |      |          
Sbjct YHRNPFPVFFLRGLNVSLSTDDP----LQIHltKEPLVEEYSIAASVWKL----SACDLC  544
DSSP  LLLLLHHHHHHLLLLEEELLLLH----HHHLllLLHHHHHHHHHHHHHLL----LHHHHH


DSSP  HHhLHHHHHHHLL----HHHLLlLLLL-------llleeeellllhhhhhhhllleeeee
Query KMiTSEGARVLGI----EKNYGiEVGK-------kadlvvlnslspqwaiidqakrlcvi  388
ident            |                                                
Sbjct EI-ARNSVYQSGFshalKSHWI-GKDYykrgpdgndihktnvphirvefrdtiwkeemqq  602
DSSP  HH-HHHHHHHLLLlhhhHHHHL-LLLLllllhhhllhhhhlllhhhhhhhhhhhhhhhhh


DSSP  elleeeeelleell
Query kngriivkdeviva  402
ident               
Sbjct vylgkavisdevvp  616
DSSP  hlllllllllllll


No 44: Query=4cqbA Sbjct=4dlfA Z-score=14.2

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
ident                                                         | | 
Sbjct ----------------------------------------------------ALRIDSHQ    8
DSSP  ----------------------------------------------------LLLEEEEE


DSSP  LHHHllllllllllllllllllhhHHHHHhhhhhhhllhhhhhhHHHHHHHHHHHLLEEE
Query HMDKsftstgerlpkfwsrpytrdAAIEDglkyyknatheeikrHVIEHAHMQVLHGTLY  120
ident |                                                           
Sbjct HFWR---------------yraadYPWIG-----agmgvlardyLPDALHPLMHAQALGA   48
DSSP  LLLL---------------llhhhLLLLL-----lllhhhllllLHHHHHHHHHHLLLLE


DSSP  EEEEEELLlllLLHHHHHHHHHHHHLLllLEEEEEEElllllllllLHHH-hhhhhHHHL
Query TRTHVDVDsvaKTKAVEAVLEAKEELKdlIDIQVVAFaqsgffvdlESES-lirksLDMG  179
ident                    ||            ||                         
Sbjct SIAVQARA---GRDETAFLLELACDEA--RIAAVVGW--------eDLRApqlaerVAEW   95
DSSP  EEEELLLL---LHHHHHHHHHHHLLLL--LEEEEEEL--------lLLLLllhhhhHHLL


DSSP  ----LLEEELLLLllLLLLHHHHHHH--HHHHHHHLL---LEEEEEElllhhhHHHHHHH
Query ----CDLVGGVDPatRENNVEGSLDL--CFKLAKEYD---VDIDYHIhdigtvGVYSINR  230
ident                 |  |    |                  |                
Sbjct rgtkLRGFRHQLQ--DEADVRAFVDDadFARGVAWLQandYVYDVLV------FERQLPD  147
DSSP  llllEEEEEELHH--HLLLHHHHHHLhhHHHHHHHHHhllLEEEELL------LHHHHHH


DSSP  HHHHHHHLLLllLEEEEE-LLHHHH------lLHHHHHHHHHHHHHH-LLEEEEElLLLL
Query LAQKTIENGYkgRVTTSH-AWCFAD------aPSEWLDEAIPLYKDS-GMKFVTCfSSTP  282
ident                  |                     |                    
Sbjct VQAFCARHDA-hWLVLDHaGKPALAefdrddtALARWRAALRELAALpHVVCKLS-GLVT  205
DSSP  HHHHHHHLLL-lLEEEHHhHLLLHHhllllllHHHHHHHHHHHHHLLlLEEEEEL-LLLL


DSSP  ---------------LLLLHHHHHHLLL--EEEEELLLLlllLLLLLLllhhHHHHHHHH
Query ---------------PTMPVIKLLEAGI--NLGCASDNIrdfWVPFGNgdmvQGALIETQ  325
ident                        | |     |   ||                 |     
Sbjct eadwrrglrasdlrhIEQCLDAALDAFGpqRLMFGSDWP-vcLLAASY---dEVASLVER  261
DSSP  lllllllllhhhhhhHHHHHHHHHHHHLhhHEEELLLLL-hhHHLLLH---hHHHHHHHH


DSSP  HhllllHHHHH--HHHHHHLHHHHHHHLLHhhlllllllllleeeellllhhhhhhhlll
Query RlelktNRDLG--LIWKMITSEGARVLGIEknygievgkkadlvvlnslspqwaiidqak  383
ident          |             ||                                   
Sbjct W----aESRLSaaERSALWGGTAARCYALP------------------------------  287
DSSP  H----hHHHLLhhHHHHHLLHHHHHHLLLL------------------------------


DSSP  eeeeeelleeeeelleell
Query rlcvikngriivkdeviva  402
ident                    
Sbjct -------------------  287
DSSP  -------------------


No 45: Query=4cqbA Sbjct=1v77A Z-score=14.0

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
ident                                                       |     
Sbjct ----------------------------------------------------VKFIEMDI    8
DSSP  ----------------------------------------------------LLLEEEEE


DSSP  LHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhhhhHHHHHHHHLlEEE
Query HMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrhviEHAHMQVLHgTLY  120
ident                                                |            
Sbjct RDK--------------------------------------------EAYELAKEW-FDE   23
DSSP  LLH--------------------------------------------HHHHHHHHH-LLE


DSSP  EEEEEelllllllhhhhhhhhhhhhllllleeeeeeELLLLLlllllhhhhHHHHHHHLL
Query TRTHVdvdsvaktkaveavleakeelkdlidiqvvaFAQSGFfvdleseslIRKSLDMGC  180
ident                                                        |    
Sbjct VVVSI-------------------------------KFNEEV---------DKEKLREAR   43
DSSP  EEEEE-------------------------------EELLLL---------LHHHHHHHH


DSSP  -----LEEELLLLllllllHHHHHHHHHHHHHhlLLEEEEEELllhhhHHHHHHHHHHHH
Query -----DLVGGVDPatrennVEGSLDLCFKLAKeyDVDIDYHIHdigtvGVYSINRLAQKT  235
ident             |                  |     |              |     | 
Sbjct keygkVAILLSNP------KPSLVRDTVQKFK--SYLIYVESN-----DLRVIRYSIEKG   90
DSSP  hhhllEEEEEELL------LHHHHHHHHHHLL--LLEEEEELL-----LHHHHHHHHHLL


DSSP  hhllllllEEEEELLHHHHLlhhhHHHHHHHHHHHLLEEEEELLL----------lLLLL
Query iengykgrVTTSHAWCFADApsewLDEAIPLYKDSGMKFVTCFSS----------tPPTM  285
ident               |               |                             
Sbjct -------vDAIISPWVNRKD-pgiDHVLAKLMVKKNVALGFSLRPllysnpyeranLLRF  142
DSSP  -------lLEEELLLLLLLL-lllLHHHHHHHHHHLLEEEEELHHhhhllhhhhhhHHHH


DSSP  ---LHHHHHHLLLEEEEELLLLLlllllLLLLLHHHHHHHHHHHHllllhhHHHHHHHHH
Query ---PVIKLLEAGINLGCASDNIRdfwvpFGNGDMVQGALIETQRLelktnrDLGLIWKMI  342
ident                   |                                        |
Sbjct mmkAWKLVEKYKVRRFLTSSAQE----kWDVRYPRDLISLGVVIG-----mEIPQAKASI  193
DSSP  hhhHHHHHHHHLLLEEEELLLLL----hHHLLLHHHHHHHHHHLL-----lLHHHHHHLL


DSSP  LHHHHHHHLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query TSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident        |                                                    
Sbjct SMYPEIILK---------------------------------------------------  202
DSSP  LHHHHHHHL---------------------------------------------------


No 46: Query=4cqbA Sbjct=1itqA Z-score=13.5

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeelllllEEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlVSPGFVDAHT   60
ident                                                         | | 
Sbjct ---------------------------------------dffrdeaerimRDSPVIDGHN   21
DSSP  ---------------------------------------lhhhhhhhhhhLLLLEEEEEE


DSSP  LHHHLlllllllllllllllllhhhhhhhhhhhhhhLLHHH-------hhhhhhHHHH-H
Query HMDKSftstgerlpkfwsrpytrdaaiedglkyyknATHEE-------ikrhviEHAH-M  112
ident                                                             
Sbjct DLPWQ---------------------------lldmFNNRLqderanlttlagtHTNIpK   54
DSSP  LHHHH---------------------------hhhhHLLLLllhhhllllllllLLLHhH


DSSP  HHHLLEEEEEEEEEL--------LLLLLLHHHHHHHHHHHHLLLL---------------
Query QVLHGTLYTRTHVDV--------DSVAKTKAVEAVLEAKEELKDL---------------  149
ident             |                     |                         
Sbjct LRAGFVGGQFWSVYTpcdtqnkdAVRRTLEQMDVVHRMCRMYPETflyvtssagirqafr  114
DSSP  HHHLLEEEEEEEELLlhhhllllHHHHHHHHHHHHHHHHHHLLLLeeelllhhhhhhhhh


DSSP  ---LEEEEEEELLLlllLLLLhHHHHHHHHHHLLLEEELLLllLLLLLH-----------
Query ---IDIQVVAFAQSgffVDLEsESLIRKSLDMGCDLVGGVDpaTRENNV-----------  195
ident                   |       |     |                           
Sbjct egkVASLIGVEGGH--sIDSS-LGVLRALYQLGMRYLTLTH-sCNTPWAdnwlvdtgdse  170
DSSP  lllEEEEEEEELHH--hLLLL-HHHHHHHHHLLEEEEELLL-lLLLLLLllhhhllllll


DSSP  ------HHHHHHHHHHHHHLLLEEEEEElllhhhHHHHHHHHHHHHhhlllLLLEEEE-E
Query ------EGSLDLCFKLAKEYDVDIDYHIhdigtvGVYSINRLAQKTiengyKGRVTTS-H  248
ident               |      | ||          |       |          |  |  
Sbjct pqsqglSPFGQRVVKELNRLGVLIDLAH-----vSVATMKATLQLS-----RAPVIFShS  220
DSSP  llllllLHHHHHHHHHHHHHLLEEELLL-----lLHHHHHHHHHHL-----LLLLEELlL


DSSP  LLHHHHL-lhhhHHHHHHHHHHHLLEEEEELLL-LLLL----------LLHHHHHHLLL-
Query AWCFADA-psewLDEAIPLYKDSGMKFVTCFSS-TPPT----------MPVIKLLEAGI-  295
ident       |      |    | |         |                        |    
Sbjct SAYSVCAsrrnvPDDVLRLVKQTDSLVMVNFYNnYISCtnkanlsqvaDHLDHIKEVAGa  280
DSSP  LLLLLLLlllllLHHHHHHHHHHLLEEEELLLHhHHLLlllllhhhhhHHHHHHHHHLLh


DSSP  -EEEEELLLLlllLLLL----LLLL-HHHHHHhhhhhhlllLHHHHH-HHHHHHLHHHHH
Query -NLGCASDNIrdfWVPF----GNGD-MVQGALietqrlelkTNRDLG-LIWKMITSEGAR  348
ident    |   |                                                   |
Sbjct rAVGFGGDFD--gVPRVpeglEDVSkYPDLIA------ellRRNWTEaEVKGALADNLLR  332
DSSP  hHEEELLLLL--lLLLLllllLLLLlHHHHHH------hhhHLLLLHhHHHHHHLHHHHH


DSSP  HHLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query VLGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident |                                                     
Sbjct VFE-----------------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHH-----------------hhhhllllllllllllllhhhlllllllllllll


No 47: Query=4cqbA Sbjct=4dziC Z-score=13.3

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllLEEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnLVSPGFVDAHT   60
ident                                                         |   
Sbjct -------------------------------------------------ALNYRVIDVDN   11
DSSP  -------------------------------------------------LLLLLEEEEEE


DSSP  LHHH-----------------------------------------llLLLL---------
Query HMDK-----------------------------------------sfTSTG---------   70
ident |                                                           
Sbjct HYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptFDPIivpgcldll   71
DSSP  ELLLllllllllllhhhlllleeeeelllleeeeelleellllllllLLLEelllllhhh


DSSP  -------------lLLLLLllllllhhhhhhhhhhhhhhllhhhhhHHHHHHHHHHHHLL
Query -------------eRLPKFwsrpytrdaaiedglkyyknatheeikRHVIEHAHMQVLHG  117
ident                                                             
Sbjct frgeipdgvdpaslMKVER--------------------ladhpeyQNRDARIAVMDEQD  111
DSSP  hhllllllllhhhlLLEEL--------------------hhhlhhhLLHHHHHHHHHHHL


DSSP  EEEEEEEE------------------elLLLLLLHHHHHHHhhHHHLLlllEEEEEEELl
Query TLYTRTHV------------------dvDSVAKTKAVEAVLeaKEELKdliDIQVVAFAq  159
ident                                      |              |       
Sbjct IETAFMLPtfgcgveealkhdieatmasVHAFNLWLDEDWG-fDRPDH---RIIAAPIV-  166
DSSP  EEEEEEELlhhhhhhhhllllhhhhhhhHHHHHHHHHHHLL-lLLLLL---LEEELLLL-


DSSP  lLLLLLLLHHHHHHHHHHHLLLEEELLLllLLLL------LHHH-hhHHHHHHHHHLLLE
Query sGFFVDLESESLIRKSLDMGCDLVGGVDpaTREN------NVEG-slDLCFKLAKEYDVD  212
ident                 |  |  ||                       |       |  | 
Sbjct -SLADPTRAVEEVDFVLARGAKLVLVRP--APVPglvkprSLGDrshDPVWARLAEAGVP  223
DSSP  -LLLLHHHHHHHHHHHHHLLLLLEELLL--LLLLllllllLLLLhhhHHHHHHHHHHLLL


DSSP  EEEEEL----------------------lLHHHHHHHHHHHH--HHHHHLLLllLEEEEE
Query IDYHIH----------------------dIGTVGVYSINRLA--QKTIENGYkgRVTTSH  248
ident    |                                                        
Sbjct VGFHLSdsgylhiaaawggakdpldqvllDDRAIHDTMASMIvhGVFTRHPK-lKAVSIE  282
DSSP  EEEELLllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHHhlLHHHHLLL-lLEEEEL


DSSP  --LLHHhhllHHHHHHH---------------HHHHHhHLLEEEEellLLLLllLHHHHH
Query --AWCFadapSEWLDEA---------------IPLYKdSGMKFVTcfsSTPPtmPVIKLL  291
ident                                                           | 
Sbjct ngSYFV----HRLIKRLkkaantqpqyfpedpVEQLR-NNVWIAP---YYED--DLPELA  332
DSSP  llLLHH----HHHHHHHhhhhhhlhhhllllhHHHHH-HHEEELL---LLLL--LHHHHH


DSSP  HLLL--EEEEELLLLllllLLLLLlLHHHHHhHHHHhhllllhHHHHHHHHHHLHHHHHH
Query EAGI--NLGCASDNIrdfwVPFGNgDMVQGAlIETQrlelktnRDLGLIWKMITSEGARV  349
ident            ||         |    |     |              | |         
Sbjct RVIGvdKILFGSDWP----HGEGLaSPVSFT-AELK------gFSESDIRKIMRDNALDL  381
DSSP  HHHLhhHLLLLLLLL----LLLLLlLHHHHH-HHHL------lLLHHHHHHHHLHHHHHH


DSSP  HLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query LGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident ||                                                   
Sbjct LG----------------------------------------------vqvgs  388
DSSP  HL----------------------------------------------lllll


No 48: Query=4cqbA Sbjct=3qy6A Z-score=12.9

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
ident                                                         | | 
Sbjct ------------------------------------------------------MIDIHC    6
DSSP  ------------------------------------------------------LEELLL


DSSP  LHH-----HLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhHHHHHHHHHHHHH
Query HMD-----KSFTstgerlpkfwsrpytrdaaiedglkyyknatheeiKRHVIEHAHMQVL  115
ident |                                                  || |   | 
Sbjct HILpamddGAGD-----------------------------------SADSIEMARAAVR   31
DSSP  LLLlllllLLLL-----------------------------------HHHHHHHHHHHHH


DSSP  LLEEEEEEEEEL-lLLLL---LHHHHHHHHHHHHLL---LLLEEEEEEEllllllllllh
Query HGTLYTRTHVDV-dSVAK---TKAVEAVLEAKEELK---DLIDIQVVAFaqsgffvdles  168
ident  |             | |       ||       |                         
Sbjct QGIRTIIATPHHnnGVYKnepAAVREAADQLNKRLIkedIPLHVLPGQE-----------   80
DSSP  LLLLEEELLLEEllLLLLllhHHHHHHHHHHHHHHHhllLLLEEELLLE-----------


DSSP  hhhhhhhhhhllleeeLLLLllllllhhhhhHHHHHHHHHLLL-------EEEEEELLLh
Query eslirksldmgcdlvgGVDPatrennvegslDLCFKLAKEYDV-------DIDYHIHDIg  221
ident                                                    |        
Sbjct ----------------IRIY-----------GEVEQDLAKRQLlslndtkYILIEFPFD-  112
DSSP  ----------------EELL-----------LLHHHHHHLLLLllhhhllEEEEELLLL-


DSSP  hHHHHHHHHHHHHHHHLLLllLEEEEELL---hHHHLlHHHHHHHHHHHhhhlLEEEEEL
Query tVGVYSINRLAQKTIENGYkgRVTTSHAW---cFADApSEWLDEAIPLYkdsgMKFVTCF  278
ident          |       ||       |              |                  
Sbjct -HVPRYAEQLFYDLQLKGY--IPVIAHPErnreIREN-PSLLYHLVEKG----AASQITS  164
DSSP  -LLLLLHHHHHHHHHHLLL--EEEEELHHhlhhHHHL-LHHHHHHHHLL----LEEEEEH


DSSP  LLL--------LLLL--LHHHHhhllLEEEEELLLLLllllLLLLLLHHHHHHHHHhhhL
Query SST--------PPTM--PVIKLleagINLGCASDNIRdfwvPFGNGDMVQGALIETqrlE  328
ident  |                |            |||          |               
Sbjct GSLagifgkqlKAFSlrLVEAN----LIHFVASDAHN---vKTRNFHTQEALYVLE---K  214
DSSP  HHHlllllhhhHHHHhhHHHLL----LLLEEELLLLL---lLLLLLLHHHHHHHHH---H


DSSP  LLLhhhHHHHHHHhLHHHHHHHLLHhhlllllllllleeeellllhhhhhhhllleeeee
Query LKTnrdLGLIWKMiTSEGARVLGIEknygievgkkadlvvlnslspqwaiidqakrlcvi  388
ident         |     |      |                                      
Sbjct EFG---SELPYML-TENAELLLRNQ-----------------------------------  235
DSSP  HHL---LHHHHHH-HHHHHHHHLLL-----------------------------------


DSSP  elleeeeelleell
Query kngriivkdeviva  402
ident               
Sbjct --tifrqppqpvkr  247
DSSP  --llllllllllll


No 49: Query=4cqbA Sbjct=2qpxA Z-score=12.1

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                         | | 
Sbjct -----------------------------------------gxddlsefvdQVPLLDHHC   19
DSSP  -----------------------------------------lllllhhhhhHLLEEEEEE


DSSP  LhhHLLLlLLLLLLLLL-llllLHHH--------------------hhhhhhhhhhhllh
Query HmdKSFTsTGERLPKFW-srpyTRDA--------------------aiedglkyyknath   99
ident |                     |                                     
Sbjct H--FLID-GKVPNRDDRlaqvsTEADkdypladtknrlayhgflalakefaldannplaa   76
DSSP  L--LLLL-LLLLLHHHHhhhhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllllll


DSSP  hhhhhhhhhhhHHHHHLLEEEEEEEEElllllllhhhhhhhHHHHHLLL--LLEEEEEEE
Query eeikrhviehaHMQVLHGTLYTRTHVDvdsvaktkaveavlEAKEELKD--LIDIQVVAF  157
ident                                                     |       
Sbjct xndpgyatynhRIFGHFHFKELLIDTG-------fvpddpiLDLDQTAElvGIPVKAIYR  129
DSSP  llhhhhhhhhhHHHHHLLEEEEEEELL-------lllllllLLHHHHHHhhLLLEEEEEE


DSSP  LLLllLLLL------------LHHHHHHHHHHHLLLEEELL-LLLL--------------
Query AQSgfFVDL------------ESESLIRKSLDMGCDLVGGV-DPAT--------------  190
ident        |                         |                          
Sbjct LET-hAEDFxlehdnfaawwqAFSNDVKQAKAHGFVGFXSIaAYRVglhlepvnvieaaa  188
DSSP  HHH-hHHHHhlllllhhhhhhHHHHHHHLLLLLLLLLEEELhHHHLllllllllhhhhhh


DSSP  --------------llLLHHHHHHHHHHHHHHLLLEEEEEEL------lLHHHHHHHHHH
Query --------------reNNVEGSLDLCFKLAKEYDVDIDYHIH------dIGTVGVYSINR  230
ident                       |          |     |                    
Sbjct gfdtwkhsgekrltskPLIDYXLYHVAPFIIAQDXPLQFHVGygdadtdXYLGNPLLXRD  248
DSSP  hhhhhhhhlllllllhHHHHHHHHHHHHHHHHHLLLEEEEELlllllllHHHLLHHHHHH


DSSP  HHHHHHHLLLllLEEEEELLHHhhllhhhhhhhHHHHHHH-LLEEEEElLLLL-----ll
Query LAQKTIENGYkgRVTTSHAWCFadapsewldeaIPLYKDS-GMKFVTCfSSTP-----pt  284
ident         |    |   |                 |        |               
Sbjct YLKAFTKKGL--KVVLLHCYPY-------hreaGYLASVFpNLYFDIS-LLDNlgpsgas  298
DSSP  HHHHHHHHLL--LEEEEELLLL-------hhhhHHHHHHLlLEEEELL-LHHHhlhhhhh


DSSP  lLHHHHHHLLL--EEEEELLLLLLlllllLLLL--HHHHHHHHHhhHLLLLHH------h
Query mPVIKLLEAGI--NLGCASDNIRDfwvpfGNGD--MVQGALIETqrLELKTNR------d  334
ident        |         |||                 |                      
Sbjct rVFNEAVELAPytRILFASDASTY----pEXYGlaARQFKQALV--AHFNQLPfvdlaqk  352
DSSP  hHHHHHLLLLLhhHEELLLLLLLL----hHHHHhhHHHHHHHHH--HHHHLLLlllhhhh


DSSP  hhHHHHHHLHHHHHHHLLHHHLLLllllllleeeellllhhhhhhhllleeeeeelleee
Query lgLIWKMITSEGARVLGIEKNYGIevgkkadlvvlnslspqwaiidqakrlcvikngrii  394
ident    |        |     |                                         
Sbjct kaWINAICWQTSAKLYHQERELRV------------------------------------  376
DSSP  hhHHHHHHLHHHHHHLLLHHHHLL------------------------------------


DSSP  eelleell
Query vkdeviva  402
ident         
Sbjct --------  376
DSSP  --------


No 50: Query=4cqbA Sbjct=3dcpA Z-score=12.0

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
ident                                                         | ||
Sbjct -----------------------------------------------------XKRDGHT    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LHHH---LLLLllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLL
Query HMDK---SFTStgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHG  117
ident |                                               | |         
Sbjct HTEFcphGTHD------------------------------------DVEEXVLKAIELD   31
DSSP  LLLLlllLLLL------------------------------------LHHHHHHHHHHLL


DSSP  EEEEEEEE----------------------ELLLLLLLHHHHHHHHHHHHLLLLLEEEEE
Query TLYTRTHV----------------------DVDSVAKTKAVEAVLEAKEELKDLIDIQVV  155
ident                                                |        |   
Sbjct FDEYSIVEhaplssefxkntagdkeavttaSXAXSDLPYYFKKXNHIKKKYASDLLIHIG   91
DSSP  LLEEEEEEellllhhhhhllllllhhhhllLLLHHHHHHHHHHHHHHHHHLLLLLEEEEE


DSSP  EellllllllllhhhhhhhhhhhllleeELLLLllllllHHHHhHHHHHHHHHLLL---e
Query AfaqsgffvdleseslirksldmgcdlvGGVDPatrennVEGSlDLCFKLAKEYDV---d  212
ident                                             |       ||      
Sbjct F---------------------------EVDYL------IGYE-DFTRDFLNEYGPqtdd  117
DSSP  E---------------------------EEELL------LLLH-HHHHHHHHHHHHhlle


DSSP  eEEEELL------------------------------lHHHHHHHHHHHHHHhhHLLLll
Query iDYHIHD------------------------------iGTVGVYSINRLAQKtiENGYkg  242
ident      |                                                  |   
Sbjct gVLSLHFlegqggfrsidfsaedynegivqfyggfeqaQLAYLEGVKQSIEA--DLGLfk  175
DSSP  eEEELLEeeelleeeellllhhhhhhhlhhhhllhhhhHHHHHHHHHHHHHL--LLLLll


DSSP  LEEEEELLH--------------hhhlLHHHHHHHHHHHHHHLLEEEEELLL--------
Query RVTTSHAWC--------------fadaPSEWLDEAIPLYKDSGMKFVTCFSS--------  280
ident      |                       |       | |                    
Sbjct PRRXGHISLcqkfqqffgedtsdfseeVXEKFRVILALVKKRDYELDFNTAGlfkplcge  235
DSSP  LLEELLLLHhhllhhhhlllhhhllhhHHHHHHHHHHHHHHHLLEEEEELHHhhllllll


DSSP  -LLLLLLHHHHHHLLLEEEEELLLLLllllllLLLLHhhHHHHHHhhhllllhhhHHHHh
Query -TPPTMPVIKLLEAGINLGCASDNIRdfwvpfGNGDMvqGALIETqrlelktnrdLGLIw  339
ident   ||   |    |  |     ||                |                 |  
Sbjct tYPPKKIVTLASELQIPFVYGSDSHG-----vQDIGR--GYSTYC----------QKLE-  277
DSSP  lLLLHHHHHHHHHLLLLEEEELLLLL-----hHHLLL--LHHHHH----------HHLL-


DSSP  hhhlhhhhhhhllhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelle
Query kmitsegarvlgieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdev  399
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  ell
Query iva  402
ident    
Sbjct ---  277
DSSP  ---


No 51: Query=4cqbA Sbjct=1j5sA Z-score=11.4

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                        || | 
Sbjct ----------------------------hmflgedylltnraavrlfnevkDLPIVDPHN   32
DSSP  ----------------------------llllllllllllhhhhhhhhhhlLLLEEELLL


DSSP  LHH------------hllLLLLllllLLLLLL----------------------------
Query HMD------------ksfTSTGerlpKFWSRP----------------------------   80
ident | |                                                         
Sbjct HLDakdivenkpwndiweVEGAtdhyVWELMRrcgvseeyitgsrsnkekwlalakvfpr   92
DSSP  LLLhhhhhhllllllhhhHHLLllhhHHHHHHhllllhhhllllllhhhhhhhhhhhhhh


DSSP  ----------------llhhhhhhhhhhhhhhllhhhhhhhhhHHHHHHHHLLEEEEEEE
Query ----------------ytrdaaiedglkyyknatheeikrhviEHAHMQVLHGTLYTRTH  124
ident                                                           | 
Sbjct fvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTT  152
DSSP  hlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELL


DSSP  EELllllLLHHhHHHHHHHHHLlLLLEEEEEEELLLLLLL--------------------
Query VDVdsvaKTKAvEAVLEAKEELkDLIDIQVVAFAQSGFFV--------------------  164
ident  |          |    |||       |           |                    
Sbjct DDP----VSTL-EHHRKAKEAV-EGVTILPTWRPDRAMNVdkegwreyvekmgerygedt  206
DSSP  LLL----LLLL-HHHHHHHHHL-LLLEEELLLLLHHHHLLllllhhhhhhhhhhhhllll


DSSP  ------lllHHHHHHHHHHHLLLEEELLL---------------------------llll
Query ------dleSESLIRKSLDMGCDLVGGVD---------------------------patr  191
ident                     ||                                      
Sbjct stldgflnaLWKSHEHFKEHGCVASDHALlepsvyyvdenraravhekafsgekltqdei  266
DSSP  llhhhhhhhHHHHHHHHHLLLLLEEEEEElllllllllhhhhhhhhhhhlllllllhhhh


DSSP  lllhhHHHHHHHHHHHHLLLEEEEEELL----------------------lhHHHHHHHH
Query ennveGSLDLCFKLAKEYDVDIDYHIHD----------------------igTVGVYSIN  229
ident             |   |       ||                                  
Sbjct ndykaFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAEGLR  326
DSSP  hhhhhHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleelllLLHHHHHH


DSSP  HHHHHHhHLLLllLEEEEeLLHHHHllhhhhhhHHHHHHHHL-LEEEE-ellLLLLLL--
Query RLAQKTiENGYkgRVTTShAWCFADapsewldeAIPLYKDSG-MKFVT-cfsSTPPTM--  285
ident                                                        |    
Sbjct YFLNEF-DGKL--KIVLY-VLDPTH-----lptISTIARAFPnVYVGApwwfNDSPFGme  377
DSSP  HHHHHL-LLLL--LEEEE-ELLHHH-----hhhHHHHHHHLLlEEELLllllLLLHHHhh


DSSP  -LHHHHHHLL---LEEEEELLLLLllllllLLLL--HHHHHHHHHHhhLLLL--------
Query -PVIKLLEAG---INLGCASDNIRdfwvpfGNGD--MVQGALIETQrlELKT--------  331
ident      |          |   |                                       
Sbjct mHLKYLASVDllyNLAGMVTDSRK-----lLSFGsrTEMFRRVLSN--VVGEmvekgqip  430
DSSP  hHHHHHHLLLlhhHLLLLLLLLLL-----lLHHHhhHHHHHHHHHH--HHHHhhhlllll


DSSP  -HHHHHHHHHHHLHHHHHHHLlhhhlllllllllleeeellllhhhhhhhllleeeeeel
Query -NRDLGLIWKMITSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrlcvikn  390
ident       |                                                     
Sbjct iKEARELVKHVSYDGPKALFF---------------------------------------  451
DSSP  hHHHHHHHHHHHLHHHHHHHL---------------------------------------


DSSP  leeeeelleell
Query griivkdeviva  402
ident             
Sbjct ------------  451
DSSP  ------------


No 52: Query=4cqbA Sbjct=3iacA Z-score=10.8

back to top
DSSP  -------llleeeeeeeeEELLlleeeeeeeelleeeeeelllllleeeeeellllleEE
Query -------skdfdliirnaYLSEkdsvydigivgdriikieakiegtvkdeidakgnlvSP   53
ident                   |                                         
Sbjct atfxtedfllkndiartlYHKY----------------------------------aaPX   26
DSSP  llllllllllllhhhhhhHHHL----------------------------------llLL


DSSP  LEEEEEELHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhhHHHHH------
Query GFVDAHTHMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeiKRHVI------  107
ident    | | |                                                    
Sbjct PIYDFHCHLS---------------------------------------PQEIAddrrfd   47
DSSP  LEEELLLLLL---------------------------------------HHHHHhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  107
ident                                                             
Sbjct nlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthle  107
DSSP  lhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhh


DSSP  ---------------------------------HHHHHHHHLLEEEEEEEEELllllLLH
Query ---------------------------------EHAHMQVLHGTLYTRTHVDVdsvaKTK  134
ident                                                 |  |        
Sbjct lrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDP----IDS  163
DSSP  hhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLL----LLL


DSSP  HhHHHHHHHHHlLLLLEEEEEEELLLLLLL--------------------------lllH
Query AvEAVLEAKEElKDLIDIQVVAFAQSGFFV--------------------------dleS  168
ident   |            |           |                                
Sbjct L-EYHRQIAADdSIDIEVAPSWRPDKVFKIeldgfvdylrkleaaadvsitrfddlrqaL  222
DSSP  L-HHHHHHHHLlLLLLEEELLLLLHHHHLLllllhhhhhhhhhhhhllllllhhhhhhhH


DSSP  HHHHHHHHHHLLLEEELLLLLL----------------------------lllLHHHHHH
Query ESLIRKSLDMGCDLVGGVDPAT----------------------------renNVEGSLD  200
ident           ||                                              | 
Sbjct TRRLDHFAACGCRASDHGIETLrfapvpddaqldailgkrlagetlseleiaqFTTAVLV  282
DSSP  HHHHHHHHHLLLLEEEEEELLLlllllllhhhhhhhhhhhhllllllhhhhhhHHHHHHH


DSSP  HHHHHHHHLLLEEEEEELL---------------------lHHHHHHHHHHHHHHHH-HL
Query LCFKLAKEYDVDIDYHIHD---------------------iGTVGVYSINRLAQKTI-EN  238
ident                ||                                 ||       |
Sbjct WLGRQYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsigDNNISWALSRLLDSXDvTN  342
DSSP  HHHHHHHHHLLEEEEEELEellllhhhhhhhllllllleelLLLLHHHHHHHHHHHHlLL


DSSP  LLllLEEEeELLHhHHLLhhHHHHHHHHHHH----hLLEEEE-ellLLLLLL---LHHHH
Query GYkgRVTTsHAWCfADAPseWLDEAIPLYKD----sGMKFVT-cfsSTPPTM---PVIKL  290
ident                      |   |             |                   |
Sbjct EL-pKTIL-YCLN-PRDN-eVLATXIGNFQGpgiagKVQFGSgwwfNDQKDGxlrQLEQL  398
DSSP  LL-lEEEE-EELL-HHHH-hHHHHHHHHLLLlllllLEEELLllhhHLLHHHhhhHHHHH


DSSP  HHLLL---EEEEELLLLLllllllLLLLhHHHHHHHHHhhLLLLHH------------hh
Query LEAGI---NLGCASDNIRdfwvpfGNGDmVQGALIETQrlELKTNR------------dl  335
ident    |      |   |                          |                  
Sbjct SQXGLlsqFVGXLTDSRS------FLSY-TRHEYFRRIlcNLLGQWaqdgeipddeaxls  451
DSSP  HHHLLhhhLLLLLLLLLL------LLLL-HHHHHHHHHhhHHHHHHhhlllllllhhhhh


DSSP  hhhhHHHLHHHHHHHLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeee
Query gliwKMITSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriiv  395
ident             |                                               
Sbjct rxvqDICFNNAQRYFT--------------------------------------------  467
DSSP  hhhhHHHLHHHHHHLL--------------------------------------------


DSSP  elleell
Query kdeviva  402
ident        
Sbjct -----ik  469
DSSP  -----ll


No 53: Query=4cqbA Sbjct=3au2A Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  --------------------llleeeeeeeeeelllleeeeeeeelleeeeeelLLLLL-
Query --------------------skdfdliirnaylsekdsvydigivgdriikieaKIEGT-   39
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaiRALPGv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhHLLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   39
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   39
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------eeeeeellllleEELEEEEEELH--HHLLlllllllll
Query ----------------------vkdeidakgnlvSPGFVDAHTHM--DKSFtstgerlpk   75
ident                                        |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStySDGQ---------  351
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLllLLLL---------


DSSP  lllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEEEE---------e
Query fwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTLYTRTHV---------d  126
ident                                 |        |  |               
Sbjct ----------------------------nTLEELWEAAKTMGYRYLAVTDhspavrvagg  383
DSSP  ----------------------------lLHHHHHHHHHHHLLLEEEEEEelhhhhllll


DSSP  LLLLLLLHHHHHHHHHHHHLLlLLEEEEEeellllllllllhhhhhhhhhhhllleEELL
Query VDSVAKTKAVEAVLEAKEELKdLIDIQVVafaqsgffvdleseslirksldmgcdlVGGV  186
ident        | |       |                                          
Sbjct PSPEEALKRVGEIRRFNETHG-PPYLLAG---------------------------AEVD  415
DSSP  LLHHHHHHHHHHHHHHHHHHL-LLEEEEE---------------------------EEEE


DSSP  LLLlllllhHHHHhhHHHHhhhLLLE----EEEEELL----lHHHHHHHHHHHHHHHhhl
Query DPAtrennvEGSLdlCFKLakeYDVD----IDYHIHD----iGTVGVYSINRLAQKTien  238
ident           | |                      |                        
Sbjct IHP------DGTL--DYPD---WVLReldlVLVSVHSrfnlpKADQTKRLLKALENP---  461
DSSP  LLL------LLLL--LLLH---HHHLllleEEEELLLlllllHHHHHHHHHHHHLLL---


DSSP  llllLEEEEELL------hhHHLLhhHHHHHHHHHHHHLLEEEEEL--LLLL-LLLLHHH
Query gykgRVTTSHAW------cfADAPseWLDEAIPLYKDSGMKFVTCF--SSTP-PTMPVIK  289
ident          |                         |  |              |      
Sbjct ---fVHVLAHPTarllgrraPIEA--DWEAVFQKAKEKGVAVEIDGyyDRMDlPDDLARM  516
DSSP  ---lLLEELLLLllllllllLLLL--LHHHHHHHHHHHLLEEEEELllLLLLlLHHHHHH


DSSP  HHHLLLEEEEELLLLLllllllLLLL-HHHHHHHHHHhhllllhhhhhHHHHhhlHHHHH
Query LLEAGINLGCASDNIRdfwvpfGNGD-MVQGALIETQrlelktnrdlgLIWKmitSEGAR  348
ident     |       |              |                                
Sbjct AYGMGLWISLSTDAHQ-----tDHLRfMELAVGTAQR---------awIGPE--rVLNTL  560
DSSP  HHHLLLLEEEELLLLL-----hHHHHhHHHHHHHHHH---------llLLLL--lLHHHL


DSSP  --hhLLHHhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell
Query --vlGIEKnygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
ident                                                         
Sbjct dyedLLSW-----------------------------------------lkarrgv  575
DSSP  lhhhHHHH-----------------------------------------hhlllll


No 54: Query=4cqbA Sbjct=1m65A Z-score=9.2

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
ident                                                        || | 
Sbjct -----------------------------------------------------yPVDLHM    7
DSSP  -----------------------------------------------------lLEELLL


DSSP  LHH----HLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhhhhHHHHHHHHHHL
Query HMD----KSFTstgerlpkfwsrpytrdaaiedglkyyknatheeikrhVIEHAHMQVLH  116
ident |         |                                                 
Sbjct HTVasthAYST--------------------------------------LSDYIAQAKQK   29
DSSP  LLLllllLLLL--------------------------------------HHHHHHHHHHH


DSSP  LEEEEEEEE-------ELLLLLllhHHHHhhHHHHhlLLLLEEEEEeellllllllllhh
Query GTLYTRTHV-------DVDSVAktkAVEAvlEAKEelKDLIDIQVVafaqsgffvdlese  169
ident |                                     |   |                 
Sbjct GIKLFAITDhgpdmedAPHHWH-fiNMRI--WPRV--VDGVGILRG--------------   70
DSSP  LLLEEEEEEellllllLLLLHH-hhHHHH--LLLE--ELLEEEEEE--------------


DSSP  hhhhhhhhhllleEELLLLLlllllhHHHHhhHHHHhhHLLL----eEEEEEL------l
Query slirksldmgcdlVGGVDPAtrennvEGSLdlCFKLakEYDV----dIDYHIH------d  219
ident                                                |    |       
Sbjct -------------IEANIKN------VDGE--IDCS--GKMFdsldlIIAGFHepvfaph  107
DSSP  -------------EEEELLL------LLLL--LLLL--HHHHhhlleEEEELLlllllll


DSSP  lHHHHHHHHHHHHHHHhhllllllEEEEELLHhHHLLhhHHHHHHHHHHHHLLEEEEELL
Query iGTVGVYSINRLAQKTiengykgrVTTSHAWCfADAPseWLDEAIPLYKDSGMKFVTCFS  279
ident                            ||                              |
Sbjct dKATNTQAMIATIASG------nvHIISHPGN-PKYE-iDVKAVAEAAAKHQVALEINNS  159
DSSP  lHHHHHHHHHHHHHLL------llLEELLLLL-LLLL-lLHHHHHHHHHHHLLEEEEELL


DSSP  LlLLLLLHHHHHHLLLEEEEELLLLLllllllLLLLhhhHHHHHHHHHLLllhhHHHHhh
Query StPPTMPVIKLLEAGINLGCASDNIRdfwvpfGNGDmvqGALIETQRLELktnrDLGLiw  339
ident |            ||      ||                        |      |     
Sbjct S-NCREVAAAVRDAGGWVALGSDSHT-----aFTMG---EFEECLKILDA---vDFPPer  207
DSSP  L-LHHHHHHHHHHHLLLEEEELLLLL-----hHHLL---LLHHHHHHHHH---lLLLHhh


DSSP  HHHLHhhhhhHLLH---hhllllllLLLLeeeellllhhhhhhhllleeeeeelleeeee
Query KMITSegarvLGIE---knygievgKKADlvvlnslspqwaiidqakrlcvikngriivk  396
ident     |     |                                                 
Sbjct ILNVS--prrLLNFlesrgmapiaeFADL-------------------------------  234
DSSP  LHHHL--hhhHHHHhhhllllllhhHLLL-------------------------------


DSSP  lleell
Query deviva  402
ident       
Sbjct ------  234
DSSP  ------


No 55: Query=4cqbA Sbjct=3f2bA Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  LLLEeeeeeeeeelllleeeeeeeelleeeeeelllllleEEEE---ellllLEEELEEE
Query SKDFdliirnaylsekdsvydigivgdriikieakiegtvKDEI---dakgnLVSPGFVD   57
ident                                                           | 
Sbjct MSGV--------kkgmwvkvrgsvqndtfvrdlviiandlNEIAanerqdtaPEGEKRVE  112
DSSP  HHLL--------lllleeeeeeeeeeelllleeeeeeeeeEEELllllllllLLLLLLLL


DSSP  eEELHH-----HLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHH
Query aHTHMD-----KSFTstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHM  112
ident               |                                      |      
Sbjct -LHLHTpmsqmDAVT-------------------------------------SVTKLIEQ  134
DSSP  -LLLLLlllllLLLL-------------------------------------LHHHHHHH


DSSP  HHHLLEEEEEEEEELllllllhHHHHhHHHHHHLL--LLLEEEEEEELlLLLL--llllh
Query QVLHGTLYTRTHVDVdsvaktkAVEAvLEAKEELK--DLIDIQVVAFAqSGFF--vdles  168
ident     |                  |                       |            
Sbjct AKKWGHPAIAVTDHA-------VVQS-FPEAYSAAkkHGMKVIYGLEA-NIVDdpfhvtl  185
DSSP  HHHLLLLLEEELLLL-------LLLL-HHHHHHHHhhHLLLEEEEEEE-EEELlleeeee


DSSP  hhhhhhhhhhllleeellllllllllhhhHHHHHHHHHhhlLLEEEEE-----ELLLHhh
Query eslirksldmgcdlvggvdpatrennvegSLDLCFKLAkeyDVDIDYH-----IHDIGtv  223
ident                                    |     |                  
Sbjct laqnetglknlfklvslshiqyfhrvpriPRSVLVKHR---DGLLVGSgcdkgELFDN--  240
DSSP  eellhhhhhhhhhhhhhhhllllllllleEHHHHHHLL---LLEEEELlllllLLLLL--


DSSP  HHHHHHhhhhhhhhlllllleeeeellhhhhllhhhhhhhhhhhhhhlLEEEEELLL---
Query GVYSINrlaqktiengykgrvttshawcfadapsewldeaiplykdsgMKFVTCFSS---  280
ident                                                             
Sbjct VEDIAR----------------------------------------fyDFLEVHPPDvyk  260
DSSP  LLLLHH----------------------------------------hlLLEEELLHHhhl


DSSP  --------lLLLL--LHHHHHHL-LLEEEEELLLLL------------------------
Query --------tPPTM--PVIKLLEA-GINLGCASDNIR------------------------  305
ident                    | |   |                                  
Sbjct plyvkdeemIKNIirSIVALGEKlDIPVVATGNVHYlnpedkiyrkilihsqgganplnr  320
DSSP  llllllhhhHHHHhhHHHHHHHHlLLLEEELLLLLLllhhhhhhhhhhhhllhhhlllll


DSSP  llLLLLLLLLHHHHHHHHHHhhllllhhHHHHHHHHHLHHHHHHHLL-------------
Query dfWVPFGNGDMVQGALIETQrlelktnrDLGLIWKMITSEGARVLGI-------------  352
ident                                                             
Sbjct heLPDVYFRTTNEMLDCFSF-------lGPEKAKEIVVDNTQKIASLigdvkpikdelyt  373
DSSP  llLLLLLLLLHHHHHHHHHH-------hHHHHHHHHHLHHHHHHHHLlllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct priegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkks  433
DSSP  lllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct lddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkn  493
DSSP  hhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct cprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyrag  553
DSSP  lllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct tigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymei  613
DSSP  eeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct ydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktip  673
DSSP  hhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct tddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisg  733
DSSP  lllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct lshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgl  793
DSSP  hllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct tpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyft  853
DSSP  lhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct vraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknid  913
DSSP  hllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellll


DSSP  -------------------------------hhhlllllllllleeeellllhhhhhhhl
Query -------------------------------eknygievgkkadlvvlnslspqwaiidq  381
ident                                                             
Sbjct lyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktll  973
DSSP  llllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhh


DSSP  lleeeeeelleeeeelleell
Query akrlcvikngriivkdeviva  402
ident                      
Sbjct eylesrgcldslpdhnqlslf  994
DSSP  hhhhhllllllllllllllll


No 56: Query=4cqbA Sbjct=1bksA Z-score=8.1

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeleEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgfVDAHT   60
ident                                                             
Sbjct --------------------------------------meryenlfaqlndrregAFVPF   22
DSSP  --------------------------------------lhhhhhhhhhhhhllllEEEEE


DSSP  LHHHLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhHHHHHHHHHHHHHLLEeE
Query HMDKSFTstgerlpkfwsrpytrdaaiedglkyyknatheeiKRHVIEHAHMQVLHGTlY  120
ident                                                         |   
Sbjct VTLGDPG-----------------------------------IEQSLKIIDTLIDAGA-D   46
DSSP  EELLLLL-----------------------------------HHHHHHHHHHHHHLLL-L


DSSP  EEEEEE--------------------llllLLLHHHHHHHHHHHHLLlllEEEEEEElLL
Query TRTHVD--------------------vdsvAKTKAVEAVLEAKEELKdliDIQVVAFaQS  160
ident                                     |      |       |        
Sbjct ALELGVpfsdpladgptiqnanlrafaagvTPAQCFEMLALIREKHP---TIPIGLL-MY  102
DSSP  LEEEELlllllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL---LLLEEEE-EL


DSSP  LLllLLLHH-HHHHHHHHHLLLEEELLLLlllllLHHHhHHHHHHHHHHLLLEEEEeELL
Query GFfvDLESE-SLIRKSLDMGCDLVGGVDPatrenNVEGsLDLCFKLAKEYDVDIDYhIHD  219
ident                    | | |   |       ||         |          |  
Sbjct ANlvFNNGIdAFYARCEQVGVDSVLVADV-----PVEE-SAPFRQAALRHNIAPIF-ICP  155
DSSP  HHhhHLLLHhHHHHHHHHHLLLEEEELLL-----LHHH-LHHHHHHHHHLLLEEEE-EEL


DSSP  LHHHhhHHHHHHHHHhhhlllllLEEEEELlhhhhllHHHHHHH-HHHHHHHLLEEEEE-
Query IGTVgvYSINRLAQKtiengykgRVTTSHAwcfadapSEWLDEA-IPLYKDSGMKFVTC-  277
ident             |          |  |             |      |            
Sbjct PNAD-dDLLRQVASY-------gRGYTYLL-------ALPLHHLiEKLKEYHAAPALQGf  200
DSSP  LLLL-hHHHHHHHHH-------lLLLEEEL-------LLLHHHHhHHHHHHLLLLEEELl


DSSP  -LLLL-lllLLHHHHhhlllEEEEELLLLllllLLLL--------------llLHHHHHH
Query -FSST-pptMPVIKLleagiNLGCASDNIrdfwVPFG--------------ngDMVQGAL  321
ident   ||       |          |  |       |                          
Sbjct gISSPeqvsAAVRAG-----AAGAISGSA---iVKIIeknlaspkqmlaelrsFVSAMKA  252
DSSP  lLLLHhhhhHHHHHL-----LLEEEELLH---hHHHHhhllllhhhhhhhhhhHHHHHHH


DSSP  HHHhhhllllhhhhhhhhhhhlhhhhhhhllhhhlllllllllleeeellllhhhhhhhl
Query IETqrlelktnrdlgliwkmitsegarvlgieknygievgkkadlvvlnslspqwaiidq  381
ident                                                             
Sbjct ASR---------------------------------------------------------  255
DSSP  LLL---------------------------------------------------------


DSSP  lleeeeeelleeeeelleell
Query akrlcvikngriivkdeviva  402
ident                      
Sbjct ---------------------  255
DSSP  ---------------------


No 57: Query=4cqbA Sbjct=2anuA Z-score=6.8

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                         | | 
Sbjct --------------------------------------------------tEWLLCDFHV   10
DSSP  --------------------------------------------------lEEEEEEEEE


DSSP  LH--hHLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLE
Query HM--dKSFTstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGT  118
ident |                                                |       || 
Sbjct HTnxsDGHL-------------------------------------PLGEVVDLFGKHGV   33
DSSP  LLlllLLLL-------------------------------------LHHHHHHHHHHLLL


DSSP  EEEEEEEEL-------------------LLLLLLHHHHHHHHHHHHLLL--LLEEEEEEE
Query LYTRTHVDV-------------------DSVAKTKAVEAVLEAKEELKD--LIDIQVVAF  157
ident                                                             
Sbjct DVVSITDHIvdrrtleqrkrngeplgaiTEDKFQDYLKRLWREQKRAWEeyGXILIPGVE   93
DSSP  LEEEEEEEEelhhhhhhhhhllllllllLLLLHHHHHHHHHHHHHHHHHhhLLEEEEEEE


DSSP  LLlLLLL-lllhhhhhHHHHhhllleeellllllllllhhHHHHHHHHHHHHLLLEEEEE
Query AQsGFFV-dlesesliRKSLdmgcdlvggvdpatrennveGSLDLCFKLAKEYDVDIDYH  216
ident                                                   ||        
Sbjct IT-NNTDlyhivavdvKEYV-----------------dpsLPVEEIVEKLKEQNALVIAA  135
DSSP  EE-ELLLleeeeeellLLLL-----------------lllLLHHHHHHHHHHLLLEEEEL


DSSP  EL--llHHHH-HHHHHHhHHHHhhllllllEEEEellhhhhllhhhhhhhhhhhhhhlle
Query IH--diGTVG-VYSINRlAQKTiengykgrVTTShawcfadapsewldeaiplykdsgmk  273
ident                 |    |                                      
Sbjct HPdrkkLSWYlWANXER-FKDT-------fDAWE--------------------------  161
DSSP  LLllllLLLHhHHLLLL-LLLL-------lLEEE--------------------------


DSSP  eEEELLLLLllLLHHHHHhllLEEEEELLLLLllllLLLLllhhhhhhhhhhhhllllhh
Query fVTCFSSTPptMPVIKLLeagINLGCASDNIRdfwvPFGNgdmvqgalietqrlelktnr  333
ident              |             ||                               
Sbjct -IANRDDLF--NSVGVKK---YRYVANSDFHE----LWHV--------------------  191
DSSP  -EEELLEEL--HHHHHLL---LLEEEELLLLL----HHHH--------------------


DSSP  hhhhhhhHHLH---hhhhhHLLHhhlllllllllleeeellllhhhhhhhllleeeeeel
Query dlgliwkMITS---egarvLGIEknygievgkkadlvvlnslspqwaiidqakrlcvikn  390
ident                                                             
Sbjct ----yswKTLVkseknieaIKEA-----------------------------------ir  212
DSSP  ----lleEEEEeelllhhhHHHH-----------------------------------hh


DSSP  leeeeelleell
Query griivkdeviva  402
ident             
Sbjct kntdvaiylxrk  224
DSSP  hllleeeeelll


No 58: Query=4cqbA Sbjct=3e38A Z-score=6.2

back to top
DSSP  llleeeeeeeeeELLLleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE
Query skdfdliirnayLSEKdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
ident                                                         | | 
Sbjct ---aqrrneiqvPDLD---------------------------------gyTTLKCDFHX   24
DSSP  ---lllllllllLLLL---------------------------------llEEEEEELLL


DSSP  LHHHllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEEE
Query HMDKsftstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTLY  120
ident |                                                       |   
Sbjct HSVF-----------------------------------sdglvWPTVRVDEAYRDGLDA   49
DSSP  LLLL-----------------------------------lllllLHHHHHHHHHHLLLLE


DSSP  EEEEEE------llllLLLHhHHHHHHHHHHLL-LLLEEEEEEEllllllllllhhhhhh
Query TRTHVD------vdsvAKTKaVEAVLEAKEELK-DLIDIQVVAFaqsgffvdleseslir  173
ident                              |      |                       
Sbjct ISLTEHieyrphkqdvVSDH-NRSFDLCREQAEkLGILLIKGSE----------------   92
DSSP  ELLEEEllllllllllLLLL-LHHHHHHHHHHHhHLLEELLEEE----------------


DSSP  hhhhhllleeELLLLL----------lllllhhHHHHHHHHHHHhLLLEeeeeelllhhh
Query ksldmgcdlvGGVDPA----------trennveGSLDLCFKLAKeYDVDidyhihdigtv  223
ident                |                       |  ||                
Sbjct ----------ITRAXApghfnaiflsdsnpleqKDYKDAFREAK-KQGA-----------  130
DSSP  ----------EELLLLlleeeeelllllhhhllLLHHHHHHHHH-HLLL-----------


DSSP  hhhhhhhhhhhhhhlllllLEEEEELLH--hHHLLhhhHHHH---hhhhhhhLLEEE-EE
Query gvysinrlaqktiengykgRVTTSHAWC--fADAPsewLDEA---iplykdsGMKFV-TC  277
ident                         |                                   
Sbjct -------------------FXFWNHPGWdsqQPDT--tKWWPehtalyqegcXHGIEvAN  169
DSSP  -------------------EEEELLLLLlllLLLL--lLLLHhhhhhhhlllLLEEEeEE


DSSP  LLLLLllLLHHHHHHL-LLEEEEELLLLLLllLLLL-lllhHHHHhhhhhhhllllhhhh
Query FSSTPptMPVIKLLEA-GINLGCASDNIRDfwVPFG-ngdmVQGAlietqrlelktnrdl  335
ident           |             ||                                  
Sbjct GHLYX--PEAIQWCLDkNLTXIGTSDIHQP-iQTDYdfekgEHRT---------------  211
DSSP  LLEEL--LHHHHHHHHhLLEEEEELLLLLL-hHHHLlhhhlLLLL---------------


DSSP  hhhhhHHLH----hhhhhHLLH-----------------------------hhlllllll
Query gliwkMITS----egarvLGIE-----------------------------knygievgk  362
ident                                                             
Sbjct -----XTFVfakerslqgIREAldnrrtaayfhelligredllrpffekcvkieevsrne  266
DSSP  -----EEEEeellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeeeeeel


DSSP  llleeeeLLLLhhhHHHH---------------------------------------lll
Query kadlvvlNSLSpqwAIID---------------------------------------qak  383
ident                                                             
Sbjct qgvtlsiTNVT---DLVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
DSSP  leeeeeeEELL---LLLEeeeelllllleellleeeellleeeeeeeeellllllleeee


DSSP  eeeeeelleeeeelleell
Query rlcvikngriivkdeviva  402
ident                    
Sbjct evtnfivapdkglkytisl  342
DSSP  eeeeeeeelleeeeeeeel


No 59: Query=4cqbA Sbjct=2yb1A Z-score=6.1

back to top
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE
Query skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
ident                                                         | | 
Sbjct -----------------------------------------------------aNIDLHF    7
DSSP  -----------------------------------------------------lLEELLL


DSSP  LH--hHLLLlllllllllllllllhhhhhhhhhhhhhhllhhhHHHHHHHHHHHHHhllE
Query HM--dKSFTstgerlpkfwsrpytrdaaiedglkyyknatheeIKRHVIEHAHMQVlhgT  118
ident |                                              ||  |        
Sbjct HSrtsDGAL----------------------------------TPTEVIDRAAARA---P   30
DSSP  LLlllLLLL----------------------------------LHHHHHHHHHLLL---L


DSSP  EEEEEEEELlllllLHHHHHHHHHHHHLLllLEEEEEEELLllllllllhhhhhhhhhhh
Query LYTRTHVDVdsvakTKAVEAVLEAKEELKdlIDIQVVAFAQsgffvdleseslirksldm  178
ident               |        |       |                            
Sbjct ALLALTDHD----cTGGLAEAAAAAARRG--IPFLNGVEVS-------------------   65
DSSP  LEEEELLLL----lLLLHHHHHHHHHHLL--LLEEEEEEEE-------------------


DSSP  llleeelllLLLLL----------------------------------------------
Query gcdlvggvdPATRE----------------------------------------------  192
ident                                                             
Sbjct -------vsWGRHTvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcf  118
DSSP  -------eeELLEEeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhh


DSSP  -----------------------------------------------llhhHHHHHHHHH
Query -----------------------------------------------nnveGSLDLCFKL  205
ident                                                     ||      
Sbjct dgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwASLEDAVGW  178
DSSP  hhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllllLLHHHHHHH


DSSP  HHHLLLEEEEE--eLLLH--HHHHHHHHHHHHHHhhllllllEEEEellhhhhllhhhhh
Query AKEYDVDIDYH--iHDIG--TVGVYSINRLAQKTiengykgrVTTShawcfadapsewld  261
ident                     |     |                                 
Sbjct IVGAGGMAVIAhpgRYDMgrTLIERLILDFQAAG-------gQGIE--------------  217
DSSP  HHHLLLEEEELlhhHLLLlhHHHHHHHHHHHHLL-------lLEEE--------------


DSSP  hhhhhhhhhlleeEEELlLLLLLL--LHHH-hhhlllEEEEELLLLLLlllLLLLLLhhh
Query eaiplykdsgmkfVTCFsSTPPTM--PVIK-lleagiNLGCASDNIRDfwvPFGNGDmvq  318
ident              |    |                       ||           |    
Sbjct -------------VASG-SHSLDDmhKFALhadrhglYASSGSDFHAP---GEDVGH---  257
DSSP  -------------EEEL-LLLHHHhhHHHHhhhhhllEEEEELLLLLL---LLLLLL---


DSSP  hhhhhhhhhllllhhhhhhhhhhhlhhhhHHHLLhhhlllllllllleeeellllhhhhh
Query galietqrlelktnrdlgliwkmitsegaRVLGIeknygievgkkadlvvlnslspqwai  378
ident                                                             
Sbjct --------------------tedlppicrPIWRE--------------------------  271
DSSP  --------------------lllllllllLHHHH--------------------------


DSSP  hhllleeeeeELLEeeeelleell
Query idqakrlcviKNGRiivkdeviva  402
ident                         
Sbjct --learilrpADAE---------n  284
DSSP  --lhhhllllLHHH---------l