Results: dupa

Query: 4c5yA

MOLECULE: OCHRATOXINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4c5y-A 74.6  0.0  436   436  100 PDB  MOLECULE: OCHRATOXINASE;                                             
   2:  3mkv-A 48.1  2.2  399   414   29 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   3:  3mtw-A 47.2  2.4  387   404   29 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   4:  2oof-A 33.5  2.9  345   403   17 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   5:  2paj-A 30.4  3.1  345   421   14 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   6:  1j6p-A 28.8  3.1  334   407   16 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   7:  3icj-A 28.4  3.2  323   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
   8:  3ls9-A 27.8  2.9  345   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   9:  2vun-A 27.7  3.1  303   385   19 PDB  MOLECULE: ENAMIDASE;                                                 
  10:  4cqb-A 27.5  3.1  329   402   15 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  11:  2uz9-A 27.4  3.0  341   444   18 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  12:  1k6w-A 27.2  3.0  328   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  13:  3nqb-A 25.9  3.3  306   587   19 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  4rdv-B 25.1  2.9  332   451   16 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  15:  3giq-A 24.4  3.8  328   475   16 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  16:  1onx-A 24.3  3.4  306   390   18 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  17:  1yrr-B 24.2  3.2  287   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  3ooq-A 23.4  3.1  284   384   19 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  19:  2ogj-A 22.1  4.2  298   379   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  1gkp-A 21.4  3.7  323   458   19 PDB  MOLECULE: HYDANTOINASE;                                              
  21:  3gri-A 21.1  3.6  308   422   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  3e74-A 21.0  3.8  310   429   16 PDB  MOLECULE: ALLANTOINASE;                                              
  23:  2imr-A 20.3  5.7  294   380   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  24:  4b3z-D 20.3  3.8  321   477   16 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  25:  2ob3-A 18.1  3.7  247   329   15 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  26:  1a4m-A 18.0  3.2  247   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  27:  1a5k-C 17.4  3.2  316   566   17 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  28:  2y1h-B 17.3  3.0  221   265   17 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  29:  1bf6-A 16.3  3.5  230   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  3k2g-B 16.2  3.8  239   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  31:  1v77-A 16.2  2.8  187   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  32:  2vc5-A 15.6  3.9  224   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  3cjp-A 15.5  2.8  202   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  34:  3irs-A 14.6  3.4  215   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  35:  4mup-B 14.5  4.1  221   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  36:  3gg7-A 14.4  3.4  205   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  37:  2ffi-A 14.3  3.7  216   273   10 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  38:  4dlf-A 13.6  4.0  222   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  39:  2gwg-A 13.5  4.2  216   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  40:  4hk5-D 13.3  3.8  217   380   17 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  41:  4ofc-A 13.2  3.5  209   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  42:  1itq-A 12.8  3.8  229   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  43:  2dvt-A 12.5  3.5  204   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  44:  2qpx-A 12.5  4.1  224   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  45:  2a3l-A 12.3  3.4  240   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  46:  3pnu-A 12.3  4.1  239   338   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  47:  4dzi-C 12.0  3.4  202   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  4qrn-A 12.0  3.8  207   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  49:  3iac-A 11.6  4.0  239   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  3qy6-A 10.7  3.5  181   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  51:  1j5s-A 10.3  3.7  226   451    6 PDB  MOLECULE: URONATE ISOMERASE;                                         
  52:  1m65-A 10.1  3.3  181   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  53:  3au2-A 10.1  8.7  179   575   17 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3dcp-A  9.4  3.5  172   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  8.5  8.5  193   994    8 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.9  3.8  162   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  3e38-A  4.7  3.4  139   342   14 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2yb1-A  4.5  4.4  153   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  2anu-A  4.4  3.6  134   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4c5yA Sbjct=4c5yA Z-score=74.6

back to top
DSSP  LLLLEEEEEEEEELLLLLLLEEEEEEEEELLEEEEEEEHHHLLHHHHHHLLLEEEEEEEE
Query DEAKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIPKKYLRSTQSTHRVPVLM   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DEAKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIPKKYLRSTQSTHRVPVLM   60
DSSP  LLLLEEEEEEEEELLLLLLLEEEEEEEEELLEEEEEEEHHHLLHHHHHHLLLEEEEEEEE


DSSP  ELEEEEEELLLLLLLLLLLLHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLHHHH
Query PGLWDCHMHFGGDDDYYNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYGCEV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PGLWDCHMHFGGDDDYYNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYGCEV  120
DSSP  ELEEEEEELLLLLLLLLLLLHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLHHHH


DSSP  HHHHHLLLLLLLEEEELLLEEELLLLLLLLLLLLHHHHHHHHLLLLLLLLLLLLLLEEEL
Query AKAINDGTIVGPNVYSSGAALSQTAGHGDIFALPAGEVLGSYGVMNPRPGYWGAGPLCIA  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AKAINDGTIVGPNVYSSGAALSQTAGHGDIFALPAGEVLGSYGVMNPRPGYWGAGPLCIA  180
DSSP  HHHHHLLLLLLLEEEELLLEEELLLLLLLLLLLLHHHHHHHHLLLLLLLLLLLLLLEEEL


DSSP  LLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLE
Query DGVEEVRRAVRLQIRRGAKVIXVMASGGVMSRDDNPNFAQFSPEELKVIVEEAARQNRIV  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DGVEEVRRAVRLQIRRGAKVIXVMASGGVMSRDDNPNFAQFSPEELKVIVEEAARQNRIV  240
DSSP  LLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLE


DSSP  EEEELLHHHHHHHHHHLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHHHLLLLL
Query SAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLASNGEGL  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLASNGEGL  300
DSSP  EEEELLHHHHHHHHHHLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHHHLLLLL


DSSP  LLLHHHLLLHHHHHHHHHHHHHHHLLLLEELLLLLLLLLLLHHHHHHHHHLLLLLHHHHH
Query VKESWAKLQALADSHLKAYQGAIKAGVTIALGTDTAPGGPTALELQFAVERGGMTPLEAI  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VKESWAKLQALADSHLKAYQGAIKAGVTIALGTDTAPGGPTALELQFAVERGGMTPLEAI  360
DSSP  LLLHHHLLLHHHHHHHHHHHHHHHLLLLEELLLLLLLLLLLHHHHHHHHHLLLLLHHHHH


DSSP  HHHLLLHHHHHHHHLLLLLLLLLLLLLLEEEELLLLLLLHHHHHLHHHEEEEEELLEEEE
Query KAATANAPLSVGPQAPLTGQLREGYEADVIALEENPLEDIKVFQEPKAVTHVWKGGKLFK  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KAATANAPLSVGPQAPLTGQLREGYEADVIALEENPLEDIKVFQEPKAVTHVWKGGKLFK  420
DSSP  HHHLLLHHHHHHHHLLLLLLLLLLLLLLEEEELLLLLLLHHHHHLHHHEEEEEELLEEEE


DSSP  LLLLLLLLLLLLLLLL
Query GPGIGPWGEDARNPFL  436
ident ||||||||||||||||
Sbjct GPGIGPWGEDARNPFL  436
DSSP  LLLLLLLLLLLLLLLL


No 2: Query=4c5yA Sbjct=3mkvA Z-score=48.1

back to top
DSSP  llLLEEEEEEEEELLLLL-LLEEEEEEEEELLEEEEEEEhHHLLhhhHHHLlLEEEE--E
Query deAKVTIIYAGLLIPGDG-EPLRNAALVISDKIIAFVGSeADIPkkyLRSTqSTHRV--P   57
ident           | |   |    |      | |  |  |     |             |   
Sbjct --LTTFLFRNGALLDPDHpDLLQGFEILIEDGFIREVSD-KPIK---SSNA-HVIDVkgK   53
DSSP  --LLEEEEEEEEELLLLLlLLEEEEEEEEELLEEEEEEL-LLLL---LLLL-EEEELllL


DSSP  EEEELEEEEEELLLLLllllLLLHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLH
Query VLMPGLWDCHMHFGGDddyyNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYG  117
ident   |||| | | |                        |        |  | |  ||  | |
Sbjct TIMPGLIDLHVHVVAI---eFNLPRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGGAG  110
DSSP  EEEELEEEEEELLLLL---lLLHHHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLL


DSSP  HHHHHHHHLLLLLLLEEEELLLEEELLLLLLLLLLL--LHHHHHHhhllllllLLLLLL-
Query CEVAKAINDGTIVGPNVYSSGAALSQTAGHGDIFAL--PAGEVLGsygvmnprPGYWGA-  174
ident      |   |   ||    || ||||| || |  |                   |     
Sbjct YPFKQAVESGLVEGPRLFVSGRALSQTGGHADPRARsdYMPPDSP--------CGCCVRv  162
DSSP  HHHHHHHHLLLLLLLEEEELLLEEELLLLLLLLLLLllLLLLLLL--------LLLLLLl


DSSP  -LLEEELLLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH
Query -GPLCIADGVEEVRRAVRLQIRRGAKVIXVMASGGVMSRDDNPNFAQFSPEELKVIVEEA  233
ident       |||| |||||||     ||  || |||||| |  |       |  |   || ||
Sbjct gALGRVADGVDEVRRAVREELQMGADQIXIMASGGVASPTDPVGVFGYSEDEIRAIVAEA  222
DSSP  lLLEEELLLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH


DSSP  HHLLLLEEEEELLHHHHHHHHHHLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH
Query ARQNRIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFL  293
ident       | ||    | |  |   |    ||    | |   |  | |   | |        
Sbjct QGRGTYVLAHAYTPAAIARAVRCGVRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALA  282
DSSP  HLLLLLEEEEELLHHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH


DSSP  HHLLL-LLLLLH-HHLLlHHHHHHHHHHHHHHHLLLLEELLLLLL--lLLLLHHHHHHHH
Query ASNGE-GLVKES-WAKLqALADSHLKAYQGAIKAGVTIALGTDTA--pGGPTALELQFAV  349
ident       ||  ||            |        |||    |||           |     
Sbjct SEGEKyGLPPESiAKIA-DVHGAGLHSIEIMKRAGVKMGFGTDLLgeaQRLQSDEFRILA  341
DSSP  HHLLLlLLLHHHhLLHH-HHHLLHHHHHHHHHHHLLLLLLLLLLLhhhHHHLLHHHHHHH


DSSP  HllLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLLLLLLHHHHHL-HH
Query ErgGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEENPLEDIKVFQE-PK  407
ident |     | | |  ||               |    |  |||     |||           
Sbjct E--VLSPAEVIASATIVSAEVL--GMQDkLGRIVPGAHADVLVVDGNPLKSVDCLLGqGE  397
DSSP  L--LLLHHHHHHHLLHHHHHHL--LLLLlLLLLLLLLLLLEEEELLLLLLLLLLLLLlLL


DSSP  HEEEEEELLEEEELLLLllllllllllll
Query AVTHVWKGGKLFKGPGIgpwgedarnpfl  436
ident     | | | ||                 
Sbjct HIPLVMKDGRLFVNELE------------  414
DSSP  LLLEEEELLEEEEELLL------------


No 3: Query=4c5yA Sbjct=3mtwA Z-score=47.2

back to top
DSSP  llLLEEEEEEEEELLLLL-LLEEEEEEEEELLEEEEEEEHHHLlhhHHHHLlLEEEE--E
Query deAKVTIIYAGLLIPGDG-EPLRNAALVISDKIIAFVGSEADIpkkYLRSTqSTHRV--P   57
ident   |      |  |          |      |  |   |   |                  
Sbjct --AEIKAVSAARLLDVASgKYVDNPLVIVTDGRITSIGKKGDA---VPAGA-TAVDLpgV   54
DSSP  --LLEEEEEEEEEEELLLlEEEELEEEEEELLEEEEEEELLLL---LLLLL-EEEEEeeE


DSSP  EEEELEEEEEELLLLLlllLLLLHHhHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLL--
Query VLMPGLWDCHMHFGGDddyYNDYTSgLATHPASSGARLARGCWEALQNGYTSYRDLAG--  115
ident  | ||| | | |          | | |                  |  | |  |      
Sbjct TLLPGLIDMHVHLDSL-aeVGGYNS-LEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAad  112
DSSP  EEEELEEEEEELLLLL-llLLHHHH-HHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLll


DSSP  -LHHHHHHHHHLLLLLLLEEEELLLEEELLLLLLLLLLL-LHHHhhHHHLllllllllll
Query -YGCEVAKAINDGTIVGPNVYSSGAALSQTAGHGDIFAL-PAGEvlGSYGvmnprpgywg  173
ident         ||  |   ||           | || |     |                   
Sbjct yDDVGLREAIDAGYVPGPRIVTAAISFGATGGHCDSTFFpPSMD--QKNP----------  160
DSSP  lHHHHHHHHHHLLLLLLLEEEELLLLEELLLLLLLLLLLlHHHL--LLLL----------


DSSP  llleEELLLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH
Query agplCIADGVEEVRRAVRLQIRRGAKVIXVMASGGVMSRDDNPNFAQFSPEELKVIVEEA  233
ident        |   | | |||     || |||  | ||| ||   |   |   || |  | ||
Sbjct ----FNSDSPDEARKAVRTLKKYGAQVIXICATGGVFSRGNEPGQQQLTYEEMKAVVDEA  216
DSSP  ----LLLLLHHHHHHHHHHHHHLLLLEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH


DSSP  HHLLLLEEEEELLHHHHHHHHHHLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH
Query ARQNRIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFL  293
ident       | || ||  ||  |  ||    || |  | |   |   ||              
Sbjct HMAGIKVAAHAHGASGIREAVRAGVDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQ  276
DSSP  HHLLLEEEEEELLHHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHH


DSSP  hHLLL--LLLLLH-HHLLlHHHHHHHHHHHHHHHLLLLEELLLLLL--lLLLLHHHHHHH
Query aSNGE--GLVKES-WAKLqALADSHLKAYQGAIKAGVTIALGTDTA--pGGPTALELQFA  348
ident    |   |                       | ||||    |||      |  |      
Sbjct -AEGKknGVLEDNlRKDR-DIGELQRENFRKALKAGVKMVYGTDAGiypHGDNAKQFAVM  334
DSSP  -HHHHhhLLLHHHhHHHH-HHHHHHHHHHHHHHHHLLEEELLLLLLlllLLLHHHHHHHH


DSSP  HHLlLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLLLLLLHHHHHLhh
Query VERgGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEENPLEDIKVFQEpk  407
ident |   | ||| ||  ||  |            ||   |   | ||    || |        
Sbjct VRY-GATPLQAIQSATLTAAEAL--GRSKdVGQVAVGRYGDMIAVAGDPLADVTTLEK--  389
DSSP  HHL-LLLHHHHHHHLLHHHHHHH--LLLLlLLLLLLLLLLLEEEELLLLLLLHHHHHL--


DSSP  hEEEEEELLEEEELLllllllllllllll
Query aVTHVWKGGKLFKGPgigpwgedarnpfl  436
ident     | |||   | |              
Sbjct -PVFVMKGGAVVKAP-------------x  404
DSSP  -LLEEEELLEEEELL-------------l


No 4: Query=4c5yA Sbjct=2oofA Z-score=33.5

back to top
DSSP  lLLLEEEEEEeEELLLL-----LLLEEEEEEEEELLEEEEEEEHHHLLhhhhHHLLLEEE
Query dEAKVTIIYAgLLIPGD-----GEPLRNAALVISDKIIAFVGSEADIPkkylRSTQSTHR   55
ident                          |   ||      |       |              
Sbjct lNCERVWLNV-TPATLRsdladYGLLEPHALGVHEGRIHALVPXQDLK----YPAHWQDX   55
DSSP  lLLLEEEEEE-EELLLLlllllLLLLLLEEEEEELLEEEEEEEHHHLL----LLLLLEEL


DSSP  -EEEEEELEEEEEELLLLLLLL-----------------------lLLLHHHHHLLHHHH
Query -VPVLMPGLWDCHMHFGGDDDY-----------------------yNDYTSGLATHPASS   91
ident       ||| ||| |                                      |      
Sbjct kGKLVTPGLIDCHTHLIFAGSRaeefelrqkgvpyaeiarkgggiiSTVRATRAASEDQL  115
DSSP  lLLEEEELEEEEEELLLLLLLLhhhhhhhhhlllhhhhhhllllhhHHHHHHHHLLHHHH


DSSP  HHHHHHHHHHHHHLLEEEEEELL----------lLHHHHHHHHHlllLLLLEEEELlLEE
Query GARLARGCWEALQNGYTSYRDLA----------gYGCEVAKAINdgtIVGPNVYSSgAAL  141
ident               | |                                   |       
Sbjct FELALPRVKSLIREGVTTVEIKSgygltledelkXLRVARRLGE---ALPIRVKTT-LLA  171
DSSP  HHHHHHHHHHHHHHLEEEEEEELlllllhhhhhhHHHHHHHHHH---HLLLEEEEE-EEE


DSSP  EllllLLLLllllhhHHHHhhlllllllllllllleeeLLLHHHHH-HHHHHHH-HHLLL
Query SqtagHGDIfalpagEVLGsygvmnprpgywgagplciADGVEEVR-RAVRLQI-RRGAK  199
ident      |                                   ||               | 
Sbjct A----HAVP------PEYR----------------ddpDSWVETICqEIIPAAAeAGLAD  205
DSSP  E----LLLL------HHHL----------------llhHHHHHHHHhLHHHHHHhLLLLL


DSSP  LEEEELLlllllllllllLLLLLHHHHHHHHHHHHHLLLLEEEEEL--LHHH-HHHHHHH
Query VIXVMASggvmsrddnpnFAQFSPEELKVIVEEAARQNRIVSAHVH--GKAG-IMAAIKA  256
ident    |                 ||          |      |  |       |    |   
Sbjct AVDVFCE-----------HIGFSLAQTEQVYLAADQYGLAVKGHXDqlSNLGgSTLAANF  254
DSSP  EEEEEEL-----------LLLLLHHHHHHHHHHHHHLLLEEEEEELllLLLLhHHHHHHL


DSSP  LLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhllllllllhhhlllhHHHHHh
Query GCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLasngeglvkeswaklqaLADSHl  316
ident |  |  |  | | |        |                                     
Sbjct GALSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLK-----------------ETKLP-  296
DSSP  LLLEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-----------------LLLLL-


DSSP  hHHHHHHHLLLLEELLLLLL----llLLLHHHHHHHHHLLLLLHHHHHHHHLLLHHHHHH
Query kAYQGAIKAGVTIALGTDTA----pgGPTALELQFAVERGGMTPLEAIKAATANAPLSVG  372
ident        ||||  |   |                 |    | || ||    |  |    |
Sbjct -PVVALRKAGVPXAVSSDINpgtapiVSLRXAXNXACTLFGLTPVEAXAGVTRHAARALG  355
DSSP  -LHHHHHHLLLLEEELLLLLllllllLLHHHHHHHHHHHHLLLHHHHHHHLLHHHHHHLL


DSSP  hhLLLLLLLLLLLLLLEEEELL-LLLLLHHHhHLHHHEEEEEELLEEEELllllllllll
Query pqAPLTGQLREGYEADVIALEE-NPLEDIKVfQEPKAVTHVWKGGKLFKGpgigpwgeda  431
ident       |||| |  ||        | |                 |               
Sbjct -eQEQLGQLRVGXLADFLVWNCgHPAELSYL-IGVDQLVSRVVNGEETLH----------  403
DSSP  -lLLLLLLLLLLLLLLEEEELLlLLLHHHHL-LLLLLEEEEEELLEELLL----------


DSSP  lllll
Query rnpfl  436
ident      
Sbjct -----  403
DSSP  -----


No 5: Query=4c5yA Sbjct=2pajA Z-score=30.4

back to top
DSSP  lllLEEEEE-EEEELLLL------LLLEEEEEEEEELLEEEEEEehhHLLHhhHHHLlLE
Query deaKVTIIY-AGLLIPGD------GEPLRNAALVISDKIIAFVGseaDIPKkyLRSTqST   53
ident      | |  |     |                 |    |   |                
Sbjct ---PSTLIRnAAAIMTGGrgtaddPSRVPGPDIRIVGDTIDAIG---ALAP--RPGE-TI   51
DSSP  ---LEEEEElLLEELLLLllllllLLLLLLLLEEEELLEEEEEL---LLLL--LLLL-EE


DSSP  EEE--EEEEELEEEEEELL-LLLLlllLLLHhHHHLLHHHHHHHHHHHHHHHHHLLEEEE
Query HRV--PVLMPGLWDCHMHF-GGDDdyyNDYTsGLATHPASSGARLARGCWEALQNGYTSY  110
ident       |  |     | |                             |  |    |    
Sbjct VDAtdCVIYPAWVNTHHHLfQSLL--kGEPF-RALFDERRFRLAARIGLIELARSGCATV  108
DSSP  EELllLEEEELEELLLLLHhHHHL--lLLLL-HHHLLHHHHHHHHHHHHHHHHLLLEEEE


DSSP  EELLL---------LHHHHHHHHHlllLLLLEEEELLlEEELLLlllllLLLLHHHhhHH
Query RDLAG---------YGCEVAKAINdgtIVGPNVYSSGaALSQTAghgdiFALPAGEvlGS  161
ident  |                           |                              
Sbjct ADHNYvyypgmpfdSSAILFEEAE---KLGLRFVLLR-GGATQT----rQLEADLP--TA  158
DSSP  EELLLlllllllllHHHHHHHHHH---HLLLEEEEEE-LLLLLL----lLLLLLLL--HH


DSSP  HLllllllllllllleeELLLhHHHHHHHHHHHHHLL---------LLEEE-ELLLllll
Query YGvmnprpgywgagplcIADGvEEVRRAVRLQIRRGA---------KVIXV-MASGgvms  211
ident                                   |            |            
Sbjct LR---------------PETL-DAYVADIERLAARYHdaspramrrVVMAPtTVLY----  198
DSSP  HL---------------LLLH-HHHHHHHHHHHHHLLllllllleeEEELLlLLLL----


DSSP  llllllllLLLHHHHHHHHHHHHHLLLLEEEEELLHHHHHHHH-HHLL---LEEEELLLL
Query rddnpnfaQFSPEELKVIVEEAARQNRIVSAHVHGKAGIMAAI-KAGC---KSLEHVSYA  267
ident           || |       | |       |  ||                   |    
Sbjct --------SISPREMRETAAVARRLGLRMHSHLSGKSPVAFCGeHDWLgsdVWYAHLVKV  250
DSSP  --------LLLHHHHHHHHHHHHHLLLEEEEELLLLLHHHHHHhLLLLlllEEEELLLLL


DSSP  LHHHHHHHHHHLLEEELLHHHHHHHhhhllllllllhhhlllhhhhhhhhHHHHHHHLLL
Query DEEVWELMKEKGILYVATRSVIEIFlasngeglvkeswaklqaladshlkAYQGAIKAGV  327
ident |     |    |                                             |||
Sbjct DADEIALLAQTGTGVAHCPQSNGRL-------------------------PVREMADAGV  285
DSSP  LHHHHHHHHHHLLEEEELHHHHHLL-------------------------LLLLHHHHLL


DSSP  LEELLLLLL---llLLLHHHHHHHHHLLL---LLHHHHHHHHLLLHHHHHHhhLLLLLLL
Query TIALGTDTA---pgGPTALELQFAVERGG---MTPLEAIKAATANAPLSVGpqAPLTGQL  381
ident     | | |          |                | |   ||      |      |  
Sbjct PVSIGVDGAasneaADMISEVHMTWLAQRarlASIAEVIHWGTAGGARVMG--LDEVGKV  343
DSSP  LEEELLLHHhhlllLLHHHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHL--LLLLLLL


DSSP  LLLLLLLEEEELL----------LLLLLHHHhHLHHHEEEEEELLEEEELLLLLLL----
Query REGYEADVIALEE----------NPLEDIKVfQEPKAVTHVWKGGKLFKGPGIGPW----  427
ident   || ||                              |      ||              
Sbjct AVGYAADIAVYRLddpryfglhdPAIGPVAS-GGRPSVMALFSAGKRVVVDDLIEGvdik  402
DSSP  LLLLLLLEEEEELllhhhlllllHHHHHHHL-LLLLEEEEEEELLEEEEELLLLLLllhh


DSSP  ----------lllllllll
Query ----------gedarnpfl  436
ident                    
Sbjct elggearrvvrellrevvv  421
DSSP  hhhhhhhhhhhhhhhhhhl


No 6: Query=4c5yA Sbjct=1j6pA Z-score=28.8

back to top
DSSP  lllLEEEEEEEEELLLLLLLEEEEEEEEELLEEEEEEEHHHLlhhhhhhlllEEEE--EE
Query deaKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIpkkylrstqsTHRV--PV   58
ident       ||   |            |  |    |  |                        
Sbjct ---HHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVK---------vDLDLsgKL   48
DSSP  ---LEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEELLLL---------lLEELllEE


DSSP  EEELEEEEEELL-LLLL------------llLLLLHHHHHLLHHHHHHHHHHHHHHHHHL
Query LMPGLWDCHMHF-GGDD------------dyYNDYTSGLATHPASSGARLARGCWEALQN  105
ident   | |   | |                                            |    
Sbjct VXPALFNTHTHApXTLLrgvaedlsfeewlfSKVLPIEDRLTEKXAYYGTILAQXEXARH  108
DSSP  EEELEEEEEELHhHHHHllllllllhhhhhhLLHHHHHLLLLHHHHHHHHHHHHHHHHLL


DSSP  LEEEEEELLLLHHHHHHHHHlllLLLLEEEELlLEEELLllllllllllhhhhhhhhlll
Query GYTSYRDLAGYGCEVAKAINdgtIVGPNVYSSgAALSQTaghgdifalpagevlgsygvm  165
ident |     |        |||       |         |                        
Sbjct GIAGFVDXYFHEEWIAKAVR---DFGXRALLT-RGLVDS---------------------  143
DSSP  LEEEEEEEELLHHHHHHHHH---HHLLEEEEE-EEELLL---------------------


DSSP  llllllllllleeellLHHHhhHHHHHHHHHL----------LLLEEEELLLllllllll
Query nprpgywgagplciadGVEEvrRAVRLQIRRG----------AKVIXVMASGgvmsrddn  215
ident                                                             
Sbjct ----------------NGDD-gGRLEENLKLYnewngfegriFVGFGPHSPY--------  178
DSSP  ----------------LLLL-lLHHHHHHHHHhhhllhhhleEEEEEELLLL--------


DSSP  llllLLLHHHHHHHHHHHHHLLLLEEEEEL----LHHHHHHHHHHLL----LEEEELLLL
Query pnfaQFSPEELKVIVEEAARQNRIVSAHVH----GKAGIMAAIKAGC----KSLEHVSYA  267
ident       | | ||     |   |  |  |                 |         |    
Sbjct ----LCSEEYLKRVFDTAKSLNAPVTIHLYetskEEYDLEDILNIGLkevkTIAAHCVHL  234
DSSP  ----LLLHHHHHHHHHHHHHHLLLEEEEELllllLLLLLHHHHLLLLllllEEEEELLLL


DSSP  LHHHHHHHHHHLLEEELLHHHHHHHHhhllllllllhhhlllhhHHHHhhHHHHHHHLLL
Query DEEVWELMKEKGILYVATRSVIEIFLasngeglvkeswaklqalADSHlkAYQGAIKAGV  327
ident  |      |                                           |  |  | 
Sbjct PERYFGVLKDIPFFVSHNPASNLKLG------------------NGIA--PVQRXIEHGX  274
DSSP  LHHHHHHHLLLLEEEEELHHHHHHLL------------------LLLL--LHHHHHHLLL


DSSP  LEELLLLLL---lLLLLHHHHHHHHHLL------LLLHHHHHHHHLLLHHHHHhhhLLLL
Query TIALGTDTA---pGGPTALELQFAVERG------GMTPLEAIKAATANAPLSVgpqAPLT  378
ident    |||| |          |   |                  |  |              
Sbjct KVTLGTDGAasnnSLNLFFEXRLASLLQkaqnprNLDVNTCLKXVTYDGAQAX---GFKS  331
DSSP  EEEELLLLLllllLLLHHHHHHHHHHHHhlllllLLLHHHHHHHHLHHHHHHH---LLLL


DSSP  LLLLLLLLLLEEEELL----------LLLLLHH-HHHLhhhEEEEEELLEEEELLllLLL
Query GQLREGYEADVIALEE----------NPLEDIK-VFQEpkaVTHVWKGGKLFKGPgiGPW  427
ident |   ||  ||                           |   |      ||       |  
Sbjct GKIEEGWNADLVVIDLdlpexfpvqnIKNHLVHaFSGE---VFATXVAGKWIYFD--GEY  386
DSSP  LLLLLLLLLLEEEEELllhhhllhhhHHHHHHHlLLLL---LLEEEELLEEEEEL--LLL


DSSP  LLlLLLL------------ll
Query GEdARNP------------fl  436
ident                      
Sbjct PTiDSEEvkrelariekelys  407
DSSP  LLlLHHHhhhhhhhhhhhhhl


No 7: Query=4c5yA Sbjct=3icjA Z-score=28.4

back to top
DSSP  lllLEEEEEEEEELLLL-LLLEEeEEEEEELLEEEEEEEHHHLLHHHHHHLLLEEEE--E
Query deaKVTIIYAGLLIPGD-GEPLRnAALVISDKIIAFVGSEADIPKKYLRSTQSTHRV--P   57
ident           |               ||||       |                      
Sbjct ---CMKALINGTIYTSFsPVKKV-SGLVISNERVLYAGDSSTALRIAELAGGEIIDLkgK   56
DSSP  ---LEEEEELLEEEEEElLEEEE-LEEEEELLEEEEEELHHHHHHHHHHHLLEEEELllL


DSSP  EEEELEEEEEELLLL-----------------------------llLLLL----------
Query VLMPGLWDCHMHFGG-----------------------------ddDYYN----------   78
ident   ||   | | |                                                
Sbjct FVMPAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriiFGFGwdqdelgrwp  116
DSSP  EEEELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleEEEEelhhhhllll


DSSP  -------------------------------------------------------LLHHH
Query -------------------------------------------------------DYTSG   83
ident                                                             
Sbjct tredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIIN  176
DSSP  lhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHH


DSSP  H-HLLHHHHHHHHHHHHHHHHHLLEEEEEELLL--lhHHHHHHHHLLLLLLLEEEELLLe
Query L-ATHPASSGARLARGCWEALQNGYTSYRDLAG--ygCEVAKAINDGTIVGPNVYSSGAa  140
ident                     |  |  |                         ||      
Sbjct EkILTVKDYKHYIESAQEHLLSLGVHSVGFMSVgekaLKALFELEREGRLKMNVFAYLS-  235
DSSP  HlLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEElhhhHHHHHHHHHLLLLLLEEEEEEL-


DSSP  eellllllllllllhhhhhhhhlllllllllllllleeelllhhhhhhHHHH-----hHH
Query lsqtaghgdifalpagevlgsygvmnprpgywgagplciadgveevrrAVRL-----qIR  195
ident                                                             
Sbjct -----------------------------------------------pELLDkleelnLG  248
DSSP  -----------------------------------------------hHHHHhhhhhlLL


DSSP  HL------LLLEEEELLLLLLLllLLLL-------------LLLLLHHHHHHHHHHHHHL
Query RG------AKVIXVMASGGVMSrdDNPN-------------FAQFSPEELKVIVEEAARQ  236
ident             |    |                              |     | |   
Sbjct KFegrrlrIWGVXLFVDGSLGA--RTALlsepytdnpttsgELVMNKDEIVEVIERAKPL  306
DSSP  LEellleeEEEEEEELLLLLLL--LLLLlllllllllllllLLLLLHHHHHHHHHHHLLL


DSSP  LLLEEEEELLHHHHHHHHHHL-----LLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHH
Query NRIVSAHVHGKAGIMAAIKAG-----CKSLEHVSYADEEVWELMKEKGILYVATRSVIEI  291
ident    |  |  |      |  |          || |       |  ||      |    |  
Sbjct GLDVAVHAIGDKAVDVALDAFeeaefSGRIEHASLVRDDQLERIKELKVRISAQPHFIVS  366
DSSP  LLEEEEEELLHHHHHHHHHHHhhhllLLEEEELLLLLHHHHHHHHHHLLEEEELLLHHHH


DSSP  HHhhllllllllhHHLLLHHHHHHHhHHHHHHHlLLLEELLLLLLLLLLLH-HHHHHHHH
Query FLasngeglvkesWAKLQALADSHLkAYQGAIKaGVTIALGTDTAPGGPTA-LELQFAVE  350
ident                     |                    ||              || 
Sbjct DW--------wivNRVGEERAKWAY-RLKTLSS-ITKLGFSTDSPIEPADPwVSIDAAVN  416
DSSP  LL--------lhhHHHHHHHHHHLL-LHHHHHH-HLLEEELLLLLLLLLLHhHHHHHHHH


DSSP  L------LLLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELLLLLLlhhhhh
Query R------GGMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEENPLEdikvfq  404
ident |            ||    |          |   | |  |  |  | |   ||       
Sbjct RyvvdpgERVSREEALHLYTHGSAQVTL--AEDLGKLERGFRAEYIILDRDPLK------  468
DSSP  LllllhhHLLLHHHHHHHLLHHHHHHLL--LLLLLLLLLLLLLLEEEELLLLLL------


DSSP  lhhheeeeeelleeeellllllllllllllll
Query epkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                 
Sbjct --------------------------------  468
DSSP  --------------------------------


No 8: Query=4c5yA Sbjct=3ls9A Z-score=27.8

back to top
DSSP  llllEEEEE-EEEELLLL--LLLEEEEEEEEELLEEEEEEehHHLLhhhHHHLLLEEEE-
Query deakVTIIY-AGLLIPGD--GEPLRNAALVISDKIIAFVGseADIPkkyLRSTQSTHRV-   56
ident        |      |  |     |  |   |    |  ||   |      ||   |    
Sbjct ----MILIRgLTRVITFDdqERELEDADILIDGPKIVAVG--KDLS---DRSVSRTIDGr   51
DSSP  ----LEEEEeEEEEELLLllLLEEEEEEEEEELLEEEEEE--LLLL---LLLLLEEEELl


DSSP  -EEEEELEEEEEELL-LLLL-------------lllLLLHHHHH------LLHHHHHHHH
Query -PVLMPGLWDCHMHF-GGDD-------------dyyNDYTSGLA------THPASSGARL   95
ident      |||   | |   |                     |            |       
Sbjct gMIALPGLINSHQHLyEGAMraipqlervtmaswleGVLTRSAGwwrdgkFGPDVIREVA  111
DSSP  lEEEEELEEEEEELHhHHHHlllhhhllllhhhhhhHHHHHHHHhhhlllLLHHHHHHHH


DSSP  HHHHHHHHHLLEEEEEELL---------lLHHHHHHHHHlllLLLLEEEELLlEEELL--
Query ARGCWEALQNGYTSYRDLA---------gYGCEVAKAINdgtIVGPNVYSSGaALSQT--  144
ident      | |  | |   |            |      |       |               
Sbjct RAVLLESLLGGITTVADQHlffpgatadsYIDATIEAAT---DLGIRFHAAR-SSMTLgk  167
DSSP  HHHHHHHHHLLEEEEEEEEllllllllllHHHHHHHHHH---HHLLEEEEEE-LLLLLlh


DSSP  --LLLLllllllhhhHHHHHLLlllllllllllleeelllhhhHHHHHHHHHHHL-----
Query --AGHGdifalpageVLGSYGVmnprpgywgagplciadgveeVRRAVRLQIRRG-----  197
ident    |                                       | | |            
Sbjct seGGFC---------DDLFVEP---------------------VDRVVQHCLGLIdqyhe  197
DSSP  hhLLLL---------LHHHLLL---------------------HHHHHHHHHHHHhhhll


DSSP  -------LLLEEEELLLllllllllllllLLLHHHHHHHHHHHHHLLLLEEEEELL----
Query -------AKVIXVMASGgvmsrddnpnfaQFSPEELKVIVEEAARQNRIVSAHVHG----  246
ident                                 ||        ||        |       
Sbjct pepfgmvRIALGPCGVP------------YDKPELFEAFAQMAADYDVRLHTHFYEplda  245
DSSP  lllllleEEEELLLLLL------------LLLHHHHHHHHHHHHHHLLEEEEEELLllhh


DSSP  --------hHHHHHHHHHLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHh
Query --------kAGIMAAIKAGC----KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLa  294
ident                 | |       | |      |        |               
Sbjct gmsdhlygmTPWRFLEKHGWasdrVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG-  304
DSSP  hhhhhhhllLHHHHHHHLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-


DSSP  hllllllllhhhlllhhHHHHhhHHHHHHHLLLLEELLLLLL---lLLLLHHHHHHHHHL
Query sngeglvkeswaklqalADSHlkAYQGAIKAGVTIALGTDTA---pGGPTALELQFAVER  351
ident                               || |   ||       ||     |  |   
Sbjct -----------------WGLA--PIREYLDAGITVGFGTTGSasndGGNLLGDLRLAALA  345
DSSP  -----------------LLLL--LHHHHHHLLLEEEELLLLLllllLLLHHHHHHHHHHH


DSSP  L----------LLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELL-------
Query G----------GMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEE-------  394
ident                 |    ||       |   |  | | ||  ||             
Sbjct HrpadpnepekWLSARELLRMATRGSAECLG--RPDLGVLEEGRAADIACWRLdgvdrvg  403
DSSP  LhhhllllhhhLLLHHHHHHHLLHHHHHHLL--LLLLLLLLLLLLLLEEEEELllhhhll


DSSP  ---LLLLLHHHhHLHHhEEEEEELLEEEELL-lLLLLlllLLLL--------ll
Query ---NPLEDIKVfQEPKaVTHVWKGGKLFKGP-gIGPWgedARNP--------fl  436
ident         |           |   |                             
Sbjct vhdPAIGLIMTgLSDR-ASLVVVNGQVLVENerPVLA---DLERivanttalip  453
DSSP  lllHHHHHHHLlLLLL-LLEEEELLEEEEELleELLL---LHHHhhhhhhhhll


No 9: Query=4c5yA Sbjct=2vunA Z-score=27.7

back to top
DSSP  lllLEEEEE-EEEELLLL--LLLEEEEEEEEELLEEEEEEeHHHLLHHhHHHLlLEEEE-
Query deaKVTIIY-AGLLIPGD--GEPLRNAALVISDKIIAFVGsEADIPKKyLRSTqSTHRV-   56
ident      |||   |    ||     |     |  |  ||  |      |             
Sbjct ---SKTIIKnIGKIVSGDikSPVLQADTIVVEDGLIAAIG-GEELMKD-AGDA-TIIDAa   54
DSSP  ---LEEEEElLLEEELLLllLLEELLLEEEEELLEEEEEE-LHHHHLL-LLLL-EEEELl


DSSP  -EEEEELEEEEEELLLLllllllllhhhhhllhhhhHHHH-----HHHHHHHHHLLEEEE
Query -PVLMPGLWDCHMHFGGdddyyndytsglathpassGARL-----ARGCWEALQNGYTSY  110
ident      ||| | | |  |                   |              ||  | |  
Sbjct gSTVTPGLLDTHVHVSG-------------------GDYAprqktMDFISSALHGGVTTM   95
DSSP  lLEEEELEEEEEELLLL-------------------LLEEhhhleELHHHHHHLLLEEEE


DSSP  EELLL-------------------LHHHHHHHHhlllLLLLEEEELLLEEELllllllll
Query RDLAG-------------------YGCEVAKAIndgtIVGPNVYSSGAALSQtaghgdif  151
ident                                |       |  |      |          
Sbjct ISAGSphfpgrpkdaagtkalaitLSKSYYNAR----PAGVKVHGGAVILEK--------  143
DSSP  EELLLlllllllllhhhhhhhhhhHHHHHHHLL----HHHLEEELLEELLLL--------


DSSP  lllhhhhhhhhlllllllllllllleeelllhHHHHHHHHHHHHHLLLLEEEELllllll
Query alpagevlgsygvmnprpgywgagplciadgvEEVRRAVRLQIRRGAKVIXVMAsggvms  211
ident                                              |              
Sbjct --------------------------------GLTEEDFIEMKKEGVWIVGEVG------  165
DSSP  --------------------------------LLLHHHHHHHHHLLLLEEEEEL------


DSSP  llllllllLLLHHHHHHHHHHHHHLLLLEEEEELL------hHHHH-HHHHHLLLEEEEL
Query rddnpnfaQFSPEELKVIVEEAARQNRIVSAHVHG------kAGIM-AAIKAGCKSLEHV  264
ident            ||     || |      |  |  |              ||       | 
Sbjct -----lgtIKNPEDAAPMVEWAHKHGFKVQMHTGGtsipgssTVTAdDVIKTKPDVVSHI  220
DSSP  -----lllLLLHHHHHHHHHHHHHLLLEEEEELLLlllllllLLLHhHHHHHLLLEEELL


DSSP  L----LLLHHHHHHHHH-HLLEEELLHHHhhhhhhhllllllllhhhlllhhhhhHHHHH
Query S----YADEEVWELMKE-KGILYVATRSVieiflasngeglvkeswaklqaladsHLKAY  319
ident                                                          |  
Sbjct NggptAISVQEVDRIMDeTDFAMEIVQCG--------------------------NPKIA  254
DSSP  LllllLLLHHHHHHHHHhLLLEEEEELLL--------------------------LHHHH


DSSP  HHHHHLL------lLEELLLLLL----lLLLL-HHHHHHHHHLLLLLHHHHHHHHLLLHH
Query QGAIKAG------vTIALGTDTA----pGGPT-ALELQFAVERGGMTPLEAIKAATANAP  368
ident                   | |                          |  |   || |  
Sbjct DYVARRAaekgqlgRVIFGNDAPsgtglIPLGiLRNMCQIASMSDIDPEVAVCMATGNST  314
DSSP  HHHHHHHhhhllhhHEEEELLLLlllllLLLHhHHHHHHHHHHLLLLHHHHHHHHLHHHH


DSSP  HHHhhhLLLLLLLLLLLLLLEEEELL-------LLLLL---HHHHhlhhHEEEEEELLEE
Query LSVgpqAPLTGQLREGYEADVIALEE-------NPLED---IKVFqepkAVTHVWKGGKL  418
ident          ||    | ||| |                               |   |  
Sbjct AVY---GLNTGVIAPGKEADLIIMDTplgsvaeDAMGAiaaGDIP----GISVVLIDGEA  367
DSSP  HHH---LLLLLLLLLLLLLLEEEEELlllllllLHHHHhhhLLLL----EEEEEEELLEE


DSSP  EELLllllllllllllll
Query FKGPgigpwgedarnpfl  436
ident                   
Sbjct VVTKsrntppakraakil  385
DSSP  EELLllllllllllleel


No 10: Query=4c5yA Sbjct=4cqbA Z-score=27.5

back to top
DSSP  LLLLEEEEEEEEELllllLLEEEEEEEEELLEEEEEEEhhHLLHhhhhHLLLEEEE--EE
Query DEAKVTIIYAGLLIpgdgEPLRNAALVISDKIIAFVGSeaDIPKkylrSTQSTHRV--PV   58
ident       ||    |     |        |    |        |                  
Sbjct SKDFDLIIRNAYLS----EKDSVYDIGIVGDRIIKIEA--KIEG----TVKDEIDAkgNL   50
DSSP  LLLEEEEEEEEEEL----LLLEEEEEEEELLEEEEEEL--LLLL----LEEEEEELllLL


DSSP  EEELEEEEEELLLL--LLLL-----------------lLLLHHHHHLLHHHHHHHHHHHH
Query LMPGLWDCHMHFGG--DDDY-----------------yNDYTSGLATHPASSGARLARGC   99
ident   ||  | | |                                                 
Sbjct VSPGFVDAHTHMDKsfTSTGerlpkfwsrpytrdaaieDGLKYYKNATHEEIKRHVIEHA  110
DSSP  EEELEEEEEELHHHllLLLLllllllllllllhhhhhhHHHHHHHHLLHHHHHHHHHHHH


DSSP  HHHHHLLEEEEEELL-----------lLHHHHHHHHHllllLLLEEEELlLEEELlllll
Query WEALQNGYTSYRDLA-----------gYGCEVAKAINdgtiVGPNVYSSgAALSQtaghg  148
ident       |    |                  |                   |         
Sbjct HMQVLHGTLYTRTHVdvdsvaktkaveAVLEAKEELK----DLIDIQVV-AFAQS-----  160
DSSP  HHHHHLLEEEEEEEEelllllllhhhhHHHHHHHHLL----LLLEEEEE-EELLL-----


DSSP  llllllhhhhhhhhlllllllllllllleeELLLhHHHHHHHHHHHHHLLLLEEEELLll
Query difalpagevlgsygvmnprpgywgagplcIADGvEEVRRAVRLQIRRGAKVIXVMASgg  208
ident                                     |     |     |           
Sbjct ------------------------------GFFVdLESESLIRKSLDMGCDLVGGVDP--  188
DSSP  ------------------------------LLLLlLLHHHHHHHHHHHLLLEEELLLL--


DSSP  lllllllllLLLL--LHHHHHHHHHHHHHLLLLEEEEEL-----LHHHHHHHHHHL----
Query vmsrddnpnFAQF--SPEELKVIVEEAARQNRIVSAHVH-----GKAGIMAAIKAG----  257
ident                    |      |         | |     |   |           
Sbjct ---------ATREnnVEGSLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTieng  239
DSSP  ---------LLLLllHHHHHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHhhll


DSSP  ---lLEEEELLLL-------LHHHHHHHHHHLLEEELLHHHHhhhhhhllllllllhhhl
Query ---cKSLEHVSYA-------DEEVWELMKEKGILYVATRSVIeiflasngeglvkeswak  307
ident         |             |   | |  |   |   |                    
Sbjct ykgrVTTSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSST------------------  281
DSSP  llllEEEEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLL------------------


DSSP  llhhHHHHhhHHHHHHHLLLLEELLLLLL-----llLLLH--HHHHHHHHLLLL----LH
Query lqalADSHlkAYQGAIKAGVTIALGTDTA-----pgGPTA--LELQFAVERGGM----TP  356
ident                  ||       |         |             |         
Sbjct ----PPTM--PVIKLLEAGINLGCASDNIrdfwvpfGNGDmvQGALIETQRLELktnrDL  335
DSSP  ----LLLL--LHHHHHHLLLEEEEELLLLlllllllLLLLhhHHHHHHHHHHLLllhhHH


DSSP  HHHHHHHLLLHHHHHHhhLLLLlLLLLLLLLLEEEELL-LLLLLHHHHhlhHHEEEEEEL
Query LEAIKAATANAPLSVGpqAPLTgQLREGYEADVIALEE-NPLEDIKVFqepKAVTHVWKG  415
ident     |  |       |           |  ||   |    |   |           | | 
Sbjct GLIWKMITSEGARVLG-iEKNY-GIEVGKKADLVVLNSlSPQWAIIDQ---AKRLCVIKN  390
DSSP  HHHHHHHLHHHHHHHL-lHHHL-LLLLLLLLLEEEELLlLHHHHHHHL---LLEEEEEEL


DSSP  LEEEELLlllLLLLlllllll
Query GKLFKGPgigPWGEdarnpfl  436
ident |                    
Sbjct GRIIVKD--eVIVA-------  402
DSSP  LEEEEEL--lEELL-------


No 11: Query=4c5yA Sbjct=2uz9A Z-score=27.4

back to top
DSSP  llLLEEEEEEeEELLLL----LLLEEEEEEEEEL-LEEEEEEEHHHL--LHHHHHH-llL
Query deAKVTIIYAgLLIPGD----GEPLRNAALVISD-KIIAFVGSEADI--PKKYLRS-tqS   52
ident       |               | ||   |  ||   | |           |        
Sbjct --PLAHIFRG-TFVHSTwtcpMEVLRDHLLGVSDsGKIVFLEEASQQekLAKEWCFkpcE   57
DSSP  --LLLEEEEE-EEEELLllllLEEEEEEEEEELLlLLEEEEEEHHHHhhHHHHHLLlhhH


DSSP  EEEE---EEEEELEEEEEELL-LLLL-----------llLLLL-HHHHHL-LHHHHHHHH
Query THRV---PVLMPGLWDCHMHF-GGDD-----------dyYNDY-TSGLAT-HPASSGARL   95
ident           |||| | | |                                        
Sbjct IRELshhEFFMPGLVDTHIHAsQYSFagssidlpllewlTKYTfPAEHRFqNIDFAEEVY  117
DSSP  EEELlllLEEEELEEEEEEEHhHHHHllllllllhhhhhHHLHhHHHHHHhLHHHHHHHH


DSSP  HHHHHHHHHLLEEEEEELLL----LHHHHHHHHHlllLLLLEEEELlLEEELLLllllll
Query ARGCWEALQNGYTSYRDLAG----YGCEVAKAINdgtIVGPNVYSSgAALSQTAghgdif  151
ident  |     | || |     |          |         |                    
Sbjct TRVVRRTLKNGTTTACYFATihtdSSLLLADITD---KFGQRAFVG-KVCMDLN------  167
DSSP  HHHHHHHHHLLEEEEEEELLllhhHHHHHHHHHH---HHLLEEEEE-LEELLLL------


DSSP  lllhhhHHHHhlllllllllllllleeELLLhHHHHHHHHHHHHHL--------LLLEEE
Query alpageVLGSygvmnprpgywgagplcIADGvEEVRRAVRLQIRRG--------AKVIXV  203
ident                                 ||                          
Sbjct ----dtFPEY-----------------KETT-EESIKETERFVSEMlqknysrvKPIVTP  205
DSSP  ----llLLLL-----------------LLLH-HHHHHHHHHHHHHHhhhlllleEEEEEE


DSSP  ELLLllllllllllllLLLHHHHHHHHHHHHHLLLLEEEEEL---------------lhH
Query MASGgvmsrddnpnfaQFSPEELKVIVEEAARQNRIVSAHVH---------------gkA  248
ident   |               |          |         |                    
Sbjct RFSL------------SCSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsykN  253
DSSP  LLHH------------HLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllllL


DSSP  HHHHHHHHLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhllllllllh
Query GIMAAIKAGC----KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLasngeglvkes  304
ident       |           |  |   |      | |                         
Sbjct YTSVYDKNNLltnkTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS-----------  302
DSSP  HHHHHHHLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-----------


DSSP  hhlllhhHHHHHhhHHHHHHLLLLEELLLLLL--llLLLHHHHHHHHHLL----------
Query waklqalADSHLkaYQGAIKAGVTIALGTDTA--pgGPTALELQFAVERG----------  352
ident                    |  | | |||| |             ||             
Sbjct -------SGFLN--VLEVLKHEVKIGLGTDVAggysYSMLDAIRRAVMVSnillinkvne  353
DSSP  -------LLLLL--HHHHHHLLLEEEELLLLLllllLLHHHHHHHHHHHHhhhhhlllll


DSSP  -LLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELL-----------------
Query -GMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEE-----------------  394
ident    |  |    ||       |      |    | | | |                     
Sbjct kSLTLKEVFRLATLGGSQALG-lDGEIGNFEVGKEFDAILINPkasdspidlfygdffgd  412
DSSP  lLLLHHHHHHHHLHHHHHHLL-lLLLLLLLLLLLLLLEEEELLlllllllllllhhhhll


DSSP  ----LLLLLHHHhHLHHHEEEEEELLEEEELlllllllllllllll
Query ----NPLEDIKVfQEPKAVTHVWKGGKLFKGpgigpwgedarnpfl  436
ident                      |  |||                   
Sbjct iseaVIQKFLYL-GDDRNIEEVYVGGKQVVP-------------fs  444
DSSP  lllhHHHHHHHH-LLHHHEEEEEELLEEEEL-------------ll


No 12: Query=4c5yA Sbjct=1k6wA Z-score=27.2

back to top
DSSP  lllLEEEEEEEEELllllLLEEEEEEEEELLEEEEEEEHHHllhhhhhhLLLEEEE--EE
Query deaKVTIIYAGLLIpgdgEPLRNAALVISDKIIAFVGSEADipkkylrsTQSTHRV--PV   58
ident        |    |                |  |                |          
Sbjct ---ALQTIINARLP----GEEGLWQIHLQDGKISAIDAQSG----vmpiTENSLDAeqGL   49
DSSP  ---LLLEEEEELLL----LLLLEEEEEEELLEEEEEEEELL----llllLLLEEELllLE


DSSP  EEELEEEEEELLL--LLLLLL------------LLLH-HHHHLLHHHHHHHHHHHHHHHH
Query LMPGLWDCHMHFG--GDDDYY------------NDYT-SGLATHPASSGARLARGCWEAL  103
ident   |     | |                                       |         
Sbjct VIPPFVEPHIHLDttQTAGQPnwnqsgtlfegiERWAeRKALLTHDDVKQRAWQTLKWQI  109
DSSP  EELLEEEEEELLLllLLLLLLlllllllhhhhhHHHHlLHHHLLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEELL----------lLHHHHHHHHHllllLLLEEEELlLEEELllllllllll
Query QNGYTSYRDLA----------gYGCEVAKAINdgtiVGPNVYSSgAALSQtaghgdifal  153
ident  ||    |                 ||                  |              
Sbjct ANGIQHVRTHVdvsdatltalkAMLEVKQEVA----PWIDLQIV-AFPQE----------  154
DSSP  HLLEEEEEEEEellllllhhhhHHHHHHHHHL----LLLEEEEE-EELLL----------


DSSP  lhhhhhhhhlllllllllllllleeELLLhHHHHHHHHHHHHHLLLLEEEELLLllllll
Query pagevlgsygvmnprpgywgagplcIADGvEEVRRAVRLQIRRGAKVIXVMASGgvmsrd  213
ident                                          | || |             
Sbjct -------------------------GILSyPNGEALLEEALRLGADVVGAIPHF------  183
DSSP  -------------------------LLLLlLLHHHHHHHHHHLLLLEEEELHHH------


DSSP  lllllllLLHHHHHHHHHHHHHLLLLEEEEEL-----lHHHHHHHHHHL-------lLEE
Query dnpnfaqFSPEELKVIVEEAARQNRIVSAHVH-----gKAGIMAAIKAG-------cKSL  261
ident           | |      |    |    |                              
Sbjct --eftreYGVESLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALAhhegmgarVTA  241
DSSP  --lllhhHHHHHHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHHhhhllhhhEEE


DSSP  EELLLL-------LHHHHHHHHHHLLEEELLHHHHHHHhhhllllllllhhhLLLH----
Query EHVSYA-------DEEVWELMKEKGILYVATRSVIEIFlasngeglvkeswaKLQA----  310
ident  |                 | |  ||  ||   |                          
Sbjct SHTTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHL--------------QGRFdtyp  287
DSSP  EELHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHH--------------LLLLllll


DSSP  hHHHHHhHHHHHHHLLLLEELLLLLL-------lLLLLHHHHHHHHHLLLL----LHHHH
Query lADSHLkAYQGAIKAGVTIALGTDTA-------pGGPTALELQFAVERGGM----TPLEA  359
ident                |     | |                 |                  
Sbjct kRRGIT-RVKEMLESGINVCFGHDDVfdpwyplgTANMLQVLHMGLHVCQLmgygQINDG  346
DSSP  lLLLLL-LHHHHHHLLLLEEELLLLLllllllllLLLHHHHHHHHHHHLLLllhhHHHHH


DSSP  HHHHLLLHHHHHHhhLLLLlLLLLLLLLLEEEELL-LLLLLHHHHhlhHHEEEEEELLEE
Query IKAATANAPLSVGpqAPLTgQLREGYEADVIALEE-NPLEDIKVFqepKAVTHVWKGGKL  418
ident     |                   |  |  | |   |             |     ||| 
Sbjct LNLITHHSARTLN--LQDY-GIAAGNSANLIILPAeNGFDALRRQ---VPVRYSVRGGKV  400
DSSP  HHHHLHHHHHHLL--LLLL-LLLLLLLLLEEEELLlLHHHHHHHL---LLLLEEEELLEE


DSSP  EELLL-----lllllllllllll
Query FKGPG-----igpwgedarnpfl  436
ident                        
Sbjct IASTQpaqttvyleqpeaidykr  423
DSSP  EEELLllleeeellleeeellll


No 13: Query=4c5yA Sbjct=3nqbA Z-score=25.9

back to top
DSSP  --------------------LLLLEEEEEEEEELLLLL-LLEEeEEEEEELLEEEEEEEH
Query --------------------DEAKVTIIYAGLLIPGDG-EPLRnAALVISDKIIAFVGSE   39
ident                     |      |  | |      |    |   |    || |   
Sbjct epadlnddtlraravaaargDQRFDVLITGGTLVDVVTgELRP-ADIGIVGALIASVHEP   59
DSSP  llhhhllhhhhhhhhhhhhlLLLEEEEEELLEEELLLLlLEEE-LEEEEELLEEEEEELL


DSSP  HHLLhhhhhHLLLEEEE--EEEEELEEEEEELLLLllllllllhhhhhllhhhhHHHHHH
Query ADIPkkylrSTQSTHRV--PVLMPGLWDCHMHFGGdddyyndytsglathpassGARLAR   97
ident |                      ||| | | |                          | 
Sbjct ASRR-----DAAQVIDAggAYVSPGLIDTHXHIES------------------sXITPAA   96
DSSP  LLLL-----LEEEEEELllLEEEELEEEEEELHHH------------------hLLLHHH


DSSP  HHHHHHHLLEEEEEELLL------------lHHHHHHHHhlllllLLEEEELlLEEELLl
Query GCWEALQNGYTSYRDLAG------------yGCEVAKAIndgtivGPNVYSSgAALSQTa  145
ident         | |                                          |      
Sbjct YAAAVVARGVTTIVWDPHefgnvhgvdgvrwAAKAIENL------PLRAILL-APSCVP-  148
DSSP  HHHHHHLLLEEEEEELLHhhhhhhlhhhhhhHHHHHLLL------LLEEEEE-ELLLLL-


DSSP  llLLLLlllHHHHhhHHLLlllllllllllleeelllhhhHHHHHHHHHHH-LLLLEE-E
Query ghGDIFalpAGEVlgSYGVmnprpgywgagplciadgveeVRRAVRLQIRR-GAKVIX-V  203
ident                                                         |   
Sbjct --SAPG---LERG--GADF---------------------DAAILADLLSWpEIGGIAeI  180
DSSP  --LLLL---LLLL--LLLL---------------------LHHHHHHHHLLlLEEEEEeE


DSSP  ELLlllllllllllllLLLH---HHHHHHHHHHHHLLLLEEEEELLHH--hHHHHHHHLL
Query MASggvmsrddnpnfaQFSP---EELKVIVEEAARQNRIVSAHVHGKA--gIMAAIKAGC  258
ident                             ||         |  |  |       |   || 
Sbjct XNX-------------RGVIerdPRXSGIVQAGLAAEKLVCGHARGLKnadLNAFXAAGV  227
DSSP  LLH-------------HHHHlllHHHHHHHHHHHHHLLEEEELLLLLLhhhHHHHHHLLL


DSSP  LEEEELLL--LLHHHHHHHhhhlLEEELLhHHHHhhhhhllllllllhhhlllhhhhhHH
Query KSLEHVSY--ADEEVWELMkekgILYVATrSVIEiflasngeglvkeswaklqaladsHL  316
ident  |                                                         |
Sbjct SSDHELVSgeDLXAKLRAG----LTIELR-GSHD-----------------------hLL  259
DSSP  LEELLLLLhhHHHHHHHLL----LEEEEE-LLLH-----------------------hHH


DSSP  HHHHHHHHLL----lLEELLLLLL------llLLLHHHHHHHHHLlLLLHHHHHHHHLLL
Query KAYQGAIKAG----vTIALGTDTA------pgGPTALELQFAVERgGMTPLEAIKAATAN  366
ident      |         |  | ||          |         |   |  |  |  ||| |
Sbjct PEFVAALNTLghlpqTVTLCTDDVfpddllqgGGLDDVVRRLVRY-GLKPEWALRAATLN  318
DSSP  HHHHHHHHHHlllllLEEEELLLLlhhhhhhlLLHHHHHHHHHHL-LLLHHHHHHHHLHH


DSSP  HHHHHHhhLLLLLLLLLLLLLLEEEELLlllllHHHHhlhhHEEEEEELLEEEELLlllL
Query APLSVGpqAPLTGQLREGYEADVIALEEnpledIKVFqepkAVTHVWKGGKLFKGPgigP  426
ident |    |      |    |  ||    |         |       ||   |          
Sbjct AAQRLG--RSDLGLIAAGRRADIVVFED-----LNGF----SARHVLASGRAVAEG--gR  365
DSSP  HHHHHL--LLLLLLLLLLLLLLEEEELL-----LLLL----LEEEEEELLEEEEEL--lE


DSSP  LLL---------------------------------------------------------
Query WGE---------------------------------------------------------  429
ident                                                             
Sbjct XLVdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgf  425
DSSP  ELLlllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct vvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxa  485
DSSP  ellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct laanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqp  545
DSSP  hhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllll


DSSP  -----------------------------------lllllll
Query -----------------------------------darnpfl  436
ident                                           
Sbjct pylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  llllhhhhhlllllllllleelllleeelllleeellleeel


No 14: Query=4c5yA Sbjct=4rdvB Z-score=25.1

back to top
DSSP  lllleEEEEEEEELLlLLLLEEEEEEEEEL-LEEEEEEEHHHllhhhhhhlLLEEEEEEE
Query deakvTIIYAGLLIPgDGEPLRNAALVISD-KIIAFVGSEADipkkylrstQSTHRVPVL   59
ident        | |           ||    ||     |     |                   
Sbjct -----SAIFAERALL-PEGWARNVRFEISAdGVLAEIRPDAN-------adGAERLGGAV   47
DSSP  -----LEEEEEEEEE-LLEEEEEEEEEELLlLLEEEEELLLL-------llLLEELLLLE


DSSP  EELEEEEEELLLL-----------------llllLLLLHHHHHLLHHHHHHHHHHHHHHH
Query MPGLWDCHMHFGG-----------------dddyYNDYTSGLATHPASSGARLARGCWEA  102
ident  ||    | |                           |       |            | 
Sbjct LPGMPNLHSHAFQramaglaevagnpndsfwtwrELMYRMVARLSPEQIEVIACQLYIEM  107
DSSP  EELEEEEEELHHHhhhlllllllllllllhhhhhHHHHHHHLLLLHHHHHHHHHHHHHHH


DSSP  HHLLEEEEEELLL---------------LHHHHHHHHHlllLLLLEEEELLlEEELLLLl
Query LQNGYTSYRDLAG---------------YGCEVAKAINdgtIVGPNVYSSGaALSQTAGh  147
ident |  |||                             |       |         |   || 
Sbjct LKAGYTAVAEFHYvhhdldgrsyadpaeLSLRISRAAS---AAGIGLTLLP-VLYSHAG-  162
DSSP  HHHLEEEEEEEELllllllllllllllhHHHHHHHHHH---HHLLEEEEEE-LLLLEEE-


DSSP  lllllllhhhHHHHHLlllllllllllllEEELllhhHHHHHHHHHHHHL--------lL
Query gdifalpageVLGSYGvmnprpgywgagpLCIAdgveEVRRAVRLQIRRG--------aK  199
ident                                |            |  |            
Sbjct -----fggqpASEGQR-------------RFIN----GSEAYLELLQRLRapleaaghsL  200
DSSP  -----llleeLLHHHL-------------LLLL----LHHHHHHHHHHHHhhhhhhlleE


DSSP  LEEEELLLllllllllllllLLLHHHHHHHHHHhHHLLLLEEEEEL-------------l
Query VIXVMASGgvmsrddnpnfaQFSPEELKVIVEEaARQNRIVSAHVH-------------g  246
ident                        |                |  |                
Sbjct GLCFHSLR------------AVTPQQIATVLAA-GHDDLPVHIHIAeqqkevddcqawsg  247
DSSP  LEEELLLL------------LLLHHHHHHHHLL-LLLLLLEEEEELllhhhhhhhhhhhl


DSSP  hHHHHHHH-HHLL---LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllll
Query kAGIMAAI-KAGC---KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLasngeglvk  302
ident                   | |   ||      |   |       |               
Sbjct rRPLQWLYeNVAVdqrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLG---------  298
DSSP  lLHHHHHHhHLLLlllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL---------


DSSP  lhhhlllhhHHHHhhHHHHHHHLLLLEELLLLLLllLLLH-HHHHHHHHLLL--------
Query eswaklqalADSHlkAYQGAIKAGVTIALGTDTApgGPTA-LELQFAVERGG--------  353
ident                        |     | |          ||                
Sbjct ---------DGIF--PATDFLAQGGRLGIGSDSH-vSLSVvEELRWLEYGQRlrdrkrnr  346
DSSP  ---------LLLL--LHHHHHHLLLEEEELLLLL-lLLLHhHHHHHHHHHHHhhhlllll


DSSP  -------lLHHHHHHHHLLLHHHHHhhhLLLLLLLLLLLLLLEEEELL------------
Query -------mTPLEAIKAATANAPLSVgpqAPLTGQLREGYEADVIALEE------------  394
ident                || |             | |  |  ||   |              
Sbjct lyrddqpmIGRTLYDAALAGGAQAL---GQPIGSLAVGRRADLLVLDGndpylasaegda  403
DSSP  llllllllHHHHHHHHHHHHHHHHH---LLLLLLLLLLLLLLEEEELLllhhhhllllhh


DSSP  LLLLLHHHhHLHHHEEEEEELLEEEELLlLLLL-------lllllllll
Query NPLEDIKVfQEPKAVTHVWKGGKLFKGPgIGPW-------gedarnpfl  436
ident               |  |   |                           
Sbjct LLNRWLFA-GGDRQVRDVMVAGRWVVRDgRHAGeersarafvqvlgell  451
DSSP  HHHHHHHH-LLHHHEEEEEELLEEEELLlLLLLhhhhhhhhhhhhhhhl


No 15: Query=4c5yA Sbjct=3giqA Z-score=24.4

back to top
DSSP  lLLLEEEEEEEEELLLL-LLLEEeEEEEEELLEEEEEEEhhhLLHHhhhHLLLEEEE--E
Query dEAKVTIIYAGLLIPGD-GEPLRnAALVISDKIIAFVGSeadIPKKylrSTQSTHRV--P   57
ident  |     |  |  | |      | | |   |  ||  |                      
Sbjct -EKLDFKITGGWIIDGTgAPRRR-ADLGVRDGRIAAIGE---LGAH---PARHAWDAsgK   52
DSSP  -LLEEEEEELLEELLLLlLLLEE-LEEEEELLEEEEEEL---LLLL---LEEEEEELllL


DSSP  EEEELEEEEEELLLLllllllllhhhhhllhhhHHHHHHHhHHHHHHLLEEEEEEL---L
Query VLMPGLWDCHMHFGGdddyyndytsglathpasSGARLARgCWEALQNGYTSYRDL---A  114
ident    ||  | | |                                    | |         
Sbjct IVAPGFIDVHGHDDL------------------MFVEKPD-LRWKTSQGITTVVVGncgV   93
DSSP  EEEELEEELLLLLLL------------------HHHHLLL-LHHHHLLLEEEEEELlllL


DSSP  LLH------------------------hHHHHHHHLlLLLLLEEEELlLEEEllllllll
Query GYG------------------------cEVAKAINDgTIVGPNVYSSgAALSqtaghgdi  150
ident                                 |         ||                
Sbjct SAApaplpgntaaalallgetplfadvpAYFAALDA-QRPMINVAAL-VGHA--------  143
DSSP  LLLlllllllllhhhhhhllllllllhhHHHHHHHH-LLLLLEEEEE-EEHH--------


DSSP  llllhhhhhhhhllllllllllllllEEEL------------lLHHHHHHHHHHHHHHLL
Query falpagevlgsygvmnprpgywgagpLCIA------------dGVEEVRRAVRLQIRRGA  198
ident                                                           ||
Sbjct --------------------------NLRLaamrdpqaaptaaEQQAMQDMLQAALEAGA  177
DSSP  --------------------------HHHHhhlllllllllhhHHHHHHHHHHHHHHHLL


DSSP  LLEEEELLLlllllllllllLLLLHHHHHHHHHHHHHLLLLEEEEE-----lLHHHHHHH
Query KVIXVMASGgvmsrddnpnfAQFSPEELKVIVEEAARQNRIVSAHV-----hGKAGIMAA  253
ident                     |     ||      ||   |    |         |     
Sbjct VGFSTGLAY--------qpgAVAQAAELEGLARVAAERRRLHTSHIrneadgVEAAVEEV  229
DSSP  LEEEEELLL--------llhHHLLHHHHHHHHHHHHHLLLEEEEELllllllHHHHHHHH


DSSP  HHHL-----LLEEEELLL-------lLHHHHHHHHHHL-----LEEELLHhHHHH-----
Query IKAG-----CKSLEHVSY-------aDEEVWELMKEKG-----ILYVATRsVIEI-----  291
ident    |          |                                             
Sbjct LAIGrgtgcATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYP-YPGSstili  288
DSSP  HHHHhhhllEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELL-LLEEeeell


DSSP  -----hhhhLLLLLL------------------------------LLHHHLllHHHHhhH
Query -----flasNGEGLV------------------------------KESWAKlqALADshL  316
ident                                                         |   
Sbjct peraetiddIRITWStphpecsgeyladiaarwgcdkttaarrlaPAGAIY--FAMD--E  344
DSSP  hhhllllllLEEEEElllhhhllllhhhhhhhhlllhhhhhhhhlLEEEEE--ELLL--H


DSSP  HHHHHHHHlLLLEELLLLLL--------lLLLLH-HHHHHHH-hllLLLHHHHHHHHLLL
Query KAYQGAIKaGVTIALGTDTA--------pGGPTA-LELQFAV-ergGMTPLEAIKAATAN  366
ident                | |                   |   |     ||   |    || 
Sbjct DEVKRIFQ-HPCCMVGSDGLpndarphprLWGSFtRVLGRYVrearLMTLEQAVARMTAL  403
DSSP  HHHHHHHH-LLLEEELLLLLllllllllhHHHHHhHHHHHHHhhllLLLHHHHHHHHLHH


DSSP  HHHHHhhHLLLLLLLLLLLLLLEEEELLLLlllhhHHHL---------HHHEEEEEELLE
Query APLSVgpQAPLTGQLREGYEADVIALEENPledikVFQE---------PKAVTHVWKGGK  417
ident             | |  |  |||            |                  |   | 
Sbjct PARVF--GFAERGVLQPGAWADVVVFDPDT-----VADRatwdeptlaSVGIAGVLVNGA  456
DSSP  HHHHH--LLLLLLLLLLLLLLLEEEELLLL-----LLLLlllllllllLLLEEEEEELLE


DSSP  EEELLlllllLLLLL-----llll
Query LFKGPgigpwGEDAR-----npfl  436
ident                         
Sbjct EVFPQ-----PPADGrpgqvlrax  475
DSSP  EEELL-----LLLLLlllllllll


No 16: Query=4c5yA Sbjct=1onxA Z-score=24.3

back to top
DSSP  ----lLLLEEEEEEEEELLLLllLEEEEEEEEELLEEEEEEEHhhLLHHHHHHLlLEEEE
Query ----dEAKVTIIYAGLLIPGDgePLRNAALVISDKIIAFVGSEadIPKKYLRSTqSTHRV   56
ident       |  |      |                   |  | |   ||             
Sbjct midytAAGFTLLQGAHLYAPE--DRGICDVLVANGKIIAVASN--IPSDIVPNC-TVVDL   55
DSSP  llllhHHLLEEEEEEEEELLL--EEEEEEEEEELLEEEEEELL--LLLLLLLLL-EEEEL


DSSP  --EEEEELEEEEEELLLLL--lLLLLLLhhhhhllhhhhhhHHHHhHHHHHHLLEEEEEE
Query --PVLMPGLWDCHMHFGGD--dDYYNDYtsglathpassgaRLARgCWEALQNGYTSYRD  112
ident     | ||  | | |  |                                   | ||   
Sbjct sgQILCPGFIDQHVHLIGGggeAGPTTR------------tPEVA-LSRLTEAGVTSVVG  102
DSSP  llLEEEELEEEEEELLLLLlllLLHHHL------------lLLLL-HHHHHHLLEEEEEE


DSSP  LL---------lLHHHHHHHHHLlllLLLEEEELLLEEELlllllllllllhhhhhhhhl
Query LA---------gYGCEVAKAINDgtiVGPNVYSSGAALSQtaghgdifalpagevlgsyg  163
ident |                  | |     |        |                       
Sbjct LLgtdsisrhpeSLLAKTRALNE---EGISAWMLTGAYHV--------------------  139
DSSP  LLllllllllhhHHHHHHHHHHH---HLLEEEEEEELLLL--------------------


DSSP  llllllllllllleeelllhhhhhHHHHHH-HHHL-LLLEEEELLLLlllllllllllLL
Query vmnprpgywgagplciadgveevrRAVRLQ-IRRG-AKVIXVMASGGvmsrddnpnfaQF  221
ident                           |             |   |               
Sbjct ------------------psrtitGSVEKDvAIIDrVIGVXCAISDH--------rsaAP  173
DSSP  ------------------llllllLLHHHHhHHLLlEEEEEEEELLL--------lllLL


DSSP  LHHHHHHHHHHHHHLL------LLEEEEELL-hHHHHHHHHHL--------LLEEEELL-
Query SPEELKVIVEEAARQN------RIVSAHVHG-kAGIMAAIKAG--------CKSLEHVS-  265
ident     |     |                |                            ||  
Sbjct DVYHLANMAAESRVGGllggkpGVTVFHMGDskKALQPIYDLLencdvpisKLLPTHVNr  233
DSSP  LHHHHHHHHHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHHhlllllhhHEEEELHHh


DSSP  ---LLLHhHHHHHHHHLlEEELLHHHHhhhhhhllllllllhhhlllhhHHHH-hHHHHH
Query ---YADEeVWELMKEKGiLYVATRSVIeiflasngeglvkeswaklqalADSH-lKAYQG  321
ident           |     |     | |                                   
Sbjct nvpLFEQ-ALEFARKGG-TIDITSSID----------------------EPVApaEGIAR  269
DSSP  lhhHHHH-HHHHHHLLL-LEEEELLLL----------------------LLLLhhHHHHH


DSSP  HHHLLL---LEELLLLLL-----------------lLLLLH-HHHHHHHHLLLLLHHHHH
Query AIKAGV---TIALGTDTA-----------------pGGPTA-LELQFAVERGGMTPLEAI  360
ident |  ||       |  |                    |  |     |  |         | 
Sbjct AVQAGIplaRVTLSSDGNgsqpffddegnlthigvaGFETLlETVQVLVKDYDFSISDAL  329
DSSP  HHHLLLlhhHEEEELLLLleeeeellllleeeeeelLLHHHhHHHHHHHHHHLLLHHHHH


DSSP  HHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELLLLlllhhhhhlhhHEEEEEELLEEEE
Query KAATANAPLSVGpqAPLTGQLREGYEADVIALEENPledikvfqepkAVTHVWKGGKLFK  420
ident    |              |    |  ||                       |   |||  
Sbjct RPLTSSVAGFLN--LTGKGEILPGNDADLLVMTPEL-----------RIEQVYARGKLMV  376
DSSP  HHHLHHHHHHLL--LLLLLLLLLLLLLLEEEELLLL-----------LEEEEEELLEEEE


DSSP  LL-lLLLLlllllllll
Query GP-gIGPWgedarnpfl  436
ident                  
Sbjct KDgkACVK---gtfetd  390
DSSP  ELleELLL---llllll


No 17: Query=4c5yA Sbjct=1yrrB Z-score=24.2

back to top
DSSP  lllleEEEEEEEELLLlLLLEEEEEEEEELLEEEEEEEHHHLLHHHhhhllLEEEE--EE
Query deakvTIIYAGLLIPGdGEPLRNAALVISDKIIAFVGSEADIPKKYlrstqSTHRV--PV   58
ident           |    |  | |   | || |  |  |   |  |                 
Sbjct -----YALTQGRIFTG-HEFLDDHAVVIADGLIKSVCPVAELPPEI-----EQRSLngAI   49
DSSP  -----LEEELLEEELL-LLEELLEEEEEELLEEEEEEEHHHLLLLL-----LEEELllLE


DSSP  EEELEEEEEELL----LLLLllllllhhhhHLLHhhHHHHHHHHHHHHHHLLEEEEEELL
Query LMPGLWDCHMHF----GGDDdyyndytsglATHPasSGARLARGCWEALQNGYTSYRDLA  114
ident | ||  |            |                |   |          | | |    
Sbjct LSPGFIDVQLNGcggvQFND----------TAEA-vSVETLEIMQKANEKSGCTNYLPTL   98
DSSP  EEELEEEEEELEelleELLL----------LLLL-lLHHHHHHHHHHHHLLLEEEEEEEE


DSSP  ------------lLHHHHHHHHHllllllLEEEELlLEEELlllllllllllhhhhhhhh
Query ------------gYGCEVAKAINdgtivgPNVYSSgAALSQtaghgdifalpagevlgsy  162
ident                 |                                           
Sbjct ittsdelmkqgvrVMREYLAKHP-----nQALGLH-LEGPW-------------------  133
DSSP  llllhhhhhhhhhHHHHHHHHLL-----lLLLLEE-EELLL-------------------


DSSP  lllllllllllllleeelllHHHHHHHHHHHHhhLLLLEEEELlllllllllllllLLLL
Query gvmnprpgywgagplciadgVEEVRRAVRLQIrrGAKVIXVMAsggvmsrddnpnfAQFS  222
ident                        |                                    
Sbjct ------------------lnAALVDFLCENAD--VITKVTLAP-------------EMVP  160
DSSP  ------------------llLHHHHHHHHLHH--HEEEEEELH-------------HHLL


DSSP  HHHHHHHHHHHhhllLLEEEE--elLHHHHHHHHHHLLLEEEELL----------lllhH
Query PEELKVIVEEAarqnRIVSAH--vhGKAGIMAAIKAGCKSLEHVS----------yadeE  270
ident  |               |||           |   ||     |                 
Sbjct AEVISKLANAG----IVVSAGhsnaTLKEAKAGFRAGITFATHLYnampyitgrepglaG  216
DSSP  HHHHHHHHHHL----LEEEELllllLHHHHHHHHHHLEEEELLLLlllllllllllhhhH


DSSP  HHHHHHhhLLEEELLHHHHHhhhhhllllllllhhhlllhhhhhHHHHHHHHHHLLL-LE
Query VWELMKekGILYVATRSVIEiflasngeglvkeswaklqaladsHLKAYQGAIKAGV-TI  329
ident          |                                         |        
Sbjct AILDEA--DIYCGIIADGLH-----------------------vDYANIRNAKRLKGdKL  251
DSSP  HHHHLL--LLEEEEELLLLL-----------------------lLHHHHHHHHHHHHhHE


DSSP  ELLLLLL-llLLLH-HHHHHHHHLLLLLHHHHHHHHLLLHHHHHHhHLLLLLLLLLLLLL
Query ALGTDTA-pgGPTA-LELQFAVERGGMTPLEAIKAATANAPLSVGpQAPLTGQLREGYEA  387
ident  | ||       |        ||  |    |    ||       |      | |  |  |
Sbjct CLVTDATsgsSLTMiEGVRNLVEHCGIALDEVLRMATLYPARAIG-VEKRLGTLAAGKVA  310
DSSP  EEELLLLlllLLLHhHHHHHHHHHHLLLHHHHHHHHLHHHHHHLL-LLLLLLLLLLLLLL


DSSP  LEEEELLLLlllhhhhhlhhHEEEEEELLEEEELLllllllllllllll
Query DVIALEENPledikvfqepkAVTHVWKGGKLFKGPgigpwgedarnpfl  436
ident    |                  |     |                    
Sbjct NLTAFTPDF-----------KITKTIVNGNEVVTQ--------------  334
DSSP  LEEEELLLL-----------LEEEEEELLEEEEEL--------------


No 18: Query=4c5yA Sbjct=3ooqA Z-score=23.4

back to top
DSSP  llllEEEEEEEEELLLLLLLEEeEEEEEELLEEEEEEEHhhllhhHHHHLlLEEEE--EE
Query deakVTIIYAGLLIPGDGEPLRnAALVISDKIIAFVGSEadipkkYLRSTqSTHRV--PV   58
ident               |    |        |      ||                       
Sbjct ----KILFKNATVFPITSRPFK-GDVLVSNGKVEKVGEN-----iEDPDA-EIVDLtgKF   49
DSSP  ----LEEEEEEEELLLLLLLEE-EEEEEELLEEEEEELL-----lLLLLL-EEEELllLE


DSSP  EEELEEEEEELL--LLLLLLlllLHHHH-----------hllhhhhHHHHhHHHHHHHHL
Query LMPGLWDCHMHF--GGDDDYyndYTSGL-----------athpassGARLaRGCWEALQN  105
ident | ||  | | |            |                                ||  
Sbjct LFPGFVDAHSHIglFEEGVG---YYYSDgneatdpvtphvkaldgfNPQD-PAIERALAG  105
DSSP  EEELEEEEEELLllLLLLLL---HHHLLlllllllllllllhhhhlLLLL-HHHHHHHLL


DSSP  LEEEEEELL------------llhhhhHHHHHllllllleeeellleeelllllllllll
Query GYTSYRDLA------------gygcevAKAINdgtivgpnvyssgaalsqtaghgdifal  153
ident | ||                                                        
Sbjct GVTSVXIVPgsanpvggqgsvikfrsiIVEEC----------------------------  137
DSSP  LEEEEEELLllllleeeeeeeeellllLHHHH----------------------------


DSSP  lhhhhhhhhlllllllllllllleeelllhhhhhhhhhhhhhhLLLLEEEELLLLllLLL
Query pagevlgsygvmnprpgywgagplciadgveevrravrlqirrGAKVIXVMASGGvmSRD  213
ident                                                             
Sbjct ----------------------------------------ivkDPAGLKXAFGENpkRVY  157
DSSP  ----------------------------------------eeeEEEEEEEELLHHhhHHH


DSSP  L----lllllllLHHHHH------------------------------hhhHHHHHLLLL
Query D----npnfaqfSPEELK------------------------------vivEEAARQNRI  239
ident                                                    |   |    
Sbjct GerkqtpstrxgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevgEXVLRKKIP  217
DSSP  HhlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLL


DSSP  EEEEELLHHHHHHHHHHL-----LLEEEELLLLLHhHHHHHHHHLLEEELL-HHHHhhhh
Query VSAHVHGKAGIMAAIKAG-----CKSLEHVSYADEeVWELMKEKGILYVAT-RSVIeifl  293
ident    | |    |  ||            ||   |         || |  |           
Sbjct ARXHAHRADDILTAIRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGpLLTF----  272
DSSP  EEEEELLHHHHHHHHHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEELlLLLL----


DSSP  hhllllllllhhhLLLHHHHHHH-HHHHHHHHLLLLEELLLLLL--LLLLLHHHHHHHHH
Query asngeglvkeswaKLQALADSHL-KAYQGAIKAGVTIALGTDTA--PGGPTALELQFAVE  350
ident                                | || |||  |    |          |  
Sbjct -------------RTKLELKDLTxETIAKLLKDGVLIALXCDHPviPLEFATVQAATAXR  319
DSSP  -------------LLLHHHLLLLlLHHHHHHHLLLLEEELLLLLllLHHHHHHHHHHHHH


DSSP  LlLLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELLLLlllHHHHhlhHHEE
Query RgGMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEENPledIKVFqepKAVT  410
ident   |       |  | |     |      |    |  ||       |            | 
Sbjct Y-GAKEEDLLKILTVNPAKILG-lEDRIGSIEPGKDADLVVWSGHP---FDXK---SVVE  371
DSSP  H-LLLHHHHHHLLLHHHHHHLL-lLLLLLLLLLLLLLLEEEELLLL---LLLL---LLEE


DSSP  EEEELLEEEELLLlllllllllllll
Query HVWKGGKLFKGPGigpwgedarnpfl  436
ident  |   |                    
Sbjct RVYIDGVEVFRRE-------------  384
DSSP  EEEELLEEEEELL-------------


No 19: Query=4c5yA Sbjct=2ogjA Z-score=22.1

back to top
DSSP  llLLEEEEEEEEELlLLLL--LEEEEEEEEEL-LEEEEEEehHHLLhhhHHHLlLEEEE-
Query deAKVTIIYAGLLIpGDGE--PLRNAALVISD-KIIAFVGseADIPkkyLRSTqSTHRV-   56
ident                | |           |     || ||                    
Sbjct --QAPILLTNVKPV-GFGKgaSQSSTDILIGGdGKIAAVG--SALQ---APAD-TQRIDa   51
DSSP  --LLLEEEEEEEEL-LLLLllLLLLEEEEELLlLLEEEEE--LLLL---LLLL-EEELLl


DSSP  EEEEELEEEEEELLLLLlllllllhHHHHllhhhhhhhhhhHHHH-HHHLLEEEEEELLL
Query PVLMPGLWDCHMHFGGDddyyndytSGLAthpassgarlarGCWE-ALQNGYTSYRDLAG  115
ident     ||  | | |                               |     | |   |   
Sbjct AFISPGWVDLHVHIWHG--------GTDI----------siRPSEcGAERGVTTLVDAGS   93
DSSP  LEEEELEEEEEELLLLL--------LLLL----------llLHHHlLHHHLEEEEEEELL


DSSP  --------LHHHHHHHHhlllllLLEEEELlLEEE-lllllLLLLlllhhhhhhhhllll
Query --------YGCEVAKAIndgtivGPNVYSSgAALS-qtaghGDIFalpagevlgsygvmn  166
ident                                  |                          
Sbjct ageanfhgFREYIIEPS------RERIKAF-LNLGsiglvaCNRV---------------  131
DSSP  lllllhhhHHHHLLLLL------LLEEEEE-EELLllllllLLLL---------------


DSSP  lllllllllleEELLLhhHHHHHHH-HHHHHL--LLLEEEELLLLlllllllllllllLH
Query prpgywgagplCIADGveEVRRAVR-LQIRRG--AKVIXVMASGGvmsrddnpnfaqfSP  223
ident               |                       || ||                 
Sbjct ----------pELRDIkdIDLDRILeCYAENSehIVGLXVRASHV--------itgswGV  173
DSSP  ----------lLLLLHhhLLHHHHHhHHHLLLllEEEEEEEELHH--------hhlllLL


DSSP  HHHHHHHHHHHHLLLLEEEEELLHH-HHHHHHHHL--lLEEEELL------LLLHH--HH
Query EELKVIVEEAARQNRIVSAHVHGKA-GIMAAIKAG--cKSLEHVS------YADEE--VW  272
ident    |     |         ||                     |           |     
Sbjct TPVKLGKKIAKILKVPXXVHVGEPPaLYDEVLEILgpgDVVTHCFngksgsSIXEDedLF  233
DSSP  HHHHHHHHHHHHHLLLEEEEELLLLlLHHHHHHHLlllLEEELLLllllllLLLLLhhHH


DSSP  HHHHHH-LLEEELLHHHHhhhhhhllllllllhhhlllhhhhhHHHHHHHHHH-LLLLEE
Query ELMKEK-GILYVATRSVIeiflasngeglvkeswaklqaladsHLKAYQGAIK-AGVTIA  330
ident  |     ||                                    |    ||        
Sbjct NLAERCeGIRLDIGHGGA-----------------------sfSFKVAEAAIArGLLPFS  270
DSSP  HHHHHLlLLEEELLLLLL-----------------------llLHHHHHHHHHlLLLLLL


DSSP  LLLLLL------llLLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHHhhhLLLL-lLLLL
Query LGTDTA------pgGPTALELQFAVERgGMTPLEAIKAATANAPLSVgpqAPLT-gQLRE  383
ident   ||             |                   | | |               |  
Sbjct ISTDLHghsxnfpvWDLATTXSKLLSV-DXPFENVVEAVTRNPASVI---RLDXenRLDV  326
DSSP  LLLLLLllllllllLLHHHHHHHHHHL-LLLHHHHHHLLLHHHHHHL---LLLLllLLLL


DSSP  LLLLLEEEELllLLLL---------------HHHHhlhhhEEEEEELLEEEEllllllll
Query GYEADVIALEenPLED---------------IKVFqepkaVTHVWKGGKLFKgpgigpwg  428
ident |  ||                                         |             
Sbjct GQRADFTVFD--LVDAdleatdsngdvsrlkRLFE-----PRYAVIGAEAIA--------  371
DSSP  LLLLEEEEEE--EEEEeeeeellllleeeeeEEEE-----EEEEEELLEEEE--------


DSSP  llllllll
Query edarnpfl  436
ident         
Sbjct asryipra  379
DSSP  llllllll


No 20: Query=4c5yA Sbjct=1gkpA Z-score=21.4

back to top
DSSP  llllEEEEEEEEELlLLLLLEEeEEEEEELLEEEEEEehHHLLhhHHHHLlLEEEE--EE
Query deakVTIIYAGLLIpGDGEPLRnAALVISDKIIAFVGseADIPkkYLRSTqSTHRV--PV   58
ident        |  |  |         |        |   |            |          
Sbjct ----PLLIKNGEII-TADSRYK-ADIYAEGETITRIG--QNLE--APPGT-EVIDAtgKY   49
DSSP  ----LEEEELLEEE-ELLEEEE-LEEEELLLLLLEEE--LLLL--LLLLL-EEEELllLE


DSSP  EEELEEEEEELLLLLlllllllhhHHHLLhhhHHHHHHHHHHHHHHLLEEEEEELLL---
Query LMPGLWDCHMHFGGDddyyndytsGLATHpasSGARLARGCWEALQNGYTSYRDLAG---  115
ident   ||  | | |               ||           |   ||  | | |        
Sbjct VFPGFIDPHVHIYLP---------FMATF---AKDTHETGSKAALMGGTTTYIEMCCpsr   97
DSSP  EEELEEEEEELLLLE---------ELLEE---LLLLHHHHHHHHHHLLEEEEEEEELlll


DSSP  ---------lHHHHHHHHhllllLLLEEEELlLEEEllllllllllllhhhhhhhhllll
Query ---------yGCEVAKAIndgtiVGPNVYSSgAALSqtaghgdifalpagevlgsygvmn  166
ident               |                  | |                        
Sbjct nddalegyqlWKSKAEGN-----SYCDYTFH-MAVS------------------------  127
DSSP  lllhhhhhhhHHHHHLLL-----LLLEEEEE-EELL------------------------


DSSP  lllllllllleeELLLhhHHHHHHHHHHHHLLLLEEEELLLllllllllllllLLLHHHH
Query prpgywgagplcIADGveEVRRAVRLQIRRGAKVIXVMASGgvmsrddnpnfaQFSPEEL  226
ident               |         |     |    |   |                  | 
Sbjct ------------KFDE--KTEGQLREIVADGISSFXIFLSY--------knffGVDDGEM  165
DSSP  ------------LLLL--LHHHHHHHHHHLLLLEEEEEELL--------llllLLLHHHH


DSSP  HHHHHHHHHLLLLEEEEEL-------------------------------LHHHHHHHHH
Query KVIVEEAARQNRIVSAHVH-------------------------------GKAGIMAAIK  255
ident       |     || ||                                    |      
Sbjct YQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGTARFAT  225
DSSP  HHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHH


DSSP  HL-----LLEEEELLL--LLHHHHHHHH-HHLLEEELLHHHHHHHHHHL------LLLLl
Query AG-----CKSLEHVSY--ADEEVWELMK-EKGILYVATRSVIEIFLASN------GEGLv  301
ident             | |   |             |                           
Sbjct FLettgaTGYVVHLSCkpALDAAMAAKArGVPIYIESVIPHFLLDKTYAerggveAMKY-  284
DSSP  HHhhhllEEEELLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLHHHHhllhhhHHLL-


DSSP  llhhhlllHHHHHhHHHHHHHHHLLLLEELLLLLL----------------------lLL
Query keswaklqALADShLKAYQGAIKAGVTIALGTDTA----------------------pGG  339
ident                |    |   |     |||                           
Sbjct --imspplRDKRN-QKVLWDALAQGFIDTVGTDHCpfdteqkllgkeaftaipngipaIE  341
DSSP  --llllllLLLHH-HHHHHHHHHLLLLLEEELLLLlllhhhhhhhlllhhhlllllllLL


DSSP  LLH-HHHHHHHhllLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLL--
Query PTA-LELQFAVergGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEEN--  395
ident     |     |            ||   |            |    |  ||         
Sbjct DRVnLLYTYGVsrgRLDIHRFVDAASTKAAKLF--GLFPrKGTIAVGSDADLVVYDPQyr  399
DSSP  LHHhHHHHHHLlllLLLHHHHHHHHLHHHHHHL--LLLLlLLLLLLLLLLLEEEEELLll


DSSP  -----------------lllLHHHhhlhhHEEEEEELLEEEELLllLLLLL-------ll
Query -----------------pleDIKVfqepkAVTHVWKGGKLFKGPgiGPWGE-------da  431
ident                      |           |   ||          ||         
Sbjct gtisvktqhvnndyngfegfEIDG-----RPSVVTVRGKVAVRD-gQFVGEkgwgkllrr  453
DSSP  eellhhhlllllllllllllEELL-----EEEEEEELLEEEEEL-lEELLLlllllllll


DSSP  lllll
Query rnpfl  436
ident      
Sbjct epmyf  458
DSSP  lllll


No 21: Query=4c5yA Sbjct=3griA Z-score=21.1

back to top
DSSP  llllEEEEEEEEELlllLLLEEeEEEEEELLEEEEEEEhhHLLHhhHHHLlLEEEE--EE
Query deakVTIIYAGLLIpgdGEPLRnAALVISDKIIAFVGSeaDIPKkyLRSTqSTHRV--PV   58
ident        |  |      ||    |   |  | |        |                  
Sbjct ----XKLIKNGKVL-qnGELQQ-ADILIDGKVIKQIAP--AIEP--SNGV-DIIDAkgHF   49
DSSP  ----LEEEELLEEE-elLEEEE-LEEEEELLEEEEEEL--LLLL--LLLL-EEEELllLE


DSSP  EEELEEEEEELLLLLlllllllhhhhhllhhHHHH--HHHHHHHHHHHLLEEEEEELLLL
Query LMPGLWDCHMHFGGDddyyndytsglathpaSSGA--RLARGCWEALQNGYTSYRDLAGY  116
ident   ||  | | |                              |   |   | |        
Sbjct VSPGFVDVHVHLREP----------------GGEYkeTIETGTKAAARGGFTTVCPXPNT   93
DSSP  EEELEEEEEELLLLL----------------LLLLllLHHHHHHHHHHLLEEEEEELLLL


DSSP  ---------hhHHHHHHHLllLLLLEEEELlLEEEllllllllllllhhhhhhhhlllll
Query ---------gcEVAKAINDgtIVGPNVYSSgAALSqtaghgdifalpagevlgsygvmnp  167
ident               | | |       |    |                            
Sbjct rpvpdsvehfeALQKLIDD--NAQVRVLPY-ASIT-------------------------  125
DSSP  llllllhhhhhHHHHHHHH--HLLLEELLL-EELL-------------------------


DSSP  lllllllllEEELLlhhHHHHhHHHHHHHLLLLEEEElllllllllllllllLLLHHHHH
Query rpgywgagpLCIADgveEVRRaVRLQIRRGAKVIXVMasggvmsrddnpnfaQFSPEELK  227
ident                  |           ||                             
Sbjct --------tRQLGK---ELVD-FPALVKEGAFAFTDD------------gvgVQTASXXY  161
DSSP  --------hHHLLL---LLLL-HHHHHLLLLLLEEEL------------lllLLLHHHHH


DSSP  HHHHHHHHLLLLEEEEEL----------------------------LHHHHHHHHHHL--
Query VIVEEAARQNRIVSAHVH----------------------------GKAGIMAAIKAG--  257
ident     |||  |    ||                                  |         
Sbjct EGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnicESVQIARDVLLAea  221
DSSP  HHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHhh


DSSP  ---LLEEEELLL--LLHHHHHHHH-HHLLEEELLHHHHHH-hHHHL--LLLLlllhhhll
Query ---CKSLEHVSY--ADEEVWELMK-EKGILYVATRSVIEI-fLASN--GEGLvkeswakl  308
ident         |||                      |                          
Sbjct agcHYHVCHVSTkeSVRVIRDAKRaGIHVTAEVTPHHLLLteDDIPgnNAIY---kxnpp  278
DSSP  hllLEEELLLLLhhHHHHHHHHHHlLLLEEEEELHHHHHLlhHHLLllLHHH---lllll


DSSP  lHHHHHhHHHHHHHHHLLLLEELLLLLL----------------llLLLHHHH-HHHHHL
Query qALADShLKAYQGAIKAGVTIALGTDTA----------------pgGPTALEL-QFAVER  351
ident          |       |      || |                                
Sbjct lRSTED-REALLEGLLDGTIDCIATDHAphardekaqpxekapfgiVGSETAFpLLYTHF  337
DSSP  lLLHHH-HHHHHHHHHLLLLLEELLLLLlllhhhhlllllllllllLLLLLHHhHHHHHH


DSSP  ---llLLHHHHHHHHLLLHHHHHhhhLLLLLLLLLLLLLLEEEELLL-------------
Query ---ggMTPLEAIKAATANAPLSVgpqAPLTGQLREGYEADVIALEEN-------------  395
ident       |        |              | | |   ||                    
Sbjct vkngdWTLQQLVDYLTIKPCETF---NLEYGTLKENGYADLTIIDLDseqeikgedflsk  394
DSSP  lllllLLHHHHHHHHLHHHHHHL---LLLLLLLLLLLLLLEEEEELLlleellhhhllll


DSSP  ------llllHHHHhlhhhEEEEEELLEEEELLllllllllllllll
Query ------pledIKVFqepkaVTHVWKGGKLFKGPgigpwgedarnpfl  436
ident                           |                    
Sbjct adntpfigykVYGN-----PILTXVEGEVKFEG--------------  422
DSSP  llllllllleELLE-----EEEEEELLEEEEEL--------------


No 22: Query=4c5yA Sbjct=3e74A Z-score=21.0

back to top
DSSP  llLLEEEEEEEEELLlLLLLEEeEEEEEELLEEEEEEehHHLLhhhhhHLLLEEEE--EE
Query deAKVTIIYAGLLIPgDGEPLRnAALVISDKIIAFVGseADIPkkylrSTQSTHRV--PV   58
ident       ||  |  |    |             ||  |   |                  |
Sbjct --SFDLIIKNGTVIL-ENEARV-VDIAVKGGKIAAIG--QDLG-----DAKEVXDAsgLV   49
DSSP  --LEEEEEELLEEEL-LLLEEE-LEEEEELLEEEEEE--LLLL-----LEEEEEELllLE


DSSP  EEELEEEEEELLllllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLL---
Query LMPGLWDCHMHFggdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAG---  115
ident   ||  | | |                            |   |   | |          
Sbjct VSPGXVDAHTHI-----------------------GYETGTRAAAKGGITTXIEXPLnql   86
DSSP  EEELEEEEEELL-----------------------LHHHHHHHHHHLLEEEEEELLLlll


DSSP  -------lhhHHHHHHHllLLLLLEEEELlLEEELlllllllllllhhhhhhhhllllll
Query -------ygcEVAKAINdgTIVGPNVYSSgAALSQtaghgdifalpagevlgsygvmnpr  168
ident               |                 |                           
Sbjct patvdrasieLKFDAAK--GKLTIDAAQL-GGLVS-------------------------  118
DSSP  lllllhhhhhHHHHHHL--LLLLLEEEEL-EELLL-------------------------


DSSP  lllllllleeelllhhHHHHHHHHHHHHLLLLEEEELllllllllllllllLLLHHHHHH
Query pgywgagplciadgveEVRRAVRLQIRRGAKVIXVMAsggvmsrddnpnfaQFSPEELKV  228
ident                             |    |                          
Sbjct ----------------YNIDRLHELDEVGVVGFXCFV-------------rDVNDWQFFK  149
DSSP  ----------------LLLLLHHHHHHHLLLLEEEEL-------------lLLLHHHHHH


DSSP  HHHHHHHLLLLEEEEEL-------------------------------LHHHHHHHHHHL
Query IVEEAARQNRIVSAHVH-------------------------------GKAGIMAAIKAG  257
ident            |  |                                     |       
Sbjct GAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLA  209
DSSP  HHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHH


DSSP  -----LLEEEELLL--LLHHHHHHHH-HHLLEEELLHHHHHHH-HHHL-LLLL-lllhhh
Query -----CKSLEHVSY--ADEEVWELMK-EKGILYVATRSVIEIF-LASN-GEGL-vkeswa  306
ident           |||     |||         |                     |       
Sbjct kvagcRLHVCHVSSpeGVEEVTRARQeGQDITCESCPHYFVLDtDQFEeIGTLakcsppi  269
DSSP  hhhllLEEELLLLLhhHHHHHHHHHHlLLLEEEEELLHHHHLLhHHHHhHLHHhllllll


DSSP  LLLHHHHHHHhhhHHHHHlLLLEELLLLLL-------------------lLLLLH-HHHH
Query KLQALADSHLkayQGAIKaGVTIALGTDTA-------------------pGGPTA-LELQ  346
ident                    |    |  |                                
Sbjct RDLENQKGXW---EKLFN-GEIDCLVSDHSpcppexkagnixkawggiagLQSCXdVXFD  325
DSSP  LLHHHHHHHH---HHHHL-LLLLEELLLLLllllllllllllllllllllHHHHHhHHHH


DSSP  HHHHllLLLHHHHHHHHLLLHHHHHhhHLLLLLLLLLLLLLLEEEELL------------
Query FAVErgGMTPLEAIKAATANAPLSVgpQAPLTGQLREGYEADVIALEE------------  394
ident  ||   |       |    ||           |    |  ||                  
Sbjct EAVQkrGXSLPXFGKLXATNAADIF--GLQQKGRIAPGKDADFVFIQPnssyvltnddle  383
DSSP  HHLLllLLLHHHHHHHHLHHHHHHL--LLLLLLLLLLLLLLLEEEEELllleellhhhll


DSSP  -------llllLHHHhhlhhHEEEEEELLEEEELLLLlLLLLL---llllll
Query -------npleDIKVfqepkAVTHVWKGGKLFKGPGIgPWGED---arnpfl  436
ident             |         |     |                       
Sbjct yrhkvspyvgrTIGA-----RITKTILRGDVIYDIEQ-GFPVApkgqfilkh  429
DSSP  lllllllllllEELL-----EEEEEEELLEEEEELLL-LLLLLlllleelll


No 23: Query=4c5yA Sbjct=2imrA Z-score=20.3

back to top
DSSP  llLLEEEEEEEEELLlllLLEEEEEEEEELLEEEEEEEHHHLLHHhHHHLlLEEEEE-EE
Query deAKVTIIYAGLLIPgdgEPLRNAALVISDKIIAFVGSEADIPKKyLRSTqSTHRVP-VL   59
ident             |             |      |  |                 |   | 
Sbjct --HTPRLLTCDVLYT---GAQSPGGVVVVGETVAAAGHPDELRRQ-YPHA-AEERAGaVI   53
DSSP  --LLEEEEEELEEEL---LEELLEEEEEELLEEEEEELHHHHHHH-LLLL-EEEELLlEE


DSSP  EELEEEEEELLL-------------lllllLLLLHHhhhllhhhHHHHHHHHHHHHHHLL
Query MPGLWDCHMHFG-------------gdddyYNDYTSglathpasSGARLARGCWEALQNG  106
ident  |     | |                                    |    |       |
Sbjct APPPVNAHTHLDmsayefqalpyfqwipevVIRGRH------lrGVAAAQAGADTLTRLG  107
DSSP  LLLLLEEEEELLllhhhhhhlhhhhllhhhHHHHLL------llHHHHHHHHHHHHHHLL


DSSP  EEEEEELLLL--hHHHHHHHHlllllLLEEEELlLEEELLLlllllllllhhhhhhhhll
Query YTSYRDLAGY--gCEVAKAINdgtivGPNVYSSgAALSQTAghgdifalpagevlgsygv  164
ident      |            |                                         
Sbjct AGGVGDIVWApevMDALLARE-----DLSGTLY-FEVLNPF-------------------  142
DSSP  LLLEEEEELLhhhHHHHHLLL-----LLLEEEE-EEELLLL-------------------


DSSP  lllllllllllleeelLLHHHHHHHHHHHHHHL-------LLLEEEELLlllllllllll
Query mnprpgywgagplciaDGVEEVRRAVRLQIRRG-------AKVIXVMASggvmsrddnpn  217
ident                    |    |     |                             
Sbjct --------------pdKADEVFAAARTHLERWRrlerpglRLGLSPHTP-----------  177
DSSP  --------------hhHHHHHHHHHHHHHHHHHlllllleEEEEEELLL-----------


DSSP  lLLLLHHHHHHHHHHHHHLLLLEEEEEL--------------------------------
Query fAQFSPEELKVIVEEAARQNRIVSAHVH--------------------------------  245
ident     |          ||        ||                                 
Sbjct -FTVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyphtlaev  236
DSSP  -LLLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhh


DSSP  -------lhHHHHHHH-HHLL---LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHh
Query -------gkAGIMAAI-KAGC---KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLa  294
ident                           | |               |   |           
Sbjct igrepgpdlTPVRYLDeLGVLaarPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLE-  295
DSSP  hllllllllLHHHHHHhHLLHhhlLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLL-


DSSP  hllllllllhhhlllhhHHHHhhHHHHHHHLLLLEELLLLLL---llLLLHHHHHHHHHL
Query sngeglvkeswaklqalADSHlkAYQGAIKAGVTIALGTDTA---pgGPTALELQFAVER  351
ident                               |||  |||||            |  ||   
Sbjct -----------------CGTF--DWPAFAAAGVEVALGTDSVasgetLNVREEVTFARQL  336
DSSP  -----------------LLLL--LHHHHHHLLLLEEELLLLHhhhllLLLHHHHHHHHHH


DSSP  LL-LLHHHHHHHHLLLHHHHHhhhlllLLLLLLLLLLL-EEEELLlllllhhhhHLHHhe
Query GG-MTPLEAIKAATANAPLSVgpqaplTGQLREGYEAD-VIALEEnpledikvfQEPKav  409
ident      |     ||       |      |  || |         |                
Sbjct YPgLDPRVLVRAAVKGGQRVV-----gTPFLRRGETWQeGFRWEL---------SRDL--  380
DSSP  LLlLLHHHHHHHHHHHHHHHH-----lLLLLLLLLLLLhHHLHHH---------LLLL--


DSSP  eeeeelleeeellllllllllllllll
Query thvwkggklfkgpgigpwgedarnpfl  436
ident                            
Sbjct ---------------------------  380
DSSP  ---------------------------


No 24: Query=4c5yA Sbjct=4b3zD Z-score=20.3

back to top
DSSP  lllLEEEEEEEEELLlLLLLEEeEEEEEELLEEEEEEehHHLLhhHHHHLlLEEEE--EE
Query deaKVTIIYAGLLIPgDGEPLRnAALVISDKIIAFVGseADIPkkYLRSTqSTHRV--PV   58
ident        |  |  |  |   |  |     |  |   |               |       
Sbjct ---DRLLIKGGRIIN-DDQSLY-ADVYLEDGLIKQIG--ENLI--VPGGV-KTIEAngRM   50
DSSP  ---LEEEEEEEEEEL-LLLEEE-EEEEEELLEEEEEE--LLLL--LLLLL-EEEELllLE


DSSP  EEELEEEEEELLLLllllllllhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELLL---
Query LMPGLWDCHMHFGGdddyyndytsglathpaSSGARLARGCWEALQNGYTSYRDLAG---  115
ident   ||  |                                |   ||  | |   |      
Sbjct VIPGGIDVNTYLQK-----------------TAADDFFQGTRAALVGGTTMIIDHVVpep   93
DSSP  EEELEEEEEELLLL-----------------LLLLLHHHHHHHHHHLLEEEEEEEELlll


DSSP  ---------lHHHHHHHHhllllLLLEEEELlLEEEllllllllllllhhhhhhhhllll
Query ---------yGCEVAKAIndgtiVGPNVYSSgAALSqtaghgdifalpagevlgsygvmn  166
ident             | |                                             
Sbjct gsslltsfekWHEAADTK-----SCCDYSLH-VDIT------------------------  123
DSSP  lllhhhhhhhHHHHHHLL-----LLLEEEEE-EELL------------------------


DSSP  lllllllllleeELLLhhHHHHHHHHHHH-HLLLLEEEELLLllllllllllllLLLHHH
Query prpgywgagplcIADGveEVRRAVRLQIR-RGAKVIXVMASGgvmsrddnpnfaQFSPEE  225
ident                    ||          |     |                | |   
Sbjct ------------SWYD--GVREELEVLVQdKGVNSFQVYMAY--------kdvyQMSDSQ  161
DSSP  ------------LLLL--LHHHHHHHHHHlLLLLEEEEELLL--------llllLLLHHH


DSSP  HHHHHHHHHHLLLLEEEEEL-------------------------------LHHHHHHHH
Query LKVIVEEAARQNRIVSAHVH-------------------------------GKAGIMAAI  254
ident |                |                                        ||
Sbjct LYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAI  221
DSSP  HHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHH


DSSP  HHL-----LLEEEELL--LLLHHHHHHHH-HHLLEEELLHHHhHHHHHHL------LLLL
Query KAG-----CKSLEHVS--YADEEVWELMK-EKGILYVATRSViEIFLASN------GEGL  300
ident               |    |        |                               
Sbjct TIAgrincPVYITKVMskSAADIIALARKkGPLVFGEPIAASlGTDGTHYwsknwaKAAA  281
DSSP  HHHhhhllLEEEEEELlhHHHHHHHHHHHhLLLEEEEELHHHhHLLLHHHhlllhhHHHH


DSSP  -lllhhhLLLHhhHHHHHhHHHHHHLLLLEELLLLLL----------------------l
Query -vkeswaKLQAlaDSHLKaYQGAIKAGVTIALGTDTA----------------------p  337
ident                           |     |                           
Sbjct fvtspplSPDP--TTPDY-LTSLLACGDLQVTGSGHCpystaqkavgkdnftlipegvng  338
DSSP  lllllllLLLL--LHHHH-HHHHHHHLLLLLLLLLLLlllhhhhhhhlllhhhlllllll


DSSP  LLLLH-HHHHHHHHLlLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLL
Query GGPTA-LELQFAVERgGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEEN  395
ident            ||    |           ||            |    |  |||      
Sbjct IEERMtVVWDKAVATgKMDENQFVAVTSTNAAKIF--NLYPrKGRIAVGSDADVVIWDPD  396
DSSP  LLLHHhHHHHHHLLLlLLLHHHHHHHHLHHHHHHH--LLLLlLLLLLLLLLLLEEEEEEE


DSSP  -------------------llllHHHHhlhhhEEEEEELLEEEELLLLLLLL--------
Query -------------------pledIKVFqepkaVTHVWKGGKLFKGPGIGPWG--------  428
ident                                    |   ||     |             
Sbjct klktitakshksaveynifegmeCHGS-----PLVVISQGKIVFEDGNINVNkgmgrfip  451
DSSP  eeeelllllllllllllllllleEEEE-----EEEEEELLEEEEELLEELLLllllllll


DSSP  ------------------llllllll
Query ------------------edarnpfl  436
ident                           
Sbjct rkafpehlyqrvkirnkvfglqgvsr  477
DSSP  lllllhhhhhhhhhhhhhllllllll


No 25: Query=4c5yA Sbjct=2ob3A Z-score=18.1

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ----------------------------------------------drintvrgpitise   14
DSSP  ----------------------------------------------lleeelleeelhhh


DSSP  eLEEEEEELLLlllllllllhHHHHLL--------HHHHHHHHHHHHHHHHHLLEEEEEE
Query pGLWDCHMHFGgdddyyndytSGLATH--------PASSGARLARGCWEALQNGYTSYRD  112
ident  |    | |            |                      ||   |   |     |
Sbjct aGFTLTHEHIC--------gsSAGFLRawpeffgsRKALAEKAVRGLRRARAAGVRTIVD   66
DSSP  hLLEEEEELLE--------elLLLHHHhlhhhhllHHHHHHHHHHHHHHHHHLLLLEEEE


DSSP  LL----lLHHHHHHHHhllLLLLLEEEELlLEEEllllLLLLllllhhhhhHHHLlllll
Query LA----gYGCEVAKAIndgTIVGPNVYSSgAALSqtagHGDIfalpagevlGSYGvmnpr  168
ident                                 |                   |       
Sbjct VStfdigRDVSLLAEV--sRAADVHIVAA-TGLW----FDPP---------LSMR-----  105
DSSP  LLlhhhlLLHHHHHHH--hHHHLLEEELE-EELL----LLLL---------HHHH-----


DSSP  lllllllleeelLLHHHHHHHHHHHHH-------HLLLLEEEELLlllllllllllLLLL
Query pgywgagplciaDGVEEVRRAVRLQIR-------RGAKVIXVMASggvmsrddnpnFAQF  221
ident               |||        |          |  |||                  
Sbjct -----------lRSVEELTQFFLREIQygiedtgIRAGIIXVATT-----------GKAT  143
DSSP  -----------lLLHHHHHHHHHHHHHlllllllLLLLEEEEELL-----------LLLL


DSSP  --LHHHHHHHHHHHHHLLLLEEEEELL-HHHHHHHHHHL--------lLEEEEL-LLLLH
Query --SPEELKVIVEEAARQNRIVSAHVHG-KAGIMAAIKAG--------cKSLEHV-SYADE  269
ident       ||            |  |                            |     | 
Sbjct pfQELVLKAAARASLATGVPVTTHTAAsQRDGEQQAAIFeseglspsrVCIGHSdDTDDL  203
DSSP  hhHHHHHHHHHHHHHHHLLLEEEELLHhHLHHHHHHHHHhhllllhhhEEELLHhHLLLH


DSSP  HHHHHHHHHLLEEELLHHHHhhHHHHLLlllLLLHHH-LLLHhHHHHHHHHHHHHHLLL-
Query EVWELMKEKGILYVATRSVIeiFLASNGeglVKESWA-KLQAlADSHLKAYQGAIKAGV-  327
ident          | |                        |                 |  |  
Sbjct SYLTALAARGYLIGLDHIPY--SAIGLE--dNASASAlLGIRsWQTRALLIKALIDQGYm  259
DSSP  HHHHHHHHLLLEEEELLLLL--LLLLLL--lLHHHHHhHLLLlHHHHHHHHHHHHHLLLh


DSSP  -LEELLLLLL-----------------llLLLHHH-HHHHhHLLL---LLHHHHHHHHLL
Query -TIALGTDTA-----------------pgGPTALE-LQFAvERGG---MTPLEAIKAATA  365
ident   |    |                        |   |                       
Sbjct kQILVSNDWTfgfssyvtnimdvmdrvnpDGMAFIpLRVI-PFLRekgVPQETLAGITVT  318
DSSP  hHEEELLLLLleellllllhhhhhhhhllLHHHHHhHLHH-HHHHhllLLHHHHHHHHLH


DSSP  LHHHHHHHHlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeeelllll
Query NAPLSVGPQapltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgig  425
ident |      |                                                    
Sbjct NPARFLSPT---------------------------------------------------  327
DSSP  HHHHHHLLL---------------------------------------------------


DSSP  lllllllllll
Query pwgedarnpfl  436
ident            
Sbjct ---------lr  329
DSSP  ---------ll


No 26: Query=4c5yA Sbjct=1a4mA Z-score=18.0

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct -------------------------------------------------------tpafn    5
DSSP  -------------------------------------------------------lllll


DSSP  ELEEEEEELLL--LLLL-----------------------------------llLLLH-H
Query PGLWDCHMHFG--GDDD-----------------------------------yyNDYT-S   82
ident       | |                                                   
Sbjct KPKVELHVHLDgaIKPEtilyfgkkrgialpadtveelrniigmdkplslpgflAKFDyY   65
DSSP  LLEEEEEEEHHhlLLHHhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhLLHHhH


DSSP  HHHL--LHHHHHHHHHHHHHHHHHLLEEEEEELL--------------------------
Query GLAT--HPASSGARLARGCWEALQNGYTSYRDLA--------------------------  114
ident                          |                                  
Sbjct MPVIagCREAIKRIAYEFVEMKAKEGVVYVEVRYsphllanskvdpmpwnqtegdvtpdd  125
DSSP  HHHHllLHHHHHHHHHHHHHHHHHLLEEEEEEEEllhhhllllllllhhhlllllllhhh


DSSP  --llhHHHHHHHHLllLLLLEEEELlLEEELlllllllllllhhhhhhhhllllllllll
Query --gygCEVAKAINDgtIVGPNVYSSgAALSQtaghgdifalpagevlgsygvmnprpgyw  172
ident                   |  | |                                    
Sbjct vvdlvNQGLQEGEQ--AFGIKVRSI-LCCMR-----------------------------  153
DSSP  hhhhhHHHHHHHHH--HHLLEEEEE-EEEEL-----------------------------


DSSP  lllleeELLLhhHHHHHHHHHHHHL---LLLEEEElLLLLllllllllLLLLLHHHHHHH
Query gagplcIADGveEVRRAVRLQIRRG---AKVIXVMaSGGVmsrddnpnFAQFSPEELKVI  229
ident                    |                                        
Sbjct ------HQPS--WSLEVLELCKKYNqktVVAMDLA-GDET-------iEGSSLFPGHVEA  197
DSSP  ------LLHH--HHHHHHHHHHHLLlllEEEEEEE-LLLL-------lLLHHHLHHHHHH


DSSP  HHHHHHLLLLEEEEEL---LHHHHHHHHH-HLLLEEEELLLLL--HHHHHHHHHHLLEEE
Query VEEAARQNRIVSAHVH---GKAGIMAAIK-AGCKSLEHVSYAD--EEVWELMKEKGILYV  283
ident  | |         |            |          |       |              
Sbjct YEGAVKNGIHRTVHAGevgSPEVVREAVDiLKTERVGHGYHTIedEALYNRLLKENMHFE  257
DSSP  HHHHHHHLLEEEEEELlllLHHHHHHHHHlLLLLEEEELHHHHhlHHHHHHHHHLLLEEE


DSSP  LLHHHHHHHhhhllllllllhhhlllHHHH-hhHHHHHHHHHLLLLEELLLLLL--llLL
Query ATRSVIEIFlasngeglvkeswaklqALAD-shLKAYQGAIKAGVTIALGTDTA--pgGP  340
ident                              |     |            | ||        
Sbjct VCPWSSYLT-----------------GAWDpktTHAVVRFKNDKANYSLNTDDPlifkST  300
DSSP  ELHHHHHHL-----------------LLLLlllLLHHHHHHHLLLLEEELLLLLllllLL


DSSP  LHHHHHHHHHLLLLLHHHHHHHhLLLH-HHHHhhHLLL---LLLLlllllllEEEEllll
Query TALELQFAVERGGMTPLEAIKAaTANA-PLSVgpQAPL---TGQLregyeadVIALeenp  396
ident      |      | |  |       ||   |                             
Sbjct LDTDYQMTKKDMGFTEEEFKRL-NINAaKSSF--LPEEekkELLE----rlyREYQ----  349
DSSP  HHHHHHHHHHLLLLLHHHHHHH-HHHHhHLLL--LLHHhhhHHHH----hhhHHLL----


DSSP  lllhhhhhlhhheeeeeelleeeellllllllllllllll
Query ledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                         
Sbjct ----------------------------------------  349
DSSP  ----------------------------------------


No 27: Query=4c5yA Sbjct=1a5kC Z-score=17.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -llllEEEEEEEEELlLLLLLEEeEEEEEELLEEEEEEEH--------HHLLhhHHHHLl
Query -deakVTIIYAGLLIpGDGEPLRnAALVISDKIIAFVGSE--------ADIPkkYLRSTq   51
ident             |           |     |  |   |            ||      | 
Sbjct aadcvDLVLTNALIV-DHWGIVK-ADIGVKDGRIFAIGKAgnpdiqpnVTIP--IGAAT-  115
DSSP  hhhllLEEEEEEEEE-ELLEEEE-EEEEEELLEEEEEELEelllllllLLEE--LLLLL-


DSSP  LEEEE--EEEEELEEEEEELLLlllllllllhhhhhllhhhhhhhHHHHHHHHHHLLEEE
Query STHRV--PVLMPGLWDCHMHFGgdddyyndytsglathpassgarLARGCWEALQNGYTS  109
ident             |  | | |                               |||  | | 
Sbjct EVIAAegKIVTAGGIDTHIHWI-----------------------CPQQAEEALVSGVTT  152
DSSP  EEEELllLEEEELEEEEEEELL-----------------------LLLHHHHHHHHLEEE


DSSP  EEElLLLH-----------------hHHHHHHHlllLLLLEEEELlLEEELlllllllll
Query YRDlAGYG-----------------cEVAKAINdgtIVGPNVYSSgAALSQtaghgdifa  152
ident      | |                      |         |                   
Sbjct MVG-GGTGpaagthattctpgpwyisRMLQAAD---SLPVNIGLL-GKGNV---------  198
DSSP  EEE-ELLLllhhhhhlllllhhhhhhHHHHHHL---LLLLEEEEE-EELLL---------


DSSP  llhhhhhhhhlllllllllllllleeelllhhHHHHHHHHHHHHLLLLEEEELlllllll
Query lpagevlgsygvmnprpgywgagplciadgveEVRRAVRLQIRRGAKVIXVMAsggvmsr  212
ident                                     | | |   |               
Sbjct --------------------------------SQPDALREQVAAGVIGLEIHE-------  219
DSSP  --------------------------------LLHHHHHHHHHHLLLEEEEEH-------


DSSP  lllllllLLLHHHHHHHHHHHHHLLLLEEEEE------lLHHHHHHHHHHLLLEEEELL-
Query ddnpnfaQFSPEELKVIVEEAARQNRIVSAHV------hGKAGIMAAIKAGCKSLEHVS-  265
ident           |         |      |  |              |||        |   
Sbjct -----dwGATPAAIDCALTVADEMDIQVALHSdtlnesgFVEDTLAAIGGRTIHTFHTEg  274
DSSP  -----hhLLLHHHHHHHHHHHHHHLLEEEEELlllllllLHHHHHHHHLLLLEEELLLLl


DSSP  -------LLLHhHHHHhhhHLLEEELLhHHHH----hHHHHLLLLLL------------L
Query -------YADEeVWELmkeKGILYVATrSVIE----iFLASNGEGLV------------K  302
ident                      ||   |                  |              
Sbjct aggghapDIIT-ACAH---PNILPSST-NPTLpytlnTIDEHLDMLMvchhldpdiaedV  329
DSSP  lllllllLHHH-HHHL---LLEEEEEE-HHHLlllllHHHHHHHHHHhhhllllllhhhH


DSSP  LHH-HLLLhhHHHHHHhHHHHHHLLLLEELLLLLL---lLLLLHHHHHHHHHLLL-----
Query ESW-AKLQalADSHLKaYQGAIKAGVTIALGTDTA---pGGPTALELQFAVERGG-----  353
ident                         |       |       |   |       |       
Sbjct AFAeSRIR--RETIAA-EDVLHDLGAFSLTSSDSQamgrVGEVILRTWQVAHRMKvqrga  386
DSSP  HLLlLLLL--HHHHHH-HHHHHHLLLLLEEELLLLllllLLLHHHHHHHHHHHHHhhhll


DSSP  ----------lLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLLLlllhhH
Query ----------mTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEENPledikV  402
ident                 |   | |  |          |    |  ||              
Sbjct laeetgdndnfRVKRYIAKYTINPALTH--GIAHeVGSIEVGKLADLVVWSPAF-----F  439
DSSP  lllllllllhhHHHHHHHLLLHHHHHHL--LLLLlLLLLLLLLLLLEEEELHHH-----L


DSSP  HHLhhhEEEEEELLEEEELLL-------------llLLLL-lLLLL--------------
Query FQEpkaVTHVWKGGKLFKGPG-------------igPWGE-dARNP--------------  434
ident          | |||     |                                        
Sbjct GVK---PATVIKGGMIAIAPMgdinasiptpqpvhyRPMFgaLGSArhhcrltflsqaaa  496
DSSP  LLL---LLEEEELLEEEEEEEllllllllllllleeEELHhhLHHHhhhhleeeelhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  434
ident                                                             
Sbjct angvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadv  556
DSSP  hhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllll


DSSP  --------ll
Query --------fl  436
ident           
Sbjct lpmaqryflf  566
DSSP  llllllllll


No 28: Query=4c5yA Sbjct=2y1hB Z-score=17.3

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident                                                             
Sbjct -----------------------------------------------------------G    1
DSSP  -----------------------------------------------------------L


DSSP  ELEEEEEELLLLLLllllllhhhhhllhhhHHHHHHHHHHHHHHLLEEEEEELL------
Query PGLWDCHMHFGGDDdyyndytsglathpasSGARLARGCWEALQNGYTSYRDLA------  114
ident  || ||| |    |                    |      |           |      
Sbjct VGLVDCHCHLSAPD----------------FDRDLDDVLEKAKKANVVALVAVAehsgef   45
DSSP  LLEEEEEELLLLHH----------------HLLLHHHHHHHHHHLLEEEEEELLllhhhh


DSSP  lLHHHHHHHHHlllllllEEEELlLEEELllllLLLLLllhhhhhhhhllllllllllll
Query gYGCEVAKAINdgtivgpNVYSSgAALSQtaghGDIFAlpagevlgsygvmnprpgywga  174
ident           |        |                                        
Sbjct eKIMQLSERYN------gFVLPC-LGVHP----VQGLD----------------------   72
DSSP  hHHHHHHHHLL------lLEEEE-ELLLL----EELLL----------------------


DSSP  lleeelLLHHHHHHHHHHHHHH--LLLLE-EEELLLllllLLLL--lllllLLHHHHHHH
Query gplciaDGVEEVRRAVRLQIRR--GAKVI-XVMASGgvmsRDDN--pnfaqFSPEELKVI  229
ident               |             |  |                        |   
Sbjct ---qrsVTLKDLDVALPIIENYkdRLLAIgEVGLDF---sPRFAgtgeqkeEQRQVLIRQ  126
DSSP  ---leeLLHHHHHHHHHHHHHHllLLLEEeEEEEEL---lLLLLllhhhhhHHHHHHHHH


DSSP  HHHHHHLLLLEEEEELLhhHHHHHHHHL------lLEEEELLLLLHhHHHHHHHHLLEEE
Query VEEAARQNRIVSAHVHGkaGIMAAIKAG------cKSLEHVSYADEeVWELMKEKGILYV  283
ident    | | |  |  |          |            |         |       |    
Sbjct IQLAKRLNLPVNVHSRS--AGRPTINLLqeqgaekVLLHAFDGRPS-VAMEGVRAGYFFS  183
DSSP  HHHHHHHLLLEEEEEEL--LHHHHHHHHhhlllllEEEELLLLLHH-HHHHHHHLLLEEE


DSSP  LLhHHHHHhhhhllllllllhhhlllhhHHHHHHHHHHHHhlllLEELLLLLL-------
Query ATrSVIEIflasngeglvkeswaklqalADSHLKAYQGAIkagvTIALGTDTA-------  336
ident      |                           |           | | ||         
Sbjct IP-PSIIR--------------------SGQKQKLVKQLP--ltSICLETDSPalgpekq  220
DSSP  EL-HHHHL--------------------LHHHHHHHHHLL--hhHEEELLLLLlllllll


DSSP  ---LLLLLHHHHHHHHHLlLLLH-HHHHHHHLLLHHHHHhHHLLLllllllllllleeee
Query ---PGGPTALELQFAVERgGMTP-LEAIKAATANAPLSVgPQAPLtgqlregyeadvial  392
ident                          | |   | ||     |                   
Sbjct vrnEPWNISISAEYIAQV-KGISvEEVIEVTTQNALKLF-PKLRH---------------  263
DSSP  lllLHHHHHHHHHHHHHH-HLLLhHHHHHHHHHHHHHHL-LLHHH---------------


DSSP  lllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query eenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                             
Sbjct ------------------------------------------ll  265
DSSP  ------------------------------------------hl


No 29: Query=4c5yA Sbjct=1bf6A Z-score=16.3

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct --------------------------------------------------------sfdp    4
DSSP  --------------------------------------------------------llll


DSSP  ELEEEEEELLL---llllLLLLLHhhhhllhhhHHHHHHHHHHHHHHLLEEEEEELL---
Query PGLWDCHMHFG---gdddYYNDYTsglathpasSGARLARGCWEALQNGYTSYRDLA---  114
ident  |    | |            |             |            |           
Sbjct TGYTLAHEHLHidlsgfkNNVDCR-------ldQYAFICQEMNDLMTRGVRNVIEMTnry   57
DSSP  LLEEEEEELLLeelhhhhLLHHHE-------elLHHHHHHHHHHHHHLLEEEEEELLlhh


DSSP  -llhHHHHHHHHllLLLLLEEEELlLEEELLLLllllllllhhhhhhhHLLLllllllll
Query -gygCEVAKAINdgTIVGPNVYSSgAALSQTAGhgdifalpagevlgsYGVMnprpgywg  173
ident                  | ||        | |                            
Sbjct mgrnAQFMLDVM--RETGINVVAC-TGYYQDAF---------------FPEH--------   91
DSSP  hlllHHHHHHHH--HHHLLEEEEE-ELLLLHHH---------------LLLH--------


DSSP  llleeelLLHHHHHHHHHHHHH-------HLLLLEEEELLLllllllllLLLL-lLLHHH
Query agplciaDGVEEVRRAVRLQIR-------RGAKVIXVMASGgvmsrddnPNFA-qFSPEE  225
ident          | |        |          |  |                         
Sbjct ----vatRSVQELAQEMVDEIEqgidgteLKAGIIAEIGTS--------EGKItpLEEKV  139
DSSP  ----hhhLLHHHHHHHHHHHHHlllllllLLEEEEEEEELL--------LLLLlhHHHHH


DSSP  HHHHHHHHHHLLLLEEEEE-LLHHhHHHHHHHL--------lLEEEELL--LLLHhHHHH
Query LKVIVEEAARQNRIVSAHV-HGKAgIMAAIKAG--------cKSLEHVS--YADEeVWEL  274
ident             |  | |                            |             
Sbjct FIAAALAHNQTGRPISTHTsFSTM-GLEQLALLqahgvdlsrVTVGHCDlkDNLD-NILK  197
DSSP  HHHHHHHHHHHLLLEEEELhHHLL-HHHHHHHHhhllllhhhEEELLLLllLLHH-HHHH


DSSP  HHHHLLEEELLHHHHHhhhhhllllllllhhhllLHHH-HHHHHHHHHHHHLLL--LEEL
Query MKEKGILYVATRSVIEiflasngeglvkeswaklQALA-DSHLKAYQGAIKAGV--TIAL  331
ident |   |                                               |      |
Sbjct MIDLGAYVQFDTIGKN------------------SYYPdEKRIAMLHALRDRGLlnRVML  239
DSSP  HHHLLLEEEELLLLLL------------------LLLLhHHHHHHHHHHHHLLLhhHEEE


DSSP  LLLL-----------llLLLLH-HHHHHHHHLlLLLHHHHHHHHLLLHHHHHHhhlllll
Query GTDT-----------apGGPTA-LELQFAVERgGMTPLEAIKAATANAPLSVGpqapltg  379
ident   |                              |            |             
Sbjct SMDItrrshlkanggygYDYLLtTFIPQLRQS-GFSQADVDVMLRENPSQFFQ-------  291
DSSP  LLLLllhhhlhhhllllLLHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHLL-------


DSSP  llllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query qlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                          
Sbjct ---------------------------------------------------------  291
DSSP  ---------------------------------------------------------


No 30: Query=4c5yA Sbjct=3k2gB Z-score=16.2

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ----------------------------------slselspchvrsgrixtvdgpipssa   26
DSSP  ----------------------------------llllllllllllleeeelleeeehhh


DSSP  eLEEEEEELLL----------------------------------lllLLLLLLhhhhhl
Query pGLWDCHMHFG----------------------------------gddDYYNDYtsglat   86
ident  |    | |                                          |        
Sbjct lGHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvNKHNIA------   80
DSSP  lLLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhLLLLLE------


DSSP  lhhHHHHHHHHHHHHHHHLLEEEEEELL----lLHHHHHHHHhllLLLLLEEEELlLEEE
Query hpaSSGARLARGCWEALQNGYTSYRDLA----gYGCEVAKAIndgTIVGPNVYSSgAALS  142
ident                    |  |  |               |      |  |    |   
Sbjct --lDDLDLAIAEVKQFAAVGGRSIVDPTcrgigRDPVKLRRI--sAETGVQVVXG-AGYY  135
DSSP  --eLLHHHHHHHHHHHHHLLLLEEEELLlllllLLHHHHHHH--hHHHLLEEEEL-LLLL


DSSP  LLLllLLLLlllhhhhhhhhlllllllllllllleeelLLHHHHHHHHHHHHH-------
Query QTAghGDIFalpagevlgsygvmnprpgywgagplciaDGVEEVRRAVRLQIR-------  195
ident                                                             
Sbjct LAS--SXPE-------------------------taarLSADDIADEIVAEALegtdgtd  168
DSSP  LHH--HLLH-------------------------hhhlLLHHHHHHHHHHHHHlllllll


DSSP  HLLLLEE-EELLllllllllllLLLL-LLHHHHHHHHHHHHHLLLLEEEEE-LLHHHHHH
Query RGAKVIX-VMASggvmsrddnpNFAQ-FSPEELKVIVEEAARQNRIVSAHV-HGKAGIMA  252
ident      |     |                    |        |       |          
Sbjct ARIGLIGeIGVS----------SDFTaEEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHR  218
DSSP  LLLLLEEeELLL----------LLLLhHHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHH


DSSP  HHHHL--------lLEEEELLLL---LHHHHHHHHhHLLEEELLHHHhHHHHhhllllll
Query AIKAG--------cKSLEHVSYA---DEEVWELMKeKGILYVATRSViEIFLasngeglv  301
ident                 | |             |    |            |         
Sbjct VLDLVeeegadlrhTVLCHXNPShxdPVYQATLAQ-RGAFLEFDXIG-XDFF-------y  269
DSSP  HHHHHhhllllhhhEEELLLHHHlllHHHHHHHHH-HLLEEEELLLL-LLLE-------e


DSSP  LLHHHlllHHHH--HHHHHHHHHHHLLL--LEELLLLL-----------llLLLLH-HHH
Query KESWAklqALAD--SHLKAYQGAIKAGV--TIALGTDT-----------apGGPTA-LEL  345
ident                   |  |    |    | |  |                      |
Sbjct ADQGV---QCPSddEVARAILGLADHGYldRILLSHDVfvkxxltryggngYAFVTkHFL  326
DSSP  LLLLE---ELLLhhHHHHHHHHHHHLLLhhHEEELLLLllhhhlhhhllllLLHHHhLHH


DSSP  HHHHHLlLLLHHHHHHHHLLLHHHHHhhhLLLLlllllllllleeeelllllllhhhhhl
Query QFAVERgGMTPLEAIKAATANAPLSVgpqAPLTgqlregyeadvialeenpledikvfqe  405
ident        |            |                                       
Sbjct PRLRRH-GLDDAALETLXVTNPRRVF---DASI---------------------------  355
DSSP  HHHHHL-LLLHHHHHHHHLHHHHHHH---LLLL---------------------------


DSSP  hhheeeeeelleeeellllllllllllllll
Query pkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                
Sbjct ----------------------------egh  358
DSSP  ----------------------------lll


No 31: Query=4c5yA Sbjct=1v77A Z-score=16.2

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  ELEEEEEELLLLllllllllhhhhhllhhhhhhhhhhHHHHHHHLlEEEEEELLllhhhh
Query PGLWDCHMHFGGdddyyndytsglathpassgarlarGCWEALQNgYTSYRDLAgygcev  120
ident                                          |                  
Sbjct VKFIEMDIRDKE-------------------------AYELAKEW-FDEVVVSI------   28
DSSP  LLLEEEEELLHH-------------------------HHHHHHHH-LLEEEEEE------


DSSP  hhhhhllllllleeeelllEEELlllllllllllhhhhhhhhlllllllllllllleeel
Query akaindgtivgpnvyssgaALSQtaghgdifalpagevlgsygvmnprpgywgagplcia  180
ident                                                             
Sbjct -------------------KFNE-------------------------------------   32
DSSP  -------------------EELL-------------------------------------


DSSP  llhhhhhhHHHHHHHHLL-----LLEEEELlllllllllllllllLLHHHHHHHHHHHHh
Query dgveevrrAVRLQIRRGA-----KVIXVMAsggvmsrddnpnfaqFSPEELKVIVEEAAr  235
ident               |          |                     |      |     
Sbjct -------eVDKEKLREARkeygkVAILLSN---------------PKPSLVRDTVQKFK-   69
DSSP  -------lLLHHHHHHHHhhhllEEEEEEL---------------LLHHHHHHHHHHLL-


DSSP  lLLLEEEEELLHHHHHHHHHHLLLEEEELL------LLLHHHHHHHHHHLLEEELLhHHH
Query qNRIVSAHVHGKAGIMAAIKAGCKSLEHVS------YADEEVWELMKEKGILYVATrSVI  289
ident               |   |  |                |     ||  |           
Sbjct -SYLIYVESNDLRVIRYSIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRP  127
DSSP  -LLEEEEELLLHHHHHHHHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHH


DSSP  HHHHHhllllllllHHHLLLhHHHHHHHHHHHHHHLLLLEELLLLLLLL--LLLH-HHHH
Query EIFLAsngeglvkeSWAKLQaLADSHLKAYQGAIKAGVTIALGTDTAPG--GPTA-LELQ  346
ident                      |     ||     |  |   |                  
Sbjct LLYSN---------PYERAN-LLRFMMKAWKLVEKYKVRRFLTSSAQEKwdVRYPrDLIS  177
DSSP  HHHLL---------HHHHHH-HHHHHHHHHHHHHHHLLLEEEELLLLLHhhLLLHhHHHH


DSSP  HHHHLlLLLHHHHHHHHLLLHHHHHHhhlllllllllllllleeeelllllllhhhhhlh
Query FAVERgGMTPLEAIKAATANAPLSVGpqapltgqlregyeadvialeenpledikvfqep  406
ident   |   ||    |                                               
Sbjct LGVVI-GMEIPQAKASISMYPEIILK----------------------------------  202
DSSP  HHHHL-LLLHHHHHHLLLHHHHHHHL----------------------------------


DSSP  hheeeeeelleeeellllllllllllllll
Query kavthvwkggklfkgpgigpwgedarnpfl  436
ident                               
Sbjct ------------------------------  202
DSSP  ------------------------------


No 32: Query=4c5yA Sbjct=2vc5A Z-score=15.6

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ---------------------------------------------mriplvgkdsieskd   15
DSSP  ---------------------------------------------llllllllllllhhh


DSSP  eLEEEEEELLLlllllllLLHH-----hhHLLHHHHHHHHHHHHHHHHHLLEEEEEELL-
Query pGLWDCHMHFGgdddyynDYTS-----glATHPASSGARLARGCWEALQNGYTSYRDLA-  114
ident  |    | |                                     | | |     |   
Sbjct iGFTLIHEHLR------vFSEAvrqqwphLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTv   69
DSSP  lLLEELLLLLL------lLLHHhhhhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEEELLl


DSSP  ---llhHHHHHHHHllLLLLLEEEELlLEEELLLlllllllllhhhHHHHhlllllllll
Query ---gygCEVAKAINdgTIVGPNVYSSgAALSQTAghgdifalpageVLGSygvmnprpgy  171
ident                    | |                                      
Sbjct mglgrdIRFMEKVV--KATGINLVAG-TGIYIYI----------dlPFYF----------  106
DSSP  llllllHHHHHHHH--HLLLLEEEEL-EELLLLL----------llLHHH----------


DSSP  llllleeellLHHHHHHHHHHHHH-------HLLLLEEEELLllllllllllLLLL--LL
Query wgagplciadGVEEVRRAVRLQIR-------RGAKVIXVMASggvmsrddnpNFAQ--FS  222
ident              |        |          |   |  |                   
Sbjct -------lnrSIDEIADLFIHDIKegiqgtlNKAGFVXIAAD----------EPGItkDV  149
DSSP  -------lllLHHHHHHHHHHHHHlllllllLLLLLEEEELL----------LLLLlhHH


DSSP  HHHHHHHHHHHHHLLLLEEEEELL-HHHHHHHHHHL--------lLEEEEL-lllLHHHH
Query PEELKVIVEEAARQNRIVSAHVHG-KAGIMAAIKAG--------cKSLEHV-syaDEEVW  272
ident                     |                            |          
Sbjct EKVIRAAAIANKETKVPIITHSNAhNNTGLEQQRILteegvdpgkILIGHLgdtdNIDYI  209
DSSP  HHHHHHHHHHHHHHLLLEEEELLLlLLHHHHHHHHHhhllllhhhEEELLHhhllLHHHH


DSSP  HHHHHHLLEEELLHHHHHhhhhhllllllllhhhlllHHHH--hhHHHHHHHHHLLL--L
Query ELMKEKGILYVATRSVIEiflasngeglvkeswaklqALAD--shLKAYQGAIKAGV--T  328
ident      ||      |                                      || |    
Sbjct KKIADKGSFIGLDRYGLD-------------------LFLPvdkrNETTLRLIKDGYsdK  250
DSSP  HHHHHLLLEEEELLLLLL-------------------LLLLhhhhHHHHHHHHHLLLllL


DSSP  EELLLLLL-----------------lllLLHHHH-HHHHHL--llLLHHHHHHHHLLLHH
Query IALGTDTA-----------------pggPTALEL-QFAVER--ggMTPLEAIKAATANAP  368
ident |    |                         |                         |  
Sbjct IMISHDYCctidwgtakpeykpklaprwSITLIFeDTIPFLkrngVNEEVIATIFKENPK  310
DSSP  EEELLLLLlllllllllhhhhhhhllllLLLHHHhLHHHHHhlllLLHHHHHHHHLHHHH


DSSP  HHHHhhlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllll
Query LSVGpqapltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwg  428
ident                                                             
Sbjct KFFS--------------------------------------------------------  314
DSSP  HHLL--------------------------------------------------------


DSSP  llllllll
Query edarnpfl  436
ident         
Sbjct --------  314
DSSP  --------


No 33: Query=4c5yA Sbjct=3cjpA Z-score=15.5

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEEEEEELLLLllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLL-----
Query pGLWDCHMHFGGdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAG-----  115
ident     | | |                                    |              
Sbjct -LIIDGHTHVIL---------------------PVEKHIKIMDEAGVDKTILFSTsihpe   38
DSSP  -LLEEEEEELLL---------------------LHHHHHHHHHHHLLLEEEEELLlllhh


DSSP  -----------------------------------LHHHHHHHHHlllllllEEEELlLE
Query -----------------------------------YGCEVAKAINdgtivgpNVYSSgAA  140
ident                                        |  |                 
Sbjct tavnlrdvkkemkklndvvngktnsmidvrrnsikELTNVIQAYP------sRYVGF-GN   91
DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHLL------lLEEEE-EL


DSSP  EELLllllllllllhhhhhhhhlllllllllllllleeelLLHHHHHHHHH-HHHHHLLL
Query LSQTaghgdifalpagevlgsygvmnprpgywgagplciaDGVEEVRRAVR-LQIRRGAK  199
ident                                                             
Sbjct VPVG------------------------------------LSENDTNSYIEeNIVNNKLV  115
DSSP  LLLL------------------------------------LLHHHHHHHHHhHLLLLLLL


DSSP  LEE-EELLlllllllllllLLLLLhhHHHHHHHHHH-HLLLLEEEEEL---LHHHHHHHH
Query VIX-VMASggvmsrddnpnFAQFSpeELKVIVEEAA-RQNRIVSAHVH---GKAGIMAAI  254
ident  |                   |     || |              |         |    
Sbjct GIGeLTPA-----------SGQIK--SLKPIFKYSMdSGSLPIWIHAFnplVLQDIKEIA  162
DSSP  EEEeELLL-----------LLLHH--HHHHHHHHHHhLLLLLEEELLLlllLHHHHHHHH


DSSP  HHL------LLEEEE-LLLLLHHHHHHHHHHL-LEEELLHhhhhhhhhhllllllllhhh
Query KAG------CKSLEH-VSYADEEVWELMKEKG-ILYVATRsvieiflasngeglvkeswa  306
ident             | |          || ||                              
Sbjct ELCkafpkvPVILGHmGGSNWMTAVELAKEIQnLYLDTSA--------------------  202
DSSP  HHHhhllllLEEEHHhHHHHHHHHHHHHHHLLlEEEELLL--------------------


DSSP  lllhhhhHHHHHHHHHHHLL-lLEELLLLLLlllLLHHHHHHHHHlLLLLHHHHHHHHLL
Query klqaladSHLKAYQGAIKAG-vTIALGTDTApggPTALELQFAVErGGMTPLEAIKAATA  365
ident                 |         |||        |               |      
Sbjct ------yFSTFVLKIVINELplKCIFGTDMP-fgDLQLSIEAIKK-MSNDSYVANAVLGD  254
DSSP  ------lLLHHHHHHHHHHLllLEELLLLLL-llLHHHHHHHHHH-HLLLHHHHHHHHLH


DSSP  LHHHhhhHHLLlllllllllllleeeelllllllhhhhhlhhheeeeeelleeeelllll
Query NAPLsvgPQAPltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgig  425
ident |                                                           
Sbjct NISR---LLNI-------------------------------------------------  262
DSSP  HHHH---HHLL-------------------------------------------------


DSSP  lllllllllll
Query pwgedarnpfl  436
ident            
Sbjct -----------  262
DSSP  -----------


No 34: Query=4c5yA Sbjct=3irsA Z-score=14.6

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  ELEEEEEELL----LLLL---LLLLLL-----hhhhhllhhhhhHHHHHHHHHHHHLLEE
Query PGLWDCHMHF----GGDD---DYYNDY-----tsglathpassgARLARGCWEALQNGYT  108
ident     |                                         |     |    |  
Sbjct LKIIDFRLRPpamgFLNAriyTRPDIRnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
DSSP  LLLEELLLLLllhhHHHLhhhHLHHHHhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL


DSSP  EEEELL-----------lLHHHHHHHHHlllllllEEEELlLEEEllllllllllllhhh
Query SYRDLA-----------gYGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifalpage  157
ident                       ||||                                  
Sbjct QGVCVGrnssvlgsvsnaDVAAVAKAYP------dKFHPV-GSIE---------------   98
DSSP  EEEEELleellleellhhHHHHHHHHLL------lLEEEE-EELL---------------


DSSP  hhhhhlllllllllllllleeeLLLHHHHHHHHHHHHHHLLLLEEEELLLllllllllll
Query vlgsygvmnprpgywgagplciADGVEEVRRAVRLQIRRGAKVIXVMASGgvmsrddnpn  217
ident                       |    |           |                    
Sbjct ----------------------AATRKEAMAQMQEILDLGIRIVNLEPGV-------wat  129
DSSP  ----------------------LLLHHHHHHHHHHHHHLLLLLEEELHHH-------lll


DSSP  llLLLHHHHHHHHHHHHHLLLLEEEEEL----------LHHHHHHHHH---hLLLEEEE-
Query faQFSPEELKVIVEEAARQNRIVSAHVH----------GKAGIMAAIK---aGCKSLEH-  263
ident         |             |                   |               | 
Sbjct pmHVDDRRLYPLYAFCEDNGIPVIMMTGgnagpditytNPEHIDRVLGdfpdLTVVSSHg  189
DSSP  llLLLLHHHHHHHHHHHHLLLLEEEELLllllllhhhhLHHHHHHHHHhlllLLEEEEHh


DSSP  LLLLLHHHHHHHHHHL-LEEELLhHHHHhhhhhllllllllhhhlllhhHHHHHHHHHHH
Query VSYADEEVWELMKEKG-ILYVATrSVIEiflasngeglvkeswaklqalADSHLKAYQGA  322
ident       |                                                    |
Sbjct NWPWVQEIIHVAFRRPnLYLSPD-MYLY---------------------NLPGHADFIQA  227
DSSP  HLLLHHHHHHHHHHLLlEEEELH-HHHL---------------------LLLLHHHHHHH


DSSP  HHLLL--LEELLLLLL--lLLLLH-HHHHHhhhllLLLHHHHHHHHLLLHHHHHHHHlll
Query IKAGV--TIALGTDTA--pGGPTA-LELQFavergGMTPLEAIKAATANAPLSVGPQapl  377
ident            ||              |          |    |    ||          
Sbjct ANSFLadRMLFGTAYPmcpLKEYTeWFLTL-----PIKPDAMEKILHGNAERLLAQA---  279
DSSP  HLLHHhhLLLLLLLLLlllHHHHHhHHHLL-----LLLHHHHHHHHLHHHHHHHHHL---


DSSP  llllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query tgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                            
Sbjct ---------------------------------------------------------gr  281
DSSP  ---------------------------------------------------------ll


No 35: Query=4c5yA Sbjct=4mupB Z-score=14.5

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident                                                             
Sbjct ---------------------------------------------lvrklsgtapnpafP   15
DSSP  ---------------------------------------------llllllllllllllL


DSSP  ELEEEEEELLLLLL-lllLLLHHHhhllhHHHHhHHHHHHHHHHHLLEEEEEELLL----
Query PGLWDCHMHFGGDD-dyyNDYTSGlathpASSGaRLARGCWEALQNGYTSYRDLAG----  115
ident  |  |  ||                                     |        |    
Sbjct RGAVDTQMHMYLPGypalPGGPGL---ppGALP-GPEDYRRLMQWLGIDRVIITQGnahq   71
DSSP  LLLEELLLLLLLLLllllLLLLLL---llLLLL-LHHHHHHHHHHHLLLEEEEELLhhhl


DSSP  ----LHHHHHHHHHlllllllEEEELlLEEEllllllllllllhhhhhhhhlllllllll
Query ----YGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifalpagevlgsygvmnprpgy  171
ident                                                             
Sbjct rdngNTLACVAEMG------eAAHAV-VIID-----------------------------   95
DSSP  lllhHHHHHHHHHH------hHEEEE-ELLL-----------------------------


DSSP  llllleeelllHHHHHHHHHHHHHHLLLLEEEEllLLLLLllllllllLLLHhhHHHHHH
Query wgagplciadgVEEVRRAVRLQIRRGAKVIXVMasGGVMSrddnpnfaQFSPeeLKVIVE  231
ident                          |      |                 |   |    |
Sbjct -----------ATTTEKDMEKLTAAGTVGARIM--DLPGG------avNLSE--LDAVDE  134
DSSP  -----------LLLLHHHHHHHHHLLEEEEEEE--LLLLL------llLHHH--HHHHHH


DSSP  HHHHLLLLEEEEELLHHH---hhHHHHHLL-LEEE-ELLL---------lLHHHHHHHHH
Query EAARQNRIVSAHVHGKAG---imAAIKAGC-KSLE-HVSY---------aDEEVWELMKE  277
ident  |      |     |           |         |                   |   
Sbjct RAHAADWMVAVQFDGNGLldhlpRLQKIRSrWVFDhHGKFfkgirtdgpeMAALLKLIDR  194
DSSP  HHHHLLLEEEEELLHHHHhhhhhHHHLLLLeEEELhHHHLllllllllhhHHHHHHHHHH


DSSP  HLLEEELLhhHHHHhhhhllllllllhhhLLLH-hHHHHHHHHHHHHHLL-lLEELLLLL
Query KGILYVATrsVIEIflasngeglvkeswaKLQA-lADSHLKAYQGAIKAG-vTIALGTDT  335
ident                                                      |  ||  
Sbjct GNLWFKFA--GVYE--------------sSRKSwpYADVAAFSRVIAAHApeRIVWGTNW  238
DSSP  LLEEEEEL--LHHH--------------lLLLLllLHHHHHHHHHHHHHLhhHEEELLLL


DSSP  L---------lllLLHHHHHHHHhlLLLLHHHHHHHHLLLHHHHHHhhLLLLllllllll
Query A---------pggPTALELQFAVerGGMTPLEAIKAATANAPLSVGpqAPLTgqlregye  386
ident                 |                  |   |                    
Sbjct PhnsvretaaypdDARLAELTLG--WLPDEAARHRALVENPEALFK--LSPV--------  286
DSSP  LllllllhhhlllHHHHHHHHHL--LLLLHHHHHHHHLHHHHHHHL--LLLL--------


DSSP  lleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query advialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                   
Sbjct --------------------------------------------------  286
DSSP  --------------------------------------------------


No 36: Query=4c5yA Sbjct=3gg7A Z-score=14.4

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEEEEEEL-LLLLlllllllhhhhhllhhhhhhHHHHHHHHHHHLLEeEEEELL-----
Query pGLWDCHMH-FGGDddyyndytsglathpassgaRLARGCWEALQNGYtSYRDLA-----  114
ident   | | | |                                                   
Sbjct -SLIDFHVHlDLYP--------------------DPVAVARACEERQL-TVLSVTttpaa   38
DSSP  -LLEEEEELhHHLL--------------------LHHHHHHHHHHLLL-EEEELLllhhh


DSSP  -lLHHHHHHHHhllllllLEEEELlLEEElllLLLLlllllhhhhhhHHLLlllllllll
Query -gYGCEVAKAIndgtivgPNVYSSgAALSqtaGHGDifalpagevlgSYGVmnprpgywg  173
ident        |          | |                                       
Sbjct wrGTLALAAGR-------PHVWTA-LGFH---PEVV----------sERAA---------   68
DSSP  hhHHHHHHLLL-------LLEEEL-LLLL---HHHL----------lLLHH---------


DSSP  llleeelllhhHHHHHhHHHHHhLLLLEE-EELLLllllLLLLllllllLHHHHHHHHHH
Query agplciadgveEVRRAvRLQIRrGAKVIX-VMASGgvmsRDDNpnfaqfSPEELKVIVEE  232
ident                               |   |                     |   
Sbjct -----------DLPWF-DRYLP-ETRFVGeVGLDG---sPSLR-gtwtqQFAVFQHILRR  111
DSSP  -----------HLHHH-HHHHH-HLLEEEeEELLL---lHHHH-hhhhhHHHHHHHHHHH


DSSP  HHHL-LLLEEEEELLhhHHHHHHHHL-------lLEEEELLlLLHHHHHHHHHHLLEEEL
Query AARQ-NRIVSAHVHGkaGIMAAIKAG-------cKSLEHVSyADEEVWELMKEKGILYVA  284
ident       || | |                        |   |             |     
Sbjct CEDHgGRILSIHSRR--AESEVLNCLeanprsgtPILHWYS-GSVTELRRAISLGCWFSV  168
DSSP  HHHLlLEEEEEELLL--LHHHHHHHHhhlhhheeEEEELLL-LLHHHHHHHHHLLLEEEE


DSSP  LhHHHHhhhhhllllllllhhhlllhhHHHHHHHHHHHHhlllLEELLLLLL--------
Query TrSVIEiflasngeglvkeswaklqalADSHLKAYQGAIkagvTIALGTDTA--------  336
ident                                                 ||          
Sbjct G-PTMV--------------------rTQKGAALIRSMP--rdRVLTETDGPfleldgqa  205
DSSP  L-HHHH--------------------lLHHHHHHHHHLL--hhHEEELLLLLlleellee


DSSP  lLLLL-HHHHHHHHHLLLLLHHHHHHHHLLLHHHhhHHHLllllllllllllleeeelll
Query pGGPT-ALELQFAVERGGMTPLEAIKAATANAPLsvGPQApltgqlregyeadvialeen  395
ident                       |       |                             
Sbjct aLPWDvKSVVEGLSKIWQIPASEVERIVKENVSR--LLGT--------------------  243
DSSP  lLHHHhHHHHHHHHHHHLLLHHHHHHHHHHHHHH--HHHL--------------------


DSSP  llllhhhhhlhhheeeeeelleeeellllllllllllllll
Query pledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                          
Sbjct -----------------------------------------  243
DSSP  -----------------------------------------


No 37: Query=4c5yA Sbjct=2ffiA Z-score=14.3

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ----------------------------------------------------------lh    2
DSSP  ----------------------------------------------------------ll


DSSP  ELEEEEEELLLLLLL----LLLLLHHHhhllhhhhhhHHHHHHHHHHHLLEEEEEELL--
Query PGLWDCHMHFGGDDD----YYNDYTSGlathpassgaRLARGCWEALQNGYTSYRDLA--  114
ident     | | |                             |          |          
Sbjct LTAIDSHAHVFSRGLnlasQRRYAPNY--------daPLGDYLGQLRAHGFSHGVLVQps   54
DSSP  LLLEELLLLLLLHHHhhhlLLLLLLLL--------llLHHHHHHHHHHLLLLEELLLLlh


DSSP  ------lLHHHHHHHHHlllllllEEEELlLEEEllllllllllllhhhhhhhhllllll
Query ------gYGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifalpagevlgsygvmnpr  168
ident        |                        |                           
Sbjct flgtdnrYLLSALQTVP------gQLRGV-VXLE--------------------------   81
DSSP  hhllllhHHHHHHHHLL------lLLLLL-LLLL--------------------------


DSSP  lllllllleeelllhhHHHHhhHHHHHHL---LLLEEEELLLllllllllllllLLLHH-
Query pgywgagplciadgveEVRRavRLQIRRG---AKVIXVMASGgvmsrddnpnfaQFSPE-  224
ident                                          |                  
Sbjct ----------------RDVE-qATLAEXArlgVRGVRLNLXG----------qdXPDLTg  114
DSSP  ----------------LLLL-hHHHHHHHlllLLEEELLLLL----------llLLLLLl


DSSP  -hHHHHHHHHHHLLLLEEEEELLHHhHHHHHHHL-----lLEEE-ELLL---------lL
Query -eLKVIVEEAARQNRIVSAHVHGKAgIMAAIKAG-----cKSLE-HVSY---------aD  268
ident        |    |   |  |      |     |                           
Sbjct aqWRPLLERIGEQGWHVELHRQVAD-IPVLVRALqpygldIVIDhFGRPdarrglgqpgF  173
DSSP  llLHHHHHHHHHHLLEEEELLLLLL-HHHHHHHHllllllEEELhHHLLllllllllllH


DSSP  HHHHHHhHHHLLEEELLHHHHhhhhhhllllllllhhHLLL-HHHHHHHHHHHHHHHLLL
Query EEVWELmKEKGILYVATRSVIeiflasngeglvkeswAKLQ-ALADSHLKAYQGAIKAGV  327
ident  |   |                                            |         
Sbjct AELLTLsGRGKVWVKVSGIYR---------------lQGSPeENLAFARQALCALEAHYG  218
DSSP  HHHLLLlLLLLEEEEEELHHH---------------lLLLHhHHHHHHHHHHHHHHHHLL


DSSP  --LEELLLLLL-----lllLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHHhhHLLLLll
Query --TIALGTDTA-----pggPTALELQFAVERgGMTPLEAIKAATANAPLSVgpQAPLTgq  380
ident       | |                       |             |         |   
Sbjct aeRLXWGSDWPhtqhesevSFGSAVEQFEAL-GCSAQLRQALLLDTARALF--GFELE--  273
DSSP  hhHEEEELLLLllllllllLHHHHHHHHHHH-LLLHHHHHHHHLHHHHHHL--LLLLL--


DSSP  lllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query lregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                         
Sbjct --------------------------------------------------------  273
DSSP  --------------------------------------------------------


No 38: Query=4c5yA Sbjct=4dlfA Z-score=13.6

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  ELEEEEEELLlLLLLlLLLLHHHhhllhhhhhhHHHHHHHHHHHL-LEEEEEELLL----
Query PGLWDCHMHFgGDDDyYNDYTSGlathpassgaRLARGCWEALQN-GYTSYRDLAG----  115
ident     | | ||        ||              |                         
Sbjct ALRIDSHQHF-WRYR-AADYPWIgagmgvlardYLPDALHPLMHAqALGASIAVQAragr   58
DSSP  LLLEEEEELL-LLLL-HHHLLLLllllhhhlllLLHHHHHHHHHHlLLLEEEEELLlllh


DSSP  ----LHHHHHHHHhlllllLLEEEELLLeeellllllllllllhhhhhhhhlllllllll
Query ----YGCEVAKAIndgtivGPNVYSSGAalsqtaghgdifalpagevlgsygvmnprpgy  171
ident        | |                |                                 
Sbjct detaFLLELACDE------ARIAAVVGW--------------------------------   80
DSSP  hhhhHHHHHHLLL------LLEEEEEEL--------------------------------


DSSP  llllleEELLlHHHHHHhhHHHHHHL-LLLEEEELLLlllllllllLLLL-LLHH-hHHH
Query wgagplCIADgVEEVRRavRLQIRRG-AKVIXVMASGgvmsrddnpNFAQ-FSPE-eLKV  228
ident                        |                           |        
Sbjct ------EDLR-APQLAE-rVAEWRGTkLRGFRHQLQD--------eADVRaFVDDadFAR  124
DSSP  ------LLLL-LLLHHH-hHHLLLLLlEEEEEELHHH--------lLLHHhHHHLhhHHH


DSSP  HHHHHHHLLLLEEEEELLHHhHHHHHHHL------lLEEE-ELLL-------------lL
Query IVEEAARQNRIVSAHVHGKAgIMAAIKAG------cKSLE-HVSY-------------aD  268
ident  |             |                      |                     
Sbjct GVAWLQANDYVYDVLVFERQ-LPDVQAFCarhdahwLVLDhAGKPalaefdrddtalarW  183
DSSP  HHHHHHHLLLEEEELLLHHH-HHHHHHHHhhlllllEEEHhHHLLlhhhllllllhhhhH


DSSP  HHHHHHHHHH-LLEEELL-HHHHHhhHHHLLllllllhhhlllhhHHHHHHHHHHHHHLL
Query EEVWELMKEK-GILYVAT-RSVIEifLASNGeglvkeswaklqalADSHLKAYQGAIKAG  326
ident                               |                        |  | 
Sbjct RAALRELAALpHVVCKLSgLVTEA--DWRRG---------lrasdLRHIEQCLDAALDAF  232
DSSP  HHHHHHHHLLlLEEEEELlLLLLL--LLLLL---------llhhhHHHHHHHHHHHHHHH


DSSP  L--LEELLLLLL---lllLLHHHHHHHHHL--lLLLHHHHHHHHLLLHHHhhHHHLLlll
Query V--TIALGTDTA---pggPTALELQFAVER--gGMTPLEAIKAATANAPLsvGPQAPltg  379
ident        | |                            |        |        |   
Sbjct GpqRLMFGSDWPvcllaaSYDEVASLVERWaesRLSAAERSALWGGTAAR--CYALP---  287
DSSP  LhhHEEELLLLLhhhhllLHHHHHHHHHHHhhhHLLHHHHHHHLLHHHHH--HLLLL---


DSSP  llllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query qlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                          
Sbjct ---------------------------------------------------------  287
DSSP  ---------------------------------------------------------


No 39: Query=4c5yA Sbjct=2gwgA Z-score=13.5

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEEEEEELLLLLLLL-LLLLH---------------hhhhLLHHHHHHHHHH-HHHHHH
Query pGLWDCHMHFGGDDDY-YNDYT---------------sglaTHPASSGARLAR-GCWEAL  103
ident     | | |                                       |           
Sbjct -XIIDIHGHYTTAPKAlEDWRNrqiagikdpsvxpkvselkISDDELQASIIEnQLKKXQ   59
DSSP  -LLEEEEEELLLLLHHhHHHHHhhhhhhhlhhhlllhhhllLLHHHHHHHHHLlHHHHHH


DSSP  HLLEEEEEELLL----------------LHHHHHHHHHllllllLEEEELlLEEELLLll
Query QNGYTSYRDLAG----------------YGCEVAKAINdgtivgPNVYSSgAALSQTAgh  147
ident   |                             |            |     | | |    
Sbjct ERGSDLTVFSPRagdfnvsstwaaicneLCYRVSQLFP------DNFIGA-AXLPQSP--  110
DSSP  HHLLLEEEEELLlllhhhhhhhhhhhhhHHHHHHHHLL------LLEEEE-EELLLLL--


DSSP  lllllllhhhhhhhhlllllllllllllleeelLLHHHHHHHHHHHHH-HLLLLEEEELL
Query gdifalpagevlgsygvmnprpgywgagplciaDGVEEVRRAVRLQIR-RGAKVIXVMAS  206
ident                                                   |   |     
Sbjct --------------------------------gVDPKTCIPELEKCVKeYGFVAINLNPD  138
DSSP  --------------------------------lLLHHHHHHHHHHHHHlLLLLEEEELLL


DSSP  llllllLLLL-lllllLHHHhHHHHHHHHHLLLLEEEE--------eLLHHHHHH-----
Query ggvmsrDDNP-nfaqfSPEElKVIVEEAARQNRIVSAH--------vHGKAGIMA-----  252
ident                        | |           |                      
Sbjct ----psGGHWtsppltDRIW-YPIYEKXVELEIPAXIHvstgahylnADTTAFXQcvagd  193
DSSP  ----llLLLLllllllLHHH-HHHHHHHHHHLLLEEELlllllhhhhHHHHHHHHhhhll


DSSP  ---hhhhLLLEEEE-LLLLLHH---------------hhHHHHhHLLEEELLHHhhhhhh
Query ---aikaGCKSLEH-VSYADEE---------------vwELMKeKGILYVATRSvieifl  293
ident              |                                |             
Sbjct lfkdfpeLKFVIPHgGGAVPYHwgrfrglaqexkkplleDHVL-NNIFFDTCVY------  246
DSSP  hhhhlllLLEEELHhHLLLHHHhhhhhhhhhhlllllhhHHLL-LLEEEELLLL------


DSSP  hhllllllllhhhlllhhhhhhhhhHHHHHHLLL--LEELLLLLL---------lllllH
Query asngeglvkeswaklqaladshlkaYQGAIKAGV--TIALGTDTA---------pggptA  342
ident                                                             
Sbjct ---------------------hqpgIDLLNTVIPvdNVLFASEXIgavrgidprtgfyyD  285
DSSP  ---------------------lhhhHHHHHHHLLhhHEELLLLLLllllleelllleelL


DSSP  HHHHHHHHLlLLLHHHHHHHHLLLHHHHhHHHLLlllllllllllleeeelllllllhhh
Query LELQFAVERgGMTPLEAIKAATANAPLSvGPQAPltgqlregyeadvialeenpledikv  402
ident             || |       ||     |                             
Sbjct DTKRYIEAStILTPEEKQQIYEGNARRV-YPRLD--------------------------  318
DSSP  LLHHHHHHLlLLLHHHHHHHHLHHHHHH-LHHHH--------------------------


DSSP  hhlhhheeeeeELLEEeellllllllllllllll
Query fqepkavthvwKGGKLfkgpgigpwgedarnpfl  436
ident            ||                     
Sbjct ------aalkaKGKLE-----------------h  329
DSSP  ------hhhhhHHHHL-----------------l


No 40: Query=4c5yA Sbjct=4hk5D Z-score=13.3

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident                                                             
Sbjct -----------------------------------------------------------T    1
DSSP  -----------------------------------------------------------L


DSSP  ELEEEEEELLLLL--LLLLL----LLHH--------------------------------
Query PGLWDCHMHFGGD--DDYYN----DYTS--------------------------------   82
ident |   | | |                                                   
Sbjct PVVVDIHTHMYPPsyIAMLEkrqtIPLVrtfpqadeprlillsselaaldaaladpaakl   61
DSSP  LLLEEEEEEELLHhhHHHHHllllLLEEeeelleeeeeeellhhhhhhhhhhhhllllll


DSSP  hhhllhHHHHhHHHHHHHHHHHLLEEEEEELLL---------------------LHHHHH
Query glathpASSGaRLARGCWEALQNGYTSYRDLAG---------------------YGCEVA  121
ident             ||        ||                                    
Sbjct pgrplsTHFA-SLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiadavnaEFSDMC  120
DSSP  lleellHHHL-LHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhhhhhhhHHHHHH


DSSP  HHHHlllllllEEEELlLEEELLllllllllllhhhhhhhhlllllllllllllleeelL
Query KAINdgtivgpNVYSSgAALSQTaghgdifalpagevlgsygvmnprpgywgagplciaD  181
ident                  |||                                        
Sbjct AQHV------gRLFFF-AALPLS------------------------------------A  137
DSSP  HLLL------lLEEEE-EELLLL------------------------------------L


DSSP  LHHHHHHHHHHHHHHL-LLLEEEELLllllllllllllLLLLHHHhHHHHHHHHHLLLLE
Query GVEEVRRAVRLQIRRG-AKVIXVMASggvmsrddnpnfAQFSPEElKVIVEEAARQNRIV  240
ident  |  |               |    |                |       |  |     |
Sbjct PVDAVKASIERVKNLKyCRGIILGTS--------glgkGLDDPHL-LPVFEAVADAKLLV  188
DSSP  LHHHHHHHHHHHHLLLlEEEEEELLL--------llllLLLLHHH-HHHHHHHHHLLLEE


DSSP  EEEE----------------------------LLHHHHHH--------hhhhLLLEEEE-
Query SAHV----------------------------HGKAGIMA--------aikaGCKSLEH-  263
ident   |                                                     | | 
Sbjct FLHPhyglpnevygprseeyghvlplalgfpmETTIAVARmymagvfdhvrnLQMLLAHs  248
DSSP  EELLlllllhhhhlllhhhlllhhhhhlhhhhHHHHHHHHhhhllhhhhlllLLEEEHHh


DSSP  LLLLLHHH--------------------------HHHHHhHLLEEELLHHhhhhhhhhll
Query VSYADEEV--------------------------WELMKeKGILYVATRSvieiflasng  297
ident                                   |   |   |   |             
Sbjct GGTLPFLAgriescivhdghlvktgkvpkdrrtiWTVLK-EQIYLDAVIY----------  297
DSSP  HLLHHHHHhhhhhhhhllhhhhhllllllllllhHHHHH-HLEEEELLLL----------


DSSP  llllllhhhlllhhhhhhhHHHHHHHHLLL--LEELLLLLL-----------lllLLHHH
Query eglvkeswaklqaladshlKAYQGAIKAGV--TIALGTDTA-----------pggPTALE  344
ident                       | ||          |||                   | 
Sbjct -----------------seVGLQAAIASSGadRLMFGTDHPffppieedvqgpwdSSRLN  340
DSSP  -----------------lhHHHHHHHHHHLhhHEELLLLLLlllllllllllllhHHHHH


DSSP  HHHHHHllLLLH--HHHHHHHLLLHHHHHhhHLLLllllllllllleeeelllllllhhh
Query LQFAVErgGMTP--LEAIKAATANAPLSVgpQAPLtgqlregyeadvialeenpledikv  402
ident  |              |      ||                                   
Sbjct AQAVIK--AVGEgsSDAAAVMGLNAVRVL--SLKA-------------------------  371
DSSP  HHHHHH--HHLLllHHHHHHHLHHHHHHL--LLHH-------------------------


DSSP  hhlhhheeeeeeLLEEeellllllllllllllll
Query fqepkavthvwkGGKLfkgpgigpwgedarnpfl  436
ident                                   
Sbjct --------elehHHHH-----------------h  380
DSSP  --------hhhhHHHH-----------------l


No 41: Query=4c5yA Sbjct=4ofcA Z-score=13.2

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  elEEEEEELLLLLL----------------------LLLL------LLHHhhhllhhhhh
Query pgLWDCHMHFGGDD----------------------DYYN------DYTSglathpassg   92
ident     | | |                                                   
Sbjct -mKIDIHSHILPKEwpdlkkrfgyggwvqlqhhskgEAKLlkdgkvFRVV------renc   53
DSSP  -lLEEEEEELLLLLlllhhhhhllllleeeeeeellEEEEeelleeEEEE------ehhh


DSSP  hHHHHHHHHHHHLLEEEEEELL----------------------lLHHHHHHHHHlllll
Query aRLARGCWEALQNGYTSYRDLA----------------------gYGCEVAKAINdgtiv  130
ident         |  | | |                                            
Sbjct wDPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlcqllnnDLASTVVSYP-----  108
DSSP  lLHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhhhhhhhHHHHHHHHLL-----


DSSP  lLEEEELlLEEEllllllllllllhhhhhhhhlllllllllllllleeeLLLHHHHHHHH
Query gPNVYSSgAALSqtaghgdifalpagevlgsygvmnprpgywgagplciADGVEEVRRAV  190
ident           |                                          |      
Sbjct -RRFVGL-GTLP-------------------------------------MQAPELAVKEM  129
DSSP  -LLEEEE-ELLL-------------------------------------LLLHHHHHHHH


DSSP  HHHH-HHLLLLEEEELLllllllllllllLLLLHHHhHHHHHHHHHLLLLEEEEE-----
Query RLQI-RRGAKVIXVMASggvmsrddnpnfAQFSPEElKVIVEEAARQNRIVSAHV-----  244
ident        |                          |        | |       |      
Sbjct ERCVkELGFPGVQIGTH--------vnewDLNAQEL-FPVYAAAERLKCSLFVHPwdmqm  180
DSSP  HHHHhLLLLLEEEEELE--------elleELLLHHH-HHHHHHHHHHLLEEEEELlllll


DSSP  -----------------LLHHHHHHHHH--------hLLLEEEE-LLLLLHHH-------
Query -----------------HGKAGIMAAIK--------aGCKSLEH-VSYADEEV-------  271
ident                       |   |                |        |       
Sbjct dgrmakywlpwlvgmpaETTIAICSMIMggvfekfpkLKVCFAHgGGAFPFTVgrishgf  240
DSSP  lhhhhlllhhhhlhhhhHHHHHHHHHHLllhhhhlllLLEEELHhHLLHHHHHhhhhhhh


DSSP  ---------------hHHHHhhLLEEELLHHhhhhhhhhllllllllhhhlllhhhhhhH
Query ---------------wELMKekGILYVATRSvieiflasngeglvkeswaklqaladshL  316
ident                            |                                
Sbjct smrpdlcaqdnpmnpkKYLG--SFYTDALVH---------------------------dP  271
DSSP  hhlhhhhlllllllhhHHLL--LLEEELLLL---------------------------lH


DSSP  HHHHHHHHLLL--LEELLLLLLlllLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHHHhh
Query KAYQGAIKAGV--TIALGTDTApggPTALELQFAVERgGMTPLEAIKAATANAPLSVGpq  374
ident                 ||||                          |    ||    |  
Sbjct LSLKLLTDVIGkdKVILGTDYPfplGELEPGKLIESMeEFDEETKNKLKAGNALAFLG--  329
DSSP  HHHHHHHHHHLllLEELLLLLLlllLLLLLLHHHHHLlLLLHHHHHHHHLHHHHHHHL--


DSSP  LLLLlllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllll
Query APLTgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnp  434
ident                                                             
Sbjct LERK--------------------------------------------------------  333
DSSP  LLHH--------------------------------------------------------


DSSP  ll
Query fl  436
ident   
Sbjct qf  335
DSSP  hl


No 42: Query=4c5yA Sbjct=1itqA Z-score=12.8

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeEE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvLM   60
ident                                                             
Sbjct -----------------------------------------------dffrdeaerimRD   13
DSSP  -----------------------------------------------lhhhhhhhhhhLL


DSSP  ELEEEEEELLL--LLLLlllllhhhhhLLHHH--hhHHHH------hHHHHHHHLLEEEE
Query PGLWDCHMHFG--GDDDyyndytsglaTHPAS--sgARLA------rGCWEALQNGYTSY  110
ident     | |        |                    | |                     
Sbjct SPVIDGHNDLPwqLLDM----------FNNRLqderANLTtlagthtNIPKLRAGFVGGQ   63
DSSP  LLEEEEEELHHhhHHHH----------HLLLLllhhHLLLlllllllLHHHHHHLLEEEE


DSSP  EELLL----------------LHHHHHHHHHLLLLLL-----------------LEEEEL
Query RDLAG----------------YGCEVAKAINDGTIVG-----------------PNVYSS  137
ident                          |                                  
Sbjct FWSVYtpcdtqnkdavrrtleQMDVVHRMCRMYPETFlyvtssagirqafregkVASLIG  123
DSSP  EEEELllhhhllllhhhhhhhHHHHHHHHHHHLLLLEeelllhhhhhhhhhlllEEEEEE


DSSP  lLEEELlllllllllllhhhhhhhhlllllllllllllleEELLlhhhHHHHHHHHHHHL
Query gAALSQtaghgdifalpagevlgsygvmnprpgywgagplCIADgveeVRRAVRLQIRRG  197
ident                                          |           |     |
Sbjct -VEGGH----------------------------------SIDS----SLGVLRALYQLG  144
DSSP  -EELHH----------------------------------HLLL----LHHHHHHHHHLL


DSSP  LLLEEEE-------LLLLL-llLLLLlllLLLLhHHHHHHHHHHHHLLLLEEEEELLHHH
Query AKVIXVM-------ASGGV-msRDDNpnfAQFSpEELKVIVEEAARQNRIVSAHVHGKAG  249
ident               |        |        |       | |  |            | 
Sbjct MRYLTLThscntpwADNWLvdtGDSEpqsQGLS-PFGQRVVKELNRLGVLIDLAHVSVAT  203
DSSP  EEEEELLlllllllLLLHHhllLLLLlllLLLL-HHHHHHHHHHHHHLLEEELLLLLHHH


DSSP  HHHHHHHL--lLEEE-ELLL--------LLHHHHHHHHHHLLEEELLhHHHH--hHHHHl
Query IMAAIKAG--cKSLE-HVSY--------ADEEVWELMKEKGILYVATrSVIE--iFLASn  296
ident   |                |            |  | |    |                 
Sbjct MKATLQLSrapVIFShSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN-FYNNyisCTNK-  261
DSSP  HHHHHHHLlllLEELlLLLLllllllllLLHHHHHHHHHHLLEEEEL-LLHHhhlLLLL-


DSSP  lllllllhhhlllhhhhhhhHHHHHHHHLLL--LEELLLLLL---------llLLLH-HH
Query geglvkeswaklqaladshlKAYQGAIKAGV--TIALGTDTA---------pgGPTA-LE  344
ident                                      | |                    
Sbjct -------------anlsqvaDHLDHIKEVAGarAVGFGGDFDgvprvpegledVSKYpDL  308
DSSP  -------------llhhhhhHHHHHHHHHLLhhHEEELLLLLlllllllllllLLLHhHH


DSSP  HHHHhhllLLLHHHHHHHHLLLHHHHH-HHHLllllllllllllleeeelllllllhhhh
Query LQFAvergGMTPLEAIKAATANAPLSV-GPQApltgqlregyeadvialeenpledikvf  403
ident           |  |   |   |                                      
Sbjct IAEL-lrrNWTEAEVKGALADNLLRVFeAVEQ----------------------------  339
DSSP  HHHH-hhlLLLHHHHHHHHLHHHHHHHhHHHH----------------------------


DSSP  hlhhheeeeeelleeeellllllllllllllll
Query qepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                  
Sbjct ---asnltqapeeepipldqlggscrthygyss  369
DSSP  ---llllllllllllllhhhlllllllllllll


No 43: Query=4c5yA Sbjct=2dvtA Z-score=12.5

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct -----------------------------------------------------------m    1
DSSP  -----------------------------------------------------------l


DSSP  ELEEEEEELLLLLLlllLLLH----hhhhllhhhhhhHHHH-HHHHHHHLLEEEEEELL-
Query PGLWDCHMHFGGDDdyyNDYT----sglathpassgaRLAR-GCWEALQNGYTSYRDLA-  114
ident  |      ||        |                               |         
Sbjct QGKVALEEHFAIPE-tlQDSAgfvpgdywkelqhrllDIQDtRLKLMDAHGIETMILSLn   60
DSSP  LLEEEEEEEELLHH-hhHHHLllllllhhhhhhhhhhLLLLhHHHHHHHLLEEEEEEEEl


DSSP  ---------------------lLHHHHHHHHHlllllllEEEELlLEEElllllllllll
Query ---------------------gYGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifal  153
ident                          |                   |||            
Sbjct apavqaipdrrkaieiarrandVLAEECAKRP------dRFLAF-AALP-----------  102
DSSP  llhhhhlllhhhhhhhhhhhhhHHHHHHHHLL------lLEEEE-ELLL-----------


DSSP  lhhhhhhhhlllllllllllllleeeLLLHHHHHHHHHHHHH-HLLLLEEEELLllllll
Query pagevlgsygvmnprpgywgagplciADGVEEVRRAVRLQIR-RGAKVIXVMASggvmsr  212
ident                                             |     |         
Sbjct --------------------------LQDPDAATEELQRCVNdLGFVGALVNGF----sq  132
DSSP  --------------------------LLLHHHHHHHHHHHHHlLLLLEEEEELL----ll


DSSP  lllllllLLLHH-hhHHHHHHHHHLLLLEEEEE-----------------------LLHH
Query ddnpnfaQFSPE-elKVIVEEAARQNRIVSAHV-----------------------HGKA  248
ident                     |          |                            
Sbjct egdgqtpLYYDLpqyRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQE  192
DSSP  lllllllLLLLLhhhHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHH


DSSP  HHHHHHHH-----------LLLEEEE-LLLLLHHH----------------------hHH
Query GIMAAIKA-----------GCKSLEH-VSYADEEV----------------------wEL  274
ident     |                  | |                                  
Sbjct TAVHALRLmasglfdehprLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDY  252
DSSP  HHHHHHHHhhllhhhhlllLLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHH


DSSP  HHhHLLEEELLHHhhhhhhhhllllllllhhhlllhhhhhhHHHHHHHHHLLL--LEELL
Query MKeKGILYVATRSvieiflasngeglvkeswaklqaladshLKAYQGAIKAGV--TIALG  332
ident                                                ||       |   
Sbjct FN-ENFHITTSGN--------------------------frTQTLIDAILEIGadRILFS  285
DSSP  HH-HHEEEELLLL--------------------------llHHHHHHHHLLLLhhHEELL


DSSP  LLLLlllLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHhhhHLLLllllllllllleeee
Query TDTApggPTALELQFAVERgGMTPLEAIKAATANAPLSvgpQAPLtgqlregyeadvial  392
ident ||                          |    ||                         
Sbjct TDWP-feNIDHASDWFNAT-SIAEADRVKIGRTNARRL---FKLD---------------  325
DSSP  LLLL-llLHHHHHHHHHHL-LLLHHHHHHHHLHHHHHH---LLLL---------------


DSSP  lllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query eenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                             
Sbjct --------------------------------------------  325
DSSP  --------------------------------------------


No 44: Query=4c5yA Sbjct=2qpxA Z-score=12.5

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident                                                             
Sbjct -------------------------------------------------gxddlsefvdQ   11
DSSP  -------------------------------------------------lllllhhhhhH


DSSP  ELEEEEEELLLLLL----LLLL---------------------------------llhhh
Query PGLWDCHMHFGGDD----DYYN---------------------------------dytsg   83
ident   | | | ||  |                                               
Sbjct VPLLDHHCHFLIDGkvpnRDDRlaqvsteadkdypladtknrlayhgflalakefaldan   71
DSSP  LLEEEEEELLLLLLllllHHHHhhhhlllllllllhhhhlllhhhhhhhhhhhhhlllll


DSSP  hhllhhhhhhhhHHHHHHHHHLLEEEEEELLL----lhhHHHHHHhlllLLLLEEEELlL
Query lathpassgarlARGCWEALQNGYTSYRDLAG----ygcEVAKAIndgtIVGPNVYSSgA  139
ident                                |                  ||  |     
Sbjct nplaaxndpgyaTYNHRIFGHFHFKELLIDTGfvpddpiLDLDQT--aeLVGIPVKAI-Y  128
DSSP  lllllllhhhhhHHHHHHHHHLLEEEEEEELLlllllllLLHHHH--hhHHLLLEEEE-E


DSSP  EEEllllllllllllhhhhhhhHLLLLLllllllllleeelllHHHHHHHHHHHHHHLLL
Query ALSqtaghgdifalpagevlgsYGVMNPrpgywgagplciadgVEEVRRAVRLQIRRGAK  199
ident  |                                                |      |  
Sbjct RLE----------------thaEDFXLE--------hdnfaawWQAFSNDVKQAKAHGFV  164
DSSP  EHH----------------hhhHHHHLL--------lllhhhhHHHHHHHHHLLLLLLLL


DSSP  LEEEELLLllllllllllLLLL-----------------------------LHHHHHHHH
Query VIXVMASGgvmsrddnpnFAQF-----------------------------SPEELKVIV  230
ident   |  |                                                 |    
Sbjct GFXSIAAY---------rVGLHlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVA  215
DSSP  LEEELHHH---------hLLLLlllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHH


DSSP  HHHHHLLLLEEEEEL-------LHHH-HHHHHHHL--------lLEEEELLLLLHHHHHH
Query EEAARQNRIVSAHVH-------GKAG-IMAAIKAG--------cKSLEHVSYADEEVWEL  274
ident      |      ||           |                    | |      |   |
Sbjct PFIIAQDXPLQFHVGygdadtdXYLGnPLLXRDYLkaftkkglkVVLLHCYPYHREAGYL  275
DSSP  HHHHHHLLLEEEEELlllllllHHHLlHHHHHHHHhhhhhhlllEEEEELLLLHHHHHHH


DSSP  HHHH-LLEEELL-HHHHHHHhhhllllllllhhhlllhhhhhhHHHHHHHHHLLL--LEE
Query MKEK-GILYVAT-RSVIEIFlasngeglvkeswaklqaladshLKAYQGAIKAGV--TIA  330
ident                                                  |        | 
Sbjct ASVFpNLYFDISlLDNLGPS---------------------gaSRVFNEAVELAPytRIL  314
DSSP  HHHLlLEEEELLlHHHHLHH---------------------hhHHHHHHHLLLLLhhHEE


DSSP  LLLLLL-lLLLL---HHHHHHHHHLLL---------llHHHHHHHHLLLHHHHHhhHLLL
Query LGTDTA-pGGPT---ALELQFAVERGG---------mtPLEAIKAATANAPLSVgpQAPL  377
ident    |           |     |                                      
Sbjct FASDAStyPEXYglaARQFKQALVAHFnqlpfvdlaqkKAWINAICWQTSAKLY--HQER  372
DSSP  LLLLLLllHHHHhhhHHHHHHHHHHHHhllllllhhhhHHHHHHHHLHHHHHHL--LLHH


DSSP  LLLLllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query TGQLregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                            
Sbjct ELRV-------------------------------------------------------  376
DSSP  HHLL-------------------------------------------------------


No 45: Query=4c5yA Sbjct=2a3lA Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------lllleeeeeeeeelllllLLEEeeeeeeelleeeeeeehhhllhhhhhh
Query -----------deakvtiiyagllipgdgEPLRnaalvisdkiiafvgseadipkkylrs   49
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------


DSSP  llleeeeEEEE---ELEEEEEELLL-----------------------------------
Query tqsthrvPVLM---PGLWDCHMHFG-----------------------------------   71
ident        |          | | |                                     
Sbjct ------aPHRDfynVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlr  207
DSSP  ------lLLLLlllLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhh


DSSP  ---------llllLLLL------------------------lhhhHHLL--------HHH
Query ---------gdddYYND------------------------ytsgLATH--------PAS   90
ident                                                             
Sbjct evfesldltgydlNVDLldvhadkstfhrfdkfnlkynpcgqsrlREIFlkqdnliqGRF  267
DSSP  hhhhhhlllllllLLLLllllllllllllllllhhhhllllllhhHHHHllllllllLLL


DSSP  HHHHHHHHHHHHHHLLEEEEEELL------------llhhhhhHHHHlllllLLEEEELl
Query SGARLARGCWEALQNGYTSYRDLA------------gygcevaKAINdgtivGPNVYSSg  138
ident  |              |                                     ||    
Sbjct LGEITKQVFSDLEASKYQMAEYRIsiygrkmsewdqlaswivnNDLY-----SENVVWL-  321
DSSP  HHHHHHHHHHHHLLLLLEEEEEEEelllllllhhhhhhhhhhlLLLL-----LLLEEEE-


DSSP  LEEELLLllllllllLHHHhhhhhlllllllllllllleeellLHHHHHHHHHH------
Query AALSQTAghgdifalPAGEvlgsygvmnprpgywgagplciadGVEEVRRAVRL------  192
ident   |              |                                          
Sbjct IQLPRLY----niykDMGI---------------------vtsFQNILDNIFIPlfeatv  356
DSSP  EEEELLH----hhhlLLLL---------------------lllLHHHHHHHLLHhhhhhh


DSSP  ---------hhHHLLLLEEEElLLLL-----------lllllllllllLLHHHHHHHHHH
Query ---------qiRRGAKVIXVMaSGGV-----------msrddnpnfaqFSPEELKVIVEE  232
ident                                                             
Sbjct dpdshpqlhvfLKQVVGFDLV-DDESkperrptkhmptpaqwtnafnpAFSYYVYYCYAN  415
DSSP  lhhhllllhhhHLLEEEEEEE-LLLLllllllllllllllllllllllLHHHHHHHHHHH


DSSP  HHHL----------LLLEEEEEL---LHHHHHHHHHhLLLEEEELLLLL--HHHHHHHHH
Query AARQ----------NRIVSAHVH---GKAGIMAAIKaGCKSLEHVSYAD--EEVWELMKE  277
ident                     |           |     | |  |            |   
Sbjct LYVLnklreskgmtTITLRPHSGeagDIDHLAATFL-TCHSIAHGINLRksPVLQYLYYL  474
DSSP  HHHHhhhhllllllLLEELLLLLlllLLHHHHHHHH-HLLLLLLLHHHHhlHHHHHHHHH


DSSP  HLLEEELLHHHHHHhhhhllllllllhhhlllHHHHhhHHHHHHHHHLLLLEELLLLLL-
Query KGILYVATRSVIEIflasngeglvkeswaklqALADshLKAYQGAIKAGVTIALGTDTA-  336
ident   |                                |            |    | ||   
Sbjct AQIGLAMSPLSNNS------------------LFLDyhRNPFPVFFLRGLNVSLSTDDPl  516
DSSP  HLLLEEELHHHHLL------------------LLLLllLLLHHHHHHLLLLEEELLLLHh


DSSP  ----llLLLHHHHHHHHHLLLLLHHHHHHHhLLLH-HHHHhhHLLLLL--LLLLLLllle
Query ----pgGPTALELQFAVERGGMTPLEAIKAaTANA-PLSVgpQAPLTG--QLREGYeadv  389
ident        |   |   |                 |    |                |    
Sbjct qihltkEPLVEEYSIAASVWKLSACDLCEI-ARNSvYQSG--FSHALKshWIGKDY----  569
DSSP  hhllllLHHHHHHHHHHHHHLLLHHHHHHH-HHHHhHHLL--LLHHHHhhHLLLLL----


DSSP  eeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query ialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                
Sbjct ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 46: Query=4c5yA Sbjct=3pnuA Z-score=12.3

back to top
DSSP  lllleeeeeeeeelllllllEEEEeeeeelleeeeeeehhhllhhhhhhllleeeeEEEE
Query deakvtiiyagllipgdgepLRNAalvisdkiiafvgseadipkkylrstqsthrvPVLM   60
ident                     |                                       
Sbjct ------------------enLYFQ------------------------------snAMKL   12
DSSP  ------------------llLLLL------------------------------llLEEE


DSSP  ELEEEEEELLLLllllllllhhhhhllhhhhHHHHHHHHHHHHHlLEEEEEELLLL----
Query PGLWDCHMHFGGdddyyndytsglathpassGARLARGCWEALQnGYTSYRDLAGY----  116
ident     | | |                         |                         
Sbjct KNPLDMHLHLRD-------------------NQMLELIAPLSAR-DFCAAVIMPNLippl   52
DSSP  ELLEEEEELLLL-------------------HHHHHHHHHHHHL-LLLEEEELLLLllll


DSSP  -----hHHHHHHHhlLLLL---lLEEEELlLEEEllllllllllllhhhhhhhhllllll
Query -----gCEVAKAIndGTIV---gPNVYSSgAALSqtaghgdifalpagevlgsygvmnpr  168
ident             |                                               
Sbjct cnledlKAYKMRI--LKACkdenFTPLMT-LFFK--------------------------   83
DSSP  llhhhhHHHHHHH--HHHHllllLEEEEE-EELL--------------------------


DSSP  lllllllleeelllhhHHHH-HHHHHHHhLLLLEEEElLLLLLLllllllllLLLHHHHH
Query pgywgagplciadgveEVRR-AVRLQIRrGAKVIXVMaSGGVMSrddnpnfaQFSPEELK  227
ident                                  ||     |            |  | ||
Sbjct ----------------NYDEkFLYSAKD-EIFGIXLY-PAGITT-nsnggvsSFDIEYLK  124
DSSP  ----------------LLLHhHHHHHLL-LLLEEEEL-LLLLLL-lllllllLLLHHHHH


DSSP  HHHHHHHHLLLLEEEEEL-----------LHHHHHHHHHHL---LLEEEELL--LLLHhH
Query VIVEEAARQNRIVSAHVH-----------GKAGIMAAIKAG---CKSLEHVS--YADEeV  271
ident    |     |     |                      |         ||       |  
Sbjct PTLEAMSDLNIPLLVHGEtndfvmdresnFAKIYEKLAKHFprlKIVMEHITtkTLCE-L  183
DSSP  HHHHHHHHLLLLEEELLLllllhhhllhhHHHHHHHHHHHLlllLEEELLLLlhHHHH-H


DSSP  HHHhhHHLLEEELLHHHHHH-hHHHL---LLLLlllhhhLLLHhhHHHHHHHHHHH-hlL
Query WELmkEKGILYVATRSVIEI-fLASN---GEGLvkeswaKLQAlaDSHLKAYQGAI-kaG  326
ident              |     |                              |         
Sbjct LKD--YENLYATITLHHLIItlDDVIggkMNPH-lfckpIAKR--YEDKEALCELAfsgY  238
DSSP  HHH--LLLEEEEELLHHHLLlhHHHHlllLLHH-hllllLLLL--HHHHHHHHHHHhllL


DSSP  LLEELLLLLL--------llLLLHHH--hhhhhhllLLLHHHHHHHHLLLHHHhhhhHLL
Query VTIALGTDTA--------pgGPTALE--lqfavergGMTPLEAIKAATANAPLsvgpQAP  376
ident      | | |                                  |    |          
Sbjct EKVMFGSDSAphpkgcaagvFSAPVIlpvlaelfkqNSSEENLQKFLSDNTCK---iYDL  295
DSSP  LLEEELLLLLllllllllllLLHHHHhhhhhhhhhhHLLHHHHHHHHLHHHHH---hHLL


DSSP  LLllllllLLLLEEEELL-------------------llllLHHHhhlhhHEEEeeelle
Query LTgqlregYEADVIALEE-------------------npleDIKVfqepkAVTHvwkggk  417
ident          |     |||                         |         |      
Sbjct KF------KEDKILTLEEkewqvpnvyedkynqvvpymageILKF-----QLKH------  338
DSSP  LL------LLLLEEEEELlleelllleelllleelllllllEELL-----EELL------


DSSP  eeellllllllllllllll
Query lfkgpgigpwgedarnpfl  436
ident                    
Sbjct -------------------  338
DSSP  -------------------


No 47: Query=4c5yA Sbjct=4dziC Z-score=12.0

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident                                                             
Sbjct ---------------------------------------------------------alN    3
DSSP  ---------------------------------------------------------llL


DSSP  ELEEEEEELlLLLLllllllHHHHHLL---------------------------------
Query PGLWDCHMHfGGDDdyyndyTSGLATH---------------------------------   87
ident     |   |                 |                                 
Sbjct YRVIDVDNH-YYEP------LDSFTRHldkkfkrrgvqmlsdgkrtwavigdrvnhfipn   56
DSSP  LLEEEEEEE-LLLL------LLLLLLLllhhhlllleeeeelllleeeeelleellllll


DSSP  ------------------------------------hhhhhHHHHHHHHHHHHLLEEEEE
Query ------------------------------------passgARLARGCWEALQNGYTSYR  111
ident                                                             
Sbjct ptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAF  116
DSSP  llllleelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEE


DSSP  ELL------------------------------LLHHhhHHHHhlllllllEEEELlLEE
Query DLA------------------------------GYGCevAKAIndgtivgpNVYSSgAAL  141
ident  |                                 |                        
Sbjct MLPtfgcgveealkhdieatmasvhafnlwldeDWGF--DRPD-------hRIIAA-PIV  166
DSSP  EELlhhhhhhhhllllhhhhhhhhhhhhhhhhhHLLL--LLLL-------lLEEEL-LLL


DSSP  EllllllllllllhhhhhhhhlllllllllllllleeeLLLHHHHHHHHHHHHHHLLLLE
Query SqtaghgdifalpagevlgsygvmnprpgywgagplciADGVEEVRRAVRLQIRRGAKVI  201
ident |                                               |     ||||  
Sbjct S-------------------------------------LADPTRAVEEVDFVLARGAKLV  189
DSSP  L-------------------------------------LLLHHHHHHHHHHHHHLLLLLE


DSSP  EEELLLlllllllllllllLLHHHhHHHHHHHHHLLLLEEEE------------------
Query XVMASGgvmsrddnpnfaqFSPEElKVIVEEAARQNRIVSAH------------------  243
ident  |                              |     |  |                  
Sbjct LVRPAP---vpglvkprslGDRSH-DPVWARLAEAGVPVGFHlsdsgylhiaaawggakd  245
DSSP  ELLLLL---llllllllllLLHHH-HHHHHHHHHHLLLEEEEllllllhhhhhhllllll


DSSP  ---------eLLHHHHHHHHH--------hLLLEEE--ELLLLLHHH-------------
Query ---------vHGKAGIMAAIK--------aGCKSLE--HVSYADEEV-------------  271
ident                    |                                        
Sbjct pldqvllddrAIHDTMASMIVhgvftrhpkLKAVSIenGSYFVHRLIkrlkkaantqpqy  305
DSSP  hhhhhhhllhHHHHHHHHHHHllhhhhlllLLEEEEllLLLHHHHHHhhhhhhhhhlhhh


DSSP  -----hHHHHhHLLEEELLHhhhhhhhhhllllllllhhhlllhhhhhhHHHHHHHHHLL
Query -----wELMKeKGILYVATRsvieiflasngeglvkeswaklqaladshLKAYQGAIKAG  326
ident       |                                                     
Sbjct fpedpvEQLR-NNVWIAPYY-----------------------------EDDLPELARVI  335
DSSP  llllhhHHHH-HHEEELLLL-----------------------------LLLHHHHHHHH


DSSP  L--LEELLLLLL---llLLLHHHHHHHHhllLLLHHHHHHHHLLLHHHHHHHhlllllll
Query V--TIALGTDTA---pgGPTALELQFAVergGMTPLEAIKAATANAPLSVGPqapltgql  381
ident     |  | |                     |       |    ||    |         
Sbjct GvdKILFGSDWPhgeglASPVSFTAELK---GFSESDIRKIMRDNALDLLGV--------  384
DSSP  LhhHLLLLLLLLlllllLLHHHHHHHHL---LLLHHHHHHHHLHHHHHHHLL--------


DSSP  llllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query regyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                        
Sbjct ---------------------------------------------------qvgs  388
DSSP  ---------------------------------------------------llll


No 48: Query=4c5yA Sbjct=4qrnA Z-score=12.0

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeEEE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpVLM   60
ident                                                             
Sbjct -----------------------------------------------smtqdlktggEQG   13
DSSP  -----------------------------------------------llllllllllLLL


DSSP  ELEEEEEELLLllllllllLHHHHHL------------------------------lhhh
Query PGLWDCHMHFGgdddyyndYTSGLAT------------------------------hpas   90
ident          |                                                  
Sbjct YLRIATEEAFA--------TREIIDVylrmirdgtadkgmvslwgfyaqspseratqile   65
DSSP  LLLEEEEEEEL--------LHHHHHHhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhh


DSSP  hhhHHHH-HHHHHHHLLEEEEEELLL----------------------LHHHHHHHHHll
Query sgaRLAR-GCWEALQNGYTSYRDLAG----------------------YGCEVAKAINdg  127
ident     |           |                                           
Sbjct rllDLGErRIADMDATGIDKAILALTspgvqplhdldeartlatrandTLADACQKYP--  123
DSSP  hhhLLLHhHHHHHHHLLLLEEEEEELlllllllllhhhhhhhhhhhhhHHHHHHHHLL--


DSSP  llllLEEEELlLEEELlllllllllllhhhhhhhhlllllllllllllleeelLLHHHHH
Query tivgPNVYSSgAALSQtaghgdifalpagevlgsygvmnprpgywgagplciaDGVEEVR  187
ident                                                         |   
Sbjct ----DRFIGM-GTVAP-------------------------------------QDPEWSA  141
DSSP  ----LLEEEL-LLLLL-------------------------------------LLHHHHH


DSSP  HHHHHHHH-HLLLLEEEELLlllllllllllLLLL-LHHHhHHHHHHHHHLLLLEEEEE-
Query RAVRLQIR-RGAKVIXVMASggvmsrddnpnFAQF-SPEElKVIVEEAARQNRIVSAHV-  244
ident |      |  | | |                            |             |  
Sbjct REIHRGAReLGFKGIQINSH---------tqGRYLdEEFF-DPIFRALVEVDQPLYIHPa  191
DSSP  HHHHHHHHlLLLLLEEELLL---------llLLLLlLHHH-HHHHHHHHHHLLLEEELLl


DSSP  ------------------------LLHHHHHHHH--------hhLLLEEEE-LLLLLHH-
Query ------------------------HGKAGIMAAI--------kaGCKSLEH-VSYADEE-  270
ident                                  |                |         
Sbjct tspdsmidpmleagldgaifgfgvETGMHLLRLItigifdkypsLQIMVGHmGEALPYWl  251
DSSP  lllllllhhhhhhlllllllhhhhHHHHHHHHHHhhlhhhhlllLLEEELHhHHLHHHHh


DSSP  -------------------------hhHHHHhHLLEEELLHHhhhhhhhhllllllllhh
Query -------------------------vwELMKeKGILYVATRSvieiflasngeglvkesw  305
ident                               |    |                        
Sbjct yrldymhqagvrsqryermkplkktieGYLK-SNVLVTNSGV------------------  292
DSSP  hhhhhhhhhhhhlllllllllllllhhHHHH-HLEEEELLLL------------------


DSSP  hlllhhhhhhHHHHHHHHHLLL--LEELLLLLLllLLLH-HHHHHHHHllLLLHHHHHHH
Query aklqaladshLKAYQGAIKAGV--TIALGTDTApgGPTA-LELQFAVErgGMTPLEAIKA  362
ident             |                 |       |            |      | 
Sbjct --------awEPAIKFCQQVMGedRVMYAMDYP-yQYVAdEVRAMDAM--DMSAQTKKKF  341
DSSP  --------llHHHHHHHHHHHLhhHEELLLLLL-lLLLHhHHHHHHLL--LLLHHHHHHH


DSSP  HLLLHHHHHHhhlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeeell
Query ATANAPLSVGpqapltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgp  422
ident    ||                                                       
Sbjct FQTNAEKWFK--------------------------------------------------  351
DSSP  HLHHHHHHLL--------------------------------------------------


DSSP  llllllllllllll
Query gigpwgedarnpfl  436
ident               
Sbjct -------------l  352
DSSP  -------------l


No 49: Query=4c5yA Sbjct=3iacA Z-score=11.6

back to top
DSSP  --------lllleeeeeeeEELLllllleeeeeeeeelleeeeeeehhhllhhhhhhlll
Query --------deakvtiiyagLLIPgdgeplrnaalvisdkiiafvgseadipkkylrstqs   52
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eeeeeeeEELEEEEEELLLLllllllllhhhhhllhhhhhHHHH----------------
Query thrvpvlMPGLWDCHMHFGGdddyyndytsglathpassgARLA----------------   96
ident             | | |                          |                
Sbjct ------aPXPIYDFHCHLSP--------------------QEIAddrrfdnlgqiwlegd   57
DSSP  ------lLLLEEELLLLLLH--------------------HHHHhllllllhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct hykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgt  117
DSSP  lhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllllllll


DSSP  -----------------------HHHHHHHHLLEEEEEELL--llhHHHHHHHHLLLLLL
Query -----------------------RGCWEALQNGYTSYRDLA--gygCEVAKAINDGTIVG  131
ident                               |                |    |       
Sbjct lfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDdpidsLEYHRQIAADDSID  177
DSSP  lllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLlllllLHHHHHHHHLLLLL


DSSP  LEEEELlLEEELLLLllLLLLLlHHHHHHHH--LLLLLllllllllleeellLHHHHHHH
Query PNVYSSgAALSQTAGhgDIFALpAGEVLGSY--GVMNPrpgywgagplciadGVEEVRRA  189
ident   |  |                     |                              | 
Sbjct IEVAPS-WRPDKVFK--IELDG-FVDYLRKLeaAADVS--------itrfddLRQALTRR  225
DSSP  LEEELL-LLLHHHHL--LLLLL-HHHHHHHHhhHHLLL--------lllhhhHHHHHHHH


DSSP  HHHHHHHLLLLEEEELllllllllllLLLL-----------------------------l
Query VRLQIRRGAKVIXVMAsggvmsrddnPNFA-----------------------------q  220
ident        |                                                    
Sbjct LDHFAACGCRASDHGI----------ETLRfapvpddaqldailgkrlagetlseleiaq  275
DSSP  HHHHHHLLLLEEEEEE----------LLLLllllllhhhhhhhhhhhhllllllhhhhhh


DSSP  lLHHHHHHHHHHHHHLLLLEEEEEL--------------------------LHHHHH-HH
Query fSPEELKVIVEEAARQNRIVSAHVH--------------------------GKAGIM-AA  253
ident      |       |        |                                     
Sbjct fTTAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnnISWALSrLL  335
DSSP  hHHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleellllLHHHHHhHH


DSSP  HHH------LLLEEEeLLLL--LHHHHHHHHHH-------LLEEELLHhHHHHhhhhlll
Query IKA------GCKSLEhVSYA--DEEVWELMKEK-------GILYVATRsVIEIflasnge  298
ident              |         |                                    
Sbjct DSXdvtnelPKTILY-CLNPrdNEVLATXIGNFqgpgiagKVQFGSGW-WFND-------  386
DSSP  HHHhlllllLEEEEE-ELLHhhHHHHHHHHHHLlllllllLEEELLLL-HHHL-------


DSSP  lllllhhhlllhhhHHHHHHHHHHHHLLL---LEELLLLLLLLLLLHHHHHHHHHL----
Query glvkeswaklqalaDSHLKAYQGAIKAGV---TIALGTDTAPGGPTALELQFAVER----  351
ident               |  |         |         ||            |        
Sbjct ------------qkDGXLRQLEQLSQXGLlsqFVGXLTDSRSFLSYTRHEYFRRILcnll  434
DSSP  ------------lhHHHHHHHHHHHHHLLhhhLLLLLLLLLLLLLLHHHHHHHHHHhhhh


DSSP  ------------lllLHHHHHHHHLLLHHHHHHHhlllllllllllllleeeelllllll
Query ------------ggmTPLEAIKAATANAPLSVGPqapltgqlregyeadvialeenpled  399
ident                           ||                                
Sbjct gqwaqdgeipddeaxLSRXVQDICFNNAQRYFTI--------------------------  468
DSSP  hhhhhlllllllhhhHHHHHHHHHLHHHHHHLLL--------------------------


DSSP  hhhhhlhhheeeeeelleeeellllllllllllllll
Query ikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                      
Sbjct ------------------------------------k  469
DSSP  ------------------------------------l


No 50: Query=4c5yA Sbjct=3qy6A Z-score=10.7

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  elEEEEEELLLLLlllllllhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELL------
Query pgLWDCHMHFGGDddyyndytsglathpaSSGARLARGCWEALQNGYTSYRDLA------  114
ident     | | |                       |        |   |              
Sbjct --MIDIHCHILPA-----------mddgaGDSADSIEMARAAVRQGIRTIIATPhhnngv   47
DSSP  --LEELLLLLLLL-----------lllllLLHHHHHHHHHHHHHLLLLEEELLLeellll


DSSP  ---------lLHHHHHHHHHLLlLLLLEEEELlleeellllllllllllhhhhhhhhlll
Query ---------gYGCEVAKAINDGtIVGPNVYSSgaalsqtaghgdifalpagevlgsygvm  165
ident                 |           |                               
Sbjct yknepaavreAADQLNKRLIKE-DIPLHVLPG----------------------------   78
DSSP  llllhhhhhhHHHHHHHHHHHL-LLLLEEELL----------------------------


DSSP  llllllllllleeelllhhhhhhhhhhhhhhllllEEEElllllllllllllllLLLHhh
Query nprpgywgagplciadgveevrravrlqirrgakvIXVMasggvmsrddnpnfaQFSPee  225
ident                                                             
Sbjct -----------------------------------QEIR---------------IYGE--   86
DSSP  -----------------------------------LEEE---------------LLLL--


DSSP  HHHHHHHH----hhllLLEEEEE---lLHHHHHHHHHHL-----LLEEEELL------ll
Query LKVIVEEA----arqnRIVSAHV---hGKAGIMAAIKAG-----CKSLEHVS------ya  267
ident                                                  |          
Sbjct VEQDLAKRqllslndtKYILIEFpfdhVPRYAEQLFYDLqlkgyIPVIAHPErnreiren  146
DSSP  HHHHHHLLllllhhhlLEEEEELllllLLLLHHHHHHHHhhlllEEEEELHHhlhhhhhl


DSSP  LHHHHHHHHHHlLEEELLHHH-hHHHHHhllllllllhhhlllHHHHHHHHHHHHHhhll
Query DEEVWELMKEKgILYVATRSV-iEIFLAsngeglvkeswaklqALADSHLKAYQGAikag  326
ident       |          |      ||                  |    |          
Sbjct PSLLYHLVEKG-AASQITSGSlaGIFGK---------------QLKAFSLRLVEAN----  186
DSSP  LHHHHHHHHLL-LEEEEEHHHhlLLLLH---------------HHHHHHHHHHHLL----


DSSP  LLEELLLLLL----llLLLHHHHHHHHHllLLLHHHHHHHHlLLHHHHHHHHllllllll
Query VTIALGTDTA----pgGPTALELQFAVErgGMTPLEAIKAAtANAPLSVGPQapltgqlr  382
ident        |          |   |                    || |    |        
Sbjct LIHFVASDAHnvktrnFHTQEALYVLEK--EFGSELPYMLT-ENAELLLRNQ--------  235
DSSP  LLLEEELLLLllllllLLHHHHHHHHHH--HHLLHHHHHHH-HHHHHHHLLL--------


DSSP  lllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query egyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                       
Sbjct ------------------------------------------tifrqppqpvkr  247
DSSP  ------------------------------------------llllllllllll


No 51: Query=4c5yA Sbjct=1j5sA Z-score=10.3

back to top
DSSP  -------lllleeeeeeeeELLLlllleeeeeeeeelleeeeeeehhhllhhhhhhllle
Query -------deakvtiiyaglLIPGdgeplrnaalvisdkiiafvgseadipkkylrstqst   53
ident                                                             
Sbjct hmflgedylltnraavrlfNEVK-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------


DSSP  eeeeeeEELEEEEEELLLlllllllllhhhhhllhhhhHHHHH-----------------
Query hrvpvlMPGLWDCHMHFGgdddyyndytsglathpassGARLA-----------------   96
ident            | | |                                            
Sbjct ------DLPIVDPHNHLD--------------------AKDIVenkpwndiwevegatdh   57
DSSP  ------LLLEEELLLLLL--------------------HHHHHhllllllhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct yvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvis  117
DSSP  hhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllll


DSSP  ------------------hHHHHHHHLLEEEEEELL--llhHHHHHHHHLLlLLLLEEEE
Query ------------------rGCWEALQNGYTSYRDLA--gygCEVAKAINDGtIVGPNVYS  136
ident                                           |           |     
Sbjct eetaeeiweetkkklpemtPQKLLRDMKVEILCTTDdpvstLEHHRKAKEA-VEGVTILP  176
DSSP  hhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLlllllLHHHHHHHHH-LLLLEEEL


DSSP  lLLEE--ELLLlllllllllHHHHHHHH-LLLLLllllllllleeellLHHHHHHHHHHH
Query sGAAL--SQTAghgdifalpAGEVLGSY-GVMNPrpgywgagplciadGVEEVRRAVRLQ  193
ident                                                             
Sbjct -TWRPdrAMNV--------dKEGWREYVeKMGER-------ygedtstLDGFLNALWKSH  220
DSSP  -LLLLhhHHLL--------lLLLHHHHHhHHHHH-------hllllllHHHHHHHHHHHH


DSSP  HHHL---LLLEEEELllllllllllLLLL----------------------------llL
Query IRRG---AKVIXVMAsggvmsrddnPNFA----------------------------qfS  222
ident                                                             
Sbjct EHFKehgCVASDHAL----------LEPSvyyvdenraravhekafsgekltqdeindyK  270
DSSP  HHHHlllLLEEEEEE----------LLLLlllllhhhhhhhhhhhlllllllhhhhhhhH


DSSP  HHHHHHHHHHHHHLLLLEEEEEL---------------------------LHHHHHHHHH
Query PEELKVIVEEAARQNRIVSAHVH---------------------------GKAGIMAAIK  255
ident               |     |                                |      
Sbjct AFMMVQFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnflrIAEGLRYFLN  330
DSSP  HHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllllHHHHHHHHHH


DSSP  HL----LLEEeELLL--LLHHHHHHHHHHL-LEEELLHhHHHHhhhhllllllllhhhll
Query AG----CKSLeHVSY--ADEEVWELMKEKG-ILYVATRsVIEIflasngeglvkeswakl  308
ident          |  |                      |                        
Sbjct EFdgklKIVL-YVLDptHLPTISTIARAFPnVYVGAPWwFNDS-----------------  372
DSSP  HLllllLEEE-EELLhhHHHHHHHHHHHLLlEEELLLLlLLLL-----------------


DSSP  lhhhhhhHHHHHHHHHLLL---LEELLLLLLLLLLLH-HHHHHHHHL-------------
Query qaladshLKAYQGAIKAGV---TIALGTDTAPGGPTA-LELQFAVER-------------  351
ident                            ||             |                 
Sbjct ---pfgmEMHLKYLASVDLlynLAGMVTDSRKLLSFGsRTEMFRRVLsnvvgemvekgqi  429
DSSP  ---hhhhHHHHHHHHLLLLhhhLLLLLLLLLLLLHHHhHHHHHHHHHhhhhhhhhhllll


DSSP  -llllHHHHHHHHLLLHHHHHHhhlllllllllllllleeeelllllllhhhhhlhhhee
Query -ggmtPLEAIKAATANAPLSVGpqapltgqlregyeadvialeenpledikvfqepkavt  410
ident                                                             
Sbjct pikeaRELVKHVSYDGPKALFF--------------------------------------  451
DSSP  lhhhhHHHHHHHHLHHHHHHHL--------------------------------------


DSSP  eeeelleeeellllllllllllllll
Query hvwkggklfkgpgigpwgedarnpfl  436
ident                           
Sbjct --------------------------  451
DSSP  --------------------------


No 52: Query=4c5yA Sbjct=1m65A Z-score=10.1

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  elEEEEEELLLlllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLllhhhh
Query pgLWDCHMHFGgdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAgygcev  120
ident     | |||                         |      | | |              
Sbjct -yPVDLHMHTV---------------asthaysTLSDYIAQAKQKGIKLFAITD------   38
DSSP  -lLEELLLLLL---------------lllllllLHHHHHHHHHHHLLLEEEEEE------


DSSP  hhhhhllllllleeeelllEEELlllllllllllhhhhhhhhllllllllllllLLEEel
Query akaindgtivgpnvyssgaALSQtaghgdifalpagevlgsygvmnprpgywgaGPLCia  180
ident                                                             
Sbjct -------------------HGPD------------------------------mEDAP--   47
DSSP  -------------------ELLL------------------------------lLLLL--


DSSP  llhhhhhhHHHHHHHHL-----------lLLEEEELllllllllllllllLLLHhhhhhH
Query dgveevrrAVRLQIRRG-----------aKVIXVMAsggvmsrddnpnfaQFSPeelkvI  229
ident              |                 |                            
Sbjct --------HHWHFINMRiwprvvdgvgilRGIEANI--------------KNVD-geidC   84
DSSP  --------LLHHHHHHHhllleelleeeeEEEEEEL--------------LLLL-llllL


DSSP  HHHHHHLLLLEEEEE-----------lLHHHHHHHHHH-LLLEEEELL-----LLLHHHH
Query VEEAARQNRIVSAHV-----------hGKAGIMAAIKA-GCKSLEHVS-----YADEEVW  272
ident             |                    | |         |            | 
Sbjct SGKMFDSLDLIIAGFhepvfaphdkatNTQAMIATIASgNVHIISHPGnpkyeIDVKAVA  144
DSSP  LHHHHHHLLEEEEELlllllllllhhhHHHHHHHHHHLlLLLEELLLLlllllLLHHHHH


DSSP  HHHHHHLLEEELlHHHHhhhhhhllllllllhhhlllhhhhHHHHHHHHHHHLLLLEELL
Query ELMKEKGILYVAtRSVIeiflasngeglvkeswaklqaladSHLKAYQGAIKAGVTIALG  332
ident |                                                   ||   |||
Sbjct EAAAKHQVALEI-NNSS------------------------NCREVAAAVRDAGGWVALG  179
DSSP  HHHHHHLLEEEE-ELLL------------------------LHHHHHHHHHHHLLLEEEE


DSSP  LLL-LLLLLLHhHHHHHhHLLL---LLHHHHhhHHLL--LHHHHHH---HHLLLllllll
Query TDT-APGGPTAlELQFAvERGG---MTPLEAikAATA--NAPLSVG---PQAPLtgqlre  383
ident  |                         |                                
Sbjct SDShTAFTMGE-FEECL-KILDavdFPPERI--LNVSprRLLNFLEsrgMAPIA------  229
DSSP  LLLlLHHHLLL-LHHHH-HHHHhllLLHHHL--HHHLhhHHHHHHHhllLLLLH------


DSSP  lLLLLeeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query gYEADvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                      
Sbjct eFADL------------------------------------------------  234
DSSP  hHLLL------------------------------------------------


No 53: Query=4c5yA Sbjct=3au2A Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  --------------lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhLLHHH
Query --------------deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadIPKKY   46
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPGV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLLL


DSSP  H-----------------------------------------------------------
Query L-----------------------------------------------------------   47
ident                                                             
Sbjct Eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  Leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   47
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------hhllleeeeeeeEELEEEEEEL-----LLLLlllllll
Query ----------------------rstqsthrvpvlMPGLWDCHMH-----FGGDddyyndy   80
ident                                        |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHstysdGQNT-------  353
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELlllllLLLL-------


DSSP  hhhhhllhhhhhhhHHHHHHHHHHLLEEEEEELLllhhhhhhhhhllllllleeeelllE
Query tsglathpassgarLARGCWEALQNGYTSYRDLAgygcevakaindgtivgpnvyssgaA  140
ident               |      |   ||                                 
Sbjct --------------LEELWEAAKTMGYRYLAVTD-------------------------H  374
DSSP  --------------HHHHHHHHHHHLLLEEEEEE-------------------------E


DSSP  EELlllLLLLllllhhhhhhhhlllllllllllllleeelllhhhhhhHHHHHHHHL---
Query LSQtagHGDIfalpagevlgsygvmnprpgywgagplciadgveevrrAVRLQIRRG---  197
ident                                                        |    
Sbjct SPA---VRVA-----------------------------------ggpSPEEALKRVgei  396
DSSP  LHH---HHLL-----------------------------------lllLHHHHHHHHhhh


DSSP  ------------lLLEEEELllllllllllllllLLLHHhhhhHHHHHHHLLLLEEEEE-
Query ------------aKVIXVMAsggvmsrddnpnfaQFSPEelkvIVEEAARQNRIVSAHV-  244
ident                  |                               |    |   | 
Sbjct rrfnethgppyllAGAEVDI--------------HPDGT--ldYPDWVLRELDLVLVSVh  440
DSSP  hhhhhhhllleeeEEEEEEL--------------LLLLL--llLLHHHHLLLLEEEEELl


DSSP  --------lLHHHHHHHHHHL-LLEEEELL-----------llLHHHHHHHHHHLLEEEL
Query --------hGKAGIMAAIKAG-CKSLEHVS-----------yaDEEVWELMKEKGILYVA  284
ident                 |        | |                | |    ||||     
Sbjct srfnlpkadQTKRLLKALENPfVHVLAHPTarllgrrapieadWEAVFQKAKEKGVAVEI  500
DSSP  llllllhhhHHHHHHHHHLLLlLLEELLLLlllllllllllllHHHHHHHHHHHLLEEEE


DSSP  LhHHHHhhhhhllllllllhhhlllhhhhhHHHHHHHHHHLLLLEELLLLL-LLLL-LLH
Query TrSVIEiflasngeglvkeswaklqaladsHLKAYQGAIKAGVTIALGTDT-APGG-PTA  342
ident                                      |   |  | | ||          
Sbjct D-GYYD--------------------rmdlPDDLARMAYGMGLWISLSTDAhQTDHlRFM  539
DSSP  E-LLLL--------------------llllLHHHHHHHHHLLLLEEEELLLlLHHHhHHH


DSSP  H-HHHHHHhLLLLLHHHhhHHHLLlhhhhhhhhlLLLLllllllllleeeelllllllhh
Query L-ELQFAVeRGGMTPLEaiKAATAnaplsvgpqaPLTGqlregyeadvialeenpledik  401
ident       |  |    |       |                                     
Sbjct ElAVGTAQ-RAWIGPER--VLNTL---------dYEDL----------------------  565
DSSP  HhHHHHHH-HLLLLLLL--LHHHL---------lHHHH----------------------


DSSP  hhhlhhheeeeeelleeeellllllllllllllll
Query vfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                    
Sbjct -------------------------lswlkarrgv  575
DSSP  -------------------------hhhhhlllll


No 54: Query=4c5yA Sbjct=3dcpA Z-score=9.4

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEEEEEELL-----LLLLllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLl
Query pGLWDCHMHF-----GGDDdyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAg  115
ident     | | |      |  |                           |       |     
Sbjct -XKRDGHTHTefcphGTHD-------------------DVEEXVLKAIELDFDEYSIVE-   39
DSSP  -LLEEEEELLlllllLLLL-------------------LHHHHHHHHHHLLLLEEEEEE-


DSSP  lhhhhhhhhhllllllleeeellLEEELLlllllLLLLLHhhhhhhhllllllllllllL
Query ygcevakaindgtivgpnvyssgAALSQTaghgdIFALPAgevlgsygvmnprpgywgaG  175
ident                         |                                   
Sbjct -----------------------HAPLSSefxknTAGDKE----------------avtT   60
DSSP  -----------------------ELLLLHhhhhlLLLLLH----------------hhhL


DSSP  LEEElllhhhhhhhhhhhHHHLL-----------------LLEEEELlllllllllllll
Query PLCIadgveevrravrlqIRRGA-----------------KVIXVMAsggvmsrddnpnf  218
ident                                             |               
Sbjct ASXA-----------xsdLPYYFkkxnhikkkyasdllihIGFEVDY-------------   96
DSSP  LLLL-----------hhhHHHHHhhhhhhhhhllllleeeEEEEEEL-------------


DSSP  lLLLH-HHHHHHHHHHHhLLLL-eEEEE--------------------------------
Query aQFSP-EELKVIVEEAArQNRI-vSAHV--------------------------------  244
ident               |                                             
Sbjct -LIGYeDFTRDFLNEYG-PQTDdgVLSLhflegqggfrsidfsaedynegivqfyggfeq  154
DSSP  -LLLLhHHHHHHHHHHH-HHLLeeEEELleeeelleeeellllhhhhhhhlhhhhllhhh


DSSP  ---lLHHHHHHHHHH-----LLLEEEELL---------------------llLHHHHHHH
Query ---hGKAGIMAAIKA-----GCKSLEHVS---------------------yaDEEVWELM  275
ident        |    | |           | |                             | 
Sbjct aqlaYLEGVKQSIEAdlglfKPRRXGHISlcqkfqqffgedtsdfseevxekFRVILALV  214
DSSP  hhhhHHHHHHHHHHLlllllLLLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHH


DSSP  HHHLLEEELLhHHHHHHhhhllllllllHHHLllhhhhhHHHHHHHHHHLLLLEELLLLL
Query KEKGILYVATrSVIEIFlasngeglvkeSWAKlqaladsHLKAYQGAIKAGVTIALGTDT  335
ident |                                        |    |         | | 
Sbjct KKRDYELDFN-TAGLFK-----------PLCG---etypPKKIVTLASELQIPFVYGSDS  259
DSSP  HHHLLEEEEE-LHHHHL-----------LLLL---llllLHHHHHHHHHLLLLEEEELLL


DSSP  LLL-LLLHHhHHHHHHLLLllhhhhhhhhlllhhhhhhhhlllllllllllllleeeell
Query APG-GPTALeLQFAVERGGmtpleaikaatanaplsvgpqapltgqlregyeadvialee  394
ident                                                             
Sbjct HGVqDIGRG-YSTYCQKLE-----------------------------------------  277
DSSP  LLHhHLLLL-HHHHHHHLL-----------------------------------------


DSSP  lllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query npledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                           
Sbjct ------------------------------------------  277
DSSP  ------------------------------------------


No 55: Query=4c5yA Sbjct=3f2bA Z-score=8.5

back to top
DSSP  --------------lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhHH
Query --------------deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkKY   46
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaEL   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhHH


DSSP  HHH---------------------------lLLEE------eeeeEEELEEEEEElLLLL
Query LRS---------------------------tQSTH------rvpvLMPGLWDCHMhFGGD   73
ident                                                      |      
Sbjct MSGvkkgmwvkvrgsvqndtfvrdlviiandLNEIaanerqdtapEGEKRVELHL-HTPM  119
DSSP  HHLllllleeeeeeeeeeelllleeeeeeeeEEEEllllllllllLLLLLLLLLL-LLLL


DSSP  lllllllhhHHHLlhhhhhhHHHHHHHHHHHLLEEEEEELL---LLHHHHHHHHHlLLLL
Query ddyyndytsGLAThpassgaRLARGCWEALQNGYTSYRDLA---GYGCEVAKAINdGTIV  130
ident                             |   |                 |         
Sbjct ---------SQMD----avtSVTKLIEQAKKWGHPAIAVTDhavVQSFPEAYSAA-KKHG  165
DSSP  ---------LLLL----lllLHHHHHHHHHHLLLLLEEELLlllLLLHHHHHHHH-HHHL


DSSP  LlEEEELlLEEEL-lLLLL------llllllhhhhhhhhLLLLlllllllllleEELLlh
Query GpNVYSSgAALSQ-tAGHG------difalpagevlgsyGVMNprpgywgagplCIADgv  183
ident    |                                                        
Sbjct M-KVIYG-LEANIvdDPFHvtllaqnetglknlfklvslSHIQ------yfhrvPRIP--  215
DSSP  L-LEEEE-EEEEEelLLEEeeeeellhhhhhhhhhhhhhHHLL------lllllLLEE--


DSSP  hhhhhhhhhhhhhlllleeeellllllllllllllllllhhhHHHHHHHHhhLLLLEEEE
Query eevrravrlqirrgakvixvmasggvmsrddnpnfaqfspeeLKVIVEEAarQNRIVSAH  243
ident                                             | |         |   
Sbjct ------------------------------------------RSVLVKHR--DGLLVGSG  231
DSSP  ------------------------------------------HHHHHHLL--LLEEEELL


DSSP  -----ELLHHhhHHHHhhLLLEeeelllllhhhhhhhhhhlleEELLH-HHHHhhhhhll
Query -----VHGKAgiMAAIkaGCKSlehvsyadeevwelmkekgilYVATR-SVIEiflasng  297
ident               |                                   |         
Sbjct cdkgeLFDNV-eDIAR--FYDF---------------------LEVHPpDVYK-------  260
DSSP  lllllLLLLL-lLLHH--HLLL---------------------EEELLhHHHL-------


DSSP  llllllhhHLLLHHHHHHHHHHHHHHHLLL----LEELLLLLLLL---------------
Query eglvkeswAKLQALADSHLKAYQGAIKAGV----TIALGTDTAPG---------------  338
ident                             |                               
Sbjct --------PLYVKDEEMIKNIIRSIVALGEkldiPVVATGNVHYLnpedkiyrkilihsq  312
DSSP  --------LLLLLLHHHHHHHHHHHHHHHHhlllLEEELLLLLLLlhhhhhhhhhhhhll


DSSP  --------------LLLH--HHHHHHHhllLLLHHHHHHHHLLLHHHHHHHHLLL-----
Query --------------GPTA--LELQFAVergGMTPLEAIKAATANAPLSVGPQAPL-----  377
ident                       |          |  |      |                
Sbjct gganplnrhelpdvYFRTtnEMLDCFS---FLGPEKAKEIVVDNTQKIASLIGDVkpikd  369
DSSP  hhhlllllllllllLLLLhhHHHHHHH---HHHHHHHHHHHLHHHHHHHHLLLLLlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct elytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishkl  429
DSSP  lllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct vkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdl  489
DSSP  hhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct pdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednv  549
DSSP  lllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct yragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpd  609
DSSP  eeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct ymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidp  669
DSSP  lllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct ktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselv  729
DSSP  hhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct qisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrk  789
DSSP  hhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct gkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyya  849
DSSP  lllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct syftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsf  909
DSSP  hhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhlllee


DSSP  --------------------------llllllllllleeeelllllllhhhhhlhhheee
Query --------------------------tgqlregyeadvialeenpledikvfqepkavth  411
ident                                                             
Sbjct knidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgkls  969
DSSP  llllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlll


DSSP  eeelleeeellllllllllllllll
Query vwkggklfkgpgigpwgedarnpfl  436
ident                          
Sbjct ktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhhllllllllllllllll


No 56: Query=4c5yA Sbjct=1bksA Z-score=6.9

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident                                                             
Sbjct ----------------------------------------------meryenlfaqlndR   14
DSSP  ----------------------------------------------lhhhhhhhhhhhhL


DSSP  ELEEEeEELL-LLLLllllllhhhhhlLHHHHHHHHHHHHHHHhhlleeeEEELLL----
Query PGLWDcHMHF-GGDDdyyndytsglatHPASSGARLARGCWEAlqngytsYRDLAG----  115
ident             ||                 |                       |    
Sbjct REGAF-VPFVtLGDP------------GIEQSLKIIDTLIDAG------aDALELGvpfs   55
DSSP  LLLEE-EEEEeLLLL------------LHHHHHHHHHHHHHLL------lLLEEEEllll


DSSP  ----------------------------LHHHHHHHHHlllllllEEEELlLEEELLlll
Query ----------------------------YGCEVAKAINdgtivgpNVYSSgAALSQTagh  147
ident                                                             
Sbjct dpladgptiqnanlrafaagvtpaqcfeMLALIREKHP-------TIPIG-LLMYAN---  104
DSSP  llllllhhhhhhhhhhhhhlllhhhhhhHHHHHHHHLL-------LLLEE-EEELHH---


DSSP  lllllllhhhhhhhHLLLllllllllllleeelllhHHHHHHHHHHHHHLLLLEEEElll
Query gdifalpagevlgsYGVMnprpgywgagplciadgvEEVRRAVRLQIRRGAKVIXVMasg  207
ident                                                  |     |    
Sbjct --------------LVFN------------------NGIDAFYARCEQVGVDSVLVA---  129
DSSP  --------------HHHL------------------LLHHHHHHHHHHHLLLEEEEL---


DSSP  llllllllllllLLLHhhHHHHHHHHHHLLLLEEEEELLHH---HHHHHHhHLLL-EEEE
Query gvmsrddnpnfaQFSPeeLKVIVEEAARQNRIVSAHVHGKA---GIMAAIkAGCK-SLEH  263
ident                          | | |          |                   
Sbjct ----------dvPVEE--SAPFRQAALRHNIAPIFICPPNAdddLLRQVA-SYGRgYTYL  176
DSSP  ----------llLHHH--LHHHHHHHHHLLLEEEEEELLLLlhhHHHHHH-HHLLlLEEE


DSSP  LlllLHHHHHHHHH-HLLEEELLHHHHHhhhhhllllllllhhhlllhhhhhhhhhHHHH
Query VsyaDEEVWELMKE-KGILYVATRSVIEiflasngeglvkeswaklqaladshlkaYQGA  322
ident          |  ||                                              
Sbjct LalpLHHLIEKLKEyHAAPALQGFGISS---------------------peqvsaaVRAG  215
DSSP  LlllHHHHHHHHHHhLLLLEEELLLLLL---------------------hhhhhhhHHHL


DSSP  hhllllEELLLLL----------------------llllLLHHhhhhhhhlllllhhhhh
Query ikagvtIALGTDT----------------------apggPTALelqfaverggmtpleai  360
ident                                          |                  
Sbjct -----aAGAISGSaivkiieknlaspkqmlaelrsfvsaMKAA-----------------  253
DSSP  -----lLEEEELLhhhhhhhhllllhhhhhhhhhhhhhhHHHL-----------------


DSSP  hhhlllhhhhhhhhlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeee
Query kaatanaplsvgpqapltgqlregyeadvialeenpledikvfqepkavthvwkggklfk  420
ident                                                             
Sbjct ------------------------------------------------------------  253
DSSP  ------------------------------------------------------------


DSSP  llllllllllllllll
Query gpgigpwgedarnpfl  436
ident                 
Sbjct --------------sr  255
DSSP  --------------ll


No 57: Query=4c5yA Sbjct=3e38A Z-score=4.7

back to top
DSSP  lllleeeeeeeeeLLLLLLleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE
Query deakvtiiyagllIPGDGEplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
ident               |                                             
Sbjct -----aqrrneiqVPDLDG---------------------------------------yT   16
DSSP  -----llllllllLLLLLL---------------------------------------lE


DSSP  ELEEEEEELLLlllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL------
Query PGLWDCHMHFGgdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLA------  114
ident     | | |                               ||   |              
Sbjct TLKCDFHXHSV----------------fsdglvWPTVRVDEAYRDGLDAISLTEhieyrp   60
DSSP  EEEEELLLLLL----------------llllllLHHHHHHHHHHLLLLEELLEEelllll


DSSP  ----------lLHHHHHHHHHlllLLLLEEEELlleeellllllllllllhhhhhhhhll
Query ----------gYGCEVAKAINdgtIVGPNVYSSgaalsqtaghgdifalpagevlgsygv  164
ident                           |                                 
Sbjct hkqdvvsdhnrSFDLCREQAE---KLGILLIKG---------------------------   90
DSSP  llllllllllhHHHHHHHHHH---HHLLEELLE---------------------------


DSSP  lllllllllllleeelllhhhhhhhhhhhhhhlllleEEELLL--lllllllllllllll
Query mnprpgywgagplciadgveevrravrlqirrgakviXVMASG--gvmsrddnpnfaqfs  222
ident                                                             
Sbjct ------------------------------------sEITRAXapghfnaiflsdsnple  114
DSSP  ------------------------------------eEEELLLllleeeeelllllhhhl


DSSP  HHHHHHHHHHHHHLLLLeeeeellhhhhhhhhhhllLEEEELL-------LLLHH---hh
Query PEELKVIVEEAARQNRIvsahvhgkagimaaikagcKSLEHVS-------YADEE---vw  272
ident     |    ||  |                          |                   
Sbjct QKDYKDAFREAKKQGAF-------------------XFWNHPGwdsqqpdTTKWWpehta  155
DSSP  LLLHHHHHHHHHHLLLE-------------------EEELLLLlllllllLLLLLhhhhh


DSSP  hhhhhhLLEEE-LLHHHhhhhhhhllllllllhhhlllhhhhhhhhhHHHHHHLL----L
Query elmkekGILYV-ATRSVieiflasngeglvkeswaklqaladshlkaYQGAIKAG----V  327
ident             |                                     ||        
Sbjct lyqegcXHGIEvANGHL-----------------------------yXPEAIQWCldknL  186
DSSP  hhhlllLLEEEeEELLE-----------------------------eLLHHHHHHhhhlL


DSSP  LEELLLLLL--------lllllHHHHhhhhhlllllhhhhhhhHLLLhhhhhhhhLLLL-
Query TIALGTDTA--------pggptALELqfaverggmtpleaikaATANaplsvgpqAPLT-  378
ident |     |                                                     
Sbjct TXIGTSDIHqpiqtdydfekgeHRTX-----------------TFVF---akersLQGIr  226
DSSP  EEEEELLLLllhhhhllhhhllLLLE-----------------EEEE---ellllHHHHh


DSSP  ----------------------------------lllllllllleeeelLLLLLL-----
Query ----------------------------------gqlregyeadvialeENPLED-----  399
ident                                                     |       
Sbjct ealdnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnVTDLVLklkkt  286
DSSP  hhhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeeLLLLLEeeeel


DSSP  -------------------hhhhhlhhheeeeeelleeeellllllllllllllll
Query -------------------ikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                         
Sbjct ahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  llllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 58: Query=4c5yA Sbjct=2yb1A Z-score=4.5

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  elEEEEEELLllllllllllhhhhhllhhhHHHHHHHHHHHHHhllEEEEEELL----lL
Query pgLWDCHMHFggdddyyndytsglathpasSGARLARGCWEALqngYTSYRDLA----gY  116
ident     | | |                                                   
Sbjct -aNIDLHFHS-------------rtsdgalTPTEVIDRAAARA---PALLALTDhdctgG   43
DSSP  -lLEELLLLL-------------lllllllLHHHHHHHHHLLL---LLEEEELLlllllL


DSSP  HHHHHHHHHlllLLLLEEEEL--------------------------------lleeELL
Query GCEVAKAINdgtIVGPNVYSS--------------------------------gaalSQT  144
ident   | | |       |                                             
Sbjct LAEAAAAAA---RRGIPFLNGvevsvswgrhtvhivglgidpaepalaaglksiregRLE  100
DSSP  HHHHHHHHH---HLLLLEEEEeeeeeeelleeeeeeeellllllhhhhhhhhhhhllHHH


DSSP  L-------lllllllLLHHHHHHHHllllllllllllllEEELllhhhhhhhhhhhhhhl
Query A-------ghgdifaLPAGEVLGSYgvmnprpgywgagpLCIAdgveevrravrlqirrg  197
ident                                          |                  
Sbjct RarqmgasleaagiaGCFDGAMRWC-----------dnpEMIS-------------rthf  136
DSSP  HhhhhhhhhhhllllLHHHHHHLLL-----------llhHHLL-------------hhhh


DSSP  llleeeelllllllLLLL----lllllllhHHHHhhhhhhhhlllleeeeellhhhhhhH
Query akvixvmasggvmsRDDN----pnfaqfspEELKviveeaarqnrivsahvhgkagimaA  253
ident                                                             
Sbjct arhlvdsgavkdmrTVFRkyltpgkpgyvsHQWA-------------------------S  171
DSSP  hhhhhhllllllhhHHHHhlllllllllllLLLL-------------------------L


DSSP  HHHLL---------LEEEELL------llLHHHHHHHHH-HLLEEELLHHHHHhhhhhll
Query IKAGC---------KSLEHVS------yaDEEVWELMKE-KGILYVATRSVIEiflasng  297
ident                   |           |          |                  
Sbjct LEDAVgwivgaggmAVIAHPGrydmgrtlIERLILDFQAaGGQGIEVASGSHS-------  224
DSSP  HHHHHhhhhhllleEEELLHHhllllhhhHHHHHHHHHHlLLLEEEEEELLLL-------


DSSP  llllllhhhlllhhhhhhHHHHHHHHHLLLLEELLLLLL--lllllHHHHhhHHHLLlll
Query eglvkeswaklqaladshLKAYQGAIKAGVTIALGTDTA--pggptALELqfAVERGgmt  355
ident                    |    |   |     | |           |           
Sbjct --------------lddmHKFALHADRHGLYASSGSDFHapgedvgHTED--LPPIC---  265
DSSP  --------------hhhhHHHHHHHHHHLLEEEEELLLLlllllllLLLL--LLLLL---


DSSP  hhhhhhhhllLHHHhHHHHLllllllllllllleeeelllllllhhhhhlhhheeeeeEL
Query pleaikaataNAPLsVGPQApltgqlregyeadvialeenpledikvfqepkavthvwKG  415
ident                                                             
Sbjct --------rpIWRE-LEARI-----------------------------------lrpAD  281
DSSP  --------llHHHH-LHHHL-----------------------------------lllLH


DSSP  LEeeellllllllllllllll
Query GKlfkgpgigpwgedarnpfl  436
ident                      
Sbjct AE------------------n  284
DSSP  HH------------------l


No 59: Query=4c5yA Sbjct=2anuA Z-score=4.4

back to top
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee
Query deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
ident                                                             
Sbjct ----------------------------------------------------------te    2
DSSP  ----------------------------------------------------------le


DSSP  ELEEEEEElLLLLlllllllhhhhhllhhhHHHHHHHHHHHHHhllEEEEEELL------
Query PGLWDCHMhFGGDddyyndytsglathpasSGARLARGCWEALqngYTSYRDLA------  114
ident   | | |                                                     
Sbjct WLLCDFHV-HTNX------------sdghlPLGEVVDLFGKHG---VDVVSITDhivdrr   46
DSSP  EEEEEEEE-LLLL------------lllllLHHHHHHHHHHLL---LLEEEEEEeeelhh


DSSP  ------------------------lLHHHHHHHHhllLLLLLEEEELlLEEELLLLLlll
Query ------------------------gYGCEVAKAIndgTIVGPNVYSSgAALSQTAGHgdi  150
ident                                |        |                   
Sbjct tleqrkrngeplgaitedkfqdylkRLWREQKRA--wEEYGXILIPG-VEITNNTDL---  100
DSSP  hhhhhhhllllllllllllhhhhhhHHHHHHHHH--hHHHLLEEEEE-EEEEELLLL---


DSSP  llllhhhhhhhhlllllllllllllleeelllhhhhhhhhhhHHHHlllleeeellllll
Query falpagevlgsygvmnprpgywgagplciadgveevrravrlQIRRgakvixvmasggvm  210
ident                                                             
Sbjct -----------------------------------yhivavdVKEY--------------  111
DSSP  -----------------------------------eeeeeelLLLL--------------


DSSP  llllllllllllhHHHHHHHHHHHHLLLLEEEEE--------llHHHHHHHHHhLLLEEE
Query srddnpnfaqfspEELKVIVEEAARQNRIVSAHV--------hgKAGIMAAIKaGCKSLE  262
ident                   |||    ||  | |             |             |
Sbjct ---------vdpsLPVEEIVEKLKEQNALVIAAHpdrkklswylWANXERFKD-TFDAWE  161
DSSP  ---------llllLLHHHHHHHHHHLLLEEEELLllllllllhhHHLLLLLLL-LLLEEE


DSSP  E----lLLLLhhHHHHHhhhllEEELlhhhhhhhhhhllllllllhhhlllhhhhhhhhh
Query H----vSYADeeVWELMkekgiLYVAtrsvieiflasngeglvkeswaklqaladshlka  318
ident                        |||                                  
Sbjct IanrddLFNS-vGVKKY-----RYVA----------------------------------  181
DSSP  EeelleELHH-hHHLLL-----LEEE----------------------------------


DSSP  hhhhhhlllleelLLLLLllLLLHHHhhhhhhlllllhhhhhhhHLLLhhhhhhhhLLLL
Query yqgaikagvtialGTDTApgGPTALElqfaverggmtpleaikaATANaplsvgpqAPLT  378
ident                |                                            
Sbjct -------------NSDFHelWHVYSW----------------ktLVKS-----eknIEAI  207
DSSP  -------------ELLLLlhHHHLLE----------------eeEEEE-----lllHHHH


DSSP  lllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll
Query gqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
ident                                                           
Sbjct -----------------------------------------keairkntdvaiylxrk  224
DSSP  -----------------------------------------hhhhhhllleeeeelll