Results: dupa

Query: 4b3zD

MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  4b3z-D 74.2  0.0  477   477  100 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   2:  1gkp-A 56.1  1.4  452   458   36 PDB  MOLECULE: HYDANTOINASE;                                              
   3:  3e74-A 46.5  2.3  421   429   26 PDB  MOLECULE: ALLANTOINASE;                                              
   4:  3gri-A 40.4  2.7  399   422   24 PDB  MOLECULE: DIHYDROOROTASE;                                            
   5:  3giq-A 30.6  2.9  363   475   21 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   6:  3pnu-A 29.0  3.3  319   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
   7:  1yrr-B 28.2  3.3  307   334   17 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
   8:  1onx-A 27.7  2.8  333   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   9:  3nqb-A 26.9  3.3  314   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  10:  2vun-A 26.3  2.9  326   385   18 PDB  MOLECULE: ENAMIDASE;                                                 
  11:  4cqb-A 25.3  3.8  327   402   16 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  12:  3mtw-A 23.5  3.6  326   404   15 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  13:  2paj-A 23.4  3.7  317   421   15 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  14:  2ogj-A 23.2  3.5  319   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  15:  2oof-A 22.6  4.1  320   403   13 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  16:  3mkv-A 22.5  3.4  315   414   17 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  17:  1a5k-C 22.2  2.8  343   566   19 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  18:  3icj-A 21.9  3.6  300   468   15 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  19:  1k6w-A 21.7  4.0  323   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  20:  3ooq-A 21.6  3.3  286   384   20 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  21:  3ls9-A 21.3  3.7  324   453   14 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  22:  1j6p-A 21.2  4.0  316   407   17 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  23:  4c5y-A 20.3  3.8  321   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  24:  3cjp-A 18.7  2.8  226   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  25:  2ob3-A 18.5  3.3  252   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  26:  2uz9-A 18.5  4.1  315   444   12 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  27:  3irs-A 18.3  2.9  232   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  28:  4rdv-B 17.6  3.7  314   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  29:  2dvt-A 17.6  3.2  250   325   11 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  30:  4ofc-A 17.0  3.2  247   335   11 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  31:  2vc5-A 16.7  3.0  237   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  32:  3k2g-B 16.7  3.1  237   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  33:  4dlf-A 16.7  3.2  237   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  34:  1bf6-A 16.7  2.9  225   291    9 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  35:  4hk5-D 16.6  3.2  260   380    9 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  36:  2ffi-A 16.5  3.0  232   273    9 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  37:  2y1h-B 16.3  3.1  229   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  38:  2qpx-A 16.3  3.2  237   376   10 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  39:  4qrn-A 16.2  3.1  248   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  40:  1itq-A 15.6  3.2  238   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  41:  4dzi-C 15.4  3.8  251   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  42:  2imr-A 15.4  5.7  290   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  43:  4mup-B 15.1  3.3  234   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  44:  2gwg-A 14.8  3.3  227   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  45:  3gg7-A 14.6  3.4  219   243    9 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  46:  1a4m-A 14.5  3.4  236   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  47:  3qy6-A 13.9  3.1  203   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  1j5s-A 13.0  3.7  240   451    8 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  3iac-A 12.2  4.1  245   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  1v77-A 11.1  3.9  182   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  3dcp-A  9.3  4.0  195   277   13 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  52:  2a3l-A  9.3  3.8  240   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  53:  3f2b-A  8.5  9.4  200   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  1m65-A  8.3  3.5  172   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3au2-A  8.1  9.4  184   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  56:  1bks-A  7.2  4.1  177   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  5.1  3.3  140   224    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  4.5  3.6  138   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  4.5  3.9  157   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=4b3zD Sbjct=4b3zD Z-score=74.2

back to top
DSSP  LEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query DRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNT   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNT   60
DSSP  LEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LLLLLLLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHHLLLLLEEEEEE
Query YLQKTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YLQKTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHV  120
DSSP  LLLLLLLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHHLLLLLEEEEEE


DSSP  ELLLLLLLHHHHHHHHHHLLLLLEEEEELLLLLLLLLLHHHHHHHHHHHHHHLLEEEEEL
Query DITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHA  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHA  180
DSSP  ELLLLLLLHHHHHHHHHHLLLLLEEEEELLLLLLLLLLHHHHHHHHHHHHHHLLEEEEEL


DSSP  LLHHHHHHHHHHHHHLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHHLLLEEEEEELLHH
Query ENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKS  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKS  240
DSSP  LLHHHHHHHHHHHHHLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHHLLLEEEEEELLHH


DSSP  HHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLLLHHHHHHLLLLLLLLLLLLHHHHHHH
Query AADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTS  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTS  300
DSSP  HHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLLLHHHHHHLLLLLLLLLLLLHHHHHHH


DSSP  HHHHLLLLLLLLLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLLLLHHH
Query LLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQ  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQ  360
DSSP  HHHHLLLLLLLLLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLLLLHHH


DSSP  HHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEEEEELLLLLLLLLLLLLLLLLLEE
Query FVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMEC  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMEC  420
DSSP  HHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEEEEELLLLLLLLLLLLLLLLLLEE


DSSP  EEEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLLLLL
Query HGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSR  477
ident |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSR  477
DSSP  EEEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLLLLL


No 2: Query=4b3zD Sbjct=1gkpA Z-score=56.1

back to top
DSSP  lEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query dRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNT   60
ident   |||| | ||  |    || | |   |  || ||  | |   | | |  | || ||   
Sbjct -PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHV   59
DSSP  -LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LLLL-----LLLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHHLLLLLE
Query YLQK-----TAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCD  115
ident           | |    |  ||| ||||  |    |      |     |   |   | ||
Sbjct HIYLpfmatFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCD  119
DSSP  LLLLeelleELLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHLLLLLLE


DSSP  EEEEEELLLLLLLHHHHHHHHHHlLLLLEEEEELLLLLLLLLLHHHHHHHHHHHHHHLLE
Query YSLHVDITSWYDGVREELEVLVQdKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAV  175
ident |  |             |   |   |  ||     ||      |   |      | ||  
Sbjct YTFHMAVSKFDEKTEGQLREIVA-DGISSFXIFLSYKNFFGVDDGEMYQTLRLAKELGVI  178
DSSP  EEEEEELLLLLLLHHHHHHHHHH-LLLLEEEEEELLLLLLLLLHHHHHHHHHHHHHHLLE


DSSP  EEEELLLHHHHHHHHHHHHHLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHHLLLEEEEE
Query ILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITK  235
ident    | ||  |    |   |  | |||| |  ||||  |||   |  |         |   
Sbjct VTAHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVH  238
DSSP  EEEEELLHHHHHHHHHHHHHLLLLLHHHLLLLLLHHHHHHHHHHHHHHHHHHLLEEEELL


DSSP  ELLHHHHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLlLHHHHHHLLLLLLLLlLLLHH
Query VMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSkNWAKAAAFVTSPPLSpDPTTP  295
ident    | | |    |   |     |        | |         |     ||||  |    
Sbjct LSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAER-GGVEAMKYIMSPPLR-DKRNQ  296
DSSP  LLLHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHHL-LHHHHHLLLLLLLLL-LLHHH


DSSP  HHHHHHHHHLLLLLLLLLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLL
Query DYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGK  355
ident   |   || |     |  |||  | ||  ||  || || |   || |        |  | 
Sbjct KVLWDALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGR  356
DSSP  HHHHHHHHLLLLLEEELLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLL


DSSP  LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEEEEELLLLLLLLLLLLLLL
Query MDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIF  415
ident  |   ||   || ||| | | |||| |||||||| |  ||    ||  |       || |
Sbjct LDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGF  416
DSSP  LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLL


DSSP  LLLEEEEEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLLhhhhhhhhhhhhhllllll
Query EGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPehlyqrvkirnkvfglqgv  475
ident || |  | | ||   ||    ||     || |    |                       
Sbjct EGFEIDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMY-------------------  457
DSSP  LLLEELLEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLL-------------------


DSSP  ll
Query sr  477
ident   
Sbjct -f  458
DSSP  -l


No 3: Query=4b3zD Sbjct=3e74A Z-score=46.5

back to top
DSSP  -lEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLLLLllLEEEELLLLEEEELEEEEE
Query -dRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPggVKTIEANGRMVIPGGIDVN   59
ident    | || |  |        |     | |  ||  |          | |  | ||  |  
Sbjct sfDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDA--KEVXDASGLVVSPGXVDAH   58
DSSP  leEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLLE--EEEEELLLLEEEELEEEEE


DSSP  ELLllllllLHHHHHHHHHHLLEEEEEEEELLL-llllHHHHHHHHHHHHHLLLLLEEEE
Query TYLqktaadDFFQGTRAALVGGTTMIIDHVVPE-pgssLLTSFEKWHEAADTKSCCDYSL  118
ident |            |||||  || |  |              | |    ||  |   |   
Sbjct THI------GYETGTRAAAKGGITTXIEXPLNQlpatvDRASIELKFDAAKGKLTIDAAQ  112
DSSP  ELL------LHHHHHHHHHHLLEEEEEELLLLLlllllLHHHHHHHHHHHLLLLLLEEEE


DSSP  EEELLLLlllHHHHHHHHHHlLLLLEEEEELlllllLLLLHHHHHHHHHHHHHHLLEEEE
Query HVDITSWydgVREELEVLVQdKGVNSFQVYMaykdvYQMSDSQLYEAFTFLKGLGAVILV  178
ident      |        |  |    ||  |             | |       |  ||   ||
Sbjct LGGLVSY---NIDRLHELDE-VGVVGFXCFV-----RDVNDWQFFKGAQKLGELGQPVLV  163
DSSP  LEELLLL---LLLLHHHHHH-HLLLLEEEEL-----LLLLHHHHHHHHHHHHHHLLLEEE


DSSP  ELLLHHHHHHHHHHHHHLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHHLLLEEEEEELL
Query HAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMS  238
ident | ||              |         |||   | ||  |    |    |      | |
Sbjct HCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSS  223
DSSP  ELLLHHHHHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHHHHHHHHHHHHLLLEEELLLLL


DSSP  HHHHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLllhhHHHHLLLLLLLLlLLLHHHHH
Query KSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSknwaKAAAFVTSPPLSpDPTTPDYL  298
ident          ||  |     |        |                 |||   |       
Sbjct PEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEE----IGTLAKCSPPIR-DLENQKGX  278
DSSP  HHHHHHHHHHHHLLLLEEEEELLHHHHLLHHHHHH----HLHHHLLLLLLL-LHHHHHHH


DSSP  HHHHHHLLLLLLLLLLLLLLHHHHHHHlllHHHLLLLLLLLLLHHHHHHHHHLLLLLLLH
Query TSLLACGDLQVTGSGHCPYSTAQKAVGkdnFTLIPEGVNGIEERMTVVWDKAVATGKMDE  358
ident    |  |      | | |     ||           |  |      |  | ||       
Sbjct WEKLFNGEIDCLVSDHSPCPPEXKAGN---IXKAWGGIAGLQSCXDVXFDEAVQKRGXSL  335
DSSP  HHHHHLLLLLEELLLLLLLLLLLLLLL---LLLLLLLLLLHHHHHHHHHHHHLLLLLLLH


DSSP  HHHHHHHLHHHHHHHLLLlLLLLLLLLLLLLEEEEEEEEEEELLLLLLLLLLLLLLLLLL
Query NQFVAVTSTNAAKIFNLYpRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGM  418
ident   |     |||| || |   ||||| | ||| |   |      |              | 
Sbjct PXFGKLXATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGR  394
DSSP  HHHHHHHLHHHHHHLLLL-LLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLL


DSSP  EEEEEEEEEEELLEEEEELL-EELLLLlLLLLLLLLlllhhhhhhhhhhhhhllllllll
Query ECHGSPLVVISQGKIVFEDG-NINVNKgMGRFIPRKafpehlyqrvkirnkvfglqgvsr  477
ident          |  |           |    | ||                           
Sbjct TIGARITKTILRGDVIYDIEqGFPVAP-KGQFILKH------------------------  429
DSSP  EELLEEEEEEELLEEEEELLlLLLLLL-LLLEELLL------------------------


No 4: Query=4b3zD Sbjct=3griA Z-score=40.4

back to top
DSSP  lEEEEEEEEEEllLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query dRLLIKGGRIIndDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNT   60
ident    ||| |          ||       ||||        ||  | | |  | ||  ||  
Sbjct -XKLIKNGKVLqnGELQQADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHV   59
DSSP  -LEEEELLEEEelLEEEELEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LLL---LLLLLLHHHHHHHHHHLLEEEEEEEELLLlllLHHHHHHHHHHHHHLLLLLEEE
Query YLQ---KTAADDFFQGTRAALVGGTTMIIDHVVPEpgsSLLTSFEKWHEAADTKSCCDYS  117
ident  |             || ||  || |                 ||      |        
Sbjct HLRepgGEYKETIETGTKAAARGGFTTVCPXPNTRpvpDSVEHFEALQKLIDDNAQVRVL  119
DSSP  LLLlllLLLLLLHHHHHHHHHHLLEEEEEELLLLLlllLLHHHHHHHHHHHHHHLLLEEL


DSSP  EEEEL---LLLLllHHHHHHHHHHlLLLLEEEEElllllLLLL-LHHHHHHHHHHHHHHL
Query LHVDI---TSWYdgVREELEVLVQdKGVNSFQVYmaykdVYQM-SDSQLYEAFTFLKGLG  173
ident     |                ||   |   |               |  ||         
Sbjct PYASIttrQLGK--ELVDFPALVK-EGAFAFTDD-----GVGVqTASXXYEGXIEAAKVN  171
DSSP  LLEELlhhHLLL--LLLLHHHHHL-LLLLLEEEL-----LLLLlLHHHHHHHHHHHHHHL


DSSP  LEEEEELLLHHHHHHHhhhhhhllllllhHHHH----------HLLHHHHHHHHHHHHHH
Query AVILVHAENGDLIAQEqkrilemgitgpeGHAL----------SRPEELEAEAVFRAITI  223
ident   |  | |   ||                                |   |     |    
Sbjct KAIVAHCEDNSLIYGG-------------AXHEgkrskelgipGIPNICESVQIARDVLL  218
DSSP  LLEEELLLLHHHLLLL-------------LEELlhhhhhhlllEELLHHHHHHHHHHHHH


DSSP  HHHHLLLEEEEEELLHHHHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLllhhhHHHLL
Query AGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSknwakAAAFV  283
ident |    |      |  |     |  |   |  |  |     |               |   
Sbjct AEAAGCHYHVCHVSTKESVRVIRDAKRAGIHVTAEVTPHHLLLTEDDIPG----nNAIYK  274
DSSP  HHHHLLLEEELLLLLHHHHHHHHHHHHLLLLEEEEELHHHHHLLHHHLLL----lLHHHL


DSSP  LLLLLLlLLLHHHHHHHHHHHLLLLLLLLLLLLLLHHHHHHHlllHHHLLLLLLLLLLHH
Query TSPPLSpDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGkdnFTLIPEGVNGIEERM  343
ident   |||         |   |  |        | |     ||         | |  | |   
Sbjct XNPPLR-STEDREALLEGLLDGTIDCIATDHAPHARDEKAQP---XEKAPFGIVGSETAF  330
DSSP  LLLLLL-LHHHHHHHHHHHHLLLLLEELLLLLLLLHHHHLLL---LLLLLLLLLLLLLHH


DSSP  HHHHHHHLLLLLLLHHHHHHHHLHHHHHHHLLLllLLLLLLLLLLLEEEEEEEEEEELLL
Query TVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYprKGRIAVGSDADVVIWDPDKLKTITA  403
ident        |  |     | |          |||    |       ||  | | |    |  
Sbjct PLLYTHFVKNGDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDSEQEIKG  388
DSSP  HHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLLLEELLH


DSSP  LLLLLLLLLLLLLLLEEEEEEEEEEELLEEEEELleellllllllllllllllhhhhhhh
Query KSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDgninvnkgmgrfiprkafpehlyqrv  463
ident     |      | |    | |      |   ||                           
Sbjct EDFLSKADNTPFIGYKVYGNPILTXVEGEVKFEG--------------------------  422
DSSP  HHLLLLLLLLLLLLLEELLEEEEEEELLEEEEEL--------------------------


DSSP  hhhhhhllllllll
Query kirnkvfglqgvsr  477
ident               
Sbjct --------------  422
DSSP  --------------


No 5: Query=4b3zD Sbjct=3giqA Z-score=30.6

back to top
DSSP  --lEEEEEEEEEEL--LLLEEEEEEEEELLEEEEEELLLLLLllLEEEELLLLEEEELEE
Query --dRLLIKGGRIIN--DDQSLYADVYLEDGLIKQIGENLIVPggVKTIEANGRMVIPGGI   56
ident       | || ||         ||    || |  |||    |       | |  | || |
Sbjct eklDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGELGAHP-aRHAWDASGKIVAPGFI   59
DSSP  lleEEEEELLEELLllLLLLEELEEEEELLEEEEEELLLLLL-eEEEEELLLLEEEELEE


DSSP  EEEELLLLllllLHHHhHHHHHHLLEEEEEEE-----ELLLLL-------------llhH
Query DVNTYLQKtaadDFFQgTRAALVGGTTMIIDH-----VVPEPG-------------sslL   98
ident ||                |     | |            | |                  
Sbjct DVHGHDDL-mfvEKPD-LRWKTSQGITTVVVGncgvsAAPAPLpgntaaalallgetplF  117
DSSP  ELLLLLLL-hhhHLLL-LHHHHLLLEEEEEELlllllLLLLLLlllllhhhhhhlllllL


DSSP  HHHHHHHHHHH-LLLLLEEEEEEELL--LLLL--------------LHHHHHHHHHHlLL
Query TSFEKWHEAAD-TKSCCDYSLHVDIT--SWYD--------------GVREELEVLVQdKG  141
ident         | |           |                            |       |
Sbjct ADVPAYFAALDaQRPMINVAALVGHAnlRLAAmrdpqaaptaaeqqAMQDMLQAALE-AG  176
DSSP  LLHHHHHHHHHhLLLLLEEEEEEEHHhhHHHHlllllllllhhhhhHHHHHHHHHHH-HL


DSSP  LLEEEEELLLlLLLL-LLHHHHHHHHHHHHHHLLEEEEELLLhhhhhhhhhhhhhlllll
Query VNSFQVYMAYkDVYQ-MSDSQLYEAFTFLKGLGAVILVHAENgdliaqeqkrilemgitg  200
ident    |    ||           |                |  |                  
Sbjct AVGFSTGLAY-QPGAvAQAAELEGLARVAAERRRLHTSHIRN------------------  217
DSSP  LLEEEEELLL-LLHHhLLHHHHHHHHHHHHHLLLEEEEELLL------------------


DSSP  lhhhhhhllHHHHHHHHHHHHHHHHHHLLLEEEEEELL---------HHHHHHHHHHHHH
Query peghalsrpEELEAEAVFRAITIAGRINCPVYITKVMS---------KSAADIIALARKK  251
ident                ||     |     |                        |  ||  
Sbjct --------eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDRAREQ  269
DSSP  --------lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHHHHHL


DSSP  LLLEEEEELhhhHHLL------------lHHHH------llLHHHH--------------
Query GPLVFGEPIaasLGTD------------gTHYW------skNWAKA--------------  279
ident |  |                                                        
Sbjct GVEVALDIY---PYPGsstiliperaetiDDIRitwstphpECSGEyladiaarwgcdkt  326
DSSP  LLLEEEEEL---LLLEeeeellhhhllllLLLEeeeelllhHHLLLlhhhhhhhhlllhh


DSSP  ---------HHLLllllllLLLLhHHHHHHHHHHLlLLLLLLLLLLLLHhhhhhhlllhh
Query ---------AAFVtspplsPDPTtPDYLTSLLACGdLQVTGSGHCPYSTaqkavgkdnft  330
ident           |              |              ||   |              
Sbjct taarrlapaGAIY------FAMD-EDEVKRIFQHP-CCMVGSDGLPNDA-----------  367
DSSP  hhhhhhlleEEEE------ELLL-HHHHHHHHHLL-LEEELLLLLLLLL-----------


DSSP  hllllLLLLLLHHHHHHHHHLL-LLLLLHHHHHHHHLHHHHHHHLLLlLLLLLLLLLLLL
Query lipegVNGIEERMTVVWDKAVA-TGKMDENQFVAVTSTNAAKIFNLYpRKGRIAVGSDAD  389
ident              | |    |     |   | ||      |  |      |    |  ||
Sbjct ---rpHPRLWGSFTRVLGRYVReARLMTLEQAVARMTALPARVFGFA-ERGVLQPGAWAD  423
DSSP  ---llLLHHHHHHHHHHHHHHHhLLLLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLL


DSSP  EEEEEEEE-eEELL--LLLLLllllllllllleeeEEEEEEEELLEEEEElleELLL-LL
Query VVIWDPDK-lKTIT--AKSHKsaveynifegmechGSPLVVISQGKIVFEdgnINVN-KG  445
ident ||  |||      |                          |   |  ||           
Sbjct VVVFDPDTvaDRATwdEPTLA-------------sVGIAGVLVNGAEVFP---QPPAdGR  467
DSSP  EEEELLLLllLLLLllLLLLL-------------lLLEEEEEELLEEEEL---LLLLlLL


DSSP  LLLLLLLllllhhhhhhhhhhhhhllllllll
Query MGRFIPRkafpehlyqrvkirnkvfglqgvsr  477
ident  |                              
Sbjct PGQVLRA------------------------x  475
DSSP  LLLLLLL------------------------l


No 6: Query=4b3zD Sbjct=3pnuA Z-score=29.0

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeELLL-LEEEELEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktiEANG-RMVIPGGIDVN   59
ident                                                   |      |  
Sbjct -----------------------------------------enlYFQSnAMKLKNPLDMH   19
DSSP  -----------------------------------------lllLLLLlLEEEELLEEEE


DSSP  ELLLLLLllLHHHHHHHHHHlLEEEEEEEELLLLLLLHHHHHHHHHHHHHLLL---LLEE
Query TYLQKTAadDFFQGTRAALVgGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKS---CCDY  116
ident   |                              |    |                     
Sbjct LHLRDNQ--MLELIAPLSAR-DFCAAVIMPNLIPPLCNLEDLKAYKMRILKACkdeNFTP   76
DSSP  ELLLLHH--HHHHHHHHHHL-LLLEEEELLLLLLLLLLHHHHHHHHHHHHHHHlllLLEE


DSSP  EEEEElLLLLllHHHHHHHHHhlLLLLEEEEELLL----lLLLLLLHH--HHHHHHHHHH
Query SLHVDiTSWYdgVREELEVLVqdKGVNSFQVYMAY----kDVYQMSDS--QLYEAFTFLK  170
ident          |      |              | |           |     |        
Sbjct LMTLF-FKNY--DEKFLYSAK--DEIFGIXLYPAGittnsNGGVSSFDieYLKPTLEAMS  131
DSSP  EEEEE-LLLL--LHHHHHHHL--LLLLEEEELLLLlllllLLLLLLLLhhHHHHHHHHHH


DSSP  HHLLEEEEELLLHHhhhhhhhhhhhllllllhhhhhHLLHhHHHHHHHHHHHHHHHHL-L
Query GLGAVILVHAENGDliaqeqkrilemgitgpeghalSRPEeLEAEAVFRAITIAGRIN-C  229
ident  |    ||| |  |                            |          |      
Sbjct DLNIPLLVHGETND----------------------FVMD-RESNFAKIYEKLAKHFPrL  168
DSSP  HLLLLEEELLLLLL----------------------LHHH-LLHHHHHHHHHHHHHLLlL


DSSP  LEEEEEELLHHHHHHHHHHhhhlLLEEEEELHHHHHLLLHHHHLLLHhhHHHLLLLLLLL
Query PVYITKVMSKSAADIIALArkkgPLVFGEPIAASLGTDGTHYWSKNWakAAAFVTSPPLS  289
ident          |                        |                     |   
Sbjct KIVMEHITTKTLCELLKDY----ENLYATITLHHLIITLDDVIGGKM--NPHLFCKPIAK  222
DSSP  LEEELLLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHHLLLL--LHHHLLLLLLL


DSSP  lLLLHHHHHHHHHHH-LLLLLLLLLLLLLLHhhhhhhlllhhHLLLLLLLLLLHHHHHHH
Query pDPTTPDYLTSLLAC-GDLQVTGSGHCPYSTaqkavgkdnftLIPEGVNGIEERMTVVWD  348
ident         |  |          ||   |                  ||        |   
Sbjct -RYEDKEALCELAFSgYEKVMFGSDSAPHPK-----------GCAAGVFSAPVILPVLAE  270
DSSP  -LHHHHHHHHHHHHLlLLLEEELLLLLLLLL-----------LLLLLLLLHHHHHHHHHH


DSSP  hHLLLlLLLHHHHHHHHLHHHHHHHLLLLllllllllLLLLEEEEEeEEEEELLLllLLL
Query kAVATgKMDENQFVAVTSTNAAKIFNLYPrkgriavgSDADVVIWDpDKLKTITAksHKS  408
ident          |       | |  ||  |                     |           
Sbjct -LFKQ-NSSEENLQKFLSDNTCKIYDLKF--------KEDKILTLE-EKEWQVPN--VYE  317
DSSP  -HHHH-HLLHHHHHHHHLHHHHHHHLLLL--------LLLLEEEEE-LLLEELLL--LEE


DSSP  L---LLLLLLLLLEEEEEEEEeeelleeeeelleellllllllllllllllhhhhhhhhh
Query A---VEYNIFEGMECHGSPLVvisqgkivfedgninvnkgmgrfiprkafpehlyqrvki  465
ident            |                                                
Sbjct DkynQVVPYMAGEILKFQLKH---------------------------------------  338
DSSP  LlllEELLLLLLLEELLEELL---------------------------------------


DSSP  hhhhllllllll
Query rnkvfglqgvsr  477
ident             
Sbjct ------------  338
DSSP  ------------


No 7: Query=4b3zD Sbjct=1yrrB Z-score=28.2

back to top
DSSP  leEEEEEEEEELLLLEEE-EEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEE
Query drLLIKGGRIINDDQSLY-ADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVN   59
ident        |||      |    |   |||||        |        ||    || ||| 
Sbjct --YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQ   58
DSSP  --LEEELLEEELLLLEELlEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEE


DSSP  ELL-----LLLL-----lLLHHHHHHHHHHLLEEEEEEEELLLLlLLHHHHHHHHHHHHH
Query TYL-----QKTA-----aDDFFQGTRAALVGGTTMIIDHVVPEPgSSLLTSFEKWHEAAD  109
ident                           |    | |             |            
Sbjct LNGcggvqFNDTaeavsvETLEIMQKANEKSGCTNYLPTLITTS-DELMKQGVRVMREYL  117
DSSP  ELEelleeLLLLlllllhHHHHHHHHHHHLLLEEEEEEEELLLL-HHHHHHHHHHHHHHH


DSSP  LLLLLEEE-EEEELLLLLLLHHHHHHHHHhlLLLLEEEEELllllllLLLHhhhHHHHHH
Query TKSCCDYS-LHVDITSWYDGVREELEVLVqdKGVNSFQVYMaykdvyQMSDsqlYEAFTF  168
ident  |       ||             |                       |      |    
Sbjct AKHPNQALgLHLEGPWLNAALVDFLCENA--DVITKVTLAP------EMVP---AEVISK  166
DSSP  HHLLLLLLlEEEELLLLLLHHHHHHHHLH--HHEEEEEELH------HHLL---HHHHHH


DSSP  HHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhhhHHHH-HHHHHHHhh
Query LKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeeleaEAVF-RAITIAGri  227
ident |   | |                                        |    |       
Sbjct LANAGIVVSAGHS---------------------------------NATLkEAKAGFR--  191
DSSP  HHHHLLEEEELLL---------------------------------LLLHhHHHHHHH--


DSSP  LLLEEEEEELL---------hhHHHHHHHHHhhllLEEEEELHhhHHLLlhhhhlllhhh
Query NCPVYITKVMS---------ksAADIIALARkkgpLVFGEPIAasLGTDgthywsknwak  278
ident       |                |  |              ||   |             
Sbjct AGITFATHLYNampyitgrepgLAGAILDEA----DIYCGIIA--DGLH-----------  234
DSSP  HLEEEELLLLLllllllllllhHHHHHHHLL----LLEEEEEL--LLLL-----------


DSSP  hhhllllllllllllHHHHHHHHHHHLL--LLLLLLLLLlllhhhhhhhlllhhhllLLL
Query aaafvtspplspdptTPDYLTSLLACGD--LQVTGSGHCpystaqkavgkdnftlipEGV  336
ident                                                           | 
Sbjct ---------------VDYANIRNAKRLKgdKLCLVTDAT------------------SGS  261
DSSP  ---------------LLHHHHHHHHHHHhhHEEEELLLL------------------LLL


DSSP  LLllLHHHHHHHhHLLLLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEE
Query NGieERMTVVWDkAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPD  396
ident          |    |                  |       | |  | |  |      ||
Sbjct SL--TMIEGVRN-LVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPD  318
DSSP  LL--LHHHHHHH-HHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL


DSSP  eeeelllllllllllllllllleeeEEEEEEEELLEEEEELleellllllllllllllll
Query klktitakshksaveynifegmechGSPLVVISQGKIVFEDgninvnkgmgrfiprkafp  456
ident                                |  |  |                      
Sbjct -------------------------FKITKTIVNGNEVVTQ-------------------  334
DSSP  -------------------------LLEEEEEELLEEEEEL-------------------


DSSP  hhhhhhhhhhhhhllllllll
Query ehlyqrvkirnkvfglqgvsr  477
ident                      
Sbjct ---------------------  334
DSSP  ---------------------


No 8: Query=4b3zD Sbjct=1onxA Z-score=27.7

back to top
DSSP  -------LEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLL--LLLLLEEEELLLLEE
Query -------DRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI--VPGGVKTIEANGRMV   51
ident           |  |            ||    | |     |               |   
Sbjct midytaaGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPsdIVPNCTVVDLSGQIL   60
DSSP  llllhhhLLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLllLLLLLEEEELLLLEE


DSSP  EELEEEEEELLLL--------LLLLLHhhHHHHHHHLLEEEEEEEE--LLLLlllhhhHH
Query IPGGIDVNTYLQK--------TAADDFfqGTRAALVGGTTMIIDHV--VPEPgsslltSF  101
ident  || ||    |          |               | |                    
Sbjct CPGFIDQHVHLIGgggeagptTRTPEV--ALSRLTEAGVTSVVGLLgtDSIS-----rHP  113
DSSP  EELEEEEEELLLLllllllhhHLLLLL--LHHHHHHLLEEEEEELLllLLLL-----lLH


DSSP  HHHHHHHHLLL--LLEEEEEE-ELLLLlllhhHHHHHHHHLLL-LLEEEEEL-LLLLlLL
Query EKWHEAADTKS--CCDYSLHV-DITSWydgvrEELEVLVQDKG-VNSFQVYM-AYKDvYQ  156
ident |                                  |  |     |               
Sbjct ESLLAKTRALNeeGISAWMLTgAYHVPsrtitGSVEKDVAIIDrVIGVXCAIsDHRS-AA  172
DSSP  HHHHHHHHHHHhhLLEEEEEEeLLLLLlllllLLHHHHHHHLLlEEEEEEEElLLLL-LL


DSSP  LLHHHHHHHHHHHHHHL------LEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllH
Query MSDSQLYEAFTFLKGLG------AVILVHAEngdliaqeqkrilemgitgpeghalsrpE  210
ident      |          |       |   |                               
Sbjct PDVYHLANMAAESRVGGllggkpGVTVFHMG----------------------------D  204
DSSP  LLHHHHHHHHHHHHHHHhhhlllLEEEEEEL----------------------------L


DSSP  HHHHhhHHHHHHHHHHHLL---LEEEEEEL-LHHHHHHHHHHHHHllLEEEEELHHhhHL
Query ELEAeaVFRAITIAGRINC---PVYITKVM-SKSAADIIALARKKgpLVFGEPIAAslGT  266
ident    |                      | |               |               
Sbjct SKKA--LQPIYDLLENCDVpisKLLPTHVNrNVPLFEQALEFARK--GGTIDITSS--ID  258
DSSP  LLLL--LHHHHHHHHLLLLlhhHEEEELHHhLHHHHHHHHHHHHL--LLLEEEELL--LL


DSSP  LLhhhhlllhhhhhhllllllllllllHHHHHHHHHH----HLLLLLLLLLLLLLlhhhh
Query DGthywsknwakaaafvtspplspdptTPDYLTSLLA----CGDLQVTGSGHCPYstaqk  322
ident                             |                    |          
Sbjct EP------------------------vAPAEGIARAVqagiPLARVTLSSDGNGS---qp  291
DSSP  LL------------------------lLHHHHHHHHHhlllLHHHEEEELLLLLE---ee


DSSP  hhhlllHHHLLLLLLlLLLHhHHHHHHHLLLLLLLHHHHHHHHLHHHHHHHLLLlLLLLL
Query avgkdnFTLIPEGVNgIEERmTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYpRKGRI  382
ident                  |          |                  |   ||   || |
Sbjct ffddegNLTHIGVAG-FETL-LETVQVLVKDYDFSISDALRPLTSSVAGFLNLT-GKGEI  348
DSSP  eellllLEEEEEELL-LHHH-HHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLL-LLLLL


DSSP  LLLLLLLEEEEEEEeeeelllllllllllllllllleeeEEEEEEEELLEEEEELLEELL
Query AVGSDADVVIWDPDklktitakshksaveynifegmechGSPLVVISQGKIVFEDGNINV  442
ident   | |||     |                               |   ||    ||   |
Sbjct LPGNDADLLVMTPE-------------------------LRIEQVYARGKLMVKDGKACV  383
DSSP  LLLLLLLEEEELLL-------------------------LLEEEEEELLEEEEELLEELL


DSSP  LLLlllllllllllhhhhhhhhhhhhhllllllll
Query NKGmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                    
Sbjct KGT----------------------------fetd  390
DSSP  LLL----------------------------llll


No 9: Query=4b3zD Sbjct=3nqbA Z-score=26.9

back to top
DSSP  -----------------------lEEEEEEEEEELL--LLEEEEEEEEELLEEEEEEL--
Query -----------------------dRLLIKGGRIIND--DQSLYADVYLEDGLIKQIGE--   33
ident                           || ||            ||      ||    |  
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpa   60
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLllLLEEELEEEEELLEEEEEELll


DSSP  LLLLlllLEEEELLLLEEEELEEEEEELLLLllLLLHHHHHHHHHHLLEEEEEEEEL--L
Query NLIVpggVKTIEANGRMVIPGGIDVNTYLQKtaADDFFQGTRAALVGGTTMIIDHVV--P   91
ident           | | |  | || ||                  |    | | |        
Sbjct SRRD--aAQVIDAGGAYVSPGLIDTHXHIES-sXITPAAYAAAVVARGVTTIVWDPHefG  117
DSSP  LLLL--eEEEEELLLLEEEELEEEEEELHHH-hLLLHHHHHHHHHLLLEEEEEELLHhhH


DSSP  LLLLlhHHHHHHHHHHHHlLLLLEEEEEEELLLL---------lLLHHHHHHHHHHLLLL
Query EPGSslLTSFEKWHEAADtKSCCDYSLHVDITSW---------yDGVREELEVLVQDKGV  142
ident                |          |                 |     |  |      
Sbjct NVHG--VDGVRWAAKAIE-NLPLRAILLAPSCVPsapglerggaDFDAAILADLLSWPEI  174
DSSP  HHHL--HHHHHHHHHHHL-LLLLEEEEEELLLLLllllllllllLLLHHHHHHHHLLLLE


DSSP  LEE-EEELLlllllLLLH---HHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhlll
Query NSF-QVYMAykdvyQMSD---SQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgi  198
ident                                         ||                  
Sbjct GGIaEIXNX-----RGVIerdPRXSGIVQAGLAAEKLVCGHAR-----------------  212
DSSP  EEEeEELLH-----HHHHlllHHHHHHHHHHHHHLLEEEELLL-----------------


DSSP  lllhhhhhhllhhHHHH-HHHHHHHHHhhhllLEEEEEELLHHHHHHHHHHHhhlllEEE
Query tgpeghalsrpeeLEAE-AVFRAITIAgrincPVYITKVMSKSAADIIALARkkgplVFG  257
ident                                         |         |         
Sbjct -------------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-----LTI  249
DSSP  -------------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-----LEE


DSSP  EELHHHHHlllhhhhlllhhhhhhllllllllllllHHHHHHHHH---HHLL-LLLLLLL
Query EPIAASLGtdgthywsknwakaaafvtspplspdptTPDYLTSLL---ACGD-LQVTGSG  313
ident |                                           |               
Sbjct ELRGSHDH----------------------------LLPEFVAALntlGHLPqTVTLCTD  281
DSSP  EEELLLHH----------------------------HHHHHHHHHhhhLLLLlLEEEELL


DSSP  LLLLLhhhhhhhlllhhhllllllllLLHHHHHHhHHLLLlLLLHHHHHHHHLHHHHHHH
Query HCPYStaqkavgkdnftlipegvngiEERMTVVWdKAVATgKMDENQFVAVTSTNAAKIF  373
ident                                ||    |                |||   
Sbjct DVFPD----------------dllqgGGLDDVVR-RLVRY-GLKPEWALRAATLNAAQRL  323
DSSP  LLLHH----------------hhhhlLLHHHHHH-HHHHL-LLLHHHHHHHHLHHHHHHH


DSSP  LLLlLLLLLLLLLLLLEEEEEEeeeeelllllllllllllllllleEEEEEEEEEELLEE
Query NLYpRKGRIAVGSDADVVIWDPdklktitakshksaveynifegmeCHGSPLVVISQGKI  433
ident       | || |  || |                               |   |   |  
Sbjct GRS-DLGLIAAGRRADIVVFED-----------------------lNGFSARHVLASGRA  359
DSSP  LLL-LLLLLLLLLLLLEEEELL-----------------------lLLLLEEEEEELLEE


DSSP  EEELLEELLLLL------------------------------------------------
Query VFEDGNINVNKG------------------------------------------------  445
ident | | |   |                                                   
Sbjct VAEGGRXLVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetea  419
DSSP  EEELLEELLLLLllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  445
ident                                                             
Sbjct dvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfgg  479
DSSP  eeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  445
ident                                                             
Sbjct nagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgk  539
DSSP  lhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhh


DSSP  ----------------lllllllllllhhhhhhhhhhhhhllllllll
Query ----------------mgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                                 
Sbjct vvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 10: Query=4b3zD Sbjct=2vunA Z-score=26.3

back to top
DSSP  LEEEEEEE-EEELL---LLEE-EEEEEEELLEEEEEEL-LLLL-LLLLEEEELLLLEEEE
Query DRLLIKGG-RIIND---DQSL-YADVYLEDGLIKQIGE-NLIV-PGGVKTIEANGRMVIP   53
ident     ||    |         |       |||||  ||   |    |    | | |  | |
Sbjct SKTIIKNIgKIVSGdikSPVLqADTIVVEDGLIAAIGGeELMKdAGDATIIDAAGSTVTP   60
DSSP  LEEEEELLlEEELLlllLLEElLLEEEEELLEEEEEELhHHHLlLLLLEEEELLLLEEEE


DSSP  LEEEEEELLL-----LLLLLLhhHHHHHHHHLLEEEEEEEEL-----LLLL-LLHHHHHH
Query GGIDVNTYLQ-----KTAADDffQGTRAALVGGTTMIIDHVV-----PEPG-SSLLTSFE  102
ident |  |                        || || |  |                      
Sbjct GLLDTHVHVSggdyaPRQKTM--DFISSALHGGVTTMISAGSphfpgRPKDaAGTKALAI  118
DSSP  LEEEEEELLLllleeHHHLEE--LHHHHHHLLLEEEEEELLLlllllLLLLhHHHHHHHH


DSSP  HHHHHH-HLLLL-LEEEE-EEELlLLLLlHHHHHHHHHHlLLLLE-EEEEllllllLLLL
Query KWHEAA-DTKSC-CDYSL-HVDItSWYDgVREELEVLVQdKGVNS-FQVYmaykdvYQMS  158
ident                     |          |         ||     |           
Sbjct TLSKSYyNARPAgVKVHGgAVIL-EKGL-TEEDFIEMKK-EGVWIvGEVG----lgTIKN  171
DSSP  HHHHHHhHLLHHhLEEELlEELL-LLLL-LHHHHHHHHH-LLLLEeEEEL----llLLLL


DSSP  HHHHHHHHHHHHHHLLEEEEEL-LLHHHHHhhhhhhhhllllllhhhhhhllhhhhhHHH
Query DSQLYEAFTFLKGLGAVILVHA-ENGDLIAqeqkrilemgitgpeghalsrpeeleaEAV  217
ident               |     |                                       
Sbjct PEDAAPMVEWAHKHGFKVQMHTgGTSIPGS--------------------------sTVT  205
DSSP  HHHHHHHHHHHHHLLLEEEEELlLLLLLLL--------------------------lLLL


DSSP  HHHHHHHhhhlLLEEEEEE-----LLHH-HHHHHHHHHhhllLEEEEELHHHHHlllhhh
Query FRAITIAgrinCPVYITKV-----MSKS-AADIIALARkkgpLVFGEPIAASLGtdgthy  271
ident             |                  | |            |             
Sbjct ADDVIKT----KPDVVSHInggptAISVqEVDRIMDET----DFAMEIVQCGNP------  251
DSSP  HHHHHHH----LLLEEELLlllllLLLHhHHHHHHHHL----LLEEEEELLLLH------


DSSP  hlllhhhhhhlllllllllllLHHHHHHHHHH---HLLLLLLLLLLLLllhhhhhhhlll
Query wsknwakaaafvtspplspdpTTPDYLTSLLA---CGDLQVTGSGHCPystaqkavgkdn  328
ident                         ||     |          |                 
Sbjct ---------------------KIADYVARRAAekgQLGRVIFGNDAPS------------  278
DSSP  ---------------------HHHHHHHHHHHhhlLHHHEEEELLLLL------------


DSSP  hhhllLLLLLlLLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHHLLllLLLLLLLLLLL
Query ftlipEGVNGiEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLypRKGRIAVGSDA  388
ident                             |    |     |      |    | || |  |
Sbjct -----GTGLI-PLGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEA  330
DSSP  -----LLLLL-LLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLL


DSSP  LEEEEEeEEEEellllllllllllllllllEEEEEEEEEEELLEEEEELLEellllllll
Query DVVIWDpDKLKtitakshksaveynifegmECHGSPLVVISQGKIVFEDGNinvnkgmgr  448
ident |  | |   |                           ||   |  |              
Sbjct DLIIMD-TPLG-------svaedamgaiaaGDIPGISVVLIDGEAVVTKSR---------  373
DSSP  LEEEEE-LLLL-------lllllhhhhhhhLLLLEEEEEEELLEEEELLLL---------


DSSP  llllllllhhhhhhhhhhhhhllllllll
Query fiprkafpehlyqrvkirnkvfglqgvsr  477
ident                              
Sbjct -----------------ntppakraakil  385
DSSP  -----------------llllllllleel


No 11: Query=4b3zD Sbjct=4cqbA Z-score=25.3

back to top
DSSP  ---lEEEEEEEEEELllLEEEEEEEEELLEEEEEELLLLLLlLLEEEELLLLEEEELEEE
Query ---dRLLIKGGRIINddQSLYADVYLEDGLIKQIGENLIVPgGVKTIEANGRMVIPGGID   57
ident      | |              |       |  |            | | |  | ||  |
Sbjct skdfDLIIRNAYLSE--KDSVYDIGIVGDRIIKIEAKIEGT-VKDEIDAKGNLVSPGFVD   57
DSSP  llleEEEEEEEEELL--LLEEEEEEEELLEEEEEELLLLLL-EEEEEELLLLLEEELEEE


DSSP  EEELLLL-LLLL-----------------------------------LHHHHHHHHHHLL
Query VNTYLQK-TAAD-----------------------------------DFFQGTRAALVGG   81
ident   |   |                                                    |
Sbjct AHTHMDKsFTSTgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHG  117
DSSP  EEELHHHlLLLLlllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLL


DSSP  EEEEEEEELLLlLLLHHHHHHHHHHHHHLLL-LLEEEEEEELLLL---LLLHHHHHHHHH
Query TTMIIDHVVPEpGSSLLTSFEKWHEAADTKS-CCDYSLHVDITSW---YDGVREELEVLV  137
ident |     ||            |   ||        |        |                
Sbjct TLYTRTHVDVD-SVAKTKAVEAVLEAKEELKdLIDIQVVAFAQSGffvDLESESLIRKSL  176
DSSP  EEEEEEEEELL-LLLLLHHHHHHHHHHHHLLlLLEEEEEEELLLLlllLLLHHHHHHHHH


DSSP  HlLLLLEEEEEL--LLLLlllLLHHHHHHHHHHHHHHLLEEEEELLLhhhhhhhhhhhhh
Query QdKGVNSFQVYM--AYKDvyqMSDSQLYEAFTFLKGLGAVILVHAENgdliaqeqkrile  195
ident    |                      |   |   |     |  |                
Sbjct D-MGCDLVGGVDpaTREN---NVEGSLDLCFKLAKEYDVDIDYHIHD-------------  219
DSSP  H-HLLLEEELLLllLLLL---LHHHHHHHHHHHHHHLLLEEEEEELL-------------


DSSP  llllllhhhhhhllHHHHHHHHHHHHHHHHHHLL--LEEEEEEL-LHHH----hhhHHHH
Query mgitgpeghalsrpEELEAEAVFRAITIAGRINC--PVYITKVM-SKSA----adiIALA  248
ident                        |             |          |           
Sbjct -------------iGTVGVYSINRLAQKTIENGYkgRVTTSHAWcFADApsewldeAIPL  266
DSSP  -------------lHHHHHHHHHHHHHHHHHLLLllLEEEEELLhHHHLlhhhhhhHHHH


DSSP  HHhLLLEEEEELHHHHhlllhhhhlllhhhhhhllllllllllllhHHHHhhHHHHL---
Query RKkGPLVFGEPIAASLgtdgthywsknwakaaafvtspplspdpttPDYLtsLLACG---  305
ident  |            |                               |             
Sbjct YK-DSGMKFVTCFSST------------------------------PPTM--PVIKLlea  293
DSSP  HH-HHLLEEEEELLLL------------------------------LLLL--LHHHHhhl


DSSP  -LLLLLLLLLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH----lLLLLLLhH
Query -DLQVTGSGHCPYstaqkavgkdnftliPEGV-NGIEeRMTVVWDKA----vATGKMDeN  359
ident        |                                             |      
Sbjct gINLGCASDNIRD---------------FWVPfGNGD-MVQGALIETqrlelKTNRDL-G  336
DSSP  lLEEEEELLLLLL---------------LLLLlLLLL-HHHHHHHHHhhhllLLHHHH-H


DSSP  HHHHHHLHHHHHHHLLLLLLlLLLLLLLLLEEEEEEeeeeelllllllllllllllllle
Query QFVAVTSTNAAKIFNLYPRKgRIAVGSDADVVIWDPdklktitakshksaveynifegme  419
ident           |           | ||  || |                            
Sbjct LIWKMITSEGARVLGIEKNY-GIEVGKKADLVVLNS-----------------lspqwai  378
DSSP  HHHHHHLHHHHHHHLLHHHL-LLLLLLLLLEEEELL-----------------llhhhhh


DSSP  EEEE-EEEEEELLEEEEELLEELLllllllllllllllhhhhhhhhhhhhhllllllll
Query CHGS-PLVVISQGKIVFEDGNINVnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident       | ||  | |   |  |                                     
Sbjct IDQAkRLCVIKNGRIIVKDEVIVA-----------------------------------  402
DSSP  HHLLlEEEEEELLEEEEELLEELL-----------------------------------


No 12: Query=4b3zD Sbjct=3mtwA Z-score=23.5

back to top
DSSP  -LEEEEEEEEEELL--LLEEE-EEEEEELLEEEEEEL-LLLLLLLLEEEELLLLEEEELE
Query -DRLLIKGGRIIND--DQSLY-ADVYLEDGLIKQIGE-NLIVPGGVKTIEANGRMVIPGG   55
ident          |              |   || |  ||     || |       |    || 
Sbjct aEIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLPGL   60
DSSP  lLEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEELE


DSSP  EEEEELLLL---------------LLLLLHHHHHHHHHHLLEEEEEEEELllllllhhhH
Query IDVNTYLQK---------------TAADDFFQGTRAALVGGTTMIIDHVVpepgsslltS  100
ident ||    |                              |  | |                 
Sbjct IDMHVHLDSlaevggynsleysdrFWSVVQTANAKKTLEAGFTTVRNVGA---------A  111
DSSP  EEEEELLLLlllllhhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELLL---------L


DSSP  HHHHHHHHHLL-----LLLEEEEE-EELL---------------------LLLL--LHHH
Query FEKWHEAADTK-----SCCDYSLH-VDIT---------------------SWYD--GVRE  131
ident                                                           | 
Sbjct DYDDVGLREAIdagyvPGPRIVTAaISFGatgghcdstffppsmdqknpfNSDSpdEARK  171
DSSP  LLHHHHHHHHHhllllLLLEEEELlLLEEllllllllllllhhhllllllLLLLhhHHHH


DSSP  HHHHHHHlLLLLEEEEELLL--------llllLLLHHHHHHHHHHHHHHLLEEEEELLlh
Query ELEVLVQdKGVNSFQVYMAY--------kdvyQMSDSQLYEAFTFLKGLGAVILVHAEng  183
ident     |    |                      |                |     ||   
Sbjct AVRTLKK-YGAQVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHMAGIKVAAHAH--  228
DSSP  HHHHHHH-LLLLEEEEELLLllllllllllllLLLHHHHHHHHHHHHHLLLEEEEEEL--


DSSP  hhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHhhhllLEEEEEELLhhHHH
Query dliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAgrincPVYITKVMSksAAD  243
ident                               |     |            |         |
Sbjct -----------------------------GASGIREAVRAG-----VDTIEHASL--VDD  252
DSSP  -----------------------------LHHHHHHHHHLL-----LLEEEELLL--LLH


DSSP  HHHHHHhhLLLEEEEELhhHHHLL-LHHHhlllHHHHHhlllllLLLLLLLH-HHHHHHH
Query IIALARkkGPLVFGEPIaaSLGTD-GTHYwsknWAKAAafvtspPLSPDPTT-PDYLTSL  301
ident                       ||                                    
Sbjct EGIKLA-vQKGAYFSMD--IYNTDyTQAE---gKKNGVlednlrKDRDIGELqRENFRKA  306
DSSP  HHHHHH-hHHLLEEELL--LLLHHhHHHH---hHHHLLlhhhhhHHHHHHHHhHHHHHHH


DSSP  HHHLLLLLLLLLLLlllhhhhhhhlllhhhlllLLLLlLLHHhHHHHHHLlLLLLLHHHH
Query LACGDLQVTGSGHCpystaqkavgkdnftlipeGVNGiEERMtVVWDKAVaTGKMDENQF  361
ident |  |   | |                                       |        | 
Sbjct LKAGVKMVYGTDAG-------------------IYPH-GDNA-KQFAVMV-RYGATPLQA  344
DSSP  HHHLLEEELLLLLL-------------------LLLL-LLHH-HHHHHHH-HLLLLHHHH


DSSP  HHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEeeeelllllllllllllllllleEE
Query VAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDklktitakshksaveynifegmeCH  421
ident        ||         |  |||   |      |                         
Sbjct IQSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGD-------------------pladVT  385
DSSP  HHHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLL-------------------llllHH


DSSP  EE--EEEEEELLEEEEELleellllllllllllllllhhhhhhhhhhhhhllllllll
Query GS--PLVVISQGKIVFEDgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident     |  |   |  |                                           
Sbjct TLekPVFVMKGGAVVKAP---------------------------------------x  404
DSSP  HHhlLLEEEELLEEEELL---------------------------------------l


No 13: Query=4b3zD Sbjct=2pajA Z-score=23.4

back to top
DSSP  LEEEEEEE-EEELL--------LLEEEEEEEEELLEEEEEELlLLLLLLLEEEELLLLEE
Query DRLLIKGG-RIIND--------DQSLYADVYLEDGLIKQIGEnLIVPGGVKTIEANGRMV   51
ident    ||     |                 |       |  ||  |    |     |     
Sbjct PSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIGA-LAPRPGETIVDATDCVI   59
DSSP  LEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEELL-LLLLLLLEEEELLLLEE


DSSP  EELEEEEEELLLL---------------LLLLLHHHHHHHHHHLLEEEEEEEELLLLLLl
Query IPGGIDVNTYLQK---------------TAADDFFQGTRAALVGGTTMIIDHVVPEPGSs   96
ident  |        |                         |       |     ||        
Sbjct YPAWVNTHHHLFQsllkgepfralfderRFRLAARIGLIELARSGCATVADHNYVYYPG-  118
DSSP  EELEELLLLLHHHhhllllllhhhllhhHHHHHHHHHHHHHHLLLEEEEEELLLLLLLL-


DSSP  hhhhhHHHHHHHHLLL---LLEEEEEEELLL---------------LLLLH-HHHHHHHH
Query lltsfEKWHEAADTKS---CCDYSLHVDITS---------------WYDGV-REELEVLV  137
ident                         |                               | | 
Sbjct ---mpFDSSAILFEEAeklGLRFVLLRGGATqtrqleadlptalrpETLDAyVADIERLA  175
DSSP  ---llLLHHHHHHHHHhhlLLEEEEEELLLLllllllllllhhhllLLHHHhHHHHHHHH


DSSP  HLLL--------LLEEEE--ELLLlllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhh
Query QDKG--------VNSFQV--YMAYkdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdlia  187
ident                               |     |       ||     |        
Sbjct ARYHdaspramrRVVMAPttVLYS-----ISPREMRETAAVARRLGLRMHSHLS------  224
DSSP  HHLLllllllleEEEELLllLLLL-----LLHHHHHHHHHHHHHLLLEEEEELL------


DSSP  hhhhhhhhllllllhhhhhhllhhhhhHHHHHHHHHHhhhllLEEEEEELLHHhhHHHHH
Query qeqkrilemgitgpeghalsrpeeleaEAVFRAITIAgrincPVYITKVMSKSaaDIIAL  247
ident                              |             |                
Sbjct -------------------------gkSPVAFCGEHD-wlgsDVWYAHLVKVD--ADEIA  256
DSSP  -------------------------llLHHHHHHHLL-llllLEEEELLLLLL--HHHHH


DSSP  HHhhLLLEEEEELHHHhHLLLhhhhlllhhhhhhllllllllllllhhhhHHHHHHH-LL
Query ARkkGPLVFGEPIAASlGTDGthywsknwakaaafvtspplspdpttpdyLTSLLAC-GD  306
ident                |                                       |  | 
Sbjct LL-aQTGTGVAHCPQS-NGRL-----------------------------PVREMADaGV  285
DSSP  HH-hHHLLEEEELHHH-HHLL-----------------------------LLLLHHHhLL


DSSP  LLLLLLLLLLllhhhhhhhlllhhhlllLLLLLLlHHHHHHHHHlLLLL---LLHHHHHH
Query LQVTGSGHCPystaqkavgkdnftlipeGVNGIEeRMTVVWDKAvATGK---MDENQFVA  363
ident     |                                  |                    
Sbjct PVSIGVDGAA------------------SNEAAD-MISEVHMTW-LAQRarlASIAEVIH  325
DSSP  LEEELLLHHH------------------HLLLLL-HHHHHHHHH-HHHHhllLLHHHHHH


DSSP  HHLHHHHHHHLLLlLLLLLLLLLLLLEEEEEEEEeeellllllllllllllllllEEEEE
Query VTSTNAAKIFNLYpRKGRIAVGSDADVVIWDPDKlktitakshksaveynifegmECHGS  423
ident       |    |    |  |||  ||      |                           
Sbjct WGTAGGARVMGLD-EVGKVAVGYAADIAVYRLDD------pryfglhdpaigpvaSGGRP  378
DSSP  HHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELLL------hhhlllllhhhhhhhLLLLL


DSSP  -EEEEEELLEEEEELLEELLLlllllllllllllhhhhhhhhhhhhhllllllll
Query -PLVVISQGKIVFEDGNINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident       | || |  |  |                                     
Sbjct sVMALFSAGKRVVVDDLIEGV------------dikelggearrvvrellrevvv  421
DSSP  eEEEEEELLEEEEELLLLLLL------------lhhhhhhhhhhhhhhhhhhhhl


No 14: Query=4b3zD Sbjct=2ogjA Z-score=23.2

back to top
DSSP  -LEEEEEEEEEELLLL---EEEEEEEEE-LLEEEEEELLLLLLlLLEEEELLlLEEEELE
Query -DRLLIKGGRIINDDQ---SLYADVYLE-DGLIKQIGENLIVPgGVKTIEANgRMVIPGG   55
ident     |                  |     || |   |  |  |              || 
Sbjct qAPILLTNVKPVGFGKgasQSSTDILIGgDGKIAAVGSALQAP-ADTQRIDA-AFISPGW   58
DSSP  lLLEEEEEEEELLLLLlllLLLEEEEELlLLLEEEEELLLLLL-LLEEELLL-LEEEELE


DSSP  EEEEELLLLL--LLLLHhhHHHHHHHLLEEEEEE-EELLlllllhHHHHHHHHHHHHLLL
Query IDVNTYLQKT--AADDFfqGTRAALVGGTTMIID-HVVPepgsslLTSFEKWHEAADTKS  112
ident  |                         | |   |              |    |     |
Sbjct VDLHVHIWHGgtDISIR--PSECGAERGVTTLVDaGSAG------EANFHGFREYIIEPS  110
DSSP  EEEEELLLLLllLLLLL--HHHLLHHHLEEEEEEeLLLL------LLLHHHHHHHLLLLL


DSSP  LLEEEEEEELL------------LLLLL--HHHHHHHHHHLLL--LLEEEEELLllLLLL
Query CCDYSLHVDIT------------SWYDG--VREELEVLVQDKG--VNSFQVYMAykDVYQ  156
ident                                                   |      |  
Sbjct RERIKAFLNLGsiglvacnrvpeLRDIKdiDLDRILECYAENSehIVGLXVRAS--HVIT  168
DSSP  LLEEEEEEELLllllllllllllLLLHHhlLHHHHHHHHHLLLllEEEEEEEEL--HHHH


DSSP  --lLHHHHHHHHHHHHHHLLEEEEELLLHHhhhhhhhhhhhllllllhhhhhhllhhhhh
Query --mSDSQLYEAFTFLKGLGAVILVHAENGDliaqeqkrilemgitgpeghalsrpeelea  214
ident                | |     ||                                   
Sbjct gswGVTPVKLGKKIAKILKVPXXVHVGEPP------------------------------  198
DSSP  lllLLHHHHHHHHHHHHHLLLEEEEELLLL------------------------------


DSSP  hHHHHHHHHHHhhlLLEEEEEELLH---HHHH-------HHHHHHhhllLEEEEELHHhh
Query eAVFRAITIAGrinCPVYITKVMSK---SAAD-------IIALARkkgpLVFGEPIAAsl  264
ident         | |        |        |                               
Sbjct aLYDEVLEILG---PGDVVTHCFNGksgSSIXededlfnLAERCE----GIRLDIGHG--  249
DSSP  lLHHHHHHHLL---LLLEEELLLLLlllLLLLllhhhhhHHHHLL----LLEEELLLL--


DSSP  hlllhhhhlllhhhhhhllLLLLllllllHHHHHHHHH-hHLLLLLLLLLLLLllhhhhh
Query gtdgthywsknwakaaafvTSPPlspdptTPDYLTSLL-aCGDLQVTGSGHCPystaqka  323
ident                                                             
Sbjct -------------------GASF------SFKVAEAAIarGLLPFSISTDLHG-------  277
DSSP  -------------------LLLL------LHHHHHHHHhlLLLLLLLLLLLLL-------


DSSP  hhlllhhhlllLLLL--lLLHHhHHHHHHLlLLLLLHHHHHHHHLHHHHHHHLLLLLllL
Query vgkdnftlipeGVNG--iEERMtVVWDKAVaTGKMDENQFVAVTSTNAAKIFNLYPRkgR  381
ident                            |            |     | |    |     |
Sbjct -----------HSXNfpvWDLA-TTXSKLL-SVDXPFENVVEAVTRNPASVIRLDXE-nR  323
DSSP  -----------LLLLlllLLHH-HHHHHHH-HLLLLHHHHHHLLLHHHHHHLLLLLL-lL


DSSP  LLLLLLLLEEEEEEEeEEELLllllllllllllllLLEEEEEEEEEEELLEEEEElleel
Query IAVGSDADVVIWDPDkLKTITakshksaveynifeGMECHGSPLVVISQGKIVFEdgnin  441
ident   ||  ||    |                             |                 
Sbjct LDVGQRADFTVFDLV-DADLE-----atdsngdvsRLKRLFEPRYAVIGAEAIAA-----  372
DSSP  LLLLLLLEEEEEEEE-EEEEE-----eellllleeEEEEEEEEEEEEELLEEEEL-----


DSSP  lllllllllllllllhhhhhhhhhhhhhllllllll
Query vnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                     
Sbjct -----------------------------sryipra  379
DSSP  -----------------------------lllllll


No 15: Query=4b3zD Sbjct=2oofA Z-score=22.6

back to top
DSSP  --lEEEEEEEEEELL------LLEE-EEEEEEELLEEEEEE-LLLLllLLLEEEELLLLE
Query --dRLLIKGGRIIND------DQSL-YADVYLEDGLIKQIG-ENLIvpGGVKTIEANGRM   50
ident                         |         | |                    |  
Sbjct lncERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVpXQDL-kYPAHWQDXKGKL   59
DSSP  lllLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEeHHHL-lLLLLLEELLLLE


DSSP  EEELEEEEEELLLLLLL----------------------------------------lLH
Query VIPGGIDVNTYLQKTAA----------------------------------------dDF   70
ident | || ||  | |                                                
Sbjct VTPGLIDCHTHLIFAGSraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLA  119
DSSP  EEELEEEEEELLLLLLLlhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHH


DSSP  HHHHHHHHHLLEEEEEEEELLLLLLL-HHHHHHHHHHhHHLLLLLEEEEEEELL------
Query FQGTRAALVGGTTMIIDHVVPEPGSS-LLTSFEKWHEaADTKSCCDYSLHVDIT------  123
ident           | |               |                               
Sbjct LPRVKSLIREGVTTVEIKSGYGLTLEdELKXLRVARR-LGEALPIRVKTTLLAAhavppe  178
DSSP  HHHHHHHHHHLEEEEEEELLLLLLHHhHHHHHHHHHH-HHHHLLLEEEEEEEEEllllhh


DSSP  ------lLLLLH-HHHHHHHHHLLLLLEEEEELLLLlllLLLHHHHHHHHHHHHHHLLEE
Query ------sWYDGV-REELEVLVQDKGVNSFQVYMAYKdvyQMSDSQLYEAFTFLKGLGAVI  176
ident        |      |               |          |  |           |   
Sbjct yrddpdsWVETIcQEIIPAAAEAGLADAVDVFCEHI---GFSLAQTEQVYLAADQYGLAV  235
DSSP  hlllhhhHHHHHhHLHHHHHHHLLLLLEEEEEELLL---LLLHHHHHHHHHHHHHLLLEE


DSSP  EEELLlhhhhhhhhhhhhhllllllhhhhhhllhhHHHHHHHHHHhhhhhhLLLE-EEEE
Query LVHAEngdliaqeqkrilemgitgpeghalsrpeeLEAEAVFRAItiagriNCPV-YITK  235
ident   |                                        |       |        
Sbjct KGHXD----------------------------qlSNLGGSTLAA------NFGAlSVDH  261
DSSP  EEEEL----------------------------llLLLLHHHHHH------HLLLlEEEE


DSSP  ELLhhHHHHHHHHHhhLLLEEEEELHHHHHLLLhhhhlllhhhhhhlllllllllLLLHh
Query VMSksAADIIALARkkGPLVFGEPIAASLGTDGthywsknwakaaafvtspplspDPTTp  295
ident             |      |                                        
Sbjct LEY--LDPEGIQAL-aHRGVVATLLPTAFYFLK----------------------ETKL-  295
DSSP  LLL--LLHHHHHHH-hHHLLEEEELHHHHHHLL----------------------LLLL-


DSSP  hHHHHHHHH-LLLLLLLLLLLLllhhhhhhhlllhhhlLLLLLLllLHHHHHHhHHLLll
Query dYLTSLLAC-GDLQVTGSGHCPystaqkavgkdnftliPEGVNGieERMTVVWdKAVAtg  354
ident       |   |      |   |                                 |    
Sbjct -PPVVALRKaGVPXAVSSDINP----------------GTAPIV--SLRXAXN-XACTlf  335
DSSP  -LLHHHHHHlLLLEEELLLLLL----------------LLLLLL--LHHHHHH-HHHHhh


DSSP  LLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEE-----eEEELllllllll
Query KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPD-----kLKTItakshksa  409
ident         |     ||         |   ||  ||   |                     
Sbjct GLTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCGhpaelsYLIG--------  387
DSSP  LLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLlllhhhHLLL--------


DSSP  llllllllleeeeEEEEEEELLEEEEElleellllllllllllllllhhhhhhhhhhhhh
Query veynifegmechgSPLVVISQGKIVFEdgninvnkgmgrfiprkafpehlyqrvkirnkv  469
ident                      |                                      
Sbjct -----------vdQLVSRVVNGEETLH---------------------------------  403
DSSP  -----------llLEEEEEELLEELLL---------------------------------


DSSP  llllllll
Query fglqgvsr  477
ident         
Sbjct --------  403
DSSP  --------


No 16: Query=4b3zD Sbjct=3mkvA Z-score=22.5

back to top
DSSP  -LEEEEEEEEEELLL--LEEE-EEEEEELLEEEEEEL-LLLLLlLLEEEELLLLEEEELE
Query -DRLLIKGGRIINDD--QSLY-ADVYLEDGLIKQIGE-NLIVPgGVKTIEANGRMVIPGG   55
ident     |   |     |    |       ||| |                |   |    || 
Sbjct lTTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSDkPIKSS-NAHVIDVKGKTIMPGL   59
DSSP  lLEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEELlLLLLL-LLEEEELLLLEEEELE


DSSP  EEEEELLLL--------------LLLLLHHHHHHHHHHLLEEEEEEEELllllllhhhhh
Query IDVNTYLQK--------------TAADDFFQGTRAALVGGTTMIIDHVVpepgsslltsf  101
ident ||                               || |  | |   |              
Sbjct IDLHVHVVAiefnlprvatlpnvLVTLRAVPIMRAMLRRGFTTVRDAGG-----------  108
DSSP  EEEEELLLLllllhhhhllllhhHHHHHHHHHHHHHHHLLEEEEEELLL-----------


DSSP  hhHHHHHHL-----LLLLEEEEE-EELL--------------------------------
Query ekWHEAADT-----KSCCDYSLH-VDIT--------------------------------  123
ident                                                             
Sbjct -aGYPFKQAvesglVEGPRLFVSgRALSqtgghadprarsdymppdspcgccvrvgalgr  167
DSSP  -lLHHHHHHhhlllLLLLEEEELlLEEEllllllllllllllllllllllllllllllee


DSSP  LLLL--LHHHHHHHHHHlLLLLEEEEELLL--------llllLLLHHHHHHHHHHHHHHL
Query SWYD--GVREELEVLVQdKGVNSFQVYMAY--------kdvyQMSDSQLYEAFTFLKGLG  173
ident        ||       |  |                        |            | |
Sbjct VADGvdEVRRAVREELQ-MGADQIXIMASGgvasptdpvgvfGYSEDEIRAIVAEAQGRG  226
DSSP  ELLLhhHHHHHHHHHHH-HLLLLEEEELLLllllllllllllLLLHHHHHHHHHHHHLLL


DSSP  LEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHhhhllLEEE
Query AVILVHAEngdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAgrincPVYI  233
ident    | ||                                   |  ||            |
Sbjct TYVLAHAY-------------------------------TPAAIARAVRCG-----VRTI  250
DSSP  LLEEEEEL-------------------------------LHHHHHHHHHLL-----LLEE


DSSP  EEELLhhHHHHHHHHHhhLLLEEEEELHHHhhLLLHHhhlllhHHHHH----lllllLLL
Query TKVMSksAADIIALARkkGPLVFGEPIAASlgTDGTHywsknwAKAAA----fvtspPLS  289
ident          |  |            |                  |               
Sbjct EHGNL--IDDETARLV-aEHGAYVVPTLVT-yDALAS----egEKYGLppesiakiaDVH  302
DSSP  EELLL--LLHHHHHHH-hHHLLEEELLHHH-hHHHHH----hlLLLLLlhhhhllhhHHH


DSSP  LlllHHHHHHHHHHH-LLLLLLLLLLLLLlhhhhhhhlllhhhllllLLLLllhhHHHHH
Query PdptTPDYLTSLLAC-GDLQVTGSGHCPYstaqkavgkdnftlipegVNGIeermTVVWD  348
ident                 |     |                                     
Sbjct G---AGLHSIEIMKRaGVKMGFGTDLLGE-----------------aQRLQ----SDEFR  338
DSSP  L---LHHHHHHHHHHhLLLLLLLLLLLHH-----------------hHHHL----LHHHH


DSSP  HHLllLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEeeeellllllll
Query KAVatGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDklktitakshks  408
ident               |      |         |||  |  |||   |              
Sbjct ILA--EVLSPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGN------------  384
DSSP  HHH--LLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL------------


DSSP  lllllllllleEEEE------EEEEEELLEEEEELleellllllllllllllllhhhhhh
Query aveynifegmeCHGS------PLVVISQGKIVFEDgninvnkgmgrfiprkafpehlyqr  462
ident                         |   |                               
Sbjct -------plksVDCLlgqgehIPLVMKDGRLFVNE-------------------------  412
DSSP  -------llllLLLLllllllLLEEEELLEEEEEL-------------------------


DSSP  hhhhhhhllllllll
Query vkirnkvfglqgvsr  477
ident                
Sbjct -------------le  414
DSSP  -------------ll


No 17: Query=4b3zD Sbjct=1a5kC Z-score=22.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----lEEEEEEEEEELLLLEEEEEEEEELLEEEEEEL----------LLLLLLLLEEEEL
Query ----dRLLIKGGRIINDDQSLYADVYLEDGLIKQIGE----------NLIVPGGVKTIEA   46
ident       |      |        ||    || |  ||                     | |
Sbjct aadcvDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKagnpdiqpnvTIPIGAATEVIAA  120
DSSP  hhhllLEEEEEEEEEELLEEEEEEEEEELLEEEEEELeellllllllLEELLLLLEEEEL


DSSP  LLLEEEELEEEEEELLLllllllHHHHHHHHHHLLEEEEEE------------EELLlll
Query NGRMVIPGGIDVNTYLQktaaddFFQGTRAALVGGTTMIID------------HVVPepg   94
ident  |  |  ||||              |    ||| | |                   |   
Sbjct EGKIVTAGGIDTHIHWI------CPQQAEEALVSGVTTMVGggtgpaagthatTCTP---  171
DSSP  LLLEEEELEEEEEEELL------LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL---


DSSP  llHHHHHHHHHHHHHlLLLLEEEEEEELLLLlllHHHHHHHHHHlLLLLEEEEELLllll
Query ssLLTSFEKWHEAADtKSCCDYSLHVDITSWydgVREELEVLVQdKGVNSFQVYMAykdv  154
ident             |||        |              |   |   ||            
Sbjct --GPWYISRMLQAAD-SLPVNIGLLGKGNVS---QPDALREQVA-AGVIGLEIHED----  220
DSSP  --HHHHHHHHHHHHL-LLLLEEEEEEELLLL---LHHHHHHHHH-HLLLEEEEEHH----


DSSP  LLLLHHHHHHHHHHHHHHLLEEEEELLLHHHhhhhhhhhhhllllllhhhhhhllhhhhh
Query YQMSDSQLYEAFTFLKGLGAVILVHAENGDLiaqeqkrilemgitgpeghalsrpeelea  214
ident           | |           |                                   
Sbjct WGATPAAIDCALTVADEMDIQVALHSDTLNE----------------------------s  252
DSSP  HLLLHHHHHHHHHHHHHHLLEEEEELLLLLL----------------------------l


DSSP  hHHHHHHHHHHhhLLLEEEEEELL------HHHHhHHHHHHhhllLEEEEELHHHHHL--
Query eAVFRAITIAGriNCPVYITKVMS------KSAAdIIALARkkgpLVFGEPIAASLGT--  266
ident   |       |                                            |    
Sbjct gFVEDTLAAIG--GRTIHTFHTEGaggghaPDII-TACAHP----NILPSSTNPTLPYtl  305
DSSP  lLHHHHHHHHL--LLLEEELLLLLllllllLLHH-HHHHLL----LEEEEEEHHHLLLll


DSSP  -LLHHHhlllhhhhHHLL--------------lllllLLLLLHHHHHHHHHHHLLLLLLL
Query -DGTHYwsknwakaAAFV--------------tspplSPDPTTPDYLTSLLACGDLQVTG  311
ident                                           |      |   |    | 
Sbjct nTIDEH--------LDMLmvchhldpdiaedvafaesRIRRETIAAEDVLHDLGAFSLTS  357
DSSP  lHHHHH--------HHHHhhhhllllllhhhhhllllLLLHHHHHHHHHHHHLLLLLEEE


DSSP  LLLLlllhhhhhhhlllhhhlllLLLLLLLHHHHHHHHHlLLLL---------------l
Query SGHCpystaqkavgkdnftlipeGVNGIEERMTVVWDKAvATGK---------------m  356
ident |                            |     |  |    |                
Sbjct SDSQ-------------------AMGRVGEVILRTWQVA-HRMKvqrgalaeetgdndnf  397
DSSP  LLLL-------------------LLLLLLLHHHHHHHHH-HHHHhhhlllllllllllhh


DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEEeeellllllllllllllll
Query DENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKlktitakshksaveynife  416
ident       |    | |         | | ||  || | | |                     
Sbjct RVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAF-------------------  438
DSSP  HHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHH-------------------


DSSP  lleeeEEEEEEEELLEEEEEL---------------LEEL--LLLLL----LLLLL----
Query gmechGSPLVVISQGKIVFED---------------GNIN--VNKGM----GRFIP----  451
ident        |  ||  | |                                           
Sbjct ---fgVKPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfgALGSArhhcRLTFLsqaa  495
DSSP  ---llLLLLEEEELLEEEEEEellllllllllllleEEELhhHLHHHhhhhLEEEElhhh


DSSP  -----------------LLLLLHHH----------------------------hhhhhhh
Query -----------------RKAFPEHL----------------------------yqrvkir  466
ident                   |                                         
Sbjct aangvaerlnlrsaiavVKGCRTVQkadmvhnslqpnitvdaqtyevrvdgelitsepad  555
DSSP  hhhlhhhhllllleeeeLLLLLLLLhhhllllllllleeelllllleeelleelllllll


DSSP  hhhllllllll
Query nkvfglqgvsr  477
ident            
Sbjct vlpmaqryflf  566
DSSP  lllllllllll


No 18: Query=4b3zD Sbjct=3icjA Z-score=21.9

back to top
DSSP  LEEEEEEEEE-ELLL-LEEEEEEEEELLEEEEE-ELLL--LLLL--LLEEEELLLLEEEE
Query DRLLIKGGRI-INDD-QSLYADVYLEDGLIKQI-GENL--IVPG--GVKTIEANGRMVIP   53
ident        | |                                    |   |   |  | |
Sbjct CMKALINGTIyTSFSpVKKVSGLVISNERVLYAgDSSTalRIAElaGGEIIDLKGKFVMP   60
DSSP  LEEEEELLEEeEEELlEEEELEEEEELLEEEEEeLHHHhhHHHHhhLLEEEELLLLEEEE


DSSP  LEEEEEELLLL--LLLL-------------------------------------------
Query GGIDVNTYLQK--TAAD-------------------------------------------   68
ident    |    |                                                   
Sbjct AFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   68
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  -------LHHHHHHHHHHLLEEEEEE-EELLlllllhhHHHHHHHHHHH-LLLLLEEEEE
Query -------DFFQGTRAALVGGTTMIID-HVVPepgssllTSFEKWHEAAD-TKSCCDYSLH  119
ident                 |  |        |                |              
Sbjct tvkdykhYIESAQEHLLSLGVHSVGFmSVGE-------KALKALFELEReGRLKMNVFAY  233
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEeEELH-------HHHHHHHHHHHlLLLLLEEEEE


DSSP  EELLlllllHHHHHH---HHHH---llLLLEEEEELLL-------------------lll
Query VDITswydgVREELE---VLVQ---dkGVNSFQVYMAY-------------------kdv  154
ident              ||                                             
Sbjct LSPE-----LLDKLEelnLGKFegrrlRIWGVXLFVDGslgartallsepytdnpttsge  288
DSSP  ELHH-----HHHHHHhhlLLLEellleEEEEEEEELLLllllllllllllllllllllll


DSSP  lLLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHH
Query yQMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeelEA  214
ident   |      |     | ||    |||                                  
Sbjct lVMNKDEIVEVIERAKPLGLDVAVHAI-------------------------------GD  317
DSSP  lLLLHHHHHHHHHHHLLLLLEEEEEEL-------------------------------LH


DSSP  HHHHHHHHHHHHHLLLEEEEEELLHHhhHHHHHHHHhLLLEEEEELHHHHHLL--LHHHh
Query EAVFRAITIAGRINCPVYITKVMSKSaaDIIALARKkGPLVFGEPIAASLGTD--GTHYw  272
ident  ||  |            |         |      |    |           |       
Sbjct KAVDVALDAFEEAEFSGRIEHASLVR--DDQLERIK-ELKVRISAQPHFIVSDwwIVNR-  373
DSSP  HHHHHHHHHHHHHLLLLEEEELLLLL--HHHHHHHH-HHLLEEEELLLHHHHLllHHHH-


DSSP  lllhhhhhhlllllllllLLLHhhHHHHHHHHLLLLLLLLLLLlllhhhhhhhlllhhhl
Query sknwakaaafvtspplspDPTTpdYLTSLLACGDLQVTGSGHCpystaqkavgkdnftli  332
ident                         |    |                              
Sbjct --------------vgeeRAKW-aYRLKTLSSITKLGFSTDSP-----------------  401
DSSP  --------------hhhhHHHH-lLLHHHHHHHLLEEELLLLL-----------------


DSSP  lllLLLLllHHHHHHHHHLLL------lLLLHHHHHHHHLHHHHHHHLLLlLLLLLLLLL
Query pegVNGIeeRMTVVWDKAVAT------gKMDENQFVAVTSTNAAKIFNLYpRKGRIAVGS  386
ident             |  | ||                        |         |    | 
Sbjct ---IEPA--DPWVSIDAAVNRyvvdpgeRVSREEALHLYTHGSAQVTLAE-DLGKLERGF  455
DSSP  ---LLLL--LHHHHHHHHHHLllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLL


DSSP  LLLEEEE--EEEEeeelllllllllllllllllleeeeeeeeeeelleeeeelleellll
Query DADVVIW--DPDKlktitakshksaveynifegmechgsplvvisqgkivfedgninvnk  444
ident  |   |   || |                                               
Sbjct RAEYIILdrDPLK-----------------------------------------------  468
DSSP  LLLEEEEllLLLL-----------------------------------------------


DSSP  llllllllllllhhhhhhhhhhhhhllllllll
Query gmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                  
Sbjct ---------------------------------  468
DSSP  ---------------------------------


No 19: Query=4b3zD Sbjct=1k6wA Z-score=21.7

back to top
DSSP  LEEEEEEEEEellLLEE-EEEEEEELLEEEEEELL-lllllLLEEEELLLLEEEELEEEE
Query DRLLIKGGRIindDQSL-YADVYLEDGLIKQIGEN-livpgGVKTIEANGRMVIPGGIDV   58
ident     |   |              | || |  |               |    |||     
Sbjct ALQTIINARL---PGEEgLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEP   57
DSSP  LLLEEEEELL---LLLLlEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEE


DSSP  EELLLL--------------------------------lllLLHHHHHHHHHHLLEEEEE
Query NTYLQK--------------------------------taaDDFFQGTRAALVGGTTMII   86
ident    |                                         |        |     
Sbjct HIHLDTtqtagqpnwnqsgtlfegierwaerkallthddvkQRAWQTLKWQIANGIQHVR  117
DSSP  EELLLLllllllllllllllhhhhhhhhhllhhhllhhhhhHHHHHHHHHHHHLLEEEEE


DSSP  EEELLlLLLLhHHHHHHHHHHHHLLL-LLEEEEEEELLLL---LLLHHHHHHHHHHlLLL
Query DHVVPePGSSlLTSFEKWHEAADTKS-CCDYSLHVDITSW---YDGVREELEVLVQdKGV  142
ident  ||        ||      |         |             |      ||      | 
Sbjct THVDV-SDAT-LTALKAMLEVKQEVApWIDLQIVAFPQEGilsYPNGEALLEEALR-LGA  174
DSSP  EEEEL-LLLL-LHHHHHHHHHHHHHLlLLEEEEEEELLLLlllLLLHHHHHHHHHH-LLL


DSSP  LEEEEELLLLLlllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllh
Query NSFQVYMAYKDvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpe  202
ident                    |   |         | ||                       
Sbjct DVVGAIPHFEFtreYGVESLHKTFALAQKYDRLIDVHCD---------------------  213
DSSP  LEEEELHHHLLlhhHHHHHHHHHHHHHHHHLLEEEEEEL---------------------


DSSP  hhhhhLLHHHhhHHHHHHHHHHHHHLLL--EEEEEEL-LHHH----hhhHHHHHHhLLLE
Query ghalsRPEELeaEAVFRAITIAGRINCP--VYITKVM-SKSA----adiIALARKkGPLV  255
ident        |      |      |        |         |             |     
Sbjct ---eiDDEQS--RFVETVAALAHHEGMGarVTASHTTaMHSYngaytsrLFRLLK-MSGI  267
DSSP  ---llLLLLL--LHHHHHHHHHHHHLLHhhEEEEELHhHHHLlhhhhhhHHHHHH-HHLL


DSSP  EEEELHHHHHLllhhhhlllhhhhhhlllllLLLL-----LLLHHhhHHHHHHH-LLLLL
Query FGEPIAASLGTdgthywsknwakaaafvtspPLSP-----DPTTPdyLTSLLAC-GDLQV  309
ident                                                        |    
Sbjct NFVANPLVNIH--------------------LQGRfdtypKRRGI-tRVKEMLEsGINVC  306
DSSP  EEEELHHHHHH--------------------HLLLlllllLLLLL-lLHHHHHHlLLLEE


DSSP  LLLLLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH-----llLLLLLhhHHHH
Query TGSGHCPYstaqkavgkdnftliPEGV-NGIEeRMTVVWDKA-----vaTGKMDenQFVA  363
ident  |                     |            |             |         
Sbjct FGHDDVFD---------------PWYPlGTAN-MLQVLHMGLhvcqlmgYGQIN--DGLN  348
DSSP  ELLLLLLL---------------LLLLlLLLL-HHHHHHHHHhhlllllHHHHH--HHHH


DSSP  HHLHHHHHHHLLLLllLLLLLLLLLLEEEEE------EEEEeelllllllllllllllll
Query VTSTNAAKIFNLYPrkGRIAVGSDADVVIWD------PDKLktitakshksaveynifeg  417
ident       |   ||      || |  |   |                               
Sbjct LITHHSARTLNLQD--YGIAAGNSANLIILPaengfdALRR-------------------  387
DSSP  HHLHHHHHHLLLLL--LLLLLLLLLLEEEELlllhhhHHHH-------------------


DSSP  leeEEEEEEEEELLEEEEELLeellllllllllllllllhhhhhhhhhhhhhllllllll
Query mecHGSPLVVISQGKIVFEDGninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident              ||                                             
Sbjct ---QVPVRYSVRGGKVIASTQ---------------------paqttvyleqpeaidykr  423
DSSP  ---LLLLLEEEELLEEEEELL---------------------llleeeellleeeellll


No 20: Query=4b3zD Sbjct=3ooqA Z-score=21.6

back to top
DSSP  lEEEEEEEEEE-LLLLEEEEEEEEELLEEEEEELLLLLlLLLEEEELLLLEEEELEEEEE
Query dRLLIKGGRII-NDDQSLYADVYLEDGLIKQIGENLIVpGGVKTIEANGRMVIPGGIDVN   59
ident    | |              ||    |     |||             |    ||  |  
Sbjct -KILFKNATVFpITSRPFKGDVLVSNGKVEKVGENIED-PDAEIVDLTGKFLFPGFVDAH   58
DSSP  -LEEEEEEEELlLLLLLEEEEEEEELLEEEEEELLLLL-LLLEEEELLLLEEEELEEEEE


DSSP  ELL-LLLLL------------------------lLHHH-HHHHHHHLLEEEEEEEEL-ll
Query TYL-QKTAA------------------------dDFFQ-GTRAALVGGTTMIIDHVV-pe   92
ident                                            || || |          
Sbjct SHIgLFEEGvgyyysdgneatdpvtphvkaldgfNPQDpAIERALAGGVTSVXIVPGsan  118
DSSP  ELLlLLLLLllhhhlllllllllllllllhhhhlLLLLhHHHHHHLLLEEEEEELLLlll


DSSP  llllhhhhhhhhhhHHHLllllEEEEeeelllllllhhhhhhhhhhllLLLEEEEELL--
Query pgsslltsfekwheAADTksccDYSLhvditswydgvreelevlvqdkGVNSFQVYMA--  150
ident                                                             
Sbjct pvggqgsvikfrsiIVEE----CIVK----------------------DPAGLKXAFGen  152
DSSP  leeeeeeeeellllLHHH----HEEE----------------------EEEEEEEELLhh


DSSP  LLLL----------llLLHHHHHHH------------------------------hhHHH
Query YKDV----------yqMSDSQLYEA------------------------------ftFLK  170
ident  | |                                                        
Sbjct PKRVygerkqtpstrxGTAGVIRDYftkvknyxkkkelaqkegkeftetdlkxevgeXVL  212
DSSP  HHHHhhhlllllllhhHHHHHHHHHhhhhhhhhhhhhhhhhlllllllllhhhhhhhHHH


DSSP  HHLLEEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHHHHLLL
Query GLGAVILVHAengdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAGRINCP  230
ident         ||                                 |     || ||      
Sbjct RKKIPARXHA-------------------------------hRADDILTAIRIAEEFGFN  241
DSSP  LLLLLEEEEE-------------------------------lLHHHHHHHHHHHHHHLLL


DSSP  EEEEEELLhhHHHHhHHHHHHlLLEEEEELHhhHHLLLHhhhlllhhhhhhllllLLLLl
Query VYITKVMSksAADIiALARKKgPLVFGEPIAasLGTDGThywsknwakaaafvtsPPLSp  290
ident   |       |  |                   | |  |                     
Sbjct LVIEHGTE--AYKI-SKVLAE-KKIPVVVGP--LLTFRT--------------klELKD-  280
DSSP  EEEEELLL--HHHH-HHHHHH-HLLLEEELL--LLLLLL--------------lhHHLL-


DSSP  lllHHHHHHHHHHH-LLLLLLLLLLLlllhhhhhhhlllhhhllllLLLLLLHHHHHHhH
Query dptTPDYLTSLLAC-GDLQVTGSGHCpystaqkavgkdnftlipegVNGIEERMTVVWdK  349
ident            |   | |      |                     |   |         
Sbjct ---LTXETIAKLLKdGVLIALXCDHP--------------------VIPLEFATVQAA-T  316
DSSP  ---LLLLHHHHHHHlLLLEEELLLLL--------------------LLLHHHHHHHHH-H


DSSP  HLLLLLLLhHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEeeeelllllllll
Query AVATGKMDeNQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDklktitakshksa  409
ident |   |             | |||  |  | | |  | ||| | |                
Sbjct AXRYGAKE-EDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSGH-------------  362
DSSP  HHHHLLLH-HHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL-------------


DSSP  llllllllleEEEEEEEEEELLEEEEELLeellllllllllllllllhhhhhhhhhhhhh
Query veynifegmeCHGSPLVVISQGKIVFEDGninvnkgmgrfiprkafpehlyqrvkirnkv  469
ident                  |   |  ||                                  
Sbjct -------pfdXKSVVERVYIDGVEVFRRE-------------------------------  384
DSSP  -------lllLLLLEEEEEELLEEEEELL-------------------------------


DSSP  llllllll
Query fglqgvsr  477
ident         
Sbjct --------  384
DSSP  --------


No 21: Query=4b3zD Sbjct=3ls9A Z-score=21.3

back to top
DSSP  lEEEEEEE-EEELL---LLEEE-EEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELE
Query dRLLIKGG-RIIND---DQSLY-ADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGG   55
ident    || |  | |        |  ||       |   |  |       ||   |    || 
Sbjct -MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGL   59
DSSP  -LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELE


DSSP  EEEEELLLL-------------------------------------lllLLHHHHHHHHH
Query IDVNTYLQK-------------------------------------taaDDFFQGTRAAL   78
ident |     |                                                    |
Sbjct INSHQHLYEgamraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAVLLESL  119
DSSP  EEEEELHHHhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHHHHHHH


DSSP  HLLEEEEEEEELLL-LLLLhHHHHHHHHHHHHLlLLLEEEEEEELLL-------------
Query VGGTTMIIDHVVPE-PGSSlLTSFEKWHEAADTkSCCDYSLHVDITS-------------  124
ident  || |   |                   |||                             
Sbjct LGGITTVADQHLFFpGATA-DSYIDATIEAATD-LGIRFHAARSSMTlgkseggfcddlf  177
DSSP  HLLEEEEEEEELLLlLLLL-LLHHHHHHHHHHH-HLLEEEEEELLLLllhhhlllllhhh


DSSP  -LLLLH-HHHHHHHHHLLL--------LLEEE-EELLlllllLLLHHHHHHHHHHHHHHL
Query -WYDGV-REELEVLVQDKG--------VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLG  173
ident              |                                              
Sbjct vEPVDRvVQHCLGLIDQYHepepfgmvRIALGpCGVP-----YDKPELFEAFAQMAADYD  232
DSSP  lLLHHHhHHHHHHHHHHHLllllllleEEEELlLLLL-----LLLHHHHHHHHHHHHHHL


DSSP  LEEEEELllhhhhhhhhhhhhhllllllhhhhhhllHHHH--------hHHHHHHHHHHh
Query AVILVHAengdliaqeqkrilemgitgpeghalsrpEELE--------aEAVFRAITIAg  225
ident      |                                                      
Sbjct VRLHTHF---------------------------yePLDAgmsdhlygmTPWRFLEKHG-  264
DSSP  LEEEEEE---------------------------llLLHHhhhhhhhllLHHHHHHHLL-


DSSP  hhllLEEEEEELLHHhhHHHHHHHHhLLLEEEEELHHHHHLllhhhhlllhhhhhhllll
Query rincPVYITKVMSKSaaDIIALARKkGPLVFGEPIAASLGTdgthywsknwakaaafvts  285
ident      |                       |      |                       
Sbjct wasdRVWLAHAVVPP--REEIPEFA-DAGVAIAHLIAPDLR-------------------  302
DSSP  llllLEEEEELLLLL--HHHHHHHH-HHLLEEEELHHHHHH-------------------


DSSP  lLLLLlllhhHHHHHHHHH-LLLLLLLLLLLLllhhhhhhhlllhhhlllLLLLLlLHHH
Query pPLSPdpttpDYLTSLLAC-GDLQVTGSGHCPystaqkavgkdnftlipeGVNGIeERMT  344
ident                     |     |                          |      
Sbjct -MGWG-----LAPIREYLDaGITVGFGTTGSA------------------SNDGG-NLLG  337
DSSP  -LLLL-----LLLHHHHHHlLLEEEELLLLLL------------------LLLLL-LHHH


DSSP  HHHHHH----------lllLLLLhHHHHHHHLHHHHHHHLLLlLLLLLLLLLLLLEEEEE
Query VVWDKA----------vatGKMDeNQFVAVTSTNAAKIFNLYpRKGRIAVGSDADVVIWD  394
ident      |                             |         |    |  ||   | 
Sbjct DLRLAAlahrpadpnepekWLSA-RELLRMATRGSAECLGRP-DLGVLEEGRAADIACWR  395
DSSP  HHHHHHhhlhhhllllhhhLLLH-HHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEE


DSSP  E-----------------EEEEelllllllllllllllllleeeEEEEEEEELLEEEEEL
Query P-----------------DKLKtitakshksaveynifegmechGSPLVVISQGKIVFED  437
ident                     |                            |   |    | 
Sbjct LdgvdrvgvhdpaiglimTGLS----------------------DRASLVVVNGQVLVEN  433
DSSP  LllhhhlllllhhhhhhhLLLL----------------------LLLLEEEELLEEEEEL


DSSP  LEELLLLllllllllllllhhhhhhhhhhhhhllllllll
Query GNINVNKgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                         
Sbjct ERPVLAD--------------------lerivanttalip  453
DSSP  LEELLLL--------------------hhhhhhhhhhhll


No 22: Query=4b3zD Sbjct=1j6pA Z-score=21.2

back to top
DSSP  LEEEEEEEEEE-LLLL-EEEEEEEEELLEEEEEE-LLLLllllleEEELLLLEEEELEEE
Query DRLLIKGGRII-NDDQ-SLYADVYLEDGLIKQIG-ENLIvpggvkTIEANGRMVIPGGID   57
ident     |    |            |  | | ||                   |  | |    
Sbjct HHXIIGNCLILkDFSSePFWGAVEIENGTIKRVLqGEVK-----vDLDLSGKLVXPALFN   55
DSSP  LEEEEEEEEELlLLLLlLEEEEEEEELLEEEEEEeLLLL-----lLEELLLEEEEELEEE


DSSP  EEELLLL-LLLL-----------------------------LHHHHHHHHHHLLEEEEEE
Query VNTYLQK-TAAD-----------------------------DFFQGTRAALVGGTTMIID   87
ident   |                                                  |     |
Sbjct THTHAPXtLLRGvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVD  115
DSSP  EEELHHHhHHLLllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEE


DSSP  EELllllllhhhHHHHHHHHHHLlLLLEEEEEEELLL---LLLLHHHHHHHHHHLLL---
Query HVVpepgsslltSFEKWHEAADTkSCCDYSLHVDITS---WYDGVREELEVLVQDKG---  141
ident               |    |          |            |  ||   |        
Sbjct XYF---------HEEWIAKAVRD-FGXRALLTRGLVDsngDDGGRLEENLKLYNEWNgfe  165
DSSP  EEL---------LHHHHHHHHHH-HLLEEEEEEEELLlllLLLLHHHHHHHHHHHHLlhh


DSSP  ---LLEEE-EELLlllllLLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhll
Query ---VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemg  197
ident       |             |   |   |   | | |    |                  
Sbjct griFVGFGpHSPY-----LCSEEYLKRVFDTAKSLNAPVTIHLY----------------  204
DSSP  hleEEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLEEEEEL----------------


DSSP  llllhhhhhhLLHHhhhHHHHHHHHHHHhhLLLEEEEEELLhhHHHHHHHHHHhLLLEEE
Query itgpeghalsRPEEleaEAVFRAITIAGriNCPVYITKVMSksAADIIALARKkGPLVFG  257
ident             ||           |                          |     | 
Sbjct --------etSKEE---YDLEDILNIGL-kEVKTIAAHCVH--LPERYFGVLK-DIPFFV  249
DSSP  --------llLLLL---LLLHHHHLLLL-lLLLEEEEELLL--LLHHHHHHHL-LLLEEE


DSSP  EELHHhhhlllhhhhlllhhhhhhLLLLllllllllHHHHHHHHHHHLLLLLLLLLLLLl
Query EPIAAslgtdgthywsknwakaaaFVTSpplspdptTPDYLTSLLACGDLQVTGSGHCPy  317
ident     |                                          |     |      
Sbjct SHNPA----------------snlKLGN--------GIAPVQRXIEHGXKVTLGTDGAA-  284
DSSP  EELHH----------------hhhHLLL--------LLLLHHHHHHLLLEEEELLLLLL-


DSSP  lhhhhhhhlllhhhlllLLLLLlLHHHHHHHHH-----llLLLLLHHHHHHHHLHHHHHH
Query staqkavgkdnftlipeGVNGIeERMTVVWDKA-----vaTGKMDENQFVAVTSTNAAKI  372
ident                    |                        | |          |  
Sbjct -----------------SNNSL-NLFFEXRLASllqkaqnPRNLDVNTCLKXVTYDGAQA  326
DSSP  -----------------LLLLL-LHHHHHHHHHhhhhlllLLLLLHHHHHHHHLHHHHHH


DSSP  HLLllLLLLLLLLLLLLEEEEEEEEeeelllllllllllllllllleEEEE--EEEEEEL
Query FNLypRKGRIAVGSDADVVIWDPDKlktitakshksaveynifegmeCHGS--PLVVISQ  430
ident        | |  |  || |  | |                          |         
Sbjct XGF--KSGKIEEGWNADLVVIDLDL--------pexfpvqniknhlvHAFSgeVFATXVA  376
DSSP  HLL--LLLLLLLLLLLLEEEEELLL--------hhhllhhhhhhhhhHLLLllLLEEEEL


DSSP  LEEEEELLEELLLlllllllllllllhhhhhhhhhhhhhllllllll
Query GKIVFEDGNINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident ||    ||                                       
Sbjct GKWIYFDGEYPTI----------------dseevkrelariekelys  407
DSSP  LEEEEELLLLLLL----------------lhhhhhhhhhhhhhhhhl


No 23: Query=4b3zD Sbjct=4c5yA Z-score=20.3

back to top
DSSP  ---LEEEEEEEEEEL-LLLEEE-EEEEEELLEEEEEE--LLLL--LLLLL-EEEELllLE
Query ---DRLLIKGGRIIN-DDQSLY-ADVYLEDGLIKQIG--ENLI--VPGGV-KTIEAngRM   50
ident        |  |  |  |   |  |     |  |   |               |       
Sbjct deaKVTIIYAGLLIPgDGEPLRnAALVISDKIIAFVGseADIPkkYLRSTqSTHRV--PV   58
DSSP  lllLEEEEEEEEELLlLLLLEEeEEEEEELLEEEEEEehHHLLhhHHHHLlLEEEE--EE


DSSP  EEELEEEEEELLLL-----------------LLLLLHHHHHHHHHHLLEEEEEEEELlll
Query VIPGGIDVNTYLQK-----------------TAADDFFQGTRAALVGGTTMIIDHVVpep   93
ident   ||  |                                |   ||  | |   |      
Sbjct LMPGLWDCHMHFGGdddyyndytsglathpaSSGARLARGCWEALQNGYTSYRDLAG---  115
DSSP  EEELEEEEEELLLLllllllllhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELLL---


DSSP  lllhhhhhhhHHHHHHLL-----LLLEEEEE-EELL------------------------
Query gsslltsfekWHEAADTK-----SCCDYSLH-VDIT------------------------  123
ident             | |                                             
Sbjct ---------yGCEVAKAIndgtiVGPNVYSSgAALSqtaghgdifalpagevlgsygvmn  166
DSSP  ---------lHHHHHHHHhllllLLLEEEELlLEEEllllllllllllhhhhhhhhllll


DSSP  ------------LLLL--LHHHHHHHHHHlLLLLEEEEELLL--------llllLLLHHH
Query ------------SWYD--GVREELEVLVQdKGVNSFQVYMAY--------kdvyQMSDSQ  161
ident                    ||          |     |                | |   
Sbjct prpgywgagplcIADGveEVRRAVRLQIR-RGAKVIXVMASGgvmsrddnpnfaQFSPEE  225
DSSP  lllllllllleeELLLhhHHHHHHHHHHH-HLLLLEEEELLLllllllllllllLLLHHH


DSSP  HHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHH
Query LYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAI  221
ident |                |                                        ||
Sbjct LKVIVEEAARQNRIVSAHVH-------------------------------GKAGIMAAI  254
DSSP  HHHHHHHHHHLLLLEEEEEL-------------------------------LHHHHHHHH


DSSP  HHHhhhllLEEEEEELlhHHHHHHHHHHHhLLLEEEEELHHHhHLLLHHHhlllhhHHHH
Query TIAgrincPVYITKVMskSAADIIALARKkGPLVFGEPIAASlGTDGTHYwsknwaKAAA  281
ident               |    |        |                               
Sbjct KAG-----CKSLEHVS--YADEEVWELMK-EKGILYVATRSViEIFLASN------GEGL  300
DSSP  HHL-----LLEEEELL--LLLHHHHHHHH-HHLLEEELLHHHhHHHHHHL------LLLL


DSSP  lllllllLLLL--LHHHH-HHHHHHHLLLLLLLLLLLlllhhhhhhhlllhhhlllllll
Query fvtspplSPDP--TTPDY-LTSLLACGDLQVTGSGHCpystaqkavgkdnftlipegvng  338
ident                           |     |                           
Sbjct -vkeswaKLQAlaDSHLKaYQGAIKAGVTIALGTDTA----------------------p  337
DSSP  -lllhhhLLLHhhHHHHHhHHHHHHLLLLEELLLLLL----------------------l


DSSP  LLLHHhHHHHHHLLLlLLLHHHHHHHHLHHHHHHH--LLLLlLLLLLLLLLLLEEEEEEE
Query IEERMtVVWDKAVATgKMDENQFVAVTSTNAAKIF--NLYPrKGRIAVGSDADVVIWDPD  396
ident            ||    |           ||            |    |  |||      
Sbjct GGPTA-LELQFAVERgGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEEN  395
DSSP  LLLLH-HHHHHHHHLlLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLL


DSSP  eeeelllllllllllllllllleEEEE-----EEEEEELLEEEEELLEELLLllllllll
Query klktitakshksaveynifegmeCHGS-----PLVVISQGKIVFEDGNINVNkgmgrfip  451
ident                                    |   ||     |             
Sbjct -------------------pledIKVFqepkaVTHVWKGGKLFKGPGIGPWG--------  428
DSSP  -------------------llllHHHHhlhhhEEEEEELLEEEELLLLLLLL--------


DSSP  lllllhhhhhhhhhhhhhllllllll
Query rkafpehlyqrvkirnkvfglqgvsr  477
ident                           
Sbjct ------------------edarnpfl  436
DSSP  ------------------llllllll


No 24: Query=4b3zD Sbjct=3cjpA Z-score=18.7

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                        ||  |
Sbjct -----------------------------------------------------LIIDGHT    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LLLllllLLHHHHHHHHHHLLEEEEEEEELL--------------------------LLL
Query YLQktaaDDFFQGTRAALVGGTTMIIDHVVP--------------------------EPG   94
ident                     |    |                                  
Sbjct HVI----LPVEKHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkklndvvngkTNS   63
DSSP  ELL----LLHHHHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhlllLLL


DSSP  LL--HHHHHHHHHHHHHLLLlLEEEEEEELLLLLL--LHHHHHHHHHHLLLLLEEE-EEL
Query SS--LLTSFEKWHEAADTKScCDYSLHVDITSWYD--GVREELEVLVQDKGVNSFQ-VYM  149
ident        |               |                   |                
Sbjct MIdvRRNSIKELTNVIQAYP-SRYVGFGNVPVGLSenDTNSYIEENIVNNKLVGIGeLTP  122
DSSP  LHhhHHHHHHHHHHHHHHLL-LLEEEEELLLLLLLhhHHHHHHHHHLLLLLLLEEEeELL


DSSP  LLllllllLHHHHHHHHHHHHHH-LLEEEEELLLHhhhhhhhhhhhhllllllhhhhhhl
Query AYkdvyqmSDSQLYEAFTFLKGL-GAVILVHAENGdliaqeqkrilemgitgpeghalsr  208
ident |           |   |          |  || |                          
Sbjct AS-----gQIKSLKPIFKYSMDSgSLPIWIHAFNP-------------------------  152
DSSP  LL-----lLHHHHHHHHHHHHHLlLLLEEELLLLL-------------------------


DSSP  lhhHHHHHHHHHHHHHHHHL-LLEEEEEELLhHHHHHHHHHHHHLLLEEEEELhHHHHll
Query peeLEAEAVFRAITIAGRIN-CPVYITKVMSkSAADIIALARKKGPLVFGEPIaASLGtd  267
ident    |                  ||        |         |           |     
Sbjct ---LVLQDIKEIAELCKAFPkVPVILGHMGG-SNWMTAVELAKEIQNLYLDTS-AYFS--  205
DSSP  ---LLHHHHHHHHHHHHHLLlLLEEEHHHHH-HHHHHHHHHHHHLLLEEEELL-LLLL--


DSSP  lhhhhlllhhhhhhllllllllllllhHHHHHHHHHHL-lLLLLLLLLLlllhhhhhhhl
Query gthywsknwakaaafvtspplspdpttPDYLTSLLACG-dLQVTGSGHCpystaqkavgk  326
ident                               |             |               
Sbjct ---------------------------TFVLKIVINELplKCIFGTDMP-----------  227
DSSP  ---------------------------HHHHHHHHHHLllLEELLLLLL-----------


DSSP  llhhhllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHHLLlllllllllll
Query dnftlipegVNGIEERMTVVWDKAvatgkMDENQFVAVTSTNAAKIFNLyprkgriavgs  386
ident                               |     ||   |     |            
Sbjct ---------FGDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI-----------  262
DSSP  ---------LLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL-----------


DSSP  llleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllll
Query dadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgm  446
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhhhhllllllll
Query grfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                
Sbjct -------------------------------  262
DSSP  -------------------------------


No 25: Query=4b3zD Sbjct=2ob3A Z-score=18.5

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                      |      
Sbjct --------------------------------------drintvrgpitiseaGFTLTHE   22
DSSP  --------------------------------------lleeelleeelhhhhLLEEEEE


DSSP  LLLL-----------------LLLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhh
Query YLQK-----------------TAADDFFQGTRAALVGGTTMIIDHVVPEpgsslltsfek  103
ident                        |     | | |   |   | |                
Sbjct HICGssagflrawpeffgsrkALAEKAVRGLRRARAAGVRTIVDVSTFD--------igr   74
DSSP  LLEEllllhhhhlhhhhllhhHHHHHHHHHHHHHHHLLLLEEEELLLHH--------hll


DSSP  HHHHHHLLL---LLEEEEEEELL------LLLL---LHHHHHHHHHHLL------LLLEE
Query WHEAADTKS---CCDYSLHVDIT------SWYD---GVREELEVLVQDK------GVNSF  145
ident         |                                     |             
Sbjct DVSLLAEVSraaDVHIVAATGLWfdpplsMRLRsveELTQFFLREIQYGiedtgiRAGII  134
DSSP  LHHHHHHHHhhhLLEEELEEELLllllhhHHLLlhhHHHHHHHHHHHLLllllllLLLEE


DSSP  EEELLLLllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhh
Query QVYMAYKdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpegha  205
ident  |    |         |  |       |     |                          
Sbjct XVATTGK-atpFQELVLKAAARASLATGVPVTTHTA------------------------  169
DSSP  EEELLLL-llhHHHHHHHHHHHHHHHHLLLEEEELL------------------------


DSSP  hhllhhhHHHHHHHHHHHHHHHLL---LEEEEEE-LLHHhHHHHHHHHHhlLLEEEEELH
Query lsrpeelEAEAVFRAITIAGRINC---PVYITKV-MSKSaADIIALARKkgPLVFGEPIA  261
ident                  |          | |                             
Sbjct ------aSQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLDH  220
DSSP  ------hHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEELL


DSSP  HhhHLLLHHHHLllhhHHHHLLlllLLLLLL-LHHHHHHHHHHH---LLLLLLLLLLLLL
Query AslGTDGTHYWSknwaKAAAFVtspPLSPDP-TTPDYLTSLLAC---GDLQVTGSGHCPY  317
ident                  | |      |      |   |   |                  
Sbjct I--PYSAIGLED----NASASA---LLGIRSwQTRALLIKALIDqgyMKQILVSNDWTFG  271
DSSP  L--LLLLLLLLL----LHHHHH---HHLLLLhHHHHHHHHHHHHlllHHHEEELLLLLLE


DSSP  lhhhhhhhlllHHHLLL------lllLLLLHHHHHHHHHLLLLlLLHHHHHHHHLHHHHH
Query staqkavgkdnFTLIPE------gvnGIEERMTVVWDKAVATGkMDENQFVAVTSTNAAK  371
ident                           |       |       |          | || | 
Sbjct --------fssYVTNIMdvmdrvnpdGMAFIPLRVIPFLREKG-VPQETLAGITVTNPAR  322
DSSP  --------ellLLLLHHhhhhhhlllHHHHHHHLHHHHHHHLL-LLHHHHHHHHLHHHHH


DSSP  HHLllllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeell
Query IFNlyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqg  431
ident                                                             
Sbjct FLS---------------------------------------------------------  325
DSSP  HHL---------------------------------------------------------


DSSP  eeeeelleelllllllllllllLLLHhhhhhhhhhhhhllllllll
Query kivfedgninvnkgmgrfiprkAFPEhlyqrvkirnkvfglqgvsr  477
ident                                               
Sbjct ----------------------PTLR--------------------  329
DSSP  ----------------------LLLL--------------------


No 26: Query=4b3zD Sbjct=2uz9A Z-score=18.5

back to top
DSSP  -LEEEEEEeEEELLL-----LEEE-EEEEEE-LLEEEEEE-LLLL------LLLL-lEEE
Query -DRLLIKGgRIINDD-----QSLY-ADVYLE-DGLIKQIG-ENLI------VPGG-vKTI   44
ident        |              |          | |                        
Sbjct pLAHIFRG-TFVHSTwtcpmEVLRdHLLGVSdSGKIVFLEeASQQeklakeWCFKpcEIR   59
DSSP  lLLEEEEE-EEEELLlllllEEEEeEEEEELlLLLEEEEEeHHHHhhhhhhHLLLhhHEE


DSSP  ELL-LLEEEELEEEEEELLLL-------------------------------LLLLLHHH
Query EAN-GRMVIPGGIDVNTYLQK-------------------------------TAADDFFQ   72
ident |        ||  |                                       |      
Sbjct ELShHEFFMPGLVDTHIHASQysfagssidlpllewltkytfpaehrfqnidFAEEVYTR  119
DSSP  ELLlLLEEEELEEEEEEEHHHhhhllllllllhhhhhhhlhhhhhhhhhlhhHHHHHHHH


DSSP  HHHHHHHLLEEEEEEEELLlllllHHHHHHHHHHHHHLlLLLEEEEEEELLL--------
Query GTRAALVGGTTMIIDHVVPepgssLLTSFEKWHEAADTkSCCDYSLHVDITS--------  124
ident   |  |  |||                |        |                       
Sbjct VVRRTLKNGTTTACYFATI-----HTDSSLLLADITDK-FGQRAFVGKVCMDlndtfpey  173
DSSP  HHHHHHHLLEEEEEEELLL-----LHHHHHHHHHHHHH-HLLEEEEELEELLllllllll


DSSP  --LLLLHHHHHHHHHHLLL-------LLEEE-EELLlllllLLLHHHHHHHHHHHHHHLL
Query --WYDGVREELEVLVQDKG-------VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLGA  174
ident          | |  |                            |     |     |    
Sbjct keTTEESIKETERFVSEMLqknysrvKPIVTpRFSL-----SCSETLMGELGNIAKTRDL  228
DSSP  llLHHHHHHHHHHHHHHHHhhlllleEEEEEeLLHH-----HLLHHHHHHHHHHHHHHLL


DSSP  EEEEELllhhhhhhhhhhhhhllllllhhhhhhLLHHH--------hhHHHHHHHHHHhh
Query VILVHAengdliaqeqkrilemgitgpeghalsRPEEL--------eaEAVFRAITIAgr  226
ident  |  |                            | |                        
Sbjct HIQSHI------------------------senRDEVEavknlypsykNYTSVYDKNN-l  263
DSSP  EEEEEE------------------------lllHHHHHhhhhhlllllLHHHHHHHLL-l


DSSP  hllLEEEEEELLhhHHHHHHHHHhhLLLEEEEELHHHhHLLLhhhhlllhhhhhhlllll
Query incPVYITKVMSksAADIIALARkkGPLVFGEPIAASlGTDGthywsknwakaaafvtsp  286
ident                                     |                       
Sbjct ltnKTVMAHGCY--LSAEELNVF-hERGASIAHCPNS-NLSL------------------  301
DSSP  lllLEEEEELLL--LLHHHHHHH-hHHLLEEEELHHH-HHHL------------------


DSSP  LLLLlllhhhhHHHHHHH-LLLLLLLLLLLlllhhhhhhhlllhhhlllLLLLLlLHHHH
Query PLSPdpttpdyLTSLLAC-GDLQVTGSGHCpystaqkavgkdnftlipeGVNGIeERMTV  345
ident                          |                       |          
Sbjct SSGF------lNVLEVLKhEVKIGLGTDVA-------------------GGYSY-SMLDA  335
DSSP  LLLL------lLHHHHHHlLLEEEELLLLL-------------------LLLLL-LHHHH


DSSP  HHHHH-----------lllLLLLHhHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEE-
Query VWDKA-----------vatGKMDEnQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIW-  393
ident                                         |    |   ||   |     
Sbjct IRRAVmvsnillinkvnekSLTLK-EVFRLATLGGSQALGLDGEIGNFEVGKEFDAILIn  394
DSSP  HHHHHhhhhhhhhllllllLLLHH-HHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEl


DSSP  -----------------------EEEEeeelllllllllllllllllleEEEE---EEEE
Query -----------------------DPDKlktitakshksaveynifegmeCHGS---PLVV  427
ident                                                    |       |
Sbjct pkasdspidlfygdffgdiseavIQKF---------------------lYLGDdrnIEEV  433
DSSP  llllllllllllhhhhlllllhhHHHH---------------------hHHLLhhhEEEE


DSSP  EELLEEEeelleELLLlllllllllllllhhhhhhhhhhhhhllllllll
Query ISQGKIVfedgnINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident    || |                                           
Sbjct YVGGKQV-----VPFS----------------------------------  444
DSSP  EELLEEE-----ELLL----------------------------------


No 27: Query=4b3zD Sbjct=3irsA Z-score=18.3

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                        ||   
Sbjct ----------------------------------------------------LKIIDFRL    8
DSSP  ----------------------------------------------------LLLEELLL


DSSP  LLLL-----------------------------lLLLLHHHHHHHHHHLLEEEEEEEELL
Query YLQK-----------------------------tAADDFFQGTRAALVGGTTMIIDHVVP   91
ident                                                  |          
Sbjct RPPAmgflnariytrpdirnrftrqlgfepapsaEEKSLELMFEEMAAAGIEQGVCVGRN   68
DSSP  LLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhHHLLHHHHHHHHHHLLLLEEEEELLE


DSSP  LLlllhhhHHHHHHHHHHLLLlLEEEEEEELLLLL-LLHHHHHHHHHhLLLLLEEEEELL
Query EPgsslltSFEKWHEAADTKScCDYSLHVDITSWY-DGVREELEVLVqDKGVNSFQVYMA  150
ident         |       |             |                 | |         
Sbjct SS-vlgsvSNADVAAVAKAYP-DKFHPVGSIEAATrKEAMAQMQEIL-DLGIRIVNLEPG  125
DSSP  EL-lleelLHHHHHHHHHHLL-LLEEEEEELLLLLhHHHHHHHHHHH-HLLLLLEEELHH


DSSP  LLLLLLL-lHHHHHHHHHHHHHHLLEEEEEL--llHHHHhhhhhhhhhllllllhhhhhh
Query YKDVYQM-sDSQLYEAFTFLKGLGAVILVHA--enGDLIaqeqkrilemgitgpeghals  207
ident          |  ||    |    |           |  |                     
Sbjct VWATPMHvdDRRLYPLYAFCEDNGIPVIMMTggnaGPDI---------------------  164
DSSP  HLLLLLLllLHHHHHHHHHHHHLLLLEEEELllllLLLH---------------------


DSSP  llhhHHHHHHHHHHHHHHhhLLLEEEEEEL---LHHHHHHHHHHHhhllLEEEEELhHHH
Query rpeeLEAEAVFRAITIAGriNCPVYITKVM---SKSAADIIALARkkgpLVFGEPIaASL  264
ident        |   |           |                              |    |
Sbjct --tyTNPEHIDRVLGDFP--DLTVVSSHGNwpwVQEIIHVAFRRP----NLYLSPD-MYL  215
DSSP  --hhHLHHHHHHHHHHLL--LLLEEEEHHHlllHHHHHHHHHHLL----LEEEELH-HHH


DSSP  HLLlhhhhlllhhhhhhlllllllllllLHHHHHHHHHHHLL--LLLLLLLLLlllhhhh
Query GTDgthywsknwakaaafvtspplspdpTTPDYLTSLLACGD--LQVTGSGHCpystaqk  322
ident                                                 |           
Sbjct YNL-------------------------PGHADFIQAANSFLadRMLFGTAYP-------  243
DSSP  LLL-------------------------LLHHHHHHHHLLHHhhLLLLLLLLL-------


DSSP  hhhlllhhhllllLLLLLLHHHHHHHHhllllLLLHHHHHHHHLHHHHHHHLllllllll
Query avgkdnftlipegVNGIEERMTVVWDKavatgKMDENQFVAVTSTNAAKIFNlyprkgri  382
ident                   |                          ||             
Sbjct -------------MCPLKEYTEWFLTL-----PIKPDAMEKILHGNAERLLA--------  277
DSSP  -------------LLLHHHHHHHHHLL-----LLLHHHHHHHHLHHHHHHHH--------


DSSP  llllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleell
Query avgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninv  442
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllllllLLLLlhhhhhhhhhhhhhllllllll
Query nkgmgrfipRKAFpehlyqrvkirnkvfglqgvsr  477
ident                                    
Sbjct ---------QAGR----------------------  281
DSSP  ---------HLLL----------------------


No 28: Query=4b3zD Sbjct=4rdvB Z-score=17.6

back to top
DSSP  leEEEEEEEEELLLLEEE-EEEEEE-LLEEEEEE--LLLLLlllleEEELLlLEEEELEE
Query drLLIKGGRIINDDQSLY-ADVYLE-DGLIKQIG--ENLIVpggvkTIEANgRMVIPGGI   56
ident     |   |                 ||    |    |                | ||  
Sbjct --SAIFAERALLPEGWARnVRFEISaDGVLAEIRpdANADG-----AERLG-GAVLPGMP   52
DSSP  --LEEEEEEEEELLEEEEeEEEEELlLLLEEEEEllLLLLL-----LEELL-LLEEELEE


DSSP  EEEELLLL----------------------------------lllLLHHHHHHHHHHLLE
Query DVNTYLQK----------------------------------taaDDFFQGTRAALVGGT   82
ident                                                  |     |  | 
Sbjct NLHSHAFQramaglaevagnpndsfwtwrelmyrmvarlspeqieVIACQLYIEMLKAGY  112
DSSP  EEEELHHHhhhlllllllllllllhhhhhhhhhhhhllllhhhhhHHHHHHHHHHHHHLE


DSSP  EEEEEEELLLL------llLHHHHHHHHHHHHHlLLLLEEEEEEELLL------------
Query TMIIDHVVPEP------gsSLLTSFEKWHEAADtKSCCDYSLHVDITS------------  124
ident |                             ||         |     |            
Sbjct TAVAEFHYVHHdldgrsyaDPAELSLRISRAAS-AAGIGLTLLPVLYShagfggqpaseg  171
DSSP  EEEEEEELLLLllllllllLLLHHHHHHHHHHH-HHLLEEEEEELLLLeeellleellhh


DSSP  ------LLLLHHHHHHHHhHLLL-----LLEEE-EELLlllllLLLHHHHHHHHHHhHHH
Query ------WYDGVREELEVLvQDKG-----VNSFQ-VYMAykdvyQMSDSQLYEAFTFlKGL  172
ident             | |  |                              |           
Sbjct qrrfinGSEAYLELLQRL-RAPLeaaghSLGLCfHSLR-----AVTPQQIATVLAA-GHD  224
DSSP  hlllllLHHHHHHHHHHH-HHHHhhhllEELEEeLLLL-----LLLHHHHHHHHLL-LLL


DSSP  LLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhlLHHHH--------hHHHHHHHHHH
Query GAVILVHAEngdliaqeqkrilemgitgpeghalsrPEELE--------aEAVFRAITIA  224
ident       |                                                     
Sbjct DLPVHIHIA--------------------------eQQKEVddcqawsgrRPLQWLYENV  258
DSSP  LLLEEEEEL--------------------------lLHHHHhhhhhhhllLHHHHHHHHL


DSSP  HhhllLEEEEEELLHH--HHHHHHHHHhhlllEEEEELHHHHHLLlhhhhlllhhhhhhl
Query GrincPVYITKVMSKS--AADIIALARkkgplVFGEPIAASLGTDgthywsknwakaaaf  282
ident                        |                                    
Sbjct A-vdqRWCLVHATHADpaEVAAMARSG-----AVAGLCLSTEANL---------------  297
DSSP  L-lllLEEEEELLLLLhhHHHHHHHHL-----LEEEELHHHHHHL---------------


DSSP  llllLLLLlllhhhHHHHHHHH-LLLLLLLLLLllllhhhhhhhlllhhhllllLLLLll
Query vtspPLSPdpttpdYLTSLLAC-GDLQVTGSGHcpystaqkavgkdnftlipegVNGIee  341
ident                        |     ||                             
Sbjct ----GDGI------FPATDFLAqGGRLGIGSDS---------------------HVSL--  324
DSSP  ----LLLL------LLHHHHHHlLLEEEELLLL---------------------LLLL--


DSSP  HHHHHHHHHL---------lLLLL------LHHHHHHHHLHHHHHHHLLllLLLLLLLLL
Query RMTVVWDKAV---------aTGKM------DENQFVAVTSTNAAKIFNLypRKGRIAVGS  386
ident                                            |         |  ||| 
Sbjct SVVEELRWLEygqrlrdrkrNRLYrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGR  382
DSSP  LHHHHHHHHHhhhhhhhlllLLLLllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLL


DSSP  LLLEEEEE--------------EEEEeellllllllllllllllllEEEE--EEEEEEEL
Query DADVVIWD--------------PDKLktitakshksaveynifegmECHG--SPLVVISQ  430
ident  ||    |                                         |      |   
Sbjct RADLLVLDgndpylasaegdalLNRW-------------------lFAGGdrQVRDVMVA  423
DSSP  LLLEEEELlllhhhhllllhhhHHHH-------------------hHHLLhhHEEEEEEL


DSSP  LEEEEELLEELLLlllllllllllllhhhhhhhhhhhhhllllllll
Query GKIVFEDGNINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident |  |  ||                                       
Sbjct GRWVVRDGRHAGE-------------------ersarafvqvlgell  451
DSSP  LEEEELLLLLLLH-------------------hhhhhhhhhhhhhhl


No 29: Query=4b3zD Sbjct=2dvtA Z-score=17.6

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
ident                                                      |      
Sbjct ---------------------------------------------------MQGKVALEE    9
DSSP  ---------------------------------------------------LLLEEEEEE


DSSP  LLLL------------------LLLL--LHHH-HHHHHHHLLEEEEEEEEL---------
Query YLQK------------------TAAD--DFFQ-GTRAALVGGTTMIIDHVV---------   90
ident                             |            |    |             
Sbjct HFAIpetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSLNapavqaipd   69
DSSP  EELLhhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEELllhhhhlll


DSSP  -lLLLLLHHHHHHHHHHHHHLLLlLEEEEEEELLLLL-LLHHHHHHHHHHLLLLLEEEEE
Query -pEPGSSLLTSFEKWHEAADTKScCDYSLHVDITSWY-DGVREELEVLVQDKGVNSFQVY  148
ident                 |                     |   |||   | | |     | 
Sbjct rrKAIEIARRANDVLAEECAKRP-DRFLAFAALPLQDpDAATEELQRCVNDLGFVGALVN  128
DSSP  hhHHHHHHHHHHHHHHHHHHHLL-LLEEEEELLLLLLhHHHHHHHHHHHHLLLLLEEEEE


DSSP  LLLLL----llLLLH-HHHHHHHHHHHHHLLEEEEELLlhhHHHH-HHHHHHhlllLLLH
Query MAYKD----vyQMSD-SQLYEAFTFLKGLGAVILVHAEngdLIAQ-EQKRILemgiTGPE  202
ident               |  |          |      |                      | 
Sbjct GFSQEgdgqtpLYYDlPQYRPFWGEVEKLDVPFYLHPR---NPLPqDSRIYD----GHPW  181
DSSP  LLLLLllllllLLLLlHHHHHHHHHHHHHLLLEEEELL---LLLHhHLHHHL----LLHH


DSSP  HHH-hhLLHHHHHHHHHHHHH--HHHHHL-LLEEEEEELLHhHHHH--------------
Query GHA-lsRPEELEAEAVFRAIT--IAGRIN-CPVYITKVMSKsAADI--------------  244
ident             |    |                                          
Sbjct LLGptwAFAQETAVHALRLMAsgLFDEHPrLNIILGHMGEG-LPYMmwridhrnawvklp  240
DSSP  HLHhhlHHHHHHHHHHHHHHHllHHHHLLlLLEEELHHHLL-HHHHhhhhhhllllllll


DSSP  ---hhhhhHHLL---LEEEEELhHHHHlllhhhhlllhhhhhhllllllllllllhhHHH
Query ---ialarKKGP---LVFGEPIaASLGtdgthywsknwakaaafvtspplspdpttpDYL  298
ident                                                             
Sbjct prypakrrFMDYfneNFHITTS-GNFR------------------------------TQT  269
DSSP  llllllllHHHHhhhHEEEELL-LLLL------------------------------HHH


DSSP  HHHHHHLL---LLLLLLLLLlllhhhhhhhlllhhhlllLLLLlLLHHHHHHHHhllllL
Query TSLLACGD---LQVTGSGHCpystaqkavgkdnftlipeGVNGiEERMTVVWDKavatgK  355
ident                                          |                  
Sbjct LIDAILEIgadRILFSTDWP-------------------FENI-DHASDWFNAT-----S  304
DSSP  HHHHHLLLlhhHEELLLLLL-------------------LLLH-HHHHHHHHHL-----L


DSSP  LLHHHHHHHHLHHHHHHHLLLllllllllllllleeeeeeeeeeelllllllllllllll
Query MDENQFVAVTSTNAAKIFNLYprkgriavgsdadvviwdpdklktitakshksaveynif  415
ident   |   |    |||   | |                                        
Sbjct IAEADRVKIGRTNARRLFKLD---------------------------------------  325
DSSP  LLHHHHHHHHLHHHHHHLLLL---------------------------------------


DSSP  llleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllll
Query egmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgv  475
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  ll
Query sr  477
ident   
Sbjct --  325
DSSP  --


No 30: Query=4b3zD Sbjct=4ofcA Z-score=17.0

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                        ||   
Sbjct -----------------------------------------------------MKIDIHS    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LLLL-------------------------------------LLLL--LHHHHHHHHHHLL
Query YLQK-------------------------------------TAAD--DFFQGTRAALVGG   81
ident                                                |     |     |
Sbjct HILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvVRENcwDPEVRIREMDQKG   67
DSSP  ELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeEEHHhlLHHHHHHHHHHHL


DSSP  EEEEEEEE---LLLL-------LLLHHHHHHHHHHHHHLLllLEEEEEEELLLLL-LLHH
Query TTMIIDHV---VPEP-------GSSLLTSFEKWHEAADTKscCDYSLHVDITSWY-DGVR  130
ident  |                                                          
Sbjct VTVQALSTvpvMFSYwakpedtLNLCQLLNNDLASTVVSY-pRRFVGLGTLPMQApELAV  126
DSSP  LLEEEEELlhhHHLLlllhhhhHHHHHHHHHHHHHHHHHL-lLLEEEEELLLLLLhHHHH


DSSP  HHHHHHHHLLLLLEEEEELLLLLllLLLH-HHHHHHHHHHHHHLLEEEEELLlhhhHHHH
Query EELEVLVQDKGVNSFQVYMAYKDvyQMSD-SQLYEAFTFLKGLGAVILVHAEngdlIAQE  189
ident  | |  |   |    |                |         |     ||          
Sbjct KEMERCVKELGFPGVQIGTHVNE--WDLNaQELFPVYAAAERLKCSLFVHPW---dMQMD  181
DSSP  HHHHHHHHLLLLLEEEEELEELL--EELLlHHHHHHHHHHHHHLLEEEEELL---lLLLL


DSSP  hHHHHhlllllLHHHH-hhLLHHHHHHHHHHHH--HHHHHHL-LLEEEEEELLhHHHH--
Query qKRILemgitgPEGHA-lsRPEELEAEAVFRAI--TIAGRIN-CPVYITKVMSkSAAD--  243
ident   |                        |    |            |              
Sbjct -GRMA------KYWLPwlvGMPAETTIAICSMImgGVFEKFPkLKVCFAHGGG-AFPFtv  233
DSSP  -HHHH------LLLHHhhlHHHHHHHHHHHHHHllLHHHHLLlLLEEELHHHL-LHHHhh


DSSP  --------------------hhHHHHhhllLEEEEElhHHHHlllhhhhlllhhhhhhll
Query --------------------iiALARkkgpLVFGEPiaASLGtdgthywsknwakaaafv  283
ident                                                             
Sbjct grishgfsmrpdlcaqdnpmnpKKYL---gSFYTDA--LVHD------------------  270
DSSP  hhhhhhhhhlhhhhlllllllhHHHL---lLLEEEL--LLLL------------------


DSSP  llllllllllhHHHHHHHHhHLLL---LLLLLLLLLllhhhhhhhlllhhhlllLLLLlL
Query tspplspdpttPDYLTSLLaCGDL---QVTGSGHCPystaqkavgkdnftlipeGVNGiE  340
ident            |  |  |            |                             
Sbjct -----------PLSLKLLT-DVIGkdkVILGTDYPF------------------PLGE-L  299
DSSP  -----------HHHHHHHH-HHHLlllEELLLLLLL------------------LLLL-L


DSSP  LHHHHHHHHhlllLLLLHHHHHHHHLHHHHHHH-LLLLLLlllllllllleeeeeeeeee
Query ERMTVVWDKavatGKMDENQFVAVTSTNAAKIF-NLYPRKgriavgsdadvviwdpdklk  399
ident |               ||         ||                               
Sbjct EPGKLIESM----EEFDEETKNKLKAGNALAFLgLERKQF--------------------  335
DSSP  LLLHHHHHL----LLLLHHHHHHHHLHHHHHHHlLLHHHL--------------------


DSSP  elllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhh
Query titakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehl  459
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllllllll
Query yqrvkirnkvfglqgvsr  477
ident                   
Sbjct ------------------  335
DSSP  ------------------


No 31: Query=4b3zD Sbjct=2vc5A Z-score=16.7

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                      |      
Sbjct -------------------------------------mriplvgkdsieskdiGFTLIHE   23
DSSP  -------------------------------------llllllllllllhhhlLLEELLL


DSSP  LLLL----------------LLLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhHHHHH
Query YLQK----------------TAADDFFQGTRAALVGGTTMIIDHVVPEpgsslltSFEKW  104
ident  |                              |   |   | |  |              
Sbjct HLRVfseavrqqwphlynedEEFRNAVNEVKRAMQFGVKTIVDPTVMG-----lgRDIRF   78
DSSP  LLLLllhhhhhhlhhhllhhHHHHHHHHHHHHHHHLLLLEEEELLLLL-----llLLHHH


DSSP  HHHHHLLLLLEEEEEEELL---LLLL--------LHHHHHHHHHHLL------LLLEEEE
Query HEAADTKSCCDYSLHVDIT---SWYD--------GVREELEVLVQDK------GVNSFQV  147
ident  |               |                                          
Sbjct MEKVVKATGINLVAGTGIYiyiDLPFyflnrsidEIADLFIHDIKEGiqgtlnKAGFVXI  138
DSSP  HHHHHHLLLLEEEELEELLlllLLLHhhllllhhHHHHHHHHHHHLLllllllLLLLEEE


DSSP  ELLLLllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhh
Query YMAYKdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghals  207
ident                  |    |     |  |                            
Sbjct AADEPgitkDVEKVIRAAAIANKETKVPIITHSN--------------------------  172
DSSP  ELLLLlllhHHHHHHHHHHHHHHHHLLLEEEELL--------------------------


DSSP  llhhHHHHHHHHHHHHHHHHLL---LEEEEEE-LLHHhHHHHHHHHHhlLLEEEEELHHh
Query rpeeLEAEAVFRAITIAGRINC---PVYITKV-MSKSaADIIALARKkgPLVFGEPIAAs  263
ident                |            |          | |          |       
Sbjct ----AHNNTGLEQQRILTEEGVdpgKILIGHLgDTDN-IDYIKKIAD--KGSFIGLDRY-  224
DSSP  ----LLLLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEELLL-


DSSP  hhlllhhhhlllhhhhhhlllllLLLLlLLHHHHHHHHHHHLL--LLLLLLLLLLLlhhh
Query lgtdgthywsknwakaaafvtspPLSPdPTTPDYLTSLLACGD--LQVTGSGHCPYstaq  321
ident                           |          |   |           |      
Sbjct --------------------gldLFLPvDKRNETTLRLIKDGYsdKIMISHDYCCT----  260
DSSP  --------------------lllLLLLhHHHHHHHHHHHHLLLllLEEELLLLLLL----


DSSP  hhhhlllhHHLLL--------llLLLLLHHHHHHHHHLLLLlLLHHHHHHHHLHHHHHHH
Query kavgkdnfTLIPE--------gvNGIEERMTVVWDKAVATGkMDENQFVAVTSTNAAKIF  373
ident                          |              |   |         |  | |
Sbjct ------idWGTAKpeykpklaprWSITLIFEDTIPFLKRNG-VNEEVIATIFKENPKKFF  313
DSSP  ------llLLLLLhhhhhhhlllLLLLHHHHLHHHHHHLLL-LLHHHHHHHHLHHHHHHL


DSSP  Lllllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeellee
Query Nlyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgki  433
ident                                                             
Sbjct S-----------------------------------------------------------  314
DSSP  L-----------------------------------------------------------


DSSP  eeelleellllllllllllllllhhhhhhhhhhhhhllllllll
Query vfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                             
Sbjct --------------------------------------------  314
DSSP  --------------------------------------------


No 32: Query=4b3zD Sbjct=3k2gB Z-score=16.7

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                      |      
Sbjct --------------------------slselspchvrsgrixtvdgpipssalGHTLXHE   34
DSSP  --------------------------llllllllllllleeeelleeeehhhlLLEELLL


DSSP  LLL-------------------------------------------LLLLLLHHHHHHHH
Query YLQ-------------------------------------------KTAADDFFQGTRAA   77
ident  ||                                               |         
Sbjct HLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkhniaLDDLDLAIAEVKQF   94
DSSP  LLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleELLHHHHHHHHHHH


DSSP  HHLLEEEEEEEELLLllllhhhhhhhHHHHHHLLL---LLEEEEEEELL-------lLLL
Query LVGGTTMIIDHVVPEpgsslltsfekWHEAADTKS---CCDYSLHVDIT-------sWYD  127
ident    |   | |                        |                         
Sbjct AAVGGRSIVDPTCRG--------igrDPVKLRRISaetGVQVVXGAGYYlassxpetAAR  146
DSSP  HHLLLLEEEELLLLL--------lllLHHHHHHHHhhhLLEEEELLLLLlhhhllhhHHL


DSSP  L----HHHHHHHHHHLL------LLLEEE-EELLLLllllLLHHHHHHHHHHHHHHLLEE
Query G----VREELEVLVQDK------GVNSFQ-VYMAYKdvyqMSDSQLYEAFTFLKGLGAVI  176
ident         |                                    |  |       |   
Sbjct LsaddIADEIVAEALEGtdgtdaRIGLIGeIGVSSD-ftaEEEKSLRGAARAQVRTGLPL  205
DSSP  LlhhhHHHHHHHHHHLLllllllLLLLEEeELLLLL-llhHHHHHHHHHHHHHHHHLLLE


DSSP  EEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHHH-HLLL--EEE
Query LVHAEngdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAGR-INCP--VYI  233
ident  ||                                       |                 
Sbjct XVHLP------------------------------gWFRLAHRVLDLVEEeGADLrhTVL  235
DSSP  EELLL------------------------------lLLLLHHHHHHHHHHlLLLHhhEEE


DSSP  EEELL-HHHHHHHHHHHHhlLLEEEEE-LHHHhhlLLHHhhlllhhhhhhlllllLLLLl
Query TKVMS-KSAADIIALARKkgPLVFGEP-IAASlgtDGTHywsknwakaaafvtspPLSPd  291
ident              |         | |         |                        
Sbjct CHXNPsHXDPVYQATLAQ--RGAFLEFdXIGX---DFFY-----------adqgvQCPS-  278
DSSP  LLLHHhLLLHHHHHHHHH--HLLEEEElLLLL---LLEE-----------lllleELLL-


DSSP  lLHHHHHHHHHHH---LLLLLLLLLLLLLLhhhhhhhlllhhhllllLLLLLLHHHHHHH
Query pTTPDYLTSLLAC---GDLQVTGSGHCPYStaqkavgkdnftlipegVNGIEERMTVVWD  348
ident           ||     |                              ||          
Sbjct dDEVARAILGLADhgyLDRILLSHDVFVKX-----------xltrygGNGYAFVTKHFLP  327
DSSP  hHHHHHHHHHHHHlllHHHEEELLLLLLHH-----------hlhhhlLLLLLHHHHLHHH


DSSP  HHLlLLLLLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeellllllll
Query KAVaTGKMDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitakshks  408
ident         |         ||    |                                   
Sbjct RLR-RHGLDDAALETLXVTNPRRVFD----------------------------------  352
DSSP  HHH-HLLLLHHHHHHHHLHHHHHHHL----------------------------------


DSSP  lllllllllleeeeeeeeeeelleeeeelleelllllllllllllllLHHHhhhhhhhhh
Query aveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafPEHLyqrvkirnk  468
ident                                                             
Sbjct -----------------------------------------------ASIE---------  356
DSSP  -----------------------------------------------LLLL---------


DSSP  hllllllll
Query vfglqgvsr  477
ident          
Sbjct -------gh  358
DSSP  -------ll


No 33: Query=4b3zD Sbjct=4dlfA Z-score=16.7

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                        ||   
Sbjct ----------------------------------------------------ALRIDSHQ    8
DSSP  ----------------------------------------------------LLLEEEEE


DSSP  LlLLLL-----------------LLLHHHHHHHHHHLLEEEEEEEELLLllllHHHHHHH
Query YlQKTA-----------------ADDFFQGTRAALVGGTTMIIDHVVPEpgssLLTSFEK  103
ident                                           |                 
Sbjct H-FWRYraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQARA----GRDETAF   63
DSSP  L-LLLLlhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELLLL----LHHHHHH


DSSP  HHHHHHLLllLEEE-EEEELLLLLLLHHHHHHHHhHLLLLLEEEEELLLLL-lllLLHH-
Query WHEAADTKscCDYS-LHVDITSWYDGVREELEVLvQDKGVNSFQVYMAYKD-vyqMSDS-  160
ident   | |                       |             |              |  
Sbjct LLELACDE--ARIAaVVGWEDLRAPQLAERVAEW-RGTKLRGFRHQLQDEAdvraFVDDa  120
DSSP  HHHHHLLL--LLEEeEEELLLLLLLLHHHHHHLL-LLLLEEEEEELHHHLLlhhhHHHLh


DSSP  HHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllHHHHhHHHHHH
Query QLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpEELEaEAVFRA  220
ident         |     |  |                               |      |   
Sbjct DFARGVAWLQANDYVYDVLVF----------------------------ERQL-PDVQAF  151
DSSP  HHHHHHHHHHHLLLEEEELLL----------------------------HHHH-HHHHHH


DSSP  HHHHHhhLLLEEEEEEL----------------LHHHHHHHHHHHhhllLEEEEELHHHh
Query ITIAGriNCPVYITKVM----------------SKSAADIIALARkkgpLVFGEPIAASl  264
ident                                     |    |        |         
Sbjct CARHD--AHWLVLDHAGkpalaefdrddtalarWRAALRELAALP----HVVCKLSGLV-  204
DSSP  HHHLL--LLLEEEHHHHlllhhhllllllhhhhHHHHHHHHHLLL----LEEEEELLLL-


DSSP  hlLLHHHHLllhhhhhhlllllllllLLLHHHHHHHHHHHLL---LLLLLLLLLlllhhh
Query gtDGTHYWSknwakaaafvtspplspDPTTPDYLTSLLACGD---LQVTGSGHCpystaq  321
ident                           |                      ||         
Sbjct -tEADWRRG-------------lrasDLRHIEQCLDAALDAFgpqRLMFGSDWP------  244
DSSP  -lLLLLLLL-------------llhhHHHHHHHHHHHHHHHHlhhHEEELLLLL------


DSSP  hhhhlllhhhlllLLLL---LLLHHHHHHHHHLLllLLLHHHHHHHHLHHHHHHHLLLll
Query kavgkdnftlipeGVNG---IEERMTVVWDKAVAtgKMDENQFVAVTSTNAAKIFNLYpr  378
ident                       |    |   |            |     ||    |   
Sbjct -------------VCLLaasYDEVASLVERWAES--RLSAAERSALWGGTAARCYALP--  287
DSSP  -------------HHHHlllHHHHHHHHHHHHHH--HLLHHHHHHHLLHHHHHHLLLL--


DSSP  llllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeell
Query kgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedg  438
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  eellllllllllllllllhhhhhhhhhhhhhllllllll
Query ninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                        
Sbjct ---------------------------------------  287
DSSP  ---------------------------------------


No 34: Query=4b3zD Sbjct=1bf6A Z-score=16.7

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                      |      
Sbjct ------------------------------------------------sfdpTGYTLAHE   12
DSSP  ------------------------------------------------llllLLEEEEEE


DSSP  LLL-------------LLLLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhHHHH
Query YLQ-------------KTAADDFFQGTRAALVGGTTMIIDHVVPEpgsslltsfekWHEA  107
ident  |                      |        |    |                     
Sbjct HLHidlsgfknnvdcrLDQYAFICQEMNDLMTRGVRNVIEMTNRY--------mgrNAQF   64
DSSP  LLLeelhhhhllhhheELLHHHHHHHHHHHHHLLEEEEEELLLHH--------hllLHHH


DSSP  HHLLL---LLEEEEEEELL----LLLL-------LHHHHHHHHHHLL------LLLEEE-
Query ADTKS---CCDYSLHVDIT----SWYD-------GVREELEVLVQDK------GVNSFQ-  146
ident                                       |                     
Sbjct MLDVMretGINVVACTGYYqdafFPEHvatrsvqELAQEMVDEIEQGidgtelKAGIIAe  124
DSSP  HHHHHhhhLLEEEEEELLLlhhhLLLHhhhllhhHHHHHHHHHHHLLllllllLEEEEEe


DSSP  EELLLlllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhh
Query VYMAYkdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghal  206
ident                   |       |  |  |                           
Sbjct IGTSEgkitpLEEKVFIAAALAHNQTGRPISTHTS-------------------------  159
DSSP  EELLLllllhHHHHHHHHHHHHHHHHLLLEEEELH-------------------------


DSSP  hllhhhHHHHHHHHHHHHHH-HLLL--EEEEEE-LLHHhHHHHHHHHHhlLLEEEEELHH
Query srpeelEAEAVFRAITIAGR-INCP--VYITKV-MSKSaADIIALARKkgPLVFGEPIAA  262
ident                            |            | |                 
Sbjct ------FSTMGLEQLALLQAhGVDLsrVTVGHCdLKDN-LDNILKMID--LGAYVQFDTI  210
DSSP  ------HHLLHHHHHHHHHHlLLLHhhEEELLLlLLLL-HHHHHHHHH--LLLEEEELLL


DSSP  hhHLLLhhhhlllhhhhhhllllllllllllHHHHHHHHHHHL------lLLLLLLLLLL
Query slGTDGthywsknwakaaafvtspplspdptTPDYLTSLLACG------dLQVTGSGHCP  316
ident   |                                    |                    
Sbjct --GKNS-----------------------yyPDEKRIAMLHALrdrgllnRVMLSMDITR  245
DSSP  --LLLL-----------------------llLHHHHHHHHHHHhhlllhhHEEELLLLLL


DSSP  LLhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLLLLlLLHHHHHHHHLHHHHHHHLll
Query YStaqkavgkdnftlipegvNGIEERMTVVWDKAVATGkMDENQFVAVTSTNAAKIFNly  376
ident  |                   |     |         |             |    |   
Sbjct RS-----------hlkanggYGYDYLLTTFIPQLRQSG-FSQADVDVMLRENPSQFFQ--  291
DSSP  HH-----------hlhhhllLLLLHHHHLHHHHHHHLL-LLHHHHHHHHLHHHHHHLL--


DSSP  llllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeee
Query prkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfe  436
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  lleellllllllllllllllhhhhhhhhhhhhhllllllll
Query dgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                          
Sbjct -----------------------------------------  291
DSSP  -----------------------------------------


No 35: Query=4b3zD Sbjct=4hk5D Z-score=16.6

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
ident                                                     |   |  |
Sbjct ---------------------------------------------------TPVVVDIHT    9
DSSP  ---------------------------------------------------LLLLEEEEE


DSSP  LLLL----------------------------------------------------LLLL
Query YLQK----------------------------------------------------TAAD   68
ident                                                             
Sbjct HMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpLSTH   69
DSSP  EELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleeLLHH


DSSP  --LHHHHHHHHHHLLEEEEEEEE---LLLLL------LLHHHHHHHHHHHHHLLlllEEE
Query --DFFQGTRAALVGGTTMIIDHV---VPEPG------SSLLTSFEKWHEAADTKsccDYS  117
ident      |        |                                             
Sbjct faSLAQKMHFMDTNGIRVSVISLanpWFDFLapdeapGIADAVNAEFSDMCAQH-vgRLF  128
DSSP  hlLHHHHHHHHHHLLLLEEEEEElllLLLLLllllhhHHHHHHHHHHHHHHHLL-llLEE


DSSP  EEEELLLLLL--LHHHHHHHHHHLLLLLEEEEELlllllLLLL----HHHHHHHHHHHHH
Query LHVDITSWYD--GVREELEVLVQDKGVNSFQVYMaykdvYQMS----DSQLYEAFTFLKG  171
ident              |    |     |                      |  |   |     
Sbjct FFAALPLSAPvdAVKASIERVKNLKYCRGIILGT-----SGLGkgldDPHLLPVFEAVAD  183
DSSP  EEEELLLLLLhhHHHHHHHHHHLLLLEEEEEELL-----LLLLllllLHHHHHHHHHHHH


DSSP  HLLEEEEELLLhhHHHHhhHHHHhLLLLLLHhHHHH---LLHHHHHHHHHHHH--HHHHH
Query LGAVILVHAENgdLIAQeqKRILeMGITGPEgHALS---RPEELEAEAVFRAI--TIAGR  226
ident        |                        | |            || |         
Sbjct AKLLVFLHPHY--GLPN--EVYG-PRSEEYG-HVLPlalGFPMETTIAVARMYmaGVFDH  237
DSSP  LLLEEEELLLL--LLLH--HHHL-LLHHHLL-LHHHhhlHHHHHHHHHHHHHHhlLHHHH


DSSP  HL-LLEEEEEELLhHHHHH-----------------------hhHHHHH-lLLEEEEElh
Query IN-CPVYITKVMSkSAADI-----------------------iaLARKK-gPLVFGEPia  261
ident                                                             
Sbjct VRnLQMLLAHSGG-TLPFLagriescivhdghlvktgkvpkdrrTIWTVlkEQIYLDA--  294
DSSP  LLlLLEEEHHHHL-LHHHHhhhhhhhhhllhhhhhlllllllllLHHHHhhHLEEEEL--


DSSP  HHHHlllhhhhlllhhhhhhllllllllllllhhHHHHHHHHHLL---LLLLLLLLLlll
Query ASLGtdgthywsknwakaaafvtspplspdpttpDYLTSLLACGD---LQVTGSGHCpys  318
ident                                                     |  |    
Sbjct VIYS------------------------------EVGLQAAIASSgadRLMFGTDHP---  321
DSSP  LLLL------------------------------HHHHHHHHHHHlhhHEELLLLLL---


DSSP  hhhhhhhlllhhhlllLLLL-------lLLHHHHHHHHHLllLLLL--HHHHHHHHLHHH
Query taqkavgkdnftlipeGVNG-------iEERMTVVWDKAVatGKMD--ENQFVAVTSTNA  369
ident                                                      ||   ||
Sbjct ----------------FFPPieedvqgpWDSSRLNAQAVI--KAVGegSSDAAAVMGLNA  363
DSSP  ----------------LLLLllllllllLHHHHHHHHHHH--HHHLllLHHHHHHHLHHH


DSSP  HHHHLLLLLLlllllLLLLleeeeeeeeeeelllllllllllllllllleeeeeeeeeee
Query AKIFNLYPRKgriavGSDAdvviwdpdklktitakshksaveynifegmechgsplvvis  429
ident      |                                                      
Sbjct VRVLSLKAEL-----EHHH-----------------------------------------  377
DSSP  HHHLLLHHHH-----HHHH-----------------------------------------


DSSP  lleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll
Query qgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                                 
Sbjct ---------------------------------------------hhh  380
DSSP  ---------------------------------------------hhl


No 36: Query=4b3zD Sbjct=2ffiA Z-score=16.5

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                        ||   
Sbjct --------------------------------------------------lhLTAIDSHA   10
DSSP  --------------------------------------------------llLLLEELLL


DSSP  LLLLL-------------LLLLHHHHHHHHHHLLEEEEEEEE--LLLLlllhhhHHHHHH
Query YLQKT-------------AADDFFQGTRAALVGGTTMIIDHV--VPEPgsslltSFEKWH  105
ident                                  |                          
Sbjct HVFSRglnlasqrryapnYDAPLGDYLGQLRAHGFSHGVLVQpsFLGT------DNRYLL   64
DSSP  LLLLHhhhhhllllllllLLLLHHHHHHHHHHLLLLEELLLLlhHHLL------LLHHHH


DSSP  HHHHLLlllEEEEEEElLLLLlLHHHHHHHHHHlLLLLEEEEELLLLLllLLLH--HHHH
Query EAADTKsccDYSLHVDiTSWYdGVREELEVLVQdKGVNSFQVYMAYKDvyQMSD--SQLY  163
ident  |  |         |            |       ||          |         |  
Sbjct SALQTV-pgQLRGVVX-LERD-VEQATLAEXAR-LGVRGVRLNLXGQD--XPDLtgAQWR  118
DSSP  HHHHHL-llLLLLLLL-LLLL-LLHHHHHHHHL-LLLLEEELLLLLLL--LLLLllLLLH


DSSP  HHHHHHHHHLLEEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHH
Query EAFTFLKGLGAVILVHAengdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITI  223
ident          |     |                                            
Sbjct PLLERIGEQGWHVELHR--------------------------------QVADIPVLVRA  146
DSSP  HHHHHHHHHLLEEEELL--------------------------------LLLLHHHHHHH


DSSP  HHHHLLLEEEEE-ELLH-------HHHHHHHHHhHHLLLEEEEELHHHhhlllhhhhlll
Query AGRINCPVYITK-VMSK-------SAADIIALArKKGPLVFGEPIAASlgtdgthywskn  275
ident          |                             |                    
Sbjct LQPYGLDIVIDHfGRPDarrglgqPGFAELLTL-SGRGKVWVKVSGIY------------  193
DSSP  HLLLLLLEEELHhHLLLlllllllLLHHHHLLL-LLLLLEEEEEELHH------------


DSSP  hhhhhhlllllLLLLL----lLHHHHHHHHHHHLL---lLLLLLLLLlllhhhhhhhlll
Query wakaaafvtspPLSPD----pTTPDYLTSLLACGD---lQVTGSGHCpystaqkavgkdn  328
ident             |                 |           ||                
Sbjct -----------RLQGSpeenlAFARQALCALEAHYgaerLXWGSDWP-------------  229
DSSP  -----------HLLLLhhhhhHHHHHHHHHHHHHLlhhhEEEELLLL-------------


DSSP  hhhlLLLL--LLLLLHHHHHHHHHLlllllLHHHHHHHHLHHHHHHHLLLLLllllllll
Query ftliPEGV--NGIEERMTVVWDKAVatgkmDENQFVAVTSTNAAKIFNLYPRkgriavgs  386
ident                                     |     |   |             
Sbjct ---hTQHEseVSFGSAVEQFEALGC-----SAQLRQALLLDTARALFGFELE--------  273
DSSP  ---lLLLLllLLHHHHHHHHHHHLL-----LHHHHHHHHLHHHHHHLLLLLL--------


DSSP  llleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllll
Query dadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgm  446
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhhhhllllllll
Query grfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                
Sbjct -------------------------------  273
DSSP  -------------------------------


No 37: Query=4b3zD Sbjct=2y1hB Z-score=16.3

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
ident                                                      |  |   
Sbjct ---------------------------------------------------GVGLVDCHC    9
DSSP  ---------------------------------------------------LLLEEEEEE


DSSP  LLLL--lLLLLhHHHHHHHHHLLEEEEEEEELLlllllhHHHHHHHHHHHHLLLllEEEE
Query YLQK--tAADDfFQGTRAALVGGTTMIIDHVVPepgsslLTSFEKWHEAADTKSccDYSL  118
ident  |       |        |                       |||               
Sbjct HLSApdfDRDL-DDVLEKAKKANVVALVAVAEH------SGEFEKIMQLSERYN-gFVLP   61
DSSP  LLLLhhhLLLH-HHHHHHHHHLLEEEEEELLLL------HHHHHHHHHHHHHLL-lLEEE


DSSP  EEELL-------------LLLLlHHHHHHHHHhlLLLLEE-EEELL-LLLL------llL
Query HVDIT-------------SWYDgVREELEVLVqdKGVNSF-QVYMA-YKDV------yqM  157
ident                             |             |                 
Sbjct CLGVHpvqgldqrsvtlkDLDV-ALPIIENYK--DRLLAIgEVGLDfSPRFagtgeqkeE  118
DSSP  EELLLleelllleellhhHHHH-HHHHHHHHL--LLLLEEeEEEEElLLLLlllhhhhhH


DSSP  LHHHHHHHHHHHHHHLLEEEEELLLhhhhhhhhhhhhhllllllhhhhhhllhhhhhhHH
Query SDSQLYEAFTFLKGLGAVILVHAENgdliaqeqkrilemgitgpeghalsrpeeleaeAV  217
ident     |       | |     ||                                    | 
Sbjct QRQVLIRQIQLAKRLNLPVNVHSRS---------------------------------AG  145
DSSP  HHHHHHHHHHHHHHHLLLEEEEEEL---------------------------------LH


DSSP  HHHHHHHHHHLLL-EEEEEELLHhhHHHHHHHHHhlLLEEEEELHHhHHLLlhhhhlllh
Query FRAITIAGRINCP-VYITKVMSKsaADIIALARKkgPLVFGEPIAAsLGTDgthywsknw  276
ident    |          |                        |                    
Sbjct RPTINLLQEQGAEkVLLHAFDGR--PSVAMEGVR--AGYFFSIPPS-IIRS---------  191
DSSP  HHHHHHHHHLLLLlEEEELLLLL--HHHHHHHHH--LLLEEEELHH-HHLL---------


DSSP  hhhhhlllllllllllLHHHHHHHHHhHLLLLLLLLLLLlllhhhhhhhlllhhhllLLL
Query akaaafvtspplspdpTTPDYLTSLLaCGDLQVTGSGHCpystaqkavgkdnftlipEGV  336
ident                      |   |                                  
Sbjct ----------------GQKQKLVKQL-PLTSICLETDSP------------algpekQVR  222
DSSP  ----------------HHHHHHHHHL-LHHHEEELLLLL------------llllllLLL


DSSP  LLLLLHHHHHHhHHLLLLLLL-HHHHHHHhLHHHHHHHL-LLLLLlllllllllleeeee
Query NGIEERMTVVWdKAVATGKMD-ENQFVAVtSTNAAKIFN-LYPRKgriavgsdadvviwd  394
ident |                     |         || | |  |                   
Sbjct NEPWNISISAE-YIAQVKGISvEEVIEVT-TQNALKLFPkLRHLL---------------  265
DSSP  LLHHHHHHHHH-HHHHHHLLLhHHHHHHH-HHHHHHHLLlHHHHL---------------


DSSP  eeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllll
Query pdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprka  454
ident                                                             
Sbjct ------------------------------------------------------------  265
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhllllllll
Query fpehlyqrvkirnkvfglqgvsr  477
ident                        
Sbjct -----------------------  265
DSSP  -----------------------


No 38: Query=4b3zD Sbjct=2qpxA Z-score=16.3

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllLEEE--ELEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangRMVI--PGGIDV   58
ident                                                           | 
Sbjct -------------------------------------------gxddlSEFVdqVPLLDH   17
DSSP  -------------------------------------------lllllHHHHhhLLEEEE


DSSP  EELLLLLLL---------------------------------------------------
Query NTYLQKTAA---------------------------------------------------   67
ident                                                             
Sbjct HCHFLIDGKvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaax   77
DSSP  EELLLLLLLlllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhlllllllllll


DSSP  ---llhHHHHHHHHHLLEEEEEEEELLlllllhhhhhhHHHHHHHLLLLLEEEEEEEL-L
Query ---ddfFQGTRAALVGGTTMIIDHVVPepgsslltsfeKWHEAADTKSCCDYSLHVDI-T  123
ident           |                                                |
Sbjct ndpgyaTYNHRIFGHFHFKELLIDTGF-----vpddpiLDLDQTAELVGIPVKAIYRLeT  132
DSSP  lhhhhhHHHHHHHHHLLEEEEEEELLL-----llllllLLHHHHHHHHLLLEEEEEEHhH


DSSP  LLL-------------LLHHHHHHHHHHlLLLLEEEEELLLL------------------
Query SWY-------------DGVREELEVLVQdKGVNSFQVYMAYK------------------  152
ident                               |   |    ||                   
Sbjct HAEdfxlehdnfaawwQAFSNDVKQAKA-HGFVGFXSIAAYRvglhlepvnvieaaagfd  191
DSSP  HHHhhhlllllhhhhhHHHHHHHHLLLL-LLLLLEEELHHHHlllllllllhhhhhhhhh


DSSP  ----------lllllLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllh
Query ----------dvyqmSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpe  202
ident                 |  ||    |          |                       
Sbjct twkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVG---------------------  230
DSSP  hhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEEL---------------------


DSSP  hhHHHLLHHHHHhhHHHHHHHHHHHL---LLEEEEEELLhhHHHHHHHHHHHLLLEEEEE
Query ghALSRPEELEAeaVFRAITIAGRIN---CPVYITKVMSksAADIIALARKKGPLVFGEP  259
ident          |                     |                     |      
Sbjct ygDADTDXYLGN--PLLXRDYLKAFTkkgLKVVLLHCYP--YHREAGYLASVFPNLYFDI  286
DSSP  llLLLLLHHHLL--HHHHHHHHHHHHhhlLLEEEEELLL--LHHHHHHHHHHLLLEEEEL


DSSP  L--HHHHHLllhhhhlllhhhhhhllllllllllllHHHHHHHHHHH---LLLLLLLLLL
Query I--AASLGTdgthywsknwakaaafvtspplspdptTPDYLTSLLAC---GDLQVTGSGH  314
ident                                                          |  
Sbjct SllDNLGPS---------------------------GASRVFNEAVElapYTRILFASDA  319
DSSP  LlhHHHLHH---------------------------HHHHHHHHHLLlllHHHEELLLLL


DSSP  LLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLLLL--------llLHHHHHHHHL
Query CPystaqkavgkdnftlipegvNGIEERMTVVWDKAVATG--------kmDENQFVAVTS  366
ident                                     ||                  |   
Sbjct ST------------------ypEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICW  361
DSSP  LL------------------lhHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHL


DSSP  HHHHHHHLLLlLLLLLllllllleeeeeeeeeeelllllllllllllllllleeeeeeee
Query TNAAKIFNLYpRKGRIavgsdadvviwdpdklktitakshksaveynifegmechgsplv  426
ident    ||      |  |                                             
Sbjct QTSAKLYHQE-RELRV--------------------------------------------  376
DSSP  HHHHHHLLLH-HHHLL--------------------------------------------


DSSP  eeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll
Query visqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                                    
Sbjct ---------------------------------------------------  376
DSSP  ---------------------------------------------------


No 39: Query=4b3zD Sbjct=4qrnA Z-score=16.2

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeellllEEEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrMVIPGGIDVNT   60
ident                                                        |    
Sbjct ---------------------------------------smtqdlktggEQGYLRIATEE   21
DSSP  ---------------------------------------llllllllllLLLLLLEEEEE


DSSP  LLLLL-------------------------------------LLLL---HHHHHHHHHHL
Query YLQKT-------------------------------------AADD---FFQGTRAALVG   80
ident                                                             
Sbjct AFATReiidvylrmirdgtadkgmvslwgfyaqspseratqiLERLldlGERRIADMDAT   81
DSSP  EELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhHHHHhllLHHHHHHHHHL


DSSP  LEEEEEEEEL----------lLLLLLHHHHHHHHHHHHHLLllLEEEEEEELLLLL-LLH
Query GTTMIIDHVV----------pEPGSSLLTSFEKWHEAADTKscCDYSLHVDITSWY-DGV  129
ident |    |               |              |                       
Sbjct GIDKAILALTspgvqplhdldEARTLATRANDTLADACQKY-pDRFIGMGTVAPQDpEWS  140
DSSP  LLLEEEEEELlllllllllhhHHHHHHHHHHHHHHHHHHHL-lLLEEELLLLLLLLhHHH


DSSP  HHHHHHHHHLLLLLEEEEELLLLLllLLLHHHHHHHHHHHHHHLLEEEEELLlhhHHHHH
Query REELEVLVQDKGVNSFQVYMAYKDvyQMSDSQLYEAFTFLKGLGAVILVHAEngdLIAQE  189
ident   |        |    |                   |  |         |          
Sbjct AREIHRGARELGFKGIQINSHTQG-rYLDEEFFDPIFRALVEVDQPLYIHPA--tSPDSM  197
DSSP  HHHHHHHHHLLLLLLEEELLLLLL-lLLLLHHHHHHHHHHHHHLLLEEELLL--lLLLLL


DSSP  HHHHhhlllllLHHHH-hhLLHHHHHHHHHHHH--HHHHHHL-LLEEEEEELLhHHHH--
Query QKRIlemgitgPEGHA-lsRPEELEAEAVFRAI--TIAGRIN-CPVYITKVMSkSAAD--  243
ident                               | |   |                       
Sbjct IDPM-----leAGLDGaifGFGVETGMHLLRLItiGIFDKYPsLQIMVGHMGE-ALPYwl  251
DSSP  LHHH-----hhHLLLLlllHHHHHHHHHHHHHHhhLHHHHLLlLLEEELHHHH-LHHHhh


DSSP  ------------------------hhHHHHHhlLLEEEEELhHHHHlllhhhhlllhhhh
Query ------------------------iiALARKkgPLVFGEPIaASLGtdgthywsknwaka  279
ident                               |    |                        
Sbjct yrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW--------------  294
DSSP  hhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL--------------


DSSP  hhllllllllllllhHHHHHHHhHHLL---LLLLLLLLLlllhhhhhhhlllhhhlllLL
Query aafvtspplspdpttPDYLTSLlACGD---LQVTGSGHCpystaqkavgkdnftlipeGV  336
ident                                                             
Sbjct ---------------EPAIKFC-QQVMgedRVMYAMDYP-------------------YQ  319
DSSP  ---------------HHHHHHH-HHHHlhhHEELLLLLL-------------------LL


DSSP  LLlLLHHHHHHHHhllllLLLHHHHHHHHLHHHHHHHLLlllllllllllllleeeeeee
Query NGiEERMTVVWDKavatgKMDENQFVAVTSTNAAKIFNLyprkgriavgsdadvviwdpd  396
ident                    |          ||| | | |                     
Sbjct YV-ADEVRAMDAM-----DMSAQTKKKFFQTNAEKWFKL---------------------  352
DSSP  LL-HHHHHHHHLL-----LLLHHHHHHHHLHHHHHHLLL---------------------


DSSP  eeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllll
Query klktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafp  456
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhllllllll
Query ehlyqrvkirnkvfglqgvsr  477
ident                      
Sbjct ---------------------  352
DSSP  ---------------------


No 40: Query=4b3zD Sbjct=1itqA Z-score=15.6

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleEEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmVIPGGIDVNT   60
ident                                                        ||   
Sbjct ---------------------------------------dffrdeaerimRDSPVIDGHN   21
DSSP  ---------------------------------------lhhhhhhhhhhLLLLEEEEEE


DSSP  LLLL-------------------LLLLlhhHHHH-HHHHLLEEEEEEEELLL-------L
Query YLQK-------------------TAADdffQGTR-AALVGGTTMIIDHVVPE-------P   93
ident  |                      |              |        |           
Sbjct DLPWqlldmfnnrlqderanlttLAGT---HTNIpKLRAGFVGGQFWSVYTPcdtqnkdA   78
DSSP  LHHHhhhhhhllllllhhhllllLLLL---LLLHhHHHHLLEEEEEEEELLLhhhllllH


DSSP  LLLHHHHHHHHHHHHHLL-------------------lLLEEEEEEE-LLLLLllHHHHH
Query GSSLLTSFEKWHEAADTK-------------------sCCDYSLHVD-ITSWYdgVREEL  133
ident     |      |                                 |    |        |
Sbjct VRRTLEQMDVVHRMCRMYpetflyvtssagirqafregKVASLIGVEgGHSID-sSLGVL  137
DSSP  HHHHHHHHHHHHHHHHHLllleeelllhhhhhhhhhllLEEEEEEEElHHHLL-lLHHHH


DSSP  HHHHHlLLLLEEEEELLLllllLLLH-------------------HHHHHHHHHHHHHLL
Query EVLVQdKGVNSFQVYMAYkdvyQMSD-------------------SQLYEAFTFLKGLGA  174
ident   | |  |                                              |  || 
Sbjct RALYQ-LGMRYLTLTHSC----NTPWadnwlvdtgdsepqsqglsPFGQRVVKELNRLGV  192
DSSP  HHHHH-LLEEEEELLLLL----LLLLlllhhhlllllllllllllHHHHHHHHHHHHHLL


DSSP  EEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhhhhHHHHHHHHHHHH-LLLEEE
Query VILVHAengdliaqeqkrilemgitgpeghalsrpeeleaeAVFRAITIAGRI-NCPVYI  233
ident  |                                                      ||  
Sbjct LIDLAH-----------------------------------VSVATMKATLQLsRAPVIF  217
DSSP  EEELLL-----------------------------------LLHHHHHHHHHHlLLLLEE


DSSP  EEELLHH-------HHHHHHHHHhhLLLEEEEELHHhhhLLLHHHhlllhhhhhhlllll
Query TKVMSKS-------AADIIALARkkGPLVFGEPIAAslgTDGTHYwsknwakaaafvtsp  286
ident       |         |                         |                 
Sbjct SHSSAYSvcasrrnVPDDVLRLV-kQTDSLVMVNFYnnyISCTNK---------------  261
DSSP  LLLLLLLlllllllLLHHHHHHH-hHHLLEEEELLLhhhHLLLLL---------------


DSSP  lllllllHHHHHHHHHHHLL---LLLLLLLLLlllhhhhhhhlllhhhllLLLL-----L
Query plspdptTPDYLTSLLACGD---LQVTGSGHCpystaqkavgkdnftlipEGVN-----G  338
ident                            |                                
Sbjct ---anlsQVADHLDHIKEVAgarAVGFGGDFD-----------------gVPRVpegleD  301
DSSP  ---llhhHHHHHHHHHHHHLlhhHEEELLLLL-----------------lLLLLlllllL


DSSP  LLLhHHHHHHHHLLLLlLLHHHHHHHHLHHHHHHHlllllllllllllllleeeeeeeee
Query IEErMTVVWDKAVATGkMDENQFVAVTSTNAAKIFnlyprkgriavgsdadvviwdpdkl  398
ident                    |         |    |                         
Sbjct VSK-YPDLIAELLRRN-WTEAEVKGALADNLLRVF-------------------------  334
DSSP  LLL-HHHHHHHHHHLL-LLHHHHHHHHLHHHHHHH-------------------------


DSSP  eelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllHH
Query ktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpEH  458
ident                                                           | 
Sbjct ----------------------------------------------------------EA  336
DSSP  ----------------------------------------------------------HH


DSSP  HHHHHH--------------hhhhhllllllll
Query LYQRVK--------------irnkvfglqgvsr  477
ident   |                              
Sbjct VEQASNltqapeeepipldqlggscrthygyss  369
DSSP  HHHLLLlllllllllllhhhlllllllllllll


No 41: Query=4b3zD Sbjct=4dziC Z-score=15.4

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeellllEEEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrMVIPGGIDVNT   60
ident                                                        |||  
Sbjct -------------------------------------------------ALNYRVIDVDN   11
DSSP  -------------------------------------------------LLLLLEEEEEE


DSSP  LLLL--------------------------------------------------------
Query YLQK--------------------------------------------------------   64
ident                                                             
Sbjct HYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldll   71
DSSP  ELLLllllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhh


DSSP  ---------------------LLLL--LHHHHHHHHHHLLEEEEEEEE------------
Query ---------------------TAAD--DFFQGTRAALVGGTTMIIDHV------------   89
ident                                                             
Sbjct frgeipdgvdpaslmkverlaDHPEyqNRDARIAVMDEQDIETAFMLPtfgcgveealkh  131
DSSP  hhllllllllhhhllleelhhHLHHhlLHHHHHHHHHHHLEEEEEEELlhhhhhhhhlll


DSSP  -llLLLLLHHHHHHHHHHHH-hllllLEEEEEEELLLLL-LLHHHHHHHHHHlLLLLEEE
Query -vpEPGSSLLTSFEKWHEAA-dtkscCDYSLHVDITSWY-DGVREELEVLVQdKGVNSFQ  146
ident        |         |                          ||        |     
Sbjct dieATMASVHAFNLWLDEDWgfdrpdHRIIAAPIVSLADpTRAVEEVDFVLA-RGAKLVL  190
DSSP  lhhHHHHHHHHHHHHHHHHLllllllLLEEELLLLLLLLhHHHHHHHHHHHH-LLLLLEE


DSSP  EELlllllLLLL---------HHHHHHHHHHHHHHLLEEEEELLLHHhHHHHHHHHHHll
Query VYMaykdvYQMS---------DSQLYEAFTFLKGLGAVILVHAENGDlIAQEQKRILEmg  197
ident |                    |         |   |     |                  
Sbjct VRP-----APVPglvkprslgDRSHDPVWARLAEAGVPVGFHLSDSG-YLHIAAAWGG--  242
DSSP  LLL-----LLLLlllllllllLHHHHHHHHHHHHHLLLEEEELLLLL-LHHHHHHLLL--


DSSP  lLLLHHHHHHLLHHHHHHHHHHHH--HHHHHHL-LLEEEEEELLhHHHHHHHH-------
Query iTGPEGHALSRPEELEAEAVFRAI--TIAGRIN-CPVYITKVMSkSAADIIAL-------  247
ident                        |      |            |                
Sbjct -AKDPLDQVLLDDRAIHDTMASMIvhGVFTRHPkLKAVSIENGS-YFVHRLIKrlkkaan  300
DSSP  -LLLHHHHHHHLLHHHHHHHHHHHhlLHHHHLLlLLEEEELLLL-LHHHHHHHhhhhhhh


DSSP  -------hhHHLL---LEEEEElhhHHHLllhhhhlllhhhhhhllllllllllllhhhh
Query -------arKKGP---LVFGEPiaaSLGTdgthywsknwakaaafvtspplspdpttpdy  297
ident                  |   |                                      
Sbjct tqpqyfpedPVEQlrnNVWIAP---YYED-------------------------------  326
DSSP  hlhhhllllHHHHhhhHEEELL---LLLL-------------------------------


DSSP  HHHHHHHLL---LLLLLLLLLLllhhhhhhhlllhhhlllLLLLllLHHHhHHHHHLlll
Query LTSLLACGD---LQVTGSGHCPystaqkavgkdnftlipeGVNGieERMTvVWDKAVatg  354
ident     ||          ||                      |                   
Sbjct DLPELARVIgvdKILFGSDWPH------------------GEGL-aSPVS-FTAELK---  363
DSSP  LHHHHHHHHlhhHLLLLLLLLL------------------LLLL-lLHHH-HHHHHL---


DSSP  LLLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeellllllllllllll
Query KMDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitakshksaveyni  414
ident    |         ||                                             
Sbjct GFSESDIRKIMRDNALDLLG----------------------------------------  383
DSSP  LLLHHHHHHHHLHHHHHHHL----------------------------------------


DSSP  lllleeeeeeeeeeelleeeeelleellllllllllllllllhhHHHHhhhhhhhlllll
Query fegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehLYQRvkirnkvfglqg  474
ident                                                             
Sbjct --------------------------------------------VQVG------------  387
DSSP  --------------------------------------------LLLL------------


DSSP  lll
Query vsr  477
ident    
Sbjct --s  388
DSSP  --l


No 42: Query=4b3zD Sbjct=2imrA Z-score=15.4

back to top
DSSP  -LEEEeEEEE-EELLLlEEEEEEEEELLEEEEE--ELLL--LLLLlLEEEELlLLEEEEL
Query -DRLLiKGGR-IINDDqSLYADVYLEDGLIKQI--GENL--IVPGgVKTIEAnGRMVIPG   54
ident     |                 |               |    |       | |    | 
Sbjct hTPRL-LTCDvLYTGA-QSPGGVVVVGETVAAAghPDELrrQYPH-AAEERA-GAVIAPP   56
DSSP  lLEEE-EEELeEELLE-ELLEEEEEELLEEEEEelHHHHhhHLLL-LEEEEL-LLEELLL


DSSP  EEEEEELLLL--------------------LLLL----LHHHHHHHHHHLLEEEEEEEEL
Query GIDVNTYLQK--------------------TAAD----DFFQGTRAALVGGTTMIIDHVV   90
ident      | |                                  |       |     | | 
Sbjct PVNAHTHLDMsayefqalpyfqwipevvirGRHLrgvaAAQAGADTLTRLGAGGVGDIVW  116
DSSP  LLEEEEELLLlhhhhhhlhhhhllhhhhhhHLLLlhhhHHHHHHHHHHHLLLLLEEEEEL


DSSP  llllllhhhHHHHHHHhHHLLLLLEEEEEEELLL----lLLLHHHHHHHHHHLLL-----
Query pepgsslltSFEKWHEaADTKSCCDYSLHVDITS----wYDGVREELEVLVQDKG-----  141
ident            |               |            | |                 
Sbjct ---------APEVMDA-LLAREDLSGTLYFEVLNpfpdkADEVFAAARTHLERWRrlerp  166
DSSP  ---------LHHHHHH-HHLLLLLLEEEEEEELLllhhhHHHHHHHHHHHHHHHHlllll


DSSP  --LLEEE-EELLlllllLLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhlll
Query --VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgi  198
ident                    |            | |     |                   
Sbjct glRLGLSpHTPF-----TVSHRLMRLLSDYAAGEGLPLQIHVA-----------------  204
DSSP  leEEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLLEEEEL-----------------


DSSP  lllhhhhhhllHHHH----------------------------------hHHHHHHH-HH
Query tgpeghalsrpEELE----------------------------------aEAVFRAI-TI  223
ident                                                     |       
Sbjct ---------ehPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLG  255
DSSP  ---------llHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHL


DSSP  HHhhLLLEEEEEELLhhHHHHHHHHHHhLLLEEEEELHHHHHLllhhhhlllhhhhhhll
Query AGriNCPVYITKVMSksAADIIALARKkGPLVFGEPIAASLGTdgthywsknwakaaafv  283
ident                                        |                    
Sbjct VL--AARPTLVHMVN--VTPDDIARVA-RAGCAVVTCPRSNHH-----------------  293
DSSP  LH--HHLLEEEELLL--LLHHHHHHHH-HHLLLEEELHHHHHH-----------------


DSSP  llLLLLllllhhhhHHHHHHH-LLLLLLLLLLLLllhhhhhhhlllhhhlllLLLLLlLH
Query tsPPLSpdpttpdyLTSLLAC-GDLQVTGSGHCPystaqkavgkdnftlipeGVNGIeER  342
ident                    |  |     |                               
Sbjct --LECG------tfDWPAFAAaGVEVALGTDSVA------------------SGETL-NV  326
DSSP  --LLLL------llLHHHHHHlLLLEEELLLLHH------------------HHLLL-LL


DSSP  HHHHHHhHLLL-LLLLHHHHHHHHLHHHHHHHLlllllLLLLL-LLLL-lEEEEeeeeee
Query MTVVWDkAVAT-GKMDENQFVAVTSTNAAKIFNlyprkGRIAV-GSDA-dVVIWdpdklk  399
ident    |   |       |    |                       |        |      
Sbjct REEVTF-ARQLyPGLDPRVLVRAAVKGGQRVVG-----TPFLRrGETWqeGFRW------  374
DSSP  HHHHHH-HHHHlLLLLHHHHHHHHHHHHHHHHL-----LLLLLlLLLLlhHHLH------


DSSP  elllllllllllllllllleeeeeEEEEeelleeeeelleellllllllllllllllhhh
Query titakshksaveynifegmechgsPLVVisqgkivfedgninvnkgmgrfiprkafpehl  459
ident                          |                                  
Sbjct ------------------------ELSR--------------------------------  378
DSSP  ------------------------HHLL--------------------------------


DSSP  hhhhhhhhhhllllllll
Query yqrvkirnkvfglqgvsr  477
ident                   
Sbjct ----------------dl  380
DSSP  ----------------ll


No 43: Query=4b3zD Sbjct=4mupB Z-score=15.1

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeellllEEEEL-EEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrMVIPG-GIDVN   59
ident                                                     |    |  
Sbjct --------------------------------------lvrklsgtapnPAFPRgAVDTQ   22
DSSP  --------------------------------------lllllllllllLLLLLlLEELL


DSSP  ELLL-------------LLLL-LLHHHHHHHHHHLLEEEEEEEE--LLLLlllHHHHHHH
Query TYLQ-------------KTAA-DDFFQGTRAALVGGTTMIIDHV--VPEPgssLLTSFEK  103
ident                     |        |     |    |                   
Sbjct MHMYlpgypalpggpglPPGAlPGPEDYRRLMQWLGIDRVIITQgnAHQR---DNGNTLA   79
DSSP  LLLLlllllllllllllLLLLlLLHHHHHHHHHHHLLLEEEEELlhHHLL---LLHHHHH


DSSP  HHHHHHlllllEEEEEEELllLLLLHHHHHHHHHHlLLLLEEEEELLLLllLLLLhhHHH
Query WHEAADtksccDYSLHVDItsWYDGVREELEVLVQdKGVNSFQVYMAYKdvYQMSdsQLY  163
ident                 | |           | |    |                |   | 
Sbjct CVAEMG----eAAHAVVII--DATTTEKDMEKLTA-AGTVGARIMDLPGgaVNLS--ELD  130
DSSP  HHHHHH----hHEEEEELL--LLLLLHHHHHHHHH-LLEEEEEEELLLLllLLHH--HHH


DSSP  HHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllHHHHHHHhHHHHHH
Query EAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpEELEAEAvFRAITI  223
ident               |                                             
Sbjct AVDERAHAADWMVAVQFD----------------------------GNGLLDH-LPRLQK  161
DSSP  HHHHHHHHLLLEEEEELL----------------------------HHHHHHH-HHHHHL


DSSP  HhhhLLLEEEEE-ELLH-------hHHHHHHHHHHhLLLEEEEeLHHHhhlllhhhhlll
Query AgriNCPVYITK-VMSK-------sAADIIALARKkGPLVFGEpIAASlgtdgthywskn  275
ident                                              |              
Sbjct I---RSRWVFDHhGKFFkgirtdgpEMAALLKLID-RGNLWFK-FAGV------------  204
DSSP  L---LLEEEELHhHHLLlllllllhHHHHHHHHHH-HLLEEEE-ELLH------------


DSSP  hhhhhhlllllLLLLL----LLHHHHHHHHHHHL-lLLLLLLLLLL--LLHHHHhhhlll
Query wakaaafvtspPLSPD----PTTPDYLTSLLACG-dLQVTGSGHCP--YSTAQKavgkdn  328
ident              |                 |      | |                   
Sbjct ----------yESSRKswpyADVAAFSRVIAAHApeRIVWGTNWPHnsVRETAA------  248
DSSP  ----------hHLLLLllllHHHHHHHHHHHHHLhhHEEELLLLLLllLLLHHH------


DSSP  hhhlllllllLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHHLLLLLllllllllll
Query ftlipegvngIEERMTVVWDKAvatgkMDENQFVAVTSTNAAKIFNLYPRkgriavgsda  388
ident                             ||         |    | | |           
Sbjct -------ypdDARLAELTLGWL-----PDEAARHRALVENPEALFKLSPV----------  286
DSSP  -------lllHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHLLLLL----------


DSSP  leeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllll
Query dvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgr  448
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  llllllllhhhhhhhhhhhhhllllllll
Query fiprkafpehlyqrvkirnkvfglqgvsr  477
ident                              
Sbjct -----------------------------  286
DSSP  -----------------------------


No 44: Query=4b3zD Sbjct=2gwgA Z-score=14.8

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                        ||   
Sbjct -----------------------------------------------------XIIDIHG    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LLLLLL---------------------------------lLLHH-HHHHHHHHLLEEEEE
Query YLQKTA---------------------------------aDDFF-QGTRAALVGGTTMII   86
ident                                                       |     
Sbjct HYTTAPkaledwrnrqiagikdpsvxpkvselkisddelqASIIeNQLKKXQERGSDLTV   67
DSSP  ELLLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHlLHHHHHHHHLLLEEE


DSSP  EEEL----lLLLLLHHHHHHHHHHHHHLLLlLEEEEEEELLLL----llLHHHHHHHHHH
Query DHVV----pEPGSSLLTSFEKWHEAADTKScCDYSLHVDITSW----ydGVREELEVLVQ  138
ident                    |                                 |||  | 
Sbjct FSPRagdfnVSSTWAAICNELCYRVSQLFP-DNFIGAAXLPQSpgvdpkTCIPELEKCVK  126
DSSP  EELLlllhhHHHHHHHHHHHHHHHHHHHLL-LLEEEEEELLLLllllhhHHHHHHHHHHH


DSSP  LLLLLEEEEELLLLLL----llllHHHHHHHHHHHHHHLLEEEEElllhhhhhhhhhhhh
Query DKGVNSFQVYMAYKDV----yqmsDSQLYEAFTFLKGLGAVILVHaengdliaqeqkril  194
ident   |                     |   |        |      |               
Sbjct EYGFVAINLNPDPSGGhwtsppltDRIWYPIYEKXVELEIPAXIH---------------  171
DSSP  LLLLLEEEELLLLLLLllllllllLHHHHHHHHHHHHHLLLEEEL---------------


DSSP  hllllllhhhhhhllhhhHHHHHHHH--hHHHHHHL-LLEEEEEELLhHHHH--------
Query emgitgpeghalsrpeelEAEAVFRA--iTIAGRIN-CPVYITKVMSkSAAD--------  243
ident                      |                   |                  
Sbjct --------vstgahylnaDTTAFXQCvagDLFKDFPeLKFVIPHGGG-AVPYhwgrfrgl  222
DSSP  --------lllllhhhhhHHHHHHHHhhlLHHHHLLlLLEEELHHHL-LLHHhhhhhhhh


DSSP  ---hhhhhHHHLL--LEEEEELhhHHHLllhhhhlllhhhhhhlllllllllllLHHHHH
Query ---iialaRKKGP--LVFGEPIaaSLGTdgthywsknwakaaafvtspplspdpTTPDYL  298
ident                  |                                       | |
Sbjct aqexkkplLEDHVlnNIFFDTC--VYHQ--------------------------PGIDLL  254
DSSP  hhhlllllHHHHLllLEEEELL--LLLH--------------------------HHHHHH


DSSP  HHHHhHLLLLLLLLLLLLllhhhhhhhlllhhhllLLLL-------lllLHHHHHHHHhl
Query TSLLaCGDLQVTGSGHCPystaqkavgkdnftlipEGVN-------gieERMTVVWDKav  351
ident        |     |                                              
Sbjct NTVI-PVDNVLFASEXIG-----------------AVRGidprtgfyydDTKRYIEAS--  294
DSSP  HHHL-LHHHEELLLLLLL-----------------LLLLeelllleellLLHHHHHHL--


DSSP  llLLLLHHHHHHHHLHHHHHHHL--LLLLllllllLLLLleeeeeeeeeeelllllllll
Query atGKMDENQFVAVTSTNAAKIFN--LYPRkgriavGSDAdvviwdpdklktitakshksa  409
ident                 ||                                          
Sbjct --TILTPEEKQQIYEGNARRVYPrlDAAL-----kAKGK---------------------  326
DSSP  --LLLLHHHHHHHHLHHHHHHLHhhHHHH-----hHHHH---------------------


DSSP  llllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhh
Query veynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkv  469
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  llllllll
Query fglqgvsr  477
ident         
Sbjct -----leh  329
DSSP  -----hll


No 45: Query=4b3zD Sbjct=3gg7A Z-score=14.6

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                        ||   
Sbjct -----------------------------------------------------SLIDFHV    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LLLLlllLLHHHHHHHHHHLLEeEEEEEELLlllllhhHHHHHHHHHHHLllLLEEEEEE
Query YLQKtaaDDFFQGTRAALVGGTtMIIDHVVPepgssllTSFEKWHEAADTksCCDYSLHV  120
ident  |      |     ||                               |            
Sbjct HLDL--yPDPVAVARACEERQL-TVLSVTTT------pAAWRGTLALAAG--RPHVWTAL   56
DSSP  LHHH--lLLHHHHHHHHHHLLL-EEEELLLL------hHHHHHHHHHHLL--LLLEEELL


DSSP  EL---LLLL--LLHHhHHHHHHHllLLLEEE-EELL----LLLLllLLHHHHHHHHHHHH
Query DI---TSWY--DGVReELEVLVQdkGVNSFQ-VYMA----YKDVyqMSDSQLYEAFTFLK  170
ident                                 |                           
Sbjct GFhpeVVSEraADLP-WFDRYLP--ETRFVGeVGLDgspsLRGTwtQQFAVFQHILRRCE  113
DSSP  LLlhhHLLLlhHHLH-HHHHHHH--HLLEEEeEELLllhhHHHHhhHHHHHHHHHHHHHH


DSSP  HH-LLEEEEELLLhhhhhhhhhhhhhllllllhhhhhhllhhhhhhHHHHHHHHHHHHLL
Query GL-GAVILVHAENgdliaqeqkrilemgitgpeghalsrpeeleaeAVFRAITIAGRINC  229
ident    |     |                                    |             
Sbjct DHgGRILSIHSRR---------------------------------AESEVLNCLEANPR  140
DSSP  HLlLEEEEEELLL---------------------------------LHHHHHHHHHHLHH


DSSP  --LEEEEEELlhHHHHHHHHHHHhlLLEEEEELHHHHHLllhhhhlllhhhhhhllllll
Query --PVYITKVMskSAADIIALARKkgPLVFGEPIAASLGTdgthywsknwakaaafvtspp  287
ident                     |                 |                     
Sbjct sgTPILHWYS--GSVTELRRAIS--LGCWFSVGPTMVRT---------------------  175
DSSP  heEEEEELLL--LLHHHHHHHHH--LLLEEEELHHHHLL---------------------


DSSP  lllllLHHHHHHHHHhHLLLLLLLLLLLlllhhhhhhhlllhhhllLLLL-----LLLLH
Query lspdpTTPDYLTSLLaCGDLQVTGSGHCpystaqkavgkdnftlipEGVN-----GIEER  342
ident           |       |   |                                     
Sbjct -----QKGAALIRSM-PRDRVLTETDGP------------------FLELdgqaaLPWDV  211
DSSP  -----HHHHHHHHHL-LHHHEEELLLLL------------------LLEElleelLHHHH


DSSP  HHHHHhHHLLLLLLL-HHHHHHHhLHHHHHHHLllllllllllllllleeeeeeeeeeel
Query MTVVWdKAVATGKMD-ENQFVAVtSTNAAKIFNlyprkgriavgsdadvviwdpdklkti  401
ident   ||                  |   |                                 
Sbjct KSVVE-GLSKIWQIPaSEVERIV-KENVSRLLG---------------------------  242
DSSP  HHHHH-HHHHHHLLLhHHHHHHH-HHHHHHHHH---------------------------


DSSP  llllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhh
Query takshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyq  461
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllll
Query rvkirnkvfglqgvsr  477
ident                 
Sbjct ---------------t  243
DSSP  ---------------l


No 46: Query=4b3zD Sbjct=1a4mA Z-score=14.5

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                             
Sbjct -----------------------------------------------tpafnKPKVELHV   13
DSSP  -----------------------------------------------lllllLLEEEEEE


DSSP  LLL--LLLL---------------------------------------------------
Query YLQ--KTAA---------------------------------------------------   67
ident  |                                                          
Sbjct HLDgaIKPEtilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcr   73
DSSP  EHHhlLLHHhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllh


DSSP  -------lLHHHHHHHHHhllEEEEEEEELLLL----------------llLHHHHHHHH
Query -------dDFFQGTRAALvggTTMIIDHVVPEP----------------gsSLLTSFEKW  104
ident          |                    |                             
Sbjct eaikriayEFVEMKAKEG---VVYVEVRYSPHLlanskvdpmpwnqtegdvTPDDVVDLV  130
DSSP  hhhhhhhhHHHHHHHHLL---EEEEEEEELLHHhllllllllhhhllllllLHHHHHHHH


DSSP  HHHHHLLL---LLEEEEEEELL--LLLL--LHHHHHHHHHhlLLLLEEEEE-lLLLLllL
Query HEAADTKS---CCDYSLHVDIT--SWYD--GVREELEVLVqdKGVNSFQVY-mAYKDvyQ  156
ident                                | |        | |               
Sbjct NQGLQEGEqafGIKVRSILCCMrhQPSWslEVLELCKKYN-qKTVVAMDLAgdETIE-gS  188
DSSP  HHHHHHHHhhhLLEEEEEEEEEllLHHHhhHHHHHHHHLL-lLLEEEEEEEllLLLL-lH


DSSP  LLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhHHHHH
Query MSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeeLEAEA  216
ident        ||       |    |||                                  | 
Sbjct SLFPGHVEAYEGAVKNGIHRTVHAG----------------------------evGSPEV  220
DSSP  HHLHHHHHHHHHHHHHLLEEEEEEL----------------------------llLLHHH


DSSP  HHHHHHHHhhhlLLEEEEEELlhHHHH---HHHHHHHhlLLEEEEELHHhhhlllhhhhl
Query VFRAITIAgrinCPVYITKVMskSAAD---IIALARKkgPLVFGEPIAAslgtdgthyws  273
ident |  |  |                             |       |               
Sbjct VREAVDIL----KTERVGHGY--HTIEdeaLYNRLLK--ENMHFEVCPW-----------  261
DSSP  HHHHHHLL----LLLEEEELH--HHHHlhhHHHHHHH--LLLEEEELHH-----------


DSSP  llhhhhhhllllLLLLLLLLHHhHHHHHHHHLLLLLLLLLLLLllhhhhhhhlllhhhll
Query knwakaaafvtsPPLSPDPTTPdYLTSLLACGDLQVTGSGHCPystaqkavgkdnftlip  333
ident                    ||                                       
Sbjct --------ssylTGAWDPKTTH-AVVRFKNDKANYSLNTDDPL-----------------  295
DSSP  --------hhhhLLLLLLLLLL-HHHHHHHLLLLEEELLLLLL-----------------


DSSP  LLLLLLLLHHHHHH-HHHLlllllLHHHHHHHhLHHHHHHHLL----LLLLL--LLLLll
Query EGVNGIEERMTVVW-DKAVatgkmDENQFVAVtSTNAAKIFNL----YPRKG--RIAVgs  386
ident                |         |  |      ||||   |                 
Sbjct IFKSTLDTDYQMTKkDMGF-----TEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE--  347
DSSP  LLLLLHHHHHHHHHhLLLL-----LHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH--


DSSP  llleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllll
Query dadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgm  446
ident                                                             
Sbjct ------------------------------------------------------------  347
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhhhhllllllll
Query grfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                
Sbjct -----------------------------yq  349
DSSP  -----------------------------ll


No 47: Query=4b3zD Sbjct=3qy6A Z-score=13.9

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeelEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipgGIDVNT   60
ident                                                        ||   
Sbjct ------------------------------------------------------MIDIHC    6
DSSP  ------------------------------------------------------LEELLL


DSSP  LLL------LLLLLLHHHHHHHHHHLLEEEEEEEEL--lLLLL-LHHHHHHHHHHHHHLL
Query YLQ------KTAADDFFQGTRAALVGGTTMIIDHVV--pEPGS-SLLTSFEKWHEAADTK  111
ident               |     |||   |   ||                  |         
Sbjct HILpamddgAGDSADSIEMARAAVRQGIRTIIATPHhnnGVYKnEPAAVREAADQLNKRL   66
DSSP  LLLllllllLLLHHHHHHHHHHHHHLLLLEEELLLEellLLLLlLHHHHHHHHHHHHHHH


DSSP  ----LLLEEEEEEelllllllhhhhhhhhhhllllleeEEELlllllllllhhhHHHHHH
Query ----SCCDYSLHVditswydgvreelevlvqdkgvnsfQVYMaykdvyqmsdsqLYEAFT  167
ident                                                         |   
Sbjct ikedIPLHVLPGQ-------------------------EIRI------------YGEVEQ   89
DSSP  hhllLLLEEELLL-------------------------EEEL------------LLLHHH


DSSP  HHHHH-------lLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhHHHHhhhHH
Query FLKGL-------gAVILVHAEngdliaqeqkrilemgitgpeghalsrpeeLEAEavfRA  220
ident  |             ||                                          |
Sbjct DLAKRqllslndtKYILIEFP-----------------------------fDHVP--rYA  118
DSSP  HHHLLllllhhhlLEEEEELL-----------------------------lLLLL--lLH


DSSP  HHHHHHHL---LLEEEEEE-LLHHH---HHHHHHHHHhlLLEEEEELHHHH-HLLLhhhh
Query ITIAGRIN---CPVYITKV-MSKSA---ADIIALARKkgPLVFGEPIAASL-GTDGthyw  272
ident                |                                 || |  |    
Sbjct EQLFYDLQlkgYIPVIAHPeRNREIrenPSLLYHLVE--KGAASQITSGSLaGIFG----  172
DSSP  HHHHHHHHhllLEEEEELHhHLHHHhhlLHHHHHHHH--LLLEEEEEHHHHlLLLL----


DSSP  lllhhhhhhllllllllllLLHHHHHHHHHHHLLLLLLLLLLLLllhhhhhhhlllhhhl
Query sknwakaaafvtspplspdPTTPDYLTSLLACGDLQVTGSGHCPystaqkavgkdnftli  332
ident                             |          |                    
Sbjct -------------------KQLKAFSLRLVEANLIHFVASDAHN----------------  197
DSSP  -------------------HHHHHHHHHHHHLLLLLEEELLLLL----------------


DSSP  llLLLLllLHHHHHHhHHLLllLLLHHHHHHHhLHHHHHHHLllllllllllllllleee
Query peGVNGieERMTVVWdKAVAtgKMDENQFVAVtSTNAAKIFNlyprkgriavgsdadvvi  392
ident     |                              ||                       
Sbjct vkTRNF--HTQEALY-VLEK--EFGSELPYML-TENAELLLR------------------  233
DSSP  llLLLL--LHHHHHH-HHHH--HHLLHHHHHH-HHHHHHHHL------------------


DSSP  eeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllll
Query wdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfipr  452
ident                                                             
Sbjct ------------------------------------------------------------  233
DSSP  ------------------------------------------------------------


DSSP  lllLHHHhhhhhhhhhhllllllll
Query kafPEHLyqrvkirnkvfglqgvsr  477
ident                          
Sbjct ---NQTI--------frqppqpvkr  247
DSSP  ---LLLL--------llllllllll


No 48: Query=4b3zD Sbjct=1j5sA Z-score=13.0

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
ident                                                         |   
Sbjct ----------------------------hmflgedylltnraavrlfnevkDLPIVDPHN   32
DSSP  ----------------------------llllllllllllhhhhhhhhhhlLLLEEELLL


DSSP  LLLlllllLHHH------------------------------------------------
Query YLQktaadDFFQ------------------------------------------------   72
ident  |      |                                                   
Sbjct HLD---akDIVEnkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakv   89
DSSP  LLL---hhHHHHllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhh


DSSP  -----------------------------------------------HHHHHHHLLEEEE
Query -----------------------------------------------GTRAALVGGTTMI   85
ident                                                             
Sbjct fprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEIL  149
DSSP  hhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEE


DSSP  EEEELllllllHHHHHhHHHHHHHLLL-LLEEEEEEELLLL-------------------
Query IDHVVpepgssLLTSFeKWHEAADTKS-CCDYSLHVDITSW-------------------  125
ident                    |  |                                     
Sbjct CTTDD------PVSTL-EHHRKAKEAVeGVTILPTWRPDRAmnvdkegwreyvekmgery  202
DSSP  ELLLL------LLLLL-HHHHHHHHHLlLLEEELLLLLHHHhllllllhhhhhhhhhhhh


DSSP  ----------LLLHHHHHHHHHhLLLLLEEEEELL-------------------------
Query ----------YDGVREELEVLVqDKGVNSFQVYMA-------------------------  150
ident                   |      |                                  
Sbjct gedtstldgfLNALWKSHEHFK-EHGCVASDHALLepsvyyvdenraravhekafsgekl  261
DSSP  llllllhhhhHHHHHHHHHHHH-LLLLLEEEEEELllllllllhhhhhhhhhhhllllll


DSSP  -lllllllLHHHHHHHHHHHHHHLLEEEEELLLHhhHHHHhHHHHHLlllllHHHHhhLL
Query -ykdvyqmSDSQLYEAFTFLKGLGAVILVHAENGdlIAQEqKRILEMgitgpEGHAlsRP  209
ident                          |   |                       |      
Sbjct tqdeindyKAFMMVQFGKMNQETNWVTQLHIGAL--RDYR-DSLFKT-lgpdSGGD--IS  315
DSSP  lhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEE--LLLL-HHHHHH-llllLLLL--EE


DSSP  HHHhhHHHHHHHHHHHHHL---LLEEEEeELLHHHHHHHHHHHHHLLLEEEEEL-hhHHH
Query EELeaEAVFRAITIAGRIN---CPVYITkVMSKSAADIIALARKKGPLVFGEPI-aaSLG  265
ident                              |        |       | |           
Sbjct TNF--LRIAEGLRYFLNEFdgkLKIVLY-VLDPTHLPTISTIARAFPNVYVGAPwwfNDS  372
DSSP  LLL--LLHHHHHHHHHHHLlllLLEEEE-ELLHHHHHHHHHHHHHLLLEEELLLlllLLL


DSSP  LllhhhhlllhhhhhhlllllllllllLHHHHHHHHHH----HLLLLLLLLLLLLllhhh
Query TdgthywsknwakaaafvtspplspdpTTPDYLTSLLA----CGDLQVTGSGHCPystaq  321
ident                                     ||       |              
Sbjct P--------------------------FGMEMHLKYLAsvdlLYNLAGMVTDSRK-----  401
DSSP  H--------------------------HHHHHHHHHHHllllHHHLLLLLLLLLL-----


DSSP  hhhhlllhhhlllllLLLLLHHHHHHHHHLllLLLL-------------HHHHHHHHLHH
Query kavgkdnftlipegvNGIEERMTVVWDKAVatGKMD-------------ENQFVAVTSTN  368
ident                     |                                  |    
Sbjct --------------lLSFGSRTEMFRRVLS--NVVGemvekgqipikeaRELVKHVSYDG  445
DSSP  --------------lLHHHHHHHHHHHHHH--HHHHhhhhlllllhhhhHHHHHHHHLHH


DSSP  HHHHHLllllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeee
Query AAKIFNlyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvi  428
ident     |                                                       
Sbjct PKALFF------------------------------------------------------  451
DSSP  HHHHHL------------------------------------------------------


DSSP  elleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll
Query sqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                                  
Sbjct -------------------------------------------------  451
DSSP  -------------------------------------------------


No 49: Query=4b3zD Sbjct=3iacA Z-score=12.2

back to top
DSSP  -----------leeeeeeeEEELllleeeeeeeeelleeeeeellllllllleeeellll
Query -----------drllikggRIINddqslyadvyledglikqigenlivpggvktieangr   49
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eeEELEEEEEELLL-------------lLLLL----------------------------
Query mvIPGGIDVNTYLQ-------------kTAAD----------------------------   68
ident        |    |                                               
Sbjct -aPXPIYDFHCHLSpqeiaddrrfdnlgQIWLegdhykwralrsagvdeslitgketsdy   82
DSSP  -lLLLEEELLLLLLhhhhhhllllllhhHHHHllllhhhhhhhhllllhhhlllllllhh


DSSP  -------------------------------------------------------lhhHH
Query -------------------------------------------------------dffQG   73
ident                                                             
Sbjct ekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSA  142
DSSP  hhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLH


DSSP  HHHHHHLLEEEEEEEELllllllHHHHHHhHHHHHHLL--LLLEEEEEEELLLL------
Query TRAALVGGTTMIIDHVVpepgssLLTSFEkWHEAADTK--SCCDYSLHVDITSW------  125
ident                           | |  |                            
Sbjct RGIXQQXNVRXVGTTDD------PIDSLE-YHRQIAADdsIDIEVAPSWRPDKVfkield  195
DSSP  HHHHHHLLEEEEELLLL------LLLLLH-HHHHHHHLllLLLEEELLLLLHHHhlllll


DSSP  -----------------------LLLHHHHHHHHHhLLLLLEEEEELLL-----------
Query -----------------------YDGVREELEVLVqDKGVNSFQVYMAY-----------  151
ident                               |       |                     
Sbjct gfvdylrkleaaadvsitrfddlRQALTRRLDHFA-ACGCRASDHGIETlrfapvpddaq  254
DSSP  lhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHH-HLLLLEEEEEELLllllllllhhh


DSSP  ----------------llllllLHHHHHHHHHHHHHHLLEEEEELLlhhhHHHHhhhHHH
Query ----------------kdvyqmSDSQLYEAFTFLKGLGAVILVHAEngdlIAQEqkrILE  195
ident                           |          | |   |      |         
Sbjct ldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHIG---aIRNN---NTR  308
DSSP  hhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEEL---eELLL---LHH


DSSP  L-LLLL-lHHHHhhLLHHHhhHHHHHHHHHHHHHL-----LLEEEEeELLHHHHHHHHHH
Query M-GITG-pEGHAlsRPEELeaEAVFRAITIAGRIN-----CPVYITkVMSKSAADIIALA  248
ident      |   |                                               |  
Sbjct XfRLLGpdTGFD--SIGDN--NISWALSRLLDSXDvtnelPKTILY-CLNPRDNEVLATX  363
DSSP  HhHHHLllLLLL--EELLL--LLHHHHHHHHHHHHlllllLEEEEE-ELLHHHHHHHHHH


DSSP  HHHLL------LEEEEE-lhhHHHLllhhhhlllhhhhhhlllllllllllLHHHHHHHH
Query RKKGP------LVFGEP-iaaSLGTdgthywsknwakaaafvtspplspdpTTPDYLTSL  301
ident             |                                               
Sbjct IGNFQgpgiagKVQFGSgwwfNDQK--------------------------DGXLRQLEQ  397
DSSP  HHHLLllllllLEEELLllhhHLLH--------------------------HHHHHHHHH


DSSP  HHHLL----LLLLLLLLLLllhhhhhhhlllhhhllllLLLLlLHHHHHHHHHLLLL---
Query LACGD----LQVTGSGHCPystaqkavgkdnftlipegVNGIeERMTVVWDKAVATG---  354
ident |                                           |               
Sbjct LSQXGllsqFVGXLTDSRS-------------------FLSY-TRHEYFRRILCNLLgqw  437
DSSP  HHHHLlhhhLLLLLLLLLL-------------------LLLL-HHHHHHHHHHHHHHhhh


DSSP  ----------llLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeellll
Query ----------kmDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitak  404
ident                        ||   |                               
Sbjct aqdgeipddeaxLSRXVQDICFNNAQRYFT------------------------------  467
DSSP  hhlllllllhhhHHHHHHHHHLHHHHHHLL------------------------------


DSSP  lllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhh
Query shksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvk  464
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllll
Query irnkvfglqgvsr  477
ident              
Sbjct -----------ik  469
DSSP  -----------ll


No 50: Query=4b3zD Sbjct=1v77A Z-score=11.1

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                        |    
Sbjct ----------------------------------------------------VKFIEMDI    8
DSSP  ----------------------------------------------------LLLEEEEE


DSSP  LLLLlllllhhHHHHHHhhllEEEEEEEElllllllhhhhhhhhhhhhhllllleeeeee
Query YLQKtaaddffQGTRAAlvggTTMIIDHVvpepgsslltsfekwheaadtksccdyslhv  120
ident                                                             
Sbjct RDKE-----ayELAKEW----FDEVVVSI-------------------------------   28
DSSP  LLHH-----hhHHHHHH----LLEEEEEE-------------------------------


DSSP  ELLLLlllhhhhHHHHHhLLLL-----LEEEEELlllllllLLHHHHHHHHHHHHhhLLE
Query DITSWydgvreeLEVLVqDKGV-----NSFQVYMaykdvyqMSDSQLYEAFTFLKglGAV  175
ident                                             |         |     
Sbjct KFNEE------vDKEKL-REARkeygkVAILLSN-------PKPSLVRDTVQKFK--SYL   72
DSSP  EELLL------lLHHHH-HHHHhhhllEEEEEEL-------LLHHHHHHHHHHLL--LLE


DSSP  EEEELLLhhhhhhhhhhhhhllllllhhhhhhllhhhhHHHHHHHHHHHhhhllLEEEEE
Query ILVHAENgdliaqeqkrilemgitgpeghalsrpeeleAEAVFRAITIAgrincPVYITK  235
ident | |                                          |           |  
Sbjct IYVESND-------------------------------LRVIRYSIEKG-----VDAIIS   96
DSSP  EEEELLL-------------------------------HHHHHHHHHLL-----LLEEEL


DSSP  ELL---HHHHH-hHHHHHHhLLLEEEEELHHHhHLLLHHhhlllhhhhhhllllllllLL
Query VMS---KSAAD-iIALARKkGPLVFGEPIAASlGTDGTHywsknwakaaafvtspplsPD  291
ident           |   |        |                                    
Sbjct PWVnrkDPGIDhvLAKLMV-KKNVALGFSLRP-LLYSNP------------------yER  136
DSSP  LLLlllLLLLLhhHHHHHH-HHLLEEEEELHH-HHHLLH------------------hHH


DSSP  LLHHHHHHHHHHHL----LLLLLLLLLLLllhhhhhhhlllhhhlllLLLLLL--LHHHH
Query PTTPDYLTSLLACG----DLQVTGSGHCPystaqkavgkdnftlipeGVNGIE--ERMTV  345
ident                         |                                   
Sbjct ANLLRFMMKAWKLVekykVRRFLTSSAQE------------------KWDVRYprDLISL  178
DSSP  HHHHHHHHHHHHHHhhhlLLEEEELLLLL------------------HHHLLLhhHHHHH


DSSP  HHHHHlllllLLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeelllll
Query VWDKAvatgkMDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitaks  405
ident           |   |  |  |     |                                 
Sbjct GVVIG-----MEIPQAKASISMYPEIILK-------------------------------  202
DSSP  HHHLL-----LLHHHHHHLLLHHHHHHHL-------------------------------


DSSP  llllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhh
Query hksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvki  465
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllll
Query rnkvfglqgvsr  477
ident             
Sbjct ------------  202
DSSP  ------------


No 51: Query=4b3zD Sbjct=3dcpA Z-score=9.3

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
ident                                                         |  |
Sbjct -----------------------------------------------------XKRDGHT    7
DSSP  -----------------------------------------------------LLEEEEE


DSSP  LLLL---lLLLLHHHHHHHHHHLLEEEEEEEE----------------------LLLLlL
Query YLQK---tAADDFFQGTRAALVGGTTMIIDHV----------------------VPEPgS   95
ident           ||       |                                       |
Sbjct HTEFcphgTHDDVEEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttaSXAX-S   66
DSSP  LLLLllllLLLLHHHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhllLLLH-H


DSSP  LHHHHHHHHHHHHHLLL-LLEEEEEEelllllllhhhhhhhhhhllllleeEEELlllll
Query SLLTSFEKWHEAADTKS-CCDYSLHVditswydgvreelevlvqdkgvnsfQVYMaykdv  154
ident  |   | |                                            |       
Sbjct DLPYYFKKXNHIKKKYAsDLLIHIGF-------------------------EVDY-----   96
DSSP  HHHHHHHHHHHHHHHLLlLLEEEEEE-------------------------EEEL-----


DSSP  llLLHHhHHHHHHHHhHHLL----eeEEELLLHHhhHHHHhhhhhlllllLHHHHHH---
Query yqMSDSqLYEAFTFLkGLGA----viLVHAENGDliAQEQkrilemgitgPEGHALS---  207
ident              ||                      |                      
Sbjct --LIGY-EDFTRDFL-NEYGpqtddgVLSLHFLE--GQGG----frsidfSAEDYNEgiv  146
DSSP  --LLLL-HHHHHHHH-HHHHhhlleeEEELLEEE--ELLE----eeelllLHHHHHHhlh


DSSP  -------lLHHHHHHHHHHHHHHhhHHLL--lEEEEEELL-------------------h
Query -------rPEELEAEAVFRAITIagRINC--pVYITKVMS-------------------k  239
ident               | |   |                                       
Sbjct qfyggfeqAQLAYLEGVKQSIEA--DLGLfkpRRXGHISLcqkfqqffgedtsdfseevx  204
DSSP  hhhllhhhHHHHHHHHHHHHHHL--LLLLlllLEELLLLHhhllhhhhlllhhhllhhhh


DSSP  hhHHHHHHHHHHlLLEEEEELHHHhHLLLHhhhlllhhhhhhllllllllllLLHHhhHH
Query saADIIALARKKgPLVFGEPIAASlGTDGThywsknwakaaafvtspplspdPTTPdyLT  299
ident      |    ||          |                                     
Sbjct ekFRVILALVKK-RDYELDFNTAG-LFKPL----------------------CGETypPK  240
DSSP  hhHHHHHHHHHH-HLLEEEEELHH-HHLLL----------------------LLLLllLH


DSSP  HHHHHL----LLLLLLLLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLllll
Query SLLACG----DLQVTGSGHCPystaqkavgkdnftlipegvNGIEERMTVVWDKAVatgk  355
ident              | ||                          |         |      
Sbjct KIVTLAselqIPFVYGSDSHG-------------------vQDIGRGYSTYCQKLE----  277
DSSP  HHHHHHhhllLLEEEELLLLL-------------------hHHLLLLHHHHHHHLL----


DSSP  llhhhhhhhhlhhhhhhhlllllllllllllllleeeeeeeeeeelllllllllllllll
Query mdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdklktitakshksaveynif  415
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  llleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllll
Query egmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgv  475
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  ll
Query sr  477
ident   
Sbjct --  277
DSSP  --


No 52: Query=4b3zD Sbjct=2a3lA Z-score=9.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------leeeeeeeeeelllLEEEeeeeeelleeeeeellllllllleeee
Query ---------------drllikggriinddQSLYadvyledglikqigenlivpggvktie   45
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------


DSSP  llLLEEE--ELEEEEEELLLL---------------------------------------
Query anGRMVI--PGGIDVNTYLQK---------------------------------------   64
ident              |                                              
Sbjct -aPHRDFynVRKVDTHVHHSAcmnqkhllrfiksklrkepdevvifrdgtyltlrevfes  212
DSSP  -lLLLLLllLLEEEEEEELLLlllhhhhhhhhhhhhhllllllleeelleeelhhhhhhh


DSSP  ------------------------------------------------------llllLH
Query ------------------------------------------------------taadDF   70
ident                                                             
Sbjct ldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeIT  272
DSSP  hlllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHH


DSSP  HHHHHHHHHLLEEEEEEEELLLLLL--LHHHHHHHHHHHhHLLLlLEEEEEEELLL----
Query FQGTRAALVGGTTMIIDHVVPEPGS--SLLTSFEKWHEAaDTKScCDYSLHVDITS----  124
ident  |           |                          |  |                
Sbjct KQVFSDLEASKYQMAEYRISIYGRKmsEWDQLASWIVNN-DLYS-ENVVWLIQLPRlyni  330
DSSP  HHHHHHHLLLLLEEEEEEEELLLLLllHHHHHHHHHHLL-LLLL-LLEEEEEEEELlhhh


DSSP  -----------lLLLH-HHHHH-----------hhhhlLLLLEEEEELLL----------
Query -----------wYDGV-REELE-----------vlvqdKGVNSFQVYMAY----------  151
ident                     |                 | |  |                
Sbjct ykdmgivtsfqnILDNiFIPLFeatvdpdshpqlhvflKQVVGFDLVDDEskperrptkh  390
DSSP  hlllllllllhhHHHHhLLHHHhhhhlhhhllllhhhhLLEEEEEEELLLllllllllll


DSSP  --------llllllLHHHHHHHHHHHHHHL----------LEEEEELLlhhhhhhhhhhh
Query --------kdvyqmSDSQLYEAFTFLKGLG----------AVILVHAEngdliaqeqkri  193
ident                    |     |  |                |              
Sbjct mptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSG------------  438
DSSP  llllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLL------------


DSSP  hhllllllhhhhhhllhHHHHHHHHHHHHHHhhhlllEEEEEELlhhHHHH---HHHHHH
Query lemgitgpeghalsrpeELEAEAVFRAITIAgrincpVYITKVMsksAADI---IALARK  250
ident                                        |                    
Sbjct ----------------eAGDIDHLAATFLTC------HSIAHGI---NLRKspvLQYLYY  473
DSSP  ----------------lLLLLHHHHHHHHHL------LLLLLLH---HHHHlhhHHHHHH


DSSP  hLLLEEEEELHHHhhlllhhhhlllhhhhhhlllllLLLLlLLHHhHHHHHHHHLLLLLL
Query kGPLVFGEPIAASlgtdgthywsknwakaaafvtspPLSPdPTTPdYLTSLLACGDLQVT  310
ident             |                                         |     
Sbjct -LAQIGLAMSPLS--------------------nnsLFLD-YHRN-PFPVFFLRGLNVSL  510
DSSP  -HHLLLEEELHHH--------------------hllLLLL-LLLL-LHHHHHHLLLLEEE


DSSP  LLLLLlllhhhhhhhlllhhhlllLLLL--lLLHHHHHHHHHlLLLLLLHHHHHHHHlHH
Query GSGHCpystaqkavgkdnftlipeGVNG--iEERMTVVWDKAvATGKMDENQFVAVTsTN  368
ident                                |         |    |            |
Sbjct STDDP-------------------LQIHltkEPLVEEYSIAA-SVWKLSACDLCEIA-RN  549
DSSP  LLLLH-------------------HHHLlllLHHHHHHHHHH-HHHLLLHHHHHHHH-HH


DSSP  HHH-HHLL---LLLLlLLLLllllleeeeeeeeeeelllllllllllllllllleeeeee
Query AAK-IFNL---YPRKgRIAVgsdadvviwdpdklktitakshksaveynifegmechgsp  424
ident                                                             
Sbjct SVYqSGFShalKSHW-IGKD----------------------------yykrgpdgndih  580
DSSP  HHHhLLLLhhhHHHH-LLLL----------------------------lllllhhhllhh


DSSP  eeeeelleeeeelleellllllllllllllllHHHHhhhhhhhhhllllllll
Query lvvisqgkivfedgninvnkgmgrfiprkafpEHLYqrvkirnkvfglqgvsr  477
ident                                 |                    
Sbjct ktnvphirvefrdtiwkeemqqvylgkavisdEVVP-----------------  616
DSSP  hhlllhhhhhhhhhhhhhhhhhhlllllllllLLLL-----------------


No 53: Query=4b3zD Sbjct=3f2bA Z-score=8.5

back to top
DSSP  ----------------------------------------------------leeeeeee
Query ----------------------------------------------------drllikgg    8
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  eeelllleeeeeeeeelleeeeeellllllLLLEE---eellllEEEELEEEEEELLLL-
Query riinddqslyadvyledglikqigenlivpGGVKT---ieangrMVIPGGIDVNTYLQK-   64
ident                                                             
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIaanerqdtaPEGEKRVELHLHTPMs  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEElllllllllLLLLLLLLLLLLLLLl


DSSP  --lllLLHHHHHHHHHHLLEEEEEEEELllllllhhhhhhHHHHHHHLLL---LLEEEEE
Query --taaDDFFQGTRAALVGGTTMIIDHVVpepgsslltsfeKWHEAADTKS---CCDYSLH  119
ident               |   |   |                      |              
Sbjct qmdavTSVTKLIEQAKKWGHPAIAVTDH---------avvQSFPEAYSAAkkhGMKVIYG  171
DSSP  lllllLLHHHHHHHHHHLLLLLEEELLL---------lllLLHHHHHHHHhhhLLLEEEE


DSSP  EelllllllhhhhhhhhhhllllleeEEEL------------------------------
Query VditswydgvreelevlvqdkgvnsfQVYM------------------------------  149
ident                                                             
Sbjct L-------------------------EANIvddpfhvtllaqnetglknlfklvslshiq  206
DSSP  E-------------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhll


DSSP  lLLLLLLLlhhHHHHHHHHHhhHLLEeeeelllhhhhhhhhhhhhhllllllhhhhhhll
Query aYKDVYQMsdsQLYEAFTFLkgLGAVilvhaengdliaqeqkrilemgitgpeghalsrp  209
ident     |                  |                                    
Sbjct yFHRVPRI---PRSVLVKHR--DGLL----------------------------------  227
DSSP  lLLLLLLE---EHHHHHHLL--LLEE----------------------------------


DSSP  hhhhhhhhhhhhhhhhhhlllEEEEEEllhhHHHHhhHHHHhLLLE-EEEELhhHHHLll
Query eeleaeavfraitiagrincpVYITKVmsksAADIiaLARKkGPLV-FGEPIaaSLGTdg  268
ident                      |           |             | |          
Sbjct ---------------------VGSGCD-kgeLFDN--VEDI-ARFYdFLEVH--PPDV--  258
DSSP  ---------------------EELLLL-lllLLLL--LLLL-HHHLlLEEEL--LHHH--


DSSP  hhhhlllhhhhhhlllllLLLL----LLLHHHHHHHHhHHLL-----lLLLLLLLLL---
Query thywsknwakaaafvtspPLSP----DPTTPDYLTSLlACGD-----lQVTGSGHCP---  316
ident                                    |             |          
Sbjct ------------------YKPLyvkdEEMIKNIIRSI-VALGekldipVVATGNVHYlnp  299
DSSP  ------------------HLLLllllHHHHHHHHHHH-HHHHhhllllEEELLLLLLllh


DSSP  ----LLHHHHHHHLLLHHHL---llLLLLllLHHHHHHHHHLlllLLLHHHHHHHHLHHH
Query ----YSTAQKAVGKDNFTLI---peGVNGieERMTVVWDKAVatgKMDENQFVAVTSTNA  369
ident     |             |       |           |                   | 
Sbjct edkiYRKILIHSQGGANPLNrhelpDVYF--RTTNEMLDCFS---FLGPEKAKEIVVDNT  354
DSSP  hhhhHHHHHHHLLHHHLLLLlllllLLLL--LLHHHHHHHHH---HHHHHHHHHHHLHHH


DSSP  HHHHLLlllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeee
Query AKIFNLyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvis  429
ident  ||  |                                                      
Sbjct QKIASL------------------------------------------------------  360
DSSP  HHHHHL------------------------------------------------------


DSSP  lleeeeelleelllllllllLLLLlllhhhhhhhhhhhhhllllLLLL------------
Query qgkivfedgninvnkgmgrfIPRKafpehlyqrvkirnkvfglqGVSR------------  477
ident                     |                                       
Sbjct --------------------IGDV-----------kpikdelytPRIEgadeeiremsyr  389
DSSP  --------------------LLLL-----------lllllllllLLLLlhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct rakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgss  449
DSSP  hhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct fvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdip  509
DSSP  hhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct fetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvka  569
DSSP  lhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct yasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtsse  629
DSSP  hhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct wrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsstepl  689
DSSP  lleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct gvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeli  749
DSSP  lllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct qngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpew  809
DSSP  hlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct yidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsa  869
DSSP  hhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct airkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnsl  929
DSSP  hhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  477
ident                                                             
Sbjct ippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhn  989
DSSP  ellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllll


DSSP  -----
Query -----  477
ident      
Sbjct qlslf  994
DSSP  lllll


No 54: Query=4b3zD Sbjct=1m65A Z-score=8.3

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeelEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipgGIDVNT   60
ident                                                         |   
Sbjct -----------------------------------------------------yPVDLHM    7
DSSP  -----------------------------------------------------lLEELLL


DSSP  LLLL--llLLLHHHHHHHHHHLLEEEEEEEELLLLL--llhHHHHHHhHHHHH-lllLLE
Query YLQK--taADDFFQGTRAALVGGTTMIIDHVVPEPG--sslLTSFEKwHEAAD-tksCCD  115
ident                   |   |                     |               
Sbjct HTVAsthaYSTLSDYIAQAKQKGIKLFAITDHGPDMedaphHWHFIN-MRIWPrvvdGVG   66
DSSP  LLLLllllLLLHHHHHHHHHHHLLLEEEEEEELLLLlllllLHHHHH-HHHLLleelLEE


DSSP  EEEEEELLLLL-llhhhHHHHHHhlLLLLEEEEELlLLLLL-----llLHHHHHHHHHHH
Query YSLHVDITSWY-dgvreELEVLVqdKGVNSFQVYMaYKDVY-----qmSDSQLYEAFTFL  169
ident                                        |                    
Sbjct ILRGIEANIKNvdgeidCSGKMF--DSLDLIIAGF-HEPVFaphdkatNTQAMIATIASG  123
DSSP  EEEEEEEELLLllllllLLHHHH--HHLLEEEEEL-LLLLLllllhhhHHHHHHHHHHLL


DSSP  hhhlLEEEEE-LLLHHhhhhhhhhhhhllllllhhhhhhllhhhhhHHHHHHHHHHHhhL
Query kglgAVILVH-AENGDliaqeqkrilemgitgpeghalsrpeeleaEAVFRAITIAGriN  228
ident      |       |                                  |      |    
Sbjct ----NVHIIShPGNPK----------------------------yeIDVKAVAEAAA--K  149
DSSP  ----LLLEELlLLLLL----------------------------llLLHHHHHHHHH--H


DSSP  LLEEEEE---elLHHHHHHHHHHHhhlllEEEEElhhhhhlllhhhhlllhhhhhhllll
Query CPVYITK---vmSKSAADIIALARkkgplVFGEPiaaslgtdgthywsknwakaaafvts  285
ident   |             |     |                                     
Sbjct HQVALEInnssnCREVAAAVRDAG-----GWVAL--------------------------  178
DSSP  HLLEEEEellllHHHHHHHHHHHL-----LLEEE--------------------------


DSSP  llllllllhhhhhhhhhhhllllllLLLLLLllhhhhhhhlllhhhllllLLLLllHHHH
Query pplspdpttpdyltsllacgdlqvtGSGHCPystaqkavgkdnftlipegVNGIeeRMTV  345
ident                          ||                                 
Sbjct -------------------------GSDSHT-------------------AFTM--GEFE  192
DSSP  -------------------------ELLLLL-------------------HHHL--LLLH


DSSP  hhhhhlllllllhhhhhhHHLHHHHHHHLllllllllllllllleeeeeeeeeeelllll
Query vwdkavatgkmdenqfvaVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitaks  405
ident                   |                                         
Sbjct eclkildavdfpperilnVSPRRLLNFLE-------------------------------  221
DSSP  hhhhhhhhllllhhhlhhHLHHHHHHHHH-------------------------------


DSSP  llllllllllllleeeeeeeeeeelleeeeelleelllllllllllllLLLHhhhhhhhh
Query hksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkAFPEhlyqrvki  465
ident                                                             
Sbjct -----------------------------------------------sRGMA--------  226
DSSP  -----------------------------------------------hLLLL--------


DSSP  hhhhllllllll
Query rnkvfglqgvsr  477
ident             
Sbjct ----piaefadl  234
DSSP  ----llhhhlll


No 55: Query=4b3zD Sbjct=3au2A Z-score=8.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ----------------------------leeeeeeeeeelllleeeeeeeeelleeeeeE
Query ----------------------------drllikggriinddqslyadvyledglikqiG   32
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhllllL


DSSP  LLL---------------------------------------------------------
Query ENL---------------------------------------------------------   35
ident |                                                           
Sbjct ERAelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  LEEeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  -----------------------------------------------------lLLLL--
Query -----------------------------------------------------iVPGG--   40
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagETEEev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelLLHHhh


DSSP  -----------------------leeeelllleeEELEEEEEELLLL-llLLLHHHHHHH
Query -----------------------vktieangrmvIPGGIDVNTYLQK-taADDFFQGTRA   76
ident                                        |                   |
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYsdgQNTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLlllLLLHHHHHHH


DSSP  HHHLLEEEEEEEELLLL----LLLHHHHHHHHHHHHHLLL----lLEEEEEEELLLLlll
Query ALVGGTTMIIDHVVPEP----GSSLLTSFEKWHEAADTKS----cCDYSLHVDITSWydg  128
ident |   |                |        |                             
Sbjct AKTMGYRYLAVTDHSPAvrvaGGPSPEEALKRVGEIRRFNethgpPYLLAGAEVDIHpdg  420
DSSP  HHHHLLLEEEEEEELHHhhllLLLLHHHHHHHHHHHHHHHhhhllLEEEEEEEEELLlll


DSSP  hhhHHHHHHhlLLLLEEEEELLLLL--llllLHHHHHHHHHHHhhhlLEEEE-ELLLhhh
Query vreELEVLVqdKGVNSFQVYMAYKD--vyqmSDSQLYEAFTFLkglgAVILV-HAENgdl  185
ident                   |                |  |         |    |      
Sbjct tldYPDWVL--RELDLVLVSVHSRFnlpkadQTKRLLKALENP----FVHVLaHPTA---  471
DSSP  lllLLHHHH--LLLLEEEEELLLLLlllhhhHHHHHHHHHLLL----LLLEElLLLL---


DSSP  hhhhhhhhhhllllllhhhHHHLLHhhhhhhhhhHHHHHHhhLLLEEEEEEL----lhhH
Query iaqeqkrilemgitgpeghALSRPEeleaeavfrAITIAGriNCPVYITKVM----sksA  241
ident                       |               |      |              
Sbjct -----------------rlLGRRAP--ieadweaVFQKAK--EKGVAVEIDGyydrmdlP  510
DSSP  -----------------llLLLLLL--llllhhhHHHHHH--HHLLEEEEELlllllllL


DSSP  HHHHHHHHHHLllEEEEElhhhhhlllhhhhlllhhhhhhllllllllllllhhhhhhhh
Query ADIIALARKKGplVFGEPiaaslgtdgthywsknwakaaafvtspplspdpttpdyltsl  301
ident  |    |   |                                                 
Sbjct DDLARMAYGMG--LWISL------------------------------------------  526
DSSP  HHHHHHHHHLL--LLEEE------------------------------------------


DSSP  hhhllllllLLLLLLllhhhhhhhlllhhhlllLLLLlllhhhhhhhhhlllllllhhhh
Query lacgdlqvtGSGHCPystaqkavgkdnftlipeGVNGieermtvvwdkavatgkmdenqf  361
ident                                                             
Sbjct ---------STDAHQ------------------TDHL-----rfmelavgtaqrawigpe  554
DSSP  ---------ELLLLL------------------HHHH-----hhhhhhhhhhhhllllll


DSSP  hhhHLHHHHHHHLllllllllllllllleeeeeeeeeeelllllllllllllllllleee
Query vavTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitakshksaveynifegmech  421
ident                                                             
Sbjct rvlNTLDYEDLLS-----------------------------------------------  567
DSSP  llhHHLLHHHHHH-----------------------------------------------


DSSP  eeeeeeeelleeeeelleelllllllllllllllLHHHHhhhhhhhhhllllllll
Query gsplvvisqgkivfedgninvnkgmgrfiprkafPEHLYqrvkirnkvfglqgvsr  477
ident                                                         
Sbjct --------------------------------wlKARRG----------------v  575
DSSP  --------------------------------hhHLLLL----------------l


No 56: Query=4b3zD Sbjct=1bksA Z-score=7.2

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeleEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipggIDVNT   60
ident                                                          |  
Sbjct --------------------------------------meryenlfaqlndrregAFVPF   22
DSSP  --------------------------------------lhhhhhhhhhhhhllllEEEEE


DSSP  LlLLLL-----lLLHHHHHHHHhhlleeEEEEEELLL------------------llllh
Query YlQKTA-----aDDFFQGTRAAlvggttMIIDHVVPE------------------pgssl   97
ident                     |             ||                        
Sbjct VtLGDPgieqslKIIDTLIDAG-----aDALELGVPFsdpladgptiqnanlrafaagvt   77
DSSP  EeLLLLlhhhhhHHHHHHHHLL-----lLLEEEELLLlllllllhhhhhhhhhhhhhlll


DSSP  HHHHHHHHHHHHLLlllEEEEEEELLLL--LLLHH-HHHHHHHHlLLLLEEEEEllllll
Query LTSFEKWHEAADTKsccDYSLHVDITSW--YDGVR-EELEVLVQdKGVNSFQVYmaykdv  154
ident              |                             |  || |  |       
Sbjct PAQCFEMLALIREK-hpTIPIGLLMYANlvFNNGIdAFYARCEQ-VGVDSVLVA------  129
DSSP  HHHHHHHHHHHHHH-llLLLEEEEELHHhhHLLLHhHHHHHHHH-HLLLEEEEL------


DSSP  lLLLHHHHHHHHHHHHHHLLEEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhHH
Query yQMSDSQLYEAFTFLKGLGAVILVHAengdliaqeqkrilemgitgpeghalsrpeelEA  214
ident                                                             
Sbjct -DVPVEESAPFRQAALRHNIAPIFIC--------------------------------PP  156
DSSP  -LLLHHHLHHHHHHHHHLLLEEEEEE--------------------------------LL


DSSP  HH----hHHHHHHHhhhllLEEEEEEllHHHHHHHHHHHHhLLLEEEEELhHHHHlllhh
Query EA----vFRAITIAgrincPVYITKVmsKSAADIIALARKkGPLVFGEPIaASLGtdgth  270
ident  |                   |            |                         
Sbjct NAdddllRQVASYG-----RGYTYLL-aLPLHHLIEKLKE-YHAAPALQGfGISS-----  204
DSSP  LLlhhhhHHHHHHL-----LLLEEEL-lLLHHHHHHHHHH-HLLLLEEELlLLLL-----


DSSP  hhlllhhhhhhllllllllllllhhhHHHHHHhhllLLLLLLL--LLLL-LHHHHHhhll
Query ywsknwakaaafvtspplspdpttpdYLTSLLacgdLQVTGSG--HCPY-STAQKAvgkd  327
ident                                          ||                 
Sbjct ---------------------peqvsAAVRAG----AAGAISGsaIVKIiEKNLAS----  235
DSSP  ---------------------hhhhhHHHHHL----LLEEEELlhHHHHhHHLLLL----


DSSP  lhhhllllllLLLLHHHHHHhhhlllllllhhhhhhhhlhhhhhhhllllllllllllll
Query nftlipegvnGIEERMTVVWdkavatgkmdenqfvavtstnaakifnlyprkgriavgsd  387
ident                                                             
Sbjct pkqmlaelrsFVSAMKAASR----------------------------------------  255
DSSP  hhhhhhhhhhHHHHHHHLLL----------------------------------------


DSSP  lleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleelllllll
Query advviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmg  447
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhhhhhhhhllllllll
Query rfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                               
Sbjct ------------------------------  255
DSSP  ------------------------------


No 57: Query=4b3zD Sbjct=2anuA Z-score=5.1

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
ident                                                         |   
Sbjct --------------------------------------------------teWLLCDFHV   10
DSSP  --------------------------------------------------leEEEEEEEE


DSSP  LLLL-llLLLHHHHHHHHHHLLEEEEEEEELLLLL--------------llHHHHHHHHH
Query YLQK-taADDFFQGTRAALVGGTTMIIDHVVPEPG--------------ssLLTSFEKWH  105
ident                      |                                 |    
Sbjct HTNXsdgHLPLGEVVDLFGKHGVDVVSITDHIVDRrtleqrkrngeplgaiTEDKFQDYL   70
DSSP  LLLLlllLLLHHHHHHHHHHLLLLEEEEEEEEELHhhhhhhhhllllllllLLLLHHHHH


DSSP  HHHHLLL-------lLEEEEEEELLLllllhhhhhhhhhhllllleeeeellllllLLLL
Query EAADTKS-------cCDYSLHVDITSwydgvreelevlvqdkgvnsfqvymaykdvYQMS  158
ident                      | ||                                   
Sbjct KRLWREQkraweeygXILIPGVEITN------------------------------NTDL  100
DSSP  HHHHHHHhhhhhhhlLEEEEEEEEEE------------------------------LLLL


DSSP  -----------hhhhhHHHHHHHHHL---LEEEEELLlhhhhhhhhhhhhhllllllhhh
Query -----------dsqlyEAFTFLKGLG---AVILVHAEngdliaqeqkrilemgitgpegh  204
ident                         |    |                              
Sbjct yhivavdvkeyvdpslPVEEIVEKLKeqnALVIAAHP-----------------------  137
DSSP  eeeeeellllllllllLHHHHHHHHHhllLEEEELLL-----------------------


DSSP  hhhllhhhhhhHHHHhHHHHHhhLLLEEEEEEllhhhHHHHHHHHhhlllEEEEELhhhh
Query alsrpeeleaeAVFRaITIAGriNCPVYITKVmsksaADIIALARkkgplVFGEPIaasl  264
ident                                                             
Sbjct ---drkklswyLWAN-XERFK--DTFDAWEIAnrddlFNSVGVKK-----YRYVAN----  182
DSSP  ---lllllllhHHHL-LLLLL--LLLLEEEEEelleeLHHHHHLL-----LLEEEE----


DSSP  hlllhhhhlllhhhhhhllllllllllllhhhhhhhhhhhlllllllLLLLLllhhhhhh
Query gtdgthywsknwakaaafvtspplspdpttpdyltsllacgdlqvtgSGHCPystaqkav  324
ident                                                |            
Sbjct -----------------------------------------------SDFHE--------  187
DSSP  -----------------------------------------------LLLLL--------


DSSP  hlllhhhlllLLLLlllhhhhhhhhhlllllllhhhhhhhHLHH---hHHHHLLllllll
Query gkdnftlipeGVNGieermtvvwdkavatgkmdenqfvavTSTN---aAKIFNLyprkgr  381
ident                                                   |         
Sbjct ----------LWHV---------------------yswktLVKSekniEAIKEA------  210
DSSP  ----------HHHH---------------------lleeeEEEElllhHHHHHH------


DSSP  lllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleel
Query iavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgnin  441
ident                                                             
Sbjct ------------------------------------------------------------  210
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllhhhhhhhhhhhhhllllllll
Query vnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                     
Sbjct ----------------------irkntdvaiylxrk  224
DSSP  ----------------------hhhllleeeeelll


No 58: Query=4b3zD Sbjct=2yb1A Z-score=4.5

back to top
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeelEEEEEE
Query drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipgGIDVNT   60
ident                                                        ||   
Sbjct -----------------------------------------------------aNIDLHF    7
DSSP  -----------------------------------------------------lLEELLL


DSSP  L---lLLLL--lLLHHHHHHHHhhllEEEEEEEElllllllhhHHHHHHHHHHHLlLLLE
Query Y---lQKTA--aDDFFQGTRAAlvggTTMIIDHVvpepgssllTSFEKWHEAADTkSCCD  115
ident                      |                             ||       
Sbjct HsrtsDGALtptEVIDRAAARA----PALLALTD-----hdctGGLAEAAAAAAR-RGIP   57
DSSP  LllllLLLLlhhHHHHHHHLLL----LLEEEELL-----llllLLHHHHHHHHHH-LLLL


DSSP  EEEEEELLlllllhhhhhhhhhhllllleeeeellllllllLLHH---------------
Query YSLHVDITswydgvreelevlvqdkgvnsfqvymaykdvyqMSDS---------------  160
ident     |                                     |                 
Sbjct FLNGVEVS---------------------------------VSWGrhtvhivglgidpae   84
DSSP  EEEEEEEE---------------------------------EEELleeeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  160
ident                                                             
Sbjct palaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsg  144
DSSP  hhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhll


DSSP  --------------------------HHHHHHHHHHHHLLEEEEE-LLLHHhhhhhhhhh
Query --------------------------QLYEAFTFLKGLGAVILVH-AENGDliaqeqkri  193
ident                            |  |     | |           |         
Sbjct avkdmrtvfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAhPGRYD---------  195
DSSP  llllhhhhhhhlllllllllllllllLHHHHHHHHHHLLLEEEELlHHHLL---------


DSSP  hhllllllhhhhhhllhhhhhHHHHHHHHHHHHHlLLEEEEEE-------LLHHHHHHHH
Query lemgitgpeghalsrpeeleaEAVFRAITIAGRInCPVYITKV-------MSKSAADIIA  246
ident                          | |           |               |    
Sbjct ------------------mgrTLIERLILDFQAA-GGQGIEVAsgshsldDMHKFALHAD  236
DSSP  ------------------llhHHHHHHHHHHHHL-LLLEEEEEellllhhHHHHHHHHHH


DSSP  HHHhhlllEEEEelhhhhhlllhhhhlllhhhhhhllllllllllllhhhhhhhhhhhll
Query LARkkgplVFGEpiaaslgtdgthywsknwakaaafvtspplspdpttpdyltsllacgd  306
ident                                                             
Sbjct RHG-----LYAS------------------------------------------------  243
DSSP  HHL-----LEEE------------------------------------------------


DSSP  lllLLLLLLLLLhhhhhhhlllhhhllllLLLLllhhhhhhhhhlllllllhhhhhhhhl
Query lqvTGSGHCPYStaqkavgkdnftlipegVNGIeermtvvwdkavatgkmdenqfvavts  366
ident     ||                                                      
Sbjct ---SGSDFHAPG-----------------EDVG------------------htedlppic  265
DSSP  ---EELLLLLLL-----------------LLLL------------------lllllllll


DSSP  hhhHHHHLLlllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeee
Query tnaAKIFNLyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplv  426
ident                                                             
Sbjct rpiWRELEA---------------------------------------------------  274
DSSP  llhHHHLHH---------------------------------------------------


DSSP  eeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll
Query visqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
ident                                                    
Sbjct -----------------------------------------rilrpadaen  284
DSSP  -----------------------------------------hlllllhhhl


No 59: Query=4b3zD Sbjct=3e38A Z-score=4.5

back to top
DSSP  leeeeeeeeeELLLLeeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE
Query drllikggriINDDQslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
ident              |                                          |   
Sbjct -aqrrneiqvPDLDG-----------------------------------yTTLKCDFHX   24
DSSP  -lllllllllLLLLL-----------------------------------lEEEEEELLL


DSSP  LL----LLLL-lLLHHhHHHHHHhllEEEEEEEELLLL----lllhHHHHHhHHHHHHLL
Query YL----QKTA-aDDFFqGTRAALvggTTMIIDHVVPEP----gsslLTSFEkWHEAADTK  111
ident                              |      |                       
Sbjct HSvfsdGLVWptVRVD-EAYRDG---LDAISLTEHIEYrphkqdvvSDHNR-SFDLCREQ   79
DSSP  LLllllLLLLhhHHHH-HHHHLL---LLEELLEEELLLllllllllLLLLH-HHHHHHHH


DSSP  L---LLEEEEEEELLlllllhhhhhhhhhhllllleeeeellllllLLLL----------
Query S---CCDYSLHVDITswydgvreelevlvqdkgvnsfqvymaykdvYQMS----------  158
ident              ||                                             
Sbjct AeklGILLIKGSEIT-------------------------------RAXApghfnaifls  108
DSSP  HhhhLLEELLEEEEE-------------------------------LLLLlleeeeelll


DSSP  ------hhHHHHHHHHHHHHLLEEEEE-LLLHHhhhhhhhhhhhllllllhhhhhhllhh
Query ------dsQLYEAFTFLKGLGAVILVH-AENGDliaqeqkrilemgitgpeghalsrpee  211
ident             ||   |  ||                                      
Sbjct dsnpleqkDYKDAFREAKKQGAFXFWNhPGWDS-----------------------qqpd  145
DSSP  llhhhlllLHHHHHHHHHHLLLEEEELlLLLLL-----------------------llll


DSSP  HHHHhhhhhHHHHHHhLLLE-EEEEE----LLHHHHHHHHHHHhhlllEEEEElhhhhhl
Query LEAEavfraITIAGRiNCPV-YITKV----MSKSAADIIALARkkgplVFGEPiaaslgt  266
ident           |           |           |                         
Sbjct TTKW--wpeHTALYQ-EGCXhGIEVAnghlYXPEAIQWCLDKN-----LTXIG-------  190
DSSP  LLLL--lhhHHHHHH-LLLLlEEEEEelleELLHHHHHHHHHL-----LEEEE-------


DSSP  llhhhhlllhhhhhhllllllllllllhhhhhhhhhhhllllllLLLLLLLlhhhhhhhl
Query dgthywsknwakaaafvtspplspdpttpdyltsllacgdlqvtGSGHCPYstaqkavgk  326
ident                                              |              
Sbjct --------------------------------------------TSDIHQP---------  197
DSSP  --------------------------------------------ELLLLLL---------


DSSP  llhhhllllllllllhhhhhhhhhlllllllhhhhhhhHLHH--------HHHHH-----
Query dnftlipegvngieermtvvwdkavatgkmdenqfvavTSTN--------AAKIF-----  373
ident                                                             
Sbjct ----------------------iqtdydfekgehrtxtFVFAkerslqgiREALDnrrta  235
DSSP  ----------------------hhhhllhhhllllleeEEEEllllhhhhHHHHHlllee


DSSP  -----------------lllllllllllllllleeeeeeEEEE---elllllllllllll
Query -----------------nlyprkgriavgsdadvviwdpDKLK---titakshksaveyn  413
ident                                                             
Sbjct ayfhelligredllrpffekcvkieevsrneqgvtlsitNVTDlvlklkktahdtllvyf  295
DSSP  eeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeELLLlleeeeelllllleell


DSSP  lllLLEEEeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllll
Query ifeGMECHgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglq  473
ident        |                                                    
Sbjct rdxTLKPH-----------------trytvrigfkqgikggdvnfevtnfivapdkglky  338
DSSP  leeEELLL-----------------eeeeeeeeellllllleeeeeeeeeeeelleeeee


DSSP  llll
Query gvsr  477
ident     
Sbjct tisl  342
DSSP  eeel