Results: dupa

Query: 3qy6A

MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3qy6-A 49.2  0.0  247   247  100 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   2:  1bf6-A 14.6  3.2  195   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   3:  3k2g-B 14.2  3.0  203   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   4:  2vun-A 14.1  2.9  189   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
   5:  3gg7-A 14.1  2.9  183   243   16 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
   6:  2y1h-B 13.9  3.0  187   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   7:  4b3z-D 13.9  3.1  203   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   8:  3au2-A 13.8  3.2  191   575   19 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   9:  1gkp-A 13.8  3.1  202   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  10:  1v77-A 13.8  2.9  181   202   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  11:  1yrr-B 13.5  3.5  190   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  12:  3cjp-A 13.4  2.8  181   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  13:  3irs-A 13.3  3.1  185   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  14:  2ob3-A 13.2  3.1  198   329   15 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  15:  2vc5-A 13.2  3.0  196   314   15 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  16:  3gri-A 13.0  3.3  197   422   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  17:  4dlf-A 13.0  3.1  195   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  18:  4cqb-A 12.9  3.6  200   402   14 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  19:  1m65-A 12.9  3.6  189   234   19 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  20:  1a5k-C 12.9  3.0  195   566   13 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  21:  4mup-B 12.7  3.3  193   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  22:  2ffi-A 12.6  3.2  191   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  23:  3icj-A 12.5  3.6  188   468   10 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  24:  3dcp-A 12.5  3.6  188   277   15 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  25:  1onx-A 12.4  3.0  191   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  26:  2oof-A 12.3  3.3  189   403   14 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  27:  3e74-A 12.1  3.2  193   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  28:  1k6w-A 12.1  3.9  203   423    8 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  29:  3pnu-A 12.0  3.1  191   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  3nqb-A 12.0  3.2  182   587   16 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  31:  3mtw-A 12.0  3.5  186   404   12 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  32:  3mkv-A 11.9  3.4  186   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  33:  2ogj-A 11.9  2.8  186   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  34:  3giq-A 11.6  3.2  198   475   13 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  35:  3ls9-A 11.5  3.5  186   453   10 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  36:  1j6p-A 11.4  3.3  182   407    9 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  37:  2paj-A 11.1  3.2  178   421    9 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  38:  2dvt-A 11.0  3.5  190   325    9 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  39:  4ofc-A 10.9  3.3  190   335   11 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  40:  4hk5-D 10.9  3.4  188   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  41:  4c5y-A 10.7  3.5  181   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  42:  3f2b-A 10.5  3.4  167   994   14 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  43:  2qpx-A 10.4  3.3  183   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  44:  1a4m-A 10.4  4.1  197   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  45:  2gwg-A 10.1  3.4  186   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  46:  2imr-A 10.1  3.5  180   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  47:  3iac-A  9.9  3.0  184   469   15 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  4qrn-A  9.9  3.6  187   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  49:  3ooq-A  9.7  3.8  176   384   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  4rdv-B  9.5  3.2  181   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  51:  1itq-A  9.5  3.5  195   369   10 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  52:  2uz9-A  9.4  3.6  183   444   16 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  53:  1j5s-A  9.3  3.2  180   451   10 PDB  MOLECULE: URONATE ISOMERASE;                                         
  54:  2anu-A  9.1  3.7  161   224   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  55:  2yb1-A  8.1  3.0  144   284   20 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  56:  4dzi-C  8.1  3.4  173   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  57:  2a3l-A  7.3  4.0  180   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  58:  3e38-A  6.7  3.7  154   342   15 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  1bks-A  4.6  4.5  144   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3qy6A Sbjct=3qy6A Z-score=49.2

back to top
DSSP  LEELLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLEEELLLEELLLLLLLLHHHHHHHHH
Query MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAAD   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAAD   60
DSSP  LEELLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLLEEELLLEELLLLLLLLHHHHHHHHH


DSSP  HHHHHHHHLLLLLEEELLLEEELLLLHHHHHHLLLLLLHHHLLEEEEELLLLLLLLLHHH
Query QLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQ  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQ  120
DSSP  HHHHHHHHLLLLLEEELLLEEELLLLHHHHHHLLLLLLHHHLLEEEEELLLLLLLLLHHH


DSSP  HHHHHHHLLLEEEEELHHHLHHHHHLLHHHHHHHHLLLEEEEEHHHHLLLLLHHHHHHHH
Query LFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSL  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSL  180
DSSP  HHHHHHHLLLEEEEELHHHLHHHHHLLHHHHHHHHLLLEEEEEHHHHLLLLLHHHHHHHH


DSSP  HHHHLLLLLEEELLLLLLLLLLLLHHHHHHHHHHHHLLHHHHHHHHHHHHHHLLLLLLLL
Query RLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQ  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQ  240
DSSP  HHHHLLLLLEEELLLLLLLLLLLLHHHHHHHHHHHHLLHHHHHHHHHHHHHHLLLLLLLL


DSSP  LLLLLLL
Query PPQPVKR  247
ident |||||||
Sbjct PPQPVKR  247
DSSP  LLLLLLL


No 2: Query=3qy6A Sbjct=1bf6A Z-score=14.6

back to top
DSSP  ------LEELLLLLllLLLL---------lLLLHHHHHHHHHHHHHLLLLEEELLLEell
Query ------MIDIHCHIlpAMDD---------gAGDSADSIEMARAAVRQGIRTIIATPHhnn   45
ident           | |     |               |            | |  |       
Sbjct sfdptgYTLAHEHL--HIDLsgfknnvdcrLDQYAFICQEMNDLMTRGVRNVIEMTN---   55
DSSP  llllllEEEEEELL--LEELhhhhllhhheELLHHHHHHHHHHHHHLLEEEEEELLL---


DSSP  llLLLLhhhHHHHHHHHHHHHhhlllLLEEELL---------------------------
Query gvYKNEpaaVREAADQLNKRLikediPLHVLPG---------------------------   78
ident                              |                              
Sbjct --RYMG--rNAQFMLDVMRET-----GINVVACtgyyqdaffpehvatrsvqelaqemvd  106
DSSP  --HHHL--lLHHHHHHHHHHH-----LLEEEEEellllhhhlllhhhhllhhhhhhhhhh


DSSP  ----------------LEEEL--------LLLHHHHHHLLllllhhhLLEEEEELLLlll
Query ----------------QEIRI--------YGEVEQDLAKRqllslndTKYILIEFPFdhv  114
ident                  ||             |    |            |     |   
Sbjct eieqgidgtelkagiiAEIGTsegkitplEEKVFIAAALA---hnqtGRPISTHTSF---  160
DSSP  hhhllllllllleeeeEEEELllllllhhHHHHHHHHHHH---hhhhLLLEEEELHH---


DSSP  llLHHHHHHHHHHLLL---EEEEELHHhLHHHhhlLHHHHHHHHLLLEEEE-EHHHhlll
Query prYAEQLFYDLQLKGY---IPVIAHPErNREIrenPSLLYHLVEKGAASQI-TSGSlagi  170
ident           ||  |         |                    ||  |  | |     
Sbjct stMGLEQLALLQAHGVdlsRVTVGHCD-LKDN---LDNILKMIDLGAYVQFdTIGK----  212
DSSP  hlLHHHHHHHHHHLLLlhhHEEELLLL-LLLL---HHHHHHHHHLLLEEEElLLLL----


DSSP  LLHHHHHHHHHHHHLL------llLEEELLLLLLL------LLLL-LHHH-HHHHHHHH-
Query FGKQLKAFSLRLVEAN------liHFVASDAHNVK------TRNF-HTQE-ALYVLEKE-  215
ident               |              |                         |    
Sbjct NSYYPDEKRIAMLHALrdrgllnrVMLSMDITRRShlkangGYGYdYLLTtFIPQLRQSg  272
DSSP  LLLLLHHHHHHHHHHHhhlllhhhEEELLLLLLHHhlhhhlLLLLlHHHHlHHHHHHHLl


DSSP  HLLHHHHHHH-HHHHHHHLllllllllllllll
Query FGSELPYMLT-ENAELLLRnqtifrqppqpvkr  247
ident |          ||                    
Sbjct FSQADVDVMLrENPSQFFQ--------------  291
DSSP  LLHHHHHHHHlHHHHHHLL--------------


No 3: Query=3qy6A Sbjct=3k2gB Z-score=14.2

back to top
DSSP  ----------------------------LEELLLLLlLLLL-------------------
Query ----------------------------MIDIHCHIlPAMD-------------------   13
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalgHTLXHEHL-QNDCrcwwnppqeperqylaeap   59
DSSP  llllllllllllleeeelleeeehhhllLEELLLLL-LEELhhhllllllhhhhhhhhll


DSSP  -------------------llLLLHHHHHHHHHHHHHLLLLEEELLLEellllLLLLhhH
Query -------------------dgAGDSADSIEMARAAVRQGIRTIIATPHhnngvYKNEpaA   54
ident                        |    |         | | |                 
Sbjct isieilselrqdpfvnkhniaLDDLDLAIAEVKQFAAVGGRSIVDPTC-----RGIG--R  112
DSSP  llhhhhhhhhllhhhllllleELLHHHHHHHHHHHHHLLLLEEEELLL-----LLLL--L


DSSP  HHHHHHHHHHHHhhlllLLEEELL------------------------------------
Query VREAADQLNKRLikediPLHVLPG------------------------------------   78
ident                     |  |                                    
Sbjct DPVKLRRISAET-----GVQVVXGagyylassxpetaarlsaddiadeivaealegtdgt  167
DSSP  LHHHHHHHHHHH-----LLEEEELlllllhhhllhhhhlllhhhhhhhhhhhhhllllll


DSSP  -------LEEEL-----------LLLHHHHHHLLllllhhhlLEEEEELLLLLLL-LLHH
Query -------QEIRI-----------YGEVEQDLAKRqllslndtKYILIEFPFDHVP-RYAE  119
ident         ||                                       |          
Sbjct darigliGEIGVssdftaeeeksLRGAARAQVRT-------gLPLXVHLPGWFRLaHRVL  220
DSSP  lllllleEEELLlllllhhhhhhHHHHHHHHHHH-------lLLEEELLLLLLLLhHHHH


DSSP  HHHHHhhHLLL--EEEEELHHHlhhHHHLLHHHHHHHHLLLEEEE-EHHH----hlllll
Query QLFYDlqLKGY--IPVIAHPERnreIRENPSLLYHLVEKGAASQI-TSGS----lagifg  172
ident  |             |  |          |     |   ||       |           
Sbjct DLVEE--EGADlrHTVLCHXNP---SHXDPVYQATLAQRGAFLEFdXIGXdffyadqgvq  275
DSSP  HHHHH--LLLLhhHEEELLLHH---HLLLHHHHHHHHHHLLEEEElLLLLlleellllee


DSSP  hHHHHHHHHHHHLL------lLLEEELLL----LLLL--LLLL-LHHH-HHHHHHHH-HL
Query kQLKAFSLRLVEAN------lIHFVASDA----HNVK--TRNF-HTQE-ALYVLEKE-FG  217
ident         |                  |                      |  |      
Sbjct cPSDDEVARAILGLadhgyldRILLSHDVfvkxXLTRygGNGYaFVTKhFLPRLRRHgLD  335
DSSP  lLLHHHHHHHHHHHhhlllhhHEEELLLLllhhHLHHhlLLLLlHHHHlHHHHHHHLlLL


DSSP  LHHHHHHH-HHHHHHHlLLLLLLLlllllll
Query SELPYMLT-ENAELLLrNQTIFRQppqpvkr  247
ident       |   |         |          
Sbjct DAALETLXvTNPRRVF-DASIEGH-------  358
DSSP  HHHHHHHHlHHHHHHH-LLLLLLL-------


No 4: Query=3qy6A Sbjct=2vunA Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  -LEELLLLLLLllllllllHHHH-----hHHHHHHHHLLLLEEELLLE-ellLLLL---l
Query -MIDIHCHILPamddgagdSADS-----iEMARAAVRQGIRTIIATPH-hnnGVYK---n   50
ident    | | |                          |   |  | |        |  |    
Sbjct gLLDTHVHVSG--------GDYAprqktmDFISSALHGGVTTMISAGSphfpGRPKdaag  112
DSSP  lEEEEEELLLL--------LLEEhhhleeLHHHHHHLLLEEEEEELLLllllLLLLlhhh


DSSP  LHHHHHHHHHHHHHHHhhllLLLE-EELL-----------------------LEEE----
Query EPAAVREAADQLNKRLikedIPLH-VLPG-----------------------QEIR----   82
ident   |                                                  |      
Sbjct TKALAITLSKSYYNAR---pAGVKvHGGAvilekglteedfiemkkegvwivGEVGlgti  169
DSSP  HHHHHHHHHHHHHHLL---hHHLEeELLEelllllllhhhhhhhhhlllleeEEELllll


DSSP  LLLL-HHHHHHLLllllhhhLLEEEEELLL------LLLL-LLHHHHHhhhhhlllEEEE
Query IYGE-VEQDLAKRqllslndTKYILIEFPF------DHVP-RYAEQLFydlqlkgyIPVI  134
ident    |                                  |                   | 
Sbjct KNPEdAAPMVEWA----hkhGFKVQMHTGGtsipgsSTVTaDDVIKTK--------PDVV  217
DSSP  LLHHhHHHHHHHH----hhlLLEEEEELLLllllllLLLLhHHHHHHL--------LLEE


DSSP  ELHHH--LHHHhhlLHHHHHHHHLL-LEEEEEHHHhlllllhhHHHHHHHHHHLL-----
Query AHPER--NREIrenPSLLYHLVEKG-AASQITSGSlagifgkqLKAFSLRLVEAN-----  186
ident  |                         |  |                             
Sbjct SHINGgpTAIS---VQEVDRIMDETdFAMEIVQCG--------NPKIADYVARRAaekgq  266
DSSP  ELLLLllLLLL---HHHHHHHHHHLlLEEEEELLL--------LHHHHHHHHHHHhhhll


DSSP  -lLLEEELLLLLllLLLL--LHHHHHHHHHHH--HLLHHHHHH-HHHHHHHHLLL-----
Query -lIHFVASDAHNvkTRNF--HTQEALYVLEKE--FGSELPYML-TENAELLLRNQ-----  235
ident         ||    |                      |      | |             
Sbjct lgRVIFGNDAPS-gTGLIplGILRNMCQIASMsdIDPEVAVCMaTGNSTAVYGLNtgvia  325
DSSP  hhHEEEELLLLL-lLLLLllHHHHHHHHHHHHllLLHHHHHHHhLHHHHHHHLLLlllll


DSSP  ------------------------------------------------llllllllllll
Query ------------------------------------------------tifrqppqpvkr  247
ident                                                             
Sbjct pgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  lllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 5: Query=3qy6A Sbjct=3gg7A Z-score=14.1

back to top
DSSP  -LEELLLLLLlllllLLLLhhhHHHHHHHHHHLLLlEEELLLEelllllllLHHHhHHHH
Query -MIDIHCHILpamddGAGDsadSIEMARAAVRQGIrTIIATPHhnngvyknEPAAvREAA   59
ident   || | |          |       |||       |               |||     
Sbjct sLIDFHVHLD-----LYPD---PVAVARACEERQL-TVLSVTT--------TPAA-WRGT   42
DSSP  lLEEEEELHH-----HLLL---HHHHHHHHHHLLL-EEEELLL--------LHHH-HHHH


DSSP  HHHHHhhhhllLLLEEELL----------------------------LEEEL--------
Query DQLNKrlikedIPLHVLPG----------------------------QEIRI--------   83
ident   |           ||                                |           
Sbjct LALAA------GRPHVWTAlgfhpevvseraadlpwfdrylpetrfvGEVGLdgspslrg   96
DSSP  HHHHL------LLLLEEELllllhhhllllhhhlhhhhhhhhhlleeEEEELlllhhhhh


DSSP  --------LLLHHHHHHLLllllhhhlLEEEEELLlLLLLlLHHHHHHHHHhLLLEEEEE
Query --------YGEVEQDLAKRqllslndtKYILIEFPfDHVPrYAEQLFYDLQlKGYIPVIA  135
ident                                |                        |   
Sbjct twtqqfavFQHILRRCEDH------ggRILSIHSR-RAES-EVLNCLEANP-RSGTPILH  147
DSSP  hhhhhhhhHHHHHHHHHHL------llEEEEEELL-LLHH-HHHHHHHHLH-HHEEEEEE


DSSP  LHHhlhhhhhLLHHHHHHHHLLLEEEEEHHHHlllllhhHHHHHHHHHHLLL--LLEEEL
Query HPErnreireNPSLLYHLVEKGAASQITSGSLagifgkqLKAFSLRLVEANL--IHFVAS  193
ident               |      |                        |             
Sbjct WYS------gSVTELRRAISLGCWFSVGPTMV-------RTQKGAALIRSMPrdRVLTET  194
DSSP  LLL------lLHHHHHHHHHLLLEEEELHHHH-------LLHHHHHHHHHLLhhHEEELL


DSSP  LLL----llLLLLL-LHHHHHHHHHHHHLL---HHHHHHHHHHHHHHLLlllllllllll
Query DAH----nvKTRNF-HTQEALYVLEKEFGS---ELPYMLTENAELLLRNqtifrqppqpv  245
ident |                      | |       |      ||   ||             
Sbjct DGPfleldgQAALPwDVKSVVEGLSKIWQIpasEVERIVKENVSRLLGT-----------  243
DSSP  LLLlleellEELLHhHHHHHHHHHHHHHLLlhhHHHHHHHHHHHHHHHL-----------


DSSP  ll
Query kr  247
ident   
Sbjct --  243
DSSP  --


No 6: Query=3qy6A Sbjct=2y1hB Z-score=13.9

back to top
DSSP  ---LEELLLLLLLLlllLLLLhhHHHHHHHHHHHLLLLEEELLLEelllllllLHHHHhH
Query ---MIDIHCHILPAmddGAGDsaDSIEMARAAVRQGIRTIIATPHhnngvyknEPAAVrE   57
ident      | |||             |       |         |                 |
Sbjct gvgLVDCHCHLSAP---DFDR--DLDDVLEKAKKANVVALVAVAE--------HSGEF-E   46
DSSP  lllEEEEEELLLLH---HHLL--LHHHHHHHHHHLLEEEEEELLL--------LHHHH-H


DSSP  HHHHHHHHHHhllllLEEELL------------------------------------LEE
Query AADQLNKRLIkedipLHVLPG------------------------------------QEI   81
ident    ||  |         |||                                      | 
Sbjct KIMQLSERYN-----GFVLPClgvhpvqgldqrsvtlkdldvalpiienykdrllaiGEV  101
DSSP  HHHHHHHHLL-----LLEEEEelllleelllleellhhhhhhhhhhhhhhllllleeEEE


DSSP  EL----------------LLLHHHHHHLlllllhhhLLEEEEELLlLLLLlLHHHHHHHH
Query RI----------------YGEVEQDLAKrqllslndTKYILIEFPfDHVPrYAEQLFYDL  125
ident                                                        |    
Sbjct GLdfsprfagtgeqkeeqRQVLIRQIQL----akrlNLPVNVHSR-SAGR-PTINLLQEQ  155
DSSP  EEellllllllhhhhhhhHHHHHHHHHH----hhhhLLLEEEEEE-LLHH-HHHHHHHHL


DSSP  HhlLLEEEEELHHhlhhhhhLLHHHHHHHHLLLEEEEEHhHHLLlllhhhHHHHHHHHHL
Query QlkGYIPVIAHPErnreireNPSLLYHLVEKGAASQITSgSLAGifgkqlKAFSLRLVEA  185
ident                      ||     |  |    |   |               ||  
Sbjct G--AEKVLLHAFD------gRPSVAMEGVRAGYFFSIPP-SIIR------SGQKQKLVKQ  200
DSSP  L--LLLEEEELLL------lLHHHHHHHHHLLLEEEELH-HHHL------LHHHHHHHHH


DSSP  LL--LLEEELLLL-----llLLLLL-LHHHHHHHHHHHH--LLHHH-HHHHHHHHHHHLL
Query NL--IHFVASDAH-----nvKTRNF-HTQEALYVLEKEF--GSELP-YMLTENAELLLRN  234
ident           |                                |      | ||  |   
Sbjct LPltSICLETDSPalgpekqVRNEPwNISISAEYIAQVKgiSVEEViEVTTQNALKLFPK  260
DSSP  LLhhHEEELLLLLlllllllLLLLHhHHHHHHHHHHHHHllLHHHHhHHHHHHHHHHLLL


DSSP  lllllllllllll
Query qtifrqppqpvkr  247
ident              
Sbjct --------lrhll  265
DSSP  --------hhhhl


No 7: Query=3qy6A Sbjct=4b3zD Z-score=13.9

back to top
DSSP  ------------------------------------------------------LEELLL
Query ------------------------------------------------------MIDIHC    6
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipgGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeelEEEEEE


DSSP  LLLllllllLLLHHHHHHHHHHHHHLLLLEEELLLEellLLLLlLHHHHHHHHHHHHHHH
Query HILpamddgAGDSADSIEMARAAVRQGIRTIIATPHhnnGVYKnEPAAVREAADQLNKRL   66
ident               |     |||   |   ||                  |         
Sbjct YLQ------KTAADDFFQGTRAALVGGTTMIIDHVV--pEPGS-SLLTSFEKWHEAADTK  111
DSSP  LLL------LLLLLLHHHHHHHHHHLLEEEEEEEEL--lLLLL-LHHHHHHHHHHHHHLL


DSSP  hhllLLLEEELLL-------------------------EEEL------------LLLHHH
Query ikedIPLHVLPGQ-------------------------EIRI------------YGEVEQ   89
ident                                                         |   
Sbjct ----SCCDYSLHVditswydgvreelevlvqdkgvnsfQVYMaykdvyqmsdsqLYEAFT  167
DSSP  ----LLLEEEEEEelllllllhhhhhhhhhhllllleeEEELlllllllllhhhHHHHHH


DSSP  HHHLLllllhhhlLEEEEELL-----------------------------lLLLL--lLH
Query DLAKRqllslndtKYILIEFP-----------------------------fDHVP--rYA  118
ident  |             ||                                          |
Sbjct FLKGL-------gAVILVHAEngdliaqeqkrilemgitgpeghalsrpeeLEAEavfRA  220
DSSP  HHHHH-------lLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhHHHHhhhHH


DSSP  HHHHHHHHhllLEEEEELHhHLHHHhhlLHHHHHHHH--LLLEEEEEHHHHlLLLL----
Query EQLFYDLQlkgYIPVIAHPeRNREIrenPSLLYHLVE--KGAASQITSGSLaGIFG----  172
ident                |                                 || |  |    
Sbjct ITIAGRIN---CPVYITKV-MSKSA---ADIIALARKkgPLVFGEPIAASL-GTDGthyw  272
DSSP  HHHHHHHL---LLEEEEEE-LLHHH---HHHHHHHHHhlLLEEEEELHHHH-HLLLhhhh


DSSP  -------------------HHHHHHHHHHHHLLLLLEEELLLLL----------------
Query -------------------KQLKAFSLRLVEANLIHFVASDAHN----------------  197
ident                             |          |                    
Sbjct sknwakaaafvtspplspdPTTPDYLTSLLACGDLQVTGSGHCPystaqkavgkdnftli  332
DSSP  lllhhhhhhllllllllllLLHHHHHHHHHHHLLLLLLLLLLLLllhhhhhhhlllhhhl


DSSP  llLLLL--LHHHHHH-HHHH--HHLLHHHHHH-HHHHHHHHL------------------
Query vkTRNF--HTQEALY-VLEK--EFGSELPYML-TENAELLLR------------------  233
ident     |                              ||                       
Sbjct peGVNGieERMTVVWdKAVAtgKMDENQFVAVtSTNAAKIFNlyprkgriavgsdadvvi  392
DSSP  llLLLLllLHHHHHHhHHLLllLLLHHHHHHHhLHHHHHHHLllllllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  233
ident                                                             
Sbjct wdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfipr  452
DSSP  eeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllll


DSSP  ---LLLL--------llllllllll
Query ---NQTI--------frqppqpvkr  247
ident                          
Sbjct kafPEHLyqrvkirnkvfglqgvsr  477
DSSP  lllLHHHhhhhhhhhhhllllllll


No 8: Query=3qy6A Sbjct=3au2A Z-score=13.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -------------------------------------LEELLLLLllLLLLLLLlhhHHH
Query -------------------------------------MIDIHCHIlpAMDDGAGdsaDSI   23
ident                                        |   |      ||        
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHS--TYSDGQN---TLE  355
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELL--LLLLLLL---LHH


DSSP  HHHHHHHHLLLLEEELLLEELL---LLLL--lLHHHHHHHHHHHHHHHHhlllLLEEELL
Query EMARAAVRQGIRTIIATPHHNN---GVYK--nEPAAVREAADQLNKRLIkediPLHVLPG   78
ident |   ||   | |    | |             |           |        |   | |
Sbjct ELWEAAKTMGYRYLAVTDHSPAvrvAGGPspeEALKRVGEIRRFNETHG----PPYLLAG  411
DSSP  HHHHHHHHHLLLEEEEEEELHHhhlLLLLlhhHHHHHHHHHHHHHHHHL----LLEEEEE


DSSP  LEEELL--LLHHhhHHLLL--LLLHhhlleEEEELLLLL------LLLLHHHHHHHHhhl
Query QEIRIY--GEVEqdLAKRQ--LLSLndtkyILIEFPFDH------VPRYAEQLFYDLqlk  128
ident  |  |   |             | |      |                            
Sbjct AEVDIHpdGTLD--YPDWVlrELDL-----VLVSVHSRFnlpkadQTKRLLKALENP---  461
DSSP  EEEELLllLLLL--LLHHHhlLLLE-----EEEELLLLLlllhhhHHHHHHHHHLLL---


DSSP  lLEEEEELHHHL---hhhHHLLhHHHHHHHLL----LEEEEEHHHhlllllhhhhhhHHH
Query gYIPVIAHPERN---reiRENPsLLYHLVEKG----AASQITSGSlagifgkqlkafSLR  181
ident     | |||                     |      |  |                   
Sbjct -FVHVLAHPTARllgrraPIEA-DWEAVFQKAkekgVAVEIDGYY-------drmdlPDD  512
DSSP  -LLLEELLLLLLllllllLLLL-LHHHHHHHHhhhlLEEEEELLL-------lllllLHH


DSSP  HHHLL----LLLEEELLLLLLllLLLL-HHHHHHHHHHHHllhHHHHHHhHHHH---hHL
Query LVEAN----LIHFVASDAHNVktRNFH-TQEALYVLEKEFgseLPYMLTeNAEL---lLR  233
ident |        |      |||            |                     |    | 
Sbjct LARMAygmgLWISLSTDAHQT--DHLRfMELAVGTAQRAW---IGPERV-LNTLdyedLL  566
DSSP  HHHHHhhllLLEEEELLLLLH--HHHHhHHHHHHHHHHLL---LLLLLL-HHHLlhhhHH


DSSP  LLllllllllllll
Query NQtifrqppqpvkr  247
ident               
Sbjct SW-----lkarrgv  575
DSSP  HH-----hhlllll


No 9: Query=3qy6A Sbjct=1gkpA Z-score=13.8

back to top
DSSP  -----------------------------------------------------LEELLLL
Query -----------------------------------------------------MIDIHCH    7
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeelEEEEEEL


DSSP  LLLLLllllLLHHHHHHHHHHHHHLLLLEEELLLEELLLLlllLHHHHHHHhHHHHHHHh
Query ILPAMddgaGDSADSIEMARAAVRQGIRTIIATPHHNNGVyknEPAAVREAaDQLNKRLi   67
ident |                   ||   |  | |                             
Sbjct IYLPF-matFAKDTHETGSKAALMGGTTTYIEMCCPSRND--dALEGYQLW-KSKAEGN-  115
DSSP  LLLEE-lleELLLLHHHHHHHHHHLLEEEEEEEELLLLLL--lHHHHHHHH-HHHHLLL-


DSSP  hllLLLEEELLL------------------------EEEL---------LLLHHHHHHLl
Query kedIPLHVLPGQ------------------------EIRI---------YGEVEQDLAKr   94
ident                                      |            ||  | |   
Sbjct ---SYCDYTFHMavskfdektegqlreivadgissfXIFLsyknffgvdDGEMYQTLRL-  171
DSSP  ---LLLEEEEEEelllllllhhhhhhhhhhlllleeEEEElllllllllHHHHHHHHHH-


DSSP  llllhhhlLEEEEELL-----------------------------lLLLL--lLHHHHHH
Query qllslndtKYILIEFP-----------------------------fDHVP--rYAEQLFY  123
ident                                                             
Sbjct ---akelgVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEgtaRFATFLE  228
DSSP  ---hhhhlLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHhhhHHHHHHH


DSSP  HHHhllLEEEEELHHhLHHHhhlLHHHHHHHH--LLLEEEEEHHHHlLLLL---------
Query DLQlkgYIPVIAHPErNREIrenPSLLYHLVE--KGAASQITSGSLaGIFG---------  172
ident             |                                               
Sbjct TTG---ATGYVVHLS-CKPA---LDAAMAAKArgVPIYIESVIPHF-LLDKtyaerggve  280
DSSP  HHL---LEEEELLLL-LHHH---HHHHHHHHHllLLEEEEEEHHHH-HLLHhhhhllhhh


DSSP  ------------HHHHHHHHHHHHLLLLLEEELLLLL----------------llLLLL-
Query ------------KQLKAFSLRLVEANLIHFVASDAHN----------------vkTRNF-  203
ident             |              |  |  |                          
Sbjct amkyimspplrdKRNQKVLWDALAQGFIDTVGTDHCPfdteqkllgkeaftaipnGIPAi  340
DSSP  hhllllllllllLHHHHHHHHHHHLLLLLEEELLLLLllhhhhhhhlllhhhlllLLLLl


DSSP  -LHHHHHH-HHHH--HHLLHHHHHH-HHHHHHHHLLL-----------------------
Query -HTQEALY-VLEK--EFGSELPYML-TENAELLLRNQ-----------------------  235
ident       ||                     |  |                           
Sbjct eDRVNLLYtYGVSrgRLDIHRFVDAaSTKAAKLFGLFprkgtiavgsdadlvvydpqyrg  400
DSSP  lLHHHHHHhHHLLllLLLHHHHHHHhLHHHHHHLLLLllllllllllllleeeeelllle


DSSP  ----------------------------------------------llllllllllll
Query ----------------------------------------------tifrqppqpvkr  247
ident                                                           
Sbjct tisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  ellhhhllllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 10: Query=3qy6A Sbjct=1v77A Z-score=13.8

back to top
DSSP  --LEELLLLLllllllllllhhhhHHHHHHHHHlLLLEEELLLEELLlllLLLHHHHHHH
Query --MIDIHCHIlpamddgagdsadsIEMARAAVRqGIRTIIATPHHNNgvyKNEPAAVREA   58
ident    |                     |    |              |           |||
Sbjct vkFIEMDIRD--------------KEAYELAKE-WFDEVVVSIKFNE---EVDKEKLREA   42
DSSP  llLEEEEELL--------------HHHHHHHHH-HLLEEEEEEEELL---LLLHHHHHHH


DSSP  HHHHhhhhhhllllleEELLLEEE-LLLL-HHHHHHLLLLLLhhhlleEEEELLlllLLL
Query ADQLnkrlikediplhVLPGQEIR-IYGE-VEQDLAKRQLLSlndtkyILIEFPfdhVPR  116
ident                               |     |           |  |       |
Sbjct RKEY------------GKVAILLSnPKPSlVRDTVQKFKSYL------IYVESN---DLR   81
DSSP  HHHH------------LLEEEEEElLLHHhHHHHHHHLLLLE------EEEELL---LHH


DSSP  LHHHHHHHhhhllLEEEEELHHHLHHHHhllhHHHHHHHLL----LEEEEEHHHhlLLLL
Query YAEQLFYDlqlkgYIPVIAHPERNREIRenpsLLYHLVEKG----AASQITSGSlaGIFG  172
ident                  |  |  ||           |         |             
Sbjct VIRYSIEK-----GVDAIISPWVNRKDP---gIDHVLAKLMvkknVALGFSLRP--LLYS  131
DSSP  HHHHHHHL-----LLLEEELLLLLLLLL---lLLHHHHHHHhhhlLEEEEELHH--HHHL


DSSP  -----HHHHHHHHHHHHLL----LLLEEELLLLLLLllLLLH-HHHHHHHHH-HHLLHHH
Query -----KQLKAFSLRLVEAN----LIHFVASDAHNVKtrNFHT-QEALYVLEK-EFGSELP  221
ident        |  |               |  | |                            
Sbjct npyerANLLRFMMKAWKLVekykVRRFLTSSAQEKW--DVRYpRDLISLGVViGMEIPQA  189
DSSP  lhhhhHHHHHHHHHHHHHHhhhlLLEEEELLLLLHH--HLLLhHHHHHHHHHlLLLHHHH


DSSP  HHHH-HHHHHHHLllllllllllllll
Query YMLT-ENAELLLRnqtifrqppqpvkr  247
ident         |  |               
Sbjct KASIsMYPEIILK--------------  202
DSSP  HHLLlHHHHHHHL--------------


No 11: Query=3qy6A Sbjct=1yrrB Z-score=13.5

back to top
DSSP  -----------------------------------------------------LEELLLL
Query -----------------------------------------------------MIDIHCH    7
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeelEEEEEEL


DSSP  L---lLLLL-llllLHHHHHHHHHHHHHLLLLEEELLLEELllllllLHHHHHHHHHHHH
Query I---lPAMD-dgagDSADSIEMARAAVRQGIRTIIATPHHNngvyknEPAAVREAADQLN   63
ident         |            |  |    |      |                       
Sbjct GcggvQFNDtaeavSVETLEIMQKANEKSGCTNYLPTLITT---sdeLMKQGVRVMREYL  117
DSSP  EelleELLLlllllLHHHHHHHHHHHHLLLEEEEEEEELLL---lhhHHHHHHHHHHHHH


DSSP  HHHHhllllLEEELLLE----------------------EELLL-----LHHHHHHLlll
Query KRLIkedipLHVLPGQE----------------------IRIYG-----EVEQDLAKrql   96
ident                 |                                           
Sbjct AKHP----nQALGLHLEgpwlnaalvdflcenadvitkvTLAPEmvpaeVISKLANA---  170
DSSP  HHLL----lLLLLEEEEllllllhhhhhhhhlhhheeeeEELHHhllhhHHHHHHHH---


DSSP  llhhhLLEEEEELLlLLLLLLHHHHHHHHhhllleEEEELHHH-LHHH----hhllHHHH
Query lslndTKYILIEFPfDHVPRYAEQLFYDLqlkgyiPVIAHPER-NREI----renpSLLY  151
ident                      |   |             |       |            
Sbjct -----GIVVSAGHS-NATLKEAKAGFRAG-----iTFATHLYNaMPYItgrepglaGAIL  219
DSSP  -----LLEEEELLL-LLLHHHHHHHHHHL-----eEEELLLLLlLLLLlllllhhhHHHH


DSSP  HHHhlLLEEEEEhhhHLLLLlhhHHHHHHHHHHLLL-LLEEELLLLllLLLLLLHHHHHH
Query HLVekGAASQITsgsLAGIFgkqLKAFSLRLVEANL-IHFVASDAHnvKTRNFHTQEALY  210
ident           |      |       |                 ||           |   
Sbjct DEA--DIYCGII---ADGLH--vDYANIRNAKRLKGdKLCLVTDAT--SGSSLTMIEGVR  270
DSSP  HLL--LLEEEEE---LLLLL--lLHHHHHHHHHHHHhHEEEELLLL--LLLLLLHHHHHH


DSSP  HHHH--HHLLHHHHHH-HHHHHHHHLLL------------------------llllllll
Query VLEK--EFGSELPYML-TENAELLLRNQ------------------------tifrqppq  243
ident  |               |                                          
Sbjct NLVEhcGIALDEVLRMaTLYPARAIGVEkrlgtlaagkvanltaftpdfkitktivngne  330
DSSP  HHHHhhLLLHHHHHHHhLHHHHHHLLLLllllllllllllleeeellllleeeeeellee


DSSP  llll
Query pvkr  247
ident     
Sbjct vvtq  334
DSSP  eeel


No 12: Query=3qy6A Sbjct=3cjpA Z-score=13.4

back to top
DSSP  -LEELLLLLLLllllllllhhHHHHHHHHHHHLLLLEEELLL------------------
Query -MIDIHCHILPamddgagdsaDSIEMARAAVRQGIRTIIATP------------------   41
ident   || | |                         |    |                     
Sbjct lIIDGHTHVIL----------PVEKHIKIMDEAGVDKTILFStsihpetavnlrdvkkem   50
DSSP  lLEEEEEELLL----------LHHHHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhh


DSSP  -----eeLLLLLL--lLHHHHHHHHHHHHHHHHhllllLEEELL----------------
Query -----hhNNGVYK--nEPAAVREAADQLNKRLIkedipLHVLPG----------------   78
ident        |                                                    
Sbjct kklndvvNGKTNSmidVRRNSIKELTNVIQAYP-----SRYVGFgnvpvglsendtnsyi  105
DSSP  hhhhhhhLLLLLLlhhHHHHHHHHHHHHHHHLL-----LLEEEEelllllllhhhhhhhh


DSSP  ------------LEEEL----LLLHHHHHHLlllllhhhlLEEEEELLL-LLLL--LLHH
Query ------------QEIRI----YGEVEQDLAKrqllslndtKYILIEFPF-DHVP--RYAE  119
ident              |                            | |               
Sbjct eenivnnklvgiGELTPasgqIKSLKPIFKY---smdsgsLPIWIHAFNpLVLQdiKEIA  162
DSSP  hhhllllllleeEEELLllllHHHHHHHHHH---hhhlllLLEEELLLLlLLHHhhHHHH


DSSP  HHHHHHHhlLLEEEEELHhhLHHHhhllHHHHHHHHLL--LEEEEEhhhhlllllhhHHH
Query QLFYDLQlkGYIPVIAHPerNREIrenpSLLYHLVEKG--AASQITsgslagifgkqLKA  177
ident  |              |                |                          
Sbjct ELCKAFP--KVPVILGHM-gGSNW----MTAVELAKEIqnLYLDTS--------ayfSTF  207
DSSP  HHHHHLL--LLLEEEHHH-hHHHH----HHHHHHHHHLllEEEELL--------lllLHH


DSSP  HHHHHHHLL-lLLEEELLLLlllLLLL-LHHHHHHHHHhhHLLHHHHHH-HHHHHHHHLl
Query FSLRLVEAN-lIHFVASDAHnvkTRNF-HTQEALYVLEkeFGSELPYML-TENAELLLRn  234
ident                  |             ||         |         |   ||  
Sbjct VLKIVINELplKCIFGTDMP---FGDLqLSIEAIKKMS--NDSYVANAVlGDNISRLLN-  261
DSSP  HHHHHHHHLllLEELLLLLL---LLLHhHHHHHHHHHL--LLHHHHHHHhLHHHHHHHL-


DSSP  lllllllllllll
Query qtifrqppqpvkr  247
ident              
Sbjct ------------i  262
DSSP  ------------l


No 13: Query=3qy6A Sbjct=3irsA Z-score=13.3

back to top
DSSP  --LEELLLLLLLLLLL-----------------------llllhHHHHHHHHHHHHLLLL
Query --MIDIHCHILPAMDD-----------------------gagdsADSIEMARAAVRQGIR   35
ident    ||                                            |       || 
Sbjct lkIIDFRLRPPAMGFLnariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
DSSP  llLEELLLLLLLHHHHhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL


DSSP  EEELLLEELLLLLLLLHHHHHHHHHHHHhhhhhlllllEEELLL----------------
Query TIIATPHHNNGVYKNEPAAVREAADQLNkrlikediplHVLPGQ----------------   79
ident                  | |   |                 |                  
Sbjct QGVCVGRNSSVLGSVSNADVAAVAKAYP---------dKFHPVGsieaatrkeamaqmqe  111
DSSP  EEEEELLEELLLEELLHHHHHHHHHHLL---------lLEEEEEelllllhhhhhhhhhh


DSSP  ---------EEELL----------lLHHHHHHLlllllhhhLLEEEEEL------llLLL
Query ---------EIRIY----------gEVEQDLAKrqllslndTKYILIEF------pfDHV  114
ident                                |                            
Sbjct ildlgirivNLEPGvwatpmhvddrRLYPLYAF----cednGIPVIMMTggnagpdiTYT  167
DSSP  hhhllllleEELHHhlllllllllhHHHHHHHH----hhhlLLLEEEELlllllllhHHH


DSSP  L-LLHHHHHHHHHhlLLEEEEEL-HHHLhhhhhlLHHHHHHHHLL--LEEEEEhhHHLLl
Query P-RYAEQLFYDLQlkGYIPVIAH-PERNreirenPSLLYHLVEKG--AASQITsgSLAGi  170
ident           |        |  |                |                |   
Sbjct NpEHIDRVLGDFP--DLTVVSSHgNWPW------VQEIIHVAFRRpnLYLSPD-mYLYN-  217
DSSP  LhHHHHHHHHHLL--LLLEEEEHhHLLL------HHHHHHHHHHLllEEEELH-hHHLL-


DSSP  llhhhHHHHHHHHHLL-----llLEEELLLLlllLLLL--LHHHHHHHhhhHHLLHHHHH
Query fgkqlKAFSLRLVEAN-----liHFVASDAHnvkTRNF--HTQEALYVlekEFGSELPYM  223
ident               |                          |   |              
Sbjct -----LPGHADFIQAAnsfladrMLFGTAYP---MCPLkeYTEWFLTL---PIKPDAMEK  266
DSSP  -----LLLHHHHHHHHllhhhhlLLLLLLLL---LLLHhhHHHHHHLL---LLLHHHHHH


DSSP  HH-HHHHHHHLLLllllllllllll
Query LT-ENAELLLRNQtifrqppqpvkr  247
ident     ||| ||               
Sbjct ILhGNAERLLAQA----------gr  281
DSSP  HHlHHHHHHHHHL----------ll


No 14: Query=3qy6A Sbjct=2ob3A Z-score=13.2

back to top
DSSP  ----------------LEELLLLLLLLL-----------lllllLHHHHHHHHHHHHHLL
Query ----------------MIDIHCHILPAM-----------ddgagDSADSIEMARAAVRQG   33
ident                     | ||                             | |   |
Sbjct drintvrgpitiseagFTLTHEHICGSSagflrawpeffgsrkaLAEKAVRGLRRARAAG   60
DSSP  lleeelleeelhhhhlLEEEEELLEELLllhhhhlhhhhllhhhHHHHHHHHHHHHHHLL


DSSP  LLEEELLLEellllLLLLhhhhhhHHHHHHHHHHhlLLLLEEELLL--------------
Query IRTIIATPHhnngvYKNEpaavreAADQLNKRLIkeDIPLHVLPGQ--------------   79
ident  |||                        |           |                   
Sbjct VRTIVDVST-----FDIG-----rDVSLLAEVSR--AADVHIVAATglwfdpplsmrlrs  108
DSSP  LLEEEELLL-----HHHL-----lLHHHHHHHHH--HHLLEEELEEellllllhhhhlll


DSSP  --------------------------EEEL-------LLLHHHHHHLLllllhhhLLEEE
Query --------------------------EIRI-------YGEVEQDLAKRqllslndTKYIL  106
ident                                         |    |              
Sbjct veeltqfflreiqygiedtgiragiiXVATtgkatpfQELVLKAAARA---slatGVPVT  165
DSSP  hhhhhhhhhhhhhllllllllllleeEEELlllllhhHHHHHHHHHHH---hhhhLLLEE


DSSP  EELLLLLLL-LLHHHHHHHhhHLLL--EEEEELHHHLhhhhHLLHHHHHHHHLLLEEEE-
Query IEFPFDHVP-RYAEQLFYDlqLKGY--IPVIAHPERNreirENPSLLYHLVEKGAASQI-  162
ident                 |             | |           | |  |   |      
Sbjct THTAASQRDgEQQAAIFES--EGLSpsRVCIGHSDDT----DDLSYLTALAARGYLIGLd  219
DSSP  EELLHHHLHhHHHHHHHHH--LLLLhhHEEELLHHHL----LLHHHHHHHHHLLLEEEEl


DSSP  EHHH----------hlllLLHHHHHHHHHHHHLL------llLEEELLLLL---------
Query TSGS----------lagiFGKQLKAFSLRLVEAN------liHFVASDAHN---------  197
ident                    |         |  |           |  |            
Sbjct HIPYsaiglednasasalLGIRSWQTRALLIKALidqgymkqILVSNDWTFgfssyvtni  279
DSSP  LLLLllllllllhhhhhhHLLLLHHHHHHHHHHHhhlllhhhEEELLLLLLeellllllh


DSSP  ----LLLL---LLLHH-HHHHHHHHH-HLLHHHHHHH-HHHHHHHLLLllllllllllll
Query ----VKTR---NFHTQ-EALYVLEKE-FGSELPYMLT-ENAELLLRNQtifrqppqpvkr  247
ident                       |       |     |  |    |               
Sbjct mdvmDRVNpdgMAFIPlRVIPFLREKgVPQETLAGITvTNPARFLSPT----------lr  329
DSSP  hhhhHHHLllhHHHHHhLHHHHHHHLlLLHHHHHHHHlHHHHHHHLLL----------ll


No 15: Query=3qy6A Sbjct=2vc5A Z-score=13.2

back to top
DSSP  -----------------LEELLLLlLLLL-----------lllllLHHHHHHHHHHHHHL
Query -----------------MIDIHCHiLPAM-----------ddgagDSADSIEMARAAVRQ   32
ident                     || | |                              |   
Sbjct mriplvgkdsieskdigFTLIHEH-LRVFseavrqqwphlynedeEFRNAVNEVKRAMQF   59
DSSP  llllllllllllhhhllLEELLLL-LLLLlhhhhhhlhhhllhhhHHHHHHHHHHHHHHL


DSSP  LLLEEELLLEellllLLLLhhhHHHHhhHHHHHHHhlLLLLEEELLL-------------
Query GIRTIIATPHhnngvYKNEpaaVREAadQLNKRLIkeDIPLHVLPGQ-------------   79
ident |  ||                          |             |              
Sbjct GVKTIVDPTV-----MGLG---RDIR--FMEKVVK--ATGINLVAGTgiyiyidlpfyfl  107
DSSP  LLLEEEELLL-----LLLL---LLHH--HHHHHHH--LLLLEEEELEellllllllhhhl


DSSP  -----------------------------EEEL--------LLLHHHHHHLLllllhhhL
Query -----------------------------EIRI--------YGEVEQDLAKRqllslndT  102
ident                               |             |    |          
Sbjct nrsideiadlfihdikegiqgtlnkagfvXIAAdepgitkdVEKVIRAAAIA---nketK  164
DSSP  lllhhhhhhhhhhhhhlllllllllllleEEELllllllhhHHHHHHHHHHH---hhhhL


DSSP  LEEEEELLLLLLLllHHHHHHHHHHLLL---EEEEELHHHLhhhhHLLHHHHHHHHLLLE
Query KYILIEFPFDHVPryAEQLFYDLQLKGY---IPVIAHPERNreirENPSLLYHLVEKGAA  159
ident   |                   |   |       | |         |         ||  
Sbjct VPIITHSNAHNNT--GLEQQRILTEEGVdpgKILIGHLGDT----DNIDYIKKIADKGSF  218
DSSP  LLEEEELLLLLLH--HHHHHHHHHHLLLlhhHEEELLHHHL----LLHHHHHHHHHLLLE


DSSP  EE-EEHHhhlllLLHHHHHHHHHHHHLLL--LLEEELLLLL---------------lLLL
Query SQ-ITSGslagiFGKQLKAFSLRLVEANL--IHFVASDAHN---------------vKTR  201
ident       |              |||             |                      
Sbjct IGlDRYGldlflPVDKRNETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykpklaPRW  278
DSSP  EEeLLLLlllllLHHHHHHHHHHHHHLLLllLEEELLLLLLllllllllhhhhhhhlLLL


DSSP  L-LLHH-HHHHHHHHH-HLLHHHHHHH-HHHHHHHLllllllllllllll
Query N-FHTQ-EALYVLEKE-FGSELPYMLT-ENAELLLRnqtifrqppqpvkr  247
ident             |       |       ||                    
Sbjct SiTLIFeDTIPFLKRNgVNEEVIATIFkENPKKFFS--------------  314
DSSP  LlLHHHhLHHHHHHLLlLLHHHHHHHHlHHHHHHLL--------------


No 16: Query=3qy6A Sbjct=3griA Z-score=13.0

back to top
DSSP  -----------------------------------------------------LEELLLL
Query -----------------------------------------------------MIDIHCH    7
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeelEEEEEEL


DSSP  LLLLlllllLLHH--HHHHHHHHHHHLLLLEEELLLEellllllLLHHH-hHHHHHHHHH
Query ILPAmddgaGDSA--DSIEMARAAVRQGIRTIIATPHhnngvykNEPAA-vREAADQLNK   64
ident          |            || | |  |    |                ||   |  
Sbjct LREP-----GGEYkeTIETGTKAAARGGFTTVCPXPN----trpVPDSVehFEALQKLID  111
DSSP  LLLL-----LLLLllLHHHHHHHHHHLLEEEEEELLL----lllLLLLHhhHHHHHHHHH


DSSP  HHhhllLLLEEELL-------------------------LEEE---LLLL--HHHHHHLl
Query RLikedIPLHVLPG-------------------------QEIR---IYGE--VEQDLAKr   94
ident           |||                                               
Sbjct DN----AQVRVLPYasittrqlgkelvdfpalvkegafaFTDDgvgVQTAsxXYEGXIE-  166
DSSP  HH----LLLEELLLeellhhhlllllllhhhhhllllllEEELlllLLLHhhHHHHHHH-


DSSP  llllhhhLLEEEEELL-------------------------lLLLLLLHHHHHHHHHHLL
Query qllslndTKYILIEFP-------------------------fDHVPRYAEQLFYDLQLKG  129
ident         | |                                                |
Sbjct ---aakvNKAIVAHCEdnsliyggaxhegkrskelgipgipnICESVQIARDVLLAEAAG  223
DSSP  ---hhhhLLLEEELLLlhhhllllleellhhhhhhllleellHHHHHHHHHHHHHHHHHL


DSSP  LEEEEELHHhlhhhhhlLHHHHHHHHLL-----LEEEEEHHHHLL---------------
Query YIPVIAHPErnreirenPSLLYHLVEKG-----AASQITSGSLAG---------------  169
ident       |                               |   |                 
Sbjct CHYHVCHVS-------tKESVRVIRDAKragihVTAEVTPHHLLLteddipgnnaiykxn  276
DSSP  LLEEELLLL-------lHHHHHHHHHHHhllllEEEEELHHHHHLlhhhlllllhhhlll


DSSP  -lLLHH-hHHHHHHHHHLLLLLEEELLLLL-------------llLLLL--LHHHHHH-H
Query -iFGKQ-lKAFSLRLVEANLIHFVASDAHN-------------vkTRNF--HTQEALY-V  211
ident             |       |   | |                             ||  
Sbjct ppLRSTedREALLEGLLDGTIDCIATDHAPhardekaqpxekapfGIVGseTAFPLLYtH  336
DSSP  llLLLHhhHHHHHHHHHLLLLLEELLLLLLllhhhhlllllllllLLLLllLHHHHHHhH


DSSP  HHH--HHLLHHHHHHH-HHHHHHHLLL---------------------------------
Query LEK--EFGSELPYMLT-ENAELLLRNQ---------------------------------  235
ident   |                                                         
Sbjct FVKngDWTLQQLVDYLtIKPCETFNLEygtlkengyadltiidldseqeikgedflskad  396
DSSP  HLLllLLLHHHHHHHHlHHHHHHLLLLllllllllllleeeeelllleellhhhllllll


DSSP  --------------llllllllllll
Query --------------tifrqppqpvkr  247
ident                           
Sbjct ntpfigykvygnpiltxvegevkfeg  422
DSSP  llllllleelleeeeeeelleeeeel


No 17: Query=3qy6A Sbjct=4dlfA Z-score=13.0

back to top
DSSP  --LEELLLlLLLL------------lllllLLHHhHHHHHHHHHHLLLLEEELLLEelll
Query --MIDIHChILPA------------mddgaGDSAdSIEMARAAVRQGIRTIIATPHhnng   46
ident    || |                        |             |     ||       
Sbjct alRIDSHQ-HFWRyraadypwigagmgvlaRDYL-PDALHPLMHAQALGASIAVQA----   54
DSSP  llLEEEEE-LLLLllhhhllllllllhhhlLLLL-HHHHHHHHHHLLLLEEEEELL----


DSSP  lllLLHHHHHHHHHHHHHHHhhlllLLEEELL------------------------LEEE
Query vykNEPAAVREAADQLNKRLikediPLHVLPG------------------------QEIR   82
ident                |                                            
Sbjct ---RAGRDETAFLLELACDE-----ARIAAVVgwedlrapqlaervaewrgtklrgFRHQ  106
DSSP  ---LLLHHHHHHHHHHHLLL-----LLEEEEEellllllllhhhhhhlllllleeeEEEL


DSSP  L------LLLH-----HHHHHLlllllhhhLLEEEEELLLlLLLLLHHHHHHHHHhlLLE
Query I------YGEV-----EQDLAKrqllslndTKYILIEFPFdHVPRYAEQLFYDLQlkGYI  131
ident           |         |                                       
Sbjct LqdeadvRAFVddadfARGVAW----lqanDYVYDVLVFE-RQLPDVQAFCARHD--AHW  159
DSSP  HhhlllhHHHHhlhhhHHHHHH----hhhlLLEEEELLLH-HHHHHHHHHHHHLL--LLL


DSSP  EEEELHHHLH--------hHHHL-LHHHHHHHHLL-LEEEEE----hhhhlllLLHHHHH
Query PVIAHPERNR--------eIREN-PSLLYHLVEKG-AASQIT----sgslagiFGKQLKA  177
ident  |  |                      |  |                             
Sbjct LVLDHAGKPAlaefdrddtALARwRAALRELAALPhVVCKLSglvteadwrrgLRASDLR  219
DSSP  EEEHHHHLLLhhhllllllHHHHhHHHHHHHHLLLlEEEEELlllllllllllLLHHHHH


DSSP  HHHHHHHLLL------LLEEELLLLL-LLLLLL--LHHHHHHHHHHHHLLHHHHHHH-HH
Query FSLRLVEANL------IHFVASDAHN-VKTRNF--HTQEALYVLEKEFGSELPYMLT-EN  227
ident        | |           ||                     |          |    
Sbjct HIEQCLDAALdafgpqRLMFGSDWPVcLLAASYdeVASLVERWAESRLSAAERSALWgGT  279
DSSP  HHHHHHHHHHhhhlhhHEEELLLLLHhHHLLLHhhHHHHHHHHHHHHLLHHHHHHHLlHH


DSSP  HHHHHLllllllllllllll
Query AELLLRnqtifrqppqpvkr  247
ident |                   
Sbjct AARCYA------------lp  287
DSSP  HHHHLL------------ll


No 18: Query=3qy6A Sbjct=4cqbA Z-score=12.9

back to top
DSSP  ------------------------------------------------------LEELLL
Query ------------------------------------------------------MIDIHC    6
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE


DSSP  LLLlllllLLLL-----------------------------------HHHHHHHHHHHHH
Query HILpamddGAGD-----------------------------------SADSIEMARAAVR   31
ident |                                                  || |   | 
Sbjct HMD-----KSFTstgerlpkfwsrpytrdaaiedglkyyknatheeiKRHVIEHAHMQVL  115
DSSP  LHH-----HLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhHHHHHHHHHHHHH


DSSP  LLLLEEELLLEEllLLLLllhHHHHHHHHHHHHHHHhllLLLEEELLLE-----------
Query QGIRTIIATPHHnnGVYKnepAAVREAADQLNKRLIkedIPLHVLPGQE-----------   80
ident  |             | |       ||       |                         
Sbjct HGTLYTRTHVDV-dSVAK---TKAVEAVLEAKEELK---DLIDIQVVAFaqsgffvdles  168
DSSP  LLEEEEEEEEEL-lLLLL---LHHHHHHHHHHHHLL---LLLEEEEEEEllllllllllh


DSSP  ----------------EELL-----------LLHHHHHHLLLLllhhhllEEEEELLLL-
Query ----------------IRIY-----------GEVEQDLAKRQLlslndtkYILIEFPFD-  112
ident                                                    |        
Sbjct eslirksldmgcdlvgGVDPatrennvegslDLCFKLAKEYDV-------DIDYHIHDIg  221
DSSP  hhhhhhhhhhllleeeLLLLllllllhhhhhHHHHHHHHHLLL-------EEEEEELLLh


DSSP  -LLLLLHHHHHHHHHHLLL--EEEEELHHhlhhHHHL-LHHHHHHHHLL----LEEEEEH
Query -HVPRYAEQLFYDLQLKGY--IPVIAHPErnreIREN-PSLLYHLVEKG----AASQITS  164
ident          |       ||       |              |                  
Sbjct tVGVYSINRLAQKTIENGYkgRVTTSHAW---cFADApSEWLDEAIPLYkdsgMKFVTCF  278
DSSP  hHHHHHHHHHHHHHHHLLLllLEEEEELL---hHHHLlHHHHHHHHHHHhhhlLEEEEEL


DSSP  HHHlllllhhhHHHHhhHHHLL----LLLEEELLLLL---lLLLLLLHHHHHHHHH---H
Query GSLagifgkqlKAFSlrLVEAN----LIHFVASDAHN---vKTRNFHTQEALYVLE---K  214
ident  |                |            |||          |               
Sbjct SST--------PPTM--PVIKLleagINLGCASDNIRdfwvPFGNGDMVQGALIETqrlE  328
DSSP  LLL--------LLLL--LHHHHhhllLEEEEELLLLLllllLLLLLLHHHHHHHHHhhhL


DSSP  HHL---LHHHHHH-HHHHHHHHLLL-----------------------------------
Query EFG---SELPYML-TENAELLLRNQ-----------------------------------  235
ident         |     |      |                                      
Sbjct LKTnrdLGLIWKMiTSEGARVLGIEknygievgkkadlvvlnslspqwaiidqakrlcvi  388
DSSP  LLLhhhHHHHHHHhLHHHHHHHLLHhhlllllllllleeeellllhhhhhhhllleeeee


DSSP  --llllllllllll
Query --tifrqppqpvkr  247
ident               
Sbjct kngriivkdeviva  402
DSSP  elleeeeelleell


No 19: Query=3qy6A Sbjct=1m65A Z-score=12.9

back to top
DSSP  -LEELLLLllLLLL-LLLLlhhHHHHHHHHHHHLLLLEEELLLEELL-LLLLL--LHHHh
Query -MIDIHCHilPAMD-DGAGdsaDSIEMARAAVRQGIRTIIATPHHNN-GVYKN--EPAAv   55
ident    | | |                      |   ||     | |                
Sbjct yPVDLHMH--TVAStHAYS---TLSDYIAQAKQKGIKLFAITDHGPDmEDAPHhwHFIN-   54
DSSP  lLEELLLL--LLLLlLLLL---LHHHHHHHHHHHLLLEEEEEEELLLlLLLLLlhHHHH-


DSSP  HHHHhhHHHHhhhllLLLEEELLLEEELLL-lhhhhHHLLL--LLLHhhlleEEEELLL-
Query REAAdqLNKRlikedIPLHVLPGQEIRIYG-eveqdLAKRQ--LLSLndtkyILIEFPF-  111
ident                     | | |  |                | |     |   |   
Sbjct MRIW--PRVV-----DGVGILRGIEANIKNvdgeidCSGKMfdSLDL-----IIAGFHEp  102
DSSP  HHHL--LLEE-----LLEEEEEEEEEELLLllllllLLHHHhhHLLE-----EEEELLLl


DSSP  -------llLLLLHHHHHHHHhhllLEEEEELHHH-LHHHhhLLHHHHHHHHLL-LEEEE
Query -------dhVPRYAEQLFYDLqlkgYIPVIAHPER-NREIreNPSLLYHLVEKG-AASQI  162
ident                              | ||     ||            |   |  |
Sbjct vfaphdkatNTQAMIATIASG----NVHIISHPGNpKYEI--DVKAVAEAAAKHqVALEI  156
DSSP  llllllhhhHHHHHHHHHHLL----LLLEELLLLLlLLLL--LHHHHHHHHHHHlLEEEE


DSSP  EHHHhlllllhhhhhHHHHHHHLL----lLLEEELLLLLLLlLLLLHHHHHHHHHHHHll
Query TSGSlagifgkqlkaFSLRLVEAN----lIHFVASDAHNVKtRNFHTQEALYVLEKEFgs  218
ident    |                  |           || |          | |  |      
Sbjct NNSS-----------NCREVAAAVrdaggWVALGSDSHTAF-TMGEFEECLKILDAVD--  202
DSSP  ELLL-----------LHHHHHHHHhhhllLEEEELLLLLHH-HLLLLHHHHHHHHHLL--


DSSP  hHHHHHhHHHH---HHHL-LLLL-llllllllll
Query eLPYMLtENAE---LLLR-NQTI-frqppqpvkr  247
ident   |            ||                 
Sbjct -FPPER-ILNVsprRLLNfLESRgmapiaefadl  234
DSSP  -LLHHH-LHHHlhhHHHHhHHHLlllllhhhlll


No 20: Query=3qy6A Sbjct=1a5kC Z-score=12.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  --------LEELLLLLLlllllllllhhhHHHHHHHHHHLLLLEEEL-----------LL
Query --------MIDIHCHILpamddgagdsadSIEMARAAVRQGIRTIIA-----------TP   41
ident          || | |                  |  |   |  |              | 
Sbjct egkivtagGIDTHIHWI------------CPQQAEEALVSGVTTMVGggtgpaagthaTT  168
DSSP  llleeeelEEEEEEELL------------LLLHHHHHHHHLEEEEEEelllllhhhhhLL


DSSP  EEllllllLLHHHHHHHhHHHHHHHhhlllLLEEELL---------------------LE
Query HHnngvykNEPAAVREAaDQLNKRLikediPLHVLPG---------------------QE   80
ident           |        |    |     |                            |
Sbjct CT------PGPWYISRM-LQAADSL-----PVNIGLLgkgnvsqpdalreqvaagvigLE  216
DSSP  LL------LHHHHHHHH-HHHHLLL-----LLEEEEEeelllllhhhhhhhhhhllleEE


DSSP  EE----LLLL----HHHHHHLLllllhhhlLEEEEELLLLL---LLLLHHHHHHHHhhll
Query IR----IYGE----VEQDLAKRqllslndtKYILIEFPFDH---VPRYAEQLFYDLqlkg  129
ident |                                                           
Sbjct IHedwgATPAaidcALTVADEM-------dIQVALHSDTLNesgFVEDTLAAIGGR----  265
DSSP  EEhhhlLLHHhhhhHHHHHHHH-------lLEEEEELLLLLlllLHHHHHHHHLLL----


DSSP  lEEEEELHHH----LHHHhhllhHHHHhhHLLLEEEEEHHHHLL----------------
Query yIPVIAHPER----NREIrenpsLLYHlvEKGAASQITSGSLAG----------------  169
ident       | |                            |   |                  
Sbjct -TIHTFHTEGagggHAPD---iiTACA--HPNILPSSTNPTLPYtlntidehldmlmvch  319
DSSP  -LEEELLLLLllllLLLL---hhHHHH--LLLEEEEEEHHHLLLlllhhhhhhhhhhhhh


DSSP  ---------------lllHHHHHHHHHHHHLLLLLEEELLLLlllLLLL-LHHHHHHHHH
Query ---------------ifgKQLKAFSLRLVEANLIHFVASDAHnvkTRNF-HTQEALYVLE  213
ident                       |    |          ||                    
Sbjct hldpdiaedvafaesrirRETIAAEDVLHDLGAFSLTSSDSQ--aMGRVgEVILRTWQVA  377
DSSP  llllllhhhhhlllllllHHHHHHHHHHHHLLLLLEEELLLL--lLLLLlLHHHHHHHHH


DSSP  HHH-----------------LLHHHHHHH-HHHHHHHLLL--------------------
Query KEF-----------------GSELPYMLT-ENAELLLRNQ--------------------  235
ident                                |  |                         
Sbjct HRMkvqrgalaeetgdndnfRVKRYIAKYtINPALTHGIAhevgsievgkladlvvwspa  437
DSSP  HHHhhhhlllllllllllhhHHHHHHHLLlHHHHHHLLLLllllllllllllleeeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct ffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaa  497
DSSP  hlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhh


DSSP  -------------------------LLLL-LLLLLL------------------------
Query -------------------------TIFR-QPPQPV------------------------  245
ident                                                             
Sbjct ngvaerlnlrsaiavvkgcrtvqkaDMVHnSLQPNItvdaqtyevrvdgelitsepadvl  557
DSSP  hlhhhhllllleeeellllllllhhHLLLlLLLLLEeelllllleeelleelllllllll


DSSP  -------ll
Query -------kr  247
ident          
Sbjct pmaqryflf  566
DSSP  lllllllll


No 21: Query=3qy6A Sbjct=4mupB Z-score=12.7

back to top
DSSP  -----------------LEELLLlLLLL---------llllllLHHHHHHHHHHHHHLLL
Query -----------------MIDIHChILPA---------mddgagDSADSIEMARAAVRQGI   34
ident                    |                                |     ||
Sbjct lvrklsgtapnpafprgAVDTQM-HMYLpgypalpggpglppgALPGPEDYRRLMQWLGI   59
DSSP  lllllllllllllllllLEELLL-LLLLlllllllllllllllLLLLHHHHHHHHHHHLL


DSSP  LEEELLLEEllllLLLLHHHHHHHHHHHHhhhhhlllllEEELLL---------------
Query RTIIATPHHnngvYKNEPAAVREAADQLNkrlikediplHVLPGQ---------------   79
ident    | |                                                      
Sbjct DRVIITQGN---aHQRDNGNTLACVAEMG---------eAAHAVViidatttekdmeklt  107
DSSP  LEEEEELLH---hHLLLLHHHHHHHHHHH---------hHEEEEElllllllhhhhhhhh


DSSP  -------EEEL-------LLLHHHHHHLlllllhhhLLEEEEELLLLLLLLLhHHHHHHH
Query -------EIRI-------YGEVEQDLAKrqllslndTKYILIEFPFDHVPRYaEQLFYDL  125
ident         |           |                      |                
Sbjct aagtvgaRIMDlpggavnLSELDAVDER----ahaaDWMVAVQFDGNGLLDH-LPRLQKI  162
DSSP  hlleeeeEEELlllllllHHHHHHHHHH----hhhlLLEEEEELLHHHHHHH-HHHHHLL


DSSP  HhllLEEEEELHHHLHHHHH----LLHHHHHHHHLL-LEEEEEHHH---hllLLLHHHHH
Query QlkgYIPVIAHPERNREIRE----NPSLLYHLVEKG-AASQITSGS---lagIFGKQLKA  177
ident        |  |                 |  |   |                       |
Sbjct R---SRWVFDHHGKFFKGIRtdgpEMAALLKLIDRGnLWFKFAGVYessrksWPYADVAA  219
DSSP  L---LEEEELHHHHLLLLLLlllhHHHHHHHHHHHLlEEEEELLHHhlllllLLLHHHHH


DSSP  HHHHHHHLL-lLLEEELLLLL--------lLLLLlLHHHHHHHHhhhHLLHHHHHHH-HH
Query FSLRLVEAN-lIHFVASDAHN--------vKTRNfHTQEALYVLekeFGSELPYMLT-EN  227
ident ||                                      |  |              ||
Sbjct FSRVIAAHApeRIVWGTNWPHnsvretaayPDDArLAELTLGWL---PDEAARHRALvEN  276
DSSP  HHHHHHHHLhhHEEELLLLLLlllllhhhlLLHHhHHHHHHLLL---LLHHHHHHHHlHH


DSSP  HHHHHLLLllllllllllll
Query AELLLRNQtifrqppqpvkr  247
ident  | |                
Sbjct PEALFKLS----------pv  286
DSSP  HHHHHLLL----------ll


No 22: Query=3qy6A Sbjct=2ffiA Z-score=12.6

back to top
DSSP  ----LEELLLlLLLL---------lllllLLHHhHHHHHHHHHHLLLLEEELLLEEllll
Query ----MIDIHChILPA---------mddgaGDSAdSIEMARAAVRQGIRTIIATPHHnngv   47
ident      || |                     |              |              
Sbjct lhltAIDSHA-HVFSrglnlasqrryapnYDAP-LGDYLGQLRAHGFSHGVLVQPS----   54
DSSP  llllLEELLL-LLLLhhhhhhllllllllLLLL-HHHHHHHHHHLLLLEELLLLLH----


DSSP  lLLLHHhhHHHHHHHHHHHHhlllllEEELLL----------------------EEEL--
Query yKNEPAavREAADQLNKRLIkediplHVLPGQ----------------------EIRI--   83
ident                                                             
Sbjct -FLGTD--NRYLLSALQTVP-----gQLRGVVxlerdveqatlaexarlgvrgvRLNLxg  106
DSSP  -HHLLL--LHHHHHHHHHLL-----lLLLLLLlllllllhhhhhhhhllllleeELLLll


DSSP  --LLLH-----hHHHHLLllllhhhLLEEEEELLlllllLLHHHHHHHHHHLLLEEEEEL
Query --YGEV-----eQDLAKRqllslndTKYILIEFPfdhvpRYAEQLFYDLQLKGYIPVIAH  136
ident               |                             |   ||  |   || |
Sbjct qdXPDLtgaqwrPLLERI----geqGWHVELHRQ----vADIPVLVRALQPYGLDIVIDH  158
DSSP  llLLLLlllllhHHHHHH----hhhLLEEEELLL----lLLHHHHHHHHLLLLLLEEELH


DSSP  -HHHL-hHHHHL--LHHHHHhHHLL--LEEEEEHHHhlllLLHHHHHHHHHHHHLLL---
Query -PERN-rEIREN--PSLLYHlVEKG--AASQITSGSlagiFGKQLKAFSLRLVEANL---  187
ident                  |                            ||      |     
Sbjct fGRPDarRGLGQpgFAELLT-LSGRgkVWVKVSGIYrlqgSPEENLAFARQALCALEahy  217
DSSP  hHLLLllLLLLLllHHHHLL-LLLLllEEEEEELHHhlllLHHHHHHHHHHHHHHHHhhl


DSSP  ---lLEEELLLLL---LLLLLLL-HHHHHHHHhhHHLLHHHHHHH-HHHHHHHLllllll
Query ---iHFVASDAHN---VKTRNFH-TQEALYVLekEFGSELPYMLT-ENAELLLRnqtifr  239
ident         ||           |    |    |       |   |    |  |        
Sbjct gaerLXWGSDWPHtqhESEVSFGsAVEQFEAL--GCSAQLRQALLlDTARALFG------  269
DSSP  lhhhEEEELLLLLlllLLLLLHHhHHHHHHHH--LLLHHHHHHHHlHHHHHHLL------


DSSP  llllllll
Query qppqpvkr  247
ident         
Sbjct ----fele  273
DSSP  ----llll


No 23: Query=3qy6A Sbjct=3icjA Z-score=12.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  -LEELLLLLLllllLLLL------------------------------------------
Query -MIDIHCHILpamdDGAG------------------------------------------   17
ident    | | |                                                    
Sbjct aFFDSHLHLD----ELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwp  116
DSSP  lEEEEEELHH----HHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   17
ident                                                             
Sbjct tredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiin  176
DSSP  lhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhh


DSSP  --------LHHHHHHHHHHHHHLLLLEEELLLeellllllllhhhHHHHHHHHHHHHHHL
Query --------DSADSIEMARAAVRQGIRTIIATPhhnngvyknepaaVREAADQLNKRLIKE   69
ident                        |                        |   |       
Sbjct ekiltvkdYKHYIESAQEHLLSLGVHSVGFMS------------vGEKALKALFELEREG  224
DSSP  hllllhhhHHHHHHHHHHHHHHLLEEEEEEEE------------eLHHHHHHHHHHHHLL


DSSP  LLLLEEELL--------------------------LEEEL--------------------
Query DIPLHVLPG--------------------------QEIRI--------------------   83
ident      |                                                      
Sbjct RLKMNVFAYlspelldkleelnlgkfegrrlriwgVXLFVdgslgartallsepytdnpt  284
DSSP  LLLLEEEEEelhhhhhhhhhhlllleellleeeeeEEEELllllllllllllllllllll


DSSP  --------LLLHHHHHHLL--LLLLhhhlleEEEELLLLLLLLLHHHHHHHHHhllLEEE
Query --------YGEVEQDLAKR--QLLSlndtkyILIEFPFDHVPRYAEQLFYDLQlkgYIPV  133
ident           |            |              |     |   |           
Sbjct tsgelvmnKDEIVEVIERAkpLGLD------VAVHAIGDKAVDVALDAFEEAE---FSGR  335
DSSP  llllllllHHHHHHHHHHHllLLLE------EEEEELLHHHHHHHHHHHHHHL---LLLE


DSSP  EELHHhlhhhhhLLHHhHHHHHLL-LEEEEEHHHHlLLLLHH------hhhhhhhHHHLL
Query IAHPErnreireNPSLlYHLVEKG-AASQITSGSLaGIFGKQ------lkafslrLVEAN  186
ident | |                                                         
Sbjct IEHAS-----lvRDDQ-LERIKELkVRISAQPHFI-VSDWWIvnrvgeerakwayRLKTL  388
DSSP  EEELL-----llLHHH-HHHHHHHlLEEEELLLHH-HHLLLHhhhhhhhhhhhllLHHHH


DSSP  L---lLEEELLLLlllLLLLLHHHHHHHHHH--------HHLLHHHHHH-HHHHHH--HH
Query L---iHFVASDAHnvkTRNFHTQEALYVLEK--------EFGSELPYML-TENAEL--LL  232
ident           |                                |    | |       | 
Sbjct SsitkLGFSTDSP---IEPADPWVSIDAAVNryvvdpgeRVSREEALHLyTHGSAQvtLA  445
DSSP  HhhllEEELLLLL---LLLLLHHHHHHHHHHlllllhhhLLLHHHHHHHlLHHHHHhlLL


DSSP  LL--------lllllllllllll
Query RN--------qtifrqppqpvkr  247
ident                        
Sbjct EDlgklergfraeyiildrdplk  468
DSSP  LLllllllllllleeeellllll


No 24: Query=3qy6A Sbjct=3dcpA Z-score=12.5

back to top
DSSP  -LEELLLLlLLLLLLLLLLhhHHHHHHHHHHHLLLLEEELLLEELL--------------
Query -MIDIHCHiLPAMDDGAGDsaDSIEMARAAVRQGIRTIIATPHHNN--------------   45
ident    | | |       |  |  |  |    |            |                 
Sbjct xKRDGHTH-TEFCPHGTHD--DVEEXVLKAIELDFDEYSIVEHAPLssefxkntagdkea   57
DSSP  lLEEEEEL-LLLLLLLLLL--LHHHHHHHHHHLLLLEEEEEEELLLlhhhhhllllllhh


DSSP  -LLLLL---LHHHHHHHHHHHHHHHHhllLLLEEELLLEEELLL----LHHHHHHLL-lL
Query -GVYKN---EPAAVREAADQLNKRLIkedIPLHVLPGQEIRIYG----EVEQDLAKR-qL   96
ident                       |        |    | |              |      
Sbjct vTTASXaxsDLPYYFKKXNHIKKKYA---SDLLIHIGFEVDYLIgyedFTRDFLNEYgpQ  114
DSSP  hHLLLLlhhHHHHHHHHHHHHHHHLL---LLLEEEEEEEEELLLllhhHHHHHHHHHhhH


DSSP  LLHhhlleEEEELLL----------------------------------LLLL-LLHHHh
Query LSLndtkyILIEFPF----------------------------------DHVP-RYAEQl  121
ident               |                                             
Sbjct TDD-----GVLSLHFlegqggfrsidfsaedynegivqfyggfeqaqlaYLEGvKQSIE-  168
DSSP  LLE-----EEEELLEeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHhHHHHH-


DSSP  hHHHHhlLLEE-EEELHHHL---------------hhhhHLLH-HHHHHHHLLLEEEEEH
Query fYDLQlkGYIP-VIAHPERN---------------reirENPS-LLYHLVEKGAASQITS  164
ident   ||      |    |                       |     |              
Sbjct -ADLG--LFKPrRXGHISLCqkfqqffgedtsdfseevxEKFRvILALVKKRDYELDFNT  225
DSSP  -LLLL--LLLLlEELLLLHHhllhhhhlllhhhllhhhhHHHHhHHHHHHHHLLEEEEEL


DSSP  HHhlLLLLHHHH-hhHHHHHHLL----LLLEEELLLLLLLlLLLL-HHHHHHHHHhhhll
Query GSlaGIFGKQLK-afSLRLVEAN----LIHFVASDAHNVKtRNFH-TQEALYVLEkefgs  218
ident                    |             || | |              ||     
Sbjct AG--LFKPLCGEtypPKKIVTLAselqIPFVYGSDSHGVQ-DIGRgYSTYCQKLE-----  277
DSSP  HH--HHLLLLLLlllLHHHHHHHhhllLLEEEELLLLLHH-HLLLlHHHHHHHLL-----


DSSP  hhhhhhhhhhhhhhlllllllllllllll
Query elpymltenaelllrnqtifrqppqpvkr  247
ident                              
Sbjct -----------------------------  277
DSSP  -----------------------------


No 25: Query=3qy6A Sbjct=1onxA Z-score=12.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  ---LEELLLLLLLLL-llllllhhHHHHhHHHHHHLLLLEEELLLEellllLLLLhhhHH
Query ---MIDIHCHILPAM-ddgagdsaDSIEmARAAVRQGIRTIIATPHhnngvYKNEpaaVR   56
ident     || | |                          |                       
Sbjct cpgFIDQHVHLIGGGgeagpttrtPEVA-LSRLTEAGVTSVVGLLG-----TDSI-srHP  113
DSSP  eelEEEEEELLLLLLllllhhhllLLLL-HHHHHHLLEEEEEELLL-----LLLL-llLH


DSSP  HHHHHHHHHHHhlLLLLEEELL---------------------------lEEEL------
Query EAADQLNKRLIkeDIPLHVLPG---------------------------qEIRI------   83
ident |        |                                           |      
Sbjct ESLLAKTRALN--EEGISAWMLtgayhvpsrtitgsvekdvaiidrvigvXCAIsdhrsa  171
DSSP  HHHHHHHHHHH--HHLLEEEEEeellllllllllllhhhhhhhllleeeeEEEEllllll


DSSP  ---lLLHHHHHHLL--llllhhHLLEEEEELLLLL-LLLLHHHHHHHhhHLLL-EEEEEL
Query ---yGEVEQDLAKR--qllslnDTKYILIEFPFDH-VPRYAEQLFYDlqLKGY-IPVIAH  136
ident            |                               |               |
Sbjct apdvYHLANMAAESrvggllggKPGVTVFHMGDSKkALQPIYDLLEN-cDVPIsKLLPTH  230
DSSP  lllhHHHHHHHHHHhhhhhhhlLLLEEEEEELLLLlLLHHHHHHHHL-lLLLHhHEEEEL


DSSP  HHHLHHHhhlLHHHHHHHHLLLEEEEEHHHhlllllhhHHHHH-HHHHHLL-------ll
Query PERNREIrenPSLLYHLVEKGAASQITSGSlagifgkqLKAFS-LRLVEAN-------li  188
ident   ||               ||    |||                                
Sbjct VNRNVPL---FEQALEFARKGGTIDITSSI--------DEPVApAEGIARAvqagiplar  279
DSSP  HHHLHHH---HHHHHHHHHLLLLEEEELLL--------LLLLLhHHHHHHHhhllllhhh


DSSP  LEEELLLL-------------llLLLLL-LHHHHHHHHHHH--HLLHHHHHH-HHHHHHH
Query HFVASDAH-------------nvKTRNF-HTQEALYVLEKE--FGSELPYML-TENAELL  231
ident     ||                     |    |   || |   |         |      
Sbjct VTLSSDGNgsqpffddegnlthiGVAGFeTLLETVQVLVKDydFSISDALRPlTSSVAGF  339
DSSP  EEEELLLLleeeeellllleeeeEELLLhHHHHHHHHHHHHhlLLHHHHHHHhLHHHHHH


DSSP  HLLL-----------------------------------llllllllllll
Query LRNQ-----------------------------------tifrqppqpvkr  247
ident |                                                  
Sbjct LNLTgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  LLLLlllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 26: Query=3qy6A Sbjct=2oofA Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  ---LEELLLLLLLL----------------------------------lllllLLHHHHH
Query ---MIDIHCHILPA----------------------------------mddgaGDSADSI   23
ident     || | |   |                                              
Sbjct tpgLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedQLFELAL  120
DSSP  eelEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhHHHHHHH


DSSP  HHHHHHHHLLLLEEELLLEellllLLLL--HHHHHHHHHHHHHHHhhlllLLEEELLL--
Query EMARAAVRQGIRTIIATPHhnngvYKNE--PAAVREAADQLNKRLikediPLHVLPGQ--   79
ident        | |  |                        |  |   |     |  |      
Sbjct PRVKSLIREGVTTVEIKSG----yGLTLedELKXLRVARRLGEAL-----PIRVKTTLla  171
DSSP  HHHHHHHHHLEEEEEEELL----lLLLHhhHHHHHHHHHHHHHHL-----LLEEEEEEee


DSSP  ------------------------------------EEEL---------LLLHHHHHHLL
Query ------------------------------------EIRI---------YGEVEQDLAKR   94
ident                                                     |       
Sbjct ahavppeyrddpdswveticqeiipaaaeagladavDVFCehigfslaqTEQVYLAADQY  231
DSSP  ellllhhhlllhhhhhhhhhhlhhhhhhhllllleeEEEEllllllhhhHHHHHHHHHHL


DSSP  LLllhhhllEEEEEL-lLLLLLllhHHHHHHhhhllLEEEEELHHhlhhhhhlLHHHHHH
Query QLlslndtkYILIEF-pFDHVPryaEQLFYDlqlkgYIPVIAHPErnreirenPSLLYHL  153
ident  |                                        | |               
Sbjct GL-------AVKGHXdqLSNLG-gsTLAANF-----GALSVDHLE------ylDPEGIQA  272
DSSP  LL-------EEEEEEllLLLLL-hhHHHHHL-----LLLEEEELL------llLHHHHHH


DSSP  HHLL-LEEEEEHHHHlLLLLHHHhhhhHHHHHLL----LLLEEELLLLLlllLLLLHHHH
Query VEKG-AASQITSGSLaGIFGKQLkafsLRLVEAN----LIHFVASDAHNvktRNFHTQEA  208
ident                            |  | |         | ||             |
Sbjct LAHRgVVATLLPTAF-YFLKETK----LPPVVALrkagVPXAVSSDINPgtaPIVSLRXA  327
DSSP  HHHHlLEEEELHHHH-HHLLLLL----LLLHHHHhhllLLEEELLLLLLlllLLLLHHHH


DSSP  HHHHHH--HHLLHHHHHHH-HHHHHHHLLLL-----------------------------
Query LYVLEK--EFGSELPYMLT-ENAELLLRNQT-----------------------------  236
ident                       |   |  |                              
Sbjct XNXACTlfGLTPVEAXAGVtRHAARALGEQEqlgqlrvgxladflvwncghpaelsylig  387
DSSP  HHHHHHhhLLLHHHHHHHLlHHHHHHLLLLLlllllllllllleeeellllllhhhhlll


DSSP  -----lllllllllll
Query -----ifrqppqpvkr  247
ident                 
Sbjct vdqlvsrvvngeetlh  403
DSSP  llleeeeeelleelll


No 27: Query=3qy6A Sbjct=3e74A Z-score=12.1

back to top
DSSP  -----------------------------------------------------LEELLLL
Query -----------------------------------------------------MIDIHCH    7
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeelEEEEEEL


DSSP  LllllllllllhhHHHHHHHHHHHLLLLEEELLLEelllllLLLHH-HHHHHHHHhHHHH
Query IlpamddgagdsaDSIEMARAAVRQGIRTIIATPHhnngvyKNEPA-AVREAADQlNKRL   66
ident |                  |||   || | |  |                   |   |  
Sbjct I------------GYETGTRAAAKGGITTXIEXPL--nqlpATVDRaSIELKFDA-AKGK  105
DSSP  L------------LHHHHHHHHHHLLEEEEEELLL--llllLLLLHhHHHHHHHH-HLLL


DSSP  hhllLLLEEELLL---------------------EEEL----LLLHHHHHHLLllllhhh
Query ikedIPLHVLPGQ---------------------EIRI----YGEVEQDLAKRqllslnd  101
ident                                                    |        
Sbjct ----LTIDAAQLGglvsynidrlheldevgvvgfXCFVrdvnDWQFFKGAQKL----gel  157
DSSP  ----LLLEEEELEellllllllhhhhhhhlllleEEELllllHHHHHHHHHHH----hhh


DSSP  lLEEEEELLLL----------------------------LLLLLHHHHHHHHHHLLLEEE
Query tKYILIEFPFD----------------------------HVPRYAEQLFYDLQLKGYIPV  133
ident     |                                            |     |    
Sbjct gQPVLVHCENAlicdelgeeakregrvtahdyvasrpvfTEVEAIRRVLYLAKVAGCRLH  217
DSSP  lLLEEEELLLHhhhhhhhhhhhhhllllhhhhhhlllhhHHHHHHHHHHHHHHHHLLLEE


DSSP  EELHHhlhhhhhlLHHHHHHHHLL-----LEEEEEHHHHlLLLL----------------
Query IAHPErnreirenPSLLYHLVEKG-----AASQITSGSLaGIFG----------------  172
ident   |          |                                              
Sbjct VCHVS-------sPEGVEEVTRARqegqdITCESCPHYF-VLDTdqfeeigtlakcsppi  269
DSSP  ELLLL-------lHHHHHHHHHHHhllllEEEEELLHHH-HLLHhhhhhhlhhhllllll


DSSP  --HHHHHHHHHHHHLLLLLEEELLLLL--------------llLLLL-LHHH-HHHHHH-
Query --KQLKAFSLRLVEANLIHFVASDAHN--------------vkTRNF-HTQE-ALYVLE-  213
ident                  |    ||                                    
Sbjct rdLENQKGXWEKLFNGEIDCLVSDHSPcppexkagnixkawggIAGLqSCXDvXFDEAVq  329
DSSP  llHHHHHHHHHHHHLLLLLEELLLLLLllllllllllllllllLLLHhHHHHhHHHHHLl


DSSP  -HHHLLHHHHHH-HHHHHHHHLLL------------------------------------
Query -KEFGSELPYML-TENAELLLRNQ------------------------------------  235
ident            |   ||      |                                    
Sbjct kRGXSLPXFGKLxATNAADIFGLQqkgriapgkdadfvfiqpnssyvltnddleyrhkvs  389
DSSP  lLLLLHHHHHHHhLHHHHHHLLLLlllllllllllleeeeelllleellhhhllllllll


DSSP  ----------------------------llllllllllll
Query ----------------------------tifrqppqpvkr  247
ident                                         
Sbjct pyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  llllleelleeeeeeelleeeeelllllllllllleelll


No 28: Query=3qy6A Sbjct=1k6wA Z-score=12.1

back to top
DSSP  -----------------------------------------------------LEELLLL
Query -----------------------------------------------------MIDIHCH    7
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL


DSSP  LLllllLLLL------------------------------LHHHHHHHHHHHHHLLLLEE
Query ILpamdDGAG------------------------------DSADSIEMARAAVRQGIRTI   37
ident                                                        ||   
Sbjct LD----TTQTagqpnwnqsgtlfegierwaerkallthddVKQRAWQTLKWQIANGIQHV  116
DSSP  LL----LLLLlllllllllllhhhhhhhhhllhhhllhhhHHHHHHHHHHHHHHLLEEEE


DSSP  ELLLeellllLLLL-hHHHHHHHHHHHHHHHhllLLLEEELLL-----------------
Query IATPhhnngvYKNE-pAAVREAADQLNKRLIkedIPLHVLPGQ-----------------   79
ident                      |                                      
Sbjct RTHV------DVSDatLTALKAMLEVKQEVA---PWIDLQIVAfpqegilsypngealle  167
DSSP  EEEE------ELLLllLHHHHHHHHHHHHHL---LLLEEEEEEellllllllllhhhhhh


DSSP  ----------EEEL------------LLLHHHHHHLlLLLLhhhlleEEEELLL----LL
Query ----------EIRI------------YGEVEQDLAKrQLLSlndtkyILIEFPF----DH  113
ident                                    |           |            
Sbjct ealrlgadvvGAIPhfeftreygvesLHKTFALAQK-YDRL------IDVHCDEiddeQS  220
DSSP  hhhhlllleeEELHhhlllhhhhhhhHHHHHHHHHH-HLLE------EEEEELLllllLL


DSSP  LLllHHHHHHHHHHLLLE--EEEELHHHlhhHHHLLH-HHHHHHHLL----LEEEEEHHH
Query VPryAEQLFYDLQLKGYI--PVIAHPERnreIRENPS-LLYHLVEKG----AASQITSGS  166
ident      |         |        |                 |                 
Sbjct RF--VETVAALAHHEGMGarVTASHTTA---MHSYNGaYTSRLFRLLkmsgINFVANPLV  275
DSSP  LH--HHHHHHHHHHHLLHhhEEEEELHH---HHHLLHhHHHHHHHHHhhhlLEEEELHHH


DSSP  hlLLLLHH-----hHHHHhhHHHLL----LLLEEELLLLL---lLLLLLLHHHHHHHHHH
Query laGIFGKQ-----lKAFSlrLVEAN----LIHFVASDAHN---vKTRNFHTQEALYVLEK  214
ident                      |              |                 |     
Sbjct -nIHLQGRfdtypkRRGI-tRVKEMlesgINVCFGHDDVFdpwyPLGTANMLQVLHMGLH  333
DSSP  -hHHHLLLllllllLLLL-lLHHHHhhllLLEEELLLLLLllllLLLLLLHHHHHHHHHH


DSSP  --HHLL----HHHHHHH-HHHHHHHLLL--------------------------------
Query --EFGS----ELPYMLT-ENAELLLRNQ--------------------------------  235
ident                |        |  |                                
Sbjct vcQLMGygqiNDGLNLItHHSARTLNLQdygiaagnsanliilpaengfdalrrqvpvry  393
DSSP  hlLLLLhhhhHHHHHHHlHHHHHHLLLLllllllllllleeeellllhhhhhhhllllle


DSSP  ------------------llllllllllll
Query ------------------tifrqppqpvkr  247
ident                               
Sbjct svrggkviastqpaqttvyleqpeaidykr  423
DSSP  eeelleeeeellllleeeellleeeellll


No 29: Query=3qy6A Sbjct=3pnuA Z-score=12.0

back to top
DSSP  --------------LEELLLLLLLllllllllHHHHHHHHHHHHHlLLLEEELLLEelll
Query --------------MIDIHCHILPamddgagdSADSIEMARAAVRqGIRTIIATPHhnng   46
ident                 | | |                  |    |         |     
Sbjct enlyfqsnamklknPLDMHLHLRD--------NQMLELIAPLSAR-DFCAAVIMPN---l   48
DSSP  llllllllleeeelLEEEEELLLL--------HHHHHHHHHHHHL-LLLEEEELLL---l


DSSP  lLLLLHH-HHHHHHHHHHHHHHhlLLLLEEELL--------------------LEEEL--
Query vYKNEPA-AVREAADQLNKRLIkeDIPLHVLPG--------------------QEIRI--   83
ident                   |     |     |                             
Sbjct iPPLCNLeDLKAYKMRILKACK--DENFTPLMTlffknydekflysakdeifgIXLYPag  106
DSSP  lLLLLLHhHHHHHHHHHHHHHL--LLLLEEEEEeelllllhhhhhhhllllleEEELLll


DSSP  --------LLLH-----hHHHHLlllllhhhLLEEEEELLLL--------LLLLLHHHHH
Query --------YGEV-----eQDLAKrqllslndTKYILIEFPFD--------HVPRYAEQLF  122
ident                     |              |                    | | 
Sbjct ittnsnggVSSFdieylkPTLEA----msdlNIPLLVHGETNdfvmdresNFAKIYEKLA  162
DSSP  llllllllLLLLlhhhhhHHHHH----hhhlLLLEEELLLLLllhhhllhHHHHHHHHHH


DSSP  HHHHhlLLEEEEELHHhlhhhhhlLHHHHHHHHLL-LEEEEEHHHHLllLLHH-------
Query YDLQlkGYIPVIAHPErnreirenPSLLYHLVEKG-AASQITSGSLAgiFGKQ-------  174
ident           |  |            |   |         ||   |              
Sbjct KHFP--RLKIVMEHIT-------tKTLCELLKDYEnLYATITLHHLI--ITLDdviggkm  211
DSSP  HHLL--LLLEEELLLL-------lHHHHHHHHHLLlEEEEELLHHHL--LLHHhhhllll


DSSP  -----------hhHHHHHHHHL----lllLEEELLLLLL------lLLLL-LHHHHHHHH
Query -----------lkAFSLRLVEA----nliHFVASDAHNV------kTRNF-HTQEALYVL  212
ident                   | |            ||                     |  |
Sbjct nphlfckpiakryEDKEALCELafsgyekVMFGSDSAPHpkgcaagVFSApVILPVLAEL  271
DSSP  lhhhllllllllhHHHHHHHHHhhlllllEEELLLLLLLlllllllLLLHhHHHHHHHHH


DSSP  HH-HHLLHHHHHHH-HHHHHHHLL------------------------------llllll
Query EK-EFGSELPYMLT-ENAELLLRN------------------------------qtifrq  240
ident  |     |        |                                           
Sbjct FKqNSSEENLQKFLsDNTCKIYDLkfkedkiltleekewqvpnvyedkynqvvpymagei  331
DSSP  HHhHLLHHHHHHHHlHHHHHHHLLlllllleeeeellleelllleelllleellllllle


DSSP  lllllll
Query ppqpvkr  247
ident        
Sbjct lkfqlkh  338
DSSP  elleell


No 30: Query=3qy6A Sbjct=3nqbA Z-score=12.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  -------------------LEELLLLLLlllllLLLLhhHHHHHHHHHHHLLLLEEELLL
Query -------------------MIDIHCHILpamddGAGDsaDSIEMARAAVRQGIRTIIATP   41
ident                     || | ||                 | | |  |  ||   |
Sbjct srrdaaqvidaggayvspgLIDTHXHIE-----SSXI--TPAAYAAAVVARGVTTIVWDP  113
DSSP  lllleeeeeelllleeeelEEEEEELHH-----HHLL--LHHHHHHHHHLLLEEEEEELL


DSSP  EellllLLLLhHHHHHHHHHHHHHHhhlllLLEEELL-----------------------
Query HhnngvYKNEpAAVREAADQLNKRLikediPLHVLPG-----------------------   78
ident |                |      |     ||                            
Sbjct H---efGNVHgVDGVRWAAKAIENL-----PLRAILLapscvpsapglerggadfdaail  165
DSSP  H---hhHHHHlHHHHHHHHHHHLLL-----LLEEEEEellllllllllllllllllhhhh


DSSP  ------------LEEELLLL-------HHHHHHLLLlllhhhlLEEEEELLllLLLL-LH
Query ------------QEIRIYGE-------VEQDLAKRQllslndtKYILIEFPfdHVPR-YA  118
ident              ||                            |                
Sbjct adllswpeiggiAEIXNXRGvierdprXSGIVQAGL----aaeKLVCGHAR--GLKNaDL  219
DSSP  hhhhlllleeeeEEELLHHHhhlllhhHHHHHHHHH----hhlLEEEELLL--LLLHhHH


DSSP  HHHHHHHhhllleEEEELHHhlhhhhhlLHHHHHHHHLLLEEEEEHHHhlllllhhhHHH
Query EQLFYDLqlkgyiPVIAHPErnreirenPSLLYHLVEKGAASQITSGSlagifgkqlKAF  178
ident                                |      |                     
Sbjct NAFXAAG-----vSSDHELV-------sGEDLXAKLRAGLTIELRGSH---------DHL  258
DSSP  HHHHHLL-----lLEELLLL-------lHHHHHHHHHLLLEEEEELLL---------HHH


DSSP  HHHHHHLL-------llLEEELLLLLlLLLL---LLHHHHHHHHHH-HHLLHHHHHHH-H
Query SLRLVEAN-------liHFVASDAHNvKTRN---FHTQEALYVLEK-EFGSELPYMLT-E  226
ident     | |               |                    |       |        
Sbjct LPEFVAALntlghlpqtVTLCTDDVF-PDDLlqgGGLDDVVRRLVRyGLKPEWALRAAtL  317
DSSP  HHHHHHHHhhhllllllEEEELLLLL-HHHHhhlLLHHHHHHHHHHlLLLHHHHHHHHlH


DSSP  HHHHHHLLL---------------------------------------------------
Query NAELLLRNQ---------------------------------------------------  235
ident ||   |                                                      
Sbjct NAAQRLGRSdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttv  377
DSSP  HHHHHHLLLlllllllllllleeeellllllleeeeeelleeeeelleelllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct lkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisv  437
DSSP  hllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct thrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtggg  497
DSSP  ellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct xavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgat  557
DSSP  eeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlll


DSSP  ------------------llllllllllll
Query ------------------tifrqppqpvkr  247
ident                               
Sbjct lacnigphqtdxgiadvltgkvxespviev  587
DSSP  llllllleelllleeelllleeellleeel


No 31: Query=3qy6A Sbjct=3mtwA Z-score=12.0

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------M    1
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeelE


DSSP  EELLLLLLL---------llllllLLHHHHHHHHHHHHHLLLLEEELLLeellllllllh
Query IDIHCHILP---------amddgaGDSADSIEMARAAVRQGIRTIIATPhhnngvyknep   52
ident || | |                    |      |      |  |                
Sbjct IDMHVHLDSlaevggynsleysdrFWSVVQTANAKKTLEAGFTTVRNVG-----------  109
DSSP  EEEEELLLLlllllhhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELL-----------


DSSP  hhHHHHHHHHHHHHH-HLLLLLEEELL---------------------------------
Query aaVREAADQLNKRLI-KEDIPLHVLPG---------------------------------   78
ident          |                                                  
Sbjct -aADYDDVGLREAIDaGYVPGPRIVTAaisfgatgghcdstffppsmdqknpfnsdspde  168
DSSP  -lLLLHHHHHHHHHHlLLLLLLEEEELllleellllllllllllhhhllllllllllhhh


DSSP  ---------------lEEEL--------------------LLLHHHHHHLLllllhhhlL
Query ---------------qEIRI--------------------YGEVEQDLAKRqllslndtK  103
ident                  |                         |                
Sbjct arkavrtlkkygaqviXICAtggvfsrgnepgqqqltyeeMKAVVDEAHMA-------gI  221
DSSP  hhhhhhhhhhlllleeEEELlllllllllllllllllhhhHHHHHHHHHHL-------lL


DSSP  EEEEELlLLLLllLHHHHHhhhhhllleEEEELHHHLhhhhhLLHHHHHHHHLLLEEEEE
Query YILIEFpFDHVprYAEQLFydlqlkgyiPVIAHPERNreireNPSLLYHLVEKGAASQIT  163
ident               |               | |                 | |||     
Sbjct KVAAHAhGASGirEAVRAG--------vDTIEHASLV-----DDEGIKLAVQKGAYFSMD  268
DSSP  EEEEEElLHHHhhHHHHLL--------lLEEEELLLL-----LHHHHHHHHHHLLEEELL


DSSP  HHHhLLLL----------------LHHHHHHHHHHHHLL----LLLEEELLLLlllLLLL
Query SGSlAGIF----------------GKQLKAFSLRLVEAN----LIHFVASDAHnvkTRNF  203
ident                                                   ||        
Sbjct IYN-TDYTqaegkkngvlednlrkDRDIGELQRENFRKAlkagVKMVYGTDAG---IYPH  324
DSSP  LLL-HHHHhhhhhhhlllhhhhhhHHHHHHHHHHHHHHHhhhlLEEELLLLLL---LLLL


DSSP  -LHHHHHHHHHHHH-LLHHHHHHH-HHHHHHHLLL-------------------------
Query -HTQEALYVLEKEF-GSELPYMLT-ENAELLLRNQ-------------------------  235
ident         |                  |   |                            
Sbjct gDNAKQFAVMVRYGaTPLQAIQSAtLTAAEALGRSkdvgqvavgrygdmiavagdpladv  384
DSSP  lLHHHHHHHHHHLLlLHHHHHHHLlHHHHHHHLLLllllllllllllleeeelllllllh


DSSP  --------llllllllllll
Query --------tifrqppqpvkr  247
ident                     
Sbjct ttlekpvfvmkggavvkapx  404
DSSP  hhhhllleeeelleeeelll


No 32: Query=3qy6A Sbjct=3mkvA Z-score=11.9

back to top
DSSP  ----------------------------------------------------------LE
Query ----------------------------------------------------------MI    2
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE


DSSP  ELLLLLlllllLLLL-------------LHHHHHHHHHHHHHLLLLEEELLLeellllll
Query DIHCHIlpamdDGAG-------------DSADSIEMARAAVRQGIRTIIATPhhnngvyk   49
ident | | |                                ||  | |  |             
Sbjct DLHVHV-----VAIEfnlprvatlpnvlVTLRAVPIMRAMLRRGFTTVRDAG--------  107
DSSP  EEEELL-----LLLLllhhhhllllhhhHHHHHHHHHHHHHHLLEEEEEELL--------


DSSP  llhhhhhhHHHHHHHHHHHL-LLLLEEELL------------------------------
Query nepaavreAADQLNKRLIKE-DIPLHVLPG------------------------------   78
ident         |                                                   
Sbjct -------gAGYPFKQAVESGlVEGPRLFVSgralsqtgghadprarsdymppdspcgccv  160
DSSP  -------lLLHHHHHHHHLLlLLLLEEEELlleeelllllllllllllllllllllllll


DSSP  -----------------------------LEEE---------------LLLL--HHHHHH
Query -----------------------------QEIR---------------IYGE--VEQDLA   92
ident                                |                 | |       |
Sbjct rvgalgrvadgvdevrravreelqmgadqIXIMasggvasptdpvgvfGYSEdeIRAIVA  220
DSSP  llllleeelllhhhhhhhhhhhhhhllllEEEElllllllllllllllLLLHhhHHHHHH


DSSP  LLLlllhhhlLEEEEELlllLLLLlhHHHHHHHhhlllEEEEELHHhlhhhhhLLHHHHH
Query KRQllslndtKYILIEFpfdHVPRyaEQLFYDLqlkgyIPVIAHPErnreireNPSLLYH  152
ident   |        | |                           | |                
Sbjct EAQ----grgTYVLAHA--yTPAA-iARAVRCG-----VRTIEHGN-----liDDETARL  263
DSSP  HHH----lllLLEEEEE--lLHHH-hHHHHHLL-----LLEEEELL-----llLHHHHHH


DSSP  HHHLLLEEEEEHHHhlLLLL----------------HHHHHHHHHHHHLL----LLLEEE
Query LVEKGAASQITSGSlaGIFG----------------KQLKAFSLRLVEAN----LIHFVA  192
ident   | ||    |                                |   |            
Sbjct VAEHGAYVVPTLVT-yDALAsegekyglppesiakiADVHGAGLHSIEIMkragVKMGFG  322
DSSP  HHHHLLEEELLHHH-hHHHHhhlllllllhhhhllhHHHHLLHHHHHHHHhhhlLLLLLL


DSSP  LLLlLLLLlLLLHHHHHHHHHHHHLLHHHHHHH-HHHHHHHLLL----------------
Query SDAhNVKTrNFHTQEALYVLEKEFGSELPYMLT-ENAELLLRNQ----------------  235
ident  |                 |                    |  |                
Sbjct TDL-LGEA-QRLQSDEFRILAEVLSPAEVIASAtIVSAEVLGMQdklgrivpgahadvlv  380
DSSP  LLL-LHHH-HHHLLHHHHHHHLLLLHHHHHHHLlHHHHHHLLLLllllllllllllleee


DSSP  ----------------------llllllllllll
Query ----------------------tifrqppqpvkr  247
ident                                   
Sbjct vdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  ellllllllllllllllllleeeelleeeeelll


No 33: Query=3qy6A Sbjct=2ogjA Z-score=11.9

back to top
DSSP  ---------------------------------------------------------LEE
Query ---------------------------------------------------------MID    3
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE


DSSP  LLLLLLL-LLLLLLllhhhhhhHHHH-HHHLLLLEEELLLEellllllLLHHHHHHHHHH
Query IHCHILP-AMDDGAgdsadsieMARA-AVRQGIRTIIATPHhnngvykNEPAAVREAADQ   61
ident  | ||     |                    |  |                |        
Sbjct LHVHIWHgGTDISI--------RPSEcGAERGVTTLVDAGS-------AGEANFHGFREY  105
DSSP  EEELLLLlLLLLLL--------LHHHlLHHHLEEEEEEELL-------LLLLLHHHHHHH


DSSP  HHHHHhhlllLLEEELLL-----------------------------------------E
Query LNKRLikediPLHVLPGQ-----------------------------------------E   80
ident                                                             
Sbjct IIEPS-----RERIKAFLnlgsiglvacnrvpelrdikdidldrilecyaensehivglX  160
DSSP  LLLLL-----LLEEEEEEelllllllllllllllllhhhllhhhhhhhhhllllleeeeE


DSSP  EEL------------LLLHHHHHHLLllllhhhlLEEEEELLLL--LLLLlHHHHHHhhh
Query IRI------------YGEVEQDLAKRqllslndtKYILIEFPFD--HVPRyAEQLFYdlq  126
ident  |                                                          
Sbjct VRAshvitgswgvtpVKLGKKIAKIL-------kVPXXVHVGEPpaLYDE-VLEILG---  209
DSSP  EEElhhhhlllllhhHHHHHHHHHHH-------lLLEEEEELLLllLHHH-HHHHLL---


DSSP  hllLEEEEELHHH---lHHHHHL---LHHHHHHhhLLLEEEEEHHhhlllllhhHHHHHH
Query lkgYIPVIAHPER---nREIREN---PSLLYHLveKGAASQITSGslagifgkqLKAFSL  180
ident       |  |         | |      |       |    |  |               
Sbjct ---PGDVVTHCFNgksgSSIXEDedlFNLAERC--EGIRLDIGHG-----gasfSFKVAE  259
DSSP  ---LLLEEELLLLllllLLLLLLhhhHHHHHHL--LLLEEELLLL-----llllLHHHHH


DSSP  HHHH-LLLLLEEELLLLllLLLL----LLHHHHHHHHHH-HHLLHHHHHHH-HHHHHHHL
Query RLVE-ANLIHFVASDAHnvKTRN----FHTQEALYVLEK-EFGSELPYMLT-ENAELLLR  233
ident        |      | |                   |       |        |     |
Sbjct AAIArGLLPFSISTDLH--GHSXnfpvWDLATTXSKLLSvDXPFENVVEAVtRNPASVIR  317
DSSP  HHHHlLLLLLLLLLLLL--LLLLllllLLHHHHHHHHHHlLLLHHHHHHLLlHHHHHHLL


DSSP  LL------------------------------------------------llllllllll
Query NQ------------------------------------------------tifrqppqpv  245
ident                                                             
Sbjct LDxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryip  377
DSSP  LLllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllll


DSSP  ll
Query kr  247
ident   
Sbjct ra  379
DSSP  ll


No 34: Query=3qy6A Sbjct=3giqA Z-score=11.6

back to top
DSSP  ---------------------------------------------------------LEE
Query ---------------------------------------------------------MID    3
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapgFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeelEEE


DSSP  LLLLLLLllllllLLHHHHHhhHHHHHHLLLLEEELLLEE----------llLLLL----
Query IHCHILPamddgaGDSADSIemARAAVRQGIRTIIATPHH----------nnGVYK----   49
ident  | |                   |    ||| |                           
Sbjct VHGHDDL------MFVEKPD--LRWKTSQGITTVVVGNCGvsaapaplpgntAAALallg  112
DSSP  LLLLLLL------HHHHLLL--LHHHHLLLEEEEEELLLLllllllllllllLHHHhhhl


DSSP  --llhHHHHHHHHHHHHHHhhlllLLEEELLL----------------------------
Query --nepAAVREAADQLNKRLikediPLHVLPGQ----------------------------   79
ident      | |      |            |                                
Sbjct etplfADVPAYFAALDAQR----pMINVAALVghanlrlaamrdpqaaptaaeqqamqdm  168
DSSP  lllllLLHHHHHHHHHHLL----lLLEEEEEEehhhhhhhhlllllllllhhhhhhhhhh


DSSP  ------------EEEL---------LLLHHHHHHLlllllhhhLLEEEEELLL---LLLL
Query ------------EIRI---------YGEVEQDLAKrqllslndTKYILIEFPF---DHVP  115
ident                            | |                              
Sbjct lqaaleagavgfSTGLayqpgavaqAAELEGLARV----aaerRRLHTSHIRNeadGVEA  224
DSSP  hhhhhhhllleeEEELllllhhhllHHHHHHHHHH----hhhlLLEEEEELLLlllLHHH


DSSP  --LLHHHHHHHHHhllLEEEEELHHH-lhhhHHLL-HHHHHHHHLL-----LEEEEEhhh
Query --RYAEQLFYDLQlkgYIPVIAHPER-nreiRENP-SLLYHLVEKG-----AASQITsgs  166
ident                    |  |               |             |  |    
Sbjct avEEVLAIGRGTG---CATVVSHHKCmmpqnWGRSrATLANIDRAReqgveVALDIY---  278
DSSP  hhHHHHHHHHHHL---LEEEELLLLLllhhhLLLHhHHHHHHHHHHhllllEEEEEL---


DSSP  HLLLL-------------------------------------------------------
Query LAGIF-------------------------------------------------------  171
ident                                                             
Sbjct PYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
DSSP  LLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee


DSSP  -LHHHHHHHHHHHHLLlLLEEELLLLLLL--LLLL---LHHHHHHHHH---HHHLLHHHH
Query -GKQLKAFSLRLVEANlIHFVASDAHNVK--TRNF---HTQEALYVLE---KEFGSELPY  222
ident           |         | ||                   |            |   
Sbjct yFAMDEDEVKRIFQHP-CCMVGSDGLPNDarPHPRlwgSFTRVLGRYVreaRLMTLEQAV  397
DSSP  eELLLHHHHHHHHHLL-LEEELLLLLLLLllLLLHhhhHHHHHHHHHHhhlLLLLHHHHH


DSSP  HHH-HHHHHHHLLL----------------------------------------------
Query MLT-ENAELLLRNQ----------------------------------------------  235
ident                                                             
Sbjct ARMtALPARVFGFAergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngae  457
DSSP  HHHlHHHHHHHLLLlllllllllllleeeelllllllllllllllllllleeeeeellee


DSSP  ------llllllllllll
Query ------tifrqppqpvkr  247
ident                   
Sbjct vfpqppadgrpgqvlrax  475
DSSP  eellllllllllllllll


No 35: Query=3qy6A Sbjct=3ls9A Z-score=11.5

back to top
DSSP  ----------------------------------------------------------LE
Query ----------------------------------------------------------MI    2
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelEE


DSSP  ELLLLLlllllLLLL------------------------------------LHHHHHHHH
Query DIHCHIlpamdDGAG------------------------------------DSADSIEMA   26
ident   | |                                                       
Sbjct NSHQHL-----YEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvIREVARAVL  115
DSSP  EEEELH-----HHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHHHHHHH


DSSP  HHHHHLLLLEEELLLEellllllllhHHHHHHHHHHHHHHhhlllLLEEELLL-------
Query RAAVRQGIRTIIATPHhnngvyknepAAVREAADQLNKRLikediPLHVLPGQ-------   79
ident       || |                     |       |                    
Sbjct LESLLGGITTVADQHL---ffpgataDSYIDATIEAATDL-----GIRFHAARssmtlgk  167
DSSP  HHHHHLLEEEEEEEEL---lllllllLLHHHHHHHHHHHH-----LLEEEEEEllllllh


DSSP  -----------------------------------------EEELL----LLHHHHHHLL
Query -----------------------------------------EIRIY----GEVEQDLAKR   94
ident                                                    |     |  
Sbjct seggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCGVpydkPELFEAFAQM  227
DSSP  hhlllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLLLllllHHHHHHHHHH


DSSP  llllhhhlLEEEEEL-lLLLL-------lLLHHHHHHHHHhlllEEEEELHHHlhhhhhL
Query qllslndtKYILIEF-pFDHV-------pRYAEQLFYDLQlkgyIPVIAHPERnreireN  146
ident               |                                 ||          
Sbjct ---aadydVRLHTHFyePLDAgmsdhlygMTPWRFLEKHGwasdRVWLAHAVV-----pP  279
DSSP  ---hhhhlLEEEEEEllLLHHhhhhhhhlLLHHHHHHHLLllllLEEEEELLL-----lL


DSSP  LHHHHHHHHLLLEEEEEHHHHlLLLLhhhHHHHhhHHHLL----LLLEEELLLLLlllLL
Query PSLLYHLVEKGAASQITSGSLaGIFGkqlKAFSlrLVEAN----LIHFVASDAHNvktRN  202
ident           | |            |                                  
Sbjct REEIPEFADAGVAIAHLIAPD-LRMG---WGLA--PIREYldagITVGFGTTGSA-snDG  332
DSSP  HHHHHHHHHHLLEEEELHHHH-HHLL---LLLL--LHHHHhhllLEEEELLLLLL-llLL


DSSP  LLHHHHHHHHHHH------------HLLHHHHHHH-HHHHHHHLLL--------------
Query FHTQEALYVLEKE------------FGSELPYMLT-ENAELLLRNQ--------------  235
ident       |                                   |                 
Sbjct GNLLGDLRLAALAhrpadpnepekwLSARELLRMAtRGSAECLGRPdlgvleegraadia  392
DSSP  LLHHHHHHHHHHHlhhhllllhhhlLLHHHHHHHLlHHHHHHLLLLllllllllllllee


DSSP  -------------------------------------------------lllllllllll
Query -------------------------------------------------tifrqppqpvk  246
ident                                                             
Sbjct cwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttali  452
DSSP  eeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhl


DSSP  l
Query r  247
ident  
Sbjct p  453
DSSP  l


No 36: Query=3qy6A Sbjct=1j6pA Z-score=11.4

back to top
DSSP  ----------------------------------------------------LEELLLLL
Query ----------------------------------------------------MIDIHCHI    8
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpaLFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeelEEEEEELH


DSSP  LlllllLLLL-----------------------------HHHHHHHHHHHHHLLLLEEEL
Query LpamddGAGD-----------------------------SADSIEMARAAVRQGIRTIIA   39
ident                                            |       | ||     
Sbjct P-----XTLLrgvaedlsfeewlfskvlpiedrltekxaYYGTILAQXEXARHGIAGFVD  115
DSSP  H-----HHHHllllllllhhhhhhllhhhhhllllhhhhHHHHHHHHHHHHLLLEEEEEE


DSSP  LLeellllllllhhhHHHHHHHHHHHHhhlllLLEEELLL--------------------
Query TPhhnngvyknepaaVREAADQLNKRLikediPLHVLPGQ--------------------   79
ident                  |                  |                       
Sbjct XY------------fHEEWIAKAVRDF-----GXRALLTRglvdsngddggrleenlkly  158
DSSP  EE------------lLHHHHHHHHHHH-----LLEEEEEEeelllllllllhhhhhhhhh


DSSP  --------------EEEL--------LLLHHHHHHLLllllhhhlLEEEEEL----lLLL
Query --------------EIRI--------YGEVEQDLAKRqllslndtKYILIEF----pFDH  113
ident                              |                   |          
Sbjct newngfegrifvgfGPHSpylcseeyLKRVFDTAKSL-------nAPVTIHLyetskEEY  211
DSSP  hhhllhhhleeeeeEELLlllllhhhHHHHHHHHHHH-------lLLEEEEElllllLLL


DSSP  LLLLHHH-HHHHhhhllLEEEEELHHHLhhhhhLLHHHHHhHHLL-LEEEEEHHHhlLLL
Query VPRYAEQ-LFYDlqlkgYIPVIAHPERNreireNPSLLYHlVEKG-AASQITSGSlaGIF  171
ident                       ||                              |     
Sbjct DLEDILNiGLKE-----VKTIAAHCVHL-----PERYFGV-LKDIpFFVSHNPAS-nLKL  259
DSSP  LLHHHHLlLLLL-----LLEEEEELLLL-----LHHHHHH-HLLLlEEEEELHHH-hHHL


DSSP  LhhhHHHHhhHHHLL----LLLEEELLLLLlllLLLLHHHHHHHHHH--------HHLLH
Query GkqlKAFSlrLVEAN----LIHFVASDAHNvktRNFHTQEALYVLEK--------EFGSE  219
ident |          |              |                                 
Sbjct G---NGIA--PVQRXiehgXKVTLGTDGAA-snNSLNLFFEXRLASLlqkaqnprNLDVN  313
DSSP  L---LLLL--LHHHHhhllLEEEELLLLLL-llLLLLHHHHHHHHHHhhhlllllLLLHH


DSSP  HHHHHH-HHHHHHHLLL-------------------------------------------
Query LPYMLT-ENAELLLRNQ-------------------------------------------  235
ident                                                             
Sbjct TCLKXVtYDGAQAXGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfat  373
DSSP  HHHHHHlHHHHHHHLLLllllllllllleeeeelllhhhllhhhhhhhhhhlllllllee


DSSP  ----------------------llllllllllll
Query ----------------------tifrqppqpvkr  247
ident                                   
Sbjct xvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  eelleeeeellllllllhhhhhhhhhhhhhhhhl


No 37: Query=3qy6A Sbjct=2pajA Z-score=11.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  --LEELLLLLlllllLLLL--------------LHHHHHHHHHHHHHLLLLEEELLLEel
Query --MIDIHCHIlpamdDGAG--------------DSADSIEMARAAVRQGIRTIIATPHhn   44
ident       | |                                     | |  |        
Sbjct paWVNTHHHL-----FQSLlkgepfralfderrFRLAARIGLIELARSGCATVADHNY--  113
DSSP  elEELLLLLH-----HHHHllllllhhhllhhhHHHHHHHHHHHHHLLLEEEEEELLL--


DSSP  lllllllhhHHHHHHHHHHHHHhhlllLLEEELLL-------------------------
Query ngvyknepaAVREAADQLNKRLikediPLHVLPGQ-------------------------   79
ident                      |      |                               
Sbjct -vyypgmpfDSSAILFEEAEKL-----GLRFVLLRggatqtrqleadlptalrpetlday  167
DSSP  -llllllllLHHHHHHHHHHHL-----LLEEEEEEllllllllllllllhhhllllhhhh


DSSP  -------------------------EEEL--------LLLHHHHHHLLllllhhhlLEEE
Query -------------------------EIRI--------YGEVEQDLAKRqllslndtKYIL  106
ident                                        |                    
Sbjct vadierlaaryhdaspramrrvvmaPTTVlysispreMRETAAVARRL-------gLRMH  220
DSSP  hhhhhhhhhhllllllllleeeeelLLLLlllllhhhHHHHHHHHHHL-------lLEEE


DSSP  EELLllLLLLLHH-HHHHhhhhlllEEEEELHHhlhhhHHLLHHHHHHHHLLLEEEEEHH
Query IEFPfdHVPRYAE-QLFYdlqlkgyIPVIAHPErnreiRENPSLLYHLVEKGAASQITSG  165
ident                              ||                |   |        
Sbjct SHLSgkSPVAFCGeHDWL-----gsDVWYAHLV-----KVDADEIALLAQTGTGVAHCPQ  270
DSSP  EELLllLHHHHHHhLLLL-----llLEEEELLL-----LLLHHHHHHHHHHLLEEEELHH


DSSP  HhlLLLLhhhhhhhhhHHHLL----LLLEEELLLLLlllLLLLHHHHHHHHHHH-----H
Query SlaGIFGkqlkafslrLVEAN----LIHFVASDAHNvktRNFHTQEALYVLEKE-----F  216
ident |                |              |                           
Sbjct S--NGRL---------PVREMadagVPVSIGVDGAA-snEAADMISEVHMTWLAqrarlA  318
DSSP  H--HHLL---------LLLLHhhhlLLEEELLLHHH-hlLLLLHHHHHHHHHHHhhhllL


DSSP  LLHHHHHH-HHHHHHHHLLL----------------------------------------
Query GSELPYML-TENAELLLRNQ----------------------------------------  235
ident          |                                                  
Sbjct SIAEVIHWgTAGGARVMGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrp  378
DSSP  LHHHHHHHhLHHHHHHHLLLlllllllllllleeeeelllhhhlllllhhhhhhhlllll


DSSP  -------------------------------llllllllllll
Query -------------------------------tifrqppqpvkr  247
ident                                            
Sbjct svmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 38: Query=3qy6A Sbjct=2dvtA Z-score=11.0

back to top
DSSP  ---LEELLLLlLLLL--------------lllLLLH-hHHHH-HHHHHHHLLLLEEELLL
Query ---MIDIHCHiLPAM--------------ddgAGDS-aDSIE-MARAAVRQGIRTIIATP   41
ident          |                            |            || | |   
Sbjct mqgKVALEEH-FAIPetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSL   59
DSSP  lllEEEEEEE-ELLHhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEE


DSSP  E---eLLLL----lllLHHHHHHHHHHHHHHHhhllllLEEELL----------------
Query H---hNNGV----yknEPAAVREAADQLNKRLikedipLHVLPG----------------   78
ident                                          |                  
Sbjct NapavQAIPdrrkaieIARRANDVLAEECAKR-----pDRFLAFaalplqdpdaateelq  114
DSSP  LllhhHHLLlhhhhhhHHHHHHHHHHHHHHHL-----lLLEEEEellllllhhhhhhhhh


DSSP  ----------LEEELL--------------llhHHHHHLlllllhhhlLEEEEEL-----
Query ----------QEIRIY--------------gevEQDLAKrqllslndtKYILIEF-----  109
ident                                                             
Sbjct rcvndlgfvgALVNGFsqegdgqtplyydlpqyRPFWGE----vekldVPFYLHPrnplp  170
DSSP  hhhhllllleEEEELLllllllllllllllhhhHHHHHH----hhhhlLLEEEELllllh


DSSP  ------------------LLLLLLLLHHHHH-HHHH--HLLLEEEEELHHHLhhHHHLLH
Query ------------------PFDHVPRYAEQLF-YDLQ--LKGYIPVIAHPERNreIRENPS  148
ident                           |  |    |            |            
Sbjct qdsriydghpwllgptwaFAQETAVHALRLMaSGLFdeHPRLNIILGHMGEG--LPYMMW  228
DSSP  hhlhhhlllhhhlhhhlhHHHHHHHHHHHHHhLLHHhhLLLLLEEELHHHLL--HHHHHH


DSSP  -------------------hhHHHHHLLLEEEEEhHHHLllllhhhHHHHHHHHHLLL--
Query -------------------llYHLVEKGAASQITsGSLAgifgkqlKAFSLRLVEANL--  187
ident                                    |                        
Sbjct ridhrnawvklpprypakrrfMDYFNENFHITTS-GNFR-------TQTLIDAILEIGad  280
DSSP  hhhhllllllllllllllllhHHHHHHHEEEELL-LLLL-------HHHHHHHHLLLLhh


DSSP  LLEEELLLLlllLLLL--LHHHHHHHhhhHHLLHHHHHH-HHHHHHHHLLLlllllllll
Query IHFVASDAHnvkTRNF--HTQEALYVlekEFGSELPYML-TENAELLLRNQtifrqppqp  244
ident       |       |                           ||  |             
Sbjct RILFSTDWP---FENIdhASDWFNAT---SIAEADRVKIgRTNARRLFKLD---------  325
DSSP  HEELLLLLL---LLLHhhHHHHHHHL---LLLHHHHHHHhLHHHHHHLLLL---------


DSSP  lll
Query vkr  247
ident    
Sbjct ---  325
DSSP  ---


No 39: Query=3qy6A Sbjct=4ofcA Z-score=10.9

back to top
DSSP  -LEELLLLlLLLL------------------------------------lllLLLHhhHH
Query -MIDIHCHiLPAM------------------------------------ddgAGDSadSI   23
ident   |||| |                                                    
Sbjct mKIDIHSH-ILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvreNCWD--PE   57
DSSP  lLEEEEEE-LLLLllllhhhhhllllleeeeeeelleeeeeelleeeeeeehHHLL--HH


DSSP  HHHHHHHHLLLLEEELLLEE--LLLL-----lllLHHHHHHHHHHHHHHHhhllllLEEE
Query EMARAAVRQGIRTIIATPHH--NNGV-----yknEPAAVREAADQLNKRLikedipLHVL   76
ident    |     |                                                  
Sbjct VRIREMDQKGVTVQALSTVPvmFSYWakpedtlnLCQLLNNDLASTVVSY-----pRRFV  112
DSSP  HHHHHHHHHLLLEEEEELLHhhHLLLllhhhhhhHHHHHHHHHHHHHHHL-----lLLEE


DSSP  LL--------------------------LEEELL--------llHHHHHHLlllllhhhL
Query PG--------------------------QEIRIY--------geVEQDLAKrqllslndT  102
ident                               |                  |          
Sbjct GLgtlpmqapelavkemercvkelgfpgVQIGTHvnewdlnaqeLFPVYAA----aerlK  168
DSSP  EEellllllhhhhhhhhhhhhhllllleEEEELEelleelllhhHHHHHHH----hhhhL


DSSP  LEEEEEL-------------------LLLL---LLLLHH--HHHHHHHhlLLEEEEELHH
Query KYILIEF-------------------PFDH---VPRYAE--QLFYDLQlkGYIPVIAHPE  138
ident                                            |            ||  
Sbjct CSLFVHPwdmqmdgrmakywlpwlvgMPAEttiAICSMImgGVFEKFP--KLKVCFAHGG  226
DSSP  LEEEEELllllllhhhhlllhhhhlhHHHHhhhHHHHHHllLHHHHLL--LLLEEELHHH


DSSP  HLhhHHHLLH-------------------hhHHHHHlLLEEEEEhhHHLLlllhhhhHHH
Query RNreIRENPS-------------------llYHLVEkGAASQITsgSLAGifgkqlkAFS  179
ident                                                             
Sbjct GA--FPFTVGrishgfsmrpdlcaqdnpmnpKKYLG-SFYTDAL--VHDP-------LSL  274
DSSP  LL--HHHHHHhhhhhhhhlhhhhlllllllhHHHLL-LLEEELL--LLLH-------HHH


DSSP  HHHHhLLLL---LEEELLLLLllLLLL-LHHHHHHHHhHHHLLHHHHHH-HHHHHHHHLL
Query LRLVeANLI---HFVASDAHNvkTRNF-HTQEALYVLeKEFGSELPYML-TENAELLLRN  234
ident   |              |                     ||  |    |   ||   |  
Sbjct KLLT-DVIGkdkVILGTDYPF--PLGElEPGKLIESM-EEFDEETKNKLkAGNALAFLGL  330
DSSP  HHHH-HHHLlllEELLLLLLL--LLLLlLLLHHHHHL-LLLLHHHHHHHhLHHHHHHHLL


DSSP  Lllllllllllll
Query Qtifrqppqpvkr  247
ident              
Sbjct E--------rkqf  335
DSSP  L--------hhhl


No 40: Query=3qy6A Sbjct=4hk5D Z-score=10.9

back to top
DSSP  ---LEELLLLLLLL----------------------------------------------
Query ---MIDIHCHILPA----------------------------------------------   11
ident      ||| |  |                                               
Sbjct tpvVVDIHTHMYPPsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  lllLEEEEEEELLHhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  ----llllLLLHhhHHHHHHHHHHLLLLEEELLLE--ELLLL----lllLHHHHHHHHHH
Query ----mddgAGDSadSIEMARAAVRQGIRTIIATPH--HNNGV----yknEPAAVREAADQ   61
ident            |             |||                        ||      
Sbjct lpgrplstHFAS--LAQKMHFMDTNGIRVSVISLAnpWFDFLapdeapgIADAVNAEFSD  118
DSSP  llleellhHHLL--HHHHHHHHHHLLLLEEEEEELllLLLLLllllhhhHHHHHHHHHHH


DSSP  HHHHHHhlllllEEELL---------------------------LEEELLLL--------
Query LNKRLIkediplHVLPG---------------------------QEIRIYGE--------   86
ident                                                   |         
Sbjct MCAQHV-----gRLFFFaalplsapvdavkasiervknlkycrgIILGTSGLgkglddph  173
DSSP  HHHLLL-----lLEEEEeellllllhhhhhhhhhhhhlllleeeEEELLLLLllllllhh


DSSP  HHHHHHLlllllhhhLLEEEEEL-------------------------LLLL---LLLLH
Query VEQDLAKrqllslndTKYILIEF-------------------------PFDH---VPRYA  118
ident                                                             
Sbjct LLPVFEA----vadaKLLVFLHPhyglpnevygprseeyghvlplalgFPMEttiAVARM  229
DSSP  HHHHHHH----hhhlLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhhhHHHHH


DSSP  H--HHHHHHHhlLLEEEEELHHHLhhhhHLLH-----------------------hhhHH
Query E--QLFYDLQlkGYIPVIAHPERNreirENPS-----------------------llyHL  153
ident      |            ||                                        
Sbjct YmaGVFDHVR--NLQMLLAHSGGT--lpFLAGriescivhdghlvktgkvpkdrrtiwTV  285
DSSP  HhlLHHHHLL--LLLEEEHHHHLL--hhHHHHhhhhhhhllhhhhhllllllllllhhHH


DSSP  HHLLLEEEEEhhHHLLlllhhhhHHHHHHHhLLLL---LEEELLLLLLLL-------lll
Query VEKGAASQITsgSLAGifgkqlkAFSLRLVeANLI---HFVASDAHNVKT-------rnf  203
ident                                |           |                
Sbjct LKEQIYLDAV--IYSE-------VGLQAAI-ASSGadrLMFGTDHPFFPPieedvqgpwd  335
DSSP  HHHLEEEELL--LLLH-------HHHHHHH-HHHLhhhEELLLLLLLLLLlllllllllh


DSSP  LHHHHHHHHHHHHLL--HHHHHH-HHHHHHHHLllllllllllllll
Query HTQEALYVLEKEFGS--ELPYML-TENAELLLRnqtifrqppqpvkr  247
ident           |  |            ||   |               
Sbjct SSRLNAQAVIKAVGEgsSDAAAVmGLNAVRVLS--lkaelehhhhhh  380
DSSP  HHHHHHHHHHHHHLLllHHHHHHhLHHHHHHLL--lhhhhhhhhhhl


No 41: Query=3qy6A Sbjct=4c5yA Z-score=10.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  --LEELLLLLLLL-----------lllllLLHHHHHHHHHHHHHLLLLEEELLLeellll
Query --MIDIHCHILPA-----------mddgaGDSADSIEMARAAVRQGIRTIIATPhhnngv   47
ident     | | |                       |        |   |              
Sbjct pgLWDCHMHFGGDddyyndytsglathpaSSGARLARGCWEALQNGYTSYRDLA------  114
DSSP  elEEEEEELLLLLlllllllhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELL------


DSSP  llllhhhhhhHHHHHHHHHHHL-LLLLEEELL----------------------------
Query yknepaavreAADQLNKRLIKE-DIPLHVLPG----------------------------   78
ident                 |           |                               
Sbjct ---------gYGCEVAKAINDGtIVGPNVYSSgaalsqtaghgdifalpagevlgsygvm  165
DSSP  ---------lLHHHHHHHHHLLlLLLLEEEELlleeellllllllllllhhhhhhhhlll


DSSP  -----------------------------------LEEE---------------LLLL--
Query -----------------------------------QEIR---------------IYGE--   86
ident                                                             
Sbjct nprpgywgagplciadgveevrravrlqirrgakvIXVMasggvmsrddnpnfaQFSPee  225
DSSP  llllllllllleeelllhhhhhhhhhhhhhhllllEEEElllllllllllllllLLLHhh


DSSP  HHHHHHLLllllhhhlLEEEEELllllLLLLHHHHHHHHhhlllEEEEELHHhlhhhhhl
Query VEQDLAKRqllslndtKYILIEFpfdhVPRYAEQLFYDLqlkgyIPVIAHPErnreiren  146
ident                                                  |          
Sbjct LKVIVEEA----arqnRIVSAHV---hGKAGIMAAIKAG-----CKSLEHVS------ya  267
DSSP  HHHHHHHH----hhllLLEEEEE---lLHHHHHHHHHHL-----LLEEEELL------ll


DSSP  LHHHHHHHHLL-LEEEEEHHHhlLLLLH---------------HHHHHHHHHHHLL----
Query PSLLYHLVEKG-AASQITSGSlaGIFGK---------------QLKAFSLRLVEAN----  186
ident       |          |      ||                  |    |          
Sbjct DEEVWELMKEKgILYVATRSV-iEIFLAsngeglvkeswaklqALADSHLKAYQGAikag  326
DSSP  LHHHHHHHHHHlLEEELLHHH-hHHHHHhllllllllhhhlllHHHHHHHHHHHHHhhll


DSSP  LLLEEELLLLllllllLLHHHHHHHHHH--HHLLHHHHHHH-HHHHHHHLLL--------
Query LIHFVASDAHnvktrnFHTQEALYVLEK--EFGSELPYMLT-ENAELLLRNQ--------  235
ident        |          |   |                    || |    |        
Sbjct VTIALGTDTA----pgGPTALELQFAVErgGMTPLEAIKAAtANAPLSVGPQapltgqlr  382
DSSP  LLEELLLLLL----llLLLHHHHHHHHHllLLLHHHHHHHHlLLHHHHHHHHllllllll


DSSP  ------------------------------------------llllllllllll
Query ------------------------------------------tifrqppqpvkr  247
ident                                                       
Sbjct egyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 42: Query=3qy6A Sbjct=3f2bA Z-score=10.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -------------------------------------------------LEELLLLlLLL
Query -------------------------------------------------MIDIHCHiLPA   11
ident                                                      | |  | 
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegekRVELHLH-TPM  119
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllllLLLLLLL-LLL


DSSP  LL-LLLLlhhHHHHHHHHHHHLLLLEEELLLEEllllllllhhhHHHHHHHHHHHHHhlL
Query MD-DGAGdsaDSIEMARAAVRQGIRTIIATPHHnngvyknepaaVREAADQLNKRLIkeD   70
ident    |              |   |   |  | |            |               
Sbjct SQmDAVT---SVTKLIEQAKKWGHPAIAVTDHA-----------VVQSFPEAYSAAK--K  163
DSSP  LLlLLLL---LHHHHHHHHHHLLLLLEEELLLL-----------LLLLHHHHHHHHH--H


DSSP  LLLEEELLLEEELLLL-----------------------------------HHHHHHLLl
Query IPLHVLPGQEIRIYGE-----------------------------------VEQDLAKRq   95
ident     |  | |  |                                          | |  
Sbjct HGMKVIYGLEANIVDDpfhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKH-  222
DSSP  HLLLEEEEEEEEEELLleeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHL-


DSSP  lllhhhLLEEeeelllllllllhhhhhhhhhhllleeEEELH--hhLHHHhhllhhhHHH
Query llslndTKYIliefpfdhvpryaeqlfydlqlkgyipVIAHP--erNREIrenpsllYHL  153
ident                                                             
Sbjct ----rdGLLV---------------------------GSGCDkgelFDNV-------EDI  244
DSSP  ----llLEEE---------------------------ELLLLllllLLLL-------LLL


DSSP  HhLLLE-EEEEhhHHLLlLLHH---hHHHHHHHHHLLL--------lLEEELLLLLLLL-
Query VeKGAA-SQITsgSLAGiFGKQ---lKAFSLRLVEANL--------iHFVASDAHNVKT-  200
ident                                                       |     
Sbjct A-RFYDfLEVH--PPDV-YKPLyvkdEEMIKNIIRSIValgekldipVVATGNVHYLNPe  300
DSSP  H-HHLLlEEEL--LHHH-HLLLllllHHHHHHHHHHHHhhhhhllllEEELLLLLLLLHh


DSSP  -------------------------LLLLHH-HHHHHHHhHHLLHHHHHH-HHHHHHHHL
Query -------------------------RNFHTQ-EALYVLEkEFGSELPYML-TENAELLLR  233
ident                            | |  | |       | |        |      
Sbjct dkiyrkilihsqgganplnrhelpdVYFRTTnEMLDCFS-FLGPEKAKEIvVDNTQKIAS  359
DSSP  hhhhhhhhhhllhhhllllllllllLLLLLHhHHHHHHH-HHHHHHHHHHhLHHHHHHHH


DSSP  L-----------------------------------------------------------
Query N-----------------------------------------------------------  234
ident                                                             
Sbjct Ligdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgf  419
DSSP  Lllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct aviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffn  479
DSSP  hhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct dgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahny  539
DSSP  llllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct tkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgq  599
DSSP  hhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct hpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvir  659
DSSP  eeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct mlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmlee  719
DSSP  hhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct trpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepsl  779
DSSP  hllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct afkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayf  839
DSSP  hhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct kvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvleva  899
DSSP  hhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct lemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflsk  959
DSSP  hhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllh


DSSP  ----------------------lllllllllllll
Query ----------------------qtifrqppqpvkr  247
ident                                    
Sbjct edlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhlllhhhhhhhhhllllllllllllllll


No 43: Query=3qy6A Sbjct=2qpxA Z-score=10.4

back to top
DSSP  -------------LEELLLLLlllllllLLLH----------------------------
Query -------------MIDIHCHIlpamddgAGDS----------------------------   19
ident                | |||          |                             
Sbjct gxddlsefvdqvpLLDHHCHF-------LIDGkvpnrddrlaqvsteadkdypladtknr   53
DSSP  lllllhhhhhhllEEEEEELL-------LLLLllllhhhhhhhhlllllllllhhhhlll


DSSP  ---------------------------hhhhHHHHHHHHLLLLEEELLLEellllllllh
Query ---------------------------adsiEMARAAVRQGIRTIIATPHhnngvyknep   52
ident                                   |                         
Sbjct layhgflalakefaldannplaaxndpgyatYNHRIFGHFHFKELLIDTG-------fvp  106
DSSP  hhhhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLLEEEEEEELL-------lll


DSSP  hhhhHHHHHHHHhhhhlllLLEEELLL---------------------------------
Query aavrEAADQLNKrlikediPLHVLPGQ---------------------------------   79
ident        ||             |                                     
Sbjct ddpiLDLDQTAE-----lvGIPVKAIYrlethaedfxlehdnfaawwqafsndvkqakah  161
DSSP  llllLLHHHHHH-----hhLLLEEEEEehhhhhhhhhlllllhhhhhhhhhhhhhlllll


DSSP  -----EEEL-------------------------------------llLHHHHHHLLlll
Query -----EIRI-------------------------------------ygEVEQDLAKRqll   97
ident                                                             
Sbjct gfvgfXSIAayrvglhlepvnvieaaagfdtwkhsgekrltskplidyXLYHVAPFI---  218
DSSP  lllleEELHhhhlllllllllhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHH---


DSSP  lhhhLLEEEEELL-------LLLLL-LLHHHHHHHHHHLLLEEEEELHHHLhhhhhllhH
Query slndTKYILIEFP-------FDHVP-RYAEQLFYDLQLKGYIPVIAHPERNreirenpsL  149
ident                                       ||   |  |             
Sbjct -iaqDXPLQFHVGygdadtdXYLGNpLLXRDYLKAFTKKGLKVVLLHCYPY------hrE  271
DSSP  -hhhLLLEEEEELlllllllHHHLLhHHHHHHHHHHHHHLLLEEEEELLLL------hhH


DSSP  HHHHHHLL--LEEEEEhHHHLlLLLHHHHHHHHHHHHLLL--LLEEELLLLLLlLLLLL-
Query LYHLVEKG--AASQITsGSLAgIFGKQLKAFSLRLVEANL--IHFVASDAHNVkTRNFH-  204
ident    |          |                    ||         ||||          
Sbjct AGYLASVFpnLYFDIS-LLDN-LGPSGASRVFNEAVELAPytRILFASDASTYpEXYGLa  329
DSSP  HHHHHHHLllEEEELL-LHHH-HLHHHHHHHHHHHLLLLLhhHEELLLLLLLLhHHHHHh


DSSP  HHHHHHHHHHHHL----------LHHHHHHH-HHHHHHHLLLllllllllllll
Query TQEALYVLEKEFG----------SELPYMLT-ENAELLLRNQtifrqppqpvkr  247
ident        |   |                         |                
Sbjct ARQFKQALVAHFNqlpfvdlaqkKAWINAICwQTSAKLYHQE-------relrv  376
DSSP  HHHHHHHHHHHHHllllllhhhhHHHHHHHHlHHHHHHLLLH-------hhhll


No 44: Query=3qy6A Sbjct=1a4mA Z-score=10.4

back to top
DSSP  -------LEELLLLLllllLLLLL------------------------------------
Query -------MIDIHCHIlpamDDGAG------------------------------------   17
ident            | |     |                                        
Sbjct tpafnkpKVELHVHL----DGAIKpetilyfgkkrgialpadtveelrniigmdkplslp   56
DSSP  lllllllEEEEEEEH----HHLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhh


DSSP  -------------------LHHHHHHHHHHHHHLLLLEEELLLEellllLLLL-------
Query -------------------DSADSIEMARAAVRQGIRTIIATPHhnngvYKNE-------   51
ident                          |        |                         
Sbjct gflakfdyympviagcreaIKRIAYEFVEMKAKEGVVYVEVRYS----pHLLAnskvdpm  112
DSSP  hhhllhhhhhhhhlllhhhHHHHHHHHHHHHHHLLEEEEEEEEL----lHHHLlllllll


DSSP  -----------hHHHHHHHHHHHHHHHhlLLLLEEELLL---------------------
Query -----------pAAVREAADQLNKRLIkeDIPLHVLPGQ---------------------   79
ident               |      |            |                         
Sbjct pwnqtegdvtpdDVVDLVNQGLQEGEQ--AFGIKVRSILccmrhqpswslevlelckkyn  170
DSSP  hhhlllllllhhHHHHHHHHHHHHHHH--HHLLEEEEEEeeelllhhhhhhhhhhhhhll


DSSP  -------EEEL---------llLHHHHHHLLllllhhhlLEEEEEL-lLLLLLllhHHHH
Query -------EIRI---------ygEVEQDLAKRqllslndtKYILIEF-pFDHVPryaEQLF  122
ident                                                             
Sbjct qktvvamDLAGdetiegsslfpGHVEAYEGA----vkngIHRTVHAgeVGSPE-vvREAV  225
DSSP  llleeeeEEELllllllhhhlhHHHHHHHHH----hhhlLEEEEEEllLLLHH-hhHHHH


DSSP  HHHHhlllEEEEELHHhlhHHHHLLHHHHHHHHLLLEEEEEHHHhlLLLL----HHHHhH
Query YDLQlkgyIPVIAHPErnrEIRENPSLLYHLVEKGAASQITSGSlaGIFG----KQLKaF  178
ident   |          |        |   |   |            |     |    |     
Sbjct DILK----TERVGHGY---HTIEDEALYNRLLKENMHFEVCPWS-sYLTGawdpKTTH-A  276
DSSP  HLLL----LLEEEELH---HHHHLHHHHHHHHHLLLEEEELHHH-hHHLLllllLLLL-H


DSSP  HHHHHHLLLLLEEELLLLLlLLLLlLHHHHHHHHHH--HHLLHHHHHHHHHHHH-HHLLL
Query SLRLVEANLIHFVASDAHNvKTRNfHTQEALYVLEK--EFGSELPYMLTENAEL-LLRNQ  235
ident   |            |                   |   |  |    |  ||        
Sbjct VVRFKNDKANYSLNTDDPL-IFKS-TLDTDYQMTKKdmGFTEEEFKRLNINAAKsSFLPE  334
DSSP  HHHHHHLLLLEEELLLLLL-LLLL-LHHHHHHHHHHllLLLHHHHHHHHHHHHHlLLLLH


DSSP  ---llllllllllll
Query ---tifrqppqpvkr  247
ident                
Sbjct eekkellerlyreyq  349
DSSP  hhhhhhhhhhhhhll


No 45: Query=3qy6A Sbjct=2gwgA Z-score=10.1

back to top
DSSP  -LEELLLLLllllllLLLL---------------------------------HHHHH-HH
Query -MIDIHCHIlpamddGAGD---------------------------------SADSI-EM   25
ident   |||| |                                             |  |   
Sbjct xIIDIHGHY------TTAPkaledwrnrqiagikdpsvxpkvselkisddelQASIIeNQ   54
DSSP  lLEEEEEEL------LLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhHHHHHlLH


DSSP  HHHHHHLLLLEEELLLEE-lllllllLHHHHHHHHHHHHHHHHhllllLEEELL------
Query ARAAVRQGIRTIIATPHH-nngvyknEPAAVREAADQLNKRLIkedipLHVLPG------   78
ident        |       |            |   |                           
Sbjct LKKXQERGSDLTVFSPRAgdfnvsstWAAICNELCYRVSQLFP-----DNFIGAaxlpqs  109
DSSP  HHHHHHHLLLEEEEELLLllhhhhhhHHHHHHHHHHHHHHHLL-----LLEEEEeellll


DSSP  -----------------------LEEELL------------llhHHHHHLLllllhhhLL
Query -----------------------QEIRIY------------gevEQDLAKRqllslndTK  103
ident                                                             
Sbjct pgvdpktcipelekcvkeygfvaINLNPDpsgghwtsppltdriWYPIYEK---xvelEI  166
DSSP  llllhhhhhhhhhhhhhllllleEEELLLlllllllllllllhhHHHHHHH---hhhhLL


DSSP  EEEEE-----lLLLL---LLLLHHHhhHHHHHL-LLEEEEELHHHLhhHHHLLH------
Query YILIE-----fPFDH---VPRYAEQlfYDLQLK-GYIPVIAHPERNreIRENPS------  148
ident    |                                  || |                  
Sbjct PAXIHvstgahYLNAdttAFXQCVA-gDLFKDFpELKFVIPHGGGA--VPYHWGrfrgla  223
DSSP  LEEELlllllhHHHHhhhHHHHHHH-lLHHHHLlLLLEEELHHHLL--LHHHHHhhhhhh


DSSP  ---hhhHHHHLL---LEEEEEhHHHLllllhhhhHHHHHHHHLLL--LLEEELLLLLLLL
Query ---llyHLVEKG---AASQITsGSLAgifgkqlkAFSLRLVEANL--IHFVASDAHNVKT  200
ident        |                               |           ||       
Sbjct qexkkpLLEDHVlnnIFFDTC-VYHQ--------PGIDLLNTVIPvdNVLFASEXIGAVR  274
DSSP  hhllllLHHHHLlllEEEELL-LLLH--------HHHHHHHHHLLhhHEELLLLLLLLLL


DSSP  --------llLLHHHHHHHHhHHHLLHHHHHHH-HHHHHHHLLlllllllllllll
Query --------rnFHTQEALYVLeKEFGSELPYMLT-ENAELLLRNqtifrqppqpvkr  247
ident             |             |        ||                   
Sbjct gidprtgfyyDDTKRYIEAS-TILTPEEKQQIYeGNARRVYPRldaalkakgkleh  329
DSSP  leelllleelLLLHHHHHHL-LLLLHHHHHHHHlHHHHHHLHHhhhhhhhhhhhll


No 46: Query=3qy6A Sbjct=2imrA Z-score=10.1

back to top
DSSP  --------------------------------------------------------LEEL
Query --------------------------------------------------------MIDI    4
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviappPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelllLLEE


DSSP  LLLLllLLLL--------------------lLLLHHHHHHHHHHHHHLLLLEEELLLeel
Query HCHIlpAMDD--------------------gAGDSADSIEMARAAVRQGIRTIIATPhhn   44
ident | |    |                           |     |    | |           
Sbjct HTHL--DMSAyefqalpyfqwipevvirgrhLRGVAAAQAGADTLTRLGAGGVGDIV---  115
DSSP  EEEL--LLLHhhhhhlhhhhllhhhhhhhllLLHHHHHHHHHHHHHHLLLLLEEEEE---


DSSP  lllllllhhhhHHHHHHHHHHHhhlllLLEEELLL-------------------------
Query ngvyknepaavREAADQLNKRLikediPLHVLPGQ-------------------------   79
ident             |  | |  |       |                               
Sbjct ---------waPEVMDALLARE-----DLSGTLYFevlnpfpdkadevfaaarthlerwr  161
DSSP  ---------llHHHHHHHHLLL-----LLLEEEEEeellllhhhhhhhhhhhhhhhhhhh


DSSP  -----------EEEL--------LLLHHHHHHLLllllhhhlLEEEEEL-----------
Query -----------EIRI--------YGEVEQDLAKRqllslndtKYILIEF-----------  109
ident                                |              |             
Sbjct rlerpglrlglSPHTpftvshrlMRLLSDYAAGE-------gLPLQIHVaehptelemfr  214
DSSP  lllllleeeeeEELLlllllhhhHHHHHHHHHHH-------lLLLEEEElllhhhhhhhh


DSSP  ----------------------------lllLLLLLHH--HHHHhhhhllLEEEEELHHH
Query ----------------------------pfdHVPRYAE--QLFYdlqlkgYIPVIAHPER  139
ident                                   ||                |   |   
Sbjct tgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelGVLA------ARPTLVHMVN  268
DSSP  hlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhLLHH------HLLEEEELLL


DSSP  LhhhhhLLHHHHHHHHLLLEEEEEHHHHlLLLLhhhHHHHhhHHHLL----LLLEEELLL
Query NreireNPSLLYHLVEKGAASQITSGSLaGIFGkqlKAFSlrLVEAN----LIHFVASDA  195
ident        |         | |      |                  |            | 
Sbjct V-----TPDDIARVARAGCAVVTCPRSN-HHLE---CGTF--DWPAFaaagVEVALGTDS  317
DSSP  L-----LHHHHHHHHHHLLLEEELHHHH-HHLL---LLLL--LHHHHhhllLLEEELLLL


DSSP  LLlllLLLLHHHHHHHHHHH---HLLHHHHHHH-HHHHHHHL--------llllllllll
Query HNvktRNFHTQEALYVLEKE---FGSELPYMLT-ENAELLLR--------nqtifrqppq  243
ident            |                                                
Sbjct VA-sgETLNVREEVTFARQLypgLDPRVLVRAAvKGGQRVVGtpflrrgetwqegfrwel  376
DSSP  HH-hhLLLLLHHHHHHHHHHlllLLHHHHHHHHhHHHHHHHLlllllllllllhhhlhhh


DSSP  llll
Query pvkr  247
ident     
Sbjct srdl  380
DSSP  llll


No 47: Query=3qy6A Sbjct=3iacA Z-score=9.9

back to top
DSSP  ---------------------------LEELLLLLLLLllllllLHHH------------
Query ---------------------------MIDIHCHILPAmddgagDSAD------------   21
ident                              | |||  |                       
Sbjct atfxtedfllkndiartlyhkyaapxpIYDFHCHLSPQ----eiADDRrfdnlgqiwleg   56
DSSP  llllllllllllhhhhhhhhhllllllEEELLLLLLHH----hhHHLLllllhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   21
ident                                                             
Sbjct dhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitg  116
DSSP  llhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllll


DSSP  ----------------------hhHHHHHHHHLLLLEEELLLeelllllllLHHHhHHHH
Query ----------------------siEMARAAVRQGIRTIIATPhhnngvyknEPAAvREAA   59
ident                                    |    |           |    |  
Sbjct tlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD---------DPIDsLEYH  167
DSSP  llllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL---------LLLLlLHHH


DSSP  HHHHHHhhhLLLLLEEELLL----------------------------------------
Query DQLNKRlikEDIPLHVLPGQ----------------------------------------   79
ident  |         |   | |                                          
Sbjct RQIAAD---DSIDIEVAPSWrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltr  224
DSSP  HHHHHL---LLLLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhh


DSSP  -------------EEEL------------------------------------llLHHHH
Query -------------EIRI------------------------------------ygEVEQD   90
ident                 |                                           
Sbjct rldhfaacgcrasDHGIetlrfapvpddaqldailgkrlagetlseleiaqfttaVLVWL  284
DSSP  hhhhhhhlllleeEEEEllllllllllhhhhhhhhhhhhllllllhhhhhhhhhhHHHHH


DSSP  HHLlllllhhhLLEEEEELLL----------------------LLLL-LLHHHHHHHHH-
Query LAKrqllslndTKYILIEFPF----------------------DHVP-RYAEQLFYDLQ-  126
ident                                            |         |      
Sbjct GRQ----yaarGWVXQLHIGAirnnntrxfrllgpdtgfdsigDNNIsWALSRLLDSXDv  340
DSSP  HHH----hhhhLLEEEEEELEellllhhhhhhhllllllleelLLLLhHHHHHHHHHHHl


DSSP  -HLLLEEEEelHHHLHHHhhlLHHHHHHHHLL--------LEEEEehhhhlllllhhHHH
Query -LKGYIPVIahPERNREIrenPSLLYHLVEKG--------AASQItsgslagifgkqLKA  177
ident               |         |                                 | 
Sbjct tNELPKTIL--YCLNPRD---NEVLATXIGNFqgpgiagkVQFGS------gwwfndQKD  389
DSSP  lLLLLEEEE--EELLHHH---HHHHHHHHHHLllllllllEEELL------llhhhlLHH


DSSP  HHHHHHHLL-------lLLEEELLLLLLllLLLL-HHHHHHHHHHHHL------------
Query FSLRLVEAN-------lIHFVASDAHNVktRNFH-TQEALYVLEKEFG------------  217
ident   ||  |                |                  |    |            
Sbjct GXLRQLEQLsqxgllsqFVGXLTDSRSF--LSYTrHEYFRRILCNLLGqwaqdgeipdde  447
DSSP  HHHHHHHHHhhhllhhhLLLLLLLLLLL--LLLHhHHHHHHHHHHHHHhhhhlllllllh


DSSP  ---LHHHHHH-HHHHHHHHLLLllllllllllll
Query ---SELPYML-TENAELLLRNQtifrqppqpvkr  247
ident    |         ||                   
Sbjct axlSRXVQDIcFNNAQRYFTIK------------  469
DSSP  hhhHHHHHHHhLHHHHHHLLLL------------


No 48: Query=3qy6A Sbjct=4qrnA Z-score=9.9

back to top
DSSP  ---------------LEELLLlLLLL----------------------------------
Query ---------------MIDIHChILPA----------------------------------   11
ident                 |                                           
Sbjct smtqdlktggeqgylRIATEE-AFATreiidvylrmirdgtadkgmvslwgfyaqspser   59
DSSP  lllllllllllllllLEEEEE-EELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhh


DSSP  ---lllLLLLHhhHHHHHHHHHHLLLLEEELLLE--ELLLL-----lllLHHHHHHHHHH
Query ---mddGAGDSadSIEMARAAVRQGIRTIIATPH--HNNGV-----yknEPAAVREAADQ   61
ident          |              ||   |                              
Sbjct atqileRLLDL--GERRIADMDATGIDKAILALTspGVQPLhdldeartLATRANDTLAD  117
DSSP  hhhhhhHHHLL--LHHHHHHHHHLLLLEEEEEELllLLLLLllhhhhhhHHHHHHHHHHH


DSSP  HHHHHhhllllLEEELLL--------------------------EEELL--------llh
Query LNKRLikedipLHVLPGQ--------------------------EIRIY--------gev   87
ident                                              |              
Sbjct ACQKY-----pDRFIGMGtvapqdpewsareihrgarelgfkgiQINSHtqgryldeeff  172
DSSP  HHHHL-----lLLEEELLllllllhhhhhhhhhhhhhlllllleEELLLllllllllhhh


DSSP  HHHHHLlllllhhhLLEEEEELL---------------------LLLL-lLLHHHHH-HH
Query EQDLAKrqllslndTKYILIEFP---------------------FDHV-pRYAEQLF-YD  124
ident                    |                        |          |    
Sbjct DPIFRA----lvevDQPLYIHPAtspdsmidpmleagldgaifgFGVEtgMHLLRLItIG  228
DSSP  HHHHHH----hhhhLLLEEELLLlllllllhhhhhhlllllllhHHHHhhHHHHHHHhHL


DSSP  HH--HLLLEEEEELHHHLhhHHHL----------------------lhhhHHHHHLLLEE
Query LQ--LKGYIPVIAHPERNreIREN----------------------psllYHLVEKGAAS  160
ident              |                                              
Sbjct IFdkYPSLQIMVGHMGEA-lPYWLyrldymhqagvrsqryermkplkktiEGYLKSNVLV  287
DSSP  HHhhLLLLLEEELHHHHL-hHHHHhhhhhhhhhhhhlllllllllllllhHHHHHHLEEE


DSSP  EEEhHHHLllllhhhHHHHHHHHHLLL--LLEEELLLLllllLLLL--HHHHHHHHhhHH
Query QITsGSLAgifgkqlKAFSLRLVEANL--IHFVASDAHnvktRNFH--TQEALYVLekEF  216
ident     |                            | |               |        
Sbjct TNS-GVAW-------EPAIKFCQQVMGedRVMYAMDYP----YQYVadEVRAMDAM--DM  333
DSSP  ELL-LLLL-------HHHHHHHHHHHLhhHEELLLLLL----LLLLhhHHHHHHLL--LL


DSSP  LLHHHHHH-HHHHHHHHLLlllllllllllll
Query GSELPYML-TENAELLLRNqtifrqppqpvkr  247
ident            |||                  
Sbjct SAQTKKKFfQTNAEKWFKL-------------  352
DSSP  LHHHHHHHhLHHHHHHLLL-------------


No 49: Query=3qy6A Sbjct=3ooqA Z-score=9.7

back to top
DSSP  -----------------------------------------------------LEELLLL
Query -----------------------------------------------------MIDIHCH    7
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL


DSSP  LLL---------LLLL-----------llllhhhhHHHHHHHHHLLLLEEELLLEELLll
Query ILP---------AMDD-----------gagdsadsIEMARAAVRQGIRTIIATPHHNNgv   47
ident |                                        |   |       |   |  
Sbjct IGLfeegvgyyySDGNeatdpvtphvkaldgfnpqDPAIERALAGGVTSVXIVPGSAN--  118
DSSP  LLLllllllhhhLLLLlllllllllllhhhhllllLHHHHHHHLLLEEEEEELLLLLL--


DSSP  llllhhhhhhhhhHHHHHHhhllllleeeLLLEEEL---------------------LLL
Query yknepaavreaadQLNKRLikediplhvlPGQEIRI---------------------YGE   86
ident                               |                           | 
Sbjct pvggqgsvikfrsIIVEEC-----ivkdpAGLKXAFgenpkrvygerkqtpstrxgtAGV  173
DSSP  leeeeeeeeelllLLHHHH-----eeeeeEEEEEELlhhhhhhhhhlllllllhhhhHHH


DSSP  HHHHHH-------------------------LLLL-llhhhlLEEEEELlLLLLllLHHH
Query VEQDLA-------------------------KRQL-lslndtKYILIEFpFDHVprYAEQ  120
ident                                                          |  
Sbjct IRDYFTkvknyxkkkelaqkegkeftetdlkXEVGexvlrkkIPARXHAhRADDilTAIR  233
DSSP  HHHHHHhhhhhhhhhhhhhhlllllllllhhHHHHhhhhlllLLEEEEElLHHHhhHHHH


DSSP  HHHHHHhllLEEEEELHHHlhhhhhlLHHHHHHHHLLLEEEEEHhhHLLLLL-----hhH
Query LFYDLQlkgYIPVIAHPERnreirenPSLLYHLVEKGAASQITSgsLAGIFG-----kqL  175
ident             || |                | ||          |             
Sbjct IAEEFG---FNLVIEHGTE------aYKISKVLAEKKIPVVVGP--LLTFRTklelkdlT  282
DSSP  HHHHHL---LLEEEEELLL------hHHHHHHHHHHLLLEEELL--LLLLLLlhhhlllL


DSSP  HHHHHHHHHLLLLLEEELLLLlllLLLL-LHHHHHHHHHH-HHLLHHHHHH-HHHHHHHH
Query KAFSLRLVEANLIHFVASDAHnvkTRNF-HTQEALYVLEK-EFGSELPYML-TENAELLL  232
ident       |           |                          |      | |    |
Sbjct XETIAKLLKDGVLIALXCDHP---VIPLeFATVQAATAXRyGAKEEDLLKIlTVNPAKIL  339
DSSP  LLHHHHHHHLLLLEEELLLLL---LLLHhHHHHHHHHHHHhLLLHHHHHHLlLHHHHHHL


DSSP  LLL------------------------------llllllllllll
Query RNQ------------------------------tifrqppqpvkr  247
ident                                              
Sbjct GLEdrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  LLLllllllllllllleeeelllllllllleeeeeelleeeeell


No 50: Query=3qy6A Sbjct=4rdvB Z-score=9.5

back to top
DSSP  --------------------------------------------------LEELLLLLll
Query --------------------------------------------------MIDIHCHIlp   10
ident                                                   |   | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpgMPNLHSHA--   58
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeelEEEEEELH--


DSSP  lllLLLL---------------------------------LHHHHHHHHHHHHHLLLLEE
Query amdDGAG---------------------------------DSADSIEMARAAVRQGIRTI   37
ident                                                        |    
Sbjct ---FQRAmaglaevagnpndsfwtwrelmyrmvarlspeqIEVIACQLYIEMLKAGYTAV  115
DSSP  ---HHHHhlllllllllllllhhhhhhhhhhhhllllhhhHHHHHHHHHHHHHHHLEEEE


DSSP  ELLLE---ellllllllhHHHHHHHHHHHHHHhhlllLLEEELLL---------------
Query IATPH---hnngvyknepAAVREAADQLNKRLikediPLHVLPGQ---------------   79
ident                   |                                         
Sbjct AEFHYvhhdldgrsyadpAELSLRISRAASAA-----GIGLTLLPvlyshagfggqpase  170
DSSP  EEEELlllllllllllllLHHHHHHHHHHHHH-----LLEEEEEElllleeellleellh


DSSP  --------------------------------EEELL-----lLHHHHHHLLllllhhhL
Query --------------------------------EIRIY-----gEVEQDLAKRqllslndT  102
ident                                                 ||          
Sbjct gqrrfingseaylellqrlrapleaaghslglCFHSLravtpqQIATVLAAG-----hdD  225
DSSP  hhllllllhhhhhhhhhhhhhhhhhhlleeleEELLLllllhhHHHHHHLLL-----llL


DSSP  LEEEEEL--lLLLL-----------lLLHHHHhHHHHhlllEEEEELHHHlhhhhhlLHH
Query KYILIEF--pFDHV-----------pRYAEQLfYDLQlkgyIPVIAHPERnreirenPSL  149
ident     |        |                                |          |  
Sbjct LPVHIHIaeqQKEVddcqawsgrrplQWLYEN-VAVD---qRWCLVHATH-----adPAE  276
DSSP  LLEEEEElllHHHHhhhhhhhlllhhHHHHHH-LLLL---lLEEEEELLL-----llHHH


DSSP  HHHHHHLLLEEEEEHHHhlLLLLhhhHHHHhhHHHLL----LLLEEELLLLllllLLLLH
Query LYHLVEKGAASQITSGSlaGIFGkqlKAFSlrLVEAN----LIHFVASDAHnvktRNFHT  205
ident        ||             |                        || |         
Sbjct VAAMARSGAVAGLCLST-eANLG---DGIF--PATDFlaqgGRLGIGSDSH----VSLSV  326
DSSP  HHHHHHHLLEEEELHHH-hHHLL---LLLL--LHHHHhhllLEEEELLLLL----LLLLH


DSSP  HHHHHHHH----------HHHL-------LHHHHH-HHHHHHH-HHLL------------
Query QEALYVLE----------KEFG-------SELPYM-LTENAEL-LLRN------------  234
ident  | |  ||                         |          |               
Sbjct VEELRWLEygqrlrdrkrNRLYrddqpmiGRTLYDaALAGGAQaLGQPigslavgrradl  386
DSSP  HHHHHHHHhhhhhhhlllLLLLllllllhHHHHHHhHHHHHHHhHLLLllllllllllle


DSSP  ----------------------------------------------------llllllll
Query ----------------------------------------------------qtifrqpp  242
ident                                                             
Sbjct lvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqv  446
DSSP  eeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhh


DSSP  lllll
Query qpvkr  247
ident      
Sbjct lgell  451
DSSP  hhhhl


No 51: Query=3qy6A Sbjct=1itqA Z-score=9.5

back to top
DSSP  ---------------LEELLLLLLlllllLLLL----------------hhhhhhHHHHH
Query ---------------MIDIHCHILpamddGAGD----------------sadsieMARAA   29
ident                 || |                                        
Sbjct dffrdeaerimrdspVIDGHNDLP-----WQLLdmfnnrlqderanlttlagthtNIPKL   55
DSSP  lhhhhhhhhhhllllEEEEEELHH-----HHHHhhhllllllhhhllllllllllLHHHH


DSSP  HHLLLLEEELLLEELLLL----LLLLHHHHHHHHHHHHHHHHhlLLLLE-----------
Query VRQGIRTIIATPHHNNGV----YKNEPAAVREAADQLNKRLIkeDIPLH-----------   74
ident                                                |            
Sbjct RAGFVGGQFWSVYTPCDTqnkdAVRRTLEQMDVVHRMCRMYP--ETFLYvtssagirqaf  113
DSSP  HHLLEEEEEEEELLLHHHllllHHHHHHHHHHHHHHHHHHLL--LLEEElllhhhhhhhh


DSSP  ------EELLLEEE----------------------------------------------
Query ------VLPGQEIR----------------------------------------------   82
ident        | | |                                                
Sbjct regkvaSLIGVEGGhsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqs  173
DSSP  hllleeEEEEEELHhhllllhhhhhhhhhlleeeeellllllllllllhhhlllllllll


DSSP  -----llLLHHHHHhllllllhhhLLEEEEELLlllLLLLHHHHHHHHHhllLEEEEELH
Query -----iyGEVEQDLakrqllslndTKYILIEFPfdhVPRYAEQLFYDLQlkgYIPVIAHP  137
ident          |   |             |                              | 
Sbjct qglspfgQRVVKEL-------nrlGVLIDLAHV---SVATMKATLQLSR---APVIFSHS  220
DSSP  llllhhhHHHHHHH-------hhhLLEEELLLL---LHHHHHHHHHHLL---LLLEELLL


DSSP  HHL----HHHHhlLHHHHHHHHLL-LEEEEEHH-----hhllLLLHHHHHHHHHHHHLLL
Query ERN----REIRenPSLLYHLVEKG-AASQITSG-----slagIFGKQLKAFSLRLVEANL  187
ident              |     ||                         |         |   
Sbjct SAYsvcaSRRN-vPDDVLRLVKQTdSLVMVNFYnnyisctnkANLSQVADHLDHIKEVAG  279
DSSP  LLLllllLLLL-lLHHHHHHHHHHlLEEEELLLhhhhlllllLLHHHHHHHHHHHHHHLL


DSSP  --LLEEELLLL-----lllLLLL-LHHHHHHHHHHH-HLLHHHHHHH-HHHHHHhlLLLL
Query --IHFVASDAH-----nvkTRNF-HTQEALYVLEKE-FGSELPYMLT-ENAELLlrNQTI  237
ident         |                       |                |          
Sbjct arAVGFGGDFDgvprvpegLEDVsKYPDLIAELLRRnWTEAEVKGALaDNLLRV--FEAV  337
DSSP  hhHEEELLLLLllllllllLLLLlLHHHHHHHHHHLlLLHHHHHHHHlHHHHHH--HHHH


DSSP  ----------------------llllllllll
Query ----------------------frqppqpvkr  247
ident                                 
Sbjct eqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhllllllllllllllhhhlllllllllllll


No 52: Query=3qy6A Sbjct=2uz9A Z-score=9.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ----------LEELLLLLlllllLLLL------------------------------LHH
Query ----------MIDIHCHIlpamdDGAG------------------------------DSA   20
ident             | | |                                           
Sbjct lshheffmpgLVDTHIHA-----SQYSfagssidlpllewltkytfpaehrfqnidfAEE  115
DSSP  llllleeeelEEEEEEEH-----HHHHhllllllllhhhhhhhlhhhhhhhhhlhhhHHH


DSSP  HHHHHHHHHHHLLLLEEELLLEellllllLLHHHHHHHHHHHHHhhhhllLLLEEELL--
Query DSIEMARAAVRQGIRTIIATPHhnngvykNEPAAVREAADQLNKrlikedIPLHVLPG--   78
ident       |     |  |                      ||   |             |  
Sbjct VYTRVVRRTLKNGTTTACYFAT-------IHTDSSLLLADITDK------FGQRAFVGkv  162
DSSP  HHHHHHHHHHHLLEEEEEEELL-------LLHHHHHHHHHHHHH------HLLEEEEEle


DSSP  ----------------------------------------lEEEL--------LLLHHHH
Query ----------------------------------------qEIRI--------YGEVEQD   90
ident                                            |          ||    
Sbjct cmdlndtfpeyketteesiketerfvsemlqknysrvkpivTPRFslscsetlMGELGNI  222
DSSP  elllllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLhhhllhhhHHHHHHH


DSSP  HHLLllllhhhllEEEEEL-----LLLL----------LLLLHHHHHhhhhhllLEEEEE
Query LAKRqllslndtkYILIEF-----PFDH----------VPRYAEQLFydlqlkgYIPVIA  135
ident    |          |                                          | |
Sbjct AKTR-------dlHIQSHIsenrdEVEAvknlypsyknYTSVYDKNN----lltNKTVMA  271
DSSP  HHHH-------llEEEEEElllhhHHHHhhhhllllllHHHHHHHLL----lllLLEEEE


DSSP  LHHhlhhhhhLLHHHHHHHHLLLEEEEEHHHHlLLLLhhhHHHHhhHHHLL----LLLEE
Query HPErnreireNPSLLYHLVEKGAASQITSGSLaGIFGkqlKAFSlrLVEAN----LIHFV  191
ident |             |    | ||       |           |    |            
Sbjct HGC-----ylSAEELNVFHERGASIAHCPNSN-LSLS---SGFL--NVLEVlkheVKIGL  320
DSSP  ELL-----llLHHHHHHHHHHLLEEEELHHHH-HHLL---LLLL--LHHHHhhllLEEEE


DSSP  ELLLLllllLLLLHHHHHHHHHH-------------HHLLHHHHHHH-HHHHH--HHLLL
Query ASDAHnvktRNFHTQEALYVLEK-------------EFGSELPYMLT-ENAEL--LLRNQ  235
ident   |             |                            |          |   
Sbjct GTDVA--ggYSYSMLDAIRRAVMvsnillinkvnekSLTLKEVFRLAtLGGSQalGLDGE  378
DSSP  LLLLL--llLLLLHHHHHHHHHHhhhhhhhllllllLLLHHHHHHHHlHHHHHhlLLLLL


DSSP  ------------------------------------------------------llllll
Query ------------------------------------------------------tifrqp  241
ident                                                             
Sbjct ignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggk  438
DSSP  llllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelle


DSSP  llllll
Query pqpvkr  247
ident       
Sbjct qvvpfs  444
DSSP  eeelll


No 53: Query=3qy6A Sbjct=1j5sA Z-score=9.3

back to top
DSSP  --------------------------LEELLLLLLlllllllLLHHH-------------
Query --------------------------MIDIHCHILpamddgaGDSAD-------------   21
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdlpIVDPHNHLD-----akDIVENkpwndiwevegat   55
DSSP  llllllllllllhhhhhhhhhhllllEEELLLLLL-----hhHHHHLlllllhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   21
ident                                                             
Sbjct dhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkv  115
DSSP  lhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllll


DSSP  ------------------hhhHHHHHHHLLLLEEELLLeelllllllLHHHhHHHHHHHH
Query ------------------sieMARAAVRQGIRTIIATPhhnngvyknEPAAvREAADQLN   63
ident                                     |           |    |      
Sbjct iseetaeeiweetkkklpemtPQKLLRDMKVEILCTTD---------DPVStLEHHRKAK  166
DSSP  llhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL---------LLLLlLHHHHHHH


DSSP  HHHhhllLLLEEELLL--------------------------------------------
Query KRLikedIPLHVLPGQ--------------------------------------------   79
ident             ||                                              
Sbjct EAV----EGVTILPTWrpdramnvdkegwreyvekmgerygedtstldgflnalwksheh  222
DSSP  HHL----LLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhh


DSSP  ---------EEEL--------------------------------------LLLHHHHHH
Query ---------EIRI--------------------------------------YGEVEQDLA   92
ident                                                             
Sbjct fkehgcvasDHALlepsvyyvdenraravhekafsgekltqdeindykafmMVQFGKMNQ  282
DSSP  hhllllleeEEEElllllllllhhhhhhhhhhhlllllllhhhhhhhhhhhHHHHHHHHH


DSSP  LLllllhhhlLEEEEELLL-----------------------LLLL-LLHHHHHHHHHHl
Query KRqllslndtKYILIEFPF-----------------------DHVP-RYAEQLFYDLQLk  128
ident                                                             
Sbjct ET-------nWVTQLHIGAlrdyrdslfktlgpdsggdistnFLRIaEGLRYFLNEFDG-  334
DSSP  HH-------lLEEEEEELEellllhhhhhhlllllllleellLLLHhHHHHHHHHHLLL-


DSSP  LLEEEEelHHHLhhhHHLLHHHHHHHHLL--LEEEEehhhhlllllhhHHHHHHHHHHLL
Query GYIPVIahPERNreiRENPSLLYHLVEKG--AASQItsgslagifgkqLKAFSLRLVEAN  186
ident     |                                                       
Sbjct KLKIVL--YVLD---PTHLPTISTIARAFpnVYVGA------pwwfndSPFGMEMHLKYL  383
DSSP  LLLEEE--EELL---HHHHHHHHHHHHHLllEEELL------llllllLHHHHHHHHHHH


DSSP  -------lLLEEELLLLLllLLLL--LHHHHHHHHHHHHL-------------LHHHHHH
Query -------lIHFVASDAHNvkTRNF--HTQEALYVLEKEFG-------------SELPYML  224
ident               |        |   |     ||    |              ||    
Sbjct asvdllynLAGMVTDSRK--LLSFgsRTEMFRRVLSNVVGemvekgqipikeaRELVKHV  441
DSSP  hllllhhhLLLLLLLLLL--LLHHhhHHHHHHHHHHHHHHhhhhlllllhhhhHHHHHHH


DSSP  -HHHHHHHHLllllllllllllll
Query -TENAELLLRnqtifrqppqpvkr  247
ident        |                
Sbjct sYDGPKALFF--------------  451
DSSP  hLHHHHHHHL--------------


No 54: Query=3qy6A Sbjct=2anuA Z-score=9.1

back to top
DSSP  ----LEELLLLlllLLLLL-LLLHHHHHHHHHHHhhllLLEEELLLEELLL---------
Query ----MIDIHCHilpAMDDG-AGDSADSIEMARAAvrqgIRTIIATPHHNNG---------   46
ident       | | |      ||                         | |             
Sbjct tewlLCDFHVH--tNXSDGhLPLGEVVDLFGKHG----VDVVSITDHIVDRrtleqrkrn   54
DSSP  leeeEEEEEEL--lLLLLLlLLHHHHHHHHHHLL----LLEEEEEEEEELHhhhhhhhhl


DSSP  ---LLLL---LHHHHHHHHHHHHHHHHHLlLLLEEELLLEEELLLLhhhhhhlllllLHH
Query ---VYKN---EPAAVREAADQLNKRLIKEdIPLHVLPGQEIRIYGEveqdlakrqllSLN  100
ident                        ||   |       || ||                   
Sbjct gepLGAItedKFQDYLKRLWREQKRAWEE-YGXILIPGVEITNNTD------lyhivAVD  107
DSSP  lllLLLLlllLHHHHHHHHHHHHHHHHHH-HLLEEEEEEEEEELLL------leeeeEEL


DSSP  HlleeeeelllllllllhhhHHHHHHHLLL----eEEEELH-hhlHHHHhlLHHHHHHHh
Query DtkyiliefpfdhvpryaeqLFYDLQLKGY----iPVIAHP-ernREIRenPSLLYHLVe  155
ident                            |          |||                   
Sbjct V-----------keyvdpslPVEEIVEKLKeqnalVIAAHPdrkkLSWY-lWANXERFK-  154
DSSP  L-----------llllllllLHHHHHHHHHhllleEEELLLllllLLLH-hHHLLLLLL-


DSSP  LLLE-EEEEHHHHlllllhhhhhhHHHHHHLLLLLEEELLLLLLlLLLLLHhhhhhhhhh
Query KGAA-SQITSGSLagifgkqlkafSLRLVEANLIHFVASDAHNVkTRNFHTqealyvlek  214
ident        |                              || |                  
Sbjct DTFDaWEIANRDD----------lFNSVGVKKYRYVANSDFHEL-WHVYSW---------  194
DSSP  LLLLeEEEEELLE----------eLHHHHHLLLLEEEELLLLLH-HHHLLE---------


DSSP  hhllhhhhhhHHHH----hHHHLL-LLLLlllllllll
Query efgselpymlTENA----eLLLRN-QTIFrqppqpvkr  247
ident                                       
Sbjct --------ktLVKSeknieAIKEAiRKNTdvaiylxrk  224
DSSP  --------eeEEEElllhhHHHHHhHHLLleeeeelll


No 55: Query=3qy6A Sbjct=2yb1A Z-score=8.1

back to top
DSSP  -LEELLLLllLLLLLLLLL-HHHHHHHHHHHhhllLLEEELLLEEllllllllhhHHHHH
Query -MIDIHCHilPAMDDGAGD-SADSIEMARAAvrqgIRTIIATPHHnngvyknepaAVREA   58
ident   || | |      |||          |  |          | |                
Sbjct aNIDLHFH--SRTSDGALTpTEVIDRAAARA----PALLALTDHD--------ctGGLAE   46
DSSP  lLEELLLL--LLLLLLLLLhHHHHHHHHLLL----LLEEEELLLL--------llLLHHH


DSSP  HHHHHHHHhhlllLLEEELLLEEELLllhhhhhhlllllLHHH-----------------
Query ADQLNKRLikediPLHVLPGQEIRIYgeveqdlakrqllSLND-----------------  101
ident |     |          | | |                  |                   
Sbjct AAAAAARR-----GIPFLNGVEVSVS----wgrhtvhivGLGIdpaepalaaglksireg   97
DSSP  HHHHHHHL-----LLLEEEEEEEEEE----elleeeeeeEELLllllhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  101
ident                                                             
Sbjct rlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyl  157
DSSP  hhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhll


DSSP  -------------------------LLEEeeelllllllllhhhhhhhhhhllleeEEEL
Query -------------------------TKYIliefpfdhvpryaeqlfydlqlkgyipVIAH  136
ident                                                         ||||
Sbjct tpgkpgyvshqwasledavgwivgaGGMA---------------------------VIAH  190
DSSP  llllllllllllllhhhhhhhhhhlLLEE---------------------------EELL


DSSP  HHHLHHhhhLLHHHHHHHHLLL-----EEEE-EHHHhlllllhhHHHHHHHHHHLL----
Query PERNREireNPSLLYHLVEKGA-----ASQI-TSGSlagifgkqLKAFSLRLVEAN----  186
ident | |         |   |                                           
Sbjct PGRYDM---GRTLIERLILDFQaaggqGIEVaSGSH--------SLDDMHKFALHAdrhg  239
DSSP  HHHLLL---LHHHHHHHHHHHHhllllEEEEeELLL--------LHHHHHHHHHHHhhhl


DSSP  llLEEELLLLLLLLL-lLLHHhhhhhhhhhhllHHHHhhhHHHHHHHLLlllllllllll
Query liHFVASDAHNVKTR-nFHTQealyvlekefgsELPYmltENAELLLRNqtifrqppqpv  245
ident       || |                                   |              
Sbjct lyASSGSDFHAPGEDvgHTED----------lpPICR---PIWRELEAR----ilrpada  282
DSSP  leEEEELLLLLLLLLllLLLL----------llLLLL---LHHHHLHHH----lllllhh


DSSP  ll
Query kr  247
ident   
Sbjct en  284
DSSP  hl


No 56: Query=3qy6A Sbjct=4dziC Z-score=8.1

back to top
DSSP  -----LEELLLLlLLLL-------------------------------------------
Query -----MIDIHCHiLPAM-------------------------------------------   12
ident       ||   |                                                
Sbjct alnyrVIDVDNH-YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptf   59
DSSP  lllllEEEEEEE-LLLLlllllllllhhhlllleeeeelllleeeeelleelllllllll


DSSP  ----------------------------llllllHHHH---HHHHHHHHHLLLLEEELLL
Query ----------------------------ddgagdSADS---IEMARAAVRQGIRTIIATP   41
ident                                                   | | |    |
Sbjct dpiivpgcldllfrgeipdgvdpaslmkverladHPEYqnrDARIAVMDEQDIETAFMLP  119
DSSP  lleelllllhhhhhllllllllhhhllleelhhhLHHHllhHHHHHHHHHHLEEEEEEEL


DSSP  E--ELLLL------------lllLHHHHHHHHHhhhhhhhhlllllEEELLleeellllh
Query H--HNNGV------------yknEPAAVREAADqlnkrlikediplHVLPGqeiriygev   87
ident                              |                              
Sbjct TfgCGVEEalkhdieatmasvhaFNLWLDEDWG-------fdrpdhRIIAA--pivslad  170
DSSP  LhhHHHHHhllllhhhhhhhhhhHHHHHHHHLL-------llllllLEEEL--lllllll


DSSP  hhhhHLLL------lLLHH------------------------------hLLEEEEEL--
Query eqdlAKRQ------lLSLN------------------------------dTKYILIEF--  109
ident                  |                                          
Sbjct ptraVEEVdfvlargAKLVlvrpapvpglvkprslgdrshdpvwarlaeaGVPVGFHLsd  230
DSSP  hhhhHHHHhhhhhllLLLEelllllllllllllllllhhhhhhhhhhhhhLLLEEEELll


DSSP  --------------------llLLLL--LLHHHHH-HHHH--HLLLEEEEEL-HHHLhhh
Query --------------------pfDHVP--RYAEQLF-YDLQ--LKGYIPVIAH-PERNrei  143
ident                       |                         |           
Sbjct sgylhiaaawggakdpldqvllDDRAihDTMASMIvHGVFtrHPKLKAVSIEnGSYF---  287
DSSP  lllhhhhhhllllllhhhhhhhLLHHhhHHHHHHHhLLHHhhLLLLLEEEELlLLLH---


DSSP  hhlLHHH-------------------hHHHHlLLEEEEEHhhhlllllhhhHHHHHHHHH
Query renPSLL-------------------yHLVEkGAASQITSgslagifgkqlKAFSLRLVE  184
ident      |                      |                            |  
Sbjct --vHRLIkrlkkaantqpqyfpedpveQLRN-NVWIAPYY-----------EDDLPELAR  333
DSSP  --hHHHHhhhhhhhhhlhhhllllhhhHHHH-HEEELLLL-----------LLLHHHHHH


DSSP  LLL--LLEEELLLLLllLLLL-LHHHHHHHHhHHHLLHHHHHH-HHHHHHHhLLLLllll
Query ANL--IHFVASDAHNvkTRNF-HTQEALYVLeKEFGSELPYML-TENAELLlRNQTifrq  240
ident           ||                  | | |           ||  |         
Sbjct VIGvdKILFGSDWPH--GEGLaSPVSFTAEL-KGFSESDIRKImRDNALDL-LGVQ----  385
DSSP  HHLhhHLLLLLLLLL--LLLLlLHHHHHHHH-LLLLHHHHHHHhLHHHHHH-HLLL----


DSSP  lllllll
Query ppqpvkr  247
ident        
Sbjct ----vgs  388
DSSP  ----lll


No 57: Query=3qy6A Sbjct=2a3lA Z-score=7.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------------------------------------LEELLLLLL--------
Query -------------------------------------------MIDIHCHIL--------    9
ident                                              | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    9
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -------------------llllllllLHHHHHHHHHHHH-HLLLlEEELLLeellllll
Query -------------------pamddgagDSADSIEMARAAV-RQGIrTIIATPhhnngvyk   49
ident                                                             
Sbjct nlkynpcgqsrlreiflkqdnliqgrfLGEITKQVFSDLEaSKYQ-MAEYRI--------  291
DSSP  hhhhllllllhhhhhhlllllllllllHHHHHHHHHHHHLlLLLE-EEEEEE--------


DSSP  LLHH----hhhhhhHHHH-HHHHhlllLLEEELLL-------------------------
Query NEPA----avreaaDQLN-KRLIkediPLHVLPGQ-------------------------   79
ident                      |        |                             
Sbjct SIYGrkmsewdqlaSWIVnNDLY----SENVVWLIqlprlyniykdmgivtsfqnildni  347
DSSP  ELLLllllhhhhhhHHHHlLLLL----LLLEEEEEeeellhhhhlllllllllhhhhhhh


DSSP  ---------------------------EEEL-----------------------------
Query ---------------------------EIRI-----------------------------   83
ident                                                             
Sbjct fiplfeatvdpdshpqlhvflkqvvgfDLVDdeskperrptkhmptpaqwtnafnpafsy  407
DSSP  llhhhhhhhlhhhllllhhhhlleeeeEEELllllllllllllllllllllllllllhhh


DSSP  -LLLHHHHHHLLL---lllhhhlleEEEEL-lLLLLL--LLHHHHHhhhhhllleEEEEL
Query -YGEVEQDLAKRQ---llslndtkyILIEF-pFDHVP--RYAEQLFydlqlkgyiPVIAH  136
ident         |                                                |||
Sbjct yVYYCYANLYVLNklreskgmttitLRPHSgeAGDIDhlAATFLTC---------HSIAH  458
DSSP  hHHHHHHHHHHHHhhhlllllllleELLLLllLLLLHhhHHHHHHL---------LLLLL


DSSP  HHhlhHHHHLlHHHHHHHHLLLEEEEEHHHhlLLLLHHHHH-HHHHHHHLLLLLEEELLL
Query PErnrEIRENpSLLYHLVEKGAASQITSGSlaGIFGKQLKA-FSLRLVEANLIHFVASDA  195
ident        |    | |              |                     |      | 
Sbjct GI---NLRKSpVLQYLYYLAQIGLAMSPLS-nNSLFLDYHRnPFPVFFLRGLNVSLSTDD  514
DSSP  LH---HHHHLhHHHHHHHHHLLLEEELHHH-hLLLLLLLLLlLHHHHHHLLLLEEELLLL


DSSP  LllLLLL---lLHHHHHHHHHH-HHLLH-HHHHHHHHHHH-HHLLL--------------
Query HnvKTRN---fHTQEALYVLEK-EFGSE-LPYMLTENAEL-LLRNQ--------------  235
ident               |           |         |                       
Sbjct P--LQIHltkePLVEEYSIAASvWKLSAcDLCEIARNSVYqSGFSHalkshwigkdyykr  572
DSSP  H--HHHLllllHHHHHHHHHHHhHLLLHhHHHHHHHHHHHhLLLLHhhhhhhllllllll


DSSP  --------------------------------llllllllllll
Query --------------------------------tifrqppqpvkr  247
ident                                             
Sbjct gpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 58: Query=3qy6A Sbjct=3e38A Z-score=6.7

back to top
DSSP  ------------------LEELLLLllLLLLLLLLLhhhHHHHHHHHHHLLLLEEELLLE
Query ------------------MIDIHCHilPAMDDGAGDsadSIEMARAAVRQGIRTIIATPH   42
ident                     | | |      ||             | | |   |  | |
Sbjct aqrrneiqvpdldgyttlKCDFHXH--SVFSDGLVW---PTVRVDEAYRDGLDAISLTEH   55
DSSP  llllllllllllllleeeEEELLLL--LLLLLLLLL---HHHHHHHHHHLLLLEELLEEE


DSSP  EL-lllllllhhHHHHHHHHHHHHHHhlLLLLEEELLLEEELL-----------------
Query HN-ngvyknepaAVREAADQLNKRLIkeDIPLHVLPGQEIRIY-----------------   84
ident                   |                 | ||                    
Sbjct IEyrphkqdvvsDHNRSFDLCREQAE--KLGILLIKGSEITRAxapghfnaiflsdsnpl  113
DSSP  LLllllllllllLLLHHHHHHHHHHH--HHLLEELLEEEEELLlllleeeeelllllhhh


DSSP  --lLHHHHHHlLLLLlhhHLLEEEE-elLLLLL--lllHHHHHHHHHHLLLEEEeelhhh
Query --gEVEQDLAkRQLLslnDTKYILI-efPFDHV--pryAEQLFYDLQLKGYIPViahper  139
ident                                              |   |          
Sbjct eqkDYKDAFR-EAKK--qGAFXFWNhpgWDSQQpdttkWWPEHTALYQEGCXHG------  164
DSSP  lllLHHHHHH-HHHH--lLLEEEELlllLLLLLlllllLLHHHHHHHHLLLLLE------


DSSP  lhhhhhllhhhhhhhhlllEEEEEHHHhlllllhhhhhhhhhhhhLLLL---------LE
Query nreirenpsllyhlvekgaASQITSGSlagifgkqlkafslrlveANLI---------HF  190
ident                                                 |           
Sbjct -------------------IEVANGHL----------------yxPEAIqwcldknltXI  189
DSSP  -------------------EEEEELLE----------------elLHHHhhhhhhlleEE


DSSP  EELLLL-LLLLL-lllhHHHHhhhhhhhllhhhhhhhhHHHH---------hhLLLLL--
Query VASDAH-NVKTR-nfhtQEALyvlekefgselpymlteNAEL---------llRNQTI--  237
ident   || |    |       |                                         
Sbjct GTSDIHqPIQTDydfekGEHR---------------txTFVFakerslqgireALDNRrt  234
DSSP  EELLLLlLHHHHllhhhLLLL---------------leEEEEellllhhhhhhHHHLLle


DSSP  --------LLLL------------------------------------------------
Query --------FRQP------------------------------------------------  241
ident                                                             
Sbjct aayfhellIGREdllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvy  294
DSSP  eeeelleeELLHhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleel


DSSP  ------------------------------------LLLLL------l
Query ------------------------------------PQPVK------r  247
ident                                                 
Sbjct frdxtlkphtrytvrigfkqgikggdvnfevtnfivAPDKGlkytisl  342
DSSP  lleeeellleeeeeeeeellllllleeeeeeeeeeeELLEEeeeeeel


No 59: Query=3qy6A Sbjct=1bksA Z-score=4.6

back to top
DSSP  ------------------LEELllLLLLlllllLLLHHHHHHHHHHHHHLLLLEEELLLE
Query ------------------MIDIhcHILPamddgAGDSADSIEMARAAVRQGIRTIIATPH   42
ident                           |            |          |         
Sbjct meryenlfaqlndrregaFVPF--VTLG-----DPGIEQSLKIIDTLIDAGADALELGVP   53
DSSP  lhhhhhhhhhhhhlllleEEEE--EELL-----LLLHHHHHHHHHHHHHLLLLLEEEELL


DSSP  elLLLL-----------------llLHHHHHHHHHHhhhhhhhllllleeellLEEELL-
Query hnNGVY-----------------knEPAAVREAADQlnkrlikediplhvlpgQEIRIY-   84
ident                           ||   |                            
Sbjct --FSDPladgptiqnanlrafaagvTPAQCFEMLAL------irekhptipigLLMYANl  105
DSSP  --LLLLllllhhhhhhhhhhhhhllLHHHHHHHHHH------hhhhllllleeEEELHHh


DSSP  ---lLHHHHHHllllllhhHLLEEEEELlllLLLLlHHHHHHHHHHLLLEEEEeLHHHlh
Query ---gEVEQDLAkrqllslnDTKYILIEFpfdHVPRyAEQLFYDLQLKGYIPVIaHPERnr  141
ident           |             |       |                 |         
Sbjct vfnnGIDAFYA---rceqvGVDSVLVAD--vPVEE-SAPFRQAALRHNIAPIF-ICPP--  156
DSSP  hhllLHHHHHH---hhhhhLLLEEEELL--lLHHH-LHHHHHHHHHLLLEEEE-EELL--


DSSP  hhHHLLHHHHHHHhLLLE--EEEEhhhhlllllhhhhHHHHHHHHLL-----lLLEEEll
Query eiRENPSLLYHLVeKGAA--SQITsgslagifgkqlkAFSLRLVEAN-----lIHFVAsd  194
ident        ||                                 | |               
Sbjct --NADDDLLRQVA-SYGRgyTYLL------------aLPLHHLIEKLkeyhaaPALQG--  199
DSSP  --LLLHHHHHHHH-HHLLllEEEL------------lLLHHHHHHHHhhhlllLEEEL--


DSSP  lllllllllLHHH--HHHHHHHHH---------llhhhhhhhhhhhhhhlllllllllll
Query ahnvktrnfHTQE--ALYVLEKEF---------gselpymltenaelllrnqtifrqppq  243
ident                                                             
Sbjct --------fGISSpeQVSAAVRAGaagaisgsaivkiieknlaspkqmlaelrsfvsamk  251
DSSP  --------lLLLLhhHHHHHHHHLlleeeellhhhhhhhhllllhhhhhhhhhhhhhhhh


DSSP  llll
Query pvkr  247
ident     
Sbjct aasr  255
DSSP  hlll