Results: dupa

Query: 3pnuA

MOLECULE: DIHYDROOROTASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3pnu-A 62.6  0.0  338   338  100 PDB  MOLECULE: DIHYDROOROTASE;                                            
   2:  3gri-A 32.2  2.7  311   422   20 PDB  MOLECULE: DIHYDROOROTASE;                                            
   3:  3e74-A 31.5  2.6  307   429   15 PDB  MOLECULE: ALLANTOINASE;                                              
   4:  1gkp-A 30.5  3.1  314   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
   5:  4b3z-D 29.0  3.3  319   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   6:  3giq-A 20.2  3.4  270   475    9 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   7:  3irs-A 18.2  3.0  225   281   16 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   8:  3cjp-A 17.9  3.0  213   262   17 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   9:  1onx-A 17.2  3.2  247   390   12 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  10:  1a5k-C 17.0  3.4  259   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  11:  2vun-A 17.0  3.3  249   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  12:  2ffi-A 16.3  3.2  226   273   17 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  13:  4dlf-A 16.0  3.3  229   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  14:  3nqb-A 15.9  3.4  239   587   11 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  15:  2ob3-A 15.2  3.6  234   329   10 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  16:  4mup-B 15.2  3.5  230   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  17:  2dvt-A 15.1  3.2  221   325   15 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  18:  4qrn-A 15.0  3.3  221   352   14 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  19:  1yrr-B 14.9  3.5  229   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  20:  1itq-A 14.9  3.2  227   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  21:  4cqb-A 14.8  4.2  250   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  22:  2qpx-A 14.7  3.2  220   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  23:  1bf6-A 14.7  3.0  217   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  24:  3icj-A 14.6  3.9  239   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  25:  2vc5-A 14.6  3.3  225   314   15 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  26:  3k2g-B 14.5  3.2  220   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  27:  2paj-A 14.5  3.6  233   421    9 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  28:  4ofc-A 14.5  3.2  220   335   16 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  29:  2y1h-B 14.4  3.4  217   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  30:  3gg7-A 14.4  3.5  209   243   11 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  31:  4hk5-D 14.3  3.1  223   380   15 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  32:  3mtw-A 14.3  3.8  235   404   11 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  33:  3mkv-A 14.1  3.7  235   414   11 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  34:  3ls9-A 14.1  4.2  249   453   10 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  35:  2ogj-A 14.0  3.8  239   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  36:  1a4m-A 13.8  3.8  236   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  37:  1k6w-A 13.7  4.8  253   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  38:  4dzi-C 13.6  3.3  215   388   15 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  39:  2uz9-A 13.5  4.2  239   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  40:  2gwg-A 13.4  3.6  217   329   16 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  41:  2oof-A 13.1  4.2  238   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  42:  1j6p-A 13.0  4.4  242   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  43:  4rdv-B 12.7  3.8  231   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  44:  1j5s-A 12.6  3.5  221   451   14 PDB  MOLECULE: URONATE ISOMERASE;                                         
  45:  4c5y-A 12.3  4.1  239   436   14 PDB  MOLECULE: OCHRATOXINASE;                                             
  46:  2imr-A 12.2  3.7  228   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  47:  3ooq-A 12.2  4.0  219   384   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  48:  3qy6-A 12.0  3.1  191   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  3iac-A 12.0  3.5  220   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  1v77-A  9.4  3.5  179   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A  9.0  4.1  218   616    7 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3au2-A  7.5  5.6  180   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3dcp-A  7.5  4.3  175   277   13 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  7.3  3.6  167   234   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  7.2  4.0  178   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.6  3.7  172   255   12 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  3e38-A  5.8  4.5  165   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2anu-A  5.0  4.1  147   224   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  2yb1-A  4.2  3.9  140   284   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3pnuA Sbjct=3pnuA Z-score=62.6

back to top
DSSP  LLLLLLLLLEEEELLEEEEELLLLHHHHHHHHHHHHLLLLEEEELLLLLLLLLLHHHHHH
Query ENLYFQSNAMKLKNPLDMHLHLRDNQMLELIAPLSARDFCAAVIMPNLIPPLCNLEDLKA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ENLYFQSNAMKLKNPLDMHLHLRDNQMLELIAPLSARDFCAAVIMPNLIPPLCNLEDLKA   60
DSSP  LLLLLLLLLEEEELLEEEEELLLLHHHHHHHHHHHHLLLLEEEELLLLLLLLLLHHHHHH


DSSP  HHHHHHHHHLLLLLEEEEEEELLLLLHHHHHHHLLLLLEEEELLLLLLLLLLLLLLLLLH
Query YKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGIXLYPAGITTNSNGGVSSFDI  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGIXLYPAGITTNSNGGVSSFDI  120
DSSP  HHHHHHHHHLLLLLEEEEEEELLLLLHHHHHHHLLLLLEEEELLLLLLLLLLLLLLLLLH


DSSP  HHHHHHHHHHHHLLLLEEELLLLLLLHHHLLHHHHHHHHHHHHHLLLLLEEELLLLLHHH
Query EYLKPTLEAMSDLNIPLLVHGETNDFVMDRESNFAKIYEKLAKHFPRLKIVMEHITTKTL  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EYLKPTLEAMSDLNIPLLVHGETNDFVMDRESNFAKIYEKLAKHFPRLKIVMEHITTKTL  180
DSSP  HHHHHHHHHHHHLLLLEEELLLLLLLHHHLLHHHHHHHHHHHHHLLLLLEEELLLLLHHH


DSSP  HHHHHHLLLEEEEELLHHHLLLHHHHHLLLLLHHHLLLLLLLLHHHHHHHHHHHHLLLLL
Query CELLKDYENLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALCELAFSGYEK  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CELLKDYENLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALCELAFSGYEK  240
DSSP  HHHHHHLLLEEEEELLHHHLLLHHHHHLLLLLHHHLLLLLLLLHHHHHHHHHHHHLLLLL


DSSP  EEELLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHLLHHHHHHHHLHHHHHHHLLLLLLL
Query VMFGSDSAPHPKGCAAGVFSAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKFKED  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VMFGSDSAPHPKGCAAGVFSAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKFKED  300
DSSP  EEELLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHLLHHHHHHHHLHHHHHHHLLLLLLL


DSSP  LEEEEELLLEELLLLEELLLLEELLLLLLLEELLEELL
Query KILTLEEKEWQVPNVYEDKYNQVVPYMAGEILKFQLKH  338
ident ||||||||||||||||||||||||||||||||||||||
Sbjct KILTLEEKEWQVPNVYEDKYNQVVPYMAGEILKFQLKH  338
DSSP  LEEEEELLLEELLLLEELLLLEELLLLLLLEELLEELL


No 2: Query=3pnuA Sbjct=3griA Z-score=32.2

back to top
DSSP  -------------LLLL--------------------------llLLLEEEELLEEEEEL
Query -------------ENLY--------------------------fqSNAMKLKNPLDMHLH   21
ident              |                                         | | |
Sbjct xklikngkvlqngELQQadilidgkvikqiapaiepsngvdiidaKGHFVSPGFVDVHVH   60
DSSP  leeeelleeeellEEEEleeeeelleeeeeellllllllleeeelLLLEEEELEEEEEEL


DSSP  LLLH-----hHHHHHHHHHHL-LLLEEEELLLLLLLLLLHHHHHHHHHHHHHHHlllLLE
Query LRDN-----qMLELIAPLSAR-DFCAAVIMPNLIPPLCNLEDLKAYKMRILKACkdeNFT   75
ident ||          |      ||  |      ||  |     |   |    |          
Sbjct LREPggeykeTIETGTKAAARgGFTTVCPXPNTRPVPDSVEHFEALQKLIDDNA---QVR  117
DSSP  LLLLllllllLHHHHHHHHHHlLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHL---LLE


DSSP  EEEEEELL------LLLHhhHHHHLL-LLLEEEELLLllllllllLLLLLLhhHHHHHHH
Query PLMTLFFK------NYDEkfLYSAKD-EIFGIXLYPAgittnsngGVSSFDieYLKPTLE  128
ident  |                           |               ||             
Sbjct VLPYASITtrqlgkELVD--FPALVKeGAFAFTDDGV--------GVQTAS--XXYEGXI  165
DSSP  ELLLEELLhhhlllLLLL--HHHHHLlLLLLEEELLL--------LLLLHH--HHHHHHH


DSSP  HHHHLLLLEEELLLLLL-------------------LHHH-LLHHHHHHHHHHHHHLLlL
Query AMSDLNIPLLVHGETND-------------------FVMD-RESNFAKIYEKLAKHFPrL  168
ident      |     | | |                          ||        ||      
Sbjct EAAKVNKAIVAHCEDNSliyggaxhegkrskelgipGIPNiCESVQIARDVLLAEAAG-C  224
DSSP  HHHHHLLLEEELLLLHHhllllleellhhhhhhlllEELLhHHHHHHHHHHHHHHHHL-L


DSSP  LEEELLLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHhlLLLLHHHLLLLLLLLH
Query KIVMEHITTKTLCELLKDY----ENLYATITLHHLIITLDDVigGKMNPHLFCKPIAKRY  224
ident      |  ||       |         |  | |||  | ||      |      |     
Sbjct HYHVCHVSTKESVRVIRDAkragIHVTAEVTPHHLLLTEDDI--PGNNAIYKXNPPLRST  282
DSSP  LEEELLLLLHHHHHHHHHHhhllLLEEEEELHHHHHLLHHHL--LLLLHHHLLLLLLLLH


DSSP  HHHHHHHHHHHLlLLLEEELLLLLLLLL--------LLLLLLLLHHHHHHHHHHHHH--H
Query EDKEALCELAFSgYEKVMFGSDSAPHPK--------GCAAGVFSAPVILPVLAELFK--Q  274
ident || ||| |             | |||              |        | |   |    
Sbjct EDREALLEGLLD-GTIDCIATDHAPHARdekaqpxeKAPFGIVGSETAFPLLYTHFVknG  341
DSSP  HHHHHHHHHHHL-LLLLEELLLLLLLLHhhhlllllLLLLLLLLLLLHHHHHHHHHLllL


DSSP  HLLHHHHHHHHLHHHHHHHLLLL------LLLLEEEEEL-LLEELLLLEellllEELLL-
Query NSSEENLQKFLSDNTCKIYDLKF------KEDKILTLEE-KEWQVPNVYedkynQVVPY-  326
ident       |   |    |    |                    |                  
Sbjct DWTLQQLVDYLTIKPCETFNLEYgtlkenGYADLTIIDLdSEQEIKGED--flsKADNTp  399
DSSP  LLLHHHHHHHHLHHHHHHLLLLLllllllLLLLEEEEELlLLEELLHHH--lllLLLLLl


DSSP  LLLLEELLEELL-----------
Query MAGEILKFQLKH-----------  338
ident   |                    
Sbjct FIGYKVYGNPILtxvegevkfeg  422
DSSP  LLLLEELLEEEEeeelleeeeel


No 3: Query=3pnuA Sbjct=3e74A Z-score=31.5

back to top
DSSP  ----------------------------------------lllLLLLlLEEEELLEEEEE
Query ----------------------------------------enlYFQSnAMKLKNPLDMHL   20
ident                                                         | | 
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxDASG-LVVSPGXVDAHT   59
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeELLL-LEEEELEEEEEE


DSSP  LLllhhHHHHHHHHHHL-LLLEEEELLL-LLLLLLLHHHHHHHHHHHHHHHlllLLEEEE
Query HLrdnqMLELIAPLSAR-DFCAAVIMPN-LIPPLCNLEDLKAYKMRILKACkdeNFTPLM   78
ident |       |      |          |    |                            
Sbjct HI----GYETGTRAAAKgGITTXIEXPLnQLPATVDRASIELKFDAAKGKL---TIDAAQ  112
DSSP  LL----LHHHHHHHHHHlLEEEEEELLLlLLLLLLLHHHHHHHHHHHLLLL---LLEEEE


DSSP  EEELL-LLLHhHHHHHLL-LLLEEEELLllllllllLLLLLllhHHHHHHHHHHHHLLLL
Query TLFFK-NYDEkFLYSAKD-EIFGIXLYPagittnsnGGVSSfdiEYLKPTLEAMSDLNIP  136
ident             |         | |             |                 |  |
Sbjct LGGLVsYNID-RLHELDEvGVVGFXCFV--------RDVND---WQFFKGAQKLGELGQP  160
DSSP  LEELLlLLLL-LHHHHHHhLLLLEEEEL--------LLLLH---HHHHHHHHHHHHHLLL


DSSP  EEELLLLLL----------------------LHHH-LLHHHHHHHHHHHHHLlLLLEEEL
Query LLVHGETND----------------------FVMD-RESNFAKIYEKLAKHFpRLKIVME  173
ident  ||| |                               |         |||          
Sbjct VLVHCENALicdelgeeakregrvtahdyvaSRPVfTEVEAIRRVLYLAKVA-GCRLHVC  219
DSSP  EEEELLLHHhhhhhhhhhhhhllllhhhhhhLLLHhHHHHHHHHHHHHHHHH-LLLEEEL


DSSP  LLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHHllLLLHHHLLLLLLLLHHHHHH
Query HITTKTLCELLKDY----ENLYATITLHHLIITLDDVIggKMNPHLFCKPIAKRYEDKEA  229
ident |       |                  |      |            | |     |    
Sbjct HVSSPEGVEEVTRArqegQDITCESCPHYFVLDTDQFE--EIGTLAKCSPPIRDLENQKG  277
DSSP  LLLLHHHHHHHHHHhhllLLEEEEELLHHHHLLHHHHH--HHLHHHLLLLLLLLHHHHHH


DSSP  HHHHHHLLLlLEEELLLLLLLLL--------LLLLLLLLHHHHHHHHHHHHH--HHLLHH
Query LCELAFSGYeKVMFGSDSAPHPK--------GCAAGVFSAPVILPVLAELFK--QNSSEE  279
ident   |  | |       ||  | |             |         |           |  
Sbjct XWEKLFNGE-IDCLVSDHSPCPPexkagnixKAWGGIAGLQSCXDVXFDEAVqkRGXSLP  336
DSSP  HHHHHHLLL-LLEELLLLLLLLLllllllllLLLLLLLLHHHHHHHHHHHHLllLLLLHH


DSSP  HHHHHHLHHHHHHHLLLL-------LLLLEEEEEL-LLEELLLLEelllLEELLLLLLLE
Query NLQKFLSDNTCKIYDLKF-------KEDKILTLEE-KEWQVPNVYedkyNQVVPYMAGEI  331
ident    |    |   |  |         |                |         |    |  
Sbjct XFGKLXATNAADIFGLQQkgriapgKDADFVFIQPnSSYVLTNDD-leyRHKVSPYVGRT  395
DSSP  HHHHHHLHHHHHHLLLLLlllllllLLLLEEEEELlLLEELLHHH-lllLLLLLLLLLLE


DSSP  ELLEELL---------------------------
Query LKFQLKH---------------------------  338
ident                                   
Sbjct IGARITKtilrgdviydieqgfpvapkgqfilkh  429
DSSP  ELLEEEEeeelleeeeelllllllllllleelll


No 4: Query=3pnuA Sbjct=1gkpA Z-score=30.5

back to top
DSSP  ----------------------------------------lllLLLLlLEEEELLEEEEE
Query ----------------------------------------enlYFQSnAMKLKNPLDMHL   20
ident                                                         | | 
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgteviDATG-KYVFPGFIDPHV   59
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeELLL-LEEEELEEEEEE


DSSP  LLLL-------hhHHHHHHHHHHL-LLLEEEELLLLLlllLLHHHHHHHHHHHHHHHlll
Query HLRD-------nqMLELIAPLSAR-DFCAAVIMPNLIpplCNLEDLKAYKMRILKACkde   72
ident |              |                |         ||     |          
Sbjct HIYLpfmatfakdTHETGSKAALMgGTTTYIEMCCPSrndDALEGYQLWKSKAEGNS---  116
DSSP  LLLLeelleelllLHHHHHHHHHHlLEEEEEEEELLLlllLHHHHHHHHHHHHLLLL---


DSSP  LLEEEEEEEL-LLLL--HHHHHHHL-LLLLEEEELLLLllllLLLLLLLLLhhHHHHHHH
Query NFTPLMTLFF-KNYD--EKFLYSAK-DEIFGIXLYPAGittnSNGGVSSFDieYLKPTLE  128
ident            |     |  |     | |   |          |             || 
Sbjct YCDYTFHMAVsKFDEktEGQLREIVaDGISSFXIFLSY----KNFFGVDDG--EMYQTLR  170
DSSP  LLEEEEEEELlLLLLlhHHHHHHHHhLLLLEEEEEELL----LLLLLLLHH--HHHHHHH


DSSP  HHHHLLLLEEELLLLLL----------------------LHHH-LLHHHHHHHHHHHHHL
Query AMSDLNIPLLVHGETND----------------------FVMD-RESNFAKIYEKLAKHF  165
ident     |      | |                               |              
Sbjct LAKELGVIVTAHCENAElvgrlqqkllsegktgpewhepSRPEaVEAEGTARFATFLETT  230
DSSP  HHHHHLLEEEEEELLHHhhhhhhhhhhhlllllhhhlllLLLHhHHHHHHHHHHHHHHHH


DSSP  LlLLEEELLLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHHLLL-LLHHHLLLLL
Query PrLKIVMEHITTKTLCELLKDY----ENLYATITLHHLIITLDDVIGGK-MNPHLFCKPI  220
ident         |   |                |      |          |          | 
Sbjct G-ATGYVVHLSCKPALDAAMAAkargVPIYIESVIPHFLLDKTYAERGGvEAMKYIMSPP  289
DSSP  L-LEEEELLLLLHHHHHHHHHHhhllLLEEEEEEHHHHHLLHHHHHLLHhHHHLLLLLLL


DSSP  LLLHHHHHHHHHHHHLLLlLEEELLLLLLLLLL-----------LLLLLLLHHHHHHHHH
Query AKRYEDKEALCELAFSGYeKVMFGSDSAPHPKG-----------CAAGVFSAPVILPVLA  269
ident          |      |      | |  |                  |          | 
Sbjct LRDKRNQKVLWDALAQGF-IDTVGTDHCPFDTEqkllgkeaftaIPNGIPAIEDRVNLLY  348
DSSP  LLLLHHHHHHHHHHHLLL-LLEEELLLLLLLHHhhhhhlllhhhLLLLLLLLLLHHHHHH


DSSP  HHHH--HHLLHHHHHHHHLHHHHHH-HLLLL-------LLLLEEEEEL-LLEELLLLEel
Query ELFK--QNSSEENLQKFLSDNTCKI-YDLKF-------KEDKILTLEE-KEWQVPNVYed  318
ident                   |    |                                    
Sbjct TYGVsrGRLDIHRFVDAASTKAAKLfGLFPRkgtiavgSDADLVVYDPqYRGTISVKT-q  407
DSSP  HHHLllLLLLHHHHHHHHLHHHHHHlLLLLLlllllllLLLLEEEEELlLLEELLHHH-l


DSSP  llLEELLLLLLLEELLEELL-------------------------------
Query kyNQVVPYMAGEILKFQLKH-------------------------------  338
ident   |       |                                        
Sbjct hvNNDYNGFEGFEIDGRPSVvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  llLLLLLLLLLLEELLEEEEeeelleeeeelleelllllllllllllllll


No 5: Query=3pnuA Sbjct=4b3zD Z-score=29.0

back to top
DSSP  -----------------------------------------lllLLLLlLEEEELLEEEE
Query -----------------------------------------enlYFQSnAMKLKNPLDMH   19
ident                                                   |      |  
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktiEANG-RMVIPGGIDVN   59
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeELLL-LEEEELEEEEE


DSSP  ELLLLHH--HHHHHHHHHHL-LLLEEEELLLLLLLLLLHHHHHHHHHHHHHHHlllLLEE
Query LHLRDNQ--MLELIAPLSAR-DFCAAVIMPNLIPPLCNLEDLKAYKMRILKACkdeNFTP   76
ident   |                              |    |                     
Sbjct TYLQKTAadDFFQGTRAALVgGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKS---CCDY  116
DSSP  ELLLLLLllLHHHHHHHHHHlLEEEEEEEELLLLLLLHHHHHHHHHHHHHLLL---LLEE


DSSP  EEEEE-LLLL--LHHHHHHHL--LLLLEEEELLLLlllllLLLLLLLLhhHHHHHHHHHH
Query LMTLF-FKNY--DEKFLYSAK--DEIFGIXLYPAGittnsNGGVSSFDieYLKPTLEAMS  131
ident          |      |              | |           |     |        
Sbjct SLHVDiTSWYdgVREELEVLVqdKGVNSFQVYMAY----kDVYQMSDS--QLYEAFTFLK  170
DSSP  EEEEElLLLLllHHHHHHHHHhlLLLLEEEEELLL----lLLLLLLHH--HHHHHHHHHH


DSSP  HLLLLEEELLLLLL----------------------LHHH-LLHHHHHHHHHHHHHLLlL
Query DLNIPLLVHGETND----------------------FVMD-RESNFAKIYEKLAKHFPrL  168
ident  |    ||| |  |                            |          |      
Sbjct GLGAVILVHAENGDliaqeqkrilemgitgpeghalSRPEeLEAEAVFRAITIAGRIN-C  229
DSSP  HHLLEEEEELLLHHhhhhhhhhhhhllllllhhhhhHLLHhHHHHHHHHHHHHHHHHL-L


DSSP  LEEELLLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHHLLLL--LHHHLLLLLLL
Query KIVMEHITTKTLCELLKDY----ENLYATITLHHLIITLDDVIGGKM--NPHLFCKPIAK  222
ident          |                        |                     |   
Sbjct PVYITKVMSKSAADIIALArkkgPLVFGEPIAASLGTDGTHYWSKNWakAAAFVTSPPLS  289
DSSP  LEEEEEELLHHHHHHHHHHhhhlLLEEEEELHHHHHLLLHHHHLLLHhhHHHLLLLLLLL


DSSP  -LHHHHHHHHHHHHLlLLLEEELLLLLLLLL-----------LLLLLLLLHHHHHHHHHH
Query -RYEDKEALCELAFSgYEKVMFGSDSAPHPK-----------GCAAGVFSAPVILPVLAE  270
ident         |  |          ||   |                  ||        |   
Sbjct pDPTTPDYLTSLLAC-GDLQVTGSGHCPYSTaqkavgkdnftLIPEGVNGIEERMTVVWD  348
DSSP  lLLLHHHHHHHHHHH-LLLLLLLLLLLLLLHhhhhhhlllhhHLLLLLLLLLLHHHHHHH


DSSP  -HHHH-HLLHHHHHHHHLHHHHHHHLLLL--------LLLLEEEEE-LLLEELLL--LEE
Query -LFKQ-NSSEENLQKFLSDNTCKIYDLKF--------KEDKILTLE-EKEWQVPN--VYE  317
ident          |       | |  ||  |                     |           
Sbjct kAVATgKMDENQFVAVTSTNAAKIFNLYPrkgriavgSDADVVIWDpDKLKTITAksHKS  408
DSSP  hHLLLlLLLHHHHHHHHLHHHHHHHLLLLllllllllLLLLEEEEEeEEEEELLLllLLL


DSSP  LlllEELLLLLLLEELLEELL---------------------------------------
Query DkynQVVPYMAGEILKFQLKH---------------------------------------  338
ident            |                                                
Sbjct A---VEYNIFEGMECHGSPLVvisqgkivfedgninvnkgmgrfiprkafpehlyqrvki  465
DSSP  L---LLLLLLLLLEEEEEEEEeeelleeeeelleellllllllllllllllhhhhhhhhh


DSSP  ------------
Query ------------  338
ident             
Sbjct rnkvfglqgvsr  477
DSSP  hhhhllllllll


No 6: Query=3pnuA Sbjct=3giqA Z-score=20.2

back to top
DSSP  -------------------------------------------llllllLLLEEEELLEE
Query -------------------------------------------enlyfqSNAMKLKNPLD   17
ident                                                  |         |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdaSGKIVAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelLLLEEEELEEE


DSSP  EEELL--LLHHHHHhhHHHHHL-LLLEEEELlllllLLLL--------------------
Query MHLHL--RDNQMLEliAPLSAR-DFCAAVIMpnlipPLCN--------------------   54
ident  | |                        |                               
Sbjct VHGHDdlMFVEKPD--LRWKTSqGITTVVVG-ncgvSAAPaplpgntaaalallgetplf  117
DSSP  LLLLLllHHHHLLL--LHHHHLlLEEEEEEL-llllLLLLllllllllhhhhhhllllll


DSSP  --HHHHHHHHHHhHHHHllllLEEEEEEELLLL-------------------LHHHHHHH
Query --LEDLKAYKMRiLKACkdenFTPLMTLFFKNY-------------------DEKFLYSA   93
ident        |                       |                        |  |
Sbjct adVPAYFAALDA-QRPM----INVAALVGHANLrlaamrdpqaaptaaeqqaMQDMLQAA  172
DSSP  llHHHHHHHHHH-LLLL----LEEEEEEEHHHHhhhhlllllllllhhhhhhHHHHHHHH


DSSP  L-LLLLEEEELLLLllllllLLLLLLLHHHHHHHHHHHHHLLLLEEELLLLlllhHHLLH
Query K-DEIFGIXLYPAGittnsnGGVSSFDIEYLKPTLEAMSDLNIPLLVHGETndfvMDRES  152
ident       |     |                 |                |        |   
Sbjct LeAGAVGFSTGLAY------QPGAVAQAAELEGLARVAAERRRLHTSHIRN---eADGVE  223
DSSP  HhHLLLEEEEELLL------LLHHHLLHHHHHHHHHHHHHLLLEEEEELLL---lLLLHH


DSSP  HHHHHHHHHHHHLlLLLEEELLLLL---------HHHHHHHHHLL----LEEEEELLHH-
Query NFAKIYEKLAKHFpRLKIVMEHITT---------KTLCELLKDYE----NLYATITLHH-  198
ident                   |  |                                |     
Sbjct AAVEEVLAIGRGT-GCATVVSHHKCmmpqnwgrsRATLANIDRAReqgvEVALDIYPYPg  282
DSSP  HHHHHHHHHHHHH-LLEEEELLLLLllhhhlllhHHHHHHHHHHHhlllLEEEEELLLLe


DSSP  ---hlllhhhhHLLLLLH-----------------------------------HHLLlll
Query ---liitlddvIGGKMNP-----------------------------------HLFCkpi  220
ident                                                             
Sbjct sstiliperaeTIDDIRItwstphpecsgeyladiaarwgcdkttaarrlapaGAIY---  339
DSSP  eeeellhhhllLLLLLEEeeelllhhhllllhhhhhhhhlllhhhhhhhhlleEEEE---


DSSP  LLLHhhHHHHHHHHHllLLLEEELLLLLLLLLllllLLLLHHHHHHHHH-HHHH--HHLL
Query AKRYedKEALCELAFsgYEKVMFGSDSAPHPKgcaaGVFSAPVILPVLA-ELFK--QNSS  277
ident                      | |||  |                               
Sbjct FAMD--EDEVKRIFQ--HPCCMVGSDGLPNDA---rPHPRLWGSFTRVLgRYVReaRLMT  392
DSSP  ELLL--HHHHHHHHH--LLLEEELLLLLLLLL---lLLLHHHHHHHHHHhHHHHhlLLLL


DSSP  HHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELLLeelllleelllleeLLLLlll
Query EENLQKFLSDNTCKIYDLKF-------KEDKILTLEEKEwqvpnvyedkynqvVPYMage  330
ident  |                                                    |     
Sbjct LEQAVARMTALPARVFGFAErgvlqpgAWADVVVFDPDT------vadratwdEPTL---  443
DSSP  HHHHHHHHLHHHHHHHLLLLlllllllLLLLEEEELLLL------llllllllLLLL---


DSSP  eelLEELL-------------------------
Query ilkFQLKH-------------------------  338
ident                                  
Sbjct -asVGIAGvlvngaevfpqppadgrpgqvlrax  475
DSSP  -llLLEEEeeelleeeellllllllllllllll


No 7: Query=3pnuA Sbjct=3irsA Z-score=18.2

back to top
DSSP  llllllllleeeELLEEEEELLLL-------------------------------hHHHH
Query enlyfqsnamklKNPLDMHLHLRD-------------------------------nQMLE   29
ident                 |  |                                      ||
Sbjct ------------LKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeeKSLE   48
DSSP  ------------LLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHH


DSSP  HHHHHHHL-LLLEEEELLL---llLLLLLHhHHHHHHHHHHhhhllllLEEEEEEELLL-
Query LIAPLSAR-DFCAAVIMPN---liPPLCNLeDLKAYKMRILkackdenFTPLMTLFFKN-   84
ident |     |       |             |  |  |                         
Sbjct LMFEEMAAaGIEQGVCVGRnssvlGSVSNA-DVAAVAKAYP-------DKFHPVGSIEAa  100
DSSP  HHHHHHHHlLLLEEEEELLeelllEELLHH-HHHHHHHHLL-------LLEEEEEELLLl


DSSP  ---LLHHHHHHHLL-LLLEEEELLLLllllllLLLLLL-lHHHHHHHHHHHHHLLLLEEE
Query ---YDEKFLYSAKD-EIFGIXLYPAGittnsnGGVSSF-dIEYLKPTLEAMSDLNIPLLV  139
ident              |  |    | |                   | |      |  ||   
Sbjct trkEAMAQMQEILDlGIRIVNLEPGV------WATPMHvdDRRLYPLYAFCEDNGIPVIM  154
DSSP  lhhHHHHHHHHHHHlLLLLEEELHHH------LLLLLLllLHHHHHHHHHHHHLLLLEEE


DSSP  LL---LLLLlhHHLLhhHHHHHHHHHHHLLLLLEEEL-LLLL--HHHHHHHHHLLLEEEE
Query HG---ETNDfvMDREsnFAKIYEKLAKHFPRLKIVME-HITT--KTLCELLKDYENLYAT  193
ident         |                   || |  |                    |||  
Sbjct MTggnAGPD--ITYT--NPEHIDRVLGDFPDLTVVSShGNWPwvQEIIHVAFRRPNLYLS  210
DSSP  ELlllLLLL--HHHH--LHHHHHHHHHHLLLLLEEEEhHHLLlhHHHHHHHHHLLLEEEE


DSSP  ELlHHHLLLhhhhhlllllhhhllllllllhHHHHHHHHHHHL-lLLLEEELLLLLllll
Query ITlHHLIITlddviggkmnphlfckpiakryEDKEALCELAFS-gYEKVMFGSDSAphpk  252
ident      |                                  | |       ||        
Sbjct PD-MYLYNL----------------------PGHADFIQAANSflADRMLFGTAYP----  243
DSSP  LH-HHHLLL----------------------LLHHHHHHHHLLhhHHLLLLLLLLL----


DSSP  lllllLLLHHHHHHHHHHHhhhHLLHHHHHHHHLHHHHHHHLLlllllleeeeellleel
Query gcaagVFSAPVILPVLAELfkqNSSEENLQKFLSDNTCKIYDLkfkedkiltleekewqv  312
ident                   |           | |  |                        
Sbjct -----MCPLKEYTEWFLTL---PIKPDAMEKILHGNAERLLAQ-----------------  278
DSSP  -----LLLHHHHHHHHHLL---LLLHHHHHHHHLHHHHHHHHH-----------------


DSSP  llleelllleellllllleelleell
Query pnvyedkynqvvpymageilkfqlkh  338
ident                           
Sbjct -----------------------agr  281
DSSP  -----------------------lll


No 8: Query=3pnuA Sbjct=3cjpA Z-score=17.9

back to top
DSSP  llllllllleeeeLLEEEEELLLLhhHHHHHHHHHHLL-LLEEEELLLL-----------
Query enlyfqsnamklkNPLDMHLHLRDnqMLELIAPLSARD-FCAAVIMPNL-----------   48
ident                 | | |       |                               
Sbjct -------------LIIDGHTHVIL--PVEKHIKIMDEAgVDKTILFSTSihpetavnlrd   45
DSSP  -------------LLEEEEEELLL--LHHHHHHHHHHHlLLEEEEELLLllhhhlllhhh


DSSP  -----------------------LLLLllhHHHHHHHHHHHhhhllllLEEEEEEELLL-
Query -----------------------IPPLcnlEDLKAYKMRILkackdenFTPLMTLFFKN-   84
ident                                 |                           
Sbjct vkkemkklndvvngktnsmidvrRNSI---KELTNVIQAYP-------SRYVGFGNVPVg   95
DSSP  hhhhhhhhhhhhlllllllhhhhHHHH---HHHHHHHHHLL-------LLEEEEELLLLl


DSSP  ----lLHHHHHHHLL--LLLEEE-ELLLllllllllllLLLLhhHHHHHHHHHHHL-LLL
Query ----yDEKFLYSAKD--EIFGIX-LYPAgittnsnggvSSFDieYLKPTLEAMSDL-NIP  136
ident                     ||  | ||                 |||      |    |
Sbjct lsendTNSYIEENIVnnKLVGIGeLTPA---------sGQIK--SLKPIFKYSMDSgSLP  144
DSSP  llhhhHHHHHHHHLLllLLLEEEeELLL---------lLLHH--HHHHHHHHHHHLlLLL


DSSP  EEELLLLLllhhhLLHHHHHHHHHHHHHLLLLLEEELLLL---LHHHHHHHHHLLLEEEE
Query LLVHGETNdfvmdRESNFAKIYEKLAKHFPRLKIVMEHIT---TKTLCELLKDYENLYAT  193
ident    |               |    | | ||       |       |  || |   |||  
Sbjct IWIHAFNP-----LVLQDIKEIAELCKAFPKVPVILGHMGgsnWMTAVELAKEIQNLYLD  199
DSSP  EEELLLLL-----LLHHHHHHHHHHHHHLLLLLEEEHHHHhhhHHHHHHHHHHLLLEEEE


DSSP  ELlHHHLllhhhhhlllllhhhllllllllhhhHHHHHHHHHLLLLLEEELLLLLlllll
Query ITlHHLIitlddviggkmnphlfckpiakryedKEALCELAFSGYEKVMFGSDSAphpkg  253
ident                                     |         |  || |       
Sbjct TS-AYFS--------------------------TFVLKIVINELPLKCIFGTDMP-----  227
DSSP  LL-LLLL--------------------------HHHHHHHHHHLLLLEELLLLLL-----


DSSP  llllLLLHHHHHHHHHHHHhhhLLHHHHHHHHLHHHHHHHLLlllllleeeeellleell
Query caagVFSAPVILPVLAELFkqnSSEENLQKFLSDNTCKIYDLkfkedkiltleekewqvp  313
ident                                | ||                         
Sbjct ----FGDLQLSIEAIKKMS---NDSYVANAVLGDNISRLLNI------------------  262
DSSP  ----LLLHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHHLL------------------


DSSP  lleelllleellllllleelleell
Query nvyedkynqvvpymageilkfqlkh  338
ident                          
Sbjct -------------------------  262
DSSP  -------------------------


No 9: Query=3pnuA Sbjct=1onxA Z-score=17.2

back to top
DSSP  --------------------------------------------------llllLLLLlE
Query --------------------------------------------------enlyFQSNaM   10
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdLSGQ-I   59
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeeLLLL-E


DSSP  EEELLEEEEELLLL---------HHHHhhHHHHHHL-LLLEEEELLL--LLLLLllHHHH
Query KLKNPLDMHLHLRD---------NQMLelIAPLSAR-DFCAAVIMPN--LIPPLcnLEDL   58
ident       | | ||                              |       |      | |
Sbjct LCPGFIDQHVHLIGgggeagpttRTPE-vALSRLTEaGVTSVVGLLGtdSISRH--PESL  116
DSSP  EEELEEEEEELLLLllllllhhhLLLL-lLHHHHHHlLEEEEEELLLllLLLLL--HHHH


DSSP  HHHHHHHHHHhlllLLEEEEEE-ELLLL---lhHHHHHHL---LLLLEEEEL-LLLLlll
Query KAYKMRILKAckdeNFTPLMTL-FFKNY---deKFLYSAK---DEIFGIXLY-PAGIttn  110
ident  |                 |                       |   | |          
Sbjct LAKTRALNEE----GISAWMLTgAYHVPsrtitGSVEKDVaiiDRVIGVXCAiSDHR---  169
DSSP  HHHHHHHHHH----LLEEEEEEeLLLLLlllllLLHHHHHhhlLLEEEEEEEeLLLL---


DSSP  lllLLLLLLHhHHHHHHHHHHHLL------LLEEELLLLLLlhhhllhHHHHHHHHHHHH
Query sngGVSSFDIeYLKPTLEAMSDLN------IPLLVHGETNDfvmdresNFAKIYEKLAKH  164
ident             |                      |                    |   
Sbjct ---SAAPDVY-HLANMAAESRVGGllggkpGVTVFHMGDSK-------KALQPIYDLLEN  218
DSSP  ---LLLLLHH-HHHHHHHHHHHHHhhhlllLEEEEEELLLL-------LLLHHHHHHHHL


DSSP  LLLL--LEEELLLL-----LHHHHHHHHHLllEEEEELLHhHLLLhhhhhlllllhhhll
Query FPRL--KIVMEHIT-----TKTLCELLKDYenLYATITLHhLIITlddviggkmnphlfc  217
ident       |    |            |           ||                      
Sbjct CDVPisKLLPTHVNrnvplFEQALEFARKG--GTIDITSS-IDEP---------------  260
DSSP  LLLLhhHEEEELHHhlhhhHHHHHHHHHLL--LLEEEELL-LLLL---------------


DSSP  llllllhhhhhHHHHH---hhllLLLEEELLLLLLL--------llLLLLLlLLHHHHHh
Query kpiakryedkeALCEL---afsgYEKVMFGSDSAPH--------pkGCAAGvFSAPVILp  266
ident                           |   ||                          | 
Sbjct -------vapaEGIARavqagipLARVTLSSDGNGSqpffddegnlTHIGV-AGFETLL-  311
DSSP  -------llhhHHHHHhhhllllHHHEEEELLLLLEeeeellllleEEEEE-LLLHHHH-


DSSP  HHHHHHHH--HLLHHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELlleellllee
Query VLAELFKQ--NSSEENLQKFLSDNTCKIYDLKF-------KEDKILTLEEkewqvpnvye  317
ident             |       |         |              |              
Sbjct ETVQVLVKdyDFSISDALRPLTSSVAGFLNLTGkgeilpgNDADLLVMTP----------  361
DSSP  HHHHHHHHhhLLLHHHHHHHHLHHHHHHLLLLLlllllllLLLLEEEELL----------


DSSP  lllleellllllleeLLEELL-----------------------
Query dkynqvvpymageilKFQLKH-----------------------  338
ident                                             
Sbjct ---------------ELRIEQvyargklmvkdgkacvkgtfetd  390
DSSP  ---------------LLLEEEeeelleeeeelleelllllllll


No 10: Query=3pnuA Sbjct=1a5kC Z-score=17.0

back to top
DSSP  --------------LLLLLLLL--------------------------------------
Query --------------ENLYFQSN--------------------------------------    8
ident                                                             
Sbjct snisrqayadmfgpTVGDKVRLadtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhllLLLLEEELllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    8
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  --LEEEELLEEEEELLLlhhhHHHHHHHHHL-LLLEEEELL-lLLLL------LLLHHHH
Query --AMKLKNPLDMHLHLRdnqmLELIAPLSAR-DFCAAVIMP-nLIPP------LCNLEDL   58
ident           | | |          |           |                      
Sbjct egKIVTAGGIDTHIHWI----CPQQAEEALVsGVTTMVGGGtgPAAGthattcTPGPWYI  176
DSSP  llLEEEELEEEEEEELL----LLLHHHHHHHhLEEEEEEELllLLHHhhhlllLLHHHHH


DSSP  HHHHHHHHHHHllllLEEEEEEELLLLLHHHHHHHLL-LLLEEEELLLllllllllLLLL
Query KAYKMRILKACkdenFTPLMTLFFKNYDEKFLYSAKD-EIFGIXLYPAgittnsngGVSS  117
ident                                |         |                  
Sbjct SRMLQAADSLP----VNIGLLGKGNVSQPDALREQVAaGVIGLEIHED--------WGAT  224
DSSP  HHHHHHHLLLL----LEEEEEEELLLLLHHHHHHHHHhLLLEEEEEHH--------HLLL


DSSP  LLhhhhHHHHHHHHHLLLLEEELLLLLLlhhhllhHHHHHHHHHHHHLlllLEEELLLLL
Query FDieylKPTLEAMSDLNIPLLVHGETNDfvmdresNFAKIYEKLAKHFprlKIVMEHITT  177
ident          |       |    |  |          |               |   |   
Sbjct PA--aiDCALTVADEMDIQVALHSDTLN-----esGFVEDTLAAIGGR---TIHTFHTEG  274
DSSP  HH--hhHHHHHHHHHHLLEEEEELLLLL-----llLLHHHHHHHHLLL---LEEELLLLL


DSSP  ------hHHHHHHHhLLLEEEEELLHHHLL---LHHHHhlllllHHHL------------
Query ------kTLCELLKdYENLYATITLHHLII---TLDDViggkmnPHLF------------  216
ident                  |     |   |     | |                        
Sbjct aggghapDIITACA-HPNILPSSTNPTLPYtlnTIDEH------LDMLmvchhldpdiae  327
DSSP  lllllllLHHHHHH-LLLEEEEEEHHHLLLlllHHHHH------HHHHhhhhllllllhh


DSSP  ---lllllLLHHHHHHHHHHHHLLLllEEELLLLLllllllllLLLLHHHHHHHHHHHHH
Query ---ckpiaKRYEDKEALCELAFSGYekVMFGSDSAphpkgcaaGVFSAPVILPVLAELFK  273
ident          | |   |   |   |       |||                          
Sbjct dvafaesrIRRETIAAEDVLHDLGA-fSLTSSDSQ--------AMGRVGEVILRTWQVAH  378
DSSP  hhhlllllLLHHHHHHHHHHHHLLL-lLEEELLLL--------LLLLLLLHHHHHHHHHH


DSSP  HH----------------lLHHHHHHHHLHHHHHH-HLLLL-------LLLLEEEEELLL
Query QN----------------sSEENLQKFLSDNTCKI-YDLKF-------KEDKILTLEEKE  309
ident                               |                 |           
Sbjct RMkvqrgalaeetgdndnfRVKRYIAKYTINPALThGIAHEvgsievgKLADLVVWSPAF  438
DSSP  HHhhhhlllllllllllhhHHHHHHHLLLHHHHHHlLLLLLlllllllLLLLEEEELHHH


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  309
ident                                                             
Sbjct fgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaan  498
DSSP  lllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  309
ident                                                             
Sbjct gvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlp  558
DSSP  lhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllllll


DSSP  ---EELLLleelllleellllllleelleell
Query ---WQVPNvyedkynqvvpymageilkfqlkh  338
ident                                 
Sbjct maqRYFLF------------------------  566
DSSP  lllLLLLL------------------------


No 11: Query=3pnuA Sbjct=2vunA Z-score=17.0

back to top
DSSP  -----------------------------------------------llllllllLEEEE
Query -----------------------------------------------enlyfqsnAMKLK   13
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagSTVTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllLEEEE


DSSP  LLEEEEELLLLHHHH-----HHHHHHHHL-LLLEEEE-LLLL-LLLL-----LLHH--HH
Query NPLDMHLHLRDNQML-----ELIAPLSAR-DFCAAVI-MPNL-IPPL-----CNLE--DL   58
ident   || | |                                                   |
Sbjct GLLDTHVHVSGGDYAprqktMDFISSALHgGVTTMISaGSPHfPGRPkdaagTKALaiTL  120
DSSP  LEEEEEELLLLLLEEhhhleELHHHHHHLlLEEEEEElLLLLlLLLLllhhhHHHHhhHH


DSSP  HHHHHHhHHHHlllLLEEE-EEEELLL-LLHHHHHHHL-LLLLEEEELLlllllllllLL
Query KAYKMRiLKACkdeNFTPL-MTLFFKN-YDEKFLYSAK-DEIFGIXLYPagittnsngGV  115
ident                               |      |                    | 
Sbjct SKSYYN-ARPA---GVKVHgGAVILEKgLTEEDFIEMKkEGVWIVGEVG--------lGT  168
DSSP  HHHHHH-LLHH---HLEEElLEELLLLlLLHHHHHHHHhLLLLEEEEEL--------lLL


DSSP  LLLLHhHHHHHHHHHHHLLLLEEELL-LLLLLHHHLLhhHHHHHHHHHhhllllLEEELL
Query SSFDIeYLKPTLEAMSDLNIPLLVHG-ETNDFVMDREsnFAKIYEKLAkhfprlKIVMEH  174
ident          |  |           |   |           |    |          |  |
Sbjct IKNPE-DAAPMVEWAHKHGFKVQMHTgGTSIPGSSTV--TADDVIKTK------PDVVSH  219
DSSP  LLLHH-HHHHHHHHHHHLLLEEEEELlLLLLLLLLLL--LHHHHHHHL------LLEEEL


DSSP  LL------LHHHHH-HHHHLLlEEEEELLHHHLllhhhhhlllllhhhllllllllhhhh
Query IT------TKTLCE-LLKDYEnLYATITLHHLIitlddviggkmnphlfckpiakryedk  227
ident |                         |                                 
Sbjct INggptaiSVQEVDrIMDETD-FAMEIVQCGNP---------------------------  251
DSSP  LLllllllLHHHHHhHHHHLL-LEEEEELLLLH---------------------------


DSSP  HHHHHHHH-----llLLLEEELLLLLLllllllLLLLLHHHHHHhHHHHHHH-HLLHHHH
Query EALCELAF-----sgYEKVMFGSDSAPhpkgcaAGVFSAPVILPvLAELFKQ-NSSEENL  281
ident       |           | || |                 ||              |  
Sbjct KIADYVARraaekgqLGRVIFGNDAPS------GTGLIPLGILRnMCQIASMsDIDPEVA  305
DSSP  HHHHHHHHhhhhhllHHHEEEELLLLL------LLLLLLLHHHHhHHHHHHHlLLLHHHH


DSSP  HHHHLHHHHHHHLLLL------LLLLEEEEELLLeelllleelllleellllllleELLE
Query QKFLSDNTCKIYDLKF------KEDKILTLEEKEwqvpnvyedkynqvvpymageiLKFQ  335
ident       |    | |        ||                                    
Sbjct VCMATGNSTAVYGLNTgviapgKEADLIIMDTPL--------gsvaedamgaiaagDIPG  357
DSSP  HHHHLHHHHHHHLLLLllllllLLLLEEEEELLL--------llllllhhhhhhhlLLLE


DSSP  ELL-------------------------
Query LKH-------------------------  338
ident                             
Sbjct ISVvlidgeavvtksrntppakraakil  385
DSSP  EEEeeelleeeellllllllllllleel


No 12: Query=3pnuA Sbjct=2ffiA Z-score=16.3

back to top
DSSP  llllllllleeeeLLEEEEELLLLH---------------hHHHHHHHHHHLL-LLEEEE
Query enlyfqsnamklkNPLDMHLHLRDN---------------qMLELIAPLSARD-FCAAVI   44
ident                 | | |                     |           |   | 
Sbjct ----------lhlTAIDSHAHVFSRglnlasqrryapnydaPLGDYLGQLRAHgFSHGVL   50
DSSP  ----------lllLLEELLLLLLLHhhhhhlllllllllllLHHHHHHHHHHLlLLEELL


DSSP  LLLLLLLlLLHHHHHHHHHHHHhhhlllllEEEEEEELLL-LLHHHHHHHLLL-LLEEEE
Query MPNLIPPlCNLEDLKAYKMRILkackdenfTPLMTLFFKN-YDEKFLYSAKDE-IFGIXL  102
ident              |                                |         |  |
Sbjct VQPSFLG-TDNRYLLSALQTVP-------gQLRGVVXLERdVEQATLAEXARLgVRGVRL  102
DSSP  LLLHHHL-LLLHHHHHHHHHLL-------lLLLLLLLLLLlLLHHHHHHHHLLlLLEEEL


DSSP  LLLLLllllllllLLLL--HHHHHHHHHHHHHLLLLEEELLLllllhhhlLHHHHHHHHH
Query YPAGIttnsnggvSSFD--IEYLKPTLEAMSDLNIPLLVHGEtndfvmdrESNFAKIYEK  160
ident    |            |       | ||           |                    
Sbjct NLXGQ--------DXPDltGAQWRPLLERIGEQGWHVELHRQ--------VADIPVLVRA  146
DSSP  LLLLL--------LLLLllLLLLHHHHHHHHHHLLEEEELLL--------LLLHHHHHHH


DSSP  HhHHLLlLLEEELLLL------------lHHHHHHhHHLLLEEEEELLHHhlLLHHHHhl
Query LaKHFPrLKIVMEHIT------------tKTLCELlKDYENLYATITLHHliITLDDVig  208
ident |      | ||  |                 |  |                         
Sbjct L-QPYG-LDIVIDHFGrpdarrglgqpgfAELLTL-SGRGKVWVKVSGIY-rLQGSPE--  200
DSSP  H-LLLL-LLEEELHHHllllllllllllhHHHLLL-LLLLLEEEEEELHH-hLLLLHH--


DSSP  llllhhhllllllllHHHHHHHHHHH-hlLLLLEEELLLLLLlllllLLLL--LLHHHHH
Query gkmnphlfckpiakrYEDKEALCELA-fsGYEKVMFGSDSAPhpkgcAAGV--FSAPVIL  265
ident                     ||| |    | |    |||               |     
Sbjct ------------enlAFARQALCALEahyGAERLXWGSDWPH-----TQHEseVSFGSAV  243
DSSP  ------------hhhHHHHHHHHHHHhhlLHHHEEEELLLLL-----LLLLllLLHHHHH


DSSP  HHHHHHHhhhLLHHHHHHHHLHHHHHHHLLLLLllleeeeellleelllleelllleell
Query PVLAELFkqnSSEENLQKFLSDNTCKIYDLKFKedkiltleekewqvpnvyedkynqvvp  325
ident      |     |    |  | |                                      
Sbjct EQFEALG---CSAQLRQALLLDTARALFGFELE---------------------------  273
DSSP  HHHHHHL---LLHHHHHHHHLHHHHHHLLLLLL---------------------------


DSSP  llllleelleell
Query ymageilkfqlkh  338
ident              
Sbjct -------------  273
DSSP  -------------


No 13: Query=3pnuA Sbjct=4dlfA Z-score=16.0

back to top
DSSP  llllllllleeeELLEEEEELLLLH----------------HHHH-HHHHHHHL--LLLE
Query enlyfqsnamklKNPLDMHLHLRDN----------------QMLE-LIAPLSAR--DFCA   41
ident                 | | |                                      |
Sbjct ------------ALRIDSHQHFWRYraadypwigagmgvlaRDYLpDALHPLMHaqALGA   48
DSSP  ------------LLLEEEEELLLLLlhhhllllllllhhhlLLLLhHHHHHHHHhlLLLE


DSSP  EEELLLLllLLLL-HHHHHHHHHHHHhhhllllLEEEEEEELLL---lLHHHHHHHLLL-
Query AVIMPNLipPLCN-LEDLKAYKMRILkackdenFTPLMTLFFKN---yDEKFLYSAKDE-   96
ident                  |                                          
Sbjct SIAVQAR--AGRDeTAFLLELACDEA-------RIAAVVGWEDLrapqLAERVAEWRGTk   99
DSSP  EEEELLL--LLHHhHHHHHHHHLLLL-------LEEEEEELLLLllllHHHHHHLLLLLl


DSSP  LLEEEELLLLLlllllllllLLLHHHHHHHHHHHHHLLLLEEELLLllllhhhllHHHHH
Query IFGIXLYPAGIttnsnggvsSFDIEYLKPTLEAMSDLNIPLLVHGEtndfvmdreSNFAK  156
ident   |                   |                   |                 
Sbjct LRGFRHQLQDE----advraFVDDADFARGVAWLQANDYVYDVLVF---------ERQLP  146
DSSP  EEEEEELHHHL----llhhhHHHLHHHHHHHHHHHHLLLEEEELLL---------HHHHH


DSSP  HHHHHHHHLLLLLEEELLL----------------lLHHHHHHHHHLLLEEEEELLHHhL
Query IYEKLAKHFPRLKIVMEHI----------------tTKTLCELLKDYENLYATITLHHlI  200
ident               |  |                         |                
Sbjct DVQAFCARHDAHWLVLDHAgkpalaefdrddtalarWRAALRELAALPHVVCKLSGLV-T  205
DSSP  HHHHHHHHLLLLLEEEHHHhlllhhhllllllhhhhHHHHHHHHHLLLLEEEEELLLL-L


DSSP  LLHhhhhllllLHHHllllllllHHHHHHHHHHH-hlLLLLEEELLLLLLlllllllLLL
Query ITLddviggkmNPHLfckpiakrYEDKEALCELA-fsGYEKVMFGSDSAPhpkgcaaGVF  259
ident               |              |       |    |||||             
Sbjct EAD-------wRRGL---rasdlRHIEQCLDAALdafGPQRLMFGSDWPV-----clLAA  250
DSSP  LLL-------lLLLL---lhhhhHHHHHHHHHHHhhhLHHHEEELLLLLH-----hhHLL


DSSP  LHHHHHHHHHHHHHHHLLHHHHHHHHLHHHHHHHLLLllllleeeeellleelllleell
Query SAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKfkedkiltleekewqvpnvyedk  319
ident |                |               | |                        
Sbjct SYDEVASLVERWAESRLSAAERSALWGGTAARCYALP-----------------------  287
DSSP  LHHHHHHHHHHHHHHHLLHHHHHHHLLHHHHHHLLLL-----------------------


DSSP  lleellllllleelleell
Query ynqvvpymageilkfqlkh  338
ident                    
Sbjct -------------------  287
DSSP  -------------------


No 14: Query=3pnuA Sbjct=3nqbA Z-score=15.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  -----llllllLLLEEEELLEEEEELLL-lhHHHHHHHHHHHL-LLLEEEELLLllLLLL
Query -----enlyfqSNAMKLKNPLDMHLHLR-dnQMLELIAPLSAR-DFCAAVIMPNliPPLC   53
ident              |       | | |           |           |  |       
Sbjct srrdaaqvidaGGAYVSPGLIDTHXHIEssxITPAAYAAAVVArGVTTIVWDPH--EFGN  118
DSSP  lllleeeeeelLLLEEEELEEEEEELHHhhlLLHHHHHHHHHLlLEEEEEELLH--HHHH


DSSP  --LHHHHHHHHHHHHHHhlllLLEEEEEEELL------------lLLHHHHHHHLLL--L
Query --NLEDLKAYKMRILKAckdeNFTPLMTLFFK------------nYDEKFLYSAKDE--I   97
ident              |                                |   |        |
Sbjct vhGVDGVRWAAKAIENL----PLRAILLAPSCvpsapglerggadFDAAILADLLSWpeI  174
DSSP  hhLHHHHHHHHHHHLLL----LLEEEEEELLLlllllllllllllLLHHHHHHHHLLllE


DSSP  LEE-EELLllllllllllLLLL-LHHH-HHHHHHHHHHLLLLEEELLLllllhhhllhHH
Query FGI-XLYPagittnsnggVSSF-DIEY-LKPTLEAMSDLNIPLLVHGEtndfvmdresNF  154
ident  ||                               |          |              
Sbjct GGIaEIXN----------XRGViERDPrXSGIVQAGLAAEKLVCGHAR----------GL  214
DSSP  EEEeEELL----------HHHHhLLLHhHHHHHHHHHHHLLEEEELLL----------LL


DSSP  HH-HHHHHHHHlllLLEEELLLLLHHHHHHHHHLLlEEEEELLHHHLllhhhhhlllllh
Query AK-IYEKLAKHfprLKIVMEHITTKTLCELLKDYEnLYATITLHHLIitlddviggkmnp  213
ident                                     |       |               
Sbjct KNaDLNAFXAA---GVSSDHELVSGEDLXAKLRAG-LTIELRGSHDH-------------  257
DSSP  LHhHHHHHHHL---LLLEELLLLLHHHHHHHHHLL-LEEEEELLLHH-------------


DSSP  hhllllllllhhHHHHHHHH---hhLLLLLEEELLLLLLlllllllLLLL--hHHHHHHH
Query hlfckpiakryeDKEALCEL---afSGYEKVMFGSDSAPhpkgcaaGVFS--aPVILPVL  268
ident                               |    |                      | 
Sbjct ------------LLPEFVAAlntlgHLPQTVTLCTDDVF-------PDDLlqgGGLDDVV  298
DSSP  ------------HHHHHHHHhhhhlLLLLLEEEELLLLL-------HHHHhhlLLHHHHH


DSSP  HHHHHHHLLHHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELlleelllleellll
Query AELFKQNSSEENLQKFLSDNTCKIYDLKF-------KEDKILTLEEkewqvpnvyedkyn  321
ident   |       |        |                    |   |               
Sbjct RRLVRYGLKPEWALRAATLNAAQRLGRSDlgliaagRRADIVVFED--------------  344
DSSP  HHHHHLLLLHHHHHHHHLHHHHHHHLLLLlllllllLLLLEEEELL--------------


DSSP  eellllllleeLLEELL-------------------------------------------
Query qvvpymageilKFQLKH-------------------------------------------  338
ident             |   |                                           
Sbjct ---------lnGFSARHvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvk  395
DSSP  ---------llLLLEEEeeelleeeeelleelllllllllhhhllllllllllhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  338
ident                                                             
Sbjct sqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltg  455
DSSP  lllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  338
ident                                                             
Sbjct wgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplpls  515
DSSP  lllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  338
ident                                                             
Sbjct glvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvl  575
DSSP  lllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeell


DSSP  ------------
Query ------------  338
ident             
Sbjct tgkvxespviev  587
DSSP  lleeellleeel


No 15: Query=3pnuA Sbjct=2ob3A Z-score=15.2

back to top
DSSP  --llllllllleeeeLLEEEEELLL-------------------LHHHHHHHHHHHHL-L
Query --enlyfqsnamklkNPLDMHLHLR-------------------DNQMLELIAPLSAR-D   38
ident                     | |                                     
Sbjct drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkaLAEKAVRGLRRARAaG   60
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhHHHHHHHHHHHHHHlL


DSSP  LLEEEELLLlLLLLllhhhHHHHHHHHHHHHlllLLEEEEEEELL------------llL
Query FCAAVIMPNlIPPLcnledLKAYKMRILKACkdeNFTPLMTLFFK------------nyD   86
ident     |                        |                              
Sbjct VRTIVDVSTfDIGR-----DVSLLAEVSRAA---DVHIVAATGLWfdpplsmrlrsveeL  112
DSSP  LLEEEELLLhHHLL-----LHHHHHHHHHHH---LLEEELEEELLllllhhhhlllhhhH


DSSP  HHHHHHHLL--------LLLEEEELLLllllllllllLLLL-HHHHHHHHHHHHHLLLLE
Query EKFLYSAKD--------EIFGIXLYPAgittnsnggvSSFD-IEYLKPTLEAMSDLNIPL  137
ident   |                  ||                      ||    |      | 
Sbjct TQFFLREIQygiedtgiRAGIIXVATT--------gkATPFqELVLKAAARASLATGVPV  164
DSSP  HHHHHHHHHllllllllLLLEEEEELL--------llLLHHhHHHHHHHHHHHHHHLLLE


DSSP  EELLLllllhhhlLHHHH-HHHHHHHHHLLLL--LEEELLL-LLHH--HHHHHHHLLlEE
Query LVHGEtndfvmdrESNFA-KIYEKLAKHFPRL--KIVMEHI-TTKT--LCELLKDYEnLY  191
ident   |           |                        |   |        |       
Sbjct TTHTA--------ASQRDgEQQAAIFESEGLSpsRVCIGHSdDTDDlsYLTALAARG-YL  215
DSSP  EEELL--------HHHLHhHHHHHHHHHLLLLhhHEEELLHhHLLLhhHHHHHHHLL-LE


DSSP  EEE-LLHHhlLLHHHHHlllLLHHHLLllLLLLHhhhhHHHHHHHL-----lLLLEEELL
Query ATI-TLHHliITLDDVIggkMNPHLFCkpIAKRYedkeALCELAFS-----gYEKVMFGS  245
ident                                 |         |                 
Sbjct IGLdHIPY--SAIGLED---NASASAL--LGIRS--wqTRALLIKAlidqgyMKQILVSN  266
DSSP  EEElLLLL--LLLLLLL---LHHHHHH--HLLLL--hhHHHHHHHHhhhlllHHHEEELL


DSSP  LLLLL---llLLLL------lllLHHHHHHHHHHHHHHH-LLHHHHHHHHLHHHHHHHLl
Query DSAPH---pkGCAA------gvfSAPVILPVLAELFKQN-SSEENLQKFLSDNTCKIYDl  295
ident |                          |               | |      |       
Sbjct DWTFGfssyvTNIMdvmdrvnpdGMAFIPLRVIPFLREKgVPQETLAGITVTNPARFLS-  325
DSSP  LLLLEellllLLHHhhhhhhlllHHHHHHHLHHHHHHHLlLLHHHHHHHHLHHHHHHHL-


DSSP  lllllleeeeellleelllleelllleellllllleelleell
Query kfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                            
Sbjct ---------------------------------------ptlr  329
DSSP  ---------------------------------------llll


No 16: Query=3pnuA Sbjct=4mupB Z-score=15.2

back to top
DSSP  --lllllllllEEEE-LLEEEEELLLLH---------------HHHHHHHHHHHL--LLL
Query --enlyfqsnaMKLK-NPLDMHLHLRDN---------------QMLELIAPLSAR--DFC   40
ident                    |   |                                    
Sbjct lvrklsgtapnPAFPrGAVDTQMHMYLPgypalpggpglppgaLPGPEDYRRLMQwlGID   60
DSSP  lllllllllllLLLLlLLEELLLLLLLLlllllllllllllllLLLHHHHHHHHHhhLLL


DSSP  EEEELLLLLLLLLLhHHHHHHHHHHHhhhlllllEEEEEEELLL-LLHHHHHHHLLL-LL
Query AAVIMPNLIPPLCNlEDLKAYKMRILkackdenfTPLMTLFFKN-YDEKFLYSAKDE-IF   98
ident    |         |     |                           ||           
Sbjct RVIITQGNAHQRDN-GNTLACVAEMG-------eAAHAVVIIDAtTTEKDMEKLTAAgTV  112
DSSP  EEEEELLHHHLLLL-HHHHHHHHHHH-------hHEEEEELLLLlLLHHHHHHHHHLlEE


DSSP  EEEELLlllLLLLlLLLLLLlhhhhHHHHHHHHHLLLLEEELLLllllhhHLLHHHHHHH
Query GIXLYPagiTTNSnGGVSSFdieylKPTLEAMSDLNIPLLVHGEtndfvmDRESNFAKIY  158
ident |                 |          |          |                   
Sbjct GARIMD---LPGG-AVNLSE----lDAVDERAHAADWMVAVQFD-----gNGLLDHLPRL  159
DSSP  EEEEEL---LLLL-LLLHHH----hHHHHHHHHHLLLEEEEELL-----hHHHHHHHHHH


DSSP  HHHhhhllLLLEEELLLL------------lHHHHHHHHhLLLEEEEELLHHhlLLHHHh
Query EKLakhfpRLKIVMEHIT------------tKTLCELLKdYENLYATITLHHliITLDDv  206
ident  |      |   |  |                 |  |     ||                
Sbjct QKI-----RSRWVFDHHGkffkgirtdgpemAALLKLID-RGNLWFKFAGVYesSRKSW-  212
DSSP  HLL-----LLEEEELHHHhlllllllllhhhHHHHHHHH-HLLEEEEELLHHhlLLLLL-


DSSP  hlllllhhhllllllllHHHHHHHHHHHHLLLLLEEELLLLLL--LLLLLllllLLHHHH
Query iggkmnphlfckpiakrYEDKEALCELAFSGYEKVMFGSDSAP--HPKGCaagvFSAPVI  264
ident                            |    |    |                      
Sbjct ---------------pyADVAAFSRVIAAHAPERIVWGTNWPHnsVRETA--ayPDDARL  255
DSSP  ---------------llHHHHHHHHHHHHHLHHHEEELLLLLLllLLLHH--hlLLHHHH


DSSP  HHHHHHHHhhhLLHHHHHHHHLHHHHHH-HLLLLlllleeeeellleelllleellllee
Query LPVLAELFkqnSSEENLQKFLSDNTCKI-YDLKFkedkiltleekewqvpnvyedkynqv  323
ident              |      |  |                                    
Sbjct AELTLGWL---PDEAARHRALVENPEALfKLSPV--------------------------  286
DSSP  HHHHHLLL---LLHHHHHHHHLHHHHHHhLLLLL--------------------------


DSSP  llllllleelleell
Query vpymageilkfqlkh  338
ident                
Sbjct ---------------  286
DSSP  ---------------


No 17: Query=3pnuA Sbjct=2dvtA Z-score=15.1

back to top
DSSP  llllllllleeEELLEEEEEL------------------------LLLHhhHHHHHHHHH
Query enlyfqsnamkLKNPLDMHLH------------------------LRDNqmLELIAPLSA   36
ident                     |                                    |  
Sbjct -----------MQGKVALEEHfaipetlqdsagfvpgdywkelqhRLLD-iQDTRLKLMD   48
DSSP  -----------LLLEEEEEEEellhhhhhhhlllllllhhhhhhhHHHL-lLLHHHHHHH


DSSP  LL-LLEEEELLL-------------llLLLLLHHHHHHHHHHHHhhhllllLEEEEEEEL
Query RD-FCAAVIMPN-------------liPPLCNLEDLKAYKMRILkackdenFTPLMTLFF   82
ident            |                       |                  |     
Sbjct AHgIETMILSLNapavqaipdrrkaieIARRANDVLAEECAKRP-------DRFLAFAAL  101
DSSP  HLlEEEEEEEELllhhhhlllhhhhhhHHHHHHHHHHHHHHHLL-------LLEEEEELL


DSSP  LL----LLHHHHHHHLL--LLLEEEELLLLlllllllllLLLLHHHHHHHHHHHHHLLLL
Query KN----YDEKFLYSAKD--EIFGIXLYPAGittnsnggvSSFDIEYLKPTLEAMSDLNIP  136
ident            |          |                   |     |       |  |
Sbjct PLqdpdAATEELQRCVNdlGFVGALVNGFS-qegdgqtpLYYDLPQYRPFWGEVEKLDVP  160
DSSP  LLllhhHHHHHHHHHHHllLLLEEEEELLL-llllllllLLLLLHHHHHHHHHHHHHLLL


DSSP  EEELLLLLL---------------lHHHLLHHHHHHHHHH-----HHHLLLLLEEELLLL
Query LLVHGETND---------------fVMDRESNFAKIYEKL-----AKHFPRLKIVMEHIT  176
ident    |                             |     |         ||| |   |  
Sbjct FYLHPRNPLpqdsriydghpwllgpTWAFAQETAVHALRLmasglFDEHPRLNIILGHMG  220
DSSP  EEEELLLLLhhhlhhhlllhhhlhhHLHHHHHHHHHHHHHhhllhHHHLLLLLEEELHHH


DSSP  LhHHHH----------------------hHHHL--LLEEEEELLHHHLllhhhhhlllll
Query TkTLCE----------------------lLKDY--ENLYATITLHHLIitlddviggkmn  212
ident    |                           ||  ||   |                   
Sbjct E-GLPYmmwridhrnawvklpprypakrrFMDYfnENFHITTSGNFRT------------  267
DSSP  L-LHHHhhhhhhhllllllllllllllllHHHHhhHHEEEELLLLLLH------------


DSSP  hhhllllllllhhhhHHHHHHH-hlLLLLEEELLLLLlllllllllLLLHHHHHHHHHHH
Query phlfckpiakryedkEALCELA-fsGYEKVMFGSDSAphpkgcaagVFSAPVILPVLAEL  271
ident                  |       |     |  |                         
Sbjct ---------------QTLIDAIleiGADRILFSTDWP---------FENIDHASDWFNAT  303
DSSP  ---------------HHHHHHHlllLHHHEELLLLLL---------LLLHHHHHHHHHHL


DSSP  hhhHLLHHHHHHHHLHHHHHHHLLLllllleeeeellleelllleelllleellllllle
Query fkqNSSEENLQKFLSDNTCKIYDLKfkedkiltleekewqvpnvyedkynqvvpymagei  331
ident       |    |    |      |                                    
Sbjct ---SIAEADRVKIGRTNARRLFKLD-----------------------------------  325
DSSP  ---LLLHHHHHHHHLHHHHHHLLLL-----------------------------------


DSSP  elleell
Query lkfqlkh  338
ident        
Sbjct -------  325
DSSP  -------


No 18: Query=3pnuA Sbjct=4qrnA Z-score=15.0

back to top
DSSP  llllllLLLE-------EEELLEEEEEL--------------------------------
Query enlyfqSNAM-------KLKNPLDMHLH--------------------------------   21
ident       |                                                     
Sbjct ------SMTQdlktggeQGYLRIATEEAfatreiidvylrmirdgtadkgmvslwgfyaq   54
DSSP  ------LLLLlllllllLLLLLEEEEEEellhhhhhhhhhhhhhllllhhhhhhhhhhhh


DSSP  -----------LLLHhhHHHHHHHHHL-LLLEEEELLL----------lllllLLHHHHH
Query -----------LRDNqmLELIAPLSAR-DFCAAVIMPN----------lipplCNLEDLK   59
ident                   |             |                           
Sbjct spseratqileRLLD-lGERRIADMDAtGIDKAILALTspgvqplhdldeartLATRAND  113
DSSP  lllhhhhhhhhHHHL-lLHHHHHHHHHlLLLEEEEEELlllllllllhhhhhhHHHHHHH


DSSP  HHHHHHHHHhllllLEEEEEEELLL----LLHHHHHHHLL--LLLEEEELLLllllllll
Query AYKMRILKAckdenFTPLMTLFFKN----YDEKFLYSAKD--EIFGIXLYPAgittnsng  113
ident        |                                     ||             
Sbjct TLADACQKY----pDRFIGMGTVAPqdpeWSAREIHRGARelGFKGIQINSH--------  161
DSSP  HHHHHHHHL----lLLEEELLLLLLllhhHHHHHHHHHHHllLLLLEEELLL--------


DSSP  LLLLL-LHHHHHHHHHHHHHLLLLEEELLLLL-----------LLHH---HLLHHHHHHH
Query GVSSF-DIEYLKPTLEAMSDLNIPLLVHGETN-----------DFVM---DRESNFAKIY  158
ident       | |   |   |      ||  |  |                             
Sbjct TQGRYlDEEFFDPIFRALVEVDQPLYIHPATSpdsmidpmleaGLDGaifGFGVETGMHL  221
DSSP  LLLLLlLLHHHHHHHHHHHHHLLLEEELLLLLlllllhhhhhhLLLLlllHHHHHHHHHH


DSSP  HHHH-HHLL----LLLEEELLLllhHHHH--------------------------hhHHL
Query EKLA-KHFP----RLKIVMEHIttkTLCE--------------------------llKDY  187
ident   |           | |   |     |                                |
Sbjct LRLItIGIFdkypSLQIMVGHM-geALPYwlyrldymhqagvrsqryermkplkktiEGY  280
DSSP  HHHHhHLHHhhllLLLEEELHH-hhLHHHhhhhhhhhhhhhhhlllllllllllllhHHH


DSSP  L--LEEEEELlHHHLllhhhhhlllllhhhllllllllhhhhHHHHHHH-hllLLLEEEL
Query E--NLYATITlHHLIitlddviggkmnphlfckpiakryedkEALCELA-fsgYEKVMFG  244
ident    |   |                                   |            ||  
Sbjct LksNVLVTNS-GVAW--------------------------ePAIKFCQqvmgEDRVMYA  313
DSSP  HhhLEEEELL-LLLL--------------------------hHHHHHHHhhhlHHHEELL


DSSP  LLLLllllllllLLLLhHHHHHHHHHHhhhHLLHHHHHHHHLHHHHHHHLLlllllleee
Query SDSAphpkgcaaGVFSaPVILPVLAELfkqNSSEENLQKFLSDNTCKIYDLkfkedkilt  304
ident  |                              |     ||   |  |   |         
Sbjct MDYP--------YQYV-ADEVRAMDAM---DMSAQTKKKFFQTNAEKWFKL---------  352
DSSP  LLLL--------LLLL-HHHHHHHHLL---LLLHHHHHHHHLHHHHHHLLL---------


DSSP  eellleelllleelllleellllllleelleell
Query leekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                   
Sbjct ----------------------------------  352
DSSP  ----------------------------------


No 19: Query=3pnuA Sbjct=1yrrB Z-score=14.9

back to top
DSSP  ---------------------------------------llllllLLLEEEELLEEEEEL
Query ---------------------------------------enlyfqSNAMKLKNPLDMHLH   21
ident                                                |       |  | 
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslNGAILSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelLLLEEEELEEEEEEL


DSSP  L------------lLHHHHHHHHHHHHL-LLLEEEELLLlllLLLL--HHHHHHHHHHHH
Query L------------rDNQMLELIAPLSAR-DFCAAVIMPNlipPLCN--LEDLKAYKMRIL   66
ident                   ||                                       |
Sbjct GcggvqfndtaeavSVETLEIMQKANEKsGCTNYLPTLI---TTSDelMKQGVRVMREYL  117
DSSP  EelleellllllllLHHHHHHHHHHHHLlLEEEEEEEEL---LLLHhhHHHHHHHHHHHH


DSSP  HhhlllLLEEEEEEELL---LLLHHHHHHHLLLLLEEEELllllllllllllllLLHHhh
Query KackdeNFTPLMTLFFK---NYDEKFLYSAKDEIFGIXLYpagittnsnggvssFDIEyl  123
ident       |      |           ||    | |    |                     
Sbjct A--khpNQALGLHLEGPwlnAALVDFLCENADVITKVTLA-------------pEMVP--  160
DSSP  H--hllLLLLLEEEELLlllLHHHHHHHHLHHHEEEEEEL-------------hHHLL--


DSSP  HHHHHHHHHLLLLEEELLLLlllhhhllhhHHHHHHHHHHHlllLLEEELLLL-------
Query KPTLEAMSDLNIPLLVHGETndfvmdresnFAKIYEKLAKHfprLKIVMEHIT-------  176
ident            |                    |                 |         
Sbjct AEVISKLANAGIVVSAGHSN---------aTLKEAKAGFRA---GITFATHLYnampyit  208
DSSP  HHHHHHHHHHLLEEEELLLL---------lLHHHHHHHHHH---LEEEELLLLlllllll


DSSP  --lhHHHHHHHHLLLEEEEELLH--HHLLlhhhhhlllllhhhllllllllhhhhHHHHH
Query --tkTLCELLKDYENLYATITLH--HLIItlddviggkmnphlfckpiakryedkEALCE  232
ident      |     |    |  |     |                                  
Sbjct grepGLAGAILDEADIYCGIIADglHVDY--------------------------ANIRN  242
DSSP  llllHHHHHHHHLLLLEEEEELLllLLLH--------------------------HHHHH


DSSP  HHhllLLLEEELLLLLlllllllLLLLLHhhHHHHHHHHHHH-HLLHHHHHHHHLHHHHH
Query LAfsgYEKVMFGSDSAphpkgcaAGVFSApvILPVLAELFKQ-NSSEENLQKFLSDNTCK  291
ident        |     |          |             |                     
Sbjct AKrlkGDKLCLVTDAT-------SGSSLT--MIEGVRNLVEHcGIALDEVLRMATLYPAR  293
DSSP  HHhhhHHHEEEELLLL-------LLLLLL--HHHHHHHHHHHhLLLHHHHHHHHLHHHHH


DSSP  H-HLLLL-------LLLLEEEEELLleelllleelllleellllllleelLEELL-----
Query I-YDLKF-------KEDKILTLEEKewqvpnvyedkynqvvpymageilkFQLKH-----  338
ident      |        |                                   |         
Sbjct AiGVEKRlgtlaagKVANLTAFTPD-------------------------FKITKtivng  328
DSSP  HlLLLLLlllllllLLLLEEEELLL-------------------------LLEEEeeell


DSSP  ------
Query ------  338
ident       
Sbjct nevvtq  334
DSSP  eeeeel


No 20: Query=3pnuA Sbjct=1itqA Z-score=14.9

back to top
DSSP  lllllllllEEEE--LLEEEEELLL-------------lhHHHHH------HHHHHHL-L
Query enlyfqsnaMKLK--NPLDMHLHLR-------------dnQMLEL------IAPLSAR-D   38
ident                   | |  |                  |          |      
Sbjct -dffrdeaeRIMRdsPVIDGHNDLPwqlldmfnnrlqderANLTTlagthtNIPKLRAgF   59
DSSP  -lhhhhhhhHHHLllLEEEEEELHHhhhhhhhllllllhhHLLLLllllllLHHHHHHlL


DSSP  LLEEEELLLLL-------lllLLHHHHHHHHHHhHHHHLLL-----------------LL
Query FCAAVIMPNLI-------pplCNLEDLKAYKMRiLKACKDE-----------------NF   74
ident                        ||                                   
Sbjct VGGQFWSVYTPcdtqnkdavrRTLEQMDVVHRM-CRMYPETflyvtssagirqafregKV  118
DSSP  EEEEEEEELLLhhhllllhhhHHHHHHHHHHHH-HHHLLLLeeelllhhhhhhhhhllLE


DSSP  EEEEEEELL---LLLHHHHHHHLL-LLLEEE-ELLLllllllllLLLLL-----------
Query TPLMTLFFK---NYDEKFLYSAKD-EIFGIX-LYPAgittnsngGVSSF-----------  118
ident   |               |                                         
Sbjct ASLIGVEGGhsiDSSLGVLRALYQlGMRYLTlTHSC--------NTPWAdnwlvdtgdse  170
DSSP  EEEEEEELHhhlLLLHHHHHHHHHlLEEEEElLLLL--------LLLLLllhhhllllll


DSSP  -----LHHHHHHHHHHHHHLLLLEEELLLllllhhhllhhHHHHHHHHHHHLlLLLEEEL
Query -----DIEYLKPTLEAMSDLNIPLLVHGEtndfvmdresnFAKIYEKLAKHFpRLKIVME  173
ident                    |                                 |      
Sbjct pqsqgLSPFGQRVVKELNRLGVLIDLAHV-----------SVATMKATLQLS-RAPVIFS  218
DSSP  lllllLLHHHHHHHHHHHHHLLEEELLLL-----------LHHHHHHHHHHL-LLLLEEL


DSSP  -LLLLH------HHHH-HHHH--LLLEEEEELLH-hhLLLHHHHhlllllhhhlllllll
Query -HITTK------TLCE-LLKD--YENLYATITLH-hlIITLDDViggkmnphlfckpiak  222
ident                   |                  |                      
Sbjct hSSAYSvcasrrNVPDdVLRLvkQTDSLVMVNFYnnyISCTNKA---------------n  263
DSSP  lLLLLLllllllLLLHhHHHHhhHHLLEEEELLLhhhHLLLLLL---------------l


DSSP  lhhhhHHHHHHH-hllLLLEEELLLLLllllllLLLL----LLHHHHHHHHHHHHHHHLL
Query ryedkEALCELA-fsgYEKVMFGSDSAphpkgcAAGV----FSAPVILPVLAELFKQNSS  277
ident        |           | || |           |              |||   |  
Sbjct lsqvaDHLDHIKevagARAVGFGGDFD-----gVPRVpeglEDVSKYPDLIAELLRRNWT  318
DSSP  hhhhhHHHHHHHhhllHHHEEELLLLL-----lLLLLllllLLLLLHHHHHHHHHHLLLL


DSSP  HHHHHHHHLHHHHHHHLllllllleeeeellleelllleelllleellllllleelleel
Query EENLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlk  337
ident |      | ||                                                 
Sbjct EAEVKGALADNLLRVFE----------aveqasnltqapeeepipldqlggscrthygys  368
DSSP  HHHHHHHHLHHHHHHHH----------hhhhllllllllllllllhhhllllllllllll


DSSP  l
Query h  338
ident  
Sbjct s  369
DSSP  l


No 21: Query=3pnuA Sbjct=4cqbA Z-score=14.8

back to top
DSSP  ---------------LLLL-------------------------llLLLEEEELLEEEEE
Query ---------------ENLY-------------------------fqSNAMKLKNPLDMHL   20
ident                                                         | | 
Sbjct skdfdliirnaylseKDSVydigivgdriikieakiegtvkdeidaKGNLVSPGFVDAHT   60
DSSP  llleeeeeeeeeellLLEEeeeeeelleeeeeelllllleeeeeelLLLLEEELEEEEEE


DSSP  LLL--------------------------------------LHHHHHHHHHHHHL-LLLE
Query HLR--------------------------------------DNQMLELIAPLSAR-DFCA   41
ident |                                                |          
Sbjct HMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeIKRHVIEHAHMQVLhGTLY  120
DSSP  LHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhHHHHHHHHHHHHHHlLEEE


DSSP  EEELLllllLLLL---HHHHHHHHHHHHHhHLLLlLEEEEEE--ELLL----llHHHHHH
Query AVIMPnlipPLCN---LEDLKAYKMRILKaCKDEnFTPLMTL--FFKN----ydEKFLYS   92
ident                      |         ||                     |     
Sbjct TRTHV----DVDSvakTKAVEAVLEAKEE-LKDL-IDIQVVAfaQSGFfvdlesESLIRK  174
DSSP  EEEEE----ELLLlllLHHHHHHHHHHHH-LLLL-LEEEEEEelLLLLlllllhHHHHHH


DSSP  HLL-LLLEEEELLlllllllllLLLLLLHhhHHHHHHHHHHLLLLEEELLLllllhhhLL
Query AKD-EIFGIXLYPagittnsngGVSSFDIeyLKPTLEAMSDLNIPLLVHGEtndfvmdRE  151
ident   |                            |                |           
Sbjct SLDmGCDLVGGVD------patRENNVEG-sLDLCFKLAKEYDVDIDYHIH-------DI  220
DSSP  HHHhLLLEEELLL------lllLLLLHHH-hHHHHHHHHHHLLLEEEEEEL-------LL


DSSP  HH-HHHHHHHHHHH---LLLL-LEEELLLLLHH------hhhHHHHL--LLEEEEELLHH
Query SN-FAKIYEKLAKH---FPRL-KIVMEHITTKT------lceLLKDY--ENLYATITLHH  198
ident           ||               |                  |             
Sbjct GTvGVYSINRLAQKtieNGYKgRVTTSHAWCFAdapsewldeAIPLYkdSGMKFVTCFSS  280
DSSP  HHhHHHHHHHHHHHhhhLLLLlLEEEEELLHHHhllhhhhhhHHHHHhhHLLEEEEELLL


DSSP  HLLlhhhhhlllllhhhllllllllhhhHHHHHHHHhllLLLEEELLLLLLLllllLLLL
Query LIItlddviggkmnphlfckpiakryedKEALCELAfsgYEKVMFGSDSAPHpkgcAAGV  258
ident                                   |           ||            
Sbjct TPP-------------------------TMPVIKLL-eaGINLGCASDNIRD----FWVP  310
DSSP  LLL-------------------------LLLHHHHH-hlLLEEEEELLLLLL----LLLL


DSSP  LLHHHHHHHHHHHH-----hHHLLHHHHHHHHLHHHHHH-HLLLL------LLLLEEEEE
Query FSAPVILPVLAELF-----kQNSSEENLQKFLSDNTCKI-YDLKF------KEDKILTLE  306
ident |                    |       |             |       |      | 
Sbjct FGNGDMVQGALIETqrlelkTNRDLGLIWKMITSEGARVlGIEKNygievgKKADLVVLN  370
DSSP  LLLLLHHHHHHHHHhhhlllLHHHHHHHHHHHLHHHHHHhLLHHHllllllLLLLEEEEL


DSSP  LlleelllleelllleellllllleELLEELL-----------------
Query EkewqvpnvyedkynqvvpymageiLKFQLKH-----------------  338
ident                                                  
Sbjct S-----------------lspqwaiIDQAKRLcvikngriivkdeviva  402
DSSP  L-----------------llhhhhhHHLLLEEeeeelleeeeelleell


No 22: Query=3pnuA Sbjct=2qpxA Z-score=14.7

back to top
DSSP  lllllllLLEE-EELLEEEEELLLLHH---------------------------------
Query enlyfqsNAMK-LKNPLDMHLHLRDNQ---------------------------------   26
ident                 || | |                                      
Sbjct --gxddlSEFVdQVPLLDHHCHFLIDGkvpnrddrlaqvsteadkdypladtknrlayhg   58
DSSP  --lllllHHHHhHLLEEEEEELLLLLLllllhhhhhhhhlllllllllhhhhlllhhhhh


DSSP  -----------------------hhhhhHHHHHLL-LLEEEELLLLLlllllhhhhhHHH
Query -----------------------mleliAPLSARD-FCAAVIMPNLIpplcnledlkAYK   62
ident                                     |    |                  
Sbjct flalakefaldannplaaxndpgyatynHRIFGHFhFKELLIDTGFV-----pddpiLDL  113
DSSP  hhhhhhhhllllllllllllhhhhhhhhHHHHHHLlEEEEEEELLLL-----lllllLLH


DSSP  HHHHHHHlllLLEEEEEEELL-----------------llLHHHHHHHL-LLLLEEEEL-
Query MRILKACkdeNFTPLMTLFFK-----------------nyDEKFLYSAK-DEIFGIXLY-  103
ident                                                ||     | |   
Sbjct DQTAELV---GIPVKAIYRLEthaedfxlehdnfaawwqaFSNDVKQAKaHGFVGFXSIa  170
DSSP  HHHHHHH---LLLEEEEEEHHhhhhhhhlllllhhhhhhhHHHHHHLLLlLLLLLEEELh


DSSP  LLLL-----------------------llllllllLLLLhhHHHHHHHHHHHLLLLEEEL
Query PAGI-----------------------ttnsnggvSSFDieYLKPTLEAMSDLNIPLLVH  140
ident                                           |            ||  |
Sbjct AYRVglhlepvnvieaaagfdtwkhsgekrltskpLIDY--XLYHVAPFIIAQDXPLQFH  228
DSSP  HHHLllllllllhhhhhhhhhhhhhhlllllllhhHHHH--HHHHHHHHHHHHLLLEEEE


DSSP  LL---lLLLHhHLLHhHHHHhHHHHHHLL--LLLEEELLLL--LHHHHHHHHHLLLEEEE
Query GE---tNDFVmDRESnFAKIyEKLAKHFP--RLKIVMEHIT--TKTLCELLKDYENLYAT  193
ident                          | |    || |  |          |     |||  
Sbjct VGygdaDTDX-YLGN-PLLX-RDYLKAFTkkGLKVVLLHCYpyHREAGYLASVFPNLYFD  285
DSSP  ELllllLLLH-HHLL-HHHH-HHHHHHHHhhLLLEEEEELLllHHHHHHHHHHLLLEEEE


DSSP  ELLHH--HLLLhhhhhlllllhhhllllllllhhhhHHHHHhhhllLLLEEELLLLLLll
Query ITLHH--LIITlddviggkmnphlfckpiakryedkEALCElafsgYEKVMFGSDSAPhp  251
ident | |                                     |     |    | ||     
Sbjct ISLLDnlGPSG--------------------asrvfNEAVE--lapYTRILFASDAST--  321
DSSP  LLLHHhhLHHH--------------------hhhhhHHHLL--lllHHHEELLLLLLL--


DSSP  lllllllLLHHHHHHHHHHHHHHHL----------LHHHHHHHHLHHHHHHHL-LLLLLL
Query kgcaagvFSAPVILPVLAELFKQNS----------SEENLQKFLSDNTCKIYD-LKFKED  300
ident                                                  | |        
Sbjct -----ypEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHqERELRV  376
DSSP  -----lhHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLlHHHHLL


DSSP  leeeeellleelllleelllleellllllleelleell
Query kiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                       
Sbjct --------------------------------------  376
DSSP  --------------------------------------


No 23: Query=3pnuA Sbjct=1bf6A Z-score=14.7

back to top
DSSP  llllllllleeeELLEEEEELLL-------------LHHHhHHHHHHHHLL----LLEEE
Query enlyfqsnamklKNPLDMHLHLR-------------DNQMlELIAPLSARD----FCAAV   43
ident                   | ||                |    |                
Sbjct --------sfdpTGYTLAHEHLHidlsgfknnvdcrLDQY-AFICQEMNDLmtrgVRNVI   51
DSSP  --------llllLLEEEEEELLLeelhhhhllhhheELLH-HHHHHHHHHHhhllEEEEE


DSSP  ELLLlLLLLllhhhHHHHHHHHHHHHlllLLEEEEEEEL--------------llLLHHH
Query IMPNlIPPLcnledLKAYKMRILKACkdeNFTPLMTLFF--------------knYDEKF   89
ident  | |                                                        
Sbjct EMTNrYMGR-----NAQFMLDVMRET---GINVVACTGYyqdaffpehvatrsvqELAQE  103
DSSP  ELLLhHHLL-----LHHHHHHHHHHH---LLEEEEEELLllhhhlllhhhhllhhHHHHH


DSSP  HHHHLL--------LLLEEE-ELLLlllllllllLLLLLHhhHHHHHHHHHHLLLLEEEL
Query LYSAKD--------EIFGIX-LYPAgittnsnggVSSFDIeyLKPTLEAMSDLNIPLLVH  140
ident                   |                             |      |   |
Sbjct MVDEIEqgidgtelKAGIIAeIGTS-----egkiTPLEEK-vFIAAALAHNQTGRPISTH  157
DSSP  HHHHHHllllllllLEEEEEeEELL-----llllLHHHHH-hHHHHHHHHHHHLLLEEEE


DSSP  LLllllhhhlLHHHHHHHHHHHHHLLLL--LEEELLLL---LHHHHHHHHHLLlEEEEE-
Query GEtndfvmdrESNFAKIYEKLAKHFPRL--KIVMEHIT---TKTLCELLKDYEnLYATI-  194
ident            |        |              |              |    |    
Sbjct TS--------FSTMGLEQLALLQAHGVDlsRVTVGHCDlkdNLDNILKMIDLG-AYVQFd  208
DSSP  LH--------HHLLHHHHHHHHHHLLLLhhHEEELLLLlllLHHHHHHHHHLL-LEEEEl


DSSP  LLHHhlllhhhhhlllllhhHLLLlllllhhhHHHHHHH-hhLLLLLEEELLLLLLLLll
Query TLHHliitlddviggkmnphLFCKpiakryedKEALCEL-afSGYEKVMFGSDSAPHPkg  253
ident |                                  |  |        ||   |       
Sbjct TIGK----------------NSYY---pdekrIAMLHALrdrGLLNRVMLSMDITRRShl  249
DSSP  LLLL----------------LLLL---lhhhhHHHHHHHhhlLLHHHEEELLLLLLHHhl


DSSP  lllllLLHHHHHHH-HHHHHHHHLLHHHHHHHHLHHHHHHHLllllllleeeeellleel
Query caagvFSAPVILPV-LAELFKQNSSEENLQKFLSDNTCKIYDlkfkedkiltleekewqv  312
ident            |      |     |       |  |                        
Sbjct kanggYGYDYLLTTfIPQLRQSGFSQADVDVMLRENPSQFFQ------------------  291
DSSP  hhhllLLLLHHHHLhHHHHHHLLLLHHHHHHHHLHHHHHHLL------------------


DSSP  llleelllleellllllleelleell
Query pnvyedkynqvvpymageilkfqlkh  338
ident                           
Sbjct --------------------------  291
DSSP  --------------------------


No 24: Query=3pnuA Sbjct=3icjA Z-score=14.6

back to top
DSSP  ------------------------------------------------lllllLLLLeEE
Query ------------------------------------------------enlyfQSNAmKL   12
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlKGKF-VM   59
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelLLLE-EE


DSSP  ELLEEEEELLL-------------------------------------------------
Query KNPLDMHLHLR-------------------------------------------------   23
ident     | ||||                                                  
Sbjct PAFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   23
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll


DSSP  -----LHHHHHHHHHHHHL-LLLEEEELLlllllLLLHhHHHHHHHHH--HHHHllllLE
Query -----DNQMLELIAPLSAR-DFCAAVIMPnlippLCNLeDLKAYKMRI--LKACkdenFT   75
ident           |                |            |||                 
Sbjct ltvkdYKHYIESAQEHLLSlGVHSVGFMS-----VGEK-ALKALFELEreGRLK----MN  229
DSSP  llhhhHHHHHHHHHHHHHHlLEEEEEEEE-----ELHH-HHHHHHHHHhlLLLL----LE


DSSP  EEEEEELLlllHHHHH---HHLLL-----LLEEEELLLLL--------------llllll
Query PLMTLFFKnydEKFLY---SAKDE-----IFGIXLYPAGI--------------ttnsng  113
ident     |         |      | |     | | ||   |                     
Sbjct VFAYLSPE--lLDKLEelnLGKFEgrrlrIWGVXLFVDGSlgartallsepytdnpttsg  287
DSSP  EEEEELHH--hHHHHHhhlLLLEEllleeEEEEEEELLLLllllllllllllllllllll


DSSP  llLLLLHhHHHHHHHHHHHLLLLEEELLLllllhhhlLHHHHHHHHHHHHHLLlLLEEEL
Query gvSSFDIeYLKPTLEAMSDLNIPLLVHGEtndfvmdrESNFAKIYEKLAKHFPrLKIVME  173
ident               |    |     ||                                |
Sbjct elVMNKD-EIVEVIERAKPLGLDVAVHAI--------GDKAVDVALDAFEEAE-FSGRIE  337
DSSP  llLLLHH-HHHHHHHHHLLLLLEEEEEEL--------LHHHHHHHHHHHHHHL-LLLEEE


DSSP  LLLLHH--HHHHHHHLLlEEEEELLHHHL-LLHHHHhlllllhhhlllllllLHHHHhhH
Query HITTKT--LCELLKDYEnLYATITLHHLI-ITLDDViggkmnphlfckpiakRYEDKeaL  230
ident |         |  |           |                          |       
Sbjct HASLVRddQLERIKELK-VRISAQPHFIVsDWWIVN-----------rvgeeRAKWA-yR  384
DSSP  ELLLLLhhHHHHHHHHL-LEEEELLLHHHhLLLHHH-----------hhhhhHHHHL-lL


DSSP  HHHhhLLLLLEEELLLLLlllllllllLLLHhHHHHHHHHHHH-------hHLLHHHHHH
Query CELafSGYEKVMFGSDSAphpkgcaagVFSApVILPVLAELFK-------qNSSEENLQK  283
ident      |   |  |  ||             |                      | |    
Sbjct LKT-lSSITKLGFSTDSP---------IEPA-DPWVSIDAAVNryvvdpgeRVSREEALH  433
DSSP  HHH-hHHHLLEEELLLLL---------LLLL-LHHHHHHHHHHlllllhhhLLLHHHHHH


DSSP  HHLHHHHHH-HLLLL------LLLLEEEEELLleelllleelllleellllllleellee
Query FLSDNTCKI-YDLKF------KEDKILTLEEKewqvpnvyedkynqvvpymageilkfql  336
ident                             |                               
Sbjct LYTHGSAQVtLAEDLgklergFRAEYIILDRD---------------------------p  466
DSSP  HLLHHHHHHlLLLLLllllllLLLLEEEELLL---------------------------l


DSSP  ll
Query kh  338
ident   
Sbjct lk  468
DSSP  ll


No 25: Query=3pnuA Sbjct=2vc5A Z-score=14.6

back to top
DSSP  ---llllllllleeeeLLEEEEELLL------------------LHHHHHHHHHHHHL-L
Query ---enlyfqsnamklkNPLDMHLHLR------------------DNQMLELIAPLSAR-D   38
ident                      | |||                                  
Sbjct mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeEFRNAVNEVKRAMQfG   60
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhHHHHHHHHHHHHHHlL


DSSP  LLEEEELLLlLLLLllhhhHHHHHHHHHHHHLlllLEEEEEEELL--------------l
Query FCAAVIMPNlIPPLcnledLKAYKMRILKACKdenFTPLMTLFFK--------------n   84
ident     |                       ||                              
Sbjct VKTIVDPTVmGLGR-----DIRFMEKVVKATG---INLVAGTGIYiyidlpfyflnrsid  112
DSSP  LLEEEELLLlLLLL-----LHHHHHHHHHLLL---LEEEELEELLllllllhhhllllhh


DSSP  lLHHHHHHHLL--------LLLEEEELLLllllllllllLLLL-HHHH-HHHHHHHHHLL
Query yDEKFLYSAKD--------EIFGIXLYPAgittnsnggvSSFD-IEYL-KPTLEAMSDLN  134
ident                         |                    |        |     
Sbjct eIADLFIHDIKegiqgtlnKAGFVXIAAD--------epGITKdVEKViRAAAIANKETK  164
DSSP  hHHHHHHHHHHllllllllLLLLEEEELL--------llLLLHhHHHHhHHHHHHHHHHL


DSSP  LLEEELLLllllhhhlLHHHH-HHHHHHHHHLLLL--LEEELLL-LLHH--HHHHHHHLL
Query IPLLVHGEtndfvmdrESNFA-KIYEKLAKHFPRL--KIVMEHI-TTKT--LCELLKDYE  188
ident  |   |            |                  ||   |   |          |  
Sbjct VPIITHSN--------AHNNTgLEQQRILTEEGVDpgKILIGHLgDTDNidYIKKIADKG  216
DSSP  LLEEEELL--------LLLLHhHHHHHHHHHLLLLhhHEEELLHhHLLLhhHHHHHHHLL


DSSP  lEEEEE-LLHHhlllhhhhhlllllhhhllllLLLL-HHHHHHHHHHH-hLLLLLEEELL
Query nLYATI-TLHHliitlddviggkmnphlfckpIAKR-YEDKEALCELA-fSGYEKVMFGS  245
ident                                          |    |       | |   
Sbjct -SFIGLdRYGL--------------------dLFLPvDKRNETTLRLIkdGYSDKIMISH  255
DSSP  -LEEEElLLLL--------------------lLLLLhHHHHHHHHHHHhlLLLLLEEELL


DSSP  LLLLL-llLLLL--------llLLHHHHHHHHHHHHHHH-LLHHHHHHHHLHHHHHHHLl
Query DSAPH-pkGCAA--------gvFSAPVILPVLAELFKQN-SSEENLQKFLSDNTCKIYDl  295
ident |       | |            |   |        | |   ||        |  |    
Sbjct DYCCTidwGTAKpeykpklaprWSITLIFEDTIPFLKRNgVNEEVIATIFKENPKKFFS-  314
DSSP  LLLLLlllLLLLhhhhhhhlllLLLLHHHHLHHHHHHLLlLLHHHHHHHHLHHHHHHLL-


DSSP  lllllleeeeellleelllleelllleellllllleelleell
Query kfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                            
Sbjct -------------------------------------------  314
DSSP  -------------------------------------------


No 26: Query=3pnuA Sbjct=3k2gB Z-score=14.5

back to top
DSSP  --------------llllllllleeeeLLEEEEELLL-----------------------
Query --------------enlyfqsnamklkNPLDMHLHLR-----------------------   23
ident                                 | ||                        
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlll


DSSP  ----------------------LHHHHHHHHHHHHL-LLLEEEELLLlLLLLllhhhHHH
Query ----------------------DNQMLELIAPLSAR-DFCAAVIMPNlIPPLcnledLKA   60
ident                       |           |       |                 
Sbjct sieilselrqdpfvnkhnialdDLDLAIAEVKQFAAvGGRSIVDPTCrGIGR-----DPV  115
DSSP  lhhhhhhhhllhhhllllleelLHHHHHHHHHHHHHlLLLEEEELLLlLLLL-----LHH


DSSP  HHHHHHHHHlllLLEEEEEEEL---------------lLLLHhHHHHHLL--------LL
Query YKMRILKACkdeNFTPLMTLFF---------------kNYDEkFLYSAKD--------EI   97
ident    ||                                                      |
Sbjct KLRRISAET---GVQVVXGAGYylassxpetaarlsadDIAD-EIVAEALegtdgtdaRI  171
DSSP  HHHHHHHHH---LLEEEELLLLllhhhllhhhhlllhhHHHH-HHHHHHHllllllllLL


DSSP  LEEE-ELLLllllllllllLLLL-HHHHHHHHHHHHHLLLLEEELLLllllhhhlLHHHH
Query FGIX-LYPAgittnsnggvSSFD-IEYLKPTLEAMSDLNIPLLVHGEtndfvmdrESNFA  155
ident   |                        |     |      || ||              |
Sbjct GLIGeIGVS--------sdFTAEeEKSLRGAARAQVRTGLPLXVHLP-------gWFRLA  216
DSSP  LLEEeELLL--------llLLHHhHHHHHHHHHHHHHHLLLEEELLL-------lLLLLH


DSSP  HHHHHHHHHLLLL--LEEELLLLL----HHHHHHHHHLLlEEEEE-LLHHhlLLHHhhhl
Query KIYEKLAKHFPRL--KIVMEHITT----KTLCELLKDYEnLYATI-TLHHliITLDdvig  208
ident      |           |  |             |                         
Sbjct HRVLDLVEEEGADlrHTVLCHXNPshxdPVYQATLAQRG-AFLEFdXIGX--DFFY----  269
DSSP  HHHHHHHHHLLLLhhHEEELLLHHhlllHHHHHHHHHHL-LEEEElLLLL--LLEE----


DSSP  llllhhhllllLLLL-hhhhHHHHHH-hhllLLLEEELLLLLLLLllllllLLLHHHHHH
Query gkmnphlfckpIAKR-yedkEALCEL-afsgYEKVMFGSDSAPHPkgcaagVFSAPVILP  266
ident                      |   |             |                    
Sbjct ------adqgvQCPSddevaRAILGLadhgyLDRILLSHDVFVKXxltrygGNGYAFVTK  323
DSSP  ------lllleELLLhhhhhHHHHHHhhlllHHHEEELLLLLLHHhlhhhlLLLLLHHHH


DSSP  HHHHHHHHH-LLHHHHHHHHLHHHHHHHLllllllleeeeellleelllleelllleell
Query VLAELFKQN-SSEENLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvp  325
ident                |      |     |                               
Sbjct HFLPRLRRHgLDDAALETLXVTNPRRVFD-------------------------------  352
DSSP  LHHHHHHHLlLLHHHHHHHHLHHHHHHHL-------------------------------


DSSP  llllleelleell
Query ymageilkfqlkh  338
ident              
Sbjct -------asiegh  358
DSSP  -------llllll


No 27: Query=3pnuA Sbjct=2pajA Z-score=14.5

back to top
DSSP  ------------------------------------------------llllllllLEEE
Query ------------------------------------------------enlyfqsnAMKL   12
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdCVIY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllLEEE


DSSP  ELLEEEEELLL-----------------LHHHHHHHHHHHHLL-LLEEEELLLLLLllll
Query KNPLDMHLHLR-----------------DNQMLELIAPLSARD-FCAAVIMPNLIPplcn   54
ident       | ||                              ||                  
Sbjct PAWVNTHHHLFqsllkgepfralfderrFRLAARIGLIELARSgCATVADHNYVYYpgmp  120
DSSP  ELEELLLLLHHhhhllllllhhhllhhhHHHHHHHHHHHHHLLlEEEEEELLLLLLllll


DSSP  hHHHHHHHHHHHHhhllLLLEEEEEEELLL-------------------llHHHHHHHLL
Query lEDLKAYKMRILKackdENFTPLMTLFFKN-------------------ydEKFLYSAKD   95
ident             |                                               
Sbjct fDSSAILFEEAEK----LGLRFVLLRGGATqtrqleadlptalrpetldayVADIERLAA  176
DSSP  lLHHHHHHHHHHH----LLLEEEEEELLLLllllllllllhhhllllhhhhHHHHHHHHH


DSSP  L----------LLEEE--ELLLllllllllLLLLllhHHHHHHHHHHHHLLLLEEELLLl
Query E----------IFGIX--LYPAgittnsngGVSSfdiEYLKPTLEAMSDLNIPLLVHGEt  143
ident                                 |         |      |      |   
Sbjct RyhdaspramrRVVMAptTVLY--------SISP---REMRETAAVARRLGLRMHSHLS-  224
DSSP  HllllllllleEEEELllLLLL--------LLLH---HHHHHHHHHHHHLLLEEEEELL-


DSSP  lllhhhllhHHHHHHHHHHhhllllLEEELLLLLHH--HHHHHHHLLlEEEEELLHHHLL
Query ndfvmdresNFAKIYEKLAkhfprlKIVMEHITTKT--LCELLKDYEnLYATITLHHLII  201
ident                               |          ||                 
Sbjct -------gkSPVAFCGEHD--wlgsDVWYAHLVKVDadEIALLAQTG-TGVAHCPQSNGR  274
DSSP  -------llLHHHHHHHLL--llllLEEEELLLLLLhhHHHHHHHHL-LEEEELHHHHHL


DSSP  LhhhhhlllllhhhllllllllhhhhhHHHHHHhllLLLEEELLLLLLlllllllLLLLH
Query TlddviggkmnphlfckpiakryedkeALCELAfsgYEKVMFGSDSAPhpkgcaaGVFSA  261
ident                               | |      |  | | |            |
Sbjct L--------------------------PVREMA-daGVPVSIGVDGAA-------SNEAA  300
DSSP  L--------------------------LLLLHH-hhLLLEEELLLHHH-------HLLLL


DSSP  H--HHHHHHHHHHHHH-LLHHHHHHHHLHHHHHH-HLLLL------LLLLEEEE-elLLE
Query P--VILPVLAELFKQN-SSEENLQKFLSDNTCKI-YDLKF------KEDKILTL-eeKEW  310
ident                   |                               |         
Sbjct DmiSEVHMTWLAQRARlASIAEVIHWGTAGGARVmGLDEVgkvavgYAADIAVYrldDPR  360
DSSP  LhhHHHHHHHHHHHHLlLLHHHHHHHHLHHHHHHhLLLLLllllllLLLLEEEEellLHH


DSSP  ElllleelllleellllllleELLEELL--------------------------------
Query QvpnvyedkynqvvpymageiLKFQLKH--------------------------------  338
ident                                                             
Sbjct Y---------fglhdpaigpvASGGRPSvmalfsagkrvvvddliegvdikelggearrv  411
DSSP  H---------lllllhhhhhhHLLLLLEeeeeeelleeeeellllllllhhhhhhhhhhh


DSSP  ----------
Query ----------  338
ident           
Sbjct vrellrevvv  421
DSSP  hhhhhhhhhl


No 28: Query=3pnuA Sbjct=4ofcA Z-score=14.5

back to top
DSSP  llllllllleeeelLEEEEELLLLH-----------------------------------
Query enlyfqsnamklknPLDMHLHLRDN-----------------------------------   25
ident                 | | |                                       
Sbjct -------------mKIDIHSHILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfr   47
DSSP  -------------lLEEEEEELLLLllllhhhhhllllleeeeeeelleeeeeelleeee


DSSP  ------hHHHHHHHHHHL-LLLEEEELLL------------lllLLLL-HHHHHHHHHHH
Query ------qMLELIAPLSAR-DFCAAVIMPN------------lipPLCN-LEDLKAYKMRI   65
ident          |                                         ||       
Sbjct vvrencwDPEVRIREMDQkGVTVQALSTVpvmfsywakpedtlnLCQLlNNDLASTVVSY  107
DSSP  eeehhhlLHHHHHHHHHHhLLLEEEEELLhhhhlllllhhhhhhHHHHhHHHHHHHHHHL


DSSP  HhhhllllLEEEEEEELLL----LLHHHHHHHLL--LLLEEEELLLlllllllllLLLL-
Query LkackdenFTPLMTLFFKN----YDEKFLYSAKD--EIFGIXLYPAgittnsnggVSSF-  118
ident                           |            |               |    
Sbjct P-------RRFVGLGTLPMqapeLAVKEMERCVKelGFPGVQIGTH---------VNEWd  151
DSSP  L-------LLEEEEELLLLllhhHHHHHHHHHHHllLLLEEEEELE---------ELLEe


DSSP  -LHHHHHHHHHHHHHLLLLEEELLLLLL----------LHHHLLHHH-HHHHHHH-----
Query -DIEYLKPTLEAMSDLNIPLLVHGETND----------FVMDRESNF-AKIYEKL-----  161
ident      | |   |   |   | ||                                     
Sbjct lNAQELFPVYAAAERLKCSLFVHPWDMQmdgrmakywlPWLVGMPAEtTIAICSMimggv  211
DSSP  lLLHHHHHHHHHHHHHLLEEEEELLLLLllhhhhlllhHHHLHHHHHhHHHHHHHhlllh


DSSP  HHHLLLLLEEELLLLLhHHHH----------------------hhHHLL-LEEEEELlHH
Query AKHFPRLKIVMEHITTkTLCE----------------------llKDYE-NLYATITlHH  198
ident    || ||    |                                | |    |      |
Sbjct FEKFPKLKVCFAHGGG-AFPFtvgrishgfsmrpdlcaqdnpmnpKKYLgSFYTDAL-VH  269
DSSP  HHHLLLLLEEELHHHL-LHHHhhhhhhhhhhhlhhhhlllllllhHHHLlLLEEELL-LL


DSSP  HLllhhhhhlllllhhhllllllllhhhhHHHHHHH-hllLLLEEELLLLLLlllllllL
Query LIitlddviggkmnphlfckpiakryedkEALCELA-fsgYEKVMFGSDSAPhpkgcaaG  257
ident                                |  |       ||  | |           
Sbjct DP---------------------------LSLKLLTdvigKDKVILGTDYPF-------P  295
DSSP  LH---------------------------HHHHHHHhhhlLLLEELLLLLLL-------L


DSSP  LLLHhHHHHHHHHHhhHHLLHHHHHHHHLHHHHHH-HLLLLLllleeeeellleelllle
Query VFSApVILPVLAELfkQNSSEENLQKFLSDNTCKI-YDLKFKedkiltleekewqvpnvy  316
ident                     ||   |    |                             
Sbjct LGEL-EPGKLIESM--EEFDEETKNKLKAGNALAFlGLERKQ------------------  334
DSSP  LLLL-LLLHHHHHL--LLLLHHHHHHHHLHHHHHHhLLLHHH------------------


DSSP  elllleellllllleelleell
Query edkynqvvpymageilkfqlkh  338
ident                       
Sbjct ---------------------f  335
DSSP  ---------------------l


No 29: Query=3pnuA Sbjct=2y1hB Z-score=14.4

back to top
DSSP  llllllllleeEELLEEEEELLL---LHHHHHHHHHHHHL-LLLEEEELLLlllLLLLHH
Query enlyfqsnamkLKNPLDMHLHLR---DNQMLELIAPLSAR-DFCAAVIMPNlipPLCNLE   56
ident                 | | ||        |             | |            |
Sbjct -----------GVGLVDCHCHLSapdFDRDLDDVLEKAKKaNVVALVAVAE---HSGEFE   46
DSSP  -----------LLLEEEEEELLLlhhHLLLHHHHHHHHHHlLEEEEEELLL---LHHHHH


DSSP  HHHHHHHHHHhhhlllllEEEEEEELL---------------lllHHHHHHHLLLLLEE-
Query DLKAYKMRILkackdenfTPLMTLFFK---------------nydEKFLYSAKDEIFGI-  100
ident        |            |  |                            ||    | 
Sbjct KIMQLSERYN-------gFVLPCLGVHpvqgldqrsvtlkdldvaLPIIENYKDRLLAIg   99
DSSP  HHHHHHHHLL-------lLEEEEELLLleelllleellhhhhhhhHHHHHHHLLLLLEEe


DSSP  EELLLLL---llllllllLLLLhhhHHHHHHHHHHLLLLEEELLLLlllhhhllhHHHHH
Query XLYPAGI---ttnsnggvSSFDieyLKPTLEAMSDLNIPLLVHGETndfvmdresNFAKI  157
ident                          |         || |  ||                 
Sbjct EVGLDFSprfagtgeqkeEQRQ--vLIRQIQLAKRLNLPVNVHSRS---------AGRPT  148
DSSP  EEEEELLllllllhhhhhHHHH--hHHHHHHHHHHHLLLEEEEEEL---------LHHHH


DSSP  HHHHHHHLLlLLEEELLLL-LHHHHHHHHHLLlEEEEELLHhHLLLhhhhhlllllhhhl
Query YEKLAKHFPrLKIVMEHIT-TKTLCELLKDYEnLYATITLHhLIITlddviggkmnphlf  216
ident    |       |                         |     |                
Sbjct INLLQEQGA-EKVLLHAFDgRPSVAMEGVRAG-YFFSIPPS-IIRS--------------  191
DSSP  HHHHHHLLL-LLEEEELLLlLHHHHHHHHHLL-LEEEELHH-HHLL--------------


DSSP  lllllllHHHHHHHHHHhhllLLLEEELLLLLllllllLLLLLLHHHHHHHHHHHHH-HH
Query ckpiakrYEDKEALCELafsgYEKVMFGSDSAphpkgcAAGVFSAPVILPVLAELFK-QN  275
ident                 |            ||                |            
Sbjct -------GQKQKLVKQL---pLTSICLETDSP-algpeKQVRNEPWNISISAEYIAQvKG  240
DSSP  -------HHHHHHHHHL---lHHHEEELLLLL-lllllLLLLLLHHHHHHHHHHHHHhHL


DSSP  LL-HHHHHHHhLHHHHHH-HLLLLlllleeeeellleelllleelllleellllllleel
Query SS-EENLQKFlSDNTCKI-YDLKFkedkiltleekewqvpnvyedkynqvvpymageilk  333
ident  | ||        |  |    |                                      
Sbjct ISvEEVIEVT-TQNALKLfPKLRH------------------------------------  263
DSSP  LLhHHHHHHH-HHHHHHHlLLHHH------------------------------------


DSSP  leell
Query fqlkh  338
ident      
Sbjct ---ll  265
DSSP  ---hl


No 30: Query=3pnuA Sbjct=3gg7A Z-score=14.4

back to top
DSSP  llllllllleeeeLLEEEEELLLLhHHHHHHHHHHHLLLLEEEELLllllLLLLhhHHHH
Query enlyfqsnamklkNPLDMHLHLRDnQMLELIAPLSARDFCAAVIMPnlipPLCNleDLKA   60
ident                 | | ||         |                            
Sbjct -------------SLIDFHVHLDLyPDPVAVARACEERQLTVLSVT----TTPA--AWRG   41
DSSP  -------------LLEEEEELHHHlLLHHHHHHHHHHLLLEEEELL----LLHH--HHHH


DSSP  HHHhHHHHHllllLEEEEEEEL-------llllhHHHHHHLLLLLEEE-ELLLLLlllll
Query YKMrILKACkdenFTPLMTLFF-------knydeKFLYSAKDEIFGIX-LYPAGIttnsn  112
ident                    | |                    |          |      
Sbjct TLA-LAAGR----PHVWTALGFhpevvseraadlPWFDRYLPETRFVGeVGLDGSpslrg   96
DSSP  HHH-HHLLL----LLEEELLLLlhhhllllhhhlHHHHHHHHHLLEEEeEELLLLhhhhh


DSSP  lllLLLLhhhHHHHHHHHHHL-LLLEEELLLLlllhhhllhhHHHHHHHHHHHLLLL-LE
Query ggvSSFDieyLKPTLEAMSDL-NIPLLVHGETndfvmdresnFAKIYEKLAKHFPRL-KI  170
ident      |        |    |     |  |                         ||    
Sbjct twtQQFA--vFQHILRRCEDHgGRILSIHSRR----------AESEVLNCLEANPRSgTP  144
DSSP  hhhHHHH--hHHHHHHHHHHLlLEEEEEELLL----------LHHHHHHHHHHLHHHeEE


DSSP  EELLLL-LHHHHHHHHHLLlEEEEELLHHHLLlhhhhhlllllhhhllllllllHHHHHH
Query VMEHIT-TKTLCELLKDYEnLYATITLHHLIItlddviggkmnphlfckpiakrYEDKEA  229
ident          |                                                  
Sbjct ILHWYSgSVTELRRAISLG-CWFSVGPTMVRT----------------------QKGAAL  181
DSSP  EEELLLlLHHHHHHHHHLL-LEEEELHHHHLL----------------------HHHHHH


DSSP  HHHHhhllLLLEEELLLLLLllllLLLLlLLHHHHHHhHHHHHH-HHLL-HHHHHHHhLH
Query LCELafsgYEKVMFGSDSAPhpkgCAAGvFSAPVILPvLAELFK-QNSS-EENLQKFlSD  287
ident            |    |                        | |       |        
Sbjct IRSM---pRDRVLTETDGPF-lelDGQA-ALPWDVKSvVEGLSKiWQIPaSEVERIV-KE  235
DSSP  HHHL---lHHHEEELLLLLL-leeLLEE-LLHHHHHHhHHHHHHhHLLLhHHHHHHH-HH


DSSP  HHHHHHLllllllleeeeellleelllleelllleellllllleelleell
Query NTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident |                                                  
Sbjct NVSRLLG-------------------------------------------t  243
DSSP  HHHHHHH-------------------------------------------l


No 31: Query=3pnuA Sbjct=4hk5D Z-score=14.3

back to top
DSSP  llllllllleeEELLEEEEELLLLH-----------------------------------
Query enlyfqsnamkLKNPLDMHLHLRDN-----------------------------------   25
ident                 | | |                                       
Sbjct -----------TPVVVDIHTHMYPPsyiamlekrqtiplvrtfpqadeprlillsselaa   49
DSSP  -----------LLLLEEEEEEELLHhhhhhhhlllllleeeeelleeeeeeellhhhhhh


DSSP  --------------------hHHHHHHHHHHL--LLLEEEELLL---------llllllL
Query --------------------qMLELIAPLSAR--DFCAAVIMPN---------lipplcN   54
ident                                        ||                   
Sbjct ldaaladpaaklpgrplsthfASLAQKMHFMDtnGIRVSVISLAnpwfdflapdeapgiA  109
DSSP  hhhhhhlllllllleellhhhLLHHHHHHHHHhlLLLEEEEEELlllllllllllhhhhH


DSSP  HHHHHHHHHHHHHhhllllLEEEEEEELLL-----LLHHHHHHHLLL--LLEEEELLLll
Query LEDLKAYKMRILKackdenFTPLMTLFFKN-----YDEKFLYSAKDE--IFGIXLYPAgi  107
ident                                             |      || |     
Sbjct DAVNAEFSDMCAQ----hvGRLFFFAALPLsapvdAVKASIERVKNLkyCRGIILGTS--  163
DSSP  HHHHHHHHHHHHL----llLLEEEEEELLLlllhhHHHHHHHHHHLLllEEEEEELLL--


DSSP  llllllLLLL--LLHHhHHHHHHHHHHLLLLEEELLLLLLL-------------------
Query ttnsngGVSS--FDIEyLKPTLEAMSDLNIPLLVHGETNDF-------------------  146
ident       |      |   | |  ||  |       |                         
Sbjct ------GLGKglDDPH-LLPVFEAVADAKLLVFLHPHYGLPnevygprseeyghvlplal  216
DSSP  ------LLLLllLLHH-HHHHHHHHHHLLLEEEELLLLLLLhhhhlllhhhlllhhhhhl


DSSP  -hhHLLHHHHHHHH--HHHHHLLLLLEEELLLLLhHHHH---------------------
Query -vmDRESNFAKIYE--KLAKHFPRLKIVMEHITTkTLCE---------------------  182
ident                     |   |     |    ||                       
Sbjct gfpMETTIAVARMYmaGVFDHVRNLQMLLAHSGG-TLPFlagriescivhdghlvktgkv  275
DSSP  hhhHHHHHHHHHHHhlLHHHHLLLLLEEEHHHHL-LHHHhhhhhhhhhhllhhhhhllll


DSSP  -----hHHHL--LLEEEEELlHHHLllhhhhhlllllhhhllllllllhhhhHHHHHHH-
Query -----lLKDY--ENLYATITlHHLIitlddviggkmnphlfckpiakryedkEALCELA-  234
ident             |  |                                      |     
Sbjct pkdrrtIWTVlkEQIYLDAV-IYSE---------------------------VGLQAAIa  307
DSSP  llllllHHHHhhHLEEEELL-LLLH---------------------------HHHHHHHh


DSSP  hllLLLEEELLLLLllllllllLLLL-------hHHHHHHHHHHHHHH-LLHH-HHHHHH
Query fsgYEKVMFGSDSAphpkgcaaGVFS-------aPVILPVLAELFKQN-SSEE-NLQKFL  285
ident        ||| |                             |                  
Sbjct ssgADRLMFGTDHP--------FFPPieedvqgpWDSSRLNAQAVIKAvGEGSsDAAAVM  359
DSSP  hhlHHHEELLLLLL--------LLLLllllllllLHHHHHHHHHHHHHhLLLLhHHHHHH


DSSP  LHHHHHHHLLL--LLLLleeeeellleelllleelllleellllllleelleell
Query SDNTCKIYDLK--FKEDkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident   |      ||                                            
Sbjct GLNAVRVLSLKaeLEHH----------------------------------hhhh  380
DSSP  LHHHHHHLLLHhhHHHH----------------------------------hhhl


No 32: Query=3pnuA Sbjct=3mtwA Z-score=14.3

back to top
DSSP  ---------------------------------------------llllllllLEEEELL
Query ---------------------------------------------enlyfqsnAMKLKNP   15
ident                                                         |   
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgVTLLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeEEEEELE


DSSP  EEEEELLL-----------------LHHHHHHHHHHHHL-LLLEEEELLLLllllllhhh
Query LDMHLHLR-----------------DNQMLELIAPLSAR-DFCAAVIMPNLipplcnled   57
ident  ||| ||                          |       |                  
Sbjct IDMHVHLDslaevggynsleysdrfWSVVQTANAKKTLEaGFTTVRNVGAA---------  111
DSSP  EEEEELLLllllllhhhhhhllhhhHHHHHHHHHHHHHHlLEEEEEELLLL---------


DSSP  HHHHHHHHHHH--hLLLLLEEEEE-EELL--------------------------lLLHH
Query LKAYKMRILKA--cKDENFTPLMT-LFFK--------------------------nYDEK   88
ident                            |                               |
Sbjct DYDDVGLREAIdagYVPGPRIVTAaISFGatgghcdstffppsmdqknpfnsdspdEARK  171
DSSP  LLHHHHHHHHHhllLLLLLEEEELlLLEEllllllllllllhhhllllllllllhhHHHH


DSSP  HHHHHLL-LLLEEEELLlLLLLL----llllLLLLLhhhhHHHHHHHHHLLLLEEELLLl
Query FLYSAKD-EIFGIXLYPaGITTN----snggVSSFDieylKPTLEAMSDLNIPLLVHGEt  143
ident      |      ||    |                     |          |    |   
Sbjct AVRTLKKyGAQVIXICAtGGVFSrgnepgqqQLTYE--emKAVVDEAHMAGIKVAAHAH-  228
DSSP  HHHHHHHlLLLEEEEELlLLLLLllllllllLLLHH--hhHHHHHHHHHLLLEEEEEEL-


DSSP  lllhhhlLHHHHHHHHHHHhhllllLEEELLLLLHH--HHHHHHHLLlEEEEELLHhhll
Query ndfvmdrESNFAKIYEKLAkhfprlKIVMEHITTKT--LCELLKDYEnLYATITLHhlii  201
ident                              ||          |       |          
Sbjct -------GASGIREAVRAG------VDTIEHASLVDdeGIKLAVQKG-AYFSMDIY----  270
DSSP  -------LHHHHHHHHHLL------LLEEEELLLLLhhHHHHHHHHL-LEEELLLL----


DSSP  lhhhhhllllLHHH-----------llllLLLLhhhHHHHHHHHhllLLLEEELLLLLll
Query tlddviggkmNPHL-----------fckpIAKRyedKEALCELAfsgYEKVMFGSDSAph  250
ident                              |       |           |   | |    
Sbjct -----ntdytQAEGkkngvlednlrkdrdIGEL--qRENFRKAL-kaGVKMVYGTDAG--  320
DSSP  -----lhhhhHHHHhhhlllhhhhhhhhhHHHH--hHHHHHHHH-hhLLEEELLLLLL--


DSSP  lllllllLLLHHHHHhHHHHHHHH-HLLHHHHHHHHLHHHHHH-HLLLL-------LLLL
Query pkgcaagVFSAPVILpVLAELFKQ-NSSEENLQKFLSDNTCKI-YDLKF-------KEDK  301
ident                                                |            
Sbjct -------IYPHGDNA-KQFAVMVRyGATPLQAIQSATLTAAEAlGRSKDvgqvavgRYGD  372
DSSP  -------LLLLLLHH-HHHHHHHHlLLLHHHHHHHLLHHHHHHhLLLLLlllllllLLLL


DSSP  EEEEELLleelllleelllleellllllleellEELL------------
Query ILTLEEKewqvpnvyedkynqvvpymageilkfQLKH------------  338
ident                                                  
Sbjct MIAVAGD-----------------pladvttleKPVFvmkggavvkapx  404
DSSP  EEEELLL-----------------llllhhhhhLLLEeeelleeeelll


No 33: Query=3pnuA Sbjct=3mkvA Z-score=14.1

back to top
DSSP  --------------------------------------------llllllllLEEEELLE
Query --------------------------------------------enlyfqsnAMKLKNPL   16
ident                                                             
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgKTIMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllLEEEELEE


DSSP  EEEELLL----------------LHHHHHHHHHHHHL-LLLEEEELLLlllllllhhhHH
Query DMHLHLR----------------DNQMLELIAPLSAR-DFCAAVIMPNlipplcnledLK   59
ident | | |                         |     |  |                    
Sbjct DLHVHVVaiefnlprvatlpnvlVTLRAVPIMRAMLRrGFTTVRDAGG---------aGY  111
DSSP  EEEELLLlllllhhhhllllhhhHHHHHHHHHHHHHHlLEEEEEELLL---------lLH


DSSP  HHHHH--hhHHHLlllLEEEEE-EELL---------------------------------
Query AYKMR--ilKACKdenFTPLMT-LFFK---------------------------------   83
ident   |                                                         
Sbjct PFKQAvesgLVEG---PRLFVSgRALSqtgghadprarsdymppdspcgccvrvgalgrv  168
DSSP  HHHHHhhllLLLL---LEEEELlLEEElllllllllllllllllllllllllllllleee


DSSP  -----LLLHhHHHHHLL-LLLEEEELLLLLLLL----llllLLLLLHhhHHHHHHHHHHL
Query -----NYDEkFLYSAKD-EIFGIXLYPAGITTN----snggVSSFDIeyLKPTLEAMSDL  133
ident                       ||    |              | |              
Sbjct adgvdEVRR-AVREELQmGADQIXIMASGGVASptdpvgvfGYSEDE--IRAIVAEAQGR  225
DSSP  lllhhHHHH-HHHHHHHhLLLLEEEELLLLLLLllllllllLLLHHH--HHHHHHHHHLL


DSSP  LLLEEELLLllllhhhlLHHHHHHHHHHHhhlllllEEELLLLLHH--HHHHHHHLLlEE
Query NIPLLVHGEtndfvmdrESNFAKIYEKLAkhfprlkIVMEHITTKT--LCELLKDYEnLY  191
ident     | |                                ||          |       |
Sbjct GTYVLAHAY--------TPAAIARAVRCG------vRTIEHGNLIDdeTARLVAEHG-AY  270
DSSP  LLLEEEEEL--------LHHHHHHHHHLL------lLEEEELLLLLhhHHHHHHHHL-LE


DSSP  EEELLHhhlllhhhhhllllLHHH-----------llllLLLLhhhHHHHHHHHhllLLL
Query ATITLHhliitlddviggkmNPHL-----------fckpIAKRyedKEALCELAfsgYEK  240
ident    ||                                                      |
Sbjct VVPTLV---------tydalASEGekyglppesiakiadVHGA--gLHSIEIMK-raGVK  318
DSSP  EELLHH---------hhhhhHHHLllllllhhhhllhhhHHLL--hHHHHHHHH-hhLLL


DSSP  EEELLLLLLLlllllllllLHHHHHhHHHHHHHHHLLHHHHHHHHLHHHHHH-HLLLL--
Query VMFGSDSAPHpkgcaagvfSAPVILpVLAELFKQNSSEENLQKFLSDNTCKI-YDLKF--  297
ident   || |                              |                       
Sbjct MGFGTDLLGE---------AQRLQS-DEFRILAEVLSPAEVIASATIVSAEVlGMQDKlg  368
DSSP  LLLLLLLLHH---------HHHHLL-HHHHHHHLLLLHHHHHHHLLHHHHHHlLLLLLll


DSSP  -----LLLLEEEEELlleelllleelllleelllllllEELL------EELL--------
Query -----KEDKILTLEEkewqvpnvyedkynqvvpymageILKF------QLKH--------  338
ident           |                                                 
Sbjct rivpgAHADVLVVDG-------------------nplkSVDCllgqgeHIPLvmkdgrlf  409
DSSP  lllllLLLLEEEELL-------------------llllLLLLllllllLLLEeeelleee


DSSP  -----
Query -----  338
ident      
Sbjct vnele  414
DSSP  eelll


No 34: Query=3pnuA Sbjct=3ls9A Z-score=14.1

back to top
DSSP  ---------------------------------------------lllLLLLlLEEEELL
Query ---------------------------------------------enlYFQSnAMKLKNP   15
ident                                                         |   
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtiDGRG-MIALPGL   59
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeELLL-EEEEELE


DSSP  EEEEELLL---------------------------------------LHHHHHHHHHHHH
Query LDMHLHLR---------------------------------------DNQMLELIAPLSA   36
ident    | ||                                                   | 
Sbjct INSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvIREVARAVLLESL  119
DSSP  EEEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHHHHHHHHHHH


DSSP  L-LLLEEEELLLLLLlllLHHHHHHHHHHHHHHHllllLEEEEEEELL------------
Query R-DFCAAVIMPNLIPplcNLEDLKAYKMRILKACkdenFTPLMTLFFK------------   83
ident               |         |                                   
Sbjct LgGITTVADQHLFFPgatADSYIDATIEAATDLG----IRFHAARSSMtlgkseggfcdd  175
DSSP  HlLEEEEEEEELLLLlllLLLHHHHHHHHHHHHL----LEEEEEELLLlllhhhlllllh


DSSP  ------lllHHHHHHHLLL----------LLEEE-ELLLllllllllLLLLLlhhhHHHH
Query ------nydEKFLYSAKDE----------IFGIX-LYPAgittnsngGVSSFdieyLKPT  126
ident                  |                                          
Sbjct lfvepvdrvVQHCLGLIDQyhepepfgmvRIALGpCGVP--------YDKPE---lFEAF  224
DSSP  hhlllhhhhHHHHHHHHHHhlllllllleEEEELlLLLL--------LLLHH---hHHHH


DSSP  HHHHHHLLLLEEELLLllllhhHLLHH------hhHHHHHHHHHL-LLLLEEELLLLLHH
Query LEAMSDLNIPLLVHGEtndfvmDRESN------faKIYEKLAKHF-PRLKIVMEHITTKT  179
ident      |    |  |                          | ||          |     
Sbjct AQMAADYDVRLHTHFY-----ePLDAGmsdhlygmTPWRFLEKHGwASDRVWLAHAVVPP  279
DSSP  HHHHHHHLLEEEEEEL-----lLLHHHhhhhhhllLHHHHHHHLLlLLLLEEEEELLLLL


DSSP  hhHHHHH--LLLEEEEELLHHHLLlhhhhhlllllhhhllllLLLLhhhHHHHHHHHhll
Query lcELLKD--YENLYATITLHHLIItlddviggkmnphlfckpIAKRyedKEALCELAfsg  237
ident   |                                                   |     
Sbjct -rEEIPEfaDAGVAIAHLIAPDLR------------------MGWG---LAPIREYL-da  316
DSSP  -hHHHHHhhHHLLEEEELHHHHHH------------------LLLL---LLLHHHHH-hl


DSSP  LLLEEELLLLLLlllllllLLLLHhHHHHHHHHHHH-----------hHLLHHHHHHHHL
Query YEKVMFGSDSAPhpkgcaaGVFSApVILPVLAELFK-----------qNSSEENLQKFLS  286
ident    | ||                    |  |                   |   |     
Sbjct GITVGFGTTGSA-------SNDGG-NLLGDLRLAALahrpadpnepekWLSARELLRMAT  368
DSSP  LLEEEELLLLLL-------LLLLL-LHHHHHHHHHHhlhhhllllhhhLLLHHHHHHHLL


DSSP  HHHHHH-HLLLL------LLLLEEEEELL----------------LEEL-----------
Query DNTCKI-YDLKF------KEDKILTLEEK----------------EWQV-----------  312
ident                       |                                     
Sbjct RGSAEClGRPDLgvleegRAADIACWRLDgvdrvgvhdpaiglimTGLSdraslvvvngq  428
DSSP  HHHHHHlLLLLLllllllLLLLEEEEELLlhhhlllllhhhhhhhLLLLlllleeeelle


DSSP  -----------llleELLLLEellllllleelleell
Query -----------pnvyEDKYNQvvpymageilkfqlkh  338
ident                                      
Sbjct vlvenerpvladlerIVANTT------------alip  453
DSSP  eeeelleellllhhhHHHHHH------------hhll


No 35: Query=3pnuA Sbjct=2ogjA Z-score=14.0

back to top
DSSP  -------------------------------------------lllllLLLLEEEELLEE
Query -------------------------------------------enlyfQSNAMKLKNPLD   17
ident                                                    |       |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqrIDAAFISPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeeLLLLEEEELEEE


DSSP  EEELLLLH-hhhhhHHHHHHL--LLLEEEELLLllllLLLHhHHHHHHHH-HHHHhlllL
Query MHLHLRDN-qmlelIAPLSAR--DFCAAVIMPNlippLCNLeDLKAYKMR-ILKAckdeN   73
ident  | |                        |                      |        
Sbjct LHVHIWHGgtdisiRPSECGAerGVTTLVDAGS----AGEA-NFHGFREYiIEPS----R  111
DSSP  EEELLLLLllllllLHHHLLHhhLEEEEEEELL----LLLL-LHHHHHHHlLLLL----L


DSSP  LEEEEEEELL-----------------LLLHHHHHH-HLLL---LLEEEELLLlllllll
Query FTPLMTLFFK-----------------NYDEKFLYS-AKDE---IFGIXLYPAgittnsn  112
ident       |                      |              | | |           
Sbjct ERIKAFLNLGsiglvacnrvpelrdikDIDLDRILEcYAENsehIVGLXVRAS------h  165
DSSP  LEEEEEEELLlllllllllllllllhhHLLHHHHHHhHHLLlllEEEEEEEEL------h


DSSP  LLLL-LLLHhhhHHHHHHHHHLLLLEEELLLLLllhhhllhhHHHHHHHHHhhlllLLEE
Query GGVS-SFDIeylKPTLEAMSDLNIPLLVHGETNdfvmdresnFAKIYEKLAkhfprLKIV  171
ident             |        |  |  ||                              |
Sbjct VITGsWGVT-pvKLGKKIAKILKVPXXVHVGEP-------paLYDEVLEIL----gPGDV  213
DSSP  HHHLlLLLH-hhHHHHHHHHHHLLLEEEEELLL-------llLHHHHHHHL----lLLLE


DSSP  ELLL-------LLHH---hHHHHHHLLLEEEEELLhhhlllhhhhhlllllhhhlLLLLL
Query MEHI-------TTKT---lCELLKDYENLYATITLhhliitlddviggkmnphlfCKPIA  221
ident   |                  |    |     |                           
Sbjct VTHCfngksgsSIXEdedlFNLAERCEGIRLDIGH-------------------gGASFS  254
DSSP  EELLlllllllLLLLlhhhHHHHHHLLLLEEELLL-------------------lLLLLL


DSSP  LLhhhHHHH--HHHHhlllllEEELLLLLLlllllllLLLL--hHHHHHHHHHHHHHHLL
Query KRyedKEAL--CELAfsgyekVMFGSDSAPhpkgcaaGVFS--aPVILPVLAELFKQNSS  277
ident        |     |            |                          |      
Sbjct FK-vaEAAIarGLLP------FSISTDLHG-------HSXNfpvWDLATTXSKLLSVDXP  300
DSSP  HH-hhHHHHhlLLLL------LLLLLLLLL-------LLLLlllLLHHHHHHHHHHLLLL


DSSP  HHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELLLEELllleelllleelllllll
Query EENLQKFLSDNTCKIYDLKF-------KEDKILTLEEKEWQVpnvyedkynqvvpymage  330
ident  ||       |      |                                          
Sbjct FENVVEAVTRNPASVIRLDXenrldvgQRADFTVFDLVDADL------eatdsngdvsrl  354
DSSP  HHHHHHLLLHHHHHHLLLLLlllllllLLLEEEEEEEEEEEE------eeellllleeee


DSSP  EELLEELL-----------------
Query ILKFQLKH-----------------  338
ident    |                     
Sbjct KRLFEPRYavigaeaiaasryipra  379
DSSP  EEEEEEEEeeelleeeellllllll


No 36: Query=3pnuA Sbjct=1a4mA Z-score=13.8

back to top
DSSP  llllllllLEEE-ELLEEEEELLL------------------------------------
Query enlyfqsnAMKL-KNPLDMHLHLR------------------------------------   23
ident              |     | ||                                     
Sbjct --------TPAFnKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkp   52
DSSP  --------LLLLlLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllll


DSSP  -----------------------LHHHHHHHHHHHHLL-LLEEEELLLLLLL--------
Query -----------------------DNQMLELIAPLSARD-FCAAVIMPNLIPP--------   51
ident                                    |                        
Sbjct lslpgflakfdyympviagcreaIKRIAYEFVEMKAKEgVVYVEVRYSPHLLanskvdpm  112
DSSP  llhhhhhllhhhhhhhhlllhhhHHHHHHHHHHHHHHLlEEEEEEEELLHHHllllllll


DSSP  --------llLHHHHHHHHHHHHHHHLLLLLEEEEEEEL------LLLL-hHHHHHHLLL
Query --------lcNLEDLKAYKMRILKACKDENFTPLMTLFF------KNYD-eKFLYSAKDE   96
ident                                     |                       
Sbjct pwnqtegdvtPDDVVDLVNQGLQEGEQAFGIKVRSILCCmrhqpsWSLEvlELCKKYNQK  172
DSSP  hhhlllllllHHHHHHHHHHHHHHHHHHHLLEEEEEEEEelllhhHHHHhhHHHHHLLLL


DSSP  -LLEEEELLLLLllllllllLLLLHHHHHHHHHHHHHLLLLEEELLlllllhhhlLHHHH
Query -IFGIXLYPAGIttnsnggvSSFDIEYLKPTLEAMSDLNIPLLVHGetndfvmdrESNFA  155
ident       |              |          |      |   ||          |    
Sbjct tVVAMDLAGDET------ieGSSLFPGHVEAYEGAVKNGIHRTVHA--------gEVGSP  218
DSSP  lEEEEEEELLLL------llLHHHLHHHHHHHHHHHHHLLEEEEEE--------lLLLLH


DSSP  HHHHHHHHHLllLLEEELLLLlhHHHH---HHHHL--llEEEEELLHhhlllhhhhhlll
Query KIYEKLAKHFprLKIVMEHITtkTLCE---LLKDY--enLYATITLHhliitlddviggk  210
ident                   |       |   |                             
Sbjct EVVREAVDIL--KTERVGHGY--HTIEdeaLYNRLlkenMHFEVCPW-------------  261
DSSP  HHHHHHHHLL--LLLEEEELH--HHHHlhhHHHHHhhllLEEEELHH-------------


DSSP  llhhhlLLLLLLLHHHHhHHHHHHHLLLlLEEELLLLLLlllllllLLLLhhHHHHHHHH
Query mnphlfCKPIAKRYEDKeALCELAFSGYeKVMFGSDSAPhpkgcaaGVFSapVILPVLAE  270
ident                   |                |             |          
Sbjct ---ssyLTGAWDPKTTH-AVVRFKNDKA-NYSLNTDDPL-------IFKS--TLDTDYQM  307
DSSP  ---hhhHLLLLLLLLLL-HHHHHHHLLL-LEEELLLLLL-------LLLL--LHHHHHHH


DSSP  HHHH-HLLHHHHHHHhLHHHHHHH----lLLLL--LLLEeeeellleelllleellllee
Query LFKQ-NSSEENLQKFlSDNTCKIY----dLKFK--EDKIltleekewqvpnvyedkynqv  323
ident   |     ||        |  |        |    |                        
Sbjct TKKDmGFTEEEFKRL-NINAAKSSflpeeEKKEllERLY---------------------  345
DSSP  HHHLlLLLHHHHHHH-HHHHHHLLlllhhHHHHhhHHHH---------------------


DSSP  llllllleelleell
Query vpymageilkfqlkh  338
ident                
Sbjct -----------reyq  349
DSSP  -----------hhll


No 37: Query=3pnuA Sbjct=1k6wA Z-score=13.7

back to top
DSSP  ------------LLLL---------------------------llLLLEEEELLEEEEEL
Query ------------ENLY---------------------------fqSNAMKLKNPLDMHLH   21
ident             |                                            | |
Sbjct alqtiinarlpgEEGLwqihlqdgkisaidaqsgvmpitensldaEQGLVIPPFVEPHIH   60
DSSP  llleeeeellllLLLEeeeeeelleeeeeeeellllllllleeelLLLEEELLEEEEEEL


DSSP  LL----------------------------------LHHHHHHHHHHHHL-LLLEEEELL
Query LR----------------------------------DNQMLELIAPLSAR-DFCAAVIMP   46
ident |                                     |                     
Sbjct LDttqtagqpnwnqsgtlfegierwaerkallthddVKQRAWQTLKWQIAnGIQHVRTHV  120
DSSP  LLlllllllllllllllhhhhhhhhhllhhhllhhhHHHHHHHHHHHHHHlLEEEEEEEE


DSSP  llllLLLL--HHHHHHHHHHHHHhHLLLlLEEEEEEEL---------LLLLhhhHHHHLL
Query nlipPLCN--LEDLKAYKMRILKaCKDEnFTPLMTLFF---------KNYDekfLYSAKD   95
ident           |  |||                    |                 |  |  
Sbjct ----DVSDatLTALKAMLEVKQE-VAPW-IDLQIVAFPqegilsypnGEAL---LEEALR  171
DSSP  ----ELLLllLHHHHHHHHHHHH-HLLL-LEEEEEEELlllllllllHHHH---HHHHHH


DSSP  -LLLEEEELLLLLllllllllLLLLhhhhHHHHHHHHHLLLLEEELLLllllHHHLlHHH
Query -EIFGIXLYPAGIttnsnggvSSFDieylKPTLEAMSDLNIPLLVHGEtndfVMDReSNF  154
ident          |                     |            ||           | |
Sbjct lGADVVGAIPHFE----ftreYGVE--slHKTFALAQKYDRLIDVHCD--eiDDEQ-SRF  222
DSSP  lLLLEEEELHHHL----llhhHHHH--hhHHHHHHHHHHLLEEEEEEL--llLLLL-LLH


DSSP  HhHHHHHHHHLLL-lLEEELLLLLH---------hhhHHHHHLLlEEEEELLH-HHLL-L
Query AkIYEKLAKHFPR-lKIVMEHITTK---------tlcELLKDYEnLYATITLH-HLII-T  202
ident       || |          | |               |||                   
Sbjct VeTVAALAHHEGMgaRVTASHTTAMhsyngaytsrlfRLLKMSG-INFVANPLvNIHLqG  281
DSSP  HhHHHHHHHHHLLhhHEEEEELHHHhhllhhhhhhhhHHHHHHL-LEEEELHHhHHHHlL


DSSP  HHHhhLLLLlhhhllllllllHHHHhHHHHHHhllLLLEEELLLLLLLllllLLLLLLHh
Query LDDviGGKMnphlfckpiakrYEDKeALCELAfsgYEKVMFGSDSAPHpkgcAAGVFSAp  262
ident   |                          |        | || |              | 
Sbjct RFD--TYPK------------RRGItRVKEML-esGINVCFGHDDVFD---pWYPLGTA-  322
DSSP  LLL--LLLL------------LLLLlLHHHHH-hlLLLEEELLLLLLL---lLLLLLLL-


DSSP  HHHHHHH------hhhhHHLLHHhHHHHHLHHHHHH-HLLLL-----LLLLEEEEELlle
Query VILPVLA------elfkQNSSEEnLQKFLSDNTCKI-YDLKF-----KEDKILTLEEkew  310
ident   | ||                                                |     
Sbjct NMLQVLHmglhvcqlmgYGQIND-GLNLITHHSARTlNLQDYgiaagNSANLIILPA---  378
DSSP  LHHHHHHhhhhhlllllHHHHHH-HHHHHLHHHHHHlLLLLLlllllLLLLEEEELL---


DSSP  elllleelllleelllllllEELLEELL------------------------------
Query qvpnvyedkynqvvpymageILKFQLKH------------------------------  338
ident                                                           
Sbjct -------------engfdalRRQVPVRYsvrggkviastqpaqttvyleqpeaidykr  423
DSSP  -------------llhhhhhHHLLLLLEeeelleeeeellllleeeellleeeellll


No 38: Query=3pnuA Sbjct=4dziC Z-score=13.6

back to top
DSSP  lllllllllEEEELLEEEEELLLL------------------------------------
Query enlyfqsnaMKLKNPLDMHLHLRD------------------------------------   24
ident                 |   |                                       
Sbjct ---------ALNYRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvn   51
DSSP  ---------LLLLLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleel


DSSP  ------------------------------------------HHHH---HHHHHHHHL-L
Query ------------------------------------------NQML---ELIAPLSAR-D   38
ident                                                            |
Sbjct hfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladHPEYqnrDARIAVMDEqD  111
DSSP  lllllllllleelllllhhhhhllllllllhhhllleelhhhLHHHllhHHHHHHHHHhL


DSSP  LLEEEELLLLL----------------llllLHHHHHHHHhhhhhhhlllLLEEEEEEEL
Query FCAAVIMPNLI----------------pplcNLEDLKAYKmrilkackdeNFTPLMTLFF   82
ident    |   |                           |                        
Sbjct IETAFMLPTFGcgveealkhdieatmasvhaFNLWLDEDW-----gfdrpDHRIIAAPIV  166
DSSP  EEEEEEELLHHhhhhhhllllhhhhhhhhhhHHHHHHHHL-----lllllLLLEEELLLL


DSSP  LL----lLHHHHHHHL-LLLLEEEELLlllllllllLLLL-------LLHHHHHHHHHHH
Query KN----yDEKFLYSAK-DEIFGIXLYPagittnsngGVSS-------FDIEYLKPTLEAM  130
ident                           |                           |     
Sbjct SLadptrAVEEVDFVLaRGAKLVLVRP---------APVPglvkprsLGDRSHDPVWARL  217
DSSP  LLllhhhHHHHHHHHHhLLLLLEELLL---------LLLLlllllllLLLHHHHHHHHHH


DSSP  HHLLLLEEELL-lLLLL---------------HHHLLHHHHHHHHHHH-HHLL----LLL
Query SDLNIPLLVHG-eTNDF---------------VMDRESNFAKIYEKLA-KHFP----RLK  169
ident      |   |                      |                         ||
Sbjct AEAGVPVGFHLsdSGYLhiaaawggakdpldqVLLDDRAIHDTMASMIvHGVFtrhpKLK  277
DSSP  HHHLLLEEEELllLLLHhhhhhllllllhhhhHHHLLHHHHHHHHHHHhLLHHhhllLLL


DSSP  EEEL-LLLLhHHHHH------------------hHHLL--LEEEEELLHHhlllhhhhhl
Query IVME-HITTkTLCEL------------------lKDYE--NLYATITLHHliitlddvig  208
ident  |            |                         |                   
Sbjct AVSIeNGSY-FVHRLikrlkkaantqpqyfpedpVEQLrnNVWIAPYYED----------  326
DSSP  EEEElLLLL-HHHHHhhhhhhhhhhlhhhllllhHHHHhhHEEELLLLLL----------


DSSP  llllhhhllllllllhhhhhHHHHHH-hllLLLEEELLLLLLlllllllLLLLhHHHHhH
Query gkmnphlfckpiakryedkeALCELA-fsgYEKVMFGSDSAPhpkgcaaGVFSaPVILpV  267
ident                      | |||      |  ||||          |          
Sbjct --------------------DLPELArvigVDKILFGSDWPH-------GEGL-ASPV-S  357
DSSP  --------------------LHHHHHhhhlHHHLLLLLLLLL-------LLLL-LLHH-H


DSSP  HHHHHHhHLLHHHHHHHHLHHHHHHHLllllllleeeeellleelllleelllleellll
Query LAELFKqNSSEENLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpym  327
ident      |   ||    |   ||                                       
Sbjct FTAELK-GFSESDIRKIMRDNALDLLG---------------------------------  383
DSSP  HHHHHL-LLLHHHHHHHHLHHHHHHHL---------------------------------


DSSP  llleelleell
Query ageilkfqlkh  338
ident            
Sbjct ------vqvgs  388
DSSP  ------lllll


No 39: Query=3pnuA Sbjct=2uz9A Z-score=13.5

back to top
DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------enl    3
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  LLLLlLEEEELLEEEEELLL---------------------------------LHHHHHH
Query YFQSnAMKLKNPLDMHLHLR---------------------------------DNQMLEL   30
ident              | | |                                          
Sbjct LSHH-EFFMPGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidfAEEVYTR  119
DSSP  LLLL-LEEEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhhHHHHHHH


DSSP  HHHHHHL-LLLEEEELLlllllLLLHHHHHHHHHHHHHHHllllLEEEEEEELLL-----
Query IAPLSAR-DFCAAVIMPnlippLCNLEDLKAYKMRILKACkdenFTPLMTLFFKN-----   84
ident             |                        |                      
Sbjct VVRRTLKnGTTTACYFA-----TIHTDSSLLLADITDKFG----QRAFVGKVCMDlndtf  170
DSSP  HHHHHHHlLEEEEEEEL-----LLLHHHHHHHHHHHHHHL----LEEEEELEELLlllll


DSSP  --------lLHHHHHHHLLL---------LLEEE-ELLLllllllllLLLLllhHHHHHH
Query --------yDEKFLYSAKDE---------IFGIX-LYPAgittnsngGVSSfdiEYLKPT  126
ident            |       |                             |          
Sbjct peyketteeSIKETERFVSEmlqknysrvKPIVTpRFSL--------SCSE---TLMGEL  219
DSSP  llllllhhhHHHHHHHHHHHhhhhlllleEEEEEeLLHH--------HLLH---HHHHHH


DSSP  HHHHHHLLLLEEELLLllllhHHLLHHH-------hHHHHHHHHHL-lllLEEELLLLLH
Query LEAMSDLNIPLLVHGEtndfvMDRESNF-------aKIYEKLAKHF-prlKIVMEHITTK  178
ident              |        |                    |      | || |    
Sbjct GNIAKTRDLHIQSHIS---enRDEVEAVknlypsykNYTSVYDKNNlltnKTVMAHGCYL  276
DSSP  HHHHHHHLLEEEEEEL---llHHHHHHHhhhlllllLHHHHHHHLLllllLEEEEELLLL


DSSP  HhhHHHHH--LLLEEEEELLHHHLllhhhhhlllllhhhLLLLLLllhhhhhhHHHHhhl
Query TlcELLKD--YENLYATITLHHLIitlddviggkmnphlFCKPIAkryedkeaLCELafs  236
ident    | |                                                      
Sbjct S-aEELNVfhERGASIAHCPNSNL---------------SLSSGF-------lNVLEvlk  313
DSSP  L-hHHHHHhhHHLLEEEELHHHHH---------------HLLLLL-------lLHHHhhh


DSSP  lLLLEEELLLLLllllllllLLLLHHhHHHHHH------------hhhhhHLLHHHHHHH
Query gYEKVMFGSDSAphpkgcaaGVFSAPvILPVLA------------elfkqNSSEENLQKF  284
ident    |   | | |        |  |    |                               
Sbjct hEVKIGLGTDVA--------GGYSYS-MLDAIRravmvsnillinkvnekSLTLKEVFRL  364
DSSP  lLLEEEELLLLL--------LLLLLL-HHHHHHhhhhhhhhhhhllllllLLLHHHHHHH


DSSP  HLHHHHHH-HLLLL-------LLLLEEEEEL----LLEElllleelllleelllllllee
Query LSDNTCKI-YDLKF-------KEDKILTLEE----KEWQvpnvyedkynqvvpymageil  332
ident                      ||                                     
Sbjct ATLGGSQAlGLDGEignfevgKEFDAILINPkasdSPID--lfygdffgdiseaviqkfl  422
DSSP  HLHHHHHHlLLLLLlllllllLLLLEEEELLllllLLLL--lllhhhhlllllhhhhhhh


DSSP  lLEELL----------------
Query kFQLKH----------------  338
ident                       
Sbjct yLGDDRnieevyvggkqvvpfs  444
DSSP  hHLLHHheeeeeelleeeelll


No 40: Query=3pnuA Sbjct=2gwgA Z-score=13.4

back to top
DSSP  llllllllleeeeLLEEEEELLLL-----------------------------------H
Query enlyfqsnamklkNPLDMHLHLRD-----------------------------------N   25
ident                 | | |                                       
Sbjct -------------XIIDIHGHYTTapkaledwrnrqiagikdpsvxpkvselkisddelQ   47
DSSP  -------------LLEEEEEELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhH


DSSP  HHHHHHH-HHHHL-LLLEEEELLL-------lllLLLLHHHHHHHHHHHHhhhlllllEE
Query QMLELIA-PLSAR-DFCAAVIMPN-------lipPLCNLEDLKAYKMRILkackdenfTP   76
ident                    |  |                |                    
Sbjct ASIIENQlKKXQErGSDLTVFSPRagdfnvsstwAAICNELCYRVSQLFP-------dNF  100
DSSP  HHHHLLHhHHHHHhLLLEEEEELLlllhhhhhhhHHHHHHHHHHHHHHLL-------lLE


DSSP  EEEEELL-------LLLHHHHHHHLL--LLLEEEEL-LLLLllllllllLLLL-HHHHHH
Query LMTLFFK-------NYDEKFLYSAKD--EIFGIXLY-PAGIttnsnggvSSFD-IEYLKP  125
ident                     |           | |              |         |
Sbjct IGAAXLPqspgvdpKTCIPELEKCVKeyGFVAINLNpDPSG----ghwtSPPLtDRIWYP  156
DSSP  EEEEELLllllllhHHHHHHHHHHHHllLLLEEEELlLLLL----llllLLLLlLHHHHH


DSSP  HHHHHHHLLLLEEELllllllHHHL----LHHHHHHHH--HHHHHLLLLLEEELLLLLhH
Query TLEAMSDLNIPLLVHgetndfVMDR----ESNFAKIYE--KLAKHFPRLKIVMEHITTkT  179
ident   |    | ||   |                          | | || || |  |     
Sbjct IYEKXVELEIPAXIH----vsTGAHylnaDTTAFXQCVagDLFKDFPELKFVIPHGGG-A  211
DSSP  HHHHHHHHLLLEEEL----llLLLHhhhhHHHHHHHHHhlLHHHHLLLLLEEELHHHL-L


DSSP  HHH----------------HHHHL-LLEEEEELlHHHLLlhhhhhlllllhhhlllllll
Query LCE----------------LLKDY-ENLYATITlHHLIItlddviggkmnphlfckpiak  222
ident                    |      |                                 
Sbjct VPYhwgrfrglaqexkkplLEDHVlNNIFFDTC-VYHQP---------------------  249
DSSP  LHHhhhhhhhhhhhlllllHHHHLlLLEEEELL-LLLHH---------------------


DSSP  lhhhhHHHHHHhhllLLLEEELLLLLLlllllllLLLL--------hhHHHHHHHHHhhH
Query ryedkEALCELafsgYEKVMFGSDSAPhpkgcaaGVFS--------apVILPVLAELfkQ  274
ident        |          | | |            |                        
Sbjct ---giDLLNTV--ipVDNVLFASEXIG-------AVRGidprtgfyydDTKRYIEAS--T  295
DSSP  ---hhHHHHHH--llHHHEELLLLLLL-------LLLLeelllleellLLHHHHHHL--L


DSSP  HLLHHHHHHHHLHHHHHHHL----lLLLLlleeeeellleelllleelllleelllllll
Query NSSEENLQKFLSDNTCKIYD----lKFKEdkiltleekewqvpnvyedkynqvvpymage  330
ident     |  |     |    |                                         
Sbjct ILTPEEKQQIYEGNARRVYPrldaaLKAK-------------------------------  324
DSSP  LLLHHHHHHHHLHHHHHHLHhhhhhHHHH-------------------------------


DSSP  eelleell
Query ilkfqlkh  338
ident         
Sbjct ---gkleh  329
DSSP  ---hhhll


No 41: Query=3pnuA Sbjct=2oofA Z-score=13.1

back to top
DSSP  -------------------------------------------------llllllllLEE
Query -------------------------------------------------enlyfqsnAMK   11
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgKLV   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllLEE


DSSP  EELLEEEEELLL------------------------------------------LHHHHH
Query LKNPLDMHLHLR------------------------------------------DNQMLE   29
ident      | | ||                                                 
Sbjct TPGLIDCHTHLIfagsraeefelrqkgvpyaeiarkgggiistvratraasedqLFELAL  120
DSSP  EELEEEEEELLLlllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhHHHHHH


DSSP  HHHHHHHLL-LLEEEELLLlllLLLL----HHHHHhHHHHHHHHHlllLLEEEEEEELL-
Query LIAPLSARD-FCAAVIMPNlipPLCN----LEDLKaYKMRILKACkdeNFTPLMTLFFK-   83
ident        |       |              |  |     |   |          ||    
Sbjct PRVKSLIREgVTTVEIKSG---YGLTledeLKXLR-VARRLGEAL---PIRVKTTLLAAh  173
DSSP  HHHHHHHHHlEEEEEEELL---LLLLhhhhHHHHH-HHHHHHHHL---LLEEEEEEEEEl


DSSP  ---------------lLLHHHHHHHL--LLLLEEEEL-LLLLlllllllLLLLlhhhhHH
Query ---------------nYDEKFLYSAK--DEIFGIXLY-PAGIttnsnggVSSFdieylKP  125
ident                         |                         |         
Sbjct avppeyrddpdswvetICQEIIPAAAeaGLADAVDVFcEHIG-------FSLA---qtEQ  223
DSSP  lllhhhlllhhhhhhhHHHLHHHHHHhlLLLLEEEEEeLLLL-------LLHH---hhHH


DSSP  HHHHHHHLLLLEEELLLllllhhhlLHHHHhHHHHHHHhllLLLEEELLLLLHH--hHHH
Query TLEAMSDLNIPLLVHGEtndfvmdrESNFAkIYEKLAKhfpRLKIVMEHITTKT--lCEL  183
ident    |          |           ||        |           |           
Sbjct VYLAADQYGLAVKGHXD-------qLSNLG-GSTLAAN---FGALSVDHLEYLDpegIQA  272
DSSP  HHHHHHHLLLEEEEEEL-------lLLLLL-HHHHHHH---LLLLEEEELLLLLhhhHHH


DSSP  HHHLLlEEEEELLHHHLLlhhhhhlllllhhhllllLLLLhhHHHHHHHHhhllLLLEEE
Query LKDYEnLYATITLHHLIItlddviggkmnphlfckpIAKRyeDKEALCELafsgYEKVMF  243
ident |       ||                                       |          
Sbjct LAHRG-VVATLLPTAFYF------------------LKET--KLPPVVAL-rkaGVPXAV  310
DSSP  HHHHL-LEEEELHHHHHH------------------LLLL--LLLLHHHH-hhlLLLEEE


DSSP  LLLLLLllllllLLLLLHHhHHHHHHHHHH-hHLLHHHHHHHHLHHHHH--HHLLLL---
Query GSDSAPhpkgcaAGVFSAPvILPVLAELFK-qNSSEENLQKFLSDNTCK--IYDLKF---  297
ident  ||  |                                                      
Sbjct SSDINP------GTAPIVS-LRXAXNXACTlfGLTPVEAXAGVTRHAARalGEQEQLgql  363
DSSP  LLLLLL------LLLLLLL-HHHHHHHHHHhhLLLHHHHHHHLLHHHHHhlLLLLLLlll


DSSP  ---LLLLEEEEEllleelllleelllleellllllleeLLEELL--------------
Query ---KEDKILTLEekewqvpnvyedkynqvvpymageilKFQLKH--------------  338
ident         |                                                 
Sbjct rvgXLADFLVWN------------------cghpaelsYLIGVDqlvsrvvngeetlh  403
DSSP  lllLLLLEEEEL------------------lllllhhhHLLLLLleeeeeelleelll


No 42: Query=3pnuA Sbjct=1j6pA Z-score=13.0

back to top
DSSP  ---------------------------------------lllLLLLlLEEEELLEEEEEL
Query ---------------------------------------enlYFQSnAMKLKNPLDMHLH   21
ident                                                          | |
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdlDLSG-KLVXPALFNTHTH   59
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleELLL-EEEEELEEEEEEL


DSSP  LL--------------------------------LHHHHHHHHHHHHLL-LLEEEELLLl
Query LR--------------------------------DNQMLELIAPLSARD-FCAAVIMPNl   48
ident                                         |     ||      |     
Sbjct APxtllrgvaedlsfeewlfskvlpiedrltekxAYYGTILAQXEXARHgIAGFVDXYF-  118
DSSP  HHhhhhllllllllhhhhhhllhhhhhllllhhhHHHHHHHHHHHHHLLlEEEEEEEEL-


DSSP  llllllhhHHHHHHHHHHHHHllllLEEEEEEELLL------llhHHHHH-HLLL-----
Query ipplcnleDLKAYKMRILKACkdenFTPLMTLFFKN------ydeKFLYS-AKDE-----   96
ident                             | |                             
Sbjct --------HEEWIAKAVRDFG----XRALLTRGLVDsngddggrlEENLKlYNEWngfeg  166
DSSP  --------LHHHHHHHHHHHL----LEEEEEEEELLlllllllhhHHHHHhHHHHllhhh


DSSP  --LLEEE-ELLLllllllllLLLLllhHHHHHHHHHHHHLLLLEEELLLllllhhHLLHH
Query --IFGIX-LYPAgittnsngGVSSfdiEYLKPTLEAMSDLNIPLLVHGEtndfvmDRESN  153
ident     |     |           |    ||||        || |   |          |  
Sbjct riFVGFGpHSPY--------LCSE---EYLKRVFDTAKSLNAPVTIHLY----etSKEEY  211
DSSP  leEEEEEeLLLL--------LLLH---HHHHHHHHHHHHHLLLEEEEEL----llLLLLL


DSSP  hhhHHHHHHHHL-LLLLEEELLLLLHHhHHHHHHL--LLEEEEELLHHHLLlhhhhhlll
Query fakIYEKLAKHF-PRLKIVMEHITTKTlCELLKDY--ENLYATITLHHLIItlddviggk  210
ident      |          |    |                                      
Sbjct ---DLEDILNIGlKEVKTIAAHCVHLP-ERYFGVLkdIPFFVSHNPASNLK---------  258
DSSP  ---LLHHHHLLLlLLLLEEEEELLLLL-HHHHHHHllLLEEEEELHHHHHH---------


DSSP  llhhhlllLLLLlhhhHHHHHHHHhllLLLEEELLLLLLlllllllLLLLHhHHHHHHHH
Query mnphlfckPIAKryedKEALCELAfsgYEKVMFGSDSAPhpkgcaaGVFSApVILPVLAE  270
ident                              ||  | | |           |          
Sbjct --------LGNG----IAPVQRXI-ehGXKVTLGTDGAA-------SNNSL-NLFFEXRL  297
DSSP  --------LLLL----LLLHHHHH-hlLLEEEELLLLLL-------LLLLL-LHHHHHHH


DSSP  HHH-------hHLLHHHHHHHHLHHHHHHHLLLL------LLLLEEEEE-LLLE------
Query LFK-------qNSSEENLQKFLSDNTCKIYDLKF------KEDKILTLE-EKEW------  310
ident            |       |            |                           
Sbjct ASLlqkaqnprNLDVNTCLKXVTYDGAQAXGFKSgkieegWNADLVVIDlDLPExfpvqn  357
DSSP  HHHhhhlllllLLLHHHHHHHHLHHHHHHHLLLLllllllLLLLEEEEElLLHHhllhhh


DSSP  ------------------------------elllleELLLLEellllllleelleell
Query ------------------------------qvpnvyEDKYNQvvpymageilkfqlkh  338
ident                                                           
Sbjct iknhlvhafsgevfatxvagkwiyfdgeyptidseeVKRELA--------riekelys  407
DSSP  hhhhhhhllllllleeeelleeeeellllllllhhhHHHHHH--------hhhhhhhl


No 43: Query=3pnuA Sbjct=4rdvB Z-score=12.7

back to top
DSSP  ------------------------------------llllllllLEEEELLEEEEELLL-
Query ------------------------------------enlyfqsnAMKLKNPLDMHLHLR-   23
ident                                                |      | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlgGAVLPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleellLLEEELEEEEEELHHh


DSSP  -----------------------------------LHHHHHHHHHHHHL-LLLEEEELLL
Query -----------------------------------DNQMLELIAPLSAR-DFCAAVIMPN   47
ident                                                      |      
Sbjct ramaglaevagnpndsfwtwrelmyrmvarlspeqIEVIACQLYIEMLKaGYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhHHHHHHHHHHHHHHhLEEEEEEEEL


DSSP  LLL------lllLHHHHHHHHHHHHHHHllllLEEEEEEEL-------------------
Query LIP------plcNLEDLKAYKMRILKACkdenFTPLMTLFF-------------------   82
ident               |           |                                 
Sbjct VHHdldgrsyadPAELSLRISRAASAAG----IGLTLLPVLyshagfggqpasegqrrfi  176
DSSP  LLLlllllllllLLHHHHHHHHHHHHHL----LEEEEEELLlleeellleellhhhllll


DSSP  LLLLhHHHHHHLLL---------LLEEE-ELLLllllllllLLLLllhHHHHHHHHHhHH
Query KNYDeKFLYSAKDE---------IFGIX-LYPAgittnsngGVSSfdiEYLKPTLEAmSD  132
ident        |                 |                |           | |   
Sbjct NGSE-AYLELLQRLrapleaaghSLGLCfHSLR--------AVTP---QQIATVLAA-GH  223
DSSP  LLHH-HHHHHHHHHhhhhhhhllEELEEeLLLL--------LLLH---HHHHHHHLL-LL


DSSP  LLLLEEELLLllllHHHL-------lhHHHHHHH-HHHHhllllLEEELLLLLHH--HHH
Query LNIPLLVHGEtndfVMDR-------esNFAKIYE-KLAKhfprlKIVMEHITTKT--LCE  182
ident    |   |                             |           | |        
Sbjct DDLPVHIHIA--eqQKEVddcqawsgrRPLQWLYeNVAV---dqRWCLVHATHADpaEVA  278
DSSP  LLLLEEEEEL--llHHHHhhhhhhhllLHHHHHHhHLLL---llLEEEEELLLLLhhHHH


DSSP  HHHHLLlEEEEELLHhhlllhhhhhlllllhhHLLLLllllhhhhhHHHHHHhllLLLEE
Query LLKDYEnLYATITLHhliitlddviggkmnphLFCKPiakryedkeALCELAfsgYEKVM  242
ident          |   |                                              
Sbjct AMARSG-AVAGLCLS--------------teaNLGDG-------ifPATDFL-aqGGRLG  315
DSSP  HHHHHL-LEEEELHH--------------hhhHLLLL-------llLHHHHH-hlLLEEE


DSSP  ELLLLllllllllllLLLHhHHHHhHHHHH---------HHHL-------LHHHHHHHHL
Query FGSDSaphpkgcaagVFSApVILPvLAELF---------KQNS-------SEENLQKFLS  286
ident  ||||            |       |  |                         |     
Sbjct IGSDS----------HVSL-SVVEeLRWLEygqrlrdrkRNRLyrddqpmIGRTLYDAAL  364
DSSP  ELLLL----------LLLL-LHHHhHHHHHhhhhhhhllLLLLlllllllHHHHHHHHHH


DSSP  HHHHH-hHLLL------LLLLLeEEEELLL------------------------------
Query DNTCK-iYDLK------FKEDKiLTLEEKE------------------------------  309
ident                     |  | |                                  
Sbjct AGGAQalGQPIgslavgRRADL-LVLDGNDpylasaegdallnrwlfaggdrqvrdvmva  423
DSSP  HHHHHhhLLLLllllllLLLLE-EEELLLLhhhhllllhhhhhhhhhhllhhheeeeeel


DSSP  ------------eelllleELLLLeellllllleelleell
Query ------------wqvpnvyEDKYNqvvpymageilkfqlkh  338
ident                                          
Sbjct grwvvrdgrhageersaraFVQVL-------------gell  451
DSSP  leeeelllllllhhhhhhhHHHHH-------------hhhl


No 44: Query=3pnuA Sbjct=1j5sA Z-score=12.6

back to top
DSSP  -----------llllllllLEEE-ELLEEEEELLLLHhHHHH------------------
Query -----------enlyfqsnAMKL-KNPLDMHLHLRDNqMLEL------------------   30
ident                             | | ||                          
Sbjct hmflgedylltnraavrlfNEVKdLPIVDPHNHLDAK-DIVEnkpwndiwevegatdhyv   59
DSSP  llllllllllllhhhhhhhHHHLlLLEEELLLLLLHH-HHHHllllllhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   30
ident                                                             
Sbjct welmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvisee  119
DSSP  hhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhh


DSSP  -----------------HHHHHH-LLLLEEEELLlllllLLLHHhhHHHHHHHHHHHLll
Query -----------------IAPLSA-RDFCAAVIMPnlippLCNLEdlKAYKMRILKACKde   72
ident                     |                                  |    
Sbjct taeeiweetkkklpemtPQKLLRdMKVEILCTTD-----DPVST--LEHHRKAKEAVE--  170
DSSP  hhhhhhhhhhhhlllllHHHHHHhLLEEEEELLL-----LLLLL--LHHHHHHHHHLL--


DSSP  LLEEEEEEELL--------------------------------llLHHHHHHHLLL-LLE
Query NFTPLMTLFFK--------------------------------nyDEKFLYSAKDE-IFG   99
ident   | | |                                        |     |      
Sbjct GVTILPTWRPDramnvdkegwreyvekmgerygedtstldgflnaLWKSHEHFKEHgCVA  230
DSSP  LLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHLLlLLE


DSSP  EEELLL---------------------lllllllllllLLLHhHHHHHHHHHHHLLLLEE
Query IXLYPA---------------------gittnsnggvsSFDIeYLKPTLEAMSDLNIPLL  138
ident                                                        |    
Sbjct SDHALLepsvyyvdenraravhekafsgekltqdeindYKAF-MMVQFGKMNQETNWVTQ  289
DSSP  EEEEELllllllllhhhhhhhhhhhlllllllhhhhhhHHHH-HHHHHHHHHHHHLLEEE


DSSP  ELLLLL------------------LLHHHLlhHHHHHHHHHHHHLL-LLLEEEL---llL
Query VHGETN------------------DFVMDResNFAKIYEKLAKHFP-RLKIVME---hiT  176
ident  |                                |         |   ||||        
Sbjct LHIGALrdyrdslfktlgpdsggdISTNFL--RIAEGLRYFLNEFDgKLKIVLYvldptH  347
DSSP  EEELEEllllhhhhhhllllllllEELLLL--LHHHHHHHHHHHLLlLLLEEEEellhhH


DSSP  LHHHHHHHHHLLLEEEEEL--lHHHLLlhhhhhlllllhhhllllllllhhhHHHHHHHH
Query TKTLCELLKDYENLYATIT--lHHLIItlddviggkmnphlfckpiakryedKEALCELA  234
ident   |         | |                                        |  ||
Sbjct LPTISTIARAFPNVYVGAPwwfNDSPF-----------------------gmEMHLKYLA  384
DSSP  HHHHHHHHHHLLLEEELLLlllLLLHH-----------------------hhHHHHHHHH


DSSP  --hlLLLLEEELLLLLLlllllllllLLHHHHHHHHHHHHHHHL-------------LHH
Query --fsGYEKVMFGSDSAPhpkgcaagvFSAPVILPVLAELFKQNS-------------SEE  279
ident      |       ||            |                               |
Sbjct svdlLYNLAGMVTDSRK--------lLSFGSRTEMFRRVLSNVVgemvekgqipikeARE  436
DSSP  llllHHHLLLLLLLLLL--------lLHHHHHHHHHHHHHHHHHhhhhhlllllhhhHHH


DSSP  HHHHHHLHHHHHHHLllllllleeeeellleelllleelllleellllllleelleell
Query NLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident        |                                                   
Sbjct LVKHVSYDGPKALFF--------------------------------------------  451
DSSP  HHHHHHLHHHHHHHL--------------------------------------------


No 45: Query=3pnuA Sbjct=4c5yA Z-score=12.3

back to top
DSSP  ------------------llLLLL------------------------------llLEEE
Query ------------------enLYFQ------------------------------snAMKL   12
ident                     |                                       
Sbjct deakvtiiyagllipgdgepLRNAalvisdkiiafvgseadipkkylrstqsthrvPVLM   60
DSSP  lllleeeeeeeeelllllllEEEEeeeeelleeeeeeehhhllhhhhhhllleeeeEEEE


DSSP  ELLEEEEELLLL-------------------HHHHHHHHHHHHL-LLLEEEELLLLllll
Query KNPLDMHLHLRD-------------------NQMLELIAPLSAR-DFCAAVIMPNLippl   52
ident     | | |                         |                         
Sbjct PGLWDCHMHFGGdddyyndytsglathpassGARLARGCWEALQnGYTSYRDLAGY----  116
DSSP  ELEEEEEELLLLllllllllhhhhhllhhhhHHHHHHHHHHHHHlLEEEEEELLLL----


DSSP  llhhhhHHHHHHH--HHHHllllLEEEEE-EELL--------------------------
Query cnledlKAYKMRI--LKACkdenFTPLMT-LFFK--------------------------   83
ident             |                                               
Sbjct -----gCEVAKAIndGTIV---gPNVYSSgAALSqtaghgdifalpagevlgsygvmnpr  168
DSSP  -----hHHHHHHHhlLLLL---lLEEEELlLEEEllllllllllllhhhhhhhhllllll


DSSP  ----------------LLLHhHHHHHLL-LLLEEEEL-LLLLLL-lllllllLLLHHHHH
Query ----------------NYDEkFLYSAKD-EIFGIXLY-PAGITT-nsnggvsSFDIEYLK  124
ident                                  ||     |            |  | ||
Sbjct pgywgagplciadgveEVRR-AVRLQIRrGAKVIXVMaSGGVMSrddnpnfaQFSPEELK  227
DSSP  lllllllleeelllhhHHHH-HHHHHHHhLLLLEEEElLLLLLLllllllllLLLHHHHH


DSSP  HHHHHHHHLLLLEEELLLllllhhhllhhHHHHHHHHHHHLlllLEEELLLLlhHHHH-H
Query PTLEAMSDLNIPLLVHGEtndfvmdresnFAKIYEKLAKHFprlKIVMEHITtkTLCE-L  183
ident    |     |     |                      |         ||       |  
Sbjct VIVEEAARQNRIVSAHVH-----------GKAGIMAAIKAG---CKSLEHVS--YADEeV  271
DSSP  HHHHHHHHLLLLEEEEEL-----------LHHHHHHHHHHL---LLEEEELL--LLLHhH


DSSP  HHH--LLLEEEEELLHHHLLlhHHHHlllLLHH-hllllLLLL--HHHHHHHHHHHhllL
Query LKD--YENLYATITLHHLIItlDDVIggkMNPH-lfckpIAKR--YEDKEALCELAfsgY  238
ident              |     |                              |         
Sbjct WELmkEKGILYVATRSVIEI-fLASN---GEGLvkeswaKLQAlaDSHLKAYQGAI-kaG  326
DSSP  HHHhhHHLLEEELLHHHHHH-hHHHL---LLLLlllhhhLLLHhhHHHHHHHHHHH-hlL


DSSP  LLEEELLLLLllllllllllLLHHHHhhhhhhhhhhHLLHHHHHHHHLHHHHH---hHLL
Query EKVMFGSDSAphpkgcaagvFSAPVIlpvlaelfkqNSSEENLQKFLSDNTCK---iYDL  295
ident      | | |                                  |    |          
Sbjct VTIALGTDTA--------pgGPTALE--lqfavergGMTPLEAIKAATANAPLsvgpQAP  376
DSSP  LLEELLLLLL--------llLLLHHH--hhhhhhllLLLHHHHHHHHLLLHHHhhhhHLL


DSSP  LL------LLLLEEEEELlleelllleelllleelllllllEELL-----EELL------
Query KF------KEDKILTLEEkewqvpnvyedkynqvvpymageILKF-----QLKH------  338
ident          |     |||                         |         |      
Sbjct LTgqlregYEADVIALEE-------------------npleDIKVfqepkAVTHvwkggk  417
DSSP  LLllllllLLLLEEEELL-------------------llllLHHHhhlhhHEEEeeelle


DSSP  -------------------
Query -------------------  338
ident                    
Sbjct lfkgpgigpwgedarnpfl  436
DSSP  eeellllllllllllllll


No 46: Query=3pnuA Sbjct=2imrA Z-score=12.2

back to top
DSSP  ------------------------------------------llllLLLLLEEEELLEEE
Query ------------------------------------------enlyFQSNAMKLKNPLDM   18
ident                                                   |     |   
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeERAGAVIAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeEELLLEELLLLLEE


DSSP  EELLL--------------------------LHHHHHHHHHHHHLL-LLEEEELLLLlll
Query HLHLR--------------------------DNQMLELIAPLSARD-FCAAVIMPNLipp   51
ident | ||                                   |    |               
Sbjct HTHLDmsayefqalpyfqwipevvirgrhlrGVAAAQAGADTLTRLgAGGVGDIVWA---  117
DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllllHHHHHHHHHHHHHHLlLLLEEEEELL---


DSSP  lllHHHHHHHHHHHHhhhllllLEEEEEEEL----------LLLL-HHHHHHHLLL----
Query lcnLEDLKAYKMRILkackdenFTPLMTLFF----------KNYD-EKFLYSAKDE----   96
ident     |   |   |                                    |          
Sbjct ---PEVMDALLARED-------LSGTLYFEVlnpfpdkadeVFAAaRTHLERWRRLerpg  167
DSSP  ---HHHHHHHHLLLL-------LLEEEEEEEllllhhhhhhHHHHhHHHHHHHHLLllll


DSSP  -LLEEEELLllllllllllLLLLLhhHHHHHHHHHHHLLLLEEELLLllllhHHLL----
Query -IFGIXLYPagittnsnggVSSFDieYLKPTLEAMSDLNIPLLVHGEtndfvMDRE----  151
ident    |                 |                  ||  |               
Sbjct lRLGLSPHT--------pfTVSHR--LMRLLSDYAAGEGLPLQIHVA---ehPTELemfr  214
DSSP  eEEEEEELL--------llLLLHH--HHHHHHHHHHHHLLLLEEEEL---llHHHHhhhh


DSSP  ------------------------------hhHHHHHH--HHHHhlllLLEEELLLLLHH
Query ------------------------------snFAKIYE--KLAKhfprLKIVMEHITTKT  179
ident                                                       |    |
Sbjct tgggplwdnrmpalyphtlaevigrepgpdltPVRYLDelGVLA----ARPTLVHMVNVT  270
DSSP  hlllllhhhllhhhllllhhhhhlllllllllHHHHHHhhLLHH----HLLEEEELLLLL


DSSP  --HHHHHHHLLlEEEEELLHHHLLlhhhhhlllllhhhllllLLLLhhhhhhHHHHhhll
Query --LCELLKDYEnLYATITLHHLIItlddviggkmnphlfckpIAKRyedkeaLCELafsg  237
ident                                                             
Sbjct pdDIARVARAG-CAVVTCPRSNHH-----------------lECGT-----fDWPAfaaa  307
DSSP  hhHHHHHHHHL-LLEEELHHHHHH-----------------lLLLL-----lLHHHhhhl


DSSP  LLLEEELLLLLLlllllllLLLLHhHHHHHHHHHHH--HHLLHHHHHHHHLHHHHHHhlL
Query YEKVMFGSDSAPhpkgcaaGVFSApVILPVLAELFK--QNSSEENLQKFLSDNTCKIydL  295
ident    |  | ||                                   |              
Sbjct GVEVALGTDSVA-------SGETL-NVREEVTFARQlyPGLDPRVLVRAAVKGGQRV-vG  358
DSSP  LLLEEELLLLHH-------HHLLL-LLHHHHHHHHHhlLLLLHHHHHHHHHHHHHHH-hL


DSSP  LLLL------llEEEEellleelllleelllleellllllleellEELL--
Query KFKE------dkILTLeekewqvpnvyedkynqvvpymageilkfQLKH--  338
ident                                               |    
Sbjct TPFLrrgetwqeGFRW-----------------------------ELSRdl  380
DSSP  LLLLlllllllhHHLH-----------------------------HHLLll


No 47: Query=3pnuA Sbjct=3ooqA Z-score=12.2

back to top
DSSP  ----------------------------------------lllLLLLlLEEEELLEEEEE
Query ----------------------------------------enlYFQSnAMKLKNPLDMHL   20
ident                                                         | | 
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivDLTG-KFLFPGFVDAHS   59
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeELLL-LEEEELEEEEEE


DSSP  L-LLLH--------------------------hHHHH-HHHHHHL-LLLEEEELLL----
Query H-LRDN--------------------------qMLEL-IAPLSAR-DFCAAVIMPN----   47
ident |                                                   | |     
Sbjct HiGLFEegvgyyysdgneatdpvtphvkaldgfNPQDpAIERALAgGVTSVXIVPGsanp  119
DSSP  LlLLLLllllhhhlllllllllllllllhhhhlLLLLhHHHHHHLlLEEEEEELLLllll


DSSP  lllllllhhhhhhHHHHHHhhhllllleeeeeeelllllhhhhhhhllLLLEEEELLLLL
Query lipplcnledlkaYKMRILkackdenftplmtlffknydekflysakdEIFGIXLYPAGI  107
ident                                                    |        
Sbjct vggqgsvikfrsiIVEECI---------------------------vkDPAGLKXAFGEN  152
DSSP  eeeeeeeeellllLHHHHE---------------------------eeEEEEEEEELLHH


DSSP  lllLLLL-----------lLLLL--HHHHHHH--------------------------HH
Query ttnSNGG-----------vSSFD--IEYLKPT--------------------------LE  128
ident                            |                               |
Sbjct ---PKRVygerkqtpstrxGTAGviRDYFTKVknyxkkkelaqkegkeftetdlkxevGE  209
DSSP  ---HHHHhhhlllllllhhHHHHhhHHHHHHHhhhhhhhhhhhhlllllllllhhhhhHH


DSSP  HHHHLLLLEEELLLllllhhhlLHHHHHHHHHHHHHLLlLLEEELLLLL-HHHHHHHHHL
Query AMSDLNIPLLVHGEtndfvmdrESNFAKIYEKLAKHFPrLKIVMEHITT-KTLCELLKDY  187
ident       ||   |                     |  |     | || |        |   
Sbjct XVLRKKIPARXHAH--------RADDILTAIRIAEEFG-FNLVIEHGTEaYKISKVLAEK  260
DSSP  HHHLLLLLEEEEEL--------LHHHHHHHHHHHHHHL-LLEEEEELLLhHHHHHHHHHH


DSSP  LlEEEEELLhHHLLLHhhhhlllllhhhllllLLLLhhHHHHH-HHHHhllllLEEELLL
Query EnLYATITLhHLIITLddviggkmnphlfckpIAKRyeDKEAL-CELAfsgyeKVMFGSD  246
ident            |                      |           |            |
Sbjct K-IPVVVGP-LLTFRT--------------klELKD--LTXETiAKLL-kdgvLIALXCD  301
DSSP  L-LLEEELL-LLLLLL--------------lhHHLL--LLLLHhHHHH-hlllLEEELLL


DSSP  LLlllllllllLLLHHHHHHHHHhHHHH-HLLHHHHHHHHLHHHHHH-HLLLL-------
Query SAphpkgcaagVFSAPVILPVLAeLFKQ-NSSEENLQKFLSDNTCKI-YDLKF-------  297
ident            |          |         || | | |  |  ||             
Sbjct HP---------VIPLEFATVQAA-TAXRyGAKEEDLLKILTVNPAKIlGLEDRigsiepg  351
DSSP  LL---------LLLHHHHHHHHH-HHHHhLLLHHHHHHLLLHHHHHHlLLLLLlllllll


DSSP  LLLLEEEEELlleelllleelllleellllllleELLEELL------------
Query KEDKILTLEEkewqvpnvyedkynqvvpymageiLKFQLKH------------  338
ident |                                  |                 
Sbjct KDADLVVWSG--------------------hpfdXKSVVERvyidgvevfrre  384
DSSP  LLLLEEEELL--------------------llllLLLLEEEeeelleeeeell


No 48: Query=3pnuA Sbjct=3qy6A Z-score=12.0

back to top
DSSP  llllllllleeeelLEEEEELLLL--------HHHHHHHHHHHHL-LLLEEEELLL---l
Query enlyfqsnamklknPLDMHLHLRD--------NQMLELIAPLSAR-DFCAAVIMPN---l   48
ident                 | | |                  |    |         |     
Sbjct --------------MIDIHCHILPamddgagdSADSIEMARAAVRqGIRTIIATPHhnng   46
DSSP  --------------LEELLLLLLLllllllllHHHHHHHHHHHHHlLLLEEELLLEelll


DSSP  lLLLLLHhHHHHHHHHHHHHHL--LLLLEEEEEeelllllhhhhhhhllllleEEELLll
Query iPPLCNLeDLKAYKMRILKACK--DENFTPLMTlffknydekflysakdeifgIXLYPag  106
ident                   |     |     |                             
Sbjct vYKNEPA-AVREAADQLNKRLIkeDIPLHVLPG--------------------QEIRI--   83
DSSP  lLLLLHH-HHHHHHHHHHHHHHhlLLLLEEELL--------------------LEEEL--


DSSP  llllllllLLLLlhhhhhHHHHH----hhhlLLLEEELLLLLllhhhllhHHHHHHHHHH
Query ittnsnggVSSFdieylkPTLEA----msdlNIPLLVHGETNdfvmdresNFAKIYEKLA  162
ident                     |              |                    | | 
Sbjct --------YGEV-----eQDLAKrqllslndTKYILIEFPFD--------HVPRYAEQLF  122
DSSP  --------LLLH-----hHHHHLlllllhhhLLEEEEELLLL--------LLLLLHHHHH


DSSP  HHLL--LLLEEELLLL-------lHHHHHHHHHLLlEEEEELLHHHL--LLHHhhhllll
Query KHFP--RLKIVMEHIT-------tKTLCELLKDYEnLYATITLHHLI--ITLDdviggkm  211
ident           |  |            |   |         ||   |              
Sbjct YDLQlkGYIPVIAHPErnreirenPSLLYHLVEKG-AASQITSGSLAgiFGKQ-------  174
DSSP  HHHHhlLLEEEEELHHhlhhhhhlLHHHHHHHHLL-LEEEEEHHHHLllLLHH-------


DSSP  lhhhllllllllhHHHHHHHHHhhlllllEEELLLLLLLlllllllLLLHhHHHHHHHHH
Query nphlfckpiakryEDKEALCELafsgyekVMFGSDSAPHpkgcaagVFSApVILPVLAEL  271
ident                   | |            ||                     |  |
Sbjct -----------lkAFSLRLVEA----nliHFVASDAHNV------kTRNF-HTQEALYVL  212
DSSP  -----------hhHHHHHHHHL----lllLEEELLLLLL------lLLLL-LHHHHHHHH


DSSP  HHhHLLHHHHHHHHlHHHHHHHLLlllllleeeeellleelllleelllleellllllle
Query FKqNSSEENLQKFLsDNTCKIYDLkfkedkiltleekewqvpnvyedkynqvvpymagei  331
ident  |     |        |                                           
Sbjct EK-EFGSELPYMLT-ENAELLLRN------------------------------qtifrq  240
DSSP  HH-HHLLHHHHHHH-HHHHHHHLL------------------------------llllll


DSSP  elleell
Query lkfqlkh  338
ident        
Sbjct ppqpvkr  247
DSSP  lllllll


No 49: Query=3pnuA Sbjct=3iacA Z-score=12.0

back to top
DSSP  -----------llllllllLEEE--ELLEEEEELLLLHhHHHH-----------------
Query -----------enlyfqsnAMKL--KNPLDMHLHLRDNqMLEL-----------------   30
ident                              | | ||                         
Sbjct atfxtedfllkndiartlyHKYAapXPIYDFHCHLSPQ-EIADdrrfdnlgqiwlegdhy   59
DSSP  llllllllllllhhhhhhhHHLLllLLEEELLLLLLHH-HHHHllllllhhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   30
ident                                                             
Sbjct kwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlf  119
DSSP  hhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllllllllll


DSSP  ----------------------HHHHHH-LLLLEEEELLlllllLLLHHhhHHHHHHHHH
Query ----------------------IAPLSA-RDFCAAVIMPnlippLCNLEdlKAYKMRILK   67
ident                                                      |   |  
Sbjct gpdtaesiwtqcneklatpafsARGIXQqXNVRXVGTTD-----DPIDS--LEYHRQIAA  172
DSSP  lhhhhhhhhhhhhhhhllhhhlHHHHHHhLLEEEEELLL-----LLLLL--LHHHHHHHH


DSSP  hhLLLLLEEEEEEELL--------------------------------llLHHHHHHHLL
Query acKDENFTPLMTLFFK--------------------------------nyDEKFLYSAKD   95
ident                                                       |     
Sbjct -dDSIDIEVAPSWRPDkvfkieldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAA  231
DSSP  -lLLLLLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHH


DSSP  -LLLEEEELLLllllllllllLLLL-------------------------------HHHH
Query -EIFGIXLYPAgittnsnggvSSFD-------------------------------IEYL  123
ident                                                            |
Sbjct cGCRASDHGIE----------TLRFapvpddaqldailgkrlagetlseleiaqftTAVL  281
DSSP  lLLLEEEEEEL----------LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHH


DSSP  HHHHHHHHHLLLLEEELLLLLL-----------------lHHHLlhHHHHHHHHHHHHLL
Query KPTLEAMSDLNIPLLVHGETND-----------------fVMDResNFAKIYEKLAKHFP  166
ident                 |                         |   |       |     
Sbjct VWLGRQYAARGWVXQLHIGAIRnnntrxfrllgpdtgfdsIGDN--NISWALSRLLDSXD  339
DSSP  HHHHHHHHHHLLEEEEEELEELlllhhhhhhhllllllleELLL--LLHHHHHHHHHHHH


DSSP  ----LLLEEEL---lllLHHHHHHHHHLL------LEEEEEL--lHHHLLlhhhhhllll
Query ----RLKIVME---hitTKTLCELLKDYE------NLYATIT--lHHLIItlddviggkm  211
ident       |             |                                       
Sbjct vtneLPKTILYclnprdNEVLATXIGNFQgpgiagKVQFGSGwwfNDQKD----------  389
DSSP  llllLLEEEEEellhhhHHHHHHHHHHLLllllllLEEELLLlhhHLLHH----------


DSSP  lhhhllllllllhhhHHHHHHH---hhlLLLLEEELLLLLLlllllllllLLHHHHHHHH
Query nphlfckpiakryedKEALCEL---afsGYEKVMFGSDSAPhpkgcaagvFSAPVILPVL  268
ident                     |           |    ||           |         
Sbjct --------------gXLRQLEQlsqxglLSQFVGXLTDSRS---------FLSYTRHEYF  426
DSSP  --------------hHHHHHHHhhhhllHHHLLLLLLLLLL---------LLLLHHHHHH


DSSP  HHHHHHHL---------------LHHHHHHHHLHHHHHHHLllllllleeeeellleell
Query AELFKQNS---------------SEENLQKFLSDNTCKIYDlkfkedkiltleekewqvp  313
ident                             |     |                         
Sbjct RRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-------------------  467
DSSP  HHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-------------------


DSSP  lleelllleellllllleelleell
Query nvyedkynqvvpymageilkfqlkh  338
ident                          
Sbjct -----------------------ik  469
DSSP  -----------------------ll


No 50: Query=3pnuA Sbjct=1v77A Z-score=9.4

back to top
DSSP  llllllllleeeELLEEEEELLLlhhhhhhHHHHHHLLLLEEEELLLlllllLLHHHHHH
Query enlyfqsnamklKNPLDMHLHLRdnqmlelIAPLSARDFCAAVIMPNlipplCNLEDLKA   60
ident                  |               |    |   |            | |  
Sbjct ------------VKFIEMDIRDK------eAYELAKEWFDEVVVSIK-fneeVDKEKLRE   41
DSSP  ------------LLLEEEEELLH------hHHHHHHHHLLEEEEEEE-elllLLHHHHHH


DSSP  HHHHhhhhhllllleEEEEeelllllhhhhhhhlllllEEEELLllllllllllllLLLH
Query YKMRilkackdenftPLMTlffknydekflysakdeifGIXLYPagittnsnggvsSFDI  120
ident                                        | |                  
Sbjct ARKE-----------YGKV-------------------AILLSN-----------pKPSL   60
DSSP  HHHH-----------HLLE-------------------EEEEEL-----------lLHHH


DSSP  hhhHHHHHHHHhlLLLEEELLLllllhhhllhhHHHHHHHHHHHlllLLEEELLLL----
Query eylKPTLEAMSdlNIPLLVHGEtndfvmdresnFAKIYEKLAKHfprLKIVMEHIT----  176
ident      |            |                                         
Sbjct --vRDTVQKFK--SYLIYVESN-----------DLRVIRYSIEK---GVDAIISPWvnrk  102
DSSP  --hHHHHHHLL--LLEEEEELL-----------LHHHHHHHHHL---LLLEEELLLllll


DSSP  LHHHHH-HHHH--LLLEEEEELLHHHLLLHHHHhlllllhhhllllllLLHHHHHHHHHH
Query TKTLCE-LLKD--YENLYATITLHHLIITLDDViggkmnphlfckpiaKRYEDKEALCEL  233
ident        | |     |      |  |                                 |
Sbjct DPGIDHvLAKLmvKKNVALGFSLRPLLYSNPYE-------------raNLLRFMMKAWKL  149
DSSP  LLLLLHhHHHHhhHHLLEEEEELHHHHHLLHHH-------------hhHHHHHHHHHHHH


DSSP  hhllLLLEEELLLLLLlllllllllLLHHhHHHHHHHHHH-hHLLHHHHHHHHLHHHHHH
Query afsgYEKVMFGSDSAPhpkgcaagvFSAPvILPVLAELFK-qNSSEENLQKFLSDNTCKI  292
ident            |                      |  |               |     |
Sbjct vekyKVRRFLTSSAQE--------kWDVR-YPRDLISLGVviGMEIPQAKASISMYPEII  200
DSSP  hhhhLLLEEEELLLLL--------hHHLL-LHHHHHHHHHhlLLLHHHHHHLLLHHHHHH


DSSP  HLllllllleeeeellleelllleelllleellllllleelleell
Query YDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                               
Sbjct LK--------------------------------------------  202
DSSP  HL--------------------------------------------


No 51: Query=3pnuA Sbjct=2a3lA Z-score=9.0

back to top
DSSP  ------LLLLLL------------------------------------------------
Query ------ENLYFQ------------------------------------------------    6
ident                                                             
Sbjct qpdpiaADILRKepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllLLLLLLllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    6
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------------llLEEE-ELLEEEEELLL--------
Query ----------------------------------snAMKL-KNPLDMHLHLR--------   23
ident                                              | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphRDFYnVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllLLLLlLLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   23
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  ---------------------------LHHHHHHHHHHH-hLLLLEEEELLL--lllllL
Query ---------------------------DNQMLELIAPLS-aRDFCAAVIMPN--lipplC   53
ident                                               |             
Sbjct nlkynpcgqsrlreiflkqdnliqgrfLGEITKQVFSDLeaSKYQMAEYRISiygrkmsE  300
DSSP  hhhhllllllhhhhhhlllllllllllHHHHHHHHHHHHllLLLEEEEEEEElllllllH


DSSP  LHHHHHHH-hHHHHhhhllllLEEEEEEEL--------------------llLLHHHHHH
Query NLEDLKAY-kMRILkackdenFTPLMTLFF--------------------knYDEKFLYS   92
ident                                                             
Sbjct WDQLASWIvnNDLY------sENVVWLIQLprlyniykdmgivtsfqnildnIFIPLFEA  354
DSSP  HHHHHHHHhlLLLL------lLLEEEEEEEellhhhhlllllllllhhhhhhHLLHHHHH


DSSP  ------------hLLLLLEEEELlLLLL------------------lllllllLLLLHhh
Query ------------aKDEIFGIXLYpAGIT------------------tnsnggvSSFDIey  122
ident                   |  |                                      
Sbjct tvdpdshpqlhvfLKQVVGFDLV-DDESkperrptkhmptpaqwtnafnpafsYYVYY-c  412
DSSP  hhlhhhllllhhhHLLEEEEEEE-LLLLlllllllllllllllllllllllhhHHHHH-h


DSSP  HHHHHHHHHHL------LLLEEELLLllllhhhLLHHHHHHHHHHhhhlllllEEELLLL
Query LKPTLEAMSDL------NIPLLVHGEtndfvmdRESNFAKIYEKLakhfprlkIVMEHIT  176
ident                   | |  |                                 |  
Sbjct YANLYVLNKLReskgmtTITLRPHSG-----eaGDIDHLAATFLT-------cHSIAHGI  460
DSSP  HHHHHHHHHHHllllllLLEELLLLL-----llLLLHHHHHHHHH-------lLLLLLLH


DSSP  LHH----hHHHHHHLLlEEEEELLHHhlllhhhhhlllllhhhllllLLLLhhhHHHHHH
Query TKT----lCELLKDYEnLYATITLHHliitlddviggkmnphlfckpIAKRyedKEALCE  232
ident           |                                                 
Sbjct NLRkspvlQYLYYLAQ-IGLAMSPLS------------------nnsLFLD-yhRNPFPV  500
DSSP  HHHhlhhhHHHHHHHL-LLEEELHHH------------------hllLLLL-llLLLHHH


DSSP  HHHllLLLEEELLLLLllllllllLLLL--hHHHHHHHHHHHHH-HLLHHHHHHHhLHHH
Query LAFsgYEKVMFGSDSAphpkgcaaGVFS--aPVILPVLAELFKQ-NSSEENLQKFlSDNT  289
ident         |    |                                 |   |      | 
Sbjct FFL-rGLNVSLSTDDP--------LQIHltkEPLVEEYSIAASVwKLSACDLCEI-ARNS  550
DSSP  HHH-lLLLEEELLLLH--------HHHLlllLHHHHHHHHHHHHhLLLHHHHHHH-HHHH


DSSP  HHH-HLLL--LLLL--------------leeeeellleelllleelllleelllllllee
Query CKI-YDLK--FKED--------------kiltleekewqvpnvyedkynqvvpymageil  332
ident                                                             
Sbjct VYQsGFSHalKSHWigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavi  610
DSSP  HHHlLLLHhhHHHHlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllll


DSSP  lleell
Query kfqlkh  338
ident       
Sbjct sdevvp  616
DSSP  llllll


No 52: Query=3pnuA Sbjct=3au2A Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ---------------------------------------------------LLLL-----
Query ---------------------------------------------------ENLY-----    4
ident                                                    |        
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarsllEAIRalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhHHHHlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    4
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    4
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------------llllleeeelLEEEEELLLLhhhhhhHHHHHHL
Query ---------------------------fqsnamklknPLDMHLHLRDnqmlelIAPLSAR   37
ident                                        |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTY-sdgqnTLEELWE  359
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLL-lllllLHHHHHH


DSSP  LL-----LEEEELLL-----lLLLLlLHHHHHHHHHHHHHHHLLLL-LEEE-EEEELLL-
Query DF-----CAAVIMPN-----lIPPLcNLEDLKAYKMRILKACKDEN-FTPL-MTLFFKN-   84
ident                             |        |            |         
Sbjct AAktmgyRYLAVTDHspavrvAGGP-SPEEALKRVGEIRRFNETHGpPYLLaGAEVDIHp  418
DSSP  HHhhhllLEEEEEEElhhhhlLLLL-LHHHHHHHHHHHHHHHHHHLlLEEEeEEEEELLl


DSSP  -llhhhHHHHLLLL-LEEEELllllllllllLLLL-----lLHHHHHHHHHHHhhlLLLE
Query -ydekfLYSAKDEI-FGIXLYpagittnsngGVSS-----fDIEYLKPTLEAMsdlNIPL  137
ident             |                                |   ||         
Sbjct dgtldyPDWVLRELdLVLVSV----------HSRFnlpkadQTKRLLKALENP---FVHV  465
DSSP  llllllLHHHHLLLlEEEEEL----------LLLLlllhhhHHHHHHHHHLLL---LLLE


DSSP  EELLL-LLLLHHHLlhhhhHHHHHHHHHLLLLLEEELL-------LLLHHHHHHHHHLLl
Query LVHGE-TNDFVMDResnfaKIYEKLAKHFPRLKIVMEH-------ITTKTLCELLKDYEn  189
ident | |                   |             |             |         
Sbjct LAHPTaRLLGRRAP---ieADWEAVFQKAKEKGVAVEIdgyydrmDLPDDLARMAYGMG-  521
DSSP  ELLLLlLLLLLLLL---llLLHHHHHHHHHHHLLEEEEellllllLLLHHHHHHHHHLL-


DSSP  EEEEEL-----------LHHHlllhhhhhlllllhhhllllllllhhhhHHHHHhhhlLL
Query LYATIT-----------LHHLiitlddviggkmnphlfckpiakryedkEALCElafsGY  238
ident |                                                         | 
Sbjct LWISLStdahqtdhlrfMELA---------------------------vGTAQR-awiGP  553
DSSP  LLEEEElllllhhhhhhHHHH---------------------------hHHHHH-lllLL


DSSP  LLEEElllllllllllllllllhhhhhhhhhhhhhhhllhhhhhhHHLH-HHHHHHLLll
Query EKVMFgsdsaphpkgcaagvfsapvilpvlaelfkqnsseenlqkFLSD-NTCKIYDLkf  297
ident | |                                           |             
Sbjct ERVLN----------------------------------------TLDYeDLLSWLKA--  571
DSSP  LLLHH----------------------------------------HLLHhHHHHHHHL--


DSSP  lllleeeeellleelllleelllleellllllleelleell
Query kedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                          
Sbjct -------------------------------------rrgv  575
DSSP  -------------------------------------llll


No 53: Query=3pnuA Sbjct=3dcpA Z-score=7.5

back to top
DSSP  llllllllleeeeLLEEEEELLL-----lhhHHHHHHHHHH-LLLLEEEELLL-------
Query enlyfqsnamklkNPLDMHLHLR-----dnqMLELIAPLSA-RDFCAAVIMPN-------   47
ident                 | | |            |         ||    |          
Sbjct -------------XKRDGHTHTEfcphgthdDVEEXVLKAIeLDFDEYSIVEHaplssef   47
DSSP  -------------LLEEEEELLLllllllllLHHHHHHHHHhLLLLEEEEEEEllllhhh


DSSP  -----------llLLLL--LHHHHHHHHHHHHHHHLLLlLEEEEEeelllllhhhhhhhl
Query -----------liPPLC--NLEDLKAYKMRILKACKDEnFTPLMTlffknydekflysak   94
ident                     |         | |                           
Sbjct xkntagdkeavttASXAxsDLPYYFKKXNHIKKKYASD-LLIHIG---------------   91
DSSP  hhllllllhhhhlLLLLhhHHHHHHHHHHHHHHHLLLL-LEEEEE---------------


DSSP  lllleEEELLllllllllllLLLLLHhhhhHHHHHhhhllllEEELLLLLL---------
Query deifgIXLYPagittnsnggVSSFDIeylkPTLEAmsdlnipLLVHGETND---------  145
ident                                 |                           
Sbjct -----FEVDY----------LIGYED-ftrDFLNEygpqtddGVLSLHFLEgqggfrsid  135
DSSP  -----EEEEL----------LLLLHH-hhhHHHHHhhhhlleEEEELLEEEelleeeell


DSSP  ------------------LHHHLLHHH-HHHHHHHhhhlLLLL-EEELLLL---------
Query ------------------FVMDRESNF-AKIYEKLakhfPRLK-IVMEHIT---------  176
ident                                 |         |     ||          
Sbjct fsaedynegivqfyggfeQAQLAYLEGvKQSIEAD---lGLFKpRRXGHISlcqkfqqff  192
DSSP  llhhhhhhhlhhhhllhhHHHHHHHHHhHHHHHLL---lLLLLlLEELLLLhhhllhhhh


DSSP  --------------LHHHHHHHHHLLlEEEEELLHHHLLlhhhhhlllllHHHLllllll
Query --------------TKTLCELLKDYEnLYATITLHHLIItlddviggkmnPHLFckpiak  222
ident                     | |             |             |         
Sbjct gedtsdfseevxekFRVILALVKKRD-YELDFNTAGLFK-----------PLCG------  234
DSSP  lllhhhllhhhhhhHHHHHHHHHHHL-LEEEEELHHHHL-----------LLLL------


DSSP  lhhhhhhHHHHHHLLL---LLEEELLLLLLlllllllllLLHHHHHHHHHHHHHhhllhh
Query ryedkeaLCELAFSGY---EKVMFGSDSAPhpkgcaagvFSAPVILPVLAELFKqnssee  279
ident                         ||||                                
Sbjct ---etypPKKIVTLASelqIPFVYGSDSHG--------vQDIGRGYSTYCQKLE------  277
DSSP  ---llllLHHHHHHHHhllLLEEEELLLLL--------hHHLLLLHHHHHHHLL------


DSSP  hhhhhhlhhhhhhhlllllllleeeeellleelllleelllleellllllleelleell
Query nlqkflsdntckiydlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
ident                                                            
Sbjct -----------------------------------------------------------  277
DSSP  -----------------------------------------------------------


No 54: Query=3pnuA Sbjct=1m65A Z-score=7.3

back to top
DSSP  llllllllleeeelLEEEEeLLLL-----HHHHhHHHHHHHL--LLLEEEELLL---lLL
Query enlyfqsnamklknPLDMHlHLRD-----NQMLeLIAPLSAR--DFCAAVIMPN---lIP   50
ident               | | |             |       |         |         
Sbjct -------------yPVDLH-MHTVasthaYSTL-SDYIAQAKqkGIKLFAITDHgpdmED   45
DSSP  -------------lLEELL-LLLLlllllLLLH-HHHHHHHHhhLLLEEEEEEEllllLL


DSSP  LLlLHHHHHHhHHHHHhhhllLLLEEEEEE-ELLL---llhhhHHHHLLLLLEEEELLll
Query PLcNLEDLKAyKMRILkackdENFTPLMTL-FFKN---ydekfLYSAKDEIFGIXLYPag  106
ident                           |                     |    |      
Sbjct AP-HHWHFIN-MRIWP--rvvDGVGILRGIeANIKnvdgeidcSGKMFDSLDLIIAGF--   99
DSSP  LL-LLHHHHH-HHHLL--leeLLEEEEEEEeEELLllllllllLHHHHHHLLEEEEEL--


DSSP  llllLLLLLL------LLLHhhhhhhHHHHhhlllLEEEL-LLLLLlhhhllhHHHHHHH
Query ittnSNGGVS------SFDIeylkptLEAMsdlniPLLVH-GETNDfvmdresNFAKIYE  159
ident                                                         |   
Sbjct ----HEPVFAphdkatNTQA-miatiASGN-----VHIIShPGNPK-----yeIDVKAVA  144
DSSP  ----LLLLLLlllhhhHHHH-hhhhhHLLL-----LLEELlLLLLL-----llLLHHHHH


DSSP  HHHhhllLLLEEELLL---lLHHHHHHHHHLLlEEEEE------------LLHHHlllhh
Query KLAkhfpRLKIVMEHI---tTKTLCELLKDYEnLYATI------------TLHHLiitld  204
ident   |          |               |                        |     
Sbjct EAA---aKHQVALEINnssnCREVAAAVRDAG-GWVALgsdshtaftmgeFEECL-----  195
DSSP  HHH---hHHLLEEEEEllllHHHHHHHHHHHL-LLEEEelllllhhhlllLHHHH-----


DSSP  hhhlllllhhhllllllllhhhhHHHHHhhhllLLLEEElllllllllllllllllhhhh
Query dviggkmnphlfckpiakryedkEALCElafsgYEKVMFgsdsaphpkgcaagvfsapvi  264
ident                          |        |                         
Sbjct -----------------------KILDA-vdfpPERILN---------------------  210
DSSP  -----------------------HHHHH-llllHHHLHH---------------------


DSSP  hhhhhhhhhhhllhhhhhhHHLHHHHHHHL-------lLLLLLleeeeellleellllee
Query lpvlaelfkqnsseenlqkFLSDNTCKIYD-------lKFKEDkiltleekewqvpnvye  317
ident                                        |                    
Sbjct -------------------VSPRRLLNFLEsrgmapiaEFADL-----------------  234
DSSP  -------------------HLHHHHHHHHHhllllllhHHLLL-----------------


DSSP  lllleellllllleelleell
Query dkynqvvpymageilkfqlkh  338
ident                      
Sbjct ---------------------  234
DSSP  ---------------------


No 55: Query=3pnuA Sbjct=3f2bA Z-score=7.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -----------------------------------lllllllllEEEELLEEEEELLL--
Query -----------------------------------enlyfqsnaMKLKNPLDMHLHLR--   23
ident                                                      |||    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtaPEGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllLLLLLLLLLLLLLLll


DSSP  ---lhhHHHHHHHHHHLL-LLEEEELLLlllllllhhhhhHHHHHHHHHHLLLLLEEEEE
Query ---dnqMLELIAPLSARD-FCAAVIMPNlipplcnledlkAYKMRILKACKDENFTPLMT   79
ident                      |                          | |         
Sbjct qmdavtSVTKLIEQAKKWgHPAIAVTDH---------avvQSFPEAYSAAKKHGMKVIYG  171
DSSP  llllllLHHHHHHHHHHLlLLLEEELLL---------lllLLHHHHHHHHHHHLLLEEEE


DSSP  EelllllhhhhhhhllllleeEELL---------------------------lllllllL
Query LffknydekflysakdeifgiXLYP---------------------------agittnsN  112
ident |                                                           
Sbjct L--------------------EANIvddpfhvtllaqnetglknlfklvslshiqyfhrV  211
DSSP  E--------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhllllllL


DSSP  LLLLlllhhhhHHHHHHHhhLLLLEeelllllllhhhllhhhhhhhhhhhhhllllleEE
Query GGVSsfdieylKPTLEAMsdLNIPLlvhgetndfvmdresnfakiyeklakhfprlkiVM  172
ident                                                             
Sbjct PRIP------rSVLVKHR--DGLLV---------------------------------GS  230
DSSP  LLEE------hHHHHHLL--LLEEE---------------------------------EL


DSSP  LLLllhhHHHHHHH-LLLE-EEEELLHHhLLLHHhhhlllllhhhllllllLLHHHHHHH
Query EHIttktLCELLKD-YENL-YATITLHHlIITLDdviggkmnphlfckpiaKRYEDKEAL  230
ident        |     |                  |                       |   
Sbjct GCD-kgeLFDNVEDiARFYdFLEVHPPDvYKPLY---------------vkDEEMIKNII  274
DSSP  LLL-lllLLLLLLLlHHHLlLEEELLHHhHLLLL---------------llLHHHHHHHH


DSSP  HHHH---hlllLLEEELLLLLL-----LLLLL----------------LLLLLLhhHHHH
Query CELA---fsgyEKVMFGSDSAP-----HPKGC----------------AAGVFSapVILP  266
ident              |                                     |        
Sbjct RSIValgekldIPVVATGNVHYlnpedKIYRKilihsqgganplnrheLPDVYF--RTTN  332
DSSP  HHHHhhhhhllLLEEELLLLLLllhhhHHHHHhhhhllhhhlllllllLLLLLL--LLHH


DSSP  HHHHHHHhHLLHHHHHHHHLHHHHHH-HLLL-----------------------------
Query VLAELFKqNSSEENLQKFLSDNTCKI-YDLK-----------------------------  296
ident      |      |       ||| ||                                  
Sbjct EMLDCFS-FLGPEKAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeiremsyrra  391
DSSP  HHHHHHH-HHHHHHHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  296
ident                                                             
Sbjct keiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfv  451
DSSP  hhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  296
ident                                                             
Sbjct atmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfe  511
DSSP  hhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellllllh


DSSP  -----------------------------------------------------lllllee
Query -----------------------------------------------------fkedkil  303
ident                                                             
Sbjct tflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkaya  571
DSSP  hhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhh


DSSP  eeellleelllleelLLLE-----------------------------------------
Query tleekewqvpnvyedKYNQ-----------------------------------------  322
ident                                                             
Sbjct sdhnlelrgaeidrlAAGCtgvkrttgqhpggiivvpdymeiydftpiqypaddtssewr  631
DSSP  hhllllllhhhhhhhHHHHllleeeeeeeeeeeeellllllhhhllleelhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  322
ident                                                             
Sbjct tthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgv  691
DSSP  eeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  322
ident                                                             
Sbjct tpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqn  751
DSSP  lhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  322
ident                                                             
Sbjct gtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyi  811
DSSP  llllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  322
ident                                                             
Sbjct dsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaai  871
DSSP  hhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  322
ident                                                             
Sbjct rkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslip  931
DSSP  hhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeel


DSSP  -----------------------------------------------ellllllleelle
Query -----------------------------------------------vvpymageilkfq  335
ident                                                             
Sbjct pfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnql  991
DSSP  lhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllllll


DSSP  ell
Query lkh  338
ident    
Sbjct slf  994
DSSP  lll


No 56: Query=3pnuA Sbjct=1bksA Z-score=6.6

back to top
DSSP  --llllllllleeeellEEEEELLLL---HHHHHHHHHHHHLLLLEEEELLLLLLL----
Query --enlyfqsnamklknpLDMHLHLRD---NQMLELIAPLSARDFCAAVIMPNLIPP----   51
ident                                    |          |             
Sbjct meryenlfaqlndrregAFVPFVTLGdpgIEQSLKIIDTLIDAGADALELGVPFSDplad   60
DSSP  lhhhhhhhhhhhhllllEEEEEEELLlllHHHHHHHHHHHHHLLLLLEEEELLLLLllll


DSSP  --------------lllHHHHHHHHHHHHhhhlllllEEEEEEELLL------lLHHHHH
Query --------------lcnLEDLKAYKMRILkackdenfTPLMTLFFKN------yDEKFLY   91
ident                            |         |    |              |  
Sbjct gptiqnanlrafaagvtPAQCFEMLALIR----ekhpTIPIGLLMYAnlvfnngIDAFYA  116
DSSP  lhhhhhhhhhhhhhlllHHHHHHHHHHHH----hhllLLLEEEEELHhhhhlllHHHHHH


DSSP  HHLL-LLLEEEELlllllllllllLLLLLhhHHHHHHHHHHHLLLLEEELLLllllhhhl
Query SAKD-EIFGIXLYpagittnsnggVSSFDieYLKPTLEAMSDLNIPLLVHGEtndfvmdr  150
ident                                   |   |    ||               
Sbjct RCEQvGVDSVLVA-----------DVPVE--ESAPFRQAALRHNIAPIFICP--------  155
DSSP  HHHHhLLLEEEEL-----------LLLHH--HLHHHHHHHHHLLLEEEEEEL--------


DSSP  LHHHHHHHHHHHHHllllLEEELLL--lLHHHHHHHHHLLLEEEEEL------lHHHLll
Query ESNFAKIYEKLAKHfprlKIVMEHI--tTKTLCELLKDYENLYATIT------lHHLIit  202
ident            |                   | | || |    |                
Sbjct PNADDDLLRQVASY---gRGYTYLLalpLHHLIEKLKEYHAAPALQGfgisspeQVSA--  210
DSSP  LLLLHHHHHHHHHH---lLLLEEELlllHHHHHHHHHHHLLLLEEELlllllhhHHHH--


DSSP  hhhhhlllllhhhllllllllhhhhhhHHHHhhlllllEEELLLLL---LLLL-------
Query lddviggkmnphlfckpiakryedkeaLCELafsgyekVMFGSDSA---PHPK-------  252
ident                                           | ||      |       
Sbjct --------------------------aVRAG------aAGAISGSAivkIIEKnlaspkq  238
DSSP  --------------------------hHHHL------lLEEEELLHhhhHHHHllllhhh


DSSP  lllllllLHHHHHHHHHhhhhhhllhhhhhhhhlhhhhhhhlllllllleeeeellleel
Query gcaagvfSAPVILPVLAelfkqnsseenlqkflsdntckiydlkfkedkiltleekewqv  312
ident                                                             
Sbjct mlaelrsFVSAMKAASR-------------------------------------------  255
DSSP  hhhhhhhHHHHHHHLLL-------------------------------------------


DSSP  llleelllleellllllleelleell
Query pnvyedkynqvvpymageilkfqlkh  338
ident                           
Sbjct --------------------------  255
DSSP  --------------------------


No 57: Query=3pnuA Sbjct=3e38A Z-score=5.8

back to top
DSSP  llllllllLEEE-----ELLEEEEELLL---lhhHHHHHHHHHHL-LLLEEEELLL---L
Query enlyfqsnAMKL-----KNPLDMHLHLR---dnqMLELIAPLSAR-DFCAAVIMPN---L   48
ident                      | | |                  |    |          
Sbjct -aqrrneiQVPDldgytTLKCDFHXHSVfsdglvWPTVRVDEAYRdGLDAISLTEHieyR   59
DSSP  -lllllllLLLLlllleEEEEELLLLLLllllllLHHHHHHHHHHlLLLEELLEEElllL


DSSP  LLLlllhHHHHHHHHHHHHHHLLLLLEEEEEEELLlllhhhhhhhllllleeeellllll
Query IPPlcnlEDLKAYKMRILKACKDENFTPLMTLFFKnydekflysakdeifgixlypagit  108
ident         |                                                   
Sbjct PHKqdvvSDHNRSFDLCREQAEKLGILLIKGSEIT-------------------------   94
DSSP  LLLllllLLLLHHHHHHHHHHHHHLLEELLEEEEE-------------------------


DSSP  lllllLLLLL--------------lhhHHHHHHHHHHHLLLLEEEL-LLLLL-lHHHLlh
Query tnsngGVSSF--------------dieYLKPTLEAMSDLNIPLLVH-GETND-fVMDRes  152
ident                              |                              
Sbjct -----RAXAPghfnaiflsdsnpleqkDYKDAFREAKKQGAFXFWNhPGWDSqqPDTT--  147
DSSP  -----LLLLLleeeeelllllhhhlllLHHHHHHHHHHLLLEEEELlLLLLLllLLLL--


DSSP  hHHHH-HHHHHHHLllLLEEELLL----LLHHHHHHHHHLLlEEEEEllhhhlllhhhhh
Query nFAKI-YEKLAKHFprLKIVMEHI----TTKTLCELLKDYEnLYATItlhhliitlddvi  207
ident          |           |                |   |                 
Sbjct -KWWPeHTALYQEG--CXHGIEVAnghlYXPEAIQWCLDKN-LTXIG-------------  190
DSSP  -LLLHhHHHHHHLL--LLLEEEEEelleELLHHHHHHHHHL-LEEEE-------------


DSSP  lllllhhhllllllllhhhhhhhhhhhhllllleeeLLLLLLLllllllllllhhhhhhh
Query ggkmnphlfckpiakryedkealcelafsgyekvmfGSDSAPHpkgcaagvfsapvilpv  267
ident                                      ||                     
Sbjct ------------------------------------TSDIHQP-----------------  197
DSSP  ------------------------------------ELLLLLL-----------------


DSSP  hhhhhhhhllhhhhhhhHLHH--------HHHHHL-------------------------
Query laelfkqnsseenlqkfLSDN--------TCKIYD-------------------------  294
ident                                                             
Sbjct -iqtdydfekgehrtxtFVFAkerslqgiREALDNrrtaayfhelligredllrpffekc  256
DSSP  -hhhhllhhhllllleeEEEEllllhhhhHHHHHLlleeeeelleeellhhhhhhhhhhh


DSSP  ----------llllllleeeEELLleelllleelllleellllllLEELL----------
Query ----------lkfkedkiltLEEKewqvpnvyedkynqvvpymagEILKF----------  334
ident                                                ||           
Sbjct vkieevsrneqgvtlsitnvTDLV----lklkktahdtllvyfrdXTLKPhtrytvrigf  312
DSSP  eeeeeeeeelleeeeeeeelLLLL----eeeeelllllleellleEEELLleeeeeeeee


DSSP  --------------------------eell
Query --------------------------qlkh  338
ident                               
Sbjct kqgikggdvnfevtnfivapdkglkytisl  342
DSSP  llllllleeeeeeeeeeeelleeeeeeeel


No 58: Query=3pnuA Sbjct=2anuA Z-score=5.0

back to top
DSSP  llllllllleEEELLEEEEELLL---lhhHHHHHHHHHHL-LLLEEEELLL---------
Query enlyfqsnamKLKNPLDMHLHLR---dnqMLELIAPLSAR-DFCAAVIMPN---------   47
ident                 | | |         |     |          |            
Sbjct ----------TEWLLCDFHVHTNxsdghlPLGEVVDLFGKhGVDVVSITDHivdrrtleq   50
DSSP  ----------LEEEEEEEEELLLllllllLHHHHHHHHHHlLLLEEEEEEEeelhhhhhh


DSSP  ------lLLLLL---LHHHHHHHHHHHHHHHLLLLLEEEEEEelllllhhhhhhhlllll
Query ------lIPPLC---NLEDLKAYKMRILKACKDENFTPLMTLffknydekflysakdeif   98
ident                    ||        |                              
Sbjct rkrngepLGAITedkFQDYLKRLWREQKRAWEEYGXILIPGV------------------   92
DSSP  hhhllllLLLLLlllHHHHHHHHHHHHHHHHHHHLLEEEEEE------------------


DSSP  eeEELLLL--------llllllLLLLlllhhhhhHHHHHHHHLL---LLEEELllllllh
Query giXLYPAG--------ittnsnGGVSsfdieylkPTLEAMSDLN---IPLLVHgetndfv  147
ident                                   |  |    |                 
Sbjct --EITNNTdlyhivavdvkeyvDPSL--------PVEEIVEKLKeqnALVIAA-----hp  137
DSSP  --EEEELLlleeeeeellllllLLLL--------LHHHHHHHHHhllLEEEEL-----ll


DSSP  hhllHHHHhHHHHhHHHLLLLLEEelllllhhhhhhhhhllleEEEELLHHHlllhhhhh
Query mdreSNFAkIYEKlAKHFPRLKIVmehittktlcellkdyenlYATITLHHLiitlddvi  207
ident                  |                                 |        
Sbjct drkkLSWY-LWAN-XERFKDTFDA-------------------WEIANRDDL--------  168
DSSP  llllLLLH-HHHL-LLLLLLLLLE-------------------EEEEELLEE--------


DSSP  lllllhhhllllllllhhhhhhHHHHhhllllLEEELLLLLLLllllllllLLHHhhhhh
Query ggkmnphlfckpiakryedkeaLCELafsgyeKVMFGSDSAPHpkgcaagvFSAPvilpv  267
ident                                      ||                     
Sbjct ----------------------FNSV-gvkkyRYVANSDFHEL--------WHVY-----  192
DSSP  ----------------------LHHH-hhlllLEEEELLLLLH--------HHHL-----


DSSP  hhhhhhhhllhhhhhhhHLHH--------hHHHHLllllllleeeeellleelllleell
Query laelfkqnsseenlqkfLSDN--------tCKIYDlkfkedkiltleekewqvpnvyedk  319
ident                                 |                           
Sbjct --------------swkTLVKseknieaikEAIRK-------------------------  213
DSSP  --------------leeEEEEelllhhhhhHHHHH-------------------------


DSSP  lleellllllleelleell
Query ynqvvpymageilkfqlkh  338
ident                    
Sbjct --------ntdvaiylxrk  224
DSSP  --------llleeeeelll


No 59: Query=3pnuA Sbjct=2yb1A Z-score=4.2

back to top
DSSP  llllllllleeeeLLEEEEELLLL---hhHHHHHHHHHHL-LLLEEEELLLlllllllhh
Query enlyfqsnamklkNPLDMHLHLRD---nqMLELIAPLSAR-DFCAAVIMPNlipplcnle   56
ident                 | | | |               |                     
Sbjct -------------ANIDLHFHSRTsdgalTPTEVIDRAAArAPALLALTDH---------   38
DSSP  -------------LLEELLLLLLLlllllLHHHHHHHHHLlLLLEEEELLL---------


DSSP  hhhhHHHHHHHHHLLLLLEEEEEEelllllhhhhhhhllllleeEELLL-----------
Query dlkaYKMRILKACKDENFTPLMTLffknydekflysakdeifgiXLYPA-----------  105
ident            |        |                                       
Sbjct dctgGLAEAAAAAARRGIPFLNGV--------------------EVSVSwgrhtvhivgl   78
DSSP  llllLHHHHHHHHHHLLLLEEEEE--------------------EEEEEelleeeeeeee


DSSP  -------lllllLLLL--------------------------------------------
Query -------gittnSNGG--------------------------------------------  114
ident                                                             
Sbjct gidpaepalaagLKSIregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfar  138
DSSP  llllllhhhhhhHHHHhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhh


DSSP  ------------------------------LLLLlhhhhhhhHHHHHHLLLLEEELllll
Query ------------------------------VSSFdieylkptLEAMSDLNIPLLVHgetn  144
ident                                 |                           
Sbjct hlvdsgavkdmrtvfrkyltpgkpgyvshqWASL-----edaVGWIVGAGGMAVIA---h  190
DSSP  hhhhllllllhhhhhhhlllllllllllllLLLH-----hhhHHHHHHLLLEEEEL---l


DSSP  llhhHLLH-HHHHHHHHHHHHLlllLEEElllllhhhhhhhhhllleeEEELLHHHlllh
Query dfvmDRES-NFAKIYEKLAKHFprlKIVMehittktlcellkdyenlyATITLHHLiitl  203
ident     |                                                 |     
Sbjct pgryDMGRtLIERLILDFQAAG---GQGI-------------------EVASGSHS----  224
DSSP  hhhlLLLHhHHHHHHHHHHHLL---LLEE-------------------EEEELLLL----


DSSP  hhhhlllllhhhllllllllhhhHHHHHHHH---hllllLEEELLLLLLLLllllllLLL
Query ddviggkmnphlfckpiakryedKEALCELA---fsgyeKVMFGSDSAPHPkgcaagVFS  260
ident                               |            |||              
Sbjct -----------------------LDDMHKFAlhadrhglYASSGSDFHAPG------EDV  255
DSSP  -----------------------HHHHHHHHhhhhhhllEEEEELLLLLLL------LLL


DSSP  HhhhhhhhhhhhhhhllhhhhhhhhlhHHHHHHLLlllllleeeeellleelllleelll
Query ApvilpvlaelfkqnsseenlqkflsdNTCKIYDLkfkedkiltleekewqvpnvyedky  320
ident                                                             
Sbjct G----------------htedlppicrPIWRELEA-------------------------  274
DSSP  L----------------llllllllllLHHHHLHH-------------------------


DSSP  leellllllleelleell
Query nqvvpymageilkfqlkh  338
ident                   
Sbjct --------rilrpadaen  284
DSSP  --------hlllllhhhl