Results: dupa

Query: 3ooqA

MOLECULE: AMIDOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3ooq-A 70.6  0.0  384   384  100 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   2:  3mkv-A 26.7  2.8  288   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   3:  3mtw-A 26.0  3.1  295   404   23 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   4:  4cqb-A 25.1  3.3  288   402   18 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   5:  3icj-A 24.5  3.0  277   468   20 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
   6:  2paj-A 24.5  2.8  277   421   16 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   7:  1onx-A 24.5  3.0  281   390   24 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   8:  1j6p-A 24.2  2.9  279   407   18 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   9:  3ls9-A 24.2  2.7  279   453   16 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  10:  2oof-A 23.9  3.2  283   403   18 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  11:  4c5y-A 23.4  3.1  284   436   19 PDB  MOLECULE: OCHRATOXINASE;                                             
  12:  3giq-A 23.2  3.2  281   475   17 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  13:  2vun-A 22.9  3.0  271   385   18 PDB  MOLECULE: ENAMIDASE;                                                 
  14:  1gkp-A 22.9  3.2  290   458   21 PDB  MOLECULE: HYDANTOINASE;                                              
  15:  1k6w-A 22.8  3.3  281   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  16:  3e74-A 22.8  3.0  273   429   23 PDB  MOLECULE: ALLANTOINASE;                                              
  17:  2uz9-A 22.7  3.3  278   444   19 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  18:  1yrr-B 22.5  3.1  267   334   15 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  19:  3gri-A 22.3  3.3  280   422   20 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  3nqb-A 22.0  3.0  267   587   19 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  21:  4b3z-D 21.6  3.3  286   477   20 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  22:  4rdv-B 20.1  3.3  273   451   17 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  23:  2ogj-A 18.6  3.7  267   379   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  1a5k-C 16.8  3.0  268   566   21 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  25:  2imr-A 14.9  5.4  249   380   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  26:  2ffi-A 13.4  3.1  196   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  27:  1bf6-A 13.4  3.4  194   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  28:  2y1h-B 13.3  3.3  200   265   17 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  29:  2ob3-A 13.2  3.1  188   329   21 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  30:  3k2g-B 12.8  3.5  202   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  31:  1a4m-A 12.5  3.2  201   349   16 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  32:  4dlf-A 12.3  3.5  200   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  33:  3irs-A 12.2  3.5  190   281   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  34:  3pnu-A 12.2  4.0  219   338   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  35:  2vc5-A 11.7  3.5  188   314   23 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  36:  3cjp-A 11.6  3.0  177   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  37:  2dvt-A 11.5  3.8  198   325   15 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  38:  1v77-A 11.3  3.3  171   202   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  39:  3gg7-A 11.1  3.4  185   243   11 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  40:  4qrn-A 10.8  3.6  193   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  41:  2qpx-A 10.8  4.3  207   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  42:  4ofc-A 10.4  3.7  194   335   18 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  43:  4mup-B 10.3  3.8  195   286   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  44:  1itq-A  9.9  3.7  196   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  45:  4hk5-D  9.8  3.6  188   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  46:  3qy6-A  9.7  3.8  176   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  2gwg-A  9.7  4.1  191   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  48:  2a3l-A  9.7  4.1  217   616   15 PDB  MOLECULE: AMP DEAMINASE;                                             
  49:  4dzi-C  9.1  3.3  176   388   14 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  50:  1j5s-A  7.6  3.7  178   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  51:  3au2-A  7.5  8.3  169   575   15 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  52:  3dcp-A  7.3  3.5  159   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  1m65-A  7.3  3.7  162   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3iac-A  7.1  4.0  190   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  55:  3f2b-A  6.6  7.1  161   994   12 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2yb1-A  4.2  4.7  149   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  57:  1bks-A  3.7  4.1  139   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  58:  2anu-A  3.3  3.8  122   224    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  2.7  4.0  127   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3ooqA Sbjct=3ooqA Z-score=70.6

back to top
DSSP  LEEEEEEEELLLLLLLEEEEEEEELLEEEEEELLLLLLLLEEEELLLLEEEELEEEEEEL
Query KILFKNATVFPITSRPFKGDVLVSNGKVEKVGENIEDPDAEIVDLTGKFLFPGFVDAHSH   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KILFKNATVFPITSRPFKGDVLVSNGKVEKVGENIEDPDAEIVDLTGKFLFPGFVDAHSH   60
DSSP  LEEEEEEEELLLLLLLEEEEEEEELLEEEEEELLLLLLLLEEEELLLLEEEELEEEEEEL


DSSP  LLLLLLLLLHHHLLLLLLLLLLLLLLLHHHHLLLLLHHHHHHHLLLEEEEEELLLLLLLE
Query IGLFEEGVGYYYSDGNEATDPVTPHVKALDGFNPQDPAIERALAGGVTSVXIVPGSANPV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IGLFEEGVGYYYSDGNEATDPVTPHVKALDGFNPQDPAIERALAGGVTSVXIVPGSANPV  120
DSSP  LLLLLLLLLHHHLLLLLLLLLLLLLLLHHHHLLLLLHHHHHHHLLLEEEEEELLLLLLLE


DSSP  EEEEEEEELLLLLHHHHEEEEEEEEEEELLHHHHHHHHHLLLLLLLHHHHHHHHHHHHHH
Query GGQGSVIKFRSIIVEECIVKDPAGLKXAFGENPKRVYGERKQTPSTRXGTAGVIRDYFTK  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GGQGSVIKFRSIIVEECIVKDPAGLKXAFGENPKRVYGERKQTPSTRXGTAGVIRDYFTK  180
DSSP  EEEEEEEELLLLLHHHHEEEEEEEEEEELLHHHHHHHHHLLLLLLLHHHHHHHHHHHHHH


DSSP  HHHHHHHHHHHHHLLLLLLLLLHHHHHHHHHHLLLLLEEEEELLHHHHHHHHHHHHHHLL
Query VKNYXKKKELAQKEGKEFTETDLKXEVGEXVLRKKIPARXHAHRADDILTAIRIAEEFGF  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VKNYXKKKELAQKEGKEFTETDLKXEVGEXVLRKKIPARXHAHRADDILTAIRIAEEFGF  240
DSSP  HHHHHHHHHHHHHLLLLLLLLLHHHHHHHHHHLLLLLEEEEELLHHHHHHHHHHHHHHLL


DSSP  LEEEEELLLHHHHHHHHHHHLLLEEELLLLLLLLLHHHLLLLLLHHHHHHHLLLLEEELL
Query NLVIEHGTEAYKISKVLAEKKIPVVVGPLLTFRTKLELKDLTXETIAKLLKDGVLIALXC  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NLVIEHGTEAYKISKVLAEKKIPVVVGPLLTFRTKLELKDLTXETIAKLLKDGVLIALXC  300
DSSP  LEEEEELLLHHHHHHHHHHHLLLEEELLLLLLLLLHHHLLLLLLHHHHHHHLLLLEEELL


DSSP  LLLLLLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEEL
Query DHPVIPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWS  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DHPVIPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWS  360
DSSP  LLLLLLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEEL


DSSP  LLLLLLLLLEEEEEELLEEEEELL
Query GHPFDXKSVVERVYIDGVEVFRRE  384
ident ||||||||||||||||||||||||
Sbjct GHPFDXKSVVERVYIDGVEVFRRE  384
DSSP  LLLLLLLLLEEEEEELLEEEEELL


No 2: Query=3ooqA Sbjct=3mkvA Z-score=26.7

back to top
DSSP  --LEEEEEEEELLLLL-LLEE-EEEEEELLEEEEEEL-LLLLLLLEEEELLLLEEEELEE
Query --KILFKNATVFPITS-RPFK-GDVLVSNGKVEKVGE-NIEDPDAEIVDLTGKFLFPGFV   55
ident     || |                 |   |    |    |    |   |  ||   ||  
Sbjct ltTFLFRNGALLDPDHpDLLQgFEILIEDGFIREVSDkPIKSSNAHVIDVKGKTIMPGLI   60
DSSP  llEEEEEEEEELLLLLlLLEEeEEEEEELLEEEEEELlLLLLLLLEEEELLLLEEEELEE


DSSP  EEEELLlLLLLlllHHHLllllllllllllllhhhhlLLLL-HHHHHHHLLLEEEEEELL
Query DAHSHIgLFEEgvgYYYSdgneatdpvtphvkaldgfNPQD-PAIERALAGGVTSVXIVP  114
ident | | |     |                               |     |  | | |    
Sbjct DLHVHV-VAIEfnlPRVA------------tlpnvlvTLRAvPIMRAMLRRGFTTVRDAG  107
DSSP  EEEELL-LLLLllhHHHL------------lllhhhhHHHHhHHHHHHHHLLEEEEEELL


DSSP  LlllleeeeeeeeelllllHHHH-------EEEE--------------------------
Query GsanpvggqgsvikfrsiiVEEC-------IVKD--------------------------  141
ident |                                                           
Sbjct G------------agypfkQAVEsglvegpRLFVsgralsqtgghadprarsdymppdsp  155
DSSP  L------------llhhhhHHHHlllllllEEEEllleeellllllllllllllllllll


DSSP  -------------------------------EEEEEEELLHHhhHHHHhlllllllhhhH
Query -------------------------------PAGLKXAFGENpkRVYGerkqtpstrxgT  170
ident                                                             
Sbjct cgccvrvgalgrvadgvdevrravreelqmgADQIXIMASGGvaSPTD-----pvgvfgY  210
DSSP  lllllllllleeelllhhhhhhhhhhhhhhlLLLEEEELLLLllLLLL-----llllllL


DSSP  HHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEELLHHHHHH
Query AGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAHRADDILT  230
ident                                                   ||     |  
Sbjct SEDEIRAI-----------------------------vAEAQGRGTYVLAHAYTPAAIAR  241
DSSP  LHHHHHHH-----------------------------hHHHHLLLLLEEEEELLHHHHHH


DSSP  HHHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEELlLLLL-----------------
Query AIRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGpLLTF-----------------  272
ident | |          ||||           ||    ||   | |                  
Sbjct AVRCG-----VRTIEHGNLIDDeTARLVAEHGAYVVPT-LVTYdalasegekyglppesi  295
DSSP  HHHLL-----LLEEEELLLLLHhHHHHHHHHLLEEELL-HHHHhhhhhhlllllllhhhh


DSSP  lLLHHHLLLLLLHHHHHHHLLLLEEELLLL--LLLLhhHHHHHHHHHHHhLLLHHHHHHL
Query rTKLELKDLTXETIAKLLKDGVLIALXCDH--PVIPleFATVQAATAXRyGAKEEDLLKI  330
ident              |      ||      |                               
Sbjct aKIADVHGAGLHSIEIMKRAGVKMGFGTDLlgEAQR--LQSDEFRILAE-VLSPAEVIAS  352
DSSP  lLHHHHHLLHHHHHHHHHHHLLLLLLLLLLlhHHHH--HLLHHHHHHHL-LLLHHHHHHH


DSSP  LLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL---LLLL----lLLEEEEEELLEEEEEL
Query LTVNPAKILGLEDRIGSIEPGKDADLVVWSGH---PFDX----kSVVERVYIDGVEVFRR  383
ident  |   |  ||  |  | | ||  ||  |  |      |           |  ||      
Sbjct ATIVSAEVLGMQDKLGRIVPGAHADVLVVDGNplkSVDCllgqgEHIPLVMKDGRLFVNE  412
DSSP  LLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLlllLLLLlllllLLLLEEEELLEEEEEL


DSSP  -l
Query -e  384
ident   
Sbjct le  414
DSSP  ll


No 3: Query=3ooqA Sbjct=3mtwA Z-score=26.0

back to top
DSSP  --LEEEEEEEELLLLL-LLEE-EEEEEELLEEEEEELL-LLLL-LLEEEELLLLEEEELE
Query --KILFKNATVFPITS-RPFK-GDVLVSNGKVEKVGEN-IEDP-DAEIVDLTGKFLFPGF   54
ident         |      |        | |  |     |      |  |  ||| |  | || 
Sbjct aeIKAVSAARLLDVASgKYVDnPLVIVTDGRITSIGKKgDAVPaGATAVDLPGVTLLPGL   60
DSSP  llEEEEEEEEEEELLLlEEEElEEEEEELLEEEEEEELlLLLLlLLEEEEEEEEEEEELE


DSSP  EEEEELLlLLLLLLLHHHLllllllllllllllhhhhLLLL-LHHHHHHHLLLEEEEEEL
Query VDAHSHIgLFEEGVGYYYSdgneatdpvtphvkaldgFNPQ-DPAIERALAGGVTSVXIV  113
ident  | | |       || | |                              |  | | |  |
Sbjct IDMHVHL-DSLAEVGGYNS-----------leysdrfWSVVqTANAKKTLEAGFTTVRNV  108
DSSP  EEEEELL-LLLLLLLHHHH-----------hhllhhhHHHHhHHHHHHHHHLLEEEEEEL


DSSP  LLlllleeeeeeeeelllLLHHHH-------EEEE-------------------------
Query PGsanpvggqgsvikfrsIIVEEC-------IVKD-------------------------  141
ident                                                             
Sbjct GA---------adyddvgLREAIDagyvpgpRIVTaaisfgatgghcdstffppsmdqkn  159
DSSP  LL---------lllhhhhHHHHHHlllllllEEEElllleellllllllllllhhhllll


DSSP  ---------------------EEEEEEELLHHHHHHHHhlllllllhhhHHHHHhhhhhh
Query ---------------------PAGLKXAFGENPKRVYGerkqtpstrxgTAGVIrdyftk  180
ident                                                             
Sbjct pfnsdspdearkavrtlkkygAQVIXICATGGVFSRGN-----epgqqqLTYEE------  208
DSSP  llllllhhhhhhhhhhhhhllLLEEEEELLLLLLLLLL-----llllllLLHHH------


DSSP  hhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEELLHHHHHHHHHHHhhhll
Query vknyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAHRADDILTAIRIAeefgf  240
ident                                    |    ||| |  |  | |       
Sbjct -----------------------mkavvDEAHMAGIKVAAHAHGASGIREAVRAG-----  240
DSSP  -----------------------hhhhhHHHHHLLLEEEEEELLHHHHHHHHHLL-----


DSSP  LEEEEELLLHHH-HHHHHHHHLLLEEELlLLLL------------------LLLHhHLLL
Query NLVIEHGTEAYK-ISKVLAEKKIPVVVGpLLTF------------------RTKLeLKDL  281
ident    |||         |    |                                      |
Sbjct VDTIEHASLVDDeGIKLAVQKGAYFSMD-IYNTdytqaegkkngvlednlrKDRD-IGEL  298
DSSP  LLEEEELLLLLHhHHHHHHHHLLEEELL-LLLHhhhhhhhhhhlllhhhhhHHHH-HHHH


DSSP  LLLHHHHHHHLLLLEEELLLLLLLLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLL
Query TXETIAKLLKDGVLIALXCDHPVIPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGL  341
ident   |   | || ||      |    |      | |   ||||         |   |  || 
Sbjct QRENFRKALKAGVKMVYGTDAGIYPHGDNAKQFAVMVRYGATPLQAIQSATLTAAEALGR  358
DSSP  HHHHHHHHHHHLLEEELLLLLLLLLLLLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLL


DSSP  LLLLLLLLLLLLLLEEEELLLL--LLLL-lLEEEEEELLEEEEELl
Query EDRIGSIEPGKDADLVVWSGHP--FDXK-sVVERVYIDGVEVFRRe  384
ident     |    |   |     | |            |   |  |    
Sbjct SKDVGQVAVGRYGDMIAVAGDPlaDVTTleKPVFVMKGGAVVKAPx  404
DSSP  LLLLLLLLLLLLLLEEEELLLLllLHHHhhLLLEEEELLEEEELLl


No 4: Query=3ooqA Sbjct=4cqbA Z-score=25.1

back to top
DSSP  ----LEEEEEEEELlllLLLEEEEEEEELLEEEEEELLLLLLLLEEEELLLLEEEELEEE
Query ----KILFKNATVFpitSRPFKGDVLVSNGKVEKVGENIEDPDAEIVDLTGKFLFPGFVD   56
ident          ||            |         |    ||       |  |    |||||
Sbjct skdfDLIIRNAYLS---EKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVD   57
DSSP  llleEEEEEEEEEL---LLLEEEEEEEELLEEEEEELLLLLLEEEEEELLLLLEEELEEE


DSSP  EEELLlLLLLLL-----LHHH-----lllLLLLllllllllhhhhlLLLL--HHHHHHHL
Query AHSHIgLFEEGV-----GYYY-----sdgNEATdpvtphvkaldgfNPQD--PAIERALA  104
ident || |                                                        
Sbjct AHTHM-DKSFTStgerlPKFWsrpytrdaAIED-glkyyknatheeIKRHviEHAHMQVL  115
DSSP  EEELH-HHLLLLlllllLLLLlllllhhhHHHH-hhhhhhhllhhhHHHHhhHHHHHHHH


DSSP  LLEEEEEELLLlllleeeeeeeeelllLLHHHHE--------------------------
Query GGVTSVXIVPGsanpvggqgsvikfrsIIVEECI--------------------------  138
ident  |                            ||                            
Sbjct HGTLYTRTHVD--vdsvaktkaveavlEAKEELKdlidiqvvafaqsgffvdleseslir  173
DSSP  LLEEEEEEEEE--lllllllhhhhhhhHHHHHLLllleeeeeeellllllllllhhhhhh


DSSP  ---eeEEEEEEEELL-HHHHhhhhhlllllllhhHHHHHHHhhhhhhhhhhhhhhhhhhl
Query ---vkDPAGLKXAFG-ENPKrvygerkqtpstrxGTAGVIRdyftkvknyxkkkelaqke  194
ident                                      |                      
Sbjct ksldmGCDLVGGVDPaTREN--------------NVEGSLD-------------------  200
DSSP  hhhhhLLLEEELLLLlLLLL--------------LHHHHHH-------------------


DSSP  llllllllhhhhhHHHHHLLLLLEEEEEL-----LHHHHHHHHHHHHHHLL--LEEEEEL
Query gkeftetdlkxevGEXVLRKKIPARXHAH-----RADDILTAIRIAEEFGF--NLVIEHG  247
ident                           | |         |        | |        | 
Sbjct -----------lcFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTIENGYkgRVTTSHA  249
DSSP  -----------hhHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHHHLLLllLEEEEEL


DSSP  LLHHH--------HHHHHHHHLLLEEELLLLlllllhhhllLLLLHHHHHHHLLLLEEEL
Query TEAYK--------ISKVLAEKKIPVVVGPLLtfrtklelkdLTXETIAKLLKDGVLIALX  299
ident                          |                      |||  |      
Sbjct WCFADapsewldeAIPLYKDSGMKFVTCFSS---------tPPTMPVIKLLEAGINLGCA  300
DSSP  LHHHHllhhhhhhHHHHHHHHLLEEEEELLL---------lLLLLLHHHHHHLLLEEEEE


DSSP  LLLL------LLLHhHHHHHHHHHH-HHLL----LHHHHHHLLLHHHHHHLLLLLLLlLL
Query CDHP------VIPLeFATVQAATAX-RYGA----KEEDLLKILTVNPAKILGLEDRIgSI  348
ident  |                  |     |             |  |   |  || |     |
Sbjct SDNIrdfwvpFGNG-DMVQGALIETqRLELktnrDLGLIWKMITSEGARVLGIEKNY-GI  358
DSSP  LLLLllllllLLLL-LHHHHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHHLLHHHL-LL


DSSP  LLLLLLLEEEELL----LLLLLLLLEEEEEELLEEEEELL----
Query EPGKDADLVVWSG----HPFDXKSVVERVYIDGVEVFRRE----  384
ident | || |||||                  |   |      |    
Sbjct EVGKKADLVVLNSlspqWAIIDQAKRLCVIKNGRIIVKDEviva  402
DSSP  LLLLLLLEEEELLllhhHHHHHLLLEEEEEELLEEEEELLeell


No 5: Query=3ooqA Sbjct=3icjA Z-score=24.5

back to top
DSSP  -LEEEEEEEELLLL--LLLEeEEEEEELLEEEEEEL--LLLL----LLLEEEELLLLEEE
Query -KILFKNATVFPIT--SRPFkGDVLVSNGKVEKVGE--NIED----PDAEIVDLTGKFLF   51
ident       | |                 ||  |   |              || || |||  
Sbjct cMKALINGTIYTSFspVKKV-SGLVISNERVLYAGDssTALRiaelAGGEIIDLKGKFVM   59
DSSP  lEEEEELLEEEEEEllEEEE-LEEEEELLEEEEEELhhHHHHhhhhHLLEEEELLLLEEE


DSSP  ELEEEEEELLLLLL--LLLLH---------------------------------------
Query PGFVDAHSHIGLFE--EGVGY---------------------------------------   70
ident | | | | |                                                   
Sbjct PAFFDSHLHLDELGmsLEMVDlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHHHHHhhHHLEEllllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  ----------------------------------------------hhllllLLLLllll
Query ----------------------------------------------yysdgnEATDpvtp   84
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIIneki  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHhhll


DSSP  lllhhhhlLLLLhHHHHHHLLLEEEEEELL-----llllleeeeeeeEELL---------
Query hvkaldgfNPQDpAIERALAGGVTSVXIVP-----gsanpvggqgsvIKFR---------  130
ident              | |  |  || ||                      |           
Sbjct ltvkdykhYIES-AQEHLLSLGVHSVGFMSvgekalkalfeleregrLKMNvfaylspel  238
DSSP  llhhhhhhHHHH-HHHHHHHLLEEEEEEEEelhhhhhhhhhhhhlllLLLEeeeeelhhh


DSSP  ---------lllhHHHEeeEEEEEEEELLHH-------hhhhhhhlllllLLHHhHHHHH
Query ---------siivEECIvkDPAGLKXAFGEN-------pkrvygerkqtpSTRXgTAGVI  174
ident                       |                                    |
Sbjct ldkleelnlgkfeGRRL--RIWGVXLFVDGSlgartallsepytdnpttsGELVmNKDEI  296
DSSP  hhhhhhhlllleeLLLE--EEEEEEEELLLLlllllllllllllllllllLLLLlLHHHH


DSSP  HHhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEELLHHHHHHHHHH
Query RDyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAHRADDILTAIRI  234
ident                                   |           ||        |   
Sbjct VE------------------------------vIERAKPLGLDVAVHAIGDKAVDVALDA  326
DSSP  HH------------------------------hHHHHLLLLLEEEEEELLHHHHHHHHHH


DSSP  HHHHLLLEEEEELLLHHH-HHHHHHHHLLLEEEL-LLLL-LLLLH-----hhLLLLLlHH
Query AEEFGFNLVIEHGTEAYK-ISKVLAEKKIPVVVG-PLLT-FRTKL-----elKDLTXeTI  286
ident  ||  |   |||             | |                                
Sbjct FEEAEFSGRIEHASLVRDdQLERIKELKVRISAQpHFIVsDWWIVnrvgeerAKWAY-RL  385
DSSP  HHHHLLLLEEEELLLLLHhHHHHHHHHLLEEEELlLHHHhLLLHHhhhhhhhHHHLL-LH


DSSP  HHHHHlLLLEEELLLLLLLLHhHHHHHHHHHHHH-------LLLHHHHHHLLLHHHHHHL
Query AKLLKdGVLIALXCDHPVIPLeFATVQAATAXRY-------GAKEEDLLKILTVNPAKIL  339
ident   |           | |  |     |    |              |  |   |   |   
Sbjct KTLSS-ITKLGFSTDSPIEPA-DPWVSIDAAVNRyvvdpgeRVSREEALHLYTHGSAQVT  443
DSSP  HHHHH-HLLEEELLLLLLLLL-LHHHHHHHHHHLllllhhhLLLHHHHHHHLLHHHHHHL


DSSP  LLLlLLLLLLLLLLLLEEEELLLLLLlllleeeeeelleeeeell
Query GLEdRIGSIEPGKDADLVVWSGHPFDxksvvervyidgvevfrre  384
ident   |   |  | |  |        |                     
Sbjct LAE-DLGKLERGFRAEYIILDRDPLK-------------------  468
DSSP  LLL-LLLLLLLLLLLLEEEELLLLLL-------------------


No 6: Query=3ooqA Sbjct=2pajA Z-score=24.5

back to top
DSSP  -LEEEEEE-EELLLL-------LLLEEEEEEEELLEEEEEElLLLLL-LLEEEELLLLEE
Query -KILFKNA-TVFPIT-------SRPFKGDVLVSNGKVEKVGeNIEDP-DAEIVDLTGKFL   50
ident    |  ||              ||    |           |          ||| |    
Sbjct pSTLIRNAaAIMTGGrgtaddpSRVPGPDIRIVGDTIDAIG-ALAPRpGETIVDATDCVI   59
DSSP  lEEEEELLlEELLLLlllllllLLLLLLLEEEELLEEEEEL-LLLLLlLLEEEELLLLEE


DSSP  EELEEEEEELLlLLLLL---lLHHHLllllllllllllllhhhhlLLLL--HHHHHHHLL
Query FPGFVDAHSHIgLFEEG---vGYYYSdgneatdpvtphvkaldgfNPQD--PAIERALAG  105
ident  |  |  | |                                                  
Sbjct YPAWVNTHHHL-FQSLLkgepFRALF---------------derrFRLAarIGLIELARS  103
DSSP  EELEELLLLLH-HHHHLllllLHHHL---------------lhhhHHHHhhHHHHHHHLL


DSSP  LEEEEEELLLlllleeeeeeeeelllLLHHHHE---------------------------
Query GVTSVXIVPGsanpvggqgsvikfrsIIVEECI---------------------------  138
ident |   |                     |  ||                             
Sbjct GCATVADHNY----vyypgmpfdssaILFEEAEklglrfvllrggatqtrqleadlptal  159
DSSP  LEEEEEELLL----lllllllllhhhHHHHHHHhllleeeeeellllllllllllllhhh


DSSP  --------------------------EEEEeEEEE-ELLHHHhhhhhhlllllllhhhHH
Query --------------------------VKDPaGLKX-AFGENPkrvygerkqtpstrxgTA  171
ident                                                             
Sbjct rpetldayvadierlaaryhdaspraMRRV-VMAPtTVLYSI----------------SP  202
DSSP  llllhhhhhhhhhhhhhhllllllllLEEE-EELLlLLLLLL----------------LH


DSSP  HHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEELlhHHHHHH
Query GVIRDyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAHraDDILTA  231
ident    |                                     |       |          
Sbjct REMRE------------------------------tAAVARRLGLRMHSHLSgkSPVAFC  232
DSSP  HHHHH------------------------------hHHHHHHLLLEEEEELLllLHHHHH


DSSP  HHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEeLLLL-LLLLlhhhllllllHHHHH
Query IRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVvGPLL-TFRTklelkdltxeTIAKL  289
ident               |           ||     |         |                
Sbjct GEHD-wlgsDVWYAHLVKVDAdEIALLAQTGTGVA-HCPQsNGRL----------PVREM  280
DSSP  HHLL-llllLEEEELLLLLLHhHHHHHHHHLLEEE-ELHHhHHLL----------LLLLH


DSSP  HHLLLLEEELLLLL--LLLHhHHHHHHHH-HHHHL---LLHHHHHHLLLHHHHHHLLLLl
Query LKDGVLIALXCDHP--VIPLeFATVQAAT-AXRYG---AKEEDLLKILTVNPAKILGLEd  343
ident    ||      |                          |         |   |   ||  
Sbjct ADAGVPVSIGVDGAasNEAA-DMISEVHMtWLAQRarlASIAEVIHWGTAGGARVMGLD-  338
DSSP  HHHLLLEEELLLHHhhLLLL-LHHHHHHHhHHHHHhllLLHHHHHHHHLHHHHHHHLLL-


DSSP  LLLLLLLLLLLLEEEELL-------------LLLL--LLLLEEEEEELLEEEEEL-----
Query RIGSIEPGKDADLVVWSG-------------HPFD--XKSVVERVYIDGVEVFRR-----  383
ident   |    |  ||  |                 |        |      |  |        
Sbjct EVGKVAVGYAADIAVYRLddpryfglhdpaiGPVAsgGRPSVMALFSAGKRVVVDdlieg  398
DSSP  LLLLLLLLLLLLEEEEELllhhhlllllhhhHHHHllLLLEEEEEEELLEEEEELlllll


DSSP  ----------------------l
Query ----------------------e  384
ident                        
Sbjct vdikelggearrvvrellrevvv  421
DSSP  llhhhhhhhhhhhhhhhhhhhhl


No 7: Query=3ooqA Sbjct=1onxA Z-score=24.5

back to top
DSSP  --------LEEEEEEEELLLlLLLEEEEEEEELLEEEEEELLLLLL---LLEEEELLLLE
Query --------KILFKNATVFPItSRPFKGDVLVSNGKVEKVGENIEDP---DAEIVDLTGKF   49
ident           |   |            |||| |||   |  ||          ||| |  
Sbjct midytaagFTLLQGAHLYAP-EDRGICDVLVANGKIIAVASNIPSDivpNCTVVDLSGQI   59
DSSP  llllhhhlLEEEEEEEEELL-LEEEEEEEEEELLEEEEEELLLLLLlllLLEEEELLLLE


DSSP  EEELEEEEEELLLLLllllLHHHLLlllllllllllllhhhHLLLllhhHHHHHLLLEEE
Query LFPGFVDAHSHIGLFeegvGYYYSDgneatdpvtphvkaldGFNPqdpaIERALAGGVTS  109
ident | ||| | | |        |                               |    ||||
Sbjct LCPGFIDQHVHLIGGggeaGPTTRT----------------PEVA----LSRLTEAGVTS   99
DSSP  EEELEEEEEELLLLLllllLHHHLL----------------LLLL----HHHHHHLLEEE


DSSP  EEELLL------------------------------LLLLEEeeeeeeelllllhhhhee
Query VXIVPG------------------------------SANPVGgqgsvikfrsiiveeciv  139
ident |    |                                                      
Sbjct VVGLLGtdsisrhpesllaktralneegisawmltgAYHVPS----rtitgsvekdvaii  155
DSSP  EEELLLlllllllhhhhhhhhhhhhhhlleeeeeeeLLLLLL----llllllhhhhhhhl


DSSP  EEEEEEEEELL-HHHHhhhhhlllllllhhHHHH-HHHHHhhhhhhhhhhhhhhhhllll
Query KDPAGLKXAFG-ENPKrvygerkqtpstrxGTAG-VIRDYftkvknyxkkkelaqkegke  197
ident     |   |                                                   
Sbjct DRVIGVXCAISdHRSA--------------APDVyHLANM--------------------  181
DSSP  LLEEEEEEEELlLLLL--------------LLLHhHHHHH--------------------


DSSP  lllllhhhhhHHHHHLLL-----LLEEEEELL-hHHHHHHHHHHHHHLL---LEEEEELL
Query ftetdlkxevGEXVLRKK-----IPARXHAHR-aDDILTAIRIAEEFGF---NLVIEHGT  248
ident            |                |               |        |   |  
Sbjct ---------aAESRVGGLlggkpGVTVFHMGDskKALQPIYDLLENCDVpisKLLPTHVN  232
DSSP  ---------hHHHHHHHHhhlllLEEEEEELLllLLLHHHHHHHHLLLLlhhHEEEELHH


DSSP  ----LHHHHHhHHHHHLLLEEELLLLLLlllhhhlLLLL-LHHHHHHHLLL---LEEELL
Query ----EAYKISkVLAEKKIPVVVGPLLTFrtklelkDLTX-ETIAKLLKDGV---LIALXC  300
ident              | |                        | ||     |       |  
Sbjct rnvpLFEQAL-EFARKGGTIDITSSIDE-------PVAPaEGIARAVQAGIplaRVTLSS  284
DSSP  hlhhHHHHHH-HHHHLLLLEEEELLLLL-------LLLHhHHHHHHHHLLLlhhHEEEEL


DSSP  LLLL----------------LLHHHHHHHHHHHH-HHLLLHHHHHHLLLHHHHHHLLLlL
Query DHPV----------------IPLEFATVQAATAX-RYGAKEEDLLKILTVNPAKILGLeD  343
ident |                      |            |     | |  ||   |  | |  
Sbjct DGNGsqpffddegnlthigvAGFETLLETVQVLVkDYDFSISDALRPLTSSVAGFLNL-T  343
DSSP  LLLLeeeeellllleeeeeeLLLHHHHHHHHHHHhHHLLLHHHHHHHHLHHHHHHLLL-L


DSSP  LLLLLLLLLLLLEEEELLLLlllllLEEEEEELLEEEEEL-----------l
Query RIGSIEPGKDADLVVWSGHPfdxksVVERVYIDGVEVFRR-----------e  384
ident   | | || |||| |            | ||  |                  
Sbjct GKGEILPGNDADLLVMTPEL-----RIEQVYARGKLMVKDgkacvkgtfetd  390
DSSP  LLLLLLLLLLLLEEEELLLL-----LEEEEEELLEEEEELleelllllllll


No 8: Query=3ooqA Sbjct=1j6pA Z-score=24.2

back to top
DSSP  -LEEEEEEEELLL-LLLLEEEEEEEELLEEEEEELLLLLllleEEELLLLEEEELEEEEE
Query -KILFKNATVFPI-TSRPFKGDVLVSNGKVEKVGENIEDpdaeIVDLTGKFLFPGFVDAH   58
ident       |        | || | |   ||    |            || ||   |     |
Sbjct hHXIIGNCLILKDfSSEPFWGAVEIENGTIKRVLQGEVK---vDLDLSGKLVXPALFNTH   57
DSSP  lEEEEEEEEELLLlLLLLEEEEEEEELLEEEEEEELLLL---lLEELLLEEEEELEEEEE


DSSP  ELLLLLLLLLL--------------HHHLllllllllllllllhhhhlLLLL--HHHHHH
Query SHIGLFEEGVG--------------YYYSdgneatdpvtphvkaldgfNPQD--PAIERA  102
ident  |                                                     |    
Sbjct THAPXTLLRGVaedlsfeewlfskvLPIE------------drltekxAYYGtiLAQXEX  105
DSSP  ELHHHHHHLLLlllllhhhhhhllhHHHH------------llllhhhHHHHhhHHHHHH


DSSP  HLLLEEEEEELLllllleeeeeeeeellllLHHHH-------------------------
Query LAGGVTSVXIVPgsanpvggqgsvikfrsiIVEEC-------------------------  137
ident    |                                                        
Sbjct ARHGIAGFVDXY-----------fheewiaKAVRDfgxralltrglvdsngddggrleen  154
DSSP  HLLLEEEEEEEE-----------llhhhhhHHHHHhlleeeeeeeelllllllllhhhhh


DSSP  -----------EEEEeEEEEE-ELLHhhhhhhhhlllllllhhhHHHHHHHhhhhhhhhh
Query -----------IVKDpAGLKX-AFGEnpkrvygerkqtpstrxgTAGVIRDyftkvknyx  185
ident                  |                                          
Sbjct lklynewngfeGRIF-VGFGPhSPYL-----------------cSEEYLKR---------  187
DSSP  hhhhhhhllhhHLEE-EEEEElLLLL-----------------lLHHHHHH---------


DSSP  hhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEEL----LHHHHHHHHHHHhhhLLL
Query kkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAH----RADDILTAIRIAeefGFN  241
ident                                |   |         |      |       
Sbjct ---------------------vfDTAKSLNAPVTIHLYetskEEYDLEDILNIG-lkEVK  225
DSSP  ---------------------hhHHHHHHLLLEEEEELllllLLLLLHHHHLLL-llLLL


DSSP  EEEEELLLHHH-HHHHHHHHLLLEEeLLLL--LLLLlhhhlLLLLlHHHHHHHLLLLEEE
Query LVIEHGTEAYK-ISKVLAEKKIPVVvGPLL--TFRTklelkDLTXeTIAKLLKDGVLIAL  298
ident     |          ||      |                              |    |
Sbjct TIAAHCVHLPErYFGVLKDIPFFVS-HNPAsnLKLG-----NGIA-PVQRXIEHGXKVTL  278
DSSP  EEEEELLLLLHhHHHHHLLLLEEEE-ELHHhhHHLL-----LLLL-LHHHHHHLLLEEEE


DSSP  LLLLL--LLLHhHHHHHHHH-HHHH------LLLHHHHHHLLLHHHHHHLLLllLLLLLL
Query XCDHP--VIPLeFATVQAAT-AXRY------GAKEEDLLKILTVNPAKILGLedRIGSIE  349
ident   |       |                           ||  |   |   |     | ||
Sbjct GTDGAasNNSL-NLFFEXRLaSLLQkaqnprNLDVNTCLKXVTYDGAQAXGF--KSGKIE  335
DSSP  LLLLLllLLLL-LHHHHHHHhHHHHhlllllLLLHHHHHHHHLHHHHHHHLL--LLLLLL


DSSP  LLLLLLEEEELL-------------LLLLLLL-LEEEEEELLEEEEELL-----------
Query PGKDADLVVWSG-------------HPFDXKS-VVERVYIDGVEVFRRE-----------  384
ident  |  |||||                |     |  |      |                  
Sbjct EGWNADLVVIDLdlpexfpvqniknHLVHAFSgEVFATXVAGKWIYFDGeyptidseevk  395
DSSP  LLLLLLEEEEELllhhhllhhhhhhHHHHLLLlLLLEEEELLEEEEELLllllllhhhhh


DSSP  ------------
Query ------------  384
ident             
Sbjct relariekelys  407
DSSP  hhhhhhhhhhhl


No 9: Query=3ooqA Sbjct=3ls9A Z-score=24.2

back to top
DSSP  LEEEEEE-EELLLL--LLLEE-EEEEEELLEEEEEELLLLLLLL-EEEELLLLEEEELEE
Query KILFKNA-TVFPIT--SRPFK-GDVLVSNGKVEKVGENIEDPDA-EIVDLTGKFLFPGFV   55
ident  ||      |       |     | |    |   ||    |       |  |    ||  
Sbjct MILIRGLtRVITFDdqERELEdADILIDGPKIVAVGKDLSDRSVsRTIDGRGMIALPGLI   60
DSSP  LEEEEEEeEEELLLllLLEEEeEEEEEELLEEEEEELLLLLLLLlEEEELLLEEEEELEE


DSSP  EEEELLlLLLLL----------------lLHHHLllllllllllllllhhhhlLLLL--H
Query DAHSHIgLFEEG----------------vGYYYSdgneatdpvtphvkaldgfNPQD--P   97
ident   | |                            |                          
Sbjct NSHQHL-YEGAMraipqlervtmaswlegVLTRS------agwwrdgkfgpdvIREVarA  113
DSSP  EEEELH-HHHHHlllhhhllllhhhhhhhHHHHH------hhhhhlllllhhhHHHHhhH


DSSP  HHHHHHLLLEEEEEELLLlllleeeeeeeeelllllHHHHE-------------------
Query AIERALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEECI-------------------  138
ident      | || | |                        |                      
Sbjct VLLESLLGGITTVADQHL----ffpgatadsyidatIEAATdlgirfhaarssmtlgkse  169
DSSP  HHHHHHHLLEEEEEEEEL----lllllllllhhhhhHHHHHhhlleeeeeellllllhhh


DSSP  ---------------------------------EEEEeEEEEELLHHHhhhhhhllllll
Query ---------------------------------VKDPaGLKXAFGENPkrvygerkqtps  165
ident                                        |                    
Sbjct ggfcddlfvepvdrvvqhclglidqyhepepfgMVRI-ALGPCGVPYD------------  216
DSSP  lllllhhhlllhhhhhhhhhhhhhhhlllllllLEEE-EELLLLLLLL------------


DSSP  lhhhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEELL-
Query trxgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAHR-  224
ident                                                        |    
Sbjct ----KPELFE------------------------------afAQMAADYDVRLHTHFYEp  242
DSSP  ----LHHHHH------------------------------hhHHHHHHHLLEEEEEELLl


DSSP  -----------hHHHHHHHHHHhhhllLEEEEELLLH-hHHHHHHHHHLLLEEELLL--L
Query -----------aDDILTAIRIAeefgfNLVIEHGTEA-yKISKVLAEKKIPVVVGPL--L  270
ident                                 |            |             |
Sbjct ldagmsdhlygmTPWRFLEKHG-wasdRVWLAHAVVPprEEIPEFADAGVAIAHLIApdL  301
DSSP  lhhhhhhhhhllLHHHHHHHLL-llllLEEEEELLLLlhHHHHHHHHHLLEEEELHHhhH


DSSP  LLLllhhhlLLLLlHHHHHHHLLLLEEELLLLL--LLLHhHHHHHHHHHHHH--------
Query TFRtklelkDLTXeTIAKLLKDGVLIALXCDHP--VIPLeFATVQAATAXRY--------  320
ident                |   |  |                         |           
Sbjct RMG------WGLA-PIREYLDAGITVGFGTTGSasNDGG-NLLGDLRLAALAhrpadpne  353
DSSP  HLL------LLLL-LHHHHHHLLLEEEELLLLLllLLLL-LHHHHHHHHHHHlhhhllll


DSSP  ---LLLHHHHHHLLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL-------------LLL
Query ---GAKEEDLLKILTVNPAKILGLEdRIGSIEPGKDADLVVWSG-------------HPF  364
ident          ||   |   |  ||     |  | |  ||   |                  
Sbjct pekWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvdrvgvhdpaiGLI  412
DSSP  hhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhhhlllllhhhHHH


DSSP  LLL--LLEEEEEELLEEEEEL-------------------l
Query DXK--SVVERVYIDGVEVFRR-------------------e  384
ident           |   |                          
Sbjct MTGlsDRASLVVVNGQVLVENerpvladlerivanttalip  453
DSSP  HLLllLLLLEEEELLEEEEELleellllhhhhhhhhhhhll


No 10: Query=3ooqA Sbjct=2oofA Z-score=23.9

back to top
DSSP  ---LEEEEEEEELLLL-----LLLE-EEEEEEELLEEEEEELL--lLLLLlEEEELLLLE
Query ---KILFKNATVFPIT-----SRPF-KGDVLVSNGKVEKVGEN--iEDPDaEIVDLTGKF   49
ident         | |                    |  |             |     |  || 
Sbjct lncERVWLNVTPATLRsdladYGLLePHALGVHEGRIHALVPXqdlKYPA-HWQDXKGKL   59
DSSP  lllLEEEEEEEELLLLlllllLLLLlLEEEEEELLEEEEEEEHhhlLLLL-LLEELLLLE


DSSP  EEELEEEEEELLLLlllLLLH----------------------HHLLlllllllllllll
Query LFPGFVDAHSHIGLfeeGVGY----------------------YYSDgneatdpvtphvk   87
ident   ||  | | |      |                                          
Sbjct VTPGLIDCHTHLIF--aGSRAeefelrqkgvpyaeiarkgggiISTV-------ratraa  110
DSSP  EEELEEEEEELLLL--lLLLHhhhhhhhhlllhhhhhhllllhHHHH-------hhhhhl


DSSP  hhhhLLLL-LHHHHHHHLLLEEEEEELLLlllleeeeeeeeelllllHHHH-----EEEE
Query aldgFNPQ-DPAIERALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEEC-----IVKD  141
ident           |        ||| | |  |                            || 
Sbjct sedqLFELaLPRVKSLIREGVTTVEIKSG---ygltledelkxlrvaRRLGealpiRVKT  167
DSSP  lhhhHHHHhHHHHHHHHHHLEEEEEEELL---llllhhhhhhhhhhhHHHHhhlllEEEE


DSSP  ------------------------------------EEEEEEELLHHHhhhhhhllllll
Query ------------------------------------PAGLKXAFGENPkrvygerkqtps  165
ident                                                             
Sbjct tllaahavppeyrddpdswveticqeiipaaaeaglADAVDVFCEHIG------------  215
DSSP  eeeeellllhhhlllhhhhhhhhhhlhhhhhhhlllLLEEEEEELLLL------------


DSSP  lhhhHHHHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLlLLLEEEEE-LL
Query trxgTAGVIRDyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRkKIPARXHA-HR  224
ident                                                        |    
Sbjct ---fSLAQTEQ-----------------------------vyLAADQY-GLAVKGHXdQL  242
DSSP  ---lLHHHHHH-----------------------------hhHHHHHL-LLEEEEEElLL


DSSP  HHHhhHHHHHHhhhLLLE-EEEELLLHHH-HHHHHHHHLLLEEELLL-LLLLLlhhHLLL
Query ADDilTAIRIAeefGFNL-VIEHGTEAYK-ISKVLAEKKIPVVVGPL-LTFRTkleLKDL  281
ident           |    |      |           ||         |    |        |
Sbjct SNL--GGSTLA--aNFGAlSVDHLEYLDPeGIQALAHRGVVATLLPTaFYFLK---ETKL  295
DSSP  LLL--LHHHHH--hHLLLlEEEELLLLLHhHHHHHHHHLLEEEELHHhHHHLL---LLLL


DSSP  LllHHHHHHHLLLLEEELLLLL---LLLHhHHHHHHHHHHH-HLLLHHHHHHLLLHHHHH
Query TxeTIAKLLKDGVLIALXCDHP---VIPLeFATVQAATAXR-YGAKEEDLLKILTVNPAK  337
ident        | | ||  |   |                  |    |          |   | 
Sbjct P--PVVALRKAGVPXAVSSDINpgtAPIV-SLRXAXNXACTlFGLTPVEAXAGVTRHAAR  352
DSSP  L--LHHHHHHLLLLEEELLLLLlllLLLL-LHHHHHHHHHHhHLLLHHHHHHHLLHHHHH


DSSP  HLLLLLLLLLLLLLLLLLEEEELL----LLLLL--LLLEEEEEELLEEEEEll
Query ILGLEDRIGSIEPGKDADLVVWSG----HPFDX--KSVVERVYIDGVEVFRre  384
ident  ||     |    |  ||  ||                       | |     
Sbjct ALGEQEQLGQLRVGXLADFLVWNCghpaELSYLigVDQLVSRVVNGEETLH--  403
DSSP  HLLLLLLLLLLLLLLLLLEEEELLllllHHHHLllLLLEEEEEELLEELLL--


No 11: Query=3ooqA Sbjct=4c5yA Z-score=23.4

back to top
DSSP  ----LEEEEEEEELLLLLLLEE-EEEEEELLEEEEEELL-----lLLLLL-EEEELllLE
Query ----KILFKNATVFPITSRPFK-GDVLVSNGKVEKVGEN-----iEDPDA-EIVDLtgKF   49
ident               |    |        |      ||                       
Sbjct deakVTIIYAGLLIPGDGEPLRnAALVISDKIIAFVGSEadipkkYLRSTqSTHRV--PV   58
DSSP  llllEEEEEEEEELLLLLLLEEeEEEEEELLEEEEEEEHhhllhhHHHHLlLEEEE--EE


DSSP  EEELEEEEEELLllLLLLLL---HHHLLlllllllllllllhhhhlLLLL-HHHHHHHLL
Query LFPGFVDAHSHIglFEEGVG---YYYSDgneatdpvtphvkaldgfNPQD-PAIERALAG  105
ident | ||  | | |            |                                ||  
Sbjct LMPGLWDCHMHF--GGDDDYyndYTSGL-----------athpassGARLaRGCWEALQN  105
DSSP  EEELEEEEEELL--LLLLLLlllLHHHH-----------hllhhhhHHHHhHHHHHHHHL


DSSP  LEEEEEELLllllleeeeeeeeellllLHHHH----------------------------
Query GVTSVXIVPgsanpvggqgsvikfrsiIVEEC----------------------------  137
ident | ||                                                        
Sbjct GYTSYRDLA------------gygcevAKAINdgtivgpnvyssgaalsqtaghgdifal  153
DSSP  LEEEEEELL------------llhhhhHHHHHllllllleeeellleeelllllllllll


DSSP  ----------------------------------------eeeEEEEEEEELLHHhhHHH
Query ----------------------------------------ivkDPAGLKXAFGENpkRVY  157
ident                                                             
Sbjct pagevlgsygvmnprpgywgagplciadgveevrravrlqirrGAKVIXVMASGGvmSRD  213
DSSP  lhhhhhhhhlllllllllllllleeelllhhhhhhhhhhhhhhLLLLEEEELLLLllLLL


DSSP  HhlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLL
Query GerkqtpstrxgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevgEXVLRKKIP  217
ident                                                    |   |    
Sbjct D----npnfaqfSPEELK------------------------------vivEEAARQNRI  239
DSSP  L----lllllllLHHHHH------------------------------hhhHHHHHLLLL


DSSP  EEEEELLHHHHHHHHHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEELlLLLL----
Query ARXHAHRADDILTAIRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGpLLTF----  272
ident    | |    |  ||            ||   |         || |  |           
Sbjct VSAHVHGKAGIMAAIKAG-----CKSLEHVSYADEeVWELMKEKGILYVAT-RSVIeifl  293
DSSP  EEEEELLHHHHHHHHHHL-----LLEEEELLLLLHhHHHHHHHHLLEEELL-HHHHhhhh


DSSP  -------------LLLHHHLLLLlLHHHHHHHLLLLEEELLLLLllLHHHHHHHHHHHHH
Query -------------RTKLELKDLTxETIAKLLKDGVLIALXCDHPviPLEFATVQAATAXR  319
ident                                | || |||  |    |          |  
Sbjct asngeglvkeswaKLQALADSHL-KAYQGAIKAGVTIALGTDTA--PGGPTALELQFAVE  350
DSSP  hhllllllllhhhLLLHHHHHHH-HHHHHHHHLLLLEELLLLLL--LLLLLHHHHHHHHH


DSSP  H-LLLHHHHHHLLLHHHHHHLL-lLLLLLLLLLLLLLLEEEELLLL---LLLL---LLEE
Query Y-GAKEEDLLKILTVNPAKILG-lEDRIGSIEPGKDADLVVWSGHP---FDXK---SVVE  371
ident   |       |  | |     |      |    |  ||       |            | 
Sbjct RgGMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEENPledIKVFqepKAVT  410
DSSP  LlLLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELLLLlllHHHHhlhHHEE


DSSP  EEEELLEEEEELL-------------
Query RVYIDGVEVFRRE-------------  384
ident  |   |                    
Sbjct HVWKGGKLFKGPGigpwgedarnpfl  436
DSSP  EEEELLEEEELLLlllllllllllll


No 12: Query=3ooqA Sbjct=3giqA Z-score=23.2

back to top
DSSP  ---LEEEEEEEELLLL-LLLEEEEEEEELLEEEEEElLLLLLLL-EEEELLLLEEEELEE
Query ---KILFKNATVFPIT-SRPFKGDVLVSNGKVEKVGeNIEDPDA-EIVDLTGKFLFPGFV   55
ident                |       |  |  |     |       |    |  ||   ||| 
Sbjct eklDFKITGGWIIDGTgAPRRRADLGVRDGRIAAIG-ELGAHPArHAWDASGKIVAPGFI   59
DSSP  lleEEEEELLEELLLLlLLLEELEEEEELLEEEEEE-LLLLLLEeEEEELLLLEEEELEE


DSSP  EEEELLLlllllllhhhlllllllllllllllhhhhLLLL-LHHHHHHHLLLEEEEEELL
Query DAHSHIGlfeegvgyyysdgneatdpvtphvkaldgFNPQ-DPAIERALAGGVTSVXIVP  114
ident | | |                                     |        | | |    
Sbjct DVHGHDD-----------------------------LMFVeKPDLRWKTSQGITTVVVGN   90
DSSP  ELLLLLL-----------------------------LHHHhLLLLHHHHLLLEEEEEELL


DSSP  LL-----------------llleeeeeeeeelllLLHH-----hHEEE------------
Query GS-----------------anpvggqgsvikfrsIIVE-----eCIVK------------  140
ident                                                             
Sbjct CGvsaapaplpgntaaalallgetplfadvpayfAALDaqrpmiNVAAlvghanlrlaam  150
DSSP  LLlllllllllllllhhhhhhllllllllhhhhhHHHHhlllllEEEEeeehhhhhhhhl


DSSP  -------------------------EEEEEEEELlhHHHHhhhhlllllllHHHHHHHHH
Query -------------------------DPAGLKXAFgeNPKRvygerkqtpstRXGTAGVIR  175
ident                             |                          |    
Sbjct rdpqaaptaaeqqamqdmlqaaleaGAVGFSTGL--AYQP----------gAVAQAAELE  198
DSSP  llllllllhhhhhhhhhhhhhhhhhLLLEEEEEL--LLLL----------hHHLLHHHHH


DSSP  HHhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEE-----lLHHHHHH
Query DYftkvknyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHA-----hRADDILT  230
ident                                              |              
Sbjct GL------------------------------aRVAAERRRLHTSHIrneadgVEAAVEE  228
DSSP  HH------------------------------hHHHHHLLLEEEEELllllllHHHHHHH


DSSP  HHHHHHHHLLLEEEEELLL--------HHHHHHHHHHHL-----LLEEElLLLL------
Query AIRIAEEFGFNLVIEHGTE--------AYKISKVLAEKK-----IPVVVgPLLT------  271
ident    |    |   |  |                                            
Sbjct VLAIGRGTGCATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDI-YPYPgsstil  287
DSSP  HHHHHHHHLLEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEE-LLLLeeeeel


DSSP  --------------------------------------------------LLLLhhhLLL
Query --------------------------------------------------FRTKlelKDL  281
ident                                                           | 
Sbjct iperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaIYFA---MDE  344
DSSP  lhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeEEEL---LLH


DSSP  L--LLHHHHhhhllLLEEELLLLL------LLLHHH-HHHHHHHHH-HHLLLHH-HHHHL
Query T--XETIAKllkdgVLIALXCDHP------VIPLEF-ATVQAATAX-RYGAKEE-DLLKI  330
ident                      |           |    |                     
Sbjct DevKRIFQH-----PCCMVGSDGLpndarpHPRLWGsFTRVLGRYVrEARLMTLeQAVAR  399
DSSP  HhhHHHHHL-----LLEEELLLLLllllllLLHHHHhHHHHHHHHHhHLLLLLHhHHHHH


DSSP  LLHHHHHHLLLlLLLLLLLLLLLLLEEEELL-LLLLL---------lLLEEEEEELLEEE
Query LTVNPAKILGLeDRIGSIEPGKDADLVVWSG-HPFDX---------kSVVERVYIDGVEV  380
ident  |  ||   |     |   ||  || ||       |                |   | ||
Sbjct MTALPARVFGF-AERGVLQPGAWADVVVFDPdTVADRatwdeptlasVGIAGVLVNGAEV  458
DSSP  HLHHHHHHHLL-LLLLLLLLLLLLLEEEELLlLLLLLllllllllllLLEEEEEELLEEE


DSSP  EEL-------------l
Query FRR-------------e  384
ident |                
Sbjct FPQppadgrpgqvlrax  475
DSSP  ELLllllllllllllll


No 13: Query=3ooqA Sbjct=2vunA Z-score=22.9

back to top
DSSP  -LEEEEEE-EELLLL---LLLEEEEEEEELLEEEEEEL-LLLL--LLLEEEELLLLEEEE
Query -KILFKNA-TVFPIT---SRPFKGDVLVSNGKVEKVGE-NIED--PDAEIVDLTGKFLFP   52
ident  |   ||                    |  |     |         || | |  |    |
Sbjct sKTIIKNIgKIVSGDiksPVLQADTIVVEDGLIAAIGGeELMKdaGDATIIDAAGSTVTP   60
DSSP  lEEEEELLlEEELLLlllLEELLLEEEEELLEEEEEELhHHHLllLLLEEEELLLLEEEE


DSSP  LEEEEEELLLlllllllhhhlllllllllllllllhhhhLLLL------LHHHHHHHLLL
Query GFVDAHSHIGlfeegvgyyysdgneatdpvtphvkaldgFNPQ------DPAIERALAGG  106
ident |  | | |                                            |  || ||
Sbjct GLLDTHVHVS-----------------------------GGDYaprqktMDFISSALHGG   91
DSSP  LEEEEEELLL-----------------------------LLLEehhhleELHHHHHHLLL


DSSP  EEEEEELLLL------llleeeeeeeeellllLHHHH-----------------------
Query VTSVXIVPGS------anpvggqgsvikfrsiIVEEC-----------------------  137
ident ||                                                          
Sbjct VTTMISAGSPhfpgrpkdaagtkalaitlsksYYNARpagvkvhggavilekglteedfi  151
DSSP  EEEEEELLLLllllllllhhhhhhhhhhhhhhHHHLLhhhleeelleelllllllhhhhh


DSSP  --eeeEEEEEEEELlhHHHHhhhhlllllllhhhHHHHHHHHhhhhhhhhhhhhhhhhll
Query --ivkDPAGLKXAFgeNPKRvygerkqtpstrxgTAGVIRDYftkvknyxkkkelaqkeg  195
ident                                                             
Sbjct emkkeGVWIVGEVG--LGTI-------------kNPEDAAPM------------------  178
DSSP  hhhhlLLLEEEEEL--LLLL-------------lLHHHHHHH------------------


DSSP  lllllllhhhhhHHHHHLlLLLEEEEELL------hHHHH-HHHHHHhhhllLEEEEELL
Query keftetdlkxevGEXVLRkKIPARXHAHR------aDDIL-TAIRIAeefgfNLVIEHGT  248
ident                          |                 |          |  |  
Sbjct -----------vEWAHKH-GFKVQMHTGGtsipgssTVTAdDVIKTK-----PDVVSHIN  221
DSSP  -----------hHHHHHL-LLEEEEELLLlllllllLLLHhHHHHHL-----LLEEELLL


DSSP  ----LHHH-HHHHHHH-HLLLEEELLLLLllllhhhllLLLL-HHHHHHHLLL--LEEEL
Query ----EAYK-ISKVLAE-KKIPVVVGPLLTfrtklelkdLTXE-TIAKLLKDGV--LIALX  299
ident                                                    |        
Sbjct ggptAISVqEVDRIMDeTDFAMEIVQCGN--------pKIADyVARRAAEKGQlgRVIFG  273
DSSP  llllLLLHhHHHHHHHhLLLEEEEELLLL--------hHHHHhHHHHHHHHLLhhHEEEE


DSSP  LLLLL---LLHHHHHHHHHHH-HHHLLLHHHHHHLLLHHHHHHLLLllLLLLLLLLLLLL
Query CDHPV---IPLEFATVQAATA-XRYGAKEEDLLKILTVNPAKILGLedRIGSIEPGKDAD  355
ident  | |                         |      | |     ||    | | ||| ||
Sbjct NDAPSgtgLIPLGILRNMCQIaSMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEAD  331
DSSP  LLLLLlllLLLLHHHHHHHHHhHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLL


DSSP  EEEELL--------LLLL----LLLLEEEEEELLEEEEEL-------------l
Query LVVWSG--------HPFD----XKSVVERVYIDGVEVFRR-------------e  384
ident |                            | |||  |                 
Sbjct LIIMDTplgsvaedAMGAiaagDIPGISVVLIDGEAVVTKsrntppakraakil  385
DSSP  EEEEELllllllllHHHHhhhlLLLEEEEEEELLEEEELLllllllllllleel


No 14: Query=3ooqA Sbjct=1gkpA Z-score=22.9

back to top
DSSP  LEEEEEEEELlLLLLLEEEEEEEELLEEEEEELLLLLLL-LEEEELLLLEEEELEEEEEE
Query KILFKNATVFpITSRPFKGDVLVSNGKVEKVGENIEDPD-AEIVDLTGKFLFPGFVDAHS   59
ident   | ||           | |           | | | |   |  | |||  |||| | | 
Sbjct PLLIKNGEII-TADSRYKADIYAEGETITRIGQNLEAPPgTEVIDATGKYVFPGFIDPHV   59
DSSP  LEEEELLEEE-ELLEEEELEEEELLLLLLEEELLLLLLLlLEEEELLLLEEEELEEEEEE


DSSP  LlLLLLlllLHHHLLlllllllllllllhhhHLLLLlHHHHHHHLLLEEEEEELLLllll
Query HiGLFEegvGYYYSDgneatdpvtphvkaldGFNPQdPAIERALAGGVTSVXIVPGsanp  119
ident |                                         || || |           
Sbjct H-IYLP---FMATFA----------------KDTHE-TGSKAALMGGTTTYIEMCC-psr   97
DSSP  L-LLLE---ELLEEL----------------LLLHH-HHHHHHHHLLEEEEEEEEL-lll


DSSP  eeeeeeeeellllLHHH----HEEE---------------------EEEEEEEELLhhHH
Query vggqgsvikfrsiIVEE----CIVK---------------------DPAGLKXAFGenPK  154
ident                |                                           |
Sbjct nddalegyqlwksKAEGnsycDYTFhmavskfdektegqlreivadGISSFXIFLS--YK  155
DSSP  lllhhhhhhhhhhHHLLllllEEEEeeelllllllhhhhhhhhhhlLLLEEEEEEL--LL


DSSP  HHhhhlllllllhhhHHHHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLL
Query RVygerkqtpstrxgTAGVIRDyftkvknyxkkkelaqkegkeftetdlkxevgEXVLRK  214
ident                  |                                          
Sbjct NF----------fgvDDGEMYQ------------------------------tlRLAKEL  175
DSSP  LL----------lllLHHHHHH------------------------------hhHHHHHH


DSSP  LLLEEEEE-------------------------------lLHHHHHHHHHHHHHHLLLEE
Query KIPARXHA-------------------------------hRADDILTAIRIAEEFGFNLV  243
ident       |                                  |          |  |    
Sbjct GVIVTAHCenaelvgrlqqkllsegktgpewhepsrpeavEAEGTARFATFLETTGATGY  235
DSSP  LLEEEEEEllhhhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHHHHHHHLLEEE


DSSP  EEELLL--HHHH-HHHHHH-HLLLEEELL-LLLLLL---------------lhHHLL--L
Query IEHGTE--AYKI-SKVLAE-KKIPVVVGP-LLTFRT---------------klELKD--L  281
ident   |     |        |    |                               | |   
Sbjct VVHLSCkpALDAaMAAKARgVPIYIESVIpHFLLDKtyaerggveamkyimspPLRDkrN  295
DSSP  ELLLLLhhHHHHhHHHHHLlLLEEEEEEHhHHHLLHhhhhllhhhhhllllllLLLLlhH


DSSP  LLLHHHHHHHlLLLEEELLLLL--------------------LLLHHHHHHHH-HHHH-H
Query TXETIAKLLKdGVLIALXCDHP--------------------VIPLEFATVQA-ATAX-R  319
ident        |   |       ||                         |            |
Sbjct QKVLWDALAQ-GFIDTVGTDHCpfdteqkllgkeaftaipngIPAIEDRVNLLyTYGVsR  354
DSSP  HHHHHHHHHL-LLLLEEELLLLlllhhhhhhhlllhhhllllLLLLLLHHHHHhHHHLlL


DSSP  HLLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELL------------------
Query YGAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSG------------------  361
ident                 ||  ||  | | |  | ||||||                     
Sbjct GRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPqyrgtisvktqhvnndyn  414
DSSP  LLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELllleellhhhllllllll


DSSP  --lllLLLLLEEEEEELLEEEEEL-------------------l
Query --hpfDXKSVVERVYIDGVEVFRR-------------------e  384
ident              |   |    |                     
Sbjct gfegfEIDGRPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
DSSP  lllllEELLEEEEEEELLEEEEELleelllllllllllllllll


No 15: Query=3ooqA Sbjct=1k6wA Z-score=22.8

back to top
DSSP  -LEEEEEEEEllllLLLE-EEEEEEELLEEEEEELL--llllLLEEEELLLLEEEELEEE
Query -KILFKNATVfpitSRPF-KGDVLVSNGKVEKVGEN--iedpDAEIVDLTGKFLFPGFVD   56
ident       ||                   ||                  |       | || 
Sbjct aLQTIINARL----PGEEgLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVE   56
DSSP  lLLEEEEELL----LLLLlEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEE


DSSP  EEELLlLLLLLL----------------LHHHlllllllllllllllhhhhlLLLL--HH
Query AHSHIgLFEEGV----------------GYYYsdgneatdpvtphvkaldgfNPQD--PA   98
ident  | |                                                  |     
Sbjct PHIHL-DTTQTAgqpnwnqsgtlfegieRWAE-----------rkallthddVKQRawQT  104
DSSP  EEELL-LLLLLLllllllllllhhhhhhHHHL-----------lhhhllhhhHHHHhhHH


DSSP  HHHHHLLLEEEEEELL------------------------------LLLLLEeeeeeeee
Query IERALAGGVTSVXIVP------------------------------GSANPVggqgsvik  128
ident      | |   |                                                
Sbjct LKWQIANGIQHVRTHVdvsdatltalkamlevkqevapwidlqivaFPQEGI----lsyp  160
DSSP  HHHHHHLLEEEEEEEEellllllhhhhhhhhhhhhhlllleeeeeeELLLLL----llll


DSSP  lllllhhhheeeEEEEEEEELLHhhhhhhhhlllllLLHHHHHHHHHhhhhhhhhhhhhh
Query frsiiveecivkDPAGLKXAFGEnpkrvygerkqtpSTRXGTAGVIRdyftkvknyxkkk  188
ident                                      ||                     
Sbjct ngealleealrlGADVVGAIPHF------------eFTREYGVESLH-------------  195
DSSP  lhhhhhhhhhhlLLLEEEELHHH------------lLLHHHHHHHHH-------------


DSSP  hhhhhlllllllllhhhhhhHHHHLLLLLEEEEELL-----HHHHHHHHHHHHHHLL--L
Query elaqkegkeftetdlkxevgEXVLRKKIPARXHAHR-----ADDILTAIRIAEEFGF--N  241
ident                                 |             |    |   |    
Sbjct -----------------ktfALAQKYDRLIDVHCDEiddeqSRFVETVAALAHHEGMgaR  238
DSSP  -----------------hhhHHHHHHLLEEEEEELLlllllLLHHHHHHHHHHHHLLhhH


DSSP  EEEEELLLHHH--------HHHHHHHHLLLEEElLLLL--LLLLH----hhLLLLllHHH
Query LVIEHGTEAYK--------ISKVLAEKKIPVVVgPLLT--FRTKL----elKDLTxeTIA  287
ident     | |                |    |  |    |                       
Sbjct VTASHTTAMHSyngaytsrLFRLLKMSGINFVA-NPLVniHLQGRfdtypkRRGI-tRVK  296
DSSP  EEEEELHHHHHllhhhhhhHHHHHHHHLLEEEE-LHHHhhHHLLLllllllLLLL-lLHH


DSSP  HHHHLLLLEEELLLLL------LLLHhHHHHHHHH-HHHHLL----LHHHHHHLLLHHHH
Query KLLKDGVLIALXCDHP------VIPLeFATVQAAT-AXRYGA----KEEDLLKILTVNPA  336
ident   |  |       |                                   | |   |   |
Sbjct EMLESGINVCFGHDDVfdpwypLGTA-NMLQVLHMgLHVCQLmgygQINDGLNLITHHSA  355
DSSP  HHHHLLLLEEELLLLLllllllLLLL-LHHHHHHHhHHHLLLllhhHHHHHHHHHLHHHH


DSSP  HHLLlLLLLlLLLLLLLLLEEEELL----LLLLLLLLEEEEEELLEEEEELL--------
Query KILGlEDRIgSIEPGKDADLVVWSG----HPFDXKSVVERVYIDGVEVFRRE--------  384
ident   |        |  |  | |                 |      |               
Sbjct RTLN-LQDY-GIAAGNSANLIILPAengfDALRRQVPVRYSVRGGKVIASTQpaqttvyl  413
DSSP  HHLL-LLLL-LLLLLLLLLEEEELLllhhHHHHHLLLLLEEEELLEEEEELLllleeeel


DSSP  ----------
Query ----------  384
ident           
Sbjct eqpeaidykr  423
DSSP  lleeeellll


No 16: Query=3ooqA Sbjct=3e74A Z-score=22.8

back to top
DSSP  --LEEEEEEEELLlLLLLEEEEEEEELLEEEEEELLLLLlLLEEEELLLLEEEELEEEEE
Query --KILFKNATVFPiTSRPFKGDVLVSNGKVEKVGENIEDpDAEIVDLTGKFLFPGFVDAH   58
ident       || ||          |  |  ||    |    |   |  |  |    || ||||
Sbjct sfDLIIKNGTVIL-ENEARVVDIAVKGGKIAAIGQDLGD-AKEVXDASGLVVSPGXVDAH   58
DSSP  leEEEEELLEEEL-LLLEEELEEEEELLEEEEEELLLLL-EEEEEELLLLEEEELEEEEE


DSSP  ELlllllllllhhhlllllllllllllllhhhhLLLLlHHHHHHHLLLEEEEEELLL---
Query SHiglfeegvgyyysdgneatdpvtphvkaldgFNPQdPAIERALAGGVTSVXIVPG---  115
ident  |                                         |  || |     |    
Sbjct TH-------------------------------IGYE-TGTRAAAKGGITTXIEXPLnql   86
DSSP  EL-------------------------------LLHH-HHHHHHHHLLEEEEEELLLlll


DSSP  lllleeeeeeeeellLLLH-hhHEEE------------------EEEEEEEELlhhhhhh
Query sanpvggqgsvikfrSIIV-eeCIVK------------------DPAGLKXAFgenpkrv  156
ident                                                |            
Sbjct patvdrasielkfdaAKGKltiDAAQlgglvsynidrlheldevGVVGFXCFV-------  139
DSSP  lllllhhhhhhhhhhHLLLlllEEEEleellllllllhhhhhhhLLLLEEEEL-------


DSSP  hhhlllllllhhhHHHHHHHHhhhhhhhhhhhhhhhhlllllllllhhhhhhhHHHLLLL
Query ygerkqtpstrxgTAGVIRDYftkvknyxkkkelaqkegkeftetdlkxevgeXVLRKKI  216
ident                                                             
Sbjct ----------rdvNDWQFFKG------------------------------aqKLGELGQ  159
DSSP  ----------lllLHHHHHHH------------------------------hhHHHHHLL


DSSP  LEEEEEL-------------------------------LHHHHHHHHHHHHHHLLLEEEE
Query PARXHAH-------------------------------RADDILTAIRIAEEFGFNLVIE  245
ident |   |                                     |      |   |  |   
Sbjct PVLVHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAKVAGCRLHVC  219
DSSP  LEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHHHHLLLEEEL


DSSP  ELLLhHHHHHHHHHHL-----LLEEELLL--LLLL----------LLHHHLL---lLLLH
Query HGTEaYKISKVLAEKK-----IPVVVGPL--LTFR----------TKLELKD---lTXET  285
ident |                    |     |                                
Sbjct HVSS-PEGVEEVTRARqegqdITCESCPHyfVLDTdqfeeigtlaKCSPPIRdlenQKGX  278
DSSP  LLLL-HHHHHHHHHHHhllllEEEEELLHhhHLLHhhhhhhlhhhLLLLLLLlhhhHHHH


DSSP  HHHHHHlLLLEEELLLLL-----------------LLLHHHHH-HHHHHHH-HHLLLHHH
Query IAKLLKdGVLIALXCDHP-----------------VIPLEFAT-VQAATAX-RYGAKEED  326
ident   ||   |    |  ||                     |     |    |    |     
Sbjct WEKLFN-GEIDCLVSDHSpcppexkagnixkawggIAGLQSCXdVXFDEAVqKRGXSLPX  337
DSSP  HHHHHL-LLLLEELLLLLlllllllllllllllllLLLHHHHHhHHHHHHLlLLLLLHHH


DSSP  HHHLLLHHHHHHLLLlLLLLLLLLLLLLLEEEELL--------------------llllL
Query LLKILTVNPAKILGLeDRIGSIEPGKDADLVVWSG--------------------hpfdX  366
ident   |    | | | ||    | | |||||| |                             
Sbjct FGKLXATNAADIFGL-QQKGRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrtI  396
DSSP  HHHHHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELllleellhhhllllllllllllleE


DSSP  LLLEEEEEELLEEEEELL---------------
Query KSVVERVYIDGVEVFRRE---------------  384
ident           |      |               
Sbjct GARITKTILRGDVIYDIEqgfpvapkgqfilkh  429
DSSP  LLEEEEEEELLEEEEELLlllllllllleelll


No 17: Query=3ooqA Sbjct=2uz9A Z-score=22.7

back to top
DSSP  --LEEEEeEEELLLL----LLLEE-EEEEEE-LLEEEEEELL-------lLLLL--lEEE
Query --KILFKnATVFPIT----SRPFK-GDVLVS-NGKVEKVGEN-------iEDPD--aEIV   43
ident      |   |    |              ||  ||     |         |      || 
Sbjct plAHIFR-GTFVHSTwtcpMEVLRdHLLGVSdSGKIVFLEEAsqqeklakEWCFkpcEIR   59
DSSP  llLEEEE-EEEEELLllllLEEEEeEEEEELlLLLEEEEEEHhhhhhhhhHHLLlhhHEE


DSSP  ELL-LLEEEELEEEEEELLlLLLLL--------------lLHHHLLlllllllllllllh
Query DLT-GKFLFPGFVDAHSHIgLFEEG--------------vGYYYSDgneatdpvtphvka   88
ident  |    |  || || | |                                          
Sbjct ELShHEFFMPGLVDTHIHA-SQYSFagssidlpllewltkYTFPAE----------hrfq  108
DSSP  ELLlLLEEEELEEEEEEEH-HHHHHllllllllhhhhhhhLHHHHH----------hhhh


DSSP  hhhlLLLL--HHHHHHHLLLEEEEEELL------------------------LLLL----
Query ldgfNPQD--PAIERALAGGVTSVXIVP------------------------GSAN----  118
ident               | |  | |                                      
Sbjct nidfAEEVytRVVRRTLKNGTTTACYFAtihtdssllladitdkfgqrafvgKVCMdlnd  168
DSSP  lhhhHHHHhhHHHHHHHHLLEEEEEEELlllhhhhhhhhhhhhhhlleeeeeLEELllll


DSSP  ----------leeeeeeeeelllllHHHHeEEEEeEEEE-ELLHhhhhhhhhlllllllh
Query ----------pvggqgsvikfrsiiVEECiVKDPaGLKX-AFGEnpkrvygerkqtpstr  167
ident                                  |                          
Sbjct tfpeyketteesiketerfvsemlqKNYS-RVKP-IVTPrFSLS----------------  210
DSSP  llllllllhhhhhhhhhhhhhhhhhHLLL-LEEE-EEEElLHHH----------------


DSSP  hhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEEL----
Query xgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAH----  223
ident                                         |            |      
Sbjct -cSETLMG------------------------------elGNIAKTRDLHIQSHISenrd  239
DSSP  -lLHHHHH------------------------------hhHHHHHHHLLEEEEEELllhh


DSSP  -----------lhHHHHHHHHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEELL--L
Query -----------raDDILTAIRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGP--L  269
ident                               |  ||         |  |        |   
Sbjct eveavknlypsykNYTSVYDKNN-lltnKTVMAHGCYLSAeELNVFHERGASIAHCPnsN  298
DSSP  hhhhhhhhlllllLHHHHHHHLL-llllLEEEEELLLLLHhHHHHHHHHLLEEEELHhhH


DSSP  LLLLllhhhlLLLLlHHHHHHHLLLLEEELLLLL-LLLHhHHHHHHHH-HHHH-------
Query LTFRtklelkDLTXeTIAKLLKDGVLIALXCDHP-VIPLeFATVQAAT-AXRY-------  320
ident |                   ||  | | |  |                            
Sbjct LSLS------SGFL-NVLEVLKHEVKIGLGTDVAgGYSY-SMLDAIRRaVMVSnillink  350
DSSP  HHLL------LLLL-LHHHHHHLLLEEEELLLLLlLLLL-LHHHHHHHhHHHHhhhhhll


DSSP  ----LLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELL---------------
Query ----GAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSG---------------  361
ident                |      |||   ||  | ||  |                     
Sbjct vnekSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPkasdspidlfygdff  410
DSSP  llllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLlllllllllllhhhh


DSSP  ---------lLLLLLL--LEEEEEELLEEEEELL
Query ---------hPFDXKS--VVERVYIDGVEVFRRE  384
ident                     | ||  |  |    
Sbjct gdiseaviqkFLYLGDdrNIEEVYVGGKQVVPFS  444
DSSP  lllllhhhhhHHHHLLhhHEEEEEELLEEEELLL


No 18: Query=3ooqA Sbjct=1yrrB Z-score=22.5

back to top
DSSP  lEEEEEEEELLLLlLLEE-EEEEEELLEEEEEELL-LLLLLLEEEELLLLEEEELEEEEE
Query kILFKNATVFPITsRPFK-GDVLVSNGKVEKVGEN-IEDPDAEIVDLTGKFLFPGFVDAH   58
ident          |           |    |    |       |  |   | |  | ||| |  
Sbjct -YALTQGRIFTGH-EFLDdHAVVIADGLIKSVCPVaELPPEIEQRSLNGAILSPGFIDVQ   58
DSSP  -LEEELLEEELLL-LEELlEEEEEELLEEEEEEEHhHLLLLLLEEELLLLEEEELEEEEE


DSSP  ELL---LLLLlllLHHHLLlllllllllllllhhhHLLLLLHHHHHHHLLLEEEEEELLL
Query SHI---GLFEegvGYYYSDgneatdpvtphvkaldGFNPQDPAIERALAGGVTSVXIVPG  115
ident         |                                         | |       
Sbjct LNGcggVQFN---DTAEAV----------------SVETLEIMQKANEKSGCTNYLPTLI   99
DSSP  ELEellEELL---LLLLLL----------------LHHHHHHHHHHHHLLLEEEEEEEEL


DSSP  lllleeeeeeeeellllLHHHH---EEEE---------------------EEEEEEEllh
Query sanpvggqgsvikfrsiIVEEC---IVKD---------------------PAGLKXAfge  151
ident                                                         |   
Sbjct -ttsdelmkqgvrvmreYLAKHpnqALGLhlegpwlnaalvdflcenadvITKVTLA---  155
DSSP  -lllhhhhhhhhhhhhhHHHHLlllLLLEeeellllllhhhhhhhhlhhhEEEEEEL---


DSSP  hhhhhhhhlllllllhhhhhHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhHHHH
Query npkrvygerkqtpstrxgtaGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevGEXV  211
ident                                                             
Sbjct -------------------pEMVPAEV----------------------------iSKLA  168
DSSP  -------------------hHHLLHHH----------------------------hHHHH


DSSP  hLLLLLEEEEEllhHHHH-HHHHHHHhhLLLEEEEELLL--------hhhhHHHHHHH-L
Query lRKKIPARXHAhraDDIL-TAIRIAEefGFNLVIEHGTE--------aykiSKVLAEK-K  261
ident     |            |  |              |                        
Sbjct -NAGIVVSAGH--sNATLkEAKAGFR--AGITFATHLYNampyitgrepglAGAILDEaD  223
DSSP  -HHLLEEEELL--lLLLHhHHHHHHH--HLEEEELLLLLllllllllllhhHHHHHHLlL


DSSP  LLEEELlLLLLlllhhhllLLLLHHHHHHHLLL-LEEELLLLL--LLLHhhHHHHHHHH-
Query IPVVVGpLLTFrtklelkdLTXETIAKLLKDGV-LIALXCDHP--VIPLefATVQAATA-  317
ident |                       |            |  |                   
Sbjct IYCGII-ADGL-------hVDYANIRNAKRLKGdKLCLVTDATsgSSLT--MIEGVRNLv  273
DSSP  LEEEEE-LLLL-------lLLHHHHHHHHHHHHhHEEEELLLLllLLLL--HHHHHHHHh


DSSP  HHHLLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLLlllllLEEEEEELL
Query XRYGAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSGHPfdxksVVERVYIDG  377
ident    |      |   |  ||   | | | |    || | |                    |
Sbjct EHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDF-----KITKTIVNG  328
DSSP  HHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLL-----LEEEEEELL


DSSP  EEEEELl
Query VEVFRRe  384
ident  ||    
Sbjct NEVVTQ-  334
DSSP  EEEEEL-


No 19: Query=3ooqA Sbjct=3griA Z-score=22.3

back to top
DSSP  LEEEEEEEELlllLLLEEEEEEEELLEEEEEELLLLLL-LLEEEELLLLEEEELEEEEEE
Query KILFKNATVFpitSRPFKGDVLVSNGKVEKVGENIEDP-DAEIVDLTGKFLFPGFVDAHS   59
ident   | ||  |          | |            ||      | |  | |  ||||| | 
Sbjct XKLIKNGKVL-qnGELQQADILIDGKVIKQIAPAIEPSnGVDIIDAKGHFVSPGFVDVHV   59
DSSP  LEEEELLEEE-elLEEEELEEEEELLEEEEEELLLLLLlLLEEEELLLLEEEELEEEEEE


DSSP  lLLLLlllllhHHLLlllllllllllllhhhHLLLlLHHHHHHHLLLEEEEEELLLllll
Query hIGLFeegvgyYYSDgneatdpvtphvkaldGFNPqDPAIERALAGGVTSVXIVPGsanp  119
ident                                           |  || | |   |     
Sbjct -HLRE------PGGE---------------yKETI-ETGTKAAARGGFTTVCPXPN-trp   95
DSSP  -LLLL------LLLL---------------lLLLH-HHHHHHHHHLLEEEEEELLL-lll


DSSP  eeeeeeeeellllLHHH----HEEE----------------------EEEEEEEEllHHH
Query vggqgsvikfrsiIVEE----CIVK----------------------DPAGLKXAfgENP  153
ident                                                             
Sbjct vpdsvehfealqkLIDDnaqvRVLPyasittrqlgkelvdfpalvkeGAFAFTDD--GVG  153
DSSP  llllhhhhhhhhhHHHHhlllEELLleellhhhlllllllhhhhhllLLLLEEEL--LLL


DSSP  HhhhhhlllllllhhHHHHHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhhhHHHL
Query KrvygerkqtpstrxGTAGVIRDyftkvknyxkkkelaqkegkeftetdlkxevgeXVLR  213
ident                 ||                                          
Sbjct V--------------QTASXXYE------------------------------gxiEAAK  169
DSSP  L--------------LLHHHHHH------------------------------hhhHHHH


DSSP  LLLLEEEEE----------------------------lLHHHHHHHHHHHHHHLLLEEEE
Query KKIPARXHA----------------------------hRADDILTAIRIAEEFGFNLVIE  245
ident        |                                  |      ||  |      
Sbjct VNKAIVAHCednsliyggaxhegkrskelgipgipnicESVQIARDVLLAEAAGCHYHVC  229
DSSP  HLLLEEELLllhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHHHHLLLEEEL


DSSP  ELLL--HHHHHHHHHH--HLLLEEELLL--LLLL----------llhHHLL---LLLLHh
Query HGTE--AYKISKVLAE--KKIPVVVGPL--LTFR----------tklELKD---LTXETi  286
ident |                       | |   |                             
Sbjct HVSTkeSVRVIRDAKRagIHVTAEVTPHhlLLTEddipgnnaiykxnPPLRsteDREAL-  288
DSSP  LLLLhhHHHHHHHHHHllLLEEEEELHHhhHLLHhhlllllhhhlllLLLLlhhHHHHH-


DSSP  HHHHHLLLLEEELLLLL-----------------LLLHHHHHHHHHHHH--HHLLLHHHH
Query AKLLKDGVLIALXCDHP-----------------VIPLEFATVQAATAX--RYGAKEEDL  327
ident    | ||       ||                      | |     |            |
Sbjct LEGLLDGTIDCIATDHAphardekaqpxekapfgIVGSETAFPLLYTHFvkNGDWTLQQL  348
DSSP  HHHHHLLLLLEELLLLLlllhhhhllllllllllLLLLLLHHHHHHHHHllLLLLLHHHH


DSSP  HHLLLHHHHHHLLLLllLLLLLLLLLLLEEEELLL--------------------lllLL
Query LKILTVNPAKILGLEdrIGSIEPGKDADLVVWSGH--------------------pfdXK  367
ident    ||  |     ||   |       |||                               
Sbjct VDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDseqeikgedflskadntpfigykVY  406
DSSP  HHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLlleellhhhllllllllllllleEL


DSSP  LLEEEEEELLEEEEELl
Query SVVERVYIDGVEVFRRe  384
ident          |   |   
Sbjct GNPILTXVEGEVKFEG-  422
DSSP  LEEEEEEELLEEEEEL-


No 20: Query=3ooqA Sbjct=3nqbA Z-score=22.0

back to top
DSSP  ------------------------LEEEEEEEELLLLL-LLEEEEEEEELLEEEEEELLL
Query ------------------------KILFKNATVFPITS-RPFKGDVLVSNGKVEKVGENI   35
ident                           |    |            |          | |  
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDVVTgELRPADIGIVGALIASVHEPA   60
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLLlLEEELEEEEELLEEEEEELLL


DSSP  -LLLLLEEEELLLLEEEELEEEEEELLLLLLLlllhhhlllllllllllllllhhhhlLL
Query -EDPDAEIVDLTGKFLFPGFVDAHSHIGLFEEgvgyyysdgneatdpvtphvkaldgfNP   94
ident      |   |  |    ||  | | ||                                |
Sbjct sRRDAAQVIDAGGAYVSPGLIDTHXHIESSXI--------------------------TP   94
DSSP  lLLLEEEEEELLLLEEEELEEEEEELHHHHLL--------------------------LH


DSSP  LLhHHHHHHLLLEEEEEELLLlllleeeeeeeeellllLHHHH-----------------
Query QDpAIERALAGGVTSVXIVPGsanpvggqgsvikfrsiIVEEC-----------------  137
ident          | |||     |                    |                   
Sbjct AA-YAAAVVARGVTTIVWDPH-efgnvhgvdgvrwaakAIENLplraillapscvpsapg  152
DSSP  HH-HHHHHHLLLEEEEEELLH-hhhhhhlhhhhhhhhhHHLLLlleeeeeelllllllll


DSSP  -----------------eeEEEEEEE-EELLhhhhhhhhhlllllllhhhHHHHhHHHHh
Query -----------------ivKDPAGLK-XAFGenpkrvygerkqtpstrxgTAGViRDYFt  179
ident                        |                                    
Sbjct lerggadfdaailadllswPEIGGIAeIXNX-----------------rgVIER-DPRX-  193
DSSP  lllllllllhhhhhhhhllLLEEEEEeELLH-----------------hhHHLL-LHHH-


DSSP  hhhhhhhhhhhhhhlllllllllhhhHHHHHHHLLLLLEEEEELLHHhhhHHHHHHHhhL
Query kvknyxkkkelaqkegkeftetdlkxEVGEXVLRKKIPARXHAHRADdilTAIRIAEefG  239
ident                                 |        ||                 
Sbjct -------------------------sGIVQAGLAAEKLVCGHARGLK-naDLNAFXA--A  225
DSSP  -------------------------hHHHHHHHHHLLEEEELLLLLL-hhHHHHHHH--L


DSSP  LLEEEeELLLHHHHHHHHHHHLLLEEELLLLLllllhhhllLLLLHHHHHHHLL----lL
Query FNLVIeHGTEAYKISKVLAEKKIPVVVGPLLTfrtklelkdLTXETIAKLLKDG----vL  295
ident       |                                           |         
Sbjct GVSSD-HELVSGEDLXAKLRAGLTIELRGSHD---------HLLPEFVAALNTLghlpqT  275
DSSP  LLLEE-LLLLLHHHHHHHHHLLLEEEEELLLH---------HHHHHHHHHHHHHlllllL


DSSP  EEELLLLLL----llhHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLLlLLLLLLLLL
Query IALXCDHPV----iplEFATVQAATAXRYGAKEEDLLKILTVNPAKILGLeDRIGSIEPG  351
ident   |  |                     ||| | |  |   | | |  ||     | |  |
Sbjct VTLCTDDVFpddllqgGGLDDVVRRLVRYGLKPEWALRAATLNAAQRLGR-SDLGLIAAG  334
DSSP  EEEELLLLLhhhhhhlLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLL


DSSP  LLLLEEEELlLLLLllLLEEEEEELLEEEEEL----------------------------
Query KDADLVVWSgHPFDxkSVVERVYIDGVEVFRR----------------------------  383
ident   || ||              |   |  |                               
Sbjct RRADIVVFE-DLNG--FSARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxand  391
DSSP  LLLLEEEEL-LLLL--LLEEEEEELLEEEEELleelllllllllhhhllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  383
ident                                                             
Sbjct flvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktg  451
DSSP  hllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  383
ident                                                             
Sbjct fltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailp  511
DSSP  eeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  383
ident                                                             
Sbjct lplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgi  571
DSSP  lllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllle


DSSP  ---------------l
Query ---------------e  384
ident                 
Sbjct advltgkvxespviev  587
DSSP  eelllleeellleeel


No 21: Query=3ooqA Sbjct=4b3zD Z-score=21.6

back to top
DSSP  -LEEEEEEEELlLLLLLEEEEEEEELLEEEEEELLLLL-LLLEEEELLLLEEEELEEEEE
Query -KILFKNATVFpITSRPFKGDVLVSNGKVEKVGENIED-PDAEIVDLTGKFLFPGFVDAH   58
ident    | |              ||    |     |||             |    ||  |  
Sbjct dRLLIKGGRII-NDDQSLYADVYLEDGLIKQIGENLIVpGGVKTIEANGRMVIPGGIDVN   59
DSSP  lEEEEEEEEEE-LLLLEEEEEEEEELLEEEEEELLLLLlLLLEEEELLLLEEEELEEEEE


DSSP  ELLlLLLLLllhhhlllllllllllllllhhhhlLLLLhHHHHHHLLLEEEEEELLLlll
Query SHIgLFEEGvgyyysdgneatdpvtphvkaldgfNPQDpAIERALAGGVTSVXIVPGsan  118
ident                                            || || |          
Sbjct TYL-QKTAA------------------------dDFFQ-GTRAALVGGTTMIIDHVV-pe   92
DSSP  ELL-LLLLL------------------------lLHHH-HHHHHHHLLEEEEEEEEL-ll


DSSP  leeeeeeeeellllLHHH----HEEE----------------------EEEEEEEELLhh
Query pvggqgsvikfrsiIVEE----CIVK----------------------DPAGLKXAFGen  152
ident                                                             
Sbjct pgsslltsfekwheAADTksccDYSLhvditswydgvreelevlvqdkGVNSFQVYMA--  150
DSSP  llllhhhhhhhhhhHHHLllllEEEEeeelllllllhhhhhhhhhhllLLLEEEEELL--


DSSP  HHHHhhhlllllllhhHHHHHHHHHhhhhhhhhhhhhhhhhlllllllllhhhhhhhHHH
Query PKRVygerkqtpstrxGTAGVIRDYftkvknyxkkkelaqkegkeftetdlkxevgeXVL  212
ident  | |                                                        
Sbjct YKDV----------yqMSDSQLYEA------------------------------ftFLK  170
DSSP  LLLL----------llLLHHHHHHH------------------------------hhHHH


DSSP  LLLLLEEEEE-------------------------------lLHHHHHHHHHHHHHHLLL
Query RKKIPARXHA-------------------------------hRADDILTAIRIAEEFGFN  241
ident         ||                                 |     || ||      
Sbjct GLGAVILVHAengdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAGRINCP  230
DSSP  HHLLEEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHHHHLLL


DSSP  EEEEELLL--HHHH-HHHHHH-HLLLEEELL--LLLLLL--------------lhHHLL-
Query LVIEHGTE--AYKI-SKVLAE-KKIPVVVGP--LLTFRT--------------klELKD-  280
ident   |       |  |                   | |  |                     
Sbjct VYITKVMSksAADIiALARKKgPLVFGEPIAasLGTDGThywsknwakaaafvtsPPLSp  290
DSSP  EEEEEELLhhHHHHhHHHHHHlLLEEEEELHhhHHLLLHhhhlllhhhhhhllllLLLLl


DSSP  ---LLLLHHHHHHHlLLLEEELLLLL--------------------LLLHHHHHHHHH-H
Query ---LTXETIAKLLKdGVLIALXCDHP--------------------VIPLEFATVQAA-T  316
ident            |   | |      |                     |   |         
Sbjct dptTPDYLTSLLAC-GDLQVTGSGHCpystaqkavgkdnftlipegVNGIEERMTVVWdK  349
DSSP  lllHHHHHHHHHHH-LLLLLLLLLLLlllhhhhhhhlllhhhllllLLLLLLHHHHHHhH


DSSP  HHHHLLLH-HHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL-------------
Query AXRYGAKE-EDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSGH-------------  362
ident |   |             | |||  |  | | |  | ||| | |                
Sbjct AVATGKMDeNQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDklktitakshksa  409
DSSP  HLLLLLLLhHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEeeeelllllllll


DSSP  -------lllLLLLEEEEEELLEEEEELL-------------------------------
Query -------pfdXKSVVERVYIDGVEVFRRE-------------------------------  384
ident                  |   |  ||                                  
Sbjct veynifegmeCHGSPLVVISQGKIVFEDGninvnkgmgrfiprkafpehlyqrvkirnkv  469
DSSP  llllllllleEEEEEEEEEELLEEEEELLeellllllllllllllllhhhhhhhhhhhhh


DSSP  --------
Query --------  384
ident         
Sbjct fglqgvsr  477
DSSP  llllllll


No 22: Query=3ooqA Sbjct=4rdvB Z-score=20.1

back to top
DSSP  lEEEEEEEELLlLLLLEE-EEEEEE-LLEEEEEEL-LLLLlllEEEELlLLEEEELEEEE
Query kILFKNATVFPiTSRPFK-GDVLVS-NGKVEKVGE-NIEDpdaEIVDLtGKFLFPGFVDA   57
ident                         |  |           |       | |    ||    
Sbjct -SAIFAERALL-PEGWARnVRFEISaDGVLAEIRPdANAD---GAERL-GGAVLPGMPNL   54
DSSP  -LEEEEEEEEE-LLEEEEeEEEEELlLLLEEEEELlLLLL---LLEEL-LLLEEELEEEE


DSSP  EELLlLLLLL-------------------lLHHHLllllllllllllllhhhhlLLLL--
Query HSHIgLFEEG-------------------vGYYYSdgneatdpvtphvkaldgfNPQD--   96
ident |||                            |                            
Sbjct HSHA-FQRAMaglaevagnpndsfwtwrelMYRMV------------arlspeqIEVIac  101
DSSP  EELH-HHHHHlllllllllllllhhhhhhhHHHHH------------llllhhhHHHHhh


DSSP  HHHHHHHLLLEEEEEELLL--lllleeeeeeeeelllLLHHHH-----------------
Query PAIERALAGGVTSVXIVPG--sanpvggqgsvikfrsIIVEEC-----------------  137
ident       |  | | |                        |                     
Sbjct QLYIEMLKAGYTAVAEFHYvhhdldgrsyadpaelslRISRAAsaagigltllpvlysha  161
DSSP  HHHHHHHHHLEEEEEEEELllllllllllllllhhhhHHHHHHhhhlleeeeeellllee


DSSP  -----------------------------------EEEEeEEEEEElLHHHhhhhhhlll
Query -----------------------------------IVKDpAGLKXAfGENPkrvygerkq  162
ident                                                             
Sbjct gfggqpasegqrrfingseaylellqrlrapleaaGHSL-GLCFHS-LRAV---------  210
DSSP  ellleellhhhllllllhhhhhhhhhhhhhhhhhhLLEE-LEEELL-LLLL---------


DSSP  llllhhhHHHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhHHHHhhlLLLLEEEEE
Query tpstrxgTAGVIRDYFtkvknyxkkkelaqkegkeftetdlkxeVGEXvlrKKIPARXHA  222
ident        |   |                                          |   | 
Sbjct -------TPQQIATVL----------------------------AAGH---DDLPVHIHI  232
DSSP  -------LHHHHHHHH----------------------------LLLL---LLLLEEEEE


DSSP  L-------------lhHHHHHHHHHHHhhllLEEEEELLLHHH-HHHHHHHHLLLEEELL
Query H-------------raDDILTAIRIAEefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGP  268
ident                                     | | |        |          
Sbjct AeqqkevddcqawsgrRPLQWLYENVA-vdqRWCLVHATHADPaEVAAMARSGAVAGLCL  291
DSSP  LllhhhhhhhhhhhllLHHHHHHHHLL-lllLEEEEELLLLLHhHHHHHHHHLLEEEELH


DSSP  --LLLLLllhhhlLLLLlHHHHHHHLLLLEEELLLLLLLLhhHHHHHHHHHHH-------
Query --LLTFRtklelkDLTXeTIAKLLKDGVLIALXCDHPVIPleFATVQAATAXR-------  319
ident              |         |  |       |  |                      
Sbjct stEANLG------DGIF-PATDFLAQGGRLGIGSDSHVSL--SVVEELRWLEYgqrlrdr  342
DSSP  hhHHHLL------LLLL-LHHHHHHLLLEEEELLLLLLLL--LHHHHHHHHHHhhhhhhl


DSSP  --HLLL-------HHHHHHLLLHHHHHHLLLllLLLLLLLLLLLLEEEELL---------
Query --YGAK-------EEDLLKILTVNPAKILGLedRIGSIEPGKDADLVVWSG---------  361
ident                 |        |  ||    |||   |  ||| |  |         
Sbjct krNRLYrddqpmiGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGndpylasae  400
DSSP  llLLLLllllllhHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLllhhhhlll


DSSP  ------lLLLLLL--LEEEEEELLEEEEEL--------------------l
Query ------hPFDXKS--VVERVYIDGVEVFRR--------------------e  384
ident                 |  |   |  | |                      
Sbjct gdallnrWLFAGGdrQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
DSSP  lhhhhhhHHHHLLhhHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl


No 23: Query=3ooqA Sbjct=2ogjA Z-score=18.6

back to top
DSSP  --LEEEEEEEELLLL--LLLEEEEEEEE-LLEEEEEELLLLLLLLEEEELlLLEEEELEE
Query --KILFKNATVFPIT--SRPFKGDVLVS-NGKVEKVGENIEDPDAEIVDLtGKFLFPGFV   55
ident    ||  |               | |    ||   ||     |          |  || |
Sbjct qaPILLTNVKPVGFGkgASQSSTDILIGgDGKIAAVGSALQAPADTQRID-AAFISPGWV   59
DSSP  llLEEEEEEEELLLLllLLLLLEEEEELlLLLEEEEELLLLLLLLEEELL-LLEEEELEE


DSSP  EEEELlLLLLllllhhHLLLllllllllllllhhhhlllllhHHHH-HHLLLEEEEEELL
Query DAHSHiGLFEegvgyyYSDGneatdpvtphvkaldgfnpqdpAIER-ALAGGVTSVXIVP  114
ident | | |             |                                |||      
Sbjct DLHVH-IWHG------GTDI--------------------siRPSEcGAERGVTTLVDAG   92
DSSP  EEEEL-LLLL------LLLL--------------------llLHHHlLHHHLEEEEEEEL


DSSP  LlllleeeeeeeeelllLLHHHH-------------------------------------
Query GsanpvggqgsvikfrsIIVEEC-------------------------------------  137
ident                   | |                                       
Sbjct S-----ageanfhgfreYIIEPSrerikaflnlgsiglvacnrvpelrdikdidldrile  147
DSSP  L-----lllllhhhhhhHLLLLLlleeeeeeelllllllllllllllllhhhllhhhhhh


DSSP  ----eeEEEEEEEEELL-HHHHhhhhhlllllllhHHHHHHHHhhhhhhhhhhhhhhhhh
Query ----ivKDPAGLKXAFG-ENPKrvygerkqtpstrXGTAGVIRdyftkvknyxkkkelaq  192
ident           ||                                                
Sbjct cyaensEHIVGLXVRAShVITG-------------SWGVTPVK-----------------  177
DSSP  hhhlllLLEEEEEEEELhHHHL-------------LLLLHHHH-----------------


DSSP  hlllllllllhhhhhHHHHHLLLLLEEEEELL-hhHHHHHHHHHHhhllLEEEEELL---
Query kegkeftetdlkxevGEXVLRKKIPARXHAHR-adDILTAIRIAEefgfNLVIEHGT---  248
ident                       | |   |             |        |  |     
Sbjct -------------lgKKIAKILKVPXXVHVGEppaLYDEVLEILG---pGDVVTHCFngk  221
DSSP  -------------hhHHHHHHHLLLEEEEELLlllLHHHHHHHLL---lLLEEELLLlll


DSSP  ---LHHH---HHHHHHHHL-LLEEELLLLLllllhhhllLLLLHHHHHH-HLLLLEEELL
Query ---EAYK---ISKVLAEKK-IPVVVGPLLTfrtklelkdLTXETIAKLL-KDGVLIALXC  300
ident                     |    |                                  
Sbjct sgsSIXEdedLFNLAERCEgIRLDIGHGGA--------sFSFKVAEAAIaRGLLPFSIST  273
DSSP  lllLLLLlhhHHHHHHHLLlLEEELLLLLL--------lLLHHHHHHHHhLLLLLLLLLL


DSSP  LLL------LLLHhhHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLLLLLllLLLLLLLL
Query DHP------VIPLefATVQAATAXRYGAKEEDLLKILTVNPAKILGLEDRigSIEPGKDA  354
ident |                             |      | |||    |         |  |
Sbjct DLHghsxnfPVWD--LATTXSKLLSVDXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRA  330
DSSP  LLLllllllLLLL--HHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLL


DSSP  LEEEELlllLLLL-----------------lLEEEEEELLEEEEEL-----l
Query DLVVWSghpFDXK-----------------sVVERVYIDGVEVFRR-----e  384
ident |  |                                 |              
Sbjct DFTVFD---LVDAdleatdsngdvsrlkrlfEPRYAVIGAEAIAASryipra  379
DSSP  EEEEEE---EEEEeeeeellllleeeeeeeeEEEEEEELLEEEELLllllll


No 24: Query=3ooqA Sbjct=1a5kC Z-score=16.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -----LEEEEEEEELlLLLLLEEEEEEEELLEEEEEELL----------LLLL-LLEEEE
Query -----KILFKNATVFpITSRPFKGDVLVSNGKVEKVGEN----------IEDP-DAEIVD   44
ident           ||          | |  |  |     |            |      |   
Sbjct aadcvDLVLTNALIV-DHWGIVKADIGVKDGRIFAIGKAgnpdiqpnvtIPIGaATEVIA  119
DSSP  hhhllLEEEEEEEEE-ELLEEEEEEEEEELLEEEEEELEelllllllllEELLlLLEEEE


DSSP  LLLLEEEELEEEEEELllLLLLlllhhhlllllllllllllllhhhhlllllHHHHHHHL
Query LTGKFLFPGFVDAHSHigLFEEgvgyyysdgneatdpvtphvkaldgfnpqdPAIERALA  104
ident   ||    |  | | |                                       | || 
Sbjct AEGKIVTAGGIDTHIH--WICP------------------------------QQAEEALV  147
DSSP  LLLLEEEELEEEEEEE--LLLL------------------------------LHHHHHHH


DSSP  LLEEEEEEL----------LLLLlleeeeeeeeelllLLHHHH--EEEE-----------
Query GGVTSVXIV----------PGSAnpvggqgsvikfrsIIVEEC--IVKD-----------  141
ident  |||                                                        
Sbjct SGVTTMVGGgtgpaagthaTTCT----pgpwyisrmlQAADSLpvNIGLlgkgnvsqpda  203
DSSP  HLEEEEEEElllllhhhhhLLLL----lhhhhhhhhhHHHLLLllEEEEeeelllllhhh


DSSP  --------EEEEEEEllHHHHhhhhhlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhh
Query --------PAGLKXAfgENPKrvygerkqtpstrxgTAGVIRdyftkvknyxkkkelaqk  193
ident           ||     |                  |   |                   
Sbjct lreqvaagVIGLEIH--EDWG--------------aTPAAID------------------  229
DSSP  hhhhhhhlLLEEEEE--HHHL--------------lLHHHHH------------------


DSSP  lllllllllhhhhhHHHHHLLLLLEEEEE---llhhHHHHHHHHHHhhLLLEEEEELLL-
Query egkeftetdlkxevGEXVLRKKIPARXHA---hradDILTAIRIAEefGFNLVIEHGTE-  249
ident                       |    |                    |      |    
Sbjct ------------caLTVADEMDIQVALHSdtlnesgFVEDTLAAIG--GRTIHTFHTEGa  275
DSSP  ------------hhHHHHHHHLLEEEEELlllllllLHHHHHHHHL--LLLEEELLLLLl


DSSP  -------HHHHhhhHHHHLLLEEEL-LLLL---------------------------llL
Query -------AYKIskvLAEKKIPVVVG-PLLT---------------------------frT  274
ident                |   |      | |                               
Sbjct ggghapdIITA---CAHPNILPSSTnPTLPytlntidehldmlmvchhldpdiaedvafA  332
DSSP  lllllllHHHH---HHLLLEEEEEEhHHLLllllhhhhhhhhhhhhhllllllhhhhhlL


DSSP  LHHH--LLLL--LLHHHHHHhlllLEEELLLLL-LLLHHHHHHHHHHH-HHHL-------
Query KLEL--KDLT--XETIAKLLkdgvLIALXCDHP-VIPLEFATVQAATA-XRYG-------  321
ident                               |                   |         
Sbjct ESRIrrETIAaeDVLHDLGA----FSLTSSDSQaMGRVGEVILRTWQVaHRMKvqrgala  388
DSSP  LLLLlhHHHHhhHHHHHLLL----LLEEELLLLlLLLLLLHHHHHHHHhHHHHhhhllll


DSSP  --------lLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEEL--LLLLllllLEE
Query --------aKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWS--GHPFdxksVVE  371
ident                   | |||   |     |||| || |||||||             
Sbjct eetgdndnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSpaFFGV----KPA  444
DSSP  lllllllhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELhhHLLL----LLL


DSSP  EEEELLEEEEELL-----------------------------------------------
Query RVYIDGVEVFRRE-----------------------------------------------  384
ident  |   |                                                      
Sbjct TVIKGGMIAIAPMgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerl  504
DSSP  EEEELLEEEEEEEllllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  384
ident                                                             
Sbjct nlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryf  564
DSSP  lllleeeellllllllhhhllllllllleeelllllleeelleellllllllllllllll


DSSP  --
Query --  384
ident   
Sbjct lf  566
DSSP  ll


No 25: Query=3ooqA Sbjct=2imrA Z-score=14.9

back to top
DSSP  --LEEEEEEEELLLlllLEEEEEEEELLEEEEEE--LLLL--LLLLEEEELllLEEEELE
Query --KILFKNATVFPItsrPFKGDVLVSNGKVEKVG--ENIE--DPDAEIVDLtgKFLFPGF   54
ident     |               | | |    |   |         | |           |  
Sbjct htPRLLTCDVLYTG--aQSPGGVVVVGETVAAAGhpDELRrqYPHAAEERA-gAVIAPPP   57
DSSP  llEEEEEELEEELL--eELLEEEEEELLEEEEEElhHHHHhhLLLLEEEEL-lLEELLLL


DSSP  EEEEELLLL--------------llllLLHHHLLlllllllllllllhhhHLLLlLHHHH
Query VDAHSHIGL--------------feegVGYYYSDgneatdpvtphvkaldGFNPqDPAIE  100
ident | || |                                            |         
Sbjct VNAHTHLDMsayefqalpyfqwipevvIRGRHLR----------------GVAAaQAGAD  101
DSSP  LEEEEELLLlhhhhhhlhhhhllhhhhHHHLLLL----------------HHHHhHHHHH


DSSP  HHHLLLEEEEEELLLlllleeeeeeeeelllllHHHH-----------------------
Query RALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEEC-----------------------  137
ident      |   |                                                  
Sbjct TLTRLGAGGVGDIVW----------apevmdalLAREdlsgtlyfevlnpfpdkadevfa  151
DSSP  HHHHLLLLLEEEEEL----------lhhhhhhhHLLLllleeeeeeellllhhhhhhhhh


DSSP  --------------EEEEEeEEEE-ELLHhhhhhhhhlllllllhhhhHHHHHhhhhhhh
Query --------------IVKDPaGLKX-AFGEnpkrvygerkqtpstrxgtAGVIRdyftkvk  182
ident                     ||                              |       
Sbjct aarthlerwrrlerPGLRL-GLSPhTPFT-----------------vsHRLMR-------  186
DSSP  hhhhhhhhhhllllLLEEE-EEEElLLLL-----------------llHHHHH-------


DSSP  hhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEEL-------------------
Query nyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAH-------------------  223
ident                                   |   |                     
Sbjct -----------------------llsDYAAGEGLPLQIHVAehptelemfrtgggplwdn  223
DSSP  -----------------------hhhHHHHHHLLLLEEEELllhhhhhhhhhlllllhhh


DSSP  --------------------lhHHHHHHH--HHHHhhlLLEEEEELLLHHH-HHHHHHHH
Query --------------------raDDILTAI--RIAEefgFNLVIEHGTEAYK-ISKVLAEK  260
ident                                             |            |  
Sbjct rmpalyphtlaevigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVTPdDIARVARA  280
DSSP  llhhhllllhhhhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLLHhHHHHHHHH


DSSP  LLLEEeLLLL--LLLLlhhhlLLLLlHHHHHHHLLLLEEELLLLL--LLLHhHHHHHHHH
Query KIPVVvGPLL--TFRTklelkDLTXeTIAKLLKDGVLIALXCDHP--VIPLeFATVQAAT  316
ident    ||                  |          ||  ||  |       |         
Sbjct GCAVV-TCPRsnHHLE-----CGTF-DWPAFAAAGVEVALGTDSVasGETL-NVREEVTF  332
DSSP  LLLEE-ELHHhhHHLL-----LLLL-LHHHHHHLLLLEEELLLLHhhHLLL-LLHHHHHH


DSSP  HHHHL--LLHHHHHHLLLHHHHHHLLllllLLLLLLLLLLL-EEEEllllllllLLEEee
Query AXRYG--AKEEDLLKILTVNPAKILGledrIGSIEPGKDAD-LVVWsghpfdxkSVVErv  373
ident |           |            |          |        |              
Sbjct ARQLYpgLDPRVLVRAAVKGGQRVVG----TPFLRRGETWQeGFRW--------ELSR--  378
DSSP  HHHHLllLLHHHHHHHHHHHHHHHHL----LLLLLLLLLLLhHHLH--------HHLL--


DSSP  eelleeeeell
Query yidgvevfrre  384
ident            
Sbjct ---------dl  380
DSSP  ---------ll


No 26: Query=3ooqA Sbjct=2ffiA Z-score=13.4

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                        | | |
Sbjct -------------------------------------------------lhLTAIDSHAH   11
DSSP  -------------------------------------------------llLLLEELLLL


DSSP  llLLLL--------lllHHHLllllllllllllllhhhhlLLLLhHHHHHHLLLEEEEEE
Query igLFEE--------gvgYYYSdgneatdpvtphvkaldgfNPQDpAIERALAGGVTSVXI  112
ident    |               |                       |       | |      
Sbjct --VFSRglnlasqrryaPNYD------------------aPLGD-YLGQLRAHGFSHGVL   50
DSSP  --LLLHhhhhhllllllLLLL------------------lLHHH-HHHHHHHLLLLEELL


DSSP  LLLLLlleeeeeeeeelllllHHHHEE----------------------EEEEEEEEELL
Query VPGSAnpvggqgsvikfrsiiVEECIV----------------------KDPAGLKXAFG  150
ident |  |                                                 |      
Sbjct VQPSF-----lgtdnryllsaLQTVPGqlrgvvxlerdveqatlaexarLGVRGVRLNLX  105
DSSP  LLLHH-----hllllhhhhhhHHHLLLlllllllllllllhhhhhhhhlLLLLEEELLLL


DSSP  HHHhhhhhhlllllllhhhHHHHHH-HHHHhhhhhhhhhhhhhhlllllllllhhhhHHH
Query ENPkrvygerkqtpstrxgTAGVIR-DYFTkvknyxkkkelaqkegkeftetdlkxeVGE  209
ident                                                            |
Sbjct GQD----------------XPDLTGaQWRP---------------------------LLE  122
DSSP  LLL----------------LLLLLLlLLHH---------------------------HHH


DSSP  HHHLLLLLEEEEElLHHHHHHHHHHHHHHLLLEEEE-ELLL----------hhHHHHHhH
Query XVLRKKIPARXHAhRADDILTAIRIAEEFGFNLVIE-HGTE----------ayKISKVlA  258
ident            |     ||    |     |   ||   |                     
Sbjct RIGEQGWHVELHR-QVADIPVLVRALQPYGLDIVIDhFGRPdarrglgqpgfaELLTLsG  181
DSSP  HHHHHLLEEEELL-LLLLHHHHHHHHLLLLLLEEELhHHLLllllllllllhhHHLLLlL


DSSP  HHLLLEEELLLlLLLLLH--hhllLLLLHHHHHHHLLL--LEEELLLLLL------LLHH
Query EKKIPVVVGPLlTFRTKL--elkdLTXETIAKLLKDGV--LIALXCDHPV------IPLE  308
ident   |  | |                        |             | |           
Sbjct RGKVWVKVSGI-YRLQGSpeenlaFARQALCALEAHYGaeRLXWGSDWPHtqheseVSFG  240
DSSP  LLLEEEEEELH-HHLLLLhhhhhhHHHHHHHHHHHHLLhhHEEEELLLLLllllllLLHH


DSSP  HHHHHHHHHHhhlLLHHHHHHLLLHHHHHHLlLLLLllllllllllleeeelllllllll
Query FATVQAATAXrygAKEEDLLKILTVNPAKILgLEDRigsiepgkdadlvvwsghpfdxks  368
ident  |  |                 |                                     
Sbjct SAVEQFEALG---CSAQLRQALLLDTARALF-GFEL------------------------  272
DSSP  HHHHHHHHHL---LLHHHHHHHHLHHHHHHL-LLLL------------------------


DSSP  leeeeeelleeeeell
Query vvervyidgvevfrre  384
ident                 
Sbjct ---------------e  273
DSSP  ---------------l


No 27: Query=3ooqA Sbjct=1bf6A Z-score=13.4

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                     |   || |
Sbjct -----------------------------------------------sfdpTGYTLAHEH   13
DSSP  -----------------------------------------------llllLLEEEEEEL


DSSP  LLLL-llllLHHHLLlllllllllllllhhhHLLLLL--HHHHHHHLLLEEEEEELLLll
Query IGLF-eegvGYYYSDgneatdpvtphvkaldGFNPQD--PAIERALAGGVTSVXIVPGsa  117
ident                                                 ||  |       
Sbjct LHIDlsgfkNNVDCR----------------LDQYAFicQEMNDLMTRGVRNVIEMTN--   55
DSSP  LLEElhhhhLLHHHE----------------ELLHHHhhHHHHHHHHLLEEEEEELLL--


DSSP  lleeeeeeeeellllLHHHHE---------------------------------------
Query npvggqgsvikfrsiIVEECI---------------------------------------  138
ident                                                             
Sbjct -------rymgrnaqFMLDVMretginvvactgyyqdaffpehvatrsvqelaqemvdei  108
DSSP  -------hhhlllhhHHHHHHhhhlleeeeeellllhhhlllhhhhllhhhhhhhhhhhh


DSSP  -------eeEEEEEE-EELLHhhhhhhhhlllllllHHHHHHHHHHhhhhhhhhhhhhhh
Query -------vkDPAGLK-XAFGEnpkrvygerkqtpstRXGTAGVIRDyftkvknyxkkkel  190
ident                     |                     |                 
Sbjct eqgidgtelKAGIIAeIGTSE------------gkiTPLEEKVFIA--------------  142
DSSP  hllllllllLEEEEEeEELLL------------lllLHHHHHHHHH--------------


DSSP  hhhlllllllllhhhhhhHHHHLLLLLEEEEELLHHHHHHHHHHHHHHLL---LEEEEEL
Query aqkegkeftetdlkxevgEXVLRKKIPARXHAHRADDILTAIRIAEEFGF---NLVIEHG  247
ident                           |   |       |         |         | 
Sbjct ----------------aaLAHNQTGRPISTHTSFSTMGLEQLALLQAHGVdlsRVTVGHC  186
DSSP  ----------------hhHHHHHHLLLEEEELHHHLLHHHHHHHHHHLLLlhhHEEELLL


DSSP  L--lHHHHHHHHHHHLLLEEELLLLLLLLlhhhllLLLLHHHHHHHLLL--LEEELLLLL
Query T--eAYKISKVLAEKKIPVVVGPLLTFRTklelkdLTXETIAKLLKDGV--LIALXCDHP  303
ident                   |                        |   |      |  |  
Sbjct DlkdNLDNILKMIDLGAYVQFDTIGKNSY--ypdeKRIAMLHALRDRGLlnRVMLSMDIT  244
DSSP  LlllLHHHHHHHHHLLLEEEELLLLLLLL--llhhHHHHHHHHHHHLLLhhHEEELLLLL


DSSP  ---------llLHHHHH-HHHHHHHHHLLLHHHHHHLLLHHHHHHLLlllllllllllll
Query ---------viPLEFAT-VQAATAXRYGAKEEDLLKILTVNPAKILGledrigsiepgkd  353
ident                            |    |    |  ||                  
Sbjct rrshlkanggyGYDYLLtTFIPQLRQSGFSQADVDVMLRENPSQFFQ-------------  291
DSSP  lhhhlhhhlllLLLHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHLL-------------


DSSP  lleeeelllllllllleeeeeelleeeeell
Query adlvvwsghpfdxksvvervyidgvevfrre  384
ident                                
Sbjct -------------------------------  291
DSSP  -------------------------------


No 28: Query=3ooqA Sbjct=2y1hB Z-score=13.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                     | || | |
Sbjct --------------------------------------------------GVGLVDCHCH   10
DSSP  --------------------------------------------------LLLEEEEEEL


DSSP  lLLLL-LLLLhhhlllllllllllllllhhhhlllLLHHHHHHHLLLEEEEEELLLllll
Query iGLFE-EGVGyyysdgneatdpvtphvkaldgfnpQDPAIERALAGGVTSVXIVPGsanp  119
ident                                     |   | |    |     |      
Sbjct -LSAPdFDRD-------------------------LDDVLEKAKKANVVALVAVAE----   40
DSSP  -LLLHhHLLL-------------------------HHHHHHHHHHLLEEEEEELLL----


DSSP  eeeeeeeeelllllHHHHEE-----------------------------------eEEEE
Query vggqgsvikfrsiiVEECIV-----------------------------------kDPAG  144
ident                |                                            
Sbjct ---hsgefekimqlSERYNGfvlpclgvhpvqgldqrsvtlkdldvalpiienykdRLLA   97
DSSP  ---lhhhhhhhhhhHHHLLLleeeeelllleelllleellhhhhhhhhhhhhhhllLLLE


DSSP  E-EEELLHHhhHHHHhlllLLLLHHHHHHHHHHhhhhhhhhhhhhhhhhhlllllllllh
Query L-KXAFGENpkRVYGerkqTPSTRXGTAGVIRDyftkvknyxkkkelaqkegkeftetdl  203
ident            |  |    |         |                              
Sbjct IgEVGLDFS-pRFAG----TGEQKEEQRQVLIR---------------------------  125
DSSP  EeEEEEELL-lLLLL----LHHHHHHHHHHHHH---------------------------


DSSP  hhhhhHHHHLLLLLEEEEELLhhHHHHHHHHHHHHLLL-EEEEELLLHHHHHHHHHHHLL
Query kxevgEXVLRKKIPARXHAHRadDILTAIRIAEEFGFN-LVIEHGTEAYKISKVLAEKKI  262
ident          |   |   |          |    | |                        
Sbjct ---qiQLAKRLNLPVNVHSRS--AGRPTINLLQEQGAEkVLLHAFDGRPSVAMEGVRAGY  180
DSSP  ---hhHHHHHHLLLEEEEEEL--LHHHHHHHHHHLLLLlEEEELLLLLHHHHHHHHHLLL


DSSP  LEEELLLLLLLllhhhlLLLLLHHHHHHhlllLEEELLLLLL--------LLHHHHHHHH
Query PVVVGPLLTFRtklelkDLTXETIAKLLkdgvLIALXCDHPV--------IPLEFATVQA  314
ident      |                    |      | |  | |                  |
Sbjct FFSIPPSIIRS------GQKQKLVKQLP--ltSICLETDSPAlgpekqvrNEPWNISISA  232
DSSP  EEEELHHHHLL------HHHHHHHHHLL--hhHEEELLLLLLllllllllLLHHHHHHHH


DSSP  HHHHHHL-LLHHHHHHLLLHHHHHHLL-LLLLLlllllllllleeeelllllllllleee
Query ATAXRYG-AKEEDLLKILTVNPAKILG-LEDRIgsiepgkdadlvvwsghpfdxksvver  372
ident            |      | |  |    |                               
Sbjct EYIAQVKgISVEEVIEVTTQNALKLFPkLRHLL---------------------------  265
DSSP  HHHHHHHlLLHHHHHHHHHHHHHHHLLlHHHHL---------------------------


DSSP  eeelleeeeell
Query vyidgvevfrre  384
ident             
Sbjct ------------  265
DSSP  ------------


No 29: Query=3ooqA Sbjct=2ob3A Z-score=13.2

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                     ||   | |
Sbjct -------------------------------------drintvrgpitiseAGFTLTHEH   23
DSSP  -------------------------------------lleeelleeelhhhHLLEEEEEL


DSSP  LllllllllhhhlLLLLLL--llllllllhhhhlLLLL-HHHHHHHLLLEEEEEELLLll
Query IglfeegvgyyysDGNEAT--dpvtphvkaldgfNPQD-PAIERALAGGVTSVXIVPGsa  117
ident |             |  |                         || | ||     |    
Sbjct I------------CGSSAGflrawpeffgsrkalAEKAvRGLRRARAAGVRTIVDVST-f   70
DSSP  L------------EELLLLhhhhlhhhhllhhhhHHHHhHHHHHHHHLLLLEEEELLL-h


DSSP  lleeeeeeeeeLLLL------------------------------------lhhhheeeE
Query npvggqgsvikFRSI------------------------------------iveecivkD  141
ident                                                             
Sbjct digrdvsllaeVSRAadvhivaatglwfdpplsmrlrsveeltqfflreiqygiedtgiR  130
DSSP  hhlllhhhhhhHHHHhlleeeleeellllllhhhhlllhhhhhhhhhhhhhllllllllL


DSSP  EEEEEEELLHhhhhhhhhlllllllhhhHHHHHHHHhhhhhhhhhhhhhhhhllllllll
Query PAGLKXAFGEnpkrvygerkqtpstrxgTAGVIRDYftkvknyxkkkelaqkegkeftet  201
ident       |                                                     
Sbjct AGIIXVATTG-----------------kATPFQELV------------------------  149
DSSP  LLEEEEELLL-----------------lLLHHHHHH------------------------


DSSP  lhhhhhHHHHHLLLLLEEEEE-LLHHHHHHHHHHHHHHLL---LEEEEELLL--hHHHHH
Query dlkxevGEXVLRKKIPARXHA-HRADDILTAIRIAEEFGF---NLVIEHGTE--aYKISK  255
ident           |    |   |      |      | |  |       | |           
Sbjct --lkaaARASLATGVPVTTHTaASQRDGEQQAAIFESEGLspsRVCIGHSDDtddLSYLT  207
DSSP  --hhhhHHHHHHHLLLEEEELlHHHLHHHHHHHHHHHLLLlhhHEEELLHHHlllHHHHH


DSSP  HHHHHLLLEEELLLLLL-------------LLLHhhllLLLLHHHHHHHLLL--LEEELL
Query VLAEKKIPVVVGPLLTF-------------RTKLelkdLTXETIAKLLKDGV--LIALXC  300
ident  ||                                        |  |   |    |    
Sbjct ALAARGYLIGLDHIPYSaiglednasasalLGIR-swqTRALLIKALIDQGYmkQILVSN  266
DSSP  HHHHLLLEEEELLLLLLlllllllhhhhhhHLLL-lhhHHHHHHHHHHHLLLhhHEEELL


DSSP  LLL------------------llLHHHHH-HHHHHHHHHLLLHHHHHHLLLHHHHHHLLl
Query DHP------------------viPLEFAT-VQAATAXRYGAKEEDLLKILTVNPAKILGl  341
ident |                         |            |   | |  |   |||  |  
Sbjct DWTfgfssyvtnimdvmdrvnpdGMAFIPlRVIPFLREKGVPQETLAGITVTNPARFLS-  325
DSSP  LLLleellllllhhhhhhhhlllHHHHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL-


DSSP  lllllllllllllleeeelllllllllleeeeeelleeeeell
Query edrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                            
Sbjct ---------------------------------------ptlr  329
DSSP  ---------------------------------------llll


No 30: Query=3ooqA Sbjct=3k2gB Z-score=12.8

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                     |    | |
Sbjct -------------------------slselspchvrsgrixtvdgpipssALGHTLXHEH   35
DSSP  -------------------------llllllllllllleeeelleeeehhHLLLEELLLL


DSSP  LLLL--------------------------------llllLHHHLLlllllllllllllh
Query IGLF--------------------------------eegvGYYYSDgneatdpvtphvka   88
ident                                                             
Sbjct LQNDcrcwwnppqeperqylaeapisieilselrqdpfvnKHNIAL--------------   81
DSSP  LLEElhhhllllllhhhhhhhhllllhhhhhhhhllhhhlLLLLEE--------------


DSSP  hhhlLLLL-HHHHHHHLLLEEEEEELLL------------------------lLLLE---
Query ldgfNPQD-PAIERALAGGVTSVXIVPG------------------------sANPV---  120
ident                 | |  |                                      
Sbjct --ddLDLAiAEVKQFAAVGGRSIVDPTCrgigrdpvklrrisaetgvqvvxgaGYYLass  139
DSSP  --llHHHHhHHHHHHHHLLLLEEEELLLllllllhhhhhhhhhhhlleeeellLLLLhhh


DSSP  -----------eeeeeeeelllllhhhheeEEEEEEEEELLHhhhhhhhhlllllllhhH
Query -----------ggqgsvikfrsiiveecivKDPAGLKXAFGEnpkrvygerkqtpstrxG  169
ident                                                             
Sbjct xpetaarlsaddiadeivaealegtdgtdaRIGLIGEIGVSS-----------------D  182
DSSP  llhhhhlllhhhhhhhhhhhhhllllllllLLLLEEEELLLL-----------------L


DSSP  HHHHHHHHhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEE-LLHHHH
Query TAGVIRDYftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHA-HRADDI  228
ident                                            |   |   |        
Sbjct FTAEEEKS--------------------------lrgaARAQVRTGLPLXVHLpGWFRLA  216
DSSP  LLHHHHHH--------------------------hhhhHHHHHHHLLLEEELLlLLLLLH


DSSP  HHHHHHHHHHLLL---EEEEELL-LHHH--HHHHHHHHLLLEEELLLLLLLLL----HHH
Query LTAIRIAEEFGFN---LVIEHGT-EAYK--ISKVLAEKKIPVVVGPLLTFRTK----LEL  278
ident        || |      |  |             ||                        
Sbjct HRVLDLVEEEGADlrhTVLCHXNpSHXDpvYQATLAQRGAFLEFDXIGXDFFYadqgVQC  276
DSSP  HHHHHHHHHLLLLhhhEEELLLHhHLLLhhHHHHHHHHLLEEEELLLLLLLEEllllEEL


DSSP  L--lLLLLHHHHHHHLLL--LEEELLLLL---------lLLHHHHH-HHHHHHHHHLLLH
Query K--dLTXETIAKLLKDGV--LIALXCDHP---------vIPLEFAT-VQAATAXRYGAKE  324
ident          |  |   |    | |  |                | |        | |   
Sbjct PsddEVARAILGLADHGYldRILLSHDVFvkxxltryggNGYAFVTkHFLPRLRRHGLDD  336
DSSP  LlhhHHHHHHHHHHHLLLhhHEEELLLLLlhhhlhhhllLLLLHHHhLHHHHHHHLLLLH


DSSP  HHHHHLLLHHHHHHlLLLLLllllllllllleeeelllllllllleeeeeelleeeeell
Query EDLLKILTVNPAKIlGLEDRigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident   |      ||                                                 
Sbjct AALETLXVTNPRRV-FDASI-------------------------------------egh  358
DSSP  HHHHHHHLHHHHHH-HLLLL-------------------------------------lll


No 31: Query=3ooqA Sbjct=1a4mA Z-score=12.5

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                       |  | |
Sbjct ----------------------------------------------tpafNKPKVELHVH   14
DSSP  ----------------------------------------------llllLLLEEEEEEE


DSSP  LLLLLLLLL---------------------------------------HHHLllllllll
Query IGLFEEGVG---------------------------------------YYYSdgneatdp   81
ident                                                  ||         
Sbjct LDGAIKPETilyfgkkrgialpadtveelrniigmdkplslpgflakfDYYM--------   66
DSSP  HHHLLLHHHhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhHHHH--------


DSSP  llllllhhhhlLLLL--HHHHHHHLLLEEEEEELLL------------------------
Query vtphvkaldgfNPQD--PAIERALAGGVTSVXIVPG------------------------  115
ident                     |     ||  |                             
Sbjct --pviagcreaIKRIayEFVEMKAKEGVVYVEVRYSphllanskvdpmpwnqtegdvtpd  124
DSSP  --hhhlllhhhHHHHhhHHHHHHHHLLEEEEEEEELlhhhllllllllhhhlllllllhh


DSSP  -------------------------LLLLeeeeeeeeelllllhhhheEEEEEEEEEEll
Query -------------------------SANPvggqgsvikfrsiiveeciVKDPAGLKXAfg  150
ident                                                  |       |  
Sbjct dvvdlvnqglqegeqafgikvrsilCCMR--hqpswslevlelckkynQKTVVAMDLA-g  181
DSSP  hhhhhhhhhhhhhhhhhlleeeeeeEEEL--llhhhhhhhhhhhhhllLLLEEEEEEE-l


DSSP  HHHHhhhhhlllllllhHHHHhhHHHHHhhhhhhhhhhhhhhhlllllllllhhhhHHHH
Query ENPKrvygerkqtpstrXGTAgvIRDYFtkvknyxkkkelaqkegkeftetdlkxeVGEX  210
ident                   |                                       | 
Sbjct DETI-------------EGSS--LFPGH--------------------------veAYEG  200
DSSP  LLLL-------------LLHH--HLHHH--------------------------hhHHHH


DSSP  HHLLLLLEEEEEL---LHHHHHHHHHHHhhhlLLEEEEELLLHHH---HHHHHHHHLLLE
Query VLRKKIPARXHAH---RADDILTAIRIAeefgFNLVIEHGTEAYK---ISKVLAEKKIPV  264
ident      |    ||           |  |           ||            |       
Sbjct AVKNGIHRTVHAGevgSPEVVREAVDIL----KTERVGHGYHTIEdeaLYNRLLKENMHF  256
DSSP  HHHHLLEEEEEELlllLHHHHHHHHHLL----LLLEEEELHHHHHlhhHHHHHHHLLLEE


DSSP  EeLLLL--LLLLlhHHLLlllLHHHHHHHLLLLEEELLLLLlllhhHHHHHHHHHH-HHL
Query VvGPLL--TFRTklELKDltxETIAKLLKDGVLIALXCDHPvipleFATVQAATAX-RYG  321
ident                              |     |  | |                  |
Sbjct E-VCPWssYLTG--AWDPkttHAVVRFKNDKANYSLNTDDPlifksTLDTDYQMTKkDMG  313
DSSP  E-ELHHhhHHLL--LLLLlllLHHHHHHHLLLLEEELLLLLlllllLHHHHHHHHHhLLL


DSSP  LLHHHHHHLlLHHHHHHLLL----LLLLL--LLLLllllleeeelllllllllleeeeee
Query AKEEDLLKIlTVNPAKILGL----EDRIG--SIEPgkdadlvvwsghpfdxksvvervyi  375
ident   ||        | ||   |                                        
Sbjct FTEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE-------------------------  347
DSSP  LLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH-------------------------


DSSP  lleeeeell
Query dgvevfrre  384
ident          
Sbjct -------yq  349
DSSP  -------ll


No 32: Query=3ooqA Sbjct=4dlfA Z-score=12.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                        | | |
Sbjct ---------------------------------------------------ALRIDSHQH    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LL---------lllllLLHHHLllllllllllllllhhhhlLLLLhHHHHHHLLLEEEEE
Query IG---------lfeegVGYYYSdgneatdpvtphvkaldgfNPQDpAIERALAGGVTSVX  111
ident                                           |         |       
Sbjct FWryraadypwigagmGVLARD------------------yLPDA-LHPLMHAQALGASI   50
DSSP  LLlllhhhllllllllHHHLLL------------------lLHHH-HHHHHHHLLLLEEE


DSSP  ELLLLLlleeeeeeeeellllLHHHHE------------------------eEEEEEEEE
Query IVPGSAnpvggqgsvikfrsiIVEECI------------------------vKDPAGLKX  147
ident  |   |                                                  |   
Sbjct AVQARA-----grdetaflleLACDEAriaavvgwedlrapqlaervaewrgTKLRGFRH  105
DSSP  EELLLL-----lhhhhhhhhhHHLLLLleeeeeellllllllhhhhhhllllLLEEEEEE


DSSP  ELLHhhhhhhhhlllllllHHHHHHHHHH-HHHHHhhhhhhhhhhhhlllllllllhhhh
Query AFGEnpkrvygerkqtpstRXGTAGVIRD-YFTKVknyxkkkelaqkegkeftetdlkxe  206
ident                             |  |                            
Sbjct QLQD---------------EADVRAFVDDaDFARG-------------------------  125
DSSP  LHHH---------------LLLHHHHHHLhHHHHH-------------------------


DSSP  hHHHHhLLLLLEEEEElLHHHHHHHHHHHHHHLL-LEEEE-ELLL--------------H
Query vGEXVlRKKIPARXHAhRADDILTAIRIAEEFGF-NLVIE-HGTE--------------A  250
ident                                     ||    |                 
Sbjct vAWLQ-ANDYVYDVLV-FERQLPDVQAFCARHDAhWLVLDhAGKPalaefdrddtalarW  183
DSSP  hHHHH-HLLLEEEELL-LHHHHHHHHHHHHHLLLlLEEEHhHHLLlhhhllllllhhhhH


DSSP  HHHHHHHHHHL-LLEEELLLLLLLL-----lhhhllLLLLHHHHHHHLLL--LEEELLLL
Query YKISKVLAEKK-IPVVVGPLLTFRT-----klelkdLTXETIAKLLKDGV--LIALXCDH  302
ident       ||           | |                       |            | 
Sbjct RAALRELAALPhVVCKLSGLVTEADwrrglrasdlrHIEQCLDAALDAFGpqRLMFGSDW  243
DSSP  HHHHHHHHLLLlEEEEELLLLLLLLllllllhhhhhHHHHHHHHHHHHHLhhHEEELLLL


DSSP  LLL----LHHHHHHHHHHHHHhLLLHH-HHHHLLLHHHHHHLLLLlllllllllllllee
Query PVI----PLEFATVQAATAXRyGAKEE-DLLKILTVNPAKILGLEdrigsiepgkdadlv  357
ident ||                                    |    |                
Sbjct PVCllaaSYDEVASLVERWAE-SRLSAaERSALWGGTAARCYALP---------------  287
DSSP  LHHhhllLHHHHHHHHHHHHH-HHLLHhHHHHHLLHHHHHHLLLL---------------


DSSP  eelllllllllleeeeeelleeeeell
Query vwsghpfdxksvvervyidgvevfrre  384
ident                            
Sbjct ---------------------------  287
DSSP  ---------------------------


No 33: Query=3ooqA Sbjct=3irsA Z-score=12.2

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                        |    
Sbjct ---------------------------------------------------LKIIDFRLR    9
DSSP  ---------------------------------------------------LLLEELLLL


DSSP  LLL---------------------------lLLLLlhhhlllllllllllllllhhhhll
Query IGL---------------------------fEEGVgyyysdgneatdpvtphvkaldgfn   93
ident                                                             
Sbjct PPAmgflnariytrpdirnrftrqlgfepapSAEE------------------------k   45
DSSP  LLLhhhhhlhhhhlhhhhhhhhhhhlllllhHHHH------------------------l


DSSP  LLLHHHHHHHLLLEEEEEELLLLLlleeeeeeeeelllllHHHHEE--------------
Query PQDPAIERALAGGVTSVXIVPGSAnpvggqgsvikfrsiiVEECIV--------------  139
ident       |   | |      |                                        
Sbjct SLELMFEEMAAAGIEQGVCVGRNS--svlgsvsnadvaavAKAYPDkfhpvgsieaatrk  103
DSSP  LHHHHHHHHHHLLLLEEEEELLEE--llleellhhhhhhhHHHLLLleeeeeelllllhh


DSSP  -----------eEEEEEEEELlhHHHHhhhhlllllLLHHhhHHHHHHHhhhhhhhhhhh
Query -----------kDPAGLKXAFgeNPKRvygerkqtpSTRXgtAGVIRDYftkvknyxkkk  188
ident                                                             
Sbjct eamaqmqeildlGIRIVNLEP--GVWA---------TPMHvdDRRLYPL-----------  141
DSSP  hhhhhhhhhhhlLLLLEEELH--HHLL---------LLLLllLHHHHHH-----------


DSSP  hhhhhlllllllllhhhhhHHHHHLLLLLEEEEEL-------lhHHHHHHHHHHHHHL-L
Query elaqkegkeftetdlkxevGEXVLRKKIPARXHAH-------raDDILTAIRIAEEFG-F  240
ident                            ||                      |    |   
Sbjct -------------------YAFCEDNGIPVIMMTGgnagpdityTNPEHIDRVLGDFPdL  182
DSSP  -------------------HHHHHHLLLLEEEELLllllllhhhHLHHHHHHHHHHLLlL


DSSP  LEEEEELLL-HHHH-HHHHHHHL-LLEEELL-LLLLlllhhhllLLLLHHHHHHHLLL--
Query NLVIEHGTE-AYKI-SKVLAEKK-IPVVVGP-LLTFrtklelkdLTXETIAKLLKDGV--  294
ident   |  ||          |              |                           
Sbjct TVVSSHGNWpWVQEiIHVAFRRPnLYLSPDMyLYNL--------PGHADFIQAANSFLad  234
DSSP  LEEEEHHHLlLHHHhHHHHHHLLlEEEELHHhHLLL--------LLHHHHHHHHLLHHhh


DSSP  LEEELLLLLLLLHHHHHHHHHHHHhhlLLHHHHHHLLLHHHHHHLLllllllllllllll
Query LIALXCDHPVIPLEFATVQAATAXrygAKEEDLLKILTVNPAKILGledrigsiepgkda  354
ident         |  ||   |    |      |     |||  |    |               
Sbjct RMLFGTAYPMCPLKEYTEWFLTLP---IKPDAMEKILHGNAERLLA--------------  277
DSSP  LLLLLLLLLLLLHHHHHHHHHLLL---LLHHHHHHHHLHHHHHHHH--------------


DSSP  leeeelllllllllleeeeeelleeeeell
Query dlvvwsghpfdxksvvervyidgvevfrre  384
ident                               
Sbjct --------------------------qagr  281
DSSP  --------------------------hlll


No 34: Query=3ooqA Sbjct=3pnuA Z-score=12.2

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeELLL-LEEEELEEEEEE
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivDLTG-KFLFPGFVDAHS   59
ident                                                         | | 
Sbjct ----------------------------------------enlYFQSnAMKLKNPLDMHL   20
DSSP  ----------------------------------------lllLLLLlLEEEELLEEEEE


DSSP  LlLLLLllllhhhlllllllllllllllhhhhlLLLLhHHHHHHLlLEEEEEELLLllll
Query HiGLFEegvgyyysdgneatdpvtphvkaldgfNPQDpAIERALAgGVTSVXIVPGsanp  119
ident |                                                   | |     
Sbjct H-LRDN--------------------------qMLEL-IAPLSAR-DFCAAVIMPN----   47
DSSP  L-LLLH--------------------------hHHHH-HHHHHHL-LLLEEEELLL----


DSSP  eeeeeeeeellllLHHHHE---------------------------eeEEEEEEEELLHH
Query vggqgsvikfrsiIVEECI---------------------------vkDPAGLKXAFGEN  152
ident                                                    |        
Sbjct lipplcnledlkaYKMRILkackdenftplmtlffknydekflysakdEIFGIXLYPAGI  107
DSSP  lllllllhhhhhhHHHHHHhhhllllleeeeeeelllllhhhhhhhllLLLEEEELLLLL


DSSP  ---HHHHhhhlllllllhhHHHHhhHHHHHHHhhhhhhhhhhhhlllllllllhhhhhHH
Query ---PKRVygerkqtpstrxGTAGviRDYFTKVknyxkkkelaqkegkeftetdlkxevGE  209
ident                            |                               |
Sbjct ttnSNGG-----------vSSFD--IEYLKPT--------------------------LE  128
DSSP  lllLLLL-----------lLLLL--HHHHHHH--------------------------HH


DSSP  HHHLLLLLEEEEEL--------LHHHHHHHHHHHHHHL-LLEEEEELLLhHHHHHHHHHH
Query XVLRKKIPARXHAH--------RADDILTAIRIAEEFG-FNLVIEHGTEaYKISKVLAEK  260
ident       ||   |                     |  |     | || |        |   
Sbjct AMSDLNIPLLVHGEtndfvmdrESNFAKIYEKLAKHFPrLKIVMEHITT-KTLCELLKDY  187
DSSP  HHHHLLLLEEELLLllllhhhlLHHHHHHHHHHHHHLLlLLEEELLLLL-HHHHHHHHHL


DSSP  L-LLEEELL-LLLLLL--------------lhHHLL--LLLLHhHHHH-hlllLEEELLL
Query K-IPVVVGP-LLTFRT--------------klELKD--LTXETiAKLL-kdgvLIALXCD  301
ident            |                      |           |            |
Sbjct EnLYATITLhHLIITLddviggkmnphlfckpIAKRyeDKEAL-CELAfsgyeKVMFGSD  246
DSSP  LlEEEEELLhHHLLLHhhhhlllllhhhllllLLLLhhHHHHH-HHHHhllllLEEELLL


DSSP  LL---------LLLHHHHHHHHH-HHHHhLLLHHHHHHLLLHHHHHHlLLLLLlllllll
Query HP---------VIPLEFATVQAA-TAXRyGAKEEDLLKILTVNPAKIlGLEDRigsiepg  351
ident            |          |         || | | |  |  ||             
Sbjct SAphpkgcaagVFSAPVILPVLAeLFKQ-NSSEENLQKFLSDNTCKI-YDLKF-------  297
DSSP  LLlllllllllLLLHHHHHHHHHhHHHH-HLLHHHHHHHHLHHHHHH-HLLLL-------


DSSP  LLLLEEEELL--------------------llllLLLLEEEeeelleeeeell
Query KDADLVVWSG--------------------hpfdXKSVVERvyidgvevfrre  384
ident |                                  |                 
Sbjct KEDKILTLEEkewqvpnvyedkynqvvpymageiLKFQLKH------------  338
DSSP  LLLLEEEEELlleelllleelllleellllllleELLEELL------------


No 35: Query=3ooqA Sbjct=2vc5A Z-score=11.7

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                     ||   | |
Sbjct ------------------------------------mriplvgkdsieskdIGFTLIHEH   24
DSSP  ------------------------------------llllllllllllhhhLLLEELLLL


DSSP  lLLLL-------lllLHHHlllllllllllllllhhhhlLLLL-HHHHHHHLLLEEEEEE
Query iGLFE-------egvGYYYsdgneatdpvtphvkaldgfNPQD-PAIERALAGGVTSVXI  112
ident                 |                               ||   ||     
Sbjct -LRVFseavrqqwphLYNE-----------------deeFRNAvNEVKRAMQFGVKTIVD   66
DSSP  -LLLLlhhhhhhlhhHLLH-----------------hhhHHHHhHHHHHHHHLLLLEEEE


DSSP  LLL--------------------------LLLL-----------eeeeeeeeelllllhh
Query VPG--------------------------SANP-----------vggqgsvikfrsiive  135
ident                                                             
Sbjct PTVmglgrdirfmekvvkatginlvagtgIYIYidlpfyflnrsideiadlfihdikegi  126
DSSP  LLLllllllhhhhhhhhhlllleeeeleeLLLLllllhhhllllhhhhhhhhhhhhhlll


DSSP  hheeeEEEEEEEELLHhhhhhhhhlllllllHHHHHHHHHhhhhhhhhhhhhhhhhhhll
Query ecivkDPAGLKXAFGEnpkrvygerkqtpstRXGTAGVIRdyftkvknyxkkkelaqkeg  195
ident             |  |                     |||                    
Sbjct qgtlnKAGFVXIAADE------------pgiTKDVEKVIR--------------------  154
DSSP  lllllLLLLEEEELLL------------lllLHHHHHHHH--------------------


DSSP  lllllllhhhhhHHHHHLLLLLEEEEELLH-HHHHHHHHHHHHHLL---LEEEEELLL--
Query keftetdlkxevGEXVLRKKIPARXHAHRA-DDILTAIRIAEEFGF---NLVIEHGTE--  249
ident                    | |   |        |   ||  | |       | |     
Sbjct ----------aaAIANKETKVPIITHSNAHnNTGLEQQRILTEEGVdpgKILIGHLGDtd  204
DSSP  ----------hhHHHHHHHLLLEEEELLLLlLHHHHHHHHHHHLLLlhhHEEELLHHHll


DSSP  hHHHHHHHHHHLLLEEELLLLLLLLlhhhlllLLLHHHHHHHLLL--LEEELLLLL----
Query aYKISKVLAEKKIPVVVGPLLTFRTklelkdlTXETIAKLLKDGV--LIALXCDHP----  303
ident      |  | |                       ||   | |||    |    |      
Sbjct nIDYIKKIADKGSFIGLDRYGLDLF--lpvdkRNETTLRLIKDGYsdKIMISHDYCctid  262
DSSP  lHHHHHHHHHLLLEEEELLLLLLLL--llhhhHHHHHHHHHHLLLllLEEELLLLLllll


DSSP  --------------lLLHHHHHH-HHHHHHHHLLLHHHHHHLLLHHHHHHLLllllllll
Query --------------vIPLEFATV-QAATAXRYGAKEEDLLKILTVNPAKILGledrigsi  348
ident                               | |  ||    |   || |           
Sbjct wgtakpeykpklaprWSITLIFEdTIPFLKRNGVNEEVIATIFKENPKKFFS--------  314
DSSP  lllllhhhhhhhlllLLLLHHHHlHHHHHHLLLLLHHHHHHHHLHHHHHHLL--------


DSSP  llllllleeeelllllllllleeeeeelleeeeell
Query epgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                     
Sbjct ------------------------------------  314
DSSP  ------------------------------------


No 36: Query=3ooqA Sbjct=3cjpA Z-score=11.6

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
ident                                                        | | |
Sbjct ----------------------------------------------------LIIDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  llLLLLlllhhhlllllllllllllllhhhhlllLLHHHHHHHLLLEEEEEELLL-----
Query igLFEEgvgyyysdgneatdpvtphvkaldgfnpQDPAIERALAGGVTSVXIVPG-----  115
ident                                       |      ||             
Sbjct --VILP----------------------------VEKHIKIMDEAGVDKTILFSTsihpe   38
DSSP  --LLLL----------------------------HHHHHHHHHHHLLLEEEEELLlllhh


DSSP  ----------------------lllleeeeeeeeelllLLHHHHEE--------------
Query ----------------------sanpvggqgsvikfrsIIVEECIV--------------  139
ident                                                             
Sbjct tavnlrdvkkemkklndvvngktnsmidvrrnsikeltNVIQAYPSryvgfgnvpvglse   98
DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhhHHHHHLLLleeeeelllllllh


DSSP  -------------eEEEEEE-EELLHhhhhhhhhlllllllhhhHHHHHHHhhhhhhhhh
Query -------------kDPAGLK-XAFGEnpkrvygerkqtpstrxgTAGVIRDyftkvknyx  185
ident                  |                                          
Sbjct ndtnsyieenivnnKLVGIGeLTPAS-----------------gQIKSLKP---------  132
DSSP  hhhhhhhhhhllllLLLEEEeELLLL-----------------lLHHHHHH---------


DSSP  hhhhhhhhlllllllllhhhhhHHHHHLLL-LLEEEEEL---LHHHHHHHHHHHHHHL-L
Query kkkelaqkegkeftetdlkxevGEXVLRKK-IPARXHAH---RADDILTAIRIAEEFG-F  240
ident                                 |   ||       ||         |   
Sbjct ---------------------iFKYSMDSGsLPIWIHAFnplVLQDIKEIAELCKAFPkV  171
DSSP  ---------------------hHHHHHHLLlLLEEELLLlllLHHHHHHHHHHHHHLLlL


DSSP  LEEEEE-LLLHHHH-HHHHHHHL-LLEEELLLllllllhhhllLLLLHHHHHHHLL-lLE
Query NLVIEH-GTEAYKI-SKVLAEKK-IPVVVGPLltfrtklelkdLTXETIAKLLKDG-vLI  296
ident      | |            |                                       
Sbjct PVILGHmGGSNWMTaVELAKEIQnLYLDTSAY-----------FSTFVLKIVINELplKC  220
DSSP  LEEEHHhHHHHHHHhHHHHHHLLlEEEELLLL-----------LLHHHHHHHHHHLllLE


DSSP  EELLLLLLLLhhhHHHHHHHHHhHLLL-HHHHHHLLLHHHHHHLLLllllllllllllll
Query ALXCDHPVIPlefATVQAATAXrYGAK-EEDLLKILTVNPAKILGLedrigsiepgkdad  355
ident     | |                            |  |    |                
Sbjct IFGTDMPFGD---LQLSIEAIK-KMSNdSYVANAVLGDNISRLLNI--------------  262
DSSP  ELLLLLLLLL---HHHHHHHHH-HHLLlHHHHHHHHLHHHHHHHLL--------------


DSSP  eeeelllllllllleeeeeelleeeeell
Query lvvwsghpfdxksvvervyidgvevfrre  384
ident                              
Sbjct -----------------------------  262
DSSP  -----------------------------


No 37: Query=3ooqA Sbjct=2dvtA Z-score=11.5

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                     | |    |
Sbjct --------------------------------------------------MQGKVALEEH   10
DSSP  --------------------------------------------------LLLEEEEEEE


DSSP  ---------lllllllLLHHHLLlllllllllllllhhhHLLLlLHHHHHHHLLLEEEEE
Query ---------iglfeegVGYYYSDgneatdpvtphvkaldGFNPqDPAIERALAGGVTSVX  111
ident                                             |       | |     
Sbjct faipetlqdsagfvpgDYWKELQ-------------hrlLDIQ-DTRLKLMDAHGIETMI   56
DSSP  ellhhhhhhhllllllLHHHHHH-------------hhhHLLL-LHHHHHHHHLLEEEEE


DSSP  ELLLLLL---------leeeeeeeeellllLHHHHEEE----------------------
Query IVPGSAN---------pvggqgsvikfrsiIVEECIVK----------------------  140
ident                                                             
Sbjct LSLNAPAvqaipdrrkaieiarrandvlaeECAKRPDRflafaalplqdpdaateelqrc  116
DSSP  EEELLLHhhhlllhhhhhhhhhhhhhhhhhHHHHLLLLeeeeellllllhhhhhhhhhhh


DSSP  ----EEEEEEEELLhhhhhhHHHLLLLlllhHHHHhhHHHHHHhhhhhhhhhhhhhhlll
Query ----DPAGLKXAFGenpkrvYGERKQTpstrXGTAgvIRDYFTkvknyxkkkelaqkegk  196
ident        |                 ||             |                   
Sbjct vndlGFVGALVNGF-----sQEGDGQT----PLYY-dLPQYRP-----------------  149
DSSP  hhllLLLEEEEELL-----lLLLLLLL----LLLL-lLHHHHH-----------------


DSSP  llllllhhhhhHHHHHLLLLLEEEEE--------------------------lLHHHHHH
Query eftetdlkxevGEXVLRKKIPARXHA--------------------------hRADDILT  230
ident               |     |   |                             |   | 
Sbjct ----------fWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALR  199
DSSP  ----------hHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHH


DSSP  HHHH-HHHHL--LLEEEEE-LLLHHHHH-----------------------HHHHhHLLL
Query AIRI-AEEFG--FNLVIEH-GTEAYKIS-----------------------KVLAeKKIP  263
ident              |    | |                                       
Sbjct LMASgLFDEHprLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFH  258
DSSP  HHHLlHHHHLllLLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEE


DSSP  EEELLLLlllllhhhlllLLLHHHHHHHLLL--LEEELLLLLLLLHHHHHHHHHHHHhhl
Query VVVGPLLtfrtklelkdlTXETIAKLLKDGV--LIALXCDHPVIPLEFATVQAATAXryg  321
ident                      |            |    | |      |           
Sbjct ITTSGNF-----------RTQTLIDAILEIGadRILFSTDWPFENIDHASDWFNATS---  304
DSSP  EELLLLL-----------LHHHHHHHHLLLLhhHEELLLLLLLLLHHHHHHHHHHLL---


DSSP  LLHHHHHHLLLHHHHHHLLLLllllllllllllleeeelllllllllleeeeeelleeee
Query AKEEDLLKILTVNPAKILGLEdrigsiepgkdadlvvwsghpfdxksvvervyidgvevf  381
ident   | |  ||   |      |                                        
Sbjct IAEADRVKIGRTNARRLFKLD---------------------------------------  325
DSSP  LLHHHHHHHHLHHHHHHLLLL---------------------------------------


DSSP  ell
Query rre  384
ident    
Sbjct ---  325
DSSP  ---


No 38: Query=3ooqA Sbjct=1v77A Z-score=11.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
ident                                                      |      
Sbjct ---------------------------------------------------VKFIEMDIR    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LLlllllllhhhlllllllllllllllhhhhlllllHHHHHHHLLlEEEEEELLLlLLLE
Query IGlfeegvgyyysdgneatdpvtphvkaldgfnpqdPAIERALAGgVTSVXIVPGsANPV  120
ident                                      | | |       |       |  
Sbjct DK----------------------------------EAYELAKEW-FDEVVVSIK-FNEE   33
DSSP  LH----------------------------------HHHHHHHHH-LLEEEEEEE-ELLL


DSSP  EeeeeeeelllllhhHHEEEeeEEEEEELlhhhhhhhhhlllllllhhhHHHHHHhhhhh
Query GgqgsvikfrsiiveECIVKdpAGLKXAFgenpkrvygerkqtpstrxgTAGVIRdyftk  180
ident                    |                                  |     
Sbjct V-----dkeklrearKEYGK--VAILLSN-------------------pKPSLVR-----   62
DSSP  L-----lhhhhhhhhHHHLL--EEEEEEL-------------------lLHHHHH-----


DSSP  hhhhhhhhhhhhhlllllllllhhhhhHHHHhllLLLEEEEELLHHHHHHHHHHHhhhll
Query vknyxkkkelaqkegkeftetdlkxevGEXVlrkKIPARXHAHRADDILTAIRIAeefgf  240
ident                                                |   |        
Sbjct ------------------------dtvQKFK---SYLIYVESNDLRVIRYSIEKG-----   90
DSSP  ------------------------hhhHHLL---LLEEEEELLLHHHHHHHHHLL-----


DSSP  LEEEEELL-----LHHH--HHHHHHHHLLLEEELL-LLLLLLlhhhLLLL---LLHHHHH
Query NLVIEHGT-----EAYK--ISKVLAEKKIPVVVGP-LLTFRTklelKDLT---XETIAKL  289
ident    |                 |    |          |          |           
Sbjct VDAIISPWvnrkdPGIDhvLAKLMVKKNVALGFSLrPLLYSNpyerANLLrfmMKAWKLV  150
DSSP  LLEEELLLlllllLLLLhhHHHHHHHHLLEEEEELhHHHHLLhhhhHHHHhhhHHHHHHH


DSSP  HHLLLLEEELLLLL-llLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLllllllll
Query LKDGVLIALXCDHP-viPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGledrigsi  348
ident  |  |   |                       |             |  ||         
Sbjct EKYKVRRFLTSSAQekwDVRYPRDLISLGVVIGMEIPQAKASISMYPEIILK--------  202
DSSP  HHHLLLEEEELLLLlhhHLLLHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHL--------


DSSP  llllllleeeelllllllllleeeeeelleeeeell
Query epgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                     
Sbjct ------------------------------------  202
DSSP  ------------------------------------


No 39: Query=3ooqA Sbjct=3gg7A Z-score=11.1

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
ident                                                        | | |
Sbjct ----------------------------------------------------SLIDFHVH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  LLLLLLlllhhhlllllllllllllllhhhhllllLHHHHHHHLLLEeEEEELLLlllle
Query IGLFEEgvgyyysdgneatdpvtphvkaldgfnpqDPAIERALAGGVtSVXIVPGsanpv  120
ident   |                                              |  |       
Sbjct LDLYPD----------------------------pVAVARACEERQL-TVLSVTT-----   34
DSSP  HHHLLL----------------------------hHHHHHHHHHLLL-EEEELLL-----


DSSP  eeeeeeeelllllHHHHE--------------------------eeEEEEEE-EELLHHh
Query ggqgsvikfrsiiVEECI--------------------------vkDPAGLK-XAFGENp  153
ident                                                             
Sbjct --tpaawrgtlalAAGRPhvwtalgfhpevvseraadlpwfdrylpETRFVGeVGLDGS-   91
DSSP  --lhhhhhhhhhhHLLLLleeelllllhhhllllhhhlhhhhhhhhHLLEEEeEELLLL-


DSSP  hHHHHhlllllLLHHHHHHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHL
Query kRVYGerkqtpSTRXGTAGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevGEXVLR  213
ident             |      |                                        
Sbjct -PSLR------GTWTQQFAVFQHIL-----------------------------RRCEDH  115
DSSP  -HHHH------HHHHHHHHHHHHHH-----------------------------HHHHHL


DSSP  LLLLEEEEELLhhHHHHHHHHHHHHLL--LEEEEELLLHHHHHHHHHHHLLLEEELLLll
Query KKIPARXHAHRadDILTAIRIAEEFGF--NLVIEHGTEAYKISKVLAEKKIPVVVGPLlt  271
ident        |  |           |                               |||   
Sbjct GGRILSIHSRR--AESEVLNCLEANPRsgTPILHWYSGSVTELRRAISLGCWFSVGPT--  171
DSSP  LLEEEEEELLL--LHHHHHHHHHHLHHheEEEEELLLLLHHHHHHHHHLLLEEEELHH--


DSSP  llllhhhlLLLLLHHHHHHhlllLEEELLLLLL-------LLHHHHHHHHHHHHHHL-LL
Query frtklelkDLTXETIAKLLkdgvLIALXCDHPV-------IPLEFATVQAATAXRYG-AK  323
ident               |              | |                            
Sbjct ----mvrtQKGAALIRSMP--rdRVLTETDGPFleldgqaALPWDVKSVVEGLSKIWqIP  225
DSSP  ----hhllHHHHHHHHHLL--hhHEEELLLLLLleelleeLLHHHHHHHHHHHHHHHlLL


DSSP  HHHHHHLLLHHHHHHLLllllllllllllllleeeelllllllllleeeeeelleeeeel
Query EEDLLKILTVNPAKILGledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrr  383
ident       |   |    ||                                           
Sbjct ASEVERIVKENVSRLLG-------------------------------------------  242
DSSP  HHHHHHHHHHHHHHHHH-------------------------------------------


DSSP  l
Query e  384
ident  
Sbjct t  243
DSSP  l


No 40: Query=3ooqA Sbjct=4qrnA Z-score=10.8

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeellllEEEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkFLFPGFVDAHSH   60
ident                                                             
Sbjct --------------------------------------smtqdlktggEQGYLRIATEEA   22
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE


DSSP  L----------------------------lllllllLHHHLLlllllllllllllhhhHL
Query I----------------------------glfeegvGYYYSDgneatdpvtphvkaldGF   92
ident                                                             
Sbjct FatreiidvylrmirdgtadkgmvslwgfyaqspseRATQIL-------------erlLD   69
DSSP  EllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhHHHHHH-------------hhhHL


DSSP  LLLLhHHHHHHLLLEEEEEELLLLLL---------leeeeeeeeellllLHHHHEE----
Query NPQDpAIERALAGGVTSVXIVPGSAN---------pvggqgsvikfrsiIVEECIV----  139
ident       |    | |         |                                    
Sbjct LGER-RIADMDATGIDKAILALTSPGvqplhdldeartlatrandtladACQKYPDrfig  128
DSSP  LLHH-HHHHHHHLLLLEEEEEELLLLllllllhhhhhhhhhhhhhhhhhHHHHLLLleee


DSSP  ----------------------eEEEEEEEELLhhhhhhhhhllllLLLHhhHHHHhHHH
Query ----------------------kDPAGLKXAFGenpkrvygerkqtPSTRxgTAGViRDY  177
ident                           |                      |          
Sbjct mgtvapqdpewsareihrgarelGFKGIQINSH-------------TQGR--YLDE-EFF  172
DSSP  llllllllhhhhhhhhhhhhhllLLLLEEELLL-------------LLLL--LLLL-HHH


DSSP  HHhhhhhhhhhhhhhhlllllllllhhhhHHHHHHLLLLLEEEEE---------------
Query FTkvknyxkkkelaqkegkeftetdlkxeVGEXVLRKKIPARXHA---------------  222
ident                                        |   |                
Sbjct DP---------------------------IFRALVEVDQPLYIHPatspdsmidpmleag  205
DSSP  HH---------------------------HHHHHHHHLLLEEELLllllllllhhhhhhl


DSSP  ----------lLHHHHHHHHH-HHHHHL--LLEEEEE-LLLHHHH---------------
Query ----------hRADDILTAIR-IAEEFG--FNLVIEH-GTEAYKI---------------  253
ident                 |  |                | |                     
Sbjct ldgaifgfgveTGMHLLRLITiGIFDKYpsLQIMVGHmGEALPYWlyrldymhqagvrsq  265
DSSP  llllllhhhhhHHHHHHHHHHhLHHHHLllLLEEELHhHHLHHHHhhhhhhhhhhhhhll


DSSP  ------------hHHHHhHLLLEEELLLLlllllhhhlllLLLHHHHHHHLLL--LEEEL
Query ------------sKVLAeKKIPVVVGPLLtfrtklelkdlTXETIAKLLKDGV--LIALX  299
ident                |      |                     |               
Sbjct ryermkplkktieGYLK-SNVLVTNSGVA-----------WEPAIKFCQQVMGedRVMYA  313
DSSP  lllllllllllhhHHHH-HLEEEELLLLL-----------LHHHHHHHHHHHLhhHEELL


DSSP  LLLLLLLhHHHHHHHHHHHhhlLLHHHHHHLLLHHHHHHLLLlllllllllllllleeee
Query CDHPVIPlEFATVQAATAXrygAKEEDLLKILTVNPAKILGLedrigsiepgkdadlvvw  359
ident  | |                         |    |  |   |                  
Sbjct MDYPYQYvADEVRAMDAMD---MSAQTKKKFFQTNAEKWFKL------------------  352
DSSP  LLLLLLLlHHHHHHHHLLL---LLHHHHHHHHLHHHHHHLLL------------------


DSSP  lllllllllleeeeeelleeeeell
Query sghpfdxksvvervyidgvevfrre  384
ident                          
Sbjct -------------------------  352
DSSP  -------------------------


No 41: Query=3ooqA Sbjct=2qpxA Z-score=10.8

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                        | | |
Sbjct ----------------------------------------gxddlsefvdQVPLLDHHCH   20
DSSP  ----------------------------------------lllllhhhhhHLLEEEEEEL


DSSP  llLLLLLL---LHHH---------------------------lllllllllllllllhhh
Query igLFEEGV---GYYY---------------------------sdgneatdpvtphvkald   90
ident       |                                                     
Sbjct --FLIDGKvpnRDDRlaqvsteadkdypladtknrlayhgflalakefaldannplaaxn   78
DSSP  --LLLLLLlllHHHHhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllll


DSSP  hlllLLHHHHHHHLLLEEEEEELLLlllleeeeeeeeelllllHHHH-----EEEE----
Query gfnpQDPAIERALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEEC-----IVKD----  141
ident                      |  |                            ||     
Sbjct dpgyATYNHRIFGHFHFKELLIDTG--------fvpddpildlDQTAelvgiPVKAiyrl  130
DSSP  hhhhHHHHHHHHHHLLEEEEEEELL--------lllllllllhHHHHhhhllLEEEeeeh


DSSP  --------------------------------EEEEEEELLHHH----------------
Query --------------------------------PAGLKXAFGENP----------------  153
ident                                   |                         
Sbjct ethaedfxlehdnfaawwqafsndvkqakahgFVGFXSIAAYRVglhlepvnvieaaagf  190
DSSP  hhhhhhhhlllllhhhhhhhhhhhhhllllllLLLEEELHHHHLllllllllhhhhhhhh


DSSP  -hhhhhHLLLlLLLHHHHHHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhhHHHH
Query -krvygERKQtPSTRXGTAGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevgEXVL  212
ident         |                                                   
Sbjct dtwkhsGEKR-LTSKPLIDYXLYHVA------------------------------PFII  219
DSSP  hhhhhhLLLL-LLLHHHHHHHHHHHH------------------------------HHHH


DSSP  LLLLLEEEEELL--------hHHHHHHHHHHHHHL---LLEEEEELL-LHHHHHHHHHHH
Query RKKIPARXHAHR--------aDDILTAIRIAEEFG---FNLVIEHGT-EAYKISKVLAEK  260
ident     |   |               |        |       |  |               
Sbjct AQDXPLQFHVGYgdadtdxylGNPLLXRDYLKAFTkkgLKVVLLHCYpYHREAGYLASVF  279
DSSP  HHLLLEEEEELLllllllhhhLLHHHHHHHHHHHHhhlLLEEEEELLlLHHHHHHHHHHL


DSSP  L-LLEEELL-LLLLlllhhhllLLLLHHHHHHHLLL--LEEELLLLL--llLHHH-HHHH
Query K-IPVVVGP-LLTFrtklelkdLTXETIAKLLKDGV--LIALXCDHP--viPLEF-ATVQ  313
ident                                        |    |           |   
Sbjct PnLYFDISLlDNLG------psGASRVFNEAVELAPytRILFASDAStypeXYGLaARQF  333
DSSP  LlEEEELLLhHHHL------hhHHHHHHHHHLLLLLhhHEELLLLLLllhhHHHHhHHHH


DSSP  HHHHHhHLLL----------HHHHHHLLLHHHHHHLLLLlLLLLLllllllleeeellll
Query AATAXrYGAK----------EEDLLKILTVNPAKILGLEdRIGSIepgkdadlvvwsghp  363
ident                           |     ||    | |                   
Sbjct KQALV-AHFNqlpfvdlaqkKAWINAICWQTSAKLYHQE-RELRV---------------  376
DSSP  HHHHH-HHHHllllllhhhhHHHHHHHHLHHHHHHLLLH-HHHLL---------------


DSSP  lllllleeeeeelleeeeell
Query fdxksvvervyidgvevfrre  384
ident                      
Sbjct ---------------------  376
DSSP  ---------------------


No 42: Query=3ooqA Sbjct=4ofcA Z-score=10.4

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
ident                                                        | |||
Sbjct ----------------------------------------------------mKIDIHSH    8
DSSP  ----------------------------------------------------lLEEEEEE


DSSP  L--------------------lllllLLLH--------HHLLlllllllllllllhhhHL
Query I--------------------glfeeGVGY--------YYSDgneatdpvtphvkaldGF   92
ident |                         |                                 
Sbjct IlpkewpdlkkrfgyggwvqlqhhskGEAKllkdgkvfRVVR--------------enCW   54
DSSP  LlllllllhhhhhllllleeeeeeelLEEEeeelleeeEEEE--------------hhHL


DSSP  LLLLhHHHHHHLLLEEEEEELLLLLL---------leeeeeeeeellllLHHHHEEE---
Query NPQDpAIERALAGGVTSVXIVPGSAN---------pvggqgsvikfrsiIVEECIVK---  140
ident  |    |      |||                                  |         
Sbjct DPEV-RIREMDQKGVTVQALSTVPVMfsywakpedtlnlcqllnndlasTVVSYPRRfvg  113
DSSP  LHHH-HHHHHHHHLLLEEEEELLHHHhlllllhhhhhhhhhhhhhhhhhHHHHLLLLeee


DSSP  -----------------------EEEEEEEELLhhhhhhhhhlllllllHHHHHHhHHHH
Query -----------------------DPAGLKXAFGenpkrvygerkqtpstRXGTAGvIRDY  177
ident                           |                                 
Sbjct lgtlpmqapelavkemercvkelGFPGVQIGTH----------------VNEWDLnAQEL  157
DSSP  eellllllhhhhhhhhhhhhhllLLLEEEEELE----------------ELLEELlLHHH


DSSP  HHhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEE---------------
Query FTkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHA---------------  222
ident |                                  | |     |                
Sbjct FP---------------------------vYAAAERLKCSLFVHPwdmqmdgrmakywlp  190
DSSP  HH---------------------------hHHHHHHHLLEEEEELllllllhhhhlllhh


DSSP  -------LLHHHHHHHH-HHHHHHL--LLEEEEE-LLLHHHHH-----------------
Query -------HRADDILTAI-RIAEEFG--FNLVIEH-GTEAYKIS-----------------  254
ident             |   |     |          | |                        
Sbjct wlvgmpaETTIAICSMImGGVFEKFpkLKVCFAHgGGAFPFTVgrishgfsmrpdlcaqd  250
DSSP  hhlhhhhHHHHHHHHHHlLLHHHHLllLLEEELHhHLLHHHHHhhhhhhhhhlhhhhlll


DSSP  -----HHHHhHLLLEEeLLLLlllllhhhlllLLLHHHHHHHLLL--LEEELLLL---LL
Query -----KVLAeKKIPVVvGPLLtfrtklelkdlTXETIAKLLKDGV--LIALXCDH---PV  304
ident      |                                 |          |  |      
Sbjct npmnpKKYL-GSFYTD-ALVH-----------DPLSLKLLTDVIGkdKVILGTDYpfpLG  297
DSSP  llllhHHHL-LLLEEE-LLLL-----------LHHHHHHHHHHHLllLEELLLLLlllLL


DSSP  LLhhHHHHHHHHHHhhLLLHHHHHHLLLHHHHHHLLLLLLLlllllllllleeeelllll
Query IPleFATVQAATAXryGAKEEDLLKILTVNPAKILGLEDRIgsiepgkdadlvvwsghpf  364
ident                    ||   |    |    ||||                      
Sbjct EL--EPGKLIESME--EFDEETKNKLKAGNALAFLGLERKQ-------------------  334
DSSP  LL--LLLHHHHHLL--LLLHHHHHHHHLHHHHHHHLLLHHH-------------------


DSSP  llllleeeeeelleeeeell
Query dxksvvervyidgvevfrre  384
ident                     
Sbjct -------------------f  335
DSSP  -------------------l


No 43: Query=3ooqA Sbjct=4mupB Z-score=10.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                     | ||   |
Sbjct ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
DSSP  ------------------------------------llllllllllllllLLLLEELLLL


DSSP  LLlllllllHHHLlllLLLLlllllllhhhHLLLlLHHHHHHHLLLEEEEEELLLLLlle
Query IGlfeegvgYYYSdgnEATDpvtphvkaldGFNPqDPAIERALAGGVTSVXIVPGSAnpv  120
ident            |                     |           |   | |  | |   
Sbjct MY------lPGYP---ALPG--gpglppgaLPGP-EDYRRLMQWLGIDRVIITQGNA---   69
DSSP  LL------lLLLL---LLLL--llllllllLLLH-HHHHHHHHHHLLLEEEEELLHH---


DSSP  eeeeeeeelllllHHHHEE----------------------eEEEEEEEELLHHHhhhhh
Query ggqgsvikfrsiiVEECIV----------------------kDPAGLKXAFGENPkrvyg  158
ident              | |                             |              
Sbjct --hqrdngntlacVAEMGEaahavviidatttekdmekltaaGTVGARIMDLPGG-----  122
DSSP  --hllllhhhhhhHHHHHHheeeeelllllllhhhhhhhhhlLEEEEEEELLLLL-----


DSSP  hlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhHHHHHHLLLLLE
Query erkqtpstrxgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxeVGEXVLRKKIPA  218
ident                                                 | |         
Sbjct ---------avNLSELD------------------------------aVDERAHAADWMV  143
DSSP  ---------llLHHHHH------------------------------hHHHHHHHLLLEE


DSSP  EEEELLHHHhHHHHHHHHhHLLL-EEEEE-LLLH---------HHHHHHHHHHL-LLEEE
Query RXHAHRADDiLTAIRIAEeFGFN-LVIEH-GTEA---------YKISKVLAEKK-IPVVV  266
ident           |              |  | |                  |          
Sbjct AVQFDGNGL-LDHLPRLQ-KIRSrWVFDHhGKFFkgirtdgpeMAALLKLIDRGnLWFKF  201
DSSP  EEELLHHHH-HHHHHHHH-LLLLeEEELHhHHLLlllllllhhHHHHHHHHHHLlEEEEE


DSSP  LLLLLLLLlhhhllLLLLHHHHHHHLL-lLEEELLLLLL------llhhHHHHHHHHHhH
Query GPLLTFRTklelkdLTXETIAKLLKDG-vLIALXCDHPV------ipleFATVQAATAxR  319
ident                               |      |                |     
Sbjct AGVYESSRkswpyaDVAAFSRVIAAHApeRIVWGTNWPHnsvretaaypDDARLAELTlG  261
DSSP  LLHHHLLLlllllhHHHHHHHHHHHHLhhHEEELLLLLLlllllhhhllLHHHHHHHHhL


DSSP  HLLLHHHHHHLLLHHHHHHLLLLLLllllllllllleeeelllllllllleeeeeellee
Query YGAKEEDLLKILTVNPAKILGLEDRigsiepgkdadlvvwsghpfdxksvvervyidgve  379
ident     |      |  ||     |                                      
Sbjct WLPDEAARHRALVENPEALFKLSPV-----------------------------------  286
DSSP  LLLLHHHHHHHHLHHHHHHHLLLLL-----------------------------------


DSSP  eeell
Query vfrre  384
ident      
Sbjct -----  286
DSSP  -----


No 44: Query=3ooqA Sbjct=1itqA Z-score=9.9

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleEEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkfLFPGFVDAHSH   60
ident                                                        | |  
Sbjct --------------------------------------dffrdeaerimRDSPVIDGHND   22
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL


DSSP  LLLLLlllLHHHLllllllllllllllhhhhlllllhHHHHHHLLLEEEEEELLL-----
Query IGLFEegvGYYYSdgneatdpvtphvkaldgfnpqdpAIERALAGGVTSVXIVPG-----  115
ident                                       |    || |             
Sbjct LPWQL--lDMFNN-------rlqderanlttlagthtNIPKLRAGFVGGQFWSVYtpcdt   73
DSSP  HHHHH--hHHHLL-------llllhhhllllllllllLHHHHHHLLEEEEEEEELllhhh


DSSP  lllleeeeeeeeellllLHHH------HEEE-----------------------------
Query sanpvggqgsvikfrsiIVEE------CIVK-----------------------------  140
ident                              |                              
Sbjct qnkdavrrtleqmdvvhRMCRmypetfLYVTssagirqafregkvasligvegghsidss  133
DSSP  llllhhhhhhhhhhhhhHHHHhlllleEELLlhhhhhhhhhllleeeeeeeelhhhllll


DSSP  ----------EEEEEEEEllHHHH--hhhhhlllllLLHHHhHHHHH-HHHHhhhhhhhh
Query ----------DPAGLKXAfgENPK--rvygerkqtpSTRXGtAGVIR-DYFTkvknyxkk  187
ident               |                                             
Sbjct lgvlralyqlGMRYLTLT--HSCNtpwadnwlvdtgDSEPQ-SQGLSpFGQR--------  182
DSSP  hhhhhhhhhlLEEEEELL--LLLLllllllhhhlllLLLLL-LLLLLhHHHH--------


DSSP  hhhhhhlllllllllhhhhhHHHHHLLLLLEEEEEllhhHHHHHHHHH-HHHLLLEEEE-
Query kelaqkegkeftetdlkxevGEXVLRKKIPARXHAhradDILTAIRIA-EEFGFNLVIE-  245
ident                          |                                  
Sbjct -------------------vVKELNRLGVLIDLAH----VSVATMKATlQLSRAPVIFSh  219
DSSP  -------------------hHHHHHHHLLEEELLL----LLHHHHHHHhHHLLLLLEELl


DSSP  ELLL--------HHHH-HHHHHHHLLLEEELLLLL--LLLLhhhllLLLLHHHHHHHLLL
Query HGTE--------AYKI-SKVLAEKKIPVVVGPLLT--FRTKlelkdLTXETIAKLLKDGV  294
ident                            | |         |                    
Sbjct SSAYsvcasrrnVPDDvLRLVKQTDSLVMVNFYNNyiSCTNkanlsQVADHLDHIKEVAG  279
DSSP  LLLLllllllllLLHHhHHHHHHHLLEEEELLLHHhhLLLLlllhhHHHHHHHHHHHHLL


DSSP  --LEEELLLLLL--------lLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLllll
Query --LIALXCDHPV--------iPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGledr  344
ident         |                     |   |    |      |  |          
Sbjct arAVGFGGDFDGvprvpegleDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFE----  335
DSSP  hhHEEELLLLLLlllllllllLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHH----


DSSP  llllllllllleeeelllllllllleeeeeelleeeeell
Query igsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                         
Sbjct ------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  ------hhhhllllllllllllllhhhlllllllllllll


No 45: Query=3ooqA Sbjct=4hk5D Z-score=9.8

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                    |  || | |
Sbjct --------------------------------------------------TPVVVDIHTH   10
DSSP  --------------------------------------------------LLLLEEEEEE


DSSP  LllllllllHHHL-----------------------------------llllllllllll
Query IglfeegvgYYYS-----------------------------------dgneatdpvtph   85
ident            |                                                
Sbjct M------ypPSYIamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgr   64
DSSP  E------llHHHHhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllle


DSSP  llhhhHLLLlLHHHHHHHLLLEEEEEELLLLLL---------------------------
Query vkaldGFNPqDPAIERALAGGVTSVXIVPGSAN---------------------------  118
ident                     |     |                                 
Sbjct plsthFASL-AQKMHFMDTNGIRVSVISLANPWfdflapdeapgiadavnaefsdmcaqh  123
DSSP  ellhhHLLH-HHHHHHHHHLLLLEEEEEELLLLllllllllhhhhhhhhhhhhhhhhhll


DSSP  --------leeeeeeeeelllllhhhheeEEEEEEEEELLhhhhhhhhhlllllllhHHH
Query --------pvggqgsvikfrsiiveecivKDPAGLKXAFGenpkrvygerkqtpstrXGT  170
ident                              |   |                          
Sbjct vgrlfffaalplsapvdavkasiervknlKYCRGIILGTS---------------glGKG  168
DSSP  llleeeeeellllllhhhhhhhhhhhhllLLEEEEEELLL---------------llLLL


DSSP  HHHhHHHHhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEE--------
Query AGViRDYFtkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHA--------  222
ident                                       | |   |     |         
Sbjct LDD-PHLL---------------------------pvFEAVADAKLLVFLHPhyglpnev  200
DSSP  LLL-HHHH---------------------------hhHHHHHHLLLEEEELLlllllhhh


DSSP  --------------------LLHHHHHHHH--HHHHHHL-LLEEEEE-LLLHHHHH----
Query --------------------HRADDILTAI--RIAEEFG-FNLVIEH-GTEAYKIS----  254
ident                                               | |           
Sbjct ygprseeyghvlplalgfpmETTIAVARMYmaGVFDHVRnLQMLLAHsGGTLPFLAgrie  260
DSSP  hlllhhhlllhhhhhlhhhhHHHHHHHHHHhlLHHHHLLlLLEEEHHhHLLHHHHHhhhh


DSSP  -----------------------HHHHhHLLLEEELLLllllllhhhlllLLLHHHHHHH
Query -----------------------KVLAeKKIPVVVGPLltfrtklelkdlTXETIAKLLK  291
ident                         ||    |                             
Sbjct scivhdghlvktgkvpkdrrtiwTVLK-EQIYLDAVIY------------SEVGLQAAIA  307
DSSP  hhhhllhhhhhllllllllllhhHHHH-HLEEEELLLL------------LHHHHHHHHH


DSSP  LLL--LEEELLLLLLL---------lhhHHHHHHHHHHhHLLL--HHHHHHLLLHHHHHH
Query DGV--LIALXCDHPVI---------pleFATVQAATAXrYGAK--EEDLLKILTVNPAKI  338
ident            |||                   |             |       |    
Sbjct SSGadRLMFGTDHPFFppieedvqgpwdSSRLNAQAVI-KAVGegSSDAAAVMGLNAVRV  366
DSSP  HHLhhHEELLLLLLLLlllllllllllhHHHHHHHHHH-HHHLllLHHHHHHHLHHHHHH


DSSP  LLLLLLLlllllLLLLleeeelllllllllleeeeeelleeeeell
Query LGLEDRIgsiepGKDAdlvvwsghpfdxksvvervyidgvevfrre  384
ident | |                                           
Sbjct LSLKAEL-----EHHH---------------------------hhh  380
DSSP  LLLHHHH-----HHHH---------------------------hhl


No 46: Query=3ooqA Sbjct=3qy6A Z-score=9.7

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
ident                                                        | | |
Sbjct -----------------------------------------------------MIDIHCH    7
DSSP  -----------------------------------------------------LEELLLL


DSSP  LLLllllllhhhLLLLlllllllllllhhhhllllLHHHHHHHLLLEEEEEELLLLLL--
Query IGLfeegvgyyySDGNeatdpvtphvkaldgfnpqDPAIERALAGGVTSVXIVPGSAN--  118
ident |                                        |   |       |   |  
Sbjct ILP---------AMDD-----------gagdsadsIEMARAAVRQGIRTIIATPHHNNgv   47
DSSP  LLL---------LLLL-----------llllhhhhHHHHHHHHHLLLLEEELLLEELLll


DSSP  leeeeeeeeelllLLHHHH-----eeeeeEEEEEELlhhhhhhhhhlllllllhhhhHHH
Query pvggqgsvikfrsIIVEEC-----ivkdpAGLKXAFgenpkrvygerkqtpstrxgtAGV  173
ident                               |                           | 
Sbjct yknepaavreaadQLNKRLikediplhvlPGQEIRI---------------------YGE   86
DSSP  llllhhhhhhhhhHHHHHHhhllllleeeLLLEEEL---------------------LLL


DSSP  HHHHHHhhhhhhhhhhhhhhlllllllllhhHHHHhhhhlllLLEEEEElLHHHhhHHHH
Query IRDYFTkvknyxkkkelaqkegkeftetdlkXEVGexvlrkkIPARXHAhRADDilTAIR  233
ident                                                          |  
Sbjct VEQDLA-------------------------KRQL-lslndtKYILIEFpFDHVprYAEQ  120
DSSP  HHHHHH-------------------------LLLL-llhhhlLEEEEELlLLLLllLHHH


DSSP  HHHHHL---LLEEEEELLL------hHHHHHHHHHHLLLEEELL--LLLLLLlhhhlllL
Query IAEEFG---FNLVIEHGTE------aYKISKVLAEKKIPVVVGP--LLTFRTklelkdlT  282
ident             || |                | ||          |             
Sbjct LFYDLQlkgYIPVIAHPERnreirenPSLLYHLVEKGAASQITSgsLAGIFG-----kqL  175
DSSP  HHHHHHhllLEEEEELHHHlhhhhhlLHHHHHHHHLLLEEEEEHhhHLLLLL-----hhH


DSSP  LLHHHHHHHLLLLEEELLLLL---LLLHhHHHHHHHHHHHhLLLHHHHHHLlLHHHHHHL
Query XETIAKLLKDGVLIALXCDHP---VIPLeFATVQAATAXRyGAKEEDLLKIlTVNPAKIL  339
ident       |           |                          |      | |    |
Sbjct KAFSLRLVEANLIHFVASDAHnvkTRNF-HTQEALYVLEK-EFGSELPYML-TENAELLL  232
DSSP  HHHHHHHHHLLLLLEEELLLLlllLLLL-LHHHHHHHHHH-HHLLHHHHHH-HHHHHHHH


DSSP  LLLllllllllllllleeeelllllllllleeeeeelleeeeell
Query GLEdrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                              
Sbjct RNQ------------------------------tifrqppqpvkr  247
DSSP  LLL------------------------------llllllllllll


No 47: Query=3ooqA Sbjct=2gwgA Z-score=9.7

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
ident                                                        | | |
Sbjct ----------------------------------------------------XIIDIHGH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  llLLLLllLHHH------------lllllllllllllllhhhhlLLLLHHHHHHHLLLEE
Query igLFEEgvGYYY------------sdgneatdpvtphvkaldgfNPQDPAIERALAGGVT  108
ident                                                          |  
Sbjct --YTTA--PKALedwrnrqiagikdpsvxpkvselkisddelqaSIIENQLKKXQERGSD   64
DSSP  --LLLL--LHHHhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLLHHHHHHHHLLL


DSSP  EEEELLLL---llleeeeeeeeelllllHHHHEE--------------------------
Query SVXIVPGS---anpvggqgsvikfrsiiVEECIV--------------------------  139
ident      |                                                      
Sbjct LTVFSPRAgdfnvsstwaaicnelcyrvSQLFPDnfigaaxlpqspgvdpktcipelekc  124
DSSP  EEEEELLLllhhhhhhhhhhhhhhhhhhHHHLLLleeeeeellllllllhhhhhhhhhhh


DSSP  ---eEEEEEEEELLhhHHHHhhhllllllLHHHHHhhHHHHHHhhhhhhhhhhhhhhlll
Query ---kDPAGLKXAFGenPKRVygerkqtpsTRXGTAgvIRDYFTkvknyxkkkelaqkegk  196
ident                 |                     |                     
Sbjct vkeyGFVAINLNPD--PSGG---------HWTSPPltDRIWYP-----------------  156
DSSP  hhllLLLEEEELLL--LLLL---------LLLLLLllLHHHHH-----------------


DSSP  llllllhhhhHHHHHHLLLLLEEEE--------eLLHHHHHHH-hHHHHHHL--LLEEEE
Query eftetdlkxeVGEXVLRKKIPARXH--------aHRADDILTA-iRIAEEFG--FNLVIE  245
ident             |      |||  |                                || 
Sbjct ----------IYEKXVELEIPAXIHvstgahylnADTTAFXQCvaGDLFKDFpeLKFVIP  206
DSSP  ----------HHHHHHHHLLLEEELlllllhhhhHHHHHHHHHhhLLHHHHLllLLEEEL


DSSP  E-LLLHHHHHH-------------hhHHHL--LLEEeLLLLLllllhhhllLLLL-HHHH
Query H-GTEAYKISK-------------vlAEKK--IPVVvGPLLTfrtklelkdLTXE-TIAK  288
ident | |                             |                           
Sbjct HgGGAVPYHWGrfrglaqexkkplleDHVLnnIFFD-TCVYH--------qPGIDlLNTV  257
DSSP  HhHLLLHHHHHhhhhhhhhlllllhhHHLLllEEEE-LLLLL--------hHHHHhHHHH


DSSP  HHhlllLEEELLLLLL----------llhhHHHHHHHHHHhhLLLHHHHHHLLLHHHHHH
Query LLkdgvLIALXCDHPV----------ipleFATVQAATAXryGAKEEDLLKILTVNPAKI  338
ident                                               |    |   |    
Sbjct IP--vdNVLFASEXIGavrgidprtgfyydDTKRYIEAST--ILTPEEKQQIYEGNARRV  313
DSSP  LL--hhHEELLLLLLLlllleelllleellLLHHHHHHLL--LLLHHHHHHHHLHHHHHH


DSSP  LL-LLLLLlllllLLLLleeeelllllllllleeeeeelleeeeell
Query LG-LEDRIgsiepGKDAdlvvwsghpfdxksvvervyidgvevfrre  384
ident    |                                           
Sbjct YPrLDAAL-----KAKG--------------------------kleh  329
DSSP  LHhHHHHH-----HHHH--------------------------hhll


No 48: Query=3ooqA Sbjct=2a3lA Z-score=9.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------leeeeeeeelllllLLEEeeeeeelleeeeeelllllllleeeel
Query ---------------kilfknatvfpitsRPFKgdvlvsngkvekvgeniedpdaeivdl   45
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------


DSSP  llLEEE--ELEEEEEELLLLLLL--LLLH-------------------------------
Query tgKFLF--PGFVDAHSHIGLFEE--GVGY-------------------------------   70
ident      |     || | |                                           
Sbjct apHRDFynVRKVDTHVHHSACMNqkHLLRfiksklrkepdevvifrdgtyltlrevfesl  213
DSSP  llLLLLllLLEEEEEEELLLLLLhhHHHHhhhhhhhllllllleeelleeelhhhhhhhh


DSSP  ------------------------hhlllLLLL------------llllllllhhhhlLL
Query ------------------------yysdgNEAT------------dpvtphvkaldgfNP   94
ident                                                             
Sbjct dltgydlnvdlldvhadkstfhrfdkfnlKYNPcgqsrlreiflkqdnliqgrflgeiTK  273
DSSP  lllllllllllllllllllllllllllhhHHLLllllhhhhhhlllllllllllhhhhHH


DSSP  LL-HHHHHHHlllEEEEEELLL-lllleeeeeeeeellllLHHHHEE-------------
Query QD-PAIERALaggVTSVXIVPG-sanpvggqgsvikfrsiIVEECIV-------------  139
ident |     |                                                     
Sbjct QVfSDLEASK---YQMAEYRISiygrkmsewdqlaswivnNDLYSENvvwliqlprlyni  330
DSSP  HHhHHHLLLL---LEEEEEEEElllllllhhhhhhhhhhlLLLLLLLeeeeeeeellhhh


DSSP  --------------------------------------eEEEEEEEE-lLHHHH------
Query --------------------------------------kDPAGLKXA-fGENPK------  154
ident                                           |         |       
Sbjct ykdmgivtsfqnildnifiplfeatvdpdshpqlhvflkQVVGFDLVddESKPErrptkh  390
DSSP  hlllllllllhhhhhhhllhhhhhhhlhhhllllhhhhlLEEEEEEEllLLLLLllllll


DSSP  ---hhhhhLLLLLllhhHHHHHHHHHHHhhhhhhhhhhhhhhlllllllllhhhhHHHHH
Query ---rvygeRKQTPstrxGTAGVIRDYFTkvknyxkkkelaqkegkeftetdlkxeVGEXV  211
ident             |                                               
Sbjct mptpaqwtNAFNP----AFSYYVYYCYA--------------------------nLYVLN  420
DSSP  llllllllLLLLL----LHHHHHHHHHH--------------------------hHHHHH


DSSP  HL------lLLLEEEEELL---HHHHHHHHHHHhhhlllEEEEELLLHHH---HHHHHHH
Query LR------kKIPARXHAHR---ADDILTAIRIAeefgfnLVIEHGTEAYK---ISKVLAE  259
ident           |  | |       |                 | ||    |          
Sbjct KLreskgmtTITLRPHSGEagdIDHLAATFLTC------HSIAHGINLRKspvLQYLYYL  474
DSSP  HHhllllllLLEELLLLLLlllLHHHHHHHHHL------LLLLLLHHHHHlhhHHHHHHH


DSSP  HLLLEEElLLLL-LLLLhhhLLLLlLHHHHHHHLLLLEEELLLL-LLLL--hHHHHHHHH
Query KKIPVVVgPLLT-FRTKlelKDLTxETIAKLLKDGVLIALXCDH-PVIP--lEFATVQAA  315
ident   |       |          |            |    |  |    |    |       
Sbjct AQIGLAM-SPLSnNSLF---LDYHrNPFPVFFLRGLNVSLSTDDpLQIHltkEPLVEEYS  530
DSSP  HLLLEEE-LHHHhLLLL---LLLLlLLHHHHHHLLLLEEELLLLhHHHLlllLHHHHHHH


DSSP  HH-HHHLLLHHHHHHLLlHHHHHHLLL-LLLL--LLLLL--------------lllllee
Query TA-XRYGAKEEDLLKILtVNPAKILGL-EDRI--GSIEP--------------gkdadlv  357
ident  |         ||  |   |     |                                  
Sbjct IAaSVWKLSACDLCEIA-RNSVYQSGFsHALKshWIGKDyykrgpdgndihktnvphirv  589
DSSP  HHhHHHLLLHHHHHHHH-HHHHHHLLLlHHHHhhHLLLLlllllhhhllhhhhlllhhhh


DSSP  eelllllllllleeeeeelleeeeell
Query vwsghpfdxksvvervyidgvevfrre  384
ident                            
Sbjct efrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhlllllllllllll


No 49: Query=3ooqA Sbjct=4dziC Z-score=9.1

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                        |   |
Sbjct ------------------------------------------------alNYRVIDVDNH   12
DSSP  ------------------------------------------------llLLLEEEEEEE


DSSP  L-------------------------------------lllllllLHHHL----------
Query I-------------------------------------glfeegvGYYYS----------   73
ident                                                             
Sbjct YyepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnpTFDPIivpgcldllf   72
DSSP  LllllllllllllhhhlllleeeeelllleeeeelleelllllllLLLLEelllllhhhh


DSSP  -------llllllllllllllhhhhLLLLLhHHHHHHLLLEEEEEELLL--LLLL-----
Query -------dgneatdpvtphvkaldgFNPQDpAIERALAGGVTSVXIVPG--SANP-----  119
ident                           |     |              |            
Sbjct rgeipdgvdpaslmkverladhpeyQNRDA-RIAVMDEQDIETAFMLPTfgCGVEealkh  131
DSSP  hllllllllhhhllleelhhhlhhhLLHHH-HHHHHHHHLEEEEEEELLhhHHHHhhlll


DSSP  --------eeeeeeeeelllllhHHHE------------------------eeEEEEEEE
Query --------vggqgsvikfrsiivEECI------------------------vkDPAGLKX  147
ident                                                             
Sbjct dieatmasvhafnlwldedwgfdRPDHriiaapivsladptraveevdfvlarGAKLVLV  191
DSSP  lhhhhhhhhhhhhhhhhhhllllLLLLleeellllllllhhhhhhhhhhhhhlLLLLEEL


DSSP  ELlhhhhhhhhhlllllllhhhHHHH-----hhhhHHHHHhhhhhhhhhhhlllllllll
Query AFgenpkrvygerkqtpstrxgTAGV-----irdyFTKVKnyxkkkelaqkegkeftetd  202
ident                                                             
Sbjct RP--------------------APVPglvkprslgDRSHD--------------------  211
DSSP  LL--------------------LLLLlllllllllLHHHH--------------------


DSSP  hhhhhhHHHHLLL---LLEEEEE-----------------------lLHHHHHHHHHHHH
Query lkxevgEXVLRKK---IPARXHA-----------------------hRADDILTAIRIAE  236
ident           |      |   |                             |        
Sbjct ------PVWARLAeagVPVGFHLsdsgylhiaaawggakdpldqvllDDRAIHDTMASMI  265
DSSP  ------HHHHHHHhhlLLEEEELlllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHH


DSSP  -HHLL------LEEEEELL-LHHHH--------------------hHHHHhHLLLEEELL
Query -EFGF------NLVIEHGT-EAYKI--------------------sKVLAeKKIPVVVGP  268
ident     |        |                                  |           
Sbjct vHGVFtrhpklKAVSIENGsYFVHRlikrlkkaantqpqyfpedpvEQLR-NNVWIAPYY  324
DSSP  hLLHHhhllllLEEEELLLlLHHHHhhhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL


DSSP  lllllllhhhlllLLLHhHHHHHLLL--LEEELLLLL---LLLHhhHHHHHHHHHhhLLL
Query lltfrtklelkdlTXETiAKLLKDGV--LIALXCDHP---VIPLefATVQAATAXryGAK  323
ident                     |        |    | |              |     |  
Sbjct -------------EDDL-PELARVIGvdKILFGSDWPhgeGLAS--PVSFTAELK--GFS  366
DSSP  -------------LLLH-HHHHHHHLhhHLLLLLLLLlllLLLL--HHHHHHHHL--LLL


DSSP  HHHHHHLLLHHHHHHLLllllllllllllllleeeelllllllllleeeeeelleeeeel
Query EEDLLKILTVNPAKILGledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrr  383
ident | |  ||   |    ||                                           
Sbjct ESDIRKIMRDNALDLLG---------------------------------------vqvg  387
DSSP  HHHHHHHHLHHHHHHHL---------------------------------------llll


DSSP  l
Query e  384
ident  
Sbjct s  388
DSSP  l


No 50: Query=3ooqA Sbjct=1j5sA Z-score=7.6

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident                                                       || | |
Sbjct ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL


DSSP  LLlllllllhhhlllllllllllllllhhhhLLLL-------------------------
Query IGlfeegvgyyysdgneatdpvtphvkaldgFNPQ-------------------------   95
ident                                                             
Sbjct LD-----------------------------AKDIvenkpwndiwevegatdhyvwelmr   64
DSSP  LL-----------------------------HHHHhhllllllhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   95
ident                                                             
Sbjct rcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeei  124
DSSP  hllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhh


DSSP  ----------lHHHHHHHLLLEEEEEELLllllleeeeeeeeellllLHHHHE-------
Query ----------dPAIERALAGGVTSVXIVPgsanpvggqgsvikfrsiIVEECI-------  138
ident                      |                                      
Sbjct weetkkklpemTPQKLLRDMKVEILCTTD-----------dpvstleHHRKAKeavegvt  173
DSSP  hhhhhhhllllLHHHHHHHLLEEEEELLL-----------llllllhHHHHHHhhlllle


DSSP  ---------------------------------------------------eEEEEEEEE
Query ---------------------------------------------------vKDPAGLKX  147
ident                                                             
Sbjct ilptwrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkeHGCVASDH  233
DSSP  eelllllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhlLLLLEEEE


DSSP  ELLH-----------------hhhhhhhhllLLLLlhhhHHHHHHHhhhhhhhhhhhhhh
Query AFGE-----------------npkrvygerkQTPStrxgTAGVIRDyftkvknyxkkkel  190
ident |  |                                    |                   
Sbjct ALLEpsvyyvdenraravhekafsgekltqdEIND---yKAFMMVQ--------------  276
DSSP  EELLlllllllhhhhhhhhhhhlllllllhhHHHH---hHHHHHHH--------------


DSSP  hhhlllllllllhhhhhHHHHHLLLLLEEEEEL------------------------lhH
Query aqkegkeftetdlkxevGEXVLRKKIPARXHAH------------------------raD  226
ident                  |            |                             
Sbjct ----------------fGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnflR  320
DSSP  ----------------hHHHHHHHLLEEEEEELeellllhhhhhhlllllllleellllL


DSSP  HHHHHHHHHHHH--LLLEEEeELLL--HHHH-HHHHHHHL-LLEEELLlllllllhhhll
Query DILTAIRIAEEF--GFNLVIeHGTE--AYKI-SKVLAEKK-IPVVVGPlltfrtklelkd  280
ident           ||      |             |          |                
Sbjct IAEGLRYFLNEFdgKLKIVL-YVLDptHLPTiSTIARAFPnVYVGAPW------wfndsp  373
DSSP  HHHHHHHHHHHLllLLLEEE-EELLhhHHHHhHHHHHHLLlEEELLLL------lllllh


DSSP  LLLL-HHHHHHHLLL---LEEELLLLL-llLHHHHHHHHHHH-HHHL------------l
Query LTXE-TIAKLLKDGV---LIALXCDHP-viPLEFATVQAATA-XRYG------------a  322
ident    |     |        |     |          |                        
Sbjct FGMEmHLKYLASVDLlynLAGMVTDSRkllSFGSRTEMFRRVlSNVVgemvekgqipike  433
DSSP  HHHHhHHHHHHLLLLhhhLLLLLLLLLlllHHHHHHHHHHHHhHHHHhhhhhlllllhhh


DSSP  LHHHHHHLLLHHHHHHLLllllllllllllllleeeelllllllllleeeeeelleeeee
Query KEEDLLKILTVNPAKILGledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfr  382
ident   |         |                                               
Sbjct ARELVKHVSYDGPKALFF------------------------------------------  451
DSSP  HHHHHHHHHLHHHHHHHL------------------------------------------


DSSP  ll
Query re  384
ident   
Sbjct --  451
DSSP  --


No 51: Query=3ooqA Sbjct=3au2A Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  --------------------leeeeeeeellllllleeeeeeeelleeeeeelllLLLLL
Query --------------------kilfknatvfpitsrpfkgdvlvsngkvekvgeniEDPDA   40
ident                                                          |  
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPGV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLLL


DSSP  EEE---------------------------------------------------------
Query EIV---------------------------------------------------------   43
ident |                                                           
Sbjct ERAelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  LEEeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   43
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------------elllleeEELEEEEEELlllllllllhhhLLLL
Query ---------------------------dltgkflFPGFVDAHSHiglfeegvgyyySDGN   76
ident                                        |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVH-----------sTYSD  349
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEEL-----------lLLLL


DSSP  lllllllllllhhhHLLLlLHHHHHHHlllEEEEEELLLLLLL-------eeeeeeeeel
Query eatdpvtphvkaldGFNPqDPAIERALaggVTSVXIVPGSANP-------vggqgsvikf  129
ident                      |                 |                    
Sbjct -----------gqnTLEElWEAAKTMG---YRYLAVTDHSPAVrvaggpspeealkrvge  395
DSSP  -----------lllLHHHhHHHHHHHL---LLEEEEEEELHHHhllllllhhhhhhhhhh


DSSP  lllLHHHHE-eeeeEEEEEELLHhhhhhhhhlllllllhhhhhhhhhhhhhhhhhhhhhh
Query rsiIVEECI-vkdpAGLKXAFGEnpkrvygerkqtpstrxgtagvirdyftkvknyxkkk  188
ident      |        ||                                            
Sbjct irrFNETHGppyllAGAEVDIHP-------------------------------------  418
DSSP  hhhHHHHHLlleeeEEEEEELLL-------------------------------------


DSSP  hhhhhlllllllllhhhhHHHHHhlLLLL-EEEEE---------lLHHHHHHHHHHhhhh
Query elaqkegkeftetdlkxeVGEXVlrKKIP-ARXHA---------hRADDILTAIRIaeef  238
ident                                                   | |       
Sbjct ------------dgtldyPDWVL--RELDlVLVSVhsrfnlpkadQTKRLLKALEN----  460
DSSP  ------------llllllLHHHH--LLLLeEEEELlllllllhhhHHHHHHHHHLL----


DSSP  lLLEE-EEELL------------lHHHHHHHHHHHLLLEEELLLLLllllhhhlllLLLH
Query gFNLV-IEHGT------------eAYKISKVLAEKKIPVVVGPLLTfrtklelkdlTXET  285
ident         | |                      ||   |                     
Sbjct -PFVHvLAHPTarllgrrapieadWEAVFQKAKEKGVAVEIDGYYD------rmdlPDDL  513
DSSP  -LLLLeELLLLlllllllllllllHHHHHHHHHHHLLEEEEELLLL------llllLHHH


DSSP  HHHHHHLLLLEEELLLLL-llLHHHHHHHHHHHHhHLLLHHHhhHLLLHhhhhhLLLLll
Query IAKLLKDGVLIALXCDHP-viPLEFATVQAATAXrYGAKEEDllKILTVnpakiLGLEdr  344
ident        |  | |  |      | |      ||              |      |     
Sbjct ARMAYGMGLWISLSTDAHqtdHLRFMELAVGTAQ-RAWIGPE-rVLNTL-dyedLLSW--  568
DSSP  HHHHHHLLLLEEEELLLLlhhHHHHHHHHHHHHH-HLLLLLL-lLHHHL-lhhhHHHH--


DSSP  llllllllllleeeelllllllllleeeeeelleeeeell
Query igsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                         
Sbjct ---------------------------------lkarrgv  575
DSSP  ---------------------------------hhlllll


No 52: Query=3ooqA Sbjct=3dcpA Z-score=7.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
ident                                                        | | |
Sbjct ----------------------------------------------------XKRDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  lllllllllhhhLLLLLllllllllllhhhHLLLlLHHHHHHHLLLEEEEEELLLLLL--
Query iglfeegvgyyySDGNEatdpvtphvkaldGFNPqDPAIERALAGGVTSVXIVPGSAN--  118
ident                                          |         ||       
Sbjct -----------tEFCPH-----------gtHDDV-EEXVLKAIELDFDEYSIVEHAPLss   45
DSSP  -----------lLLLLL-----------llLLLH-HHHHHHHHHLLLLEEEEEEELLLlh


DSSP  ------------------leeeeeeeeelllllHHHHE--eeeeEEEEEELlhhhhhhhh
Query ------------------pvggqgsvikfrsiiVEECI--vkdpAGLKXAFgenpkrvyg  158
ident                                              |              
Sbjct efxkntagdkeavttasxaxsdlpyyfkkxnhiKKKYAsdllihIGFEVDY---------   96
DSSP  hhhhllllllhhhhlllllhhhhhhhhhhhhhhHHHLLllleeeEEEEEEL---------


DSSP  hlllllllhhhHHHHHHHHHHhhhhhhhhhhhhhhlllllllllhhhhhHHHHhlLLLL-
Query erkqtpstrxgTAGVIRDYFTkvknyxkkkelaqkegkeftetdlkxevGEXVlrKKIP-  217
ident              |                                    |         
Sbjct -----------LIGYEDFTRD--------------------------flNEYG--PQTDd  117
DSSP  -----------LLLLHHHHHH--------------------------hhHHHH--HHLLe


DSSP  EEEEEL-----------------------------------LHHHHHHHHHHhHHHLLLE
Query ARXHAH-----------------------------------RADDILTAIRIaEEFGFNL  242
ident      |                                           |       |  
Sbjct GVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEA-DLGLFKP  176
DSSP  EEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHL-LLLLLLL


DSSP  -EEEELL----------------------lhHHHHHHHHHHLLLEEELL-LLLLLLLhhh
Query -VIEHGT----------------------eaYKISKVLAEKKIPVVVGP-LLTFRTKlel  278
ident     |                            |                 |        
Sbjct rRXGHISlcqkfqqffgedtsdfseevxekfRVILALVKKRDYELDFNTaGLFKPLC-ge  235
DSSP  lEELLLLhhhllhhhhlllhhhllhhhhhhhHHHHHHHHHHLLEEEEELhHHHLLLL-ll


DSSP  lllLLLHHHHHHHLLLLEEELLLLL-llLHHHHHHHHHHHhhhlllhhhhhhlllhhhhh
Query kdlTXETIAKLLKDGVLIALXCDHP-viPLEFATVQAATAxrygakeedllkiltvnpak  337
ident                       |                                     
Sbjct typPKKIVTLASELQIPFVYGSDSHgvqDIGRGYSTYCQK--------------------  275
DSSP  lllLHHHHHHHHHLLLLEEEELLLLlhhHLLLLHHHHHHH--------------------


DSSP  hllllllllllllllllleeeelllllllllleeeeeelleeeeell
Query ilgledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                                
Sbjct ---------------------------------------------le  277
DSSP  ---------------------------------------------ll


No 53: Query=3ooqA Sbjct=1m65A Z-score=7.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
ident                                                       || | |
Sbjct ----------------------------------------------------yPVDLHMH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  lllllllllhhhlLLLLllllllllllhhhHLLLlLHHHHHHHlllEEEEEELLLLLLLe
Query iglfeegvgyyysDGNEatdpvtphvkaldGFNPqDPAIERALaggVTSVXIVPGSANPv  120
ident                                                    |        
Sbjct ------------tVAST---------haysTLSDyIAQAKQKG---IKLFAITDHGPDM-   43
DSSP  ------------lLLLL---------llllLHHHhHHHHHHHL---LLEEEEEEELLLL-


DSSP  eeeeeeeelllllhHHHE---eeeeEEEEEELLHhhhhhhhhlllllllhhhhhhhhhhh
Query ggqgsvikfrsiivEECI---vkdpAGLKXAFGEnpkrvygerkqtpstrxgtagvirdy  177
ident                           |                                 
Sbjct edaphhwhfinmriWPRVvdgvgilRGIEANIKN--------------------------   77
DSSP  llllllhhhhhhhhLLLEelleeeeEEEEEELLL--------------------------


DSSP  hhhhhhhhhhhhhhhhlllllllllhhhhHHHHHhlLLLL-EEEEE-----------lLH
Query ftkvknyxkkkelaqkegkeftetdlkxeVGEXVlrKKIP-ARXHA-----------hRA  225
ident                               |                             
Sbjct ----------------------vdgeidcSGKMF--DSLDlIIAGFhepvfaphdkatNT  113
DSSP  ----------------------lllllllLHHHH--HHLLeEEEELlllllllllhhhHH


DSSP  HHHHHHHHHhhhhlLLEE-EEELL------lHHHHHHHHHHHLLLEEELLLLlllllhhh
Query DDILTAIRIaeefgFNLV-IEHGT------eAYKISKVLAEKKIPVVVGPLLtfrtklel  278
ident       |        |   | |                 |                    
Sbjct QAMIATIAS-----GNVHiISHPGnpkyeidVKAVAEAAAKHQVALEINNSS--------  160
DSSP  HHHHHHHHL-----LLLLeELLLLlllllllHHHHHHHHHHHLLEEEEELLL--------


DSSP  llLLLLHHHHHHHLLLLEEELLLLL-llLHHHHhHHHHHH-HHHLLLHHHhhHLLLH--h
Query kdLTXETIAKLLKDGVLIALXCDHP-viPLEFAtVQAATA-XRYGAKEEDllKILTV--n  334
ident      |  |     |   ||  |                         |           
Sbjct --NCREVAAAVRDAGGWVALGSDSHtafTMGEF-EECLKIlDAVDFPPER--ILNVSprr  215
DSSP  --LHHHHHHHHHHHLLLEEEELLLLlhhHLLLL-HHHHHHhHHLLLLHHH--LHHHLhhh


DSSP  HHHHLLlllllllllllLLLLeeeelllllllllleeeeeelleeeeell
Query PAKILGledrigsiepgKDADlvvwsghpfdxksvvervyidgvevfrre  384
ident     |                                             
Sbjct LLNFLE--srgmapiaeFADL-----------------------------  234
DSSP  HHHHHH--hllllllhhHLLL-----------------------------


No 54: Query=3ooqA Sbjct=3iacA Z-score=7.1

back to top
DSSP  -----------leeeeeeeELLLlllleeeeeeeelleeeeeelllllllleeeelllle
Query -----------kilfknatVFPItsrpfkgdvlvsngkvekvgeniedpdaeivdltgkf   49
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eEELEEEEEELLLLLLllllhhhlllllllllllllllhhhhlLLLL-------------
Query lFPGFVDAHSHIGLFEegvgyyysdgneatdpvtphvkaldgfNPQD-------------   96
ident       | | |    |                              |             
Sbjct aPXPIYDFHCHLSPQE---------------------------IADDrrfdnlgqiwleg   56
DSSP  lLLLEEELLLLLLHHH---------------------------HHHLlllllhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct dhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitg  116
DSSP  llhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllll


DSSP  ------------------------HHHHHHHLLLEEEEEELLllllleeeeeeeeellll
Query ------------------------PAIERALAGGVTSVXIVPgsanpvggqgsvikfrsi  132
ident                          |        |  |                      
Sbjct tlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD--------dpidsleyhr  168
DSSP  llllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL--------llllllhhhh


DSSP  LHHH------HEEE----------------------------------------------
Query IVEE------CIVK----------------------------------------------  140
ident                                                             
Sbjct QIAAddsidiEVAPswrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltrrldh  228
DSSP  HHHHllllllEEELllllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhh


DSSP  ----EEEEEEEELLH--------------hhhhhhhhllLLLLlhhhhhHHHHHHHhhhh
Query ----DPAGLKXAFGE--------------npkrvygerkQTPStrxgtaGVIRDYFtkvk  182
ident                                                             
Sbjct faacGCRASDHGIETlrfapvpddaqldailgkrlagetLSEL---eiaQFTTAVL----  281
DSSP  hhhlLLLEEEEEELLllllllllhhhhhhhhhhhhllllLLHH---hhhHHHHHHH----


DSSP  hhhhhhhhhhhlllllllllhhhhHHHHHHLLLLLEEEEEL-------------------
Query nyxkkkelaqkegkeftetdlkxeVGEXVLRKKIPARXHAH-------------------  223
ident                          |            |                     
Sbjct ----------------------vwLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgf  319
DSSP  ----------------------hhHHHHHHHHLLEEEEEELeellllhhhhhhhllllll


DSSP  ----lhHHHHHHHHHHHHHL-----LLEEEeELLL--HHHH-HHHHHHHL-------LLE
Query ----raDDILTAIRIAEEFG-----FNLVIeHGTE--AYKI-SKVLAEKK-------IPV  264
ident              |                                              
Sbjct dsigdnNISWALSRLLDSXDvtnelPKTIL-YCLNprDNEVlATXIGNFQgpgiagkVQF  378
DSSP  leelllLLHHHHHHHHHHHHlllllLEEEE-EELLhhHHHHhHHHHHHLLlllllllEEE


DSSP  EEL----LLLLllllhhhllLLLLHHHHHHHLLL---LEEELLLLL-llLHHHHHHHHHH
Query VVG----PLLTfrtklelkdLTXETIAKLLKDGV---LIALXCDHP-viPLEFATVQAAT  316
ident   |                         |   |          |                
Sbjct GSGwwfnDQKD---------GXLRQLEQLSQXGLlsqFVGXLTDSRsflSYTRHEYFRRI  429
DSSP  LLLlhhhLLHH---------HHHHHHHHHHHHLLhhhLLLLLLLLLlllLLHHHHHHHHH


DSSP  HHHHL--------------lLHHHHHHLLLHHHHHHLLllllllllllllllleeeelll
Query AXRYG--------------aKEEDLLKILTVNPAKILGledrigsiepgkdadlvvwsgh  362
ident                            |   |                            
Sbjct LCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT----------------------  467
DSSP  HHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL----------------------


DSSP  llllllleeeeeelleeeeell
Query pfdxksvvervyidgvevfrre  384
ident                       
Sbjct --------------------ik  469
DSSP  --------------------ll


No 55: Query=3ooqA Sbjct=3f2bA Z-score=6.6

back to top
DSSP  -----------------------------------------------------leeeeee
Query -----------------------------------------------------kilfkna    7
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  eellllllleeeeeeeelleeeeeelllllLLLEEE---elllleeEELEEEEEELllll
Query tvfpitsrpfkgdvlvsngkvekvgeniedPDAEIV---dltgkflFPGFVDAHSHiglf   64
ident                                  ||               |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtapeGEKRVELHLH----  116
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELllllllllllLLLLLLLLLL----


DSSP  lllllhhhlLLLLLlllllllllhhhHLLLllhhhhhhhlllEEEEEELLLllllEEEEe
Query eegvgyyysDGNEAtdpvtphvkaldGFNPqdpaieralaggVTSVXIVPGsanpVGGQg  124
ident                                                           | 
Sbjct --------tPMSQM--------davtSVTK---lieqakkwgHPAIAVTDH----AVVQ-  152
DSSP  --------lLLLLL--------llllLHHH---hhhhhhhllLLLEEELLL----LLLL-


DSSP  eeeellllLHHH--HEEEeeEEEEEELL-----------------hhhhhhhhhlllLLL
Query svikfrsiIVEE--CIVKdpAGLKXAFG-----------------enpkrvygerkqTPS  165
ident                          |                                  
Sbjct --sfpeaySAAKkhGMKV--IYGLEANIvddpfhvtllaqnetglknlfklvslshiQYF  208
DSSP  --lhhhhhHHHHhhLLLE--EEEEEEEEellleeeeeeellhhhhhhhhhhhhhhhlLLL


DSSP  LhHHHHhhhhhhhhhhhhhhhhhhhhhhlllllllllhhhhhhhhhhllllleeeeellh
Query TrXGTAgvirdyftkvknyxkkkelaqkegkeftetdlkxevgexvlrkkiparxhahra  225
ident                                                             
Sbjct H-RVPR------------------------------------------------------  213
DSSP  L-LLLL------------------------------------------------------


DSSP  hhhhhhHHHHHHHLLL--EEEEE--LLLHHHHHHHHhHHLLLEEELLLLLLLLLH-hhll
Query ddiltaIRIAEEFGFN--LVIEH--GTEAYKISKVLaEKKIPVVVGPLLTFRTKL-elkd  280
ident                          |                  | |             
Sbjct ----ipRSVLVKHRDGllVGSGCdkGELFDNVEDIA-RFYDFLEVHPPDVYKPLYvkdee  268
DSSP  ----eeHHHHHHLLLLeeEELLLllLLLLLLLLLLH-HHLLLEEELLHHHHLLLLlllhh


DSSP  lLLLHHHHHHHLL----LLEEELLLLL------------------------------LLL
Query lTXETIAKLLKDG----VLIALXCDHP------------------------------VIP  306
ident      |      |                                            |  
Sbjct mIKNIIRSIVALGekldIPVVATGNVHylnpedkiyrkilihsqgganplnrhelpdVYF  328
DSSP  hHHHHHHHHHHHHhhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllllllllLLL


DSSP  HH--HHHHHHHHhhhhlLLHHHHHHLLLHHHHHHLLL-----------------------
Query LE--FATVQAATaxrygAKEEDLLKILTVNPAKILGL-----------------------  341
ident                     |    |   |  ||  |                       
Sbjct RTtnEMLDCFSF-----LGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeei  383
DSSP  LLhhHHHHHHHH-----HHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct remsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsr  443
DSSP  hhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct gsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykk  503
DSSP  hhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct dghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadkta  563
DSSP  ellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct ygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypa  623
DSSP  hhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct ddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgif  683
DSSP  hllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct ssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlg  743
DSSP  lllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct naqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrk  803
DSSP  lhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct hdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdlda  863
DSSP  llllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  341
ident                                                             
Sbjct mikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefv  923
DSSP  hhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllle


DSSP  ----------------------------lllllllllllllleeeelllllllllleeee
Query ----------------------------edrigsiepgkdadlvvwsghpfdxksvverv  373
ident                                                             
Sbjct idgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcld  983
DSSP  eelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllll


DSSP  eelleeeeell
Query yidgvevfrre  384
ident            
Sbjct slpdhnqlslf  994
DSSP  lllllllllll


No 56: Query=3ooqA Sbjct=2yb1A Z-score=4.2

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
ident                                                        | | |
Sbjct ----------------------------------------------------aNIDLHFH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  lllllllllhhhlLLLLllllllllllhhHHLLLllhhhhhHHLLLEEEEEELLLllllE
Query iglfeegvgyyysDGNEatdpvtphvkalDGFNPqdpaierALAGGVTSVXIVPGsanpV  120
ident                                          | |                
Sbjct ------------sRTSD----------gaLTPTE---vidrAAARAPALLALTDH----D   39
DSSP  ------------lLLLL----------llLLHHH---hhhhHHLLLLLEEEELLL----L


DSSP  EEE---eeeeeLLLLlhhhheeeeeEEEEEELL-------------------------hH
Query GGQ---gsvikFRSIiveecivkdpAGLKXAFG-------------------------eN  152
ident                           |                                 
Sbjct CTGglaeaaaaAARR-----gipflNGVEVSVSwgrhtvhivglgidpaepalaaglksI   94
DSSP  LLLlhhhhhhhHHHL-----llleeEEEEEEEEelleeeeeeeellllllhhhhhhhhhH


DSSP  HHHHHHHLLL--------------------------------------------------
Query PKRVYGERKQ--------------------------------------------------  162
ident          |                                                  
Sbjct REGRLERARQmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfr  154
DSSP  HLLHHHHHHHhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhh


DSSP  ---------lLLLHhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllhhhhhhhhhhl
Query ---------tPSTRxgtagvirdyftkvknyxkkkelaqkegkeftetdlkxevgexvlr  213
ident            |                                                
Sbjct kyltpgkpgyVSHQ----------------------------------------------  168
DSSP  hlllllllllLLLL----------------------------------------------


DSSP  lllleeeeellhhHHHHHHHHHhhhLLLE--EEEELL-------lHHHHHHHHHH-HLLL
Query kkiparxhahradDILTAIRIAeefGFNL--VIEHGT-------eAYKISKVLAE-KKIP  263
ident                  |       |     || |                         
Sbjct -----------waSLEDAVGWI--vGAGGmaVIAHPGrydmgrtlIERLILDFQAaGGQG  215
DSSP  -----------llLHHHHHHHH--hHLLLeeEELLHHhllllhhhHHHHHHHHHHlLLLE


DSSP  EEE-LLLLLllllhhhllLLLL-HHHHHHHLLLLEEELLLLL--llLHHHHHhhhhhhhh
Query VVV-GPLLTfrtklelkdLTXE-TIAKLLKDGVLIALXCDHP--viPLEFATvqaataxr  319
ident   |                            |       |                    
Sbjct IEVaSGSHS--------lDDMHkFALHADRHGLYASSGSDFHapgeDVGHTE--------  259
DSSP  EEEeELLLL--------hHHHHhHHHHHHHHLLEEEEELLLLllllLLLLLL--------


DSSP  hlllHHHHhhlllhHHHHhlLLLLLLlllllllllleeeelllllllllleeeeeELLEe
Query ygakEEDLlkiltvNPAKilGLEDRIgsiepgkdadlvvwsghpfdxksvvervyIDGVe  379
ident                      || ||                                  
Sbjct --dlPPIC-----rPIWR--ELEARI----------------------------lRPAD-  281
DSSP  --llLLLL-----lLHHH--HLHHHL----------------------------lLLLH-


DSSP  eeell
Query vfrre  384
ident      
Sbjct --aen  284
DSSP  --hhl


No 57: Query=3ooqA Sbjct=1bksA Z-score=3.7

back to top
DSSP  --leeeeeeeeLLLLllleeeeeeeelleeeeeelllllllleeeelllleeeeleeeee
Query --kilfknatvFPITsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgfvdah   58
ident                                                             
Sbjct meryenlfaqlNDRR---------------------------------------egafvp   21
DSSP  lhhhhhhhhhhHHLL---------------------------------------lleeee


DSSP  ELLLLLLllllhhhlllllllllllllllhhhhlLLLL-HHHHHHHLLLEEEEEELL---
Query SHIGLFEegvgyyysdgneatdpvtphvkaldgfNPQD-PAIERALAGGVTSVXIVP---  114
ident                                     |    |      |           
Sbjct FVTLGDP--------------------------gIEQSlKIIDTLIDAGADALELGVpfs   55
DSSP  EEELLLL--------------------------lHHHHhHHHHHHHHLLLLLEEEELlll


DSSP  --------------llllleeeeeeeeelllLLHHHHEE---------------------
Query --------------gsanpvggqgsvikfrsIIVEECIV---------------------  139
ident                                 | |                         
Sbjct dpladgptiqnanlrafaagvtpaqcfemlaLIREKHPTipigllmyanlvfnngidafy  115
DSSP  llllllhhhhhhhhhhhhhlllhhhhhhhhhHHHHHLLLlleeeeelhhhhhlllhhhhh


DSSP  -----eEEEEEEEEllhhhhhhhhhlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhhl
Query -----kDPAGLKXAfgenpkrvygerkqtpstrxgTAGVIRdyftkvknyxkkkelaqke  194
ident              |                                              
Sbjct arceqvGVDSVLVA-------------------dvPVEESA-------------------  137
DSSP  hhhhhhLLLEEEEL-------------------llLHHHLH-------------------


DSSP  llllllllhhhhhHHHHHLLLLLEEEEELLHH---HHHHHHHHHhhhllLEEEEEL-llH
Query gkeftetdlkxevGEXVLRKKIPARXHAHRAD---DILTAIRIAeefgfNLVIEHG-teA  250
ident                  ||  |                                      
Sbjct -----------pfRQAALRHNIAPIFICPPNAdddLLRQVASYG-----RGYTYLLalpL  181
DSSP  -----------hhHHHHHHLLLEEEEEELLLLlhhHHHHHHHHL-----LLLEEELlllH


DSSP  HHHHHHHHHHLL-LEEEL-LLLLllllhhhllllLLHHHHHhhllllEEELLLllLLLH-
Query YKISKVLAEKKI-PVVVG-PLLTfrtklelkdltXETIAKLlkdgvlIALXCDhpVIPL-  307
ident       | |    |   |                                          
Sbjct HHLIEKLKEYHAaPALQGfGISS-------peqvSAAVRAG-----aAGAISG--SAIVk  227
DSSP  HHHHHHHHHHLLlLEEELlLLLL-------hhhhHHHHHHL-----lLEEEEL--LHHHh


DSSP  -----------------hHHHHHHhhhhhhlllhHHHHhlllhhhhhhllllllllllll
Query -----------------eFATVQAataxrygakeEDLLkiltvnpakilgledrigsiep  350
ident                   |                                         
Sbjct iieknlaspkqmlaelrsFVSAMK----------AASR----------------------  255
DSSP  hhhhllllhhhhhhhhhhHHHHHH----------HLLL----------------------


DSSP  llllleeeelllllllllleeeeeelleeeeell
Query gkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                   
Sbjct ----------------------------------  255
DSSP  ----------------------------------


No 58: Query=3ooqA Sbjct=2anuA Z-score=3.3

back to top
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleEEELEEEEEEL
Query kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkfLFPGFVDAHSH   60
ident                                                        | | |
Sbjct -------------------------------------------------TEWLLCDFHVH   11
DSSP  -------------------------------------------------LEEEEEEEEEL


DSSP  lllllllllhhhLLLLlllllllllllhhhHLLLllHHHHHHHlllEEEEEELLlLLLL-
Query iglfeegvgyyySDGNeatdpvtphvkaldGFNPqdPAIERALaggVTSVXIVPgSANP-  119
ident                                               |  | |        
Sbjct -----------tNXSD-----------ghlPLGEvvDLFGKHG---VDVVSITD-HIVDr   45
DSSP  -----------lLLLL-----------lllLHHHhhHHHHHLL---LLEEEEEE-EEELh


DSSP  ----------------eeeeeeeeellllLHHHHE-----eeeeEEEEEELLHhhhhhhh
Query ----------------vggqgsvikfrsiIVEECI-----vkdpAGLKXAFGEnpkrvyg  158
ident                                              |              
Sbjct rtleqrkrngeplgaitedkfqdylkrlwREQKRAweeygxiliPGVEITNNT-------   98
DSSP  hhhhhhhhllllllllllllhhhhhhhhhHHHHHHhhhhlleeeEEEEEEELL-------


DSSP  hlllllllhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHllllle
Query erkqtpstrxgtagvirdyftkvknyxkkkelaqkegkeftetdlkxevgEXVLrkkipa  218
ident                                                             
Sbjct ----------------------------------------dlyhivavdvKEYV------  112
DSSP  ----------------------------------------lleeeeeellLLLL------


DSSP  eeeellhhhhhHHHHHHhhHLLL-----EEEEE------llLHHHHHHHHHHHLLLEE-E
Query rxhahraddilTAIRIAeeFGFN-----LVIEH------gtEAYKISKVLAEKKIPVV-V  266
ident                |                |                           
Sbjct -------dpslPVEEIV--EKLKeqnalVIAAHpdrkklswYLWANXERFKDTFDAWEiA  163
DSSP  -------llllLHHHHH--HHHHhllleEEELLllllllllHHHHLLLLLLLLLLEEEeE


DSSP  LLLLlllllhhhllllllhHHHHHHLLLLEEELLLLLLlLHHHHhhhhhhhhhhlllhhh
Query GPLLtfrtklelkdltxetIAKLLKDGVLIALXCDHPViPLEFAtvqaataxrygakeed  326
ident                                   |                         
Sbjct NRDD--------------lFNSVGVKKYRYVANSDFHElWHVYS---------------w  194
DSSP  ELLE--------------eLHHHHHLLLLEEEELLLLLhHHHLL---------------e


DSSP  hhhlllhhhhhhLLLLllllllllllllleeeelllllllllleeeeeelleeeeell
Query llkiltvnpakiLGLEdrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
ident                                                           
Sbjct ktlvkseknieaIKEA----------------------------irkntdvaiylxrk  224
DSSP  eeeeeelllhhhHHHH----------------------------hhhllleeeeelll


No 59: Query=3ooqA Sbjct=3e38A Z-score=2.7

back to top
DSSP  leeeeeeeeLLLLLLleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL
Query kilfknatvFPITSRpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
ident           |                                            | | |
Sbjct -aqrrneiqVPDLDG----------------------------------yTTLKCDFHXH   25
DSSP  -llllllllLLLLLL----------------------------------lEEEEEELLLL


DSSP  lllllllllhhhLLLLlllllllllllhhhhllllLHHHHHHHLLLEEEEEELLLLLL--
Query iglfeegvgyyySDGNeatdpvtphvkaldgfnpqDPAIERALAGGVTSVXIVPGSAN--  118
ident                                          |   |              
Sbjct -----------sVFSD--------------glvwpTVRVDEAYRDGLDAISLTEHIEYrp   60
DSSP  -----------lLLLL--------------llllhHHHHHHHHHLLLLEELLEEELLLll


DSSP  ---------leeeeeeeeeLLLLlhhhheeeeeEEEEEELLHhhhhhhhhlllllllhhh
Query ---------pvggqgsvikFRSIiveecivkdpAGLKXAFGEnpkrvygerkqtpstrxg  169
ident                                   |                         
Sbjct hkqdvvsdhnrsfdlcreqAEKL-----gilliKGSEITRAX-apghfnaiflsdsnple  114
DSSP  llllllllllhhhhhhhhhHHHH-----lleelLEEEEELLL-llleeeeelllllhhhl


DSSP  hHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHhlLLLLeeeeellhhhhh
Query tAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevGEXVlrKKIParxhahraddil  229
ident                                        |    |               
Sbjct qKDYKD------------------------------afREAK--KQGA------------  130
DSSP  lLLHHH------------------------------hhHHHH--HLLL------------


DSSP  hhhhhhhhhllLEEEEELLL-----hhHHHH------hhhhhlLLEE-ELLLllllllhh
Query tairiaeefgfNLVIEHGTE-----ayKISK------vlaekkIPVV-VGPLltfrtkle  277
ident                 |                                           
Sbjct -----------FXFWNHPGWdsqqpdtTKWWpehtalyqegcxHGIEvANGH--------  171
DSSP  -----------EEEELLLLLlllllllLLLLhhhhhhhhllllLEEEeEELL--------


DSSP  hllllLLHHhHHHHLL----LLEEELLLLLLLLhhhhhhhhhhhhhhlllhhhhhhLLLH
Query lkdltXETIaKLLKDG----VLIALXCDHPVIPlefatvqaataxrygakeedllkILTV  333
ident                            |                               |
Sbjct -----LYXP-EAIQWCldknLTXIGTSDIHQPI----------qtdydfekgehrtXTFV  215
DSSP  -----EELL-HHHHHHhhhlLEEEEELLLLLLH----------hhhllhhhlllllEEEE


DSSP  --hhhhhllLLLL-------------------------------llllllllllleeeel
Query --npakilgLEDR-------------------------------igsiepgkdadlvvws  360
ident                                                             
Sbjct fakerslqgIREAldnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitn  275
DSSP  eellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeee


DSSP  LLLLLL-------------------------------------------llleeeeeell
Query GHPFDX-------------------------------------------ksvvervyidg  377
ident                                                             
Sbjct VTDLVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkg  335
DSSP  LLLLLEeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeellee


DSSP  eeeeell
Query vevfrre  384
ident        
Sbjct lkytisl  342
DSSP  eeeeeel