Results: dupa

Query: 3nqbA

MOLECULE: ADENINE DEAMINASE 2;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3nqb-A 68.7  0.0  587   587  100 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   2:  2vun-A 30.5  2.8  309   385   18 PDB  MOLECULE: ENAMIDASE;                                                 
   3:  1onx-A 30.4  3.3  315   390   19 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   4:  3giq-A 29.6  3.4  322   475   21 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   5:  2paj-A 29.4  3.3  329   421   15 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   6:  4cqb-A 29.1  2.8  312   402   17 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   7:  3e74-A 28.9  2.9  307   429   22 PDB  MOLECULE: ALLANTOINASE;                                              
   8:  1gkp-A 28.6  3.0  313   458   21 PDB  MOLECULE: HYDANTOINASE;                                              
   9:  1yrr-B 28.4  2.7  292   334   21 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  10:  3ls9-A 28.2  3.2  326   453   20 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  11:  3mkv-A 27.9  2.9  301   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  12:  3mtw-A 27.8  3.1  307   404   23 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  13:  4b3z-D 26.9  3.3  314   477   17 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  14:  3gri-A 26.8  3.2  305   422   19 PDB  MOLECULE: DIHYDROOROTASE;                                            
  15:  1j6p-A 26.5  3.7  318   407   17 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  16:  4c5y-A 25.9  3.3  306   436   19 PDB  MOLECULE: OCHRATOXINASE;                                             
  17:  2uz9-A 25.5  3.2  309   444   16 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  18:  2oof-A 25.3  3.3  311   403   18 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  19:  1k6w-A 25.0  3.3  302   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  20:  2ogj-A 24.3  3.3  298   379   19 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  4rdv-B 23.9  3.3  315   451   17 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  22:  3ooq-A 22.0  3.0  267   384   19 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  23:  3icj-A 21.7  3.3  280   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  24:  1a5k-C 21.2  3.1  302   566   19 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  25:  1bf6-A 17.5  3.2  226   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  26:  3cjp-A 17.3  2.9  206   262   14 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  27:  1a4m-A 16.7  2.9  224   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  28:  2y1h-B 16.7  3.1  221   265   14 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  29:  3k2g-B 16.6  3.6  230   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  30:  2ob3-A 16.2  3.2  219   329   17 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  31:  3gg7-A 16.0  3.2  209   243   17 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  32:  3pnu-A 15.9  3.4  239   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  33:  2imr-A 15.9  5.1  273   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  34:  2ffi-A 15.2  3.2  217   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  2vc5-A 15.2  3.4  219   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  36:  4hk5-D 14.7  3.5  225   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  37:  3irs-A 14.6  3.2  209   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  38:  4dlf-A 14.4  3.2  213   287   17 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  39:  2dvt-A 14.2  3.3  211   325   10 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  40:  2gwg-A 14.1  3.6  220   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  41:  4mup-B 14.1  3.3  210   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  42:  2qpx-A 13.5  4.0  218   376    9 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  43:  4qrn-A 13.3  3.3  212   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  44:  4ofc-A 13.1  3.1  205   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  45:  1itq-A 12.9  5.3  227   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  46:  4dzi-C 12.0  3.6  205   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  47:  3qy6-A 12.0  3.2  182   247   16 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  1j5s-A 11.8  3.4  225   451    8 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  1v77-A 11.3  3.3  173   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  50:  2a3l-A 11.1  3.6  234   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  3iac-A 11.1  3.4  217   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3dcp-A  8.5  3.2  162   277    7 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  1m65-A  8.4  3.5  170   234   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  1bks-A  8.4  3.5  174   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  55:  3au2-A  8.2 11.5  189   575   15 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  56:  3f2b-A  8.0  8.3  191   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  57:  3e38-A  7.6 12.5  169   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2anu-A  7.1  3.6  153   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  2yb1-A  6.8  4.1  151   284   17 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3nqbA Sbjct=3nqbA Z-score=68.7

back to top
DSSP  LLHHHLLHHHHHHHHHHHHLLLLEEEEEELLEEELLLLLLEEELEEEEELLEEEEEELLL
Query EPADLNDDTLRARAVAAARGDQRFDVLITGGTLVDVVTGELRPADIGIVGALIASVHEPA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EPADLNDDTLRARAVAAARGDQRFDVLITGGTLVDVVTGELRPADIGIVGALIASVHEPA   60
DSSP  LLHHHLLHHHHHHHHHHHHLLLLEEEEEELLEEELLLLLLEEELEEEEELLEEEEEELLL


DSSP  LLLLEEEEEELLLLEEEELEEEEEELHHHHLLLHHHHHHHHHLLLEEEEEELLHHHHHHH
Query SRRDAAQVIDAGGAYVSPGLIDTHXHIESSXITPAAYAAAVVARGVTTIVWDPHEFGNVH  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SRRDAAQVIDAGGAYVSPGLIDTHXHIESSXITPAAYAAAVVARGVTTIVWDPHEFGNVH  120
DSSP  LLLLEEEEEELLLLEEEELEEEEEELHHHHLLLHHHHHHHHHLLLEEEEEELLHHHHHHH


DSSP  LHHHHHHHHHHHLLLLLEEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHLLLLEEEEEEE
Query GVDGVRWAAKAIENLPLRAILLAPSCVPSAPGLERGGADFDAAILADLLSWPEIGGIAEI  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GVDGVRWAAKAIENLPLRAILLAPSCVPSAPGLERGGADFDAAILADLLSWPEIGGIAEI  180
DSSP  LHHHHHHHHHHHLLLLLEEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHLLLLEEEEEEE


DSSP  LLHHHHHLLLHHHHHHHHHHHHHLLEEEELLLLLLHHHHHHHHHLLLLEELLLLLHHHHH
Query XNXRGVIERDPRXSGIVQAGLAAEKLVCGHARGLKNADLNAFXAAGVSSDHELVSGEDLX  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct XNXRGVIERDPRXSGIVQAGLAAEKLVCGHARGLKNADLNAFXAAGVSSDHELVSGEDLX  240
DSSP  LLHHHHHLLLHHHHHHHHHHHHHLLEEEELLLLLLHHHHHHHHHLLLLEELLLLLHHHHH


DSSP  HHHHLLLEEEEELLLHHHHHHHHHHHHHHLLLLLLEEEELLLLLHHHHHHLLLHHHHHHH
Query AKLRAGLTIELRGSHDHLLPEFVAALNTLGHLPQTVTLCTDDVFPDDLLQGGGLDDVVRR  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AKLRAGLTIELRGSHDHLLPEFVAALNTLGHLPQTVTLCTDDVFPDDLLQGGGLDDVVRR  300
DSSP  HHHHLLLEEEEELLLHHHHHHHHHHHHHHLLLLLLEEEELLLLLHHHHHHLLLHHHHHHH


DSSP  HHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLLLLLLEEEEEELLEEE
Query LVRYGLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEDLNGFSARHVLASGRAV  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LVRYGLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEDLNGFSARHVLASGRAV  360
DSSP  HHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLLLLLLEEEEEELLEEE


DSSP  EELLEELLLLLLLLLHHHLLLLLLLLLLHHHHLLLLLLLEEEEEEEELLLLLEEEEEEEE
Query AEGGRXLVDIPTCDTTVLKGSXKLPLRXANDFLVKSQGAKVRLATIDRPRFTQWGETEAD  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AEGGRXLVDIPTCDTTVLKGSXKLPLRXANDFLVKSQGAKVRLATIDRPRFTQWGETEAD  420
DSSP  EELLEELLLLLLLLLHHHLLLLLLLLLLHHHHLLLLLLLEEEEEEEELLLLLEEEEEEEE


DSSP  EELLEELLLLLEEEEEEELLLLLLLLLEEEEEEELLLLLLLEEEELLLLLLLLEEEEELL
Query VKDGFVVPPEGATXISVTHRHGXAEPTTKTGFLTGWGRWNGAFATTVSHDSHNLTVFGGN  480
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VKDGFVVPPEGATXISVTHRHGXAEPTTKTGFLTGWGRWNGAFATTVSHDSHNLTVFGGN  480
DSSP  EELLEELLLLLEEEEEEELLLLLLLLLEEEEEEELLLLLLLEEEELLLLLLLLEEEEELL


DSSP  HHHHHHHHHHHHHLLLEEEEEELLEEEEEEELLLLLLLLLLLHHHHHHHHHHHHHHHHHH
Query AGDXALAANAVIGTGGGXAVASEGKVTAILPLPLSGLVSDAPLEEVARAFEDLREAVGKV  540
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AGDXALAANAVIGTGGGXAVASEGKVTAILPLPLSGLVSDAPLEEVARAFEDLREAVGKV  540
DSSP  HHHHHHHHHHHHHLLLEEEEEELLEEEEEEELLLLLLLLLLLHHHHHHHHHHHHHHHHHH


DSSP  LLLLLLLLLHHHHHLLLLLLLLLLEELLLLEEELLLLEEELLLEEEL
Query VEWQPPYLVFKACFGATLACNIGPHQTDXGIADVLTGKVXESPVIEV  587
ident |||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VEWQPPYLVFKACFGATLACNIGPHQTDXGIADVLTGKVXESPVIEV  587
DSSP  LLLLLLLLLHHHHHLLLLLLLLLLEELLLLEEELLLLEEELLLEEEL


No 2: Query=3nqbA Sbjct=2vunA Z-score=30.5

back to top
DSSP  llhhhllhhhhhhhhhhhhllllEEEEEELL-EEELLL--LLLEEELEEEEELLEEEEEE
Query epadlnddtlraravaaargdqrFDVLITGG-TLVDVV--TGELRPADIGIVGALIASVH   57
ident                            |      |        |    |     |||   
Sbjct -----------------------SKTIIKNIgKIVSGDikSPVLQADTIVVEDGLIAAIG   37
DSSP  -----------------------LEEEEELLlEEELLLllLLEELLLEEEEELLEEEEEE


DSSP  LlLLLLL---eEEEEELLLLEEEELEEEEEELHHhhlLLHH-------HHHHHHHLLLEE
Query EpASRRD---aAQVIDAGGAYVSPGLIDTHXHIEssxITPA-------AYAAAVVARGVT  107
ident            |  ||| |  | ||| ||| |                         |||
Sbjct G-EELMKdagdATIIDAAGSTVTPGLLDTHVHVS---GGDYaprqktmDFISSALHGGVT   93
DSSP  L-HHHHLllllLEEEELLLLEEEELEEEEEELLL---LLLEehhhleeLHHHHHHLLLEE


DSSP  EEEE-LLHHH-hHHHL----HHHHHHHHHH-HLLL--LLEEEE-EELLLLllllllllll
Query TIVW-DPHEF-gNVHG----VDGVRWAAKA-IENL--PLRAIL-LAPSCVpsapglergg  157
ident |        |                  |                               
Sbjct TMISaGSPHFpgRPKDaagtKALAITLSKSyYNARpaGVKVHGgAVILEK----------  143
DSSP  EEEElLLLLLllLLLLhhhhHHHHHHHHHHhHHLLhhHLEEELlEELLLL----------


DSSP  lLLLHHHHHHHHLLLlEEEEEEEL----LHHHHhlllhhHHHHHHHHHHHLLEEEELLL-
Query aDFDAAILADLLSWPeIGGIAEIX----NXRGVierdprXSGIVQAGLAAEKLVCGHAR-  212
ident                      |                     |         |  |   
Sbjct -GLTEEDFIEMKKEG-VWIVGEVGlgtiKNPED------AAPMVEWAHKHGFKVQMHTGg  195
DSSP  -LLLHHHHHHHHHLL-LLEEEEELllllLLHHH------HHHHHHHHHHLLLEEEEELLl


DSSP  --------LLLHhHHHHHHhllLLEELLL------LLHHHHHHHHH-LLLEEEEELL-LH
Query --------GLKNaDLNAFXaagVSSDHEL------VSGEDLXAKLR-AGLTIELRGS-HD  256
ident              |                      |               |       
Sbjct tsipgsstVTAD-DVIKTK---PDVVSHInggptaISVQEVDRIMDeTDFAMEIVQCgNP  251
DSSP  llllllllLLHH-HHHHHL---LLEEELLllllllLLHHHHHHHHHhLLLEEEEELLlLH


DSSP  HHHHHHHHHHHHHlLLLLLEEEELLLLL-HHHHhhlLLHHHHHHHHHHL-LLLHHHHHHH
Query HLLPEFVAALNTLgHLPQTVTLCTDDVF-PDDLlqgGGLDDVVRRLVRY-GLKPEWALRA  314
ident                    |    |            |               || |   
Sbjct KIADYVARRAAEK-GQLGRVIFGNDAPSgTGLI--pLGILRNMCQIASMsDIDPEVAVCM  308
DSSP  HHHHHHHHHHHHH-LLHHHEEEELLLLLlLLLL--lLHHHHHHHHHHHHlLLLHHHHHHH


DSSP  HLHHHHHHHLLlLLLLLLLLLLLLEEEE---------LLLL------LLLEEEEEELLEE
Query ATLNAAQRLGRsDLGLIAAGRRADIVVF---------EDLN------GFSARHVLASGRA  359
ident || |     |    | || |  ||                             ||  | |
Sbjct ATGNSTAVYGL-NTGVIAPGKEADLIIMdtplgsvaeDAMGaiaagdIPGISVVLIDGEA  367
DSSP  HLHHHHHHHLL-LLLLLLLLLLLLEEEEellllllllLHHHhhhhllLLEEEEEEELLEE


DSSP  EEELLEelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeee
Query VAEGGRxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetea  419
ident |    |                                                      
Sbjct VVTKSR------------------------------------------------------  373
DSSP  EELLLL------------------------------------------------------


DSSP  eeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeel
Query dvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfgg  479
ident                                                             
Sbjct ------------------------------------------------------------  373
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhh
Query nagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgk  539
ident                                                             
Sbjct ------------------------------------------------------------  373
DSSP  ------------------------------------------------------------


DSSP  hlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query vvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                 
Sbjct ------------------------------------ntppakraakil  385
DSSP  ------------------------------------llllllllleel


No 3: Query=3nqbA Sbjct=1onxA Z-score=30.4

back to top
DSSP  llhhhllHHHHhhhhhhhhlllleEEEEELLEEELLllLLEEELEEEEELLEEEEEELlL
Query epadlndDTLRaravaaargdqrfDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpA   60
ident         |                 |  |  |           |       |  |    
Sbjct ----midYTAA------------gFTLLQGAHLYAP--EDRGICDVLVANGKIIAVAS-N   41
DSSP  ----lllLHHH------------lLEEEEEEEEELL--LEEEEEEEEEELLEEEEEEL-L


DSSP  LLLL---eEEEEELLLLEEEELEEEEEELHHH---------hLLLHhhHHHHHHLLLEEE
Query SRRD---aAQVIDAGGAYVSPGLIDTHXHIES---------sXITPaaYAAAVVARGVTT  108
ident    |      | |  |    || || | |                           ||| 
Sbjct IPSDivpnCTVVDLSGQILCPGFIDQHVHLIGgggeagpttrTPEV--ALSRLTEAGVTS   99
DSSP  LLLLllllLEEEELLLLEEEELEEEEEELLLLllllllhhhlLLLL--LHHHHHHLLEEE


DSSP  EEELLHHHhHHHLhhHHHHHHHHHL---LLLLEEEEEELLLLLLllllllllllllhHHH
Query IVWDPHEFgNVHGvdGVRWAAKAIE---NLPLRAILLAPSCVPSapglerggadfdaAIL  165
ident  |                               |  |                       
Sbjct VVGLLGTD-SISR--HPESLLAKTRalnEEGISAWMLTGAYHVP--------srtitGSV  148
DSSP  EEELLLLL-LLLL--LHHHHHHHHHhhhHHLLEEEEEEELLLLL--------lllllLLH


DSSP  HHHHL-LLLEEEEEeELLH-----HHHHlllHHHHHHHHHHHHHL------LEEEELLLL
Query ADLLS-WPEIGGIAeIXNX-----RGVIerdPRXSGIVQAGLAAE------KLVCGHARG  213
ident            |                                            |   
Sbjct EKDVAiIDRVIGVX-CAISdhrsaAPDV---YHLANMAAESRVGGllggkpGVTVFHMGD  204
DSSP  HHHHHhLLLEEEEE-EEELlllllLLLH---HHHHHHHHHHHHHHhhhlllLEEEEEELL


DSSP  LlhhhHHHHHHL--------lLLEELLL-LLHHHHHHHHHLL---LEEEEELLLHH--HH
Query LknadLNAFXAA--------gVSSDHEL-VSGEDLXAKLRAG---LTIELRGSHDH--LL  259
ident      |                                |       ||    | |     
Sbjct S-kkaLQPIYDLlencdvpisKLLPTHVnRNVPLFEQALEFArkgGTIDITSSIDEpvAP  263
DSSP  L-lllLHHHHHHhhlllllhhHEEEELHhHLHHHHHHHHHHHhllLLEEEELLLLLllLH


DSSP  HHHHHHHHHHLLLLLLEEEELLLLL--------------HHHHhhlLLHHHHHHHHHH-L
Query PEFVAALNTLGHLPQTVTLCTDDVF--------------PDDLlqgGGLDDVVRRLVR-Y  304
ident  |  |     |     |||  |                          |   |  ||  |
Sbjct AEGIARAVQAGIPLARVTLSSDGNGsqpffddegnlthiGVAG--fETLLETVQVLVKdY  321
DSSP  HHHHHHHHHLLLLHHHEEEELLLLLeeeeellllleeeeEELL--lHHHHHHHHHHHHhH


DSSP  LLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLllLLLEEEEEELLEEEEELL
Query GLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEDlnGFSARHVLASGRAVAEGG  364
ident       |||  |   |  |     | |  |  ||  |           | | |      |
Sbjct DFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTP--ELRIEQVYARGKLMVKDG  379
DSSP  LLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEELL--LLLEEEEEELLEEEEELL


DSSP  EELLLLLLlllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeell
Query RXLVDIPTcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdg  424
ident    |                                                        
Sbjct KACVKGTF----------------------------------------------------  387
DSSP  EELLLLLL----------------------------------------------------


DSSP  eellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhh
Query fvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdx  484
ident                                                             
Sbjct ------------------------------------------------------------  387
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhllll
Query alaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewq  544
ident                                                             
Sbjct ------------------------------------------------------------  387
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhlllllllllleelllleeelllleeellleeel
Query ppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                            
Sbjct ----------------------------------------etd  390
DSSP  ----------------------------------------lll


No 4: Query=3nqbA Sbjct=3giqA Z-score=29.6

back to top
DSSP  llhhhllhhhhhhhhhhhhllLLEEEEEELLEEELLLLLLEEELEEEEELLEEEEEELLL
Query epadlnddtlraravaaargdQRFDVLITGGTLVDVVTGELRPADIGIVGALIASVHEPA   60
ident                         |  ||||   |      | || |     ||   |  
Sbjct ---------------------EKLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGELG   39
DSSP  ---------------------LLEEEEEELLEELLLLLLLLEELEEEEELLEEEEEELLL


DSSP  LLlLEEEEEELLLLEEEELEEEEEELHHhhlLLHH--HHHHHHHLLLEEEEEEL---lHH
Query SRrDAAQVIDAGGAYVSPGLIDTHXHIEssxITPA--AYAAAVVARGVTTIVWD---pHE  115
ident     |    || |  | || || | |                    | || |        
Sbjct AH-PARHAWDASGKIVAPGFIDVHGHDD---LMFVekPDLRWKTSQGITTVVVGncgvSA   95
DSSP  LL-LEEEEEELLLLEEEELEEELLLLLL---LHHHhlLLLHHHHLLLEEEEEELllllLL


DSSP  HHHH---------------HLHHHHHHHHHHHL--LLLLEEEEEELLLLLLL--LLLL--
Query FGNV---------------HGVDGVRWAAKAIE--NLPLRAILLAPSCVPSA--PGLE--  154
ident                         |     |            |                
Sbjct APAPlpgntaaalallgetPLFADVPAYFAALDaqRPMINVAALVGHANLRLaaMRDPqa  155
DSSP  LLLLllllllhhhhhhlllLLLLLHHHHHHHHHhlLLLLEEEEEEEHHHHHHhhLLLLll


DSSP  ---lllllLLHHHHHHHHLLLlEEEEEEEL----LHHHhhLLLHhHHHHHHHHHHHLLEE
Query ---rggadFDAAILADLLSWPeIGGIAEIX----NXRGviERDPrXSGIVQAGLAAEKLV  207
ident              |   |      |                      |          | 
Sbjct aptaaeqqAMQDMLQAALEAG-AVGFSTGLayqpGAVA--QAAE-LEGLARVAAERRRLH  211
DSSP  lllhhhhhHHHHHHHHHHHHL-LLEEEEELllllHHHL--LHHH-HHHHHHHHHHLLLEE


DSSP  EELLLLL---LHHHHHHHHHLL-----LLEE-LLLL-----LHHHhHHHHHLL-------
Query CGHARGL---KNADLNAFXAAG-----VSSD-HELV-----SGEDlXAKLRAG-------  246
ident   | |       |      | |          |         |    | |          
Sbjct TSHIRNEadgVEAAVEEVLAIGrgtgcATVVsHHKCmmpqnWGRS-RATLANIdrareqg  270
DSSP  EEELLLLlllHHHHHHHHHHHHhhhllEEEElLLLLllhhhLLLH-HHHHHHHhhhhhll


DSSP  --LEEEEELLLH------------------------------------------------
Query --LTIELRGSHD------------------------------------------------  256
ident                                                             
Sbjct veVALDIYPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaar  330
DSSP  llEEEEELLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhh


DSSP  -----------HHHHHHHHhhhhhllLLLLEEEELLLLL----HHHHhhLLLHHHHHHHH
Query -----------HLLPEFVAalntlghLPQTVTLCTDDVF----PDDLlqGGGLDDVVRRL  301
ident                |                   |       |      |    |  | 
Sbjct rlapagaiyfaMDEDEVKR-----ifQHPCCMVGSDGLPndarPHPR-lWGSFTRVLGRY  384
DSSP  hhlleeeeeelLLHHHHHH-----hhHLLLEEELLLLLLllllLLLH-hHHHHHHHHHHH


DSSP  H-HLLL-LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELlLLLL-----------
Query V-RYGL-KPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEdLNGF-----------  348
ident |    |   | |    |   |   |    |    |  || |||                 
Sbjct VrEARLmTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVFD-PDTVadratwdeptl  443
DSSP  HhHLLLlLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEL-LLLLlllllllllll


DSSP  ---LEEEEEELLEEEEElleELLLLLllllhhhllllllllllhhhhllllllleeeeee
Query ---SARHVLASGRAVAEggrXLVDIPtcdttvlkgsxklplrxandflvksqgakvrlat  405
ident        ||  |  |                                             
Sbjct asvGIAGVLVNGAEVFP---QPPADG----------------------------------  466
DSSP  lllLEEEEEELLEEEEL---LLLLLL----------------------------------


DSSP  eellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeee
Query idrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafat  465
ident                                                             
Sbjct ------------------------------------------------------------  466
DSSP  ------------------------------------------------------------


DSSP  lllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhh
Query tvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdaplee  525
ident                                                             
Sbjct ------------------------------------------------------------  466
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeelllee
Query varafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespvi  585
ident                                                             
Sbjct -----------------------------------------------------rpgqvlr  473
DSSP  -----------------------------------------------------lllllll


DSSP  el
Query ev  587
ident   
Sbjct ax  475
DSSP  ll


No 5: Query=3nqbA Sbjct=2pajA Z-score=29.4

back to top
DSSP  llhhhllhhhhhhhhhhhhllllEEEEEELL-EEELLL------LLLEEELEEEEELLEE
Query epadlnddtlraravaaargdqrFDVLITGG-TLVDVV------TGELRPADIGIVGALI   53
ident                           ||                       || |||  |
Sbjct -----------------------PSTLIRNAaAIMTGGrgtaddPSRVPGPDIRIVGDTI   37
DSSP  -----------------------LEEEEELLlEELLLLllllllLLLLLLLLEEEELLEE


DSSP  EEEELllLLLL-eEEEEELLLLEEEELEEEEEELHHHHL----------------LLHHH
Query ASVHEpaSRRD-aAQVIDAGGAYVSPGLIDTHXHIESSX----------------ITPAA   96
ident                  ||      |    || |   |                      
Sbjct DAIGA--LAPRpgETIVDATDCVIYPAWVNTHHHLFQSLlkgepfralfderrfrLAARI   95
DSSP  EEELL--LLLLllLEEEELLLLEEEELEELLLLLHHHHHllllllhhhllhhhhhHHHHH


DSSP  HHHHHHLLLEEEEEELLHhHHHH-hlhHHHHHHHHHHLLLLLEEEEEELLLllLLLLLLL
Query YAAAVVARGVTTIVWDPHeFGNV-hgvDGVRWAAKAIENLPLRAILLAPSCvpSAPGLER  155
ident         |  |               |         | | ||  ||             
Sbjct GLIELARSGCATVADHNY-VYYPgmpfDSSAILFEEAEKLGLRFVLLRGGA--TQTRQLE  152
DSSP  HHHHHHLLLEEEEEELLL-LLLLllllLHHHHHHHHHHHLLLEEEEEELLL--LLLLLLL


DSSP  ------LLLL---LLHHHHHHHHLLLL--------EEEEEEELLHHhhhLLLHhHHHHHH
Query ------GGAD---FDAAILADLLSWPE--------IGGIAEIXNXRgviERDPrXSGIVQ  198
ident                 |    |                 |                    
Sbjct adlptaLRPEtldAYVADIERLAARYHdaspramrRVVMAPTTVLY-siSPRE-MRETAA  210
DSSP  llllhhHLLLlhhHHHHHHHHHHHHLLllllllleEEEELLLLLLL-llLHHH-HHHHHH


DSSP  HHHHHLLEEEELLLlllHHHHHHHH-HLLL---LEELLLLLHH--HHHHHHHLLLEEEEE
Query AGLAAEKLVCGHARglkNADLNAFX-AAGV---SSDHELVSGE--DLXAKLRAGLTIELR  252
ident            |                          ||             |      
Sbjct VARRLGLRMHSHLS--gKSPVAFCGeHDWLgsdVWYAHLVKVDadEIALLAQTGTGVAHC  268
DSSP  HHHHLLLEEEEELL--lLLHHHHHHhLLLLlllEEEELLLLLLhhHHHHHHHHLLEEEEL


DSSP  L-LLHHhhhhHHHHHHHHlllLLLEEEELLLLLHHHHhhlLLHHHHHHHHHHLL----LL
Query G-SHDHllpeFVAALNTLghlPQTVTLCTDDVFPDDLlqgGGLDDVVRRLVRYG----LK  307
ident   |        |            |    |                |             
Sbjct PqSNGR---lPVREMADA---GVPVSIGVDGAASNEA---ADMISEVHMTWLAQrarlAS  319
DSSP  HhHHHL---lLLLLHHHH---LLLEEELLLHHHHLLL---LLHHHHHHHHHHHHhhllLL


DSSP  HHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEL------------LLLL------LL
Query PEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFE------------DLNG------FS  349
ident         |   |   |    |  | |  ||| |                         |
Sbjct IAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRlddpryfglhdpAIGPvasggrPS  379
DSSP  HHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEElllhhhlllllhHHHHhhllllLE


DSSP  EEEEEELLEEEEELLEElLLLLllllhhhllllllllllhhhhllllllleeeeeeeell
Query ARHVLASGRAVAEGGRXlVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrp  409
ident        |  |                                                 
Sbjct VMALFSAGKRVVVDDLI-EGVD--------------------------------------  400
DSSP  EEEEEELLEEEEELLLL-LLLL--------------------------------------


DSSP  llleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeellll
Query rftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvsh  469
ident                                                             
Sbjct ------------------------------------------------------------  400
DSSP  ------------------------------------------------------------


DSSP  lllleeeeellhhhhhhhhhhhhhlLLEE-EEEElleeeeeeelllllllllllhhhhhh
Query dshnltvfggnagdxalaanavigtGGGX-AVASegkvtailplplsglvsdapleevar  528
ident                                |                            
Sbjct -------------ikelggearrvvRELLrEVVV--------------------------  421
DSSP  -------------hhhhhhhhhhhhHHHHhHHHL--------------------------


DSSP  hhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query afedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                            
Sbjct -----------------------------------------------------------  421
DSSP  -----------------------------------------------------------


No 6: Query=3nqbA Sbjct=4cqbA Z-score=29.1

back to top
DSSP  llhhhllhhhhhhhhhhhhlLLLEEEEEELLEEELllllLEEELEEEEELLEEEEEELlL
Query epadlnddtlraravaaargDQRFDVLITGGTLVDvvtgELRPADIGIVGALIASVHEpA   60
ident                        ||  |    |           ||||||  |       
Sbjct --------------------SKDFDLIIRNAYLSE----KDSVYDIGIVGDRIIKIEA-K   35
DSSP  --------------------LLLEEEEEEEEEELL----LLEEEEEEEELLEEEEEEL-L


DSSP  LLLLEEEEEELLLLEEEELEEEEEELH-HHHL----------------------------
Query SRRDAAQVIDAGGAYVSPGLIDTHXHI-ESSX----------------------------   91
ident         ||| |  ||||  | | |   |                              
Sbjct IEGTVKDEIDAKGNLVSPGFVDAHTHMdKSFTstgerlpkfwsrpytrdaaiedglkyyk   95
DSSP  LLLLEEEEEELLLLLEEELEEEEEELHhHLLLlllllllllllllllhhhhhhhhhhhhh


DSSP  --------LLHHHHHHHHHLLLEEEEEELLHhhHHHH-LHHHHHHHHHHHLLL--LLEEE
Query --------ITPAAYAAAVVARGVTTIVWDPHefGNVH-GVDGVRWAAKAIENL--PLRAI  140
ident               |   |  |                    |     | | |       
Sbjct natheeikRHVIEHAHMQVLHGTLYTRTHVD--VDSVaKTKAVEAVLEAKEELkdLIDIQ  153
DSSP  hllhhhhhHHHHHHHHHHHHLLEEEEEEEEE--LLLLlLLHHHHHHHHHHHHLllLLEEE


DSSP  EEELLLLLLLLlllllllLLLHhHHHHHHLLLlEEEEEeELLH----HHHHlllHHHHHH
Query LLAPSCVPSAPglerggaDFDAaILADLLSWPeIGGIAeIXNX----RGVIerdPRXSGI  196
ident   |                         |                    |          
Sbjct VVAFAQSGFFV-----dlESES-LIRKSLDMG-CDLVG-GVDPatreNNVE---GSLDLC  202
DSSP  EEEELLLLLLL-----llLHHH-HHHHHHHHL-LLEEE-LLLLllllLLHH---HHHHHH


DSSP  HHHHHHHLLEEEELLL----LLLHhHHHHHHHLL-------lLEELLLL-LHHH----hh
Query VQAGLAAEKLVCGHAR----GLKNaDLNAFXAAG-------vSSDHELV-SGED----lx  240
ident              |             |                                
Sbjct FKLAKEYDVDIDYHIHdigtVGVY-SINRLAQKTiengykgrVTTSHAWcFADApsewld  261
DSSP  HHHHHHLLLEEEEEELllhhHHHH-HHHHHHHHHhhllllllEEEEELLhHHHLlhhhhh


DSSP  hhHHLL----LEEEEELLLHhhHHHHhhHHHHhlLLLLLEEEELLLLLH---HHHHhlLL
Query akLRAG----LTIELRGSHDhlLPEFvaALNTlgHLPQTVTLCTDDVFP---DDLLqgGG  293
ident                  |     |                    |             | 
Sbjct eaIPLYkdsgMKFVTCFSST--PPTM--PVIKllEAGINLGCASDNIRDfwvPFGN--GD  315
DSSP  hhHHHHhhhlLEEEEELLLL--LLLL--LHHHhhHLLLEEEEELLLLLLlllLLLL--LL


DSSP  HHHHHHHHHHLL-----lLHHHHHHHHLHHHHHHHL-LLLLlLLLLLLLLLEEEELL--L
Query LDDVVRRLVRYG-----lKPEWALRAATLNAAQRLG-RSDLgLIAAGRRADIVVFED--L  345
ident                            |   |  ||       |  |  || ||      
Sbjct MVQGALIETQRLelktnrDLGLIWKMITSEGARVLGiEKNY-GIEVGKKADLVVLNSlsP  374
DSSP  HHHHHHHHHHHHllllhhHHHHHHHHHLHHHHHHHLlHHHL-LLLLLLLLLEEEELLllH


DSSP  LLL-----LEEEEEELLEEEEELLEELLlllllllhhhllllllllllhhhhllllllle
Query NGF-----SARHVLASGRAVAEGGRXLVdiptcdttvlkgsxklplrxandflvksqgak  400
ident             |   ||                                          
Sbjct QWAiidqaKRLCVIKNGRIIVKDEVIVA--------------------------------  402
DSSP  HHHhhhllLEEEEEELLEEEEELLEELL--------------------------------


DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll
Query vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
ident                                                             
Sbjct ------------------------------------------------------------  402
DSSP  ------------------------------------------------------------


DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllll
Query gafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsd  520
ident                                                             
Sbjct ------------------------------------------------------------  402
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee
Query apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
ident                                                             
Sbjct ------------------------------------------------------------  402
DSSP  ------------------------------------------------------------


DSSP  llleeel
Query espviev  587
ident        
Sbjct -------  402
DSSP  -------


No 7: Query=3nqbA Sbjct=3e74A Z-score=28.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlllLEEEEEELLEEELLllLLEEELEEEEELLEEEEEELll
Query epadlnddtlraravaaargdqRFDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpa   60
ident                        ||  |  ||       | |  ||   |  ||      
Sbjct ----------------------SFDLIIKNGTVILE--NEARVVDIAVKGGKIAAIGQ--   34
DSSP  ----------------------LEEEEEELLEEELL--LLEEELEEEEELLEEEEEEL--


DSSP  LLLLEEEEEELLLLEEEELEEEEEELHhhhllLHHHHHHHHHLLLEEEEEELLHHhhHHH
Query SRRDAAQVIDAGGAYVSPGLIDTHXHIessxiTPAAYAAAVVARGVTTIVWDPHEfgNVH  120
ident    ||  | || |  ||||  | | ||            |    | ||    |       
Sbjct DLGDAKEVXDASGLVVSPGXVDAHTHI-----GYETGTRAAAKGGITTXIEXPLN--QLP   87
DSSP  LLLLEEEEEELLLLEEEELEEEEEELL-----LHHHHHHHHHHLLEEEEEELLLL--LLL


DSSP  L---HHHHHHHHHHHLL-LLLEEEEEELLLlllllllllllllLLHHHHHHHHLLLlEEE
Query G---VDGVRWAAKAIEN-LPLRAILLAPSCvpsapglerggadFDAAILADLLSWPeIGG  176
ident              |    |   |  |                      |  |       |
Sbjct AtvdRASIELKFDAAKGkLTIDAAQLGGLV------------sYNIDRLHELDEVG-VVG  134
DSSP  LlllHHHHHHHHHHHLLlLLLEEEELEELL------------lLLLLLHHHHHHHL-LLL


DSSP  EeEELL-HHHHhlllHHHHHHHHHHHHHLLEEEELLL-----------------------
Query IaEIXN-XRGVierdPRXSGIVQAGLAAEKLVCGHAR-----------------------  212
ident                       |        |  |                         
Sbjct F-XCFVrDVND----WQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdy  189
DSSP  E-EEELlLLLH----HHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhh


DSSP  -------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-----LEEEEELLL
Query -------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-----LTIELRGSH  255
ident                                   | |      ||       | |     
Sbjct vasrpvfTEVE-AIRRVLYLAkvagcRLHVCHVSSPEGVEEVTRARqegqdITCESCPHY  248
DSSP  hhlllhhHHHH-HHHHHHHHHhhhllLEEELLLLLHHHHHHHHHHHhllllEEEEELLHH


DSSP  HHH-----------------------HHHHHHHHhhhLLLLlLEEEELLLLLHH------
Query DHL-----------------------LPEFVAALntlGHLPqTVTLCTDDVFPD------  286
ident   |                              |           |  |           
Sbjct FVLdtdqfeeigtlakcsppirdlenQKGXWEKL---FNGE-IDCLVSDHSPCPpexkag  304
DSSP  HHLlhhhhhhhlhhhllllllllhhhHHHHHHHH---HLLL-LLEELLLLLLLLllllll


DSSP  -------hhhhlLLHH-HHHHHHH-HLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLL
Query -------dllqgGGLD-DVVRRLV-RYGLKPEWALRAATLNAAQRLGRSDLGLIAAGRRA  337
ident                        |   |            |||   |    | || |  |
Sbjct nixkawggiaglQSCXdVXFDEAVqKRGXSLPXFGKLXATNAADIFGLQQKGRIAPGKDA  364
DSSP  lllllllllllhHHHHhHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLL


DSSP  LEEEELL-----------------------lLLLLEEEEEELLEEEEELL-EELLLLlll
Query DIVVFED-----------------------lNGFSARHVLASGRAVAEGG-RXLVDIptc  373
ident | |                             |         |           |     
Sbjct DFVFIQPnssyvltnddleyrhkvspyvgrtIGARITKTILRGDVIYDIEqGFPVAP---  421
DSSP  LEEEEELllleellhhhllllllllllllleELLEEEEEEELLEEEEELLlLLLLLL---


DSSP  llhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleelllllee
Query dttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegat  433
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  eeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhh
Query xisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavig  493
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  llleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhh
Query tgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkac  553
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  hlllllllllleelllleeelllleeellleeel
Query fgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                   
Sbjct --------------------------kgqfilkh  429
DSSP  --------------------------llleelll


No 8: Query=3nqbA Sbjct=1gkpA Z-score=28.6

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLllLLEEELEEEEELLEEEEEELll
Query epadlnddtlraravaaargdqrfDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpa   60
ident                           ||  |            |||   |  |       
Sbjct ------------------------PLLIKNGEIITA--DSRYKADIYAEGETITRIGQ--   32
DSSP  ------------------------LEEEELLEEEEL--LEEEELEEEELLLLLLEEEL--


DSSP  LLLLE--EEEEELLLLEEEELEEEEEELHHH------HLLLHHHHHHHHHLLLEEEEEEL
Query SRRDA--AQVIDAGGAYVSPGLIDTHXHIES------SXITPAAYAAAVVARGVTTIVWD  112
ident          |||| | || || || | ||           |      |    | ||    
Sbjct NLEAPpgTEVIDATGKYVFPGFIDPHVHIYLpfmatfAKDTHETGSKAALMGGTTTYIEM   92
DSSP  LLLLLllLEEEELLLLEEEELEEEEEELLLLeelleeLLLLHHHHHHHHHHLLEEEEEEE


DSSP  LHhhHHHHL--HHHHHHHHHHHLL-LLLEEEEEELLLLlllllllllllllLHHHHHHHH
Query PHefGNVHG--VDGVRWAAKAIEN-LPLRAILLAPSCVpsapglerggadfDAAILADLL  169
ident              |        |                                |    
Sbjct CC--PSRNDdaLEGYQLWKSKAEGnSYCDYTFHMAVSK---------fdekTEGQLREIV  141
DSSP  EL--LLLLLlhHHHHHHHHHHHLLlLLLEEEEEEELLL---------llllHHHHHHHHH


DSSP  LLlLEEEeEEEL-------LHHHhhlllHHHHHHHHHHHHHLLEEEELLL----------
Query SWpEIGGiAEIX-------NXRGvierdPRXSGIVQAGLAAEKLVCGHAR----------  212
ident     |     |                                 |  |            
Sbjct AD-GISS-FXIFlsyknffGVDD-----GEMYQTLRLAKELGVIVTAHCEnaelvgrlqq  194
DSSP  HL-LLLE-EEEEellllllLLLH-----HHHHHHHHHHHHHLLEEEEEELlhhhhhhhhh


DSSP  --------------------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-
Query --------------------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-  246
ident                              |               |     | |   |  
Sbjct kllsegktgpewhepsrpeaVEAE-GTARFATFLettgaTGYVVHLSCKPALDAAMAAKa  253
DSSP  hhhhlllllhhhllllllhhHHHH-HHHHHHHHHhhhllEEEELLLLLHHHHHHHHHHHh


DSSP  ----LEEEEELLLHH--------------------------HHHHHHHHHhhhLLLLlLE
Query ----LTIELRGSHDH--------------------------LLPEFVAALntlGHLPqTV  276
ident       ||    |                                   ||          
Sbjct rgvpIYIESVIPHFLldktyaerggveamkyimspplrdkrNQKVLWDAL---AQGF-ID  309
DSSP  llllEEEEEEHHHHHllhhhhhllhhhhhlllllllllllhHHHHHHHHH---HLLL-LL


DSSP  EEELLLLLH-----------------HHHHhlLLHH-HHHHHHH-HLLLLHHHHHHHHLH
Query TLCTDDVFP-----------------DDLLqgGGLD-DVVRRLV-RYGLKPEWALRAATL  317
ident |  ||                                      | |  |       ||  
Sbjct TVGTDHCPFdteqkllgkeaftaipnGIPA-iEDRVnLLYTYGVsRGRLDIHRFVDAAST  368
DSSP  EEELLLLLLlhhhhhhhlllhhhlllLLLL-lLLHHhHHHHHHLlLLLLLHHHHHHHHLH


DSSP  HHHHHHLL-LLLLLLLLLLLLLEEEELL-----------------------lLLLLEEEE
Query NAAQRLGR-SDLGLIAAGRRADIVVFED-----------------------lNGFSARHV  353
ident  ||   |     | || |  || ||                                  |
Sbjct KAAKLFGLfPRKGTIAVGSDADLVVYDPqyrgtisvktqhvnndyngfegfeIDGRPSVV  428
DSSP  HHHHHLLLlLLLLLLLLLLLLLEEEEELllleellhhhllllllllllllleELLEEEEE


DSSP  EELLEEEEELLEELLLLLllllhhhllllllllllhhhhllllllleeeeeeeellllle
Query LASGRAVAEGGRXLVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrprftq  413
ident    |      |                                                 
Sbjct TVRGKVAVRDGQFVGEKG------------------------------------------  446
DSSP  EELLEEEEELLEELLLLL------------------------------------------


DSSP  eeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeellllllll
Query wgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshn  473
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  eeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhh
Query ltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedl  533
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query reavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                       
Sbjct ------------------------------------------wgkllrrepmyf  458
DSSP  ------------------------------------------llllllllllll


No 9: Query=3nqbA Sbjct=1yrrB Z-score=28.4

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeEEEELLEEELLLllLEEE-LEEEEELLEEEEEELL
Query epadlnddtlraravaaargdqrfdVLITGGTLVDVVtgELRP-ADIGIVGALIASVHEP   59
ident                             | |        |        |   || ||   
Sbjct -------------------------YALTQGRIFTGH--EFLDdHAVVIADGLIKSVCPV   33
DSSP  -------------------------LEEELLEEELLL--LEELlEEEEEELLEEEEEEEH


DSSP  LLLLLEEEEEELLLLEEEELEEEEEELHhHHLL------------LHHHHHHHHHLLLEE
Query ASRRDAAQVIDAGGAYVSPGLIDTHXHIeSSXI------------TPAAYAAAVVARGVT  107
ident |            ||  ||| ||                      |      |    | |
Sbjct AELPPEIEQRSLNGAILSPGFIDVQLNG-CGGVqfndtaeavsveTLEIMQKANEKSGCT   92
DSSP  HHLLLLLLEEELLLLEEEELEEEEEELE-ELLEelllllllllhhHHHHHHHHHHLLLEE


DSSP  EEEELLHhhHHHH-LHHHHHHHHHHH-LLLL-LEEEEEELLLlllllllllllllllHHH
Query TIVWDPHefGNVH-GVDGVRWAAKAI-ENLP-LRAILLAPSCvpsapglerggadfdAAI  164
ident                               |     |                    || 
Sbjct NYLPTLI--TTSDeLMKQGVRVMREYlAKHPnQALGLHLEGP------------wlnAAL  138
DSSP  EEEEEEL--LLLHhHHHHHHHHHHHHhHHLLlLLLLEEEELL------------lllLHH


DSSP  HHHHHLL-LLEEEeEEELlHHHHhlllhhHHHHHHHHHHHLLEEEELLLLLLHHHHHHHH
Query LADLLSW-PEIGGiAEIXnXRGVierdprXSGIVQAGLAAEKLVCGHARGLKNADLNAFX  223
ident    |      |           |                |   |             |  
Sbjct VDFLCENaDVITK-VTLA-PEMV------PAEVISKLANAGIVVSAGHSNATLKEAKAGF  190
DSSP  HHHHHHLhHHEEE-EEEL-HHHL------LHHHHHHHHHHLLEEEELLLLLLHHHHHHHH


DSSP  HLLLLEE-LLLL--------lhhhHHHHHHL-LLEEEEELL-LHHHHHHHHHHHHhhlll
Query AAGVSSD-HELV--------sgedLXAKLRA-GLTIELRGS-HDHLLPEFVAALNtlghl  272
ident  ||     |                 | |                       |       
Sbjct RAGITFAtHLYNampyitgrepglAGAILDEaDIYCGIIADgLHVDYANIRNAKR---lk  247
DSSP  HHLEEEElLLLLllllllllllhhHHHHHHLlLLEEEEELLlLLLLHHHHHHHHH---hh


DSSP  LLLEEEELLLLlhhhhhhLLLHHHHHHHHHHL-LLLHHHHHHHHLHHHHHHHLL-LLLLL
Query PQTVTLCTDDVfpddllqGGGLDDVVRRLVRY-GLKPEWALRAATLNAAQRLGR-SDLGL  330
ident      | ||                || ||   |      || |||  |   |    || 
Sbjct GDKLCLVTDAT----sgsSLTMIEGVRNLVEHcGIALDEVLRMATLYPARAIGVeKRLGT  303
DSSP  HHHEEEELLLL----lllLLLHHHHHHHHHHHhLLLHHHHHHHHLHHHHHHLLLlLLLLL


DSSP  LLLLLLLLEEEELLllLLLEEEEEELLEEEEELleelllllllllhhhllllllllllhh
Query IAAGRRADIVVFEDlnGFSARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxan  390
ident  |||  |    |     |        |  |                              
Sbjct LAAGKVANLTAFTP--DFKITKTIVNGNEVVTQ---------------------------  334
DSSP  LLLLLLLLEEEELL--LLLEEEEEELLEEEEEL---------------------------


DSSP  hhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleee
Query dflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttkt  450
ident                                                             
Sbjct ------------------------------------------------------------  334
DSSP  ------------------------------------------------------------


DSSP  eeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeee
Query gfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtail  510
ident                                                             
Sbjct ------------------------------------------------------------  334
DSSP  ------------------------------------------------------------


DSSP  elllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellll
Query plplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxg  570
ident                                                             
Sbjct ------------------------------------------------------------  334
DSSP  ------------------------------------------------------------


DSSP  eeelllleeellleeel
Query iadvltgkvxespviev  587
ident                  
Sbjct -----------------  334
DSSP  -----------------


No 10: Query=3nqbA Sbjct=3ls9A Z-score=28.2

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELL-EEELLL-LLLEEE-LEEEEELLEEEEEE
Query epadlnddtlraravaaargdqrfDVLITGG-TLVDVV-TGELRP-ADIGIVGALIASVH   57
ident                           || |                ||| | |  |  | 
Sbjct ------------------------MILIRGLtRVITFDdQERELEdADILIDGPKIVAVG   36
DSSP  ------------------------LEEEEEEeEEELLLlLLLEEEeEEEEEELLEEEEEE


DSSP  LlLLLLL-EEEEEELLLLEEEELEEEEEELHHHHL-------------------------
Query EpASRRD-AAQVIDAGGAYVSPGLIDTHXHIESSX-------------------------   91
ident             ||  |    ||||  | |                              
Sbjct K-DLSDRsVSRTIDGRGMIALPGLINSHQHLYEGAmraipqlervtmaswlegvltrsag   95
DSSP  L-LLLLLlLLEEEELLLEEEEELEEEEEELHHHHHhlllhhhllllhhhhhhhhhhhhhh


DSSP  -------------LLHHHHHHHHHLLLEEEEEELLHhhHHHH--LHHHHHHHHHHHLLLL
Query -------------ITPAAYAAAVVARGVTTIVWDPHefGNVH--GVDGVRWAAKAIENLP  136
ident                  |        | ||                        |   | 
Sbjct wwrdgkfgpdvirEVARAVLLESLLGGITTVADQHL--FFPGatADSYIDATIEAATDLG  153
DSSP  hhhlllllhhhhhHHHHHHHHHHHHLLEEEEEEEEL--LLLLllLLLHHHHHHHHHHHHL


DSSP  LEEEEEELLLLlLLLL-----LLLLllLLLHHHHHH-HHLLL-----------LEEEEEE
Query LRAILLAPSCVpSAPG-----LERGgaDFDAAILAD-LLSWP-----------EIGGIAE  179
ident  |      |                             |                     
Sbjct IRFHAARSSMT-LGKSeggfcDDLF--VEPVDRVVQhCLGLIdqyhepepfgmVRIALGP  210
DSSP  LEEEEEELLLL-LLHHhllllLHHH--LLLHHHHHHhHHHHHhhhllllllllEEEEELL


DSSP  ELLHhhhhlllhhHHHHHHHHHHHL----LEEEELLL--LLLH--------HHHHHHHHL
Query IXNXrgvierdprXSGIVQAGLAAE----KLVCGHAR--GLKN--------ADLNAFXAA  225
ident                    |              |                         
Sbjct CGVP-------ydKPELFEAFAQMAadydVRLHTHFYepLDAGmsdhlygmTPWRFLEKH  263
DSSP  LLLL-------llLHHHHHHHHHHHhhhlLEEEEEELllLHHHhhhhhhllLHHHHHHHL


DSSP  LL----LEELLLLL--hhhHHHHHHLLLEEEEE-LLLH---HHHHHHHhHHHHHlllLLL
Query GV----SSDHELVS--gedLXAKLRAGLTIELR-GSHD---HLLPEFVaALNTLghlPQT  275
ident |           |            ||  |             |               |
Sbjct GWasdrVWLAHAVVppreeIPEFADAGVAIAHLiAPDLrmgWGLAPIR-EYLDA---GIT  319
DSSP  LLllllEEEEELLLllhhhHHHHHHHLLEEEELhHHHHhllLLLLLHH-HHHHL---LLE


DSSP  EEEELLLLLHHHHhhlLLHHHHHHHHHHL-----------LLLHHHHHHHHLHHHHHHHL
Query VTLCTDDVFPDDLlqgGGLDDVVRRLVRY-----------GLKPEWALRAATLNAAQRLG  324
ident |   |      |    | |    |                 |     || ||   |  ||
Sbjct VGFGTTGSASNDG---GNLLGDLRLAALAhrpadpnepekWLSARELLRMATRGSAECLG  376
DSSP  EEELLLLLLLLLL---LLHHHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHHLL


DSSP  LLLLLLLLLLLLLLEEEEL--------------LLLL----LLEEEEEELLEEEEELLEE
Query RSDLGLIAAGRRADIVVFE--------------DLNG----FSARHVLASGRAVAEGGRX  366
ident | |||    || |||                   |        |  |   |    |  | 
Sbjct RPDLGVLEEGRAADIACWRldgvdrvgvhdpaiGLIMtglsDRASLVVVNGQVLVENERP  436
DSSP  LLLLLLLLLLLLLLEEEEElllhhhlllllhhhHHHHllllLLLLEEEELLEEEEELLEE


DSSP  LLLLLllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeellee
Query LVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfv  426
ident                                                             
Sbjct VLADL-------------------------------------------------------  441
DSSP  LLLLH-------------------------------------------------------


DSSP  llllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhh
Query vppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxal  486
ident                                                             
Sbjct ------------------------------------------------------------  441
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllleeeeeelleeeeeeelllllllLLLLhhhhhhhhhhhhhhhhhhllllll
Query aanavigtgggxavasegkvtailplplsglvSDAPleevarafedlreavgkvvewqpp  546
ident                                                             
Sbjct ---------------------------erivaNTTA------------------------  450
DSSP  ---------------------------hhhhhHHHH------------------------


DSSP  lllhhhhhlllllllllleelllleeelllleeellleeel
Query ylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                          
Sbjct --------------------------------------lip  453
DSSP  --------------------------------------hll


No 11: Query=3nqbA Sbjct=3mkvA Z-score=27.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlllLEEEEEELLEEELLLLLLEEE-LEEEEELLEEEEEELl
Query epadlnddtlraravaaargdqRFDVLITGGTLVDVVTGELRP-ADIGIVGALIASVHEp   59
ident                           |   | | |     |     | |    |  |   
Sbjct ----------------------LTTFLFRNGALLDPDHPDLLQgFEILIEDGFIREVSD-   37
DSSP  ----------------------LLEEEEEEEEELLLLLLLLEEeEEEEEELLEEEEEEL-


DSSP  LLLLL-EEEEEELLLLEEEELEEEEEELHHHHL---------------LLHHHHHHHHHL
Query ASRRD-AAQVIDAGGAYVSPGLIDTHXHIESSX---------------ITPAAYAAAVVA  103
ident        | |||  |    ||||| | |                            |   
Sbjct KPIKSsNAHVIDVKGKTIMPGLIDLHVHVVAIEfnlprvatlpnvlvtLRAVPIMRAMLR   97
DSSP  LLLLLlLLEEEELLLLEEEELEEEEEELLLLLLllhhhhllllhhhhhHHHHHHHHHHHH


DSSP  LLEEEEEELLHhhhhhhlhhhhhhHHHHHLLL------LLEEEEE-ELLL----------
Query RGVTTIVWDPHefgnvhgvdgvrwAAKAIENL------PLRAILL-APSC----------  146
ident || ||                                   |                   
Sbjct RGFTTVRDAGG------------aGYPFKQAVesglveGPRLFVSgRALSqtgghadpra  145
DSSP  LLEEEEEELLL------------lLHHHHHHHhlllllLLEEEELlLEEEllllllllll


DSSP  ---------------------LLLLLllllllllLLHHHHHHHHLLLlEEEEEEEL----
Query ---------------------VPSAPglerggadFDAAILADLLSWPeIGGIAEIX----  181
ident                                            |       |        
Sbjct rsdymppdspcgccvrvgalgRVADG------vdEVRRAVREELQMG-ADQIXIMAsggv  198
DSSP  lllllllllllllllllllleEELLL------hhHHHHHHHHHHHHL-LLLEEEELllll


DSSP  ---------lHHHHhlllHHHHHHHHHHHHHLLEEEELLLLLLhhHHHHHHHLLLLEELL
Query ---------nXRGVierdPRXSGIVQAGLAAEKLVCGHARGLKnaDLNAFXAAGVSSDHE  232
ident                        ||         |  ||              ||     
Sbjct asptdpvgvfGYSE----DEIRAIVAEAQGRGTYVLAHAYTPA--AIARAVRCGVRTIEH  252
DSSP  llllllllllLLLH----HHHHHHHHHHHLLLLLEEEEELLHH--HHHHHHHLLLLEEEE


DSSP  LLLHH--HHHHHHHLLLEEEEE-LLLH-----------------------HHHHHHHHHH
Query LVSGE--DLXAKLRAGLTIELR-GSHD-----------------------HLLPEFVAAL  266
ident                |          |                                 
Sbjct GNLIDdeTARLVAEHGAYVVPTlVTYDalasegekyglppesiakiadvhGAGLHSIEIM  312
DSSP  LLLLLhhHHHHHHHHLLEEELLhHHHHhhhhhlllllllhhhhllhhhhhLLHHHHHHHH


DSSP  HHHlllllLEEEELLlLLHHHHhhLLLHhHHHHHHHhLLLLHHHHHHHHLHHHHHHHLLL
Query NTLghlpqTVTLCTDdVFPDDLlqGGGLdDVVRRLVrYGLKPEWALRAATLNAAQRLGRS  326
ident              ||              |  | |    | |      ||   |  ||  
Sbjct KRA---gvKMGFGTD-LLGEAQ--RLQS-DEFRILA-EVLSPAEVIASATIVSAEVLGMQ  364
DSSP  HHH---llLLLLLLL-LLHHHH--HHLL-HHHHHHH-LLLLHHHHHHHLLHHHHHHLLLL


DSSP  -LLLLLLLLLLLLEEEELL-----LLLL-----LEEEEEELLEEEEELleelllllllll
Query -DLGLIAAGRRADIVVFED-----LNGF-----SARHVLASGRAVAEGgrxlvdiptcdt  375
ident   || |  |  ||  |                     |   ||                 
Sbjct dKLGRIVPGAHADVLVVDGnplksVDCLlgqgeHIPLVMKDGRLFVNE------------  412
DSSP  lLLLLLLLLLLLLEEEELLlllllLLLLlllllLLLEEEELLEEEEEL------------


DSSP  hhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeee
Query tvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxi  435
ident                                                             
Sbjct ------------------------------------------------------------  412
DSSP  ------------------------------------------------------------


DSSP  eeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhll
Query svthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtg  495
ident                                                             
Sbjct ------------------------------------------------------------  412
DSSP  ------------------------------------------------------------


DSSP  leeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhl
Query ggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfg  555
ident                                                             
Sbjct ------------------------------------------------------------  412
DSSP  ------------------------------------------------------------


DSSP  llllllllleelllleeelllleeellleeel
Query atlacnigphqtdxgiadvltgkvxespviev  587
ident                                 
Sbjct ------------------------------le  414
DSSP  ------------------------------ll


No 12: Query=3nqbA Sbjct=3mtwA Z-score=27.8

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLLLLEEE-LEEEEELLEEEEEELL
Query epadlnddtlraravaaargdqrfDVLITGGTLVDVVTGELRP-ADIGIVGALIASVHEP   59
ident                                 | ||  |              | |    
Sbjct ----------------------aeIKAVSAARLLDVASGKYVDnPLVIVTDGRITSIGKK   38
DSSP  ----------------------llEEEEEEEEEEELLLLEEEElEEEEEELLEEEEEEEL


DSSP  LLLLL-EEEEEELLLLEEEELEEEEEELHHHHL----------------LLHHHHHHHHH
Query ASRRD-AAQVIDAGGAYVSPGLIDTHXHIESSX----------------ITPAAYAAAVV  102
ident        |   |  |    ||||| | |  |                      | |    
Sbjct GDAVPaGATAVDLPGVTLLPGLIDMHVHLDSLAevggynsleysdrfwsVVQTANAKKTL   98
DSSP  LLLLLlLLEEEEEEEEEEEELEEEEEELLLLLLlllhhhhhhllhhhhhHHHHHHHHHHH


DSSP  LLLEEEEEELLHhhhhhhlhhHHHHHHHHHLLL------LLEEEEE-ELLLllLLLL---
Query ARGVTTIVWDPHefgnvhgvdGVRWAAKAIENL------PLRAILL-APSCvpSAPG---  152
ident   | ||                        |          |              |   
Sbjct EAGFTTVRNVGA---------ADYDDVGLREAIdagyvpGPRIVTAaISFG--ATGGhcd  147
DSSP  HLLEEEEEELLL---------LLLHHHHHHHHHhlllllLLEEEELlLLEE--LLLLlll


DSSP  ------llLLLLLL-------LHHHHHHHHLLlLEEEEEeELLH-------------HHH
Query ------leRGGADF-------DAAILADLLSWpEIGGIAeIXNX-------------RGV  186
ident              |              |        |  |                   
Sbjct stffppsmDQKNPFnsdspdeARKAVRTLKKY-GAQVIX-ICATggvfsrgnepgqqQLT  205
DSSP  lllllhhhLLLLLLllllhhhHHHHHHHHHHL-LLLEEE-EELLlllllllllllllLLL


DSSP  HlllHHHHHHHHHHHHHLLEEEELLLLLLhhhHHHHHHLLLLEELLL-LLHH-HHHHHHH
Query IerdPRXSGIVQAGLAAEKLVCGHARGLKnadLNAFXAAGVSSDHEL-VSGE-DLXAKLR  244
ident           |     |   |  || |           |||                   
Sbjct Y---EEMKAVVDEAHMAGIKVAAHAHGAS--gIREAVRAGVDTIEHAsLVDDeGIKLAVQ  260
DSSP  H---HHHHHHHHHHHHLLLEEEEEELLHH--hHHHHHHLLLLEEEELlLLLHhHHHHHHH


DSSP  LLLEEEEE-LLLH------------------------HHHHHHHHHHHHHlllllLEEEE
Query AGLTIELR-GSHD------------------------HLLPEFVAALNTLghlpqTVTLC  279
ident  |          |                             |  ||             
Sbjct KGAYFSMDiYNTDytqaegkkngvlednlrkdrdigeLQRENFRKALKAG----vKMVYG  316
DSSP  HLLEEELLlLLHHhhhhhhhhhlllhhhhhhhhhhhhHHHHHHHHHHHHL----lEEELL


DSSP  LL-LLLHhhhhhlLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLL
Query TD-DVFPddllqgGGLDDVVRRLVRYGLKPEWALRAATLNAAQRLGR-SDLGLIAAGRRA  337
ident ||    |      |         ||||  |  |   ||| ||  |||  | |  | ||  
Sbjct TDaGIYP-----hGDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRsKDVGQVAVGRYG  371
DSSP  LLlLLLL-----lLLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLlLLLLLLLLLLLL


DSSP  LEEEELL-----LLLL-LEEEEEELLEEEEELleelllllllllhhhllllllllllhhh
Query DIVVFED-----LNGF-SARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxand  391
ident |                    |   |  |                               
Sbjct DMIAVAGdpladVTTLeKPVFVMKGGAVVKAP----------------------------  403
DSSP  LEEEELLlllllHHHHhLLLEEEELLEEEELL----------------------------


DSSP  hllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeee
Query flvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktg  451
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  eeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeee
Query fltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailp  511
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  lllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllle
Query lplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgi  571
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  eelllleeellleeel
Query advltgkvxespviev  587
ident                 
Sbjct ---------------x  404
DSSP  ---------------l


No 13: Query=3nqbA Sbjct=4b3zD Z-score=26.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLllLLEEELEEEEELLEEEEEELll
Query epadlnddtlraravaaargdqrfDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpa   60
ident                           || ||            ||      ||    |  
Sbjct -----------------------dRLLIKGGRIIND--DQSLYADVYLEDGLIKQIGE--   33
DSSP  -----------------------lEEEEEEEEEELL--LLEEEEEEEEELLEEEEEEL--


DSSP  LLLL--eEEEEELLLLEEEELEEEEEELHHH-hLLLHHHHHHHHHLLLEEEEEELLHhhH
Query SRRD--aAQVIDAGGAYVSPGLIDTHXHIES-sXITPAAYAAAVVARGVTTIVWDPHefG  117
ident           | | |  | || ||                  |    | | |        
Sbjct NLIVpggVKTIEANGRMVIPGGIDVNTYLQKtaADDFFQGTRAALVGGTTMIIDHVV--P   91
DSSP  LLLLlllLEEEELLLLEEEELEEEEEELLLLllLLLHHHHHHHHHHLLEEEEEEEEL--L


DSSP  HHHL--HHHHHHHHHHHL-LLLLEEEEEELLLLLllllllllllLLLHHHHHHHHLLLLE
Query NVHG--VDGVRWAAKAIE-NLPLRAILLAPSCVPsapglerggaDFDAAILADLLSWPEI  174
ident                |          |                 |     |  |      
Sbjct EPGSslLTSFEKWHEAADtKSCCDYSLHVDITSW---------yDGVREELEVLVQDKGV  142
DSSP  LLLLlhHHHHHHHHHHHHlLLLLEEEEEEELLLL---------lLLHHHHHHHHHHLLLL


DSSP  EEEeEELLH-----HHHHlllHHHHHHHHHHHHHLLEEEELLL-----------------
Query GGIaEIXNX-----RGVIerdPRXSGIVQAGLAAEKLVCGHAR-----------------  212
ident                                         ||                  
Sbjct NSF-QVYMAykdvyQMSD---SQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgi  198
DSSP  LEE-EEELLlllllLLLH---HHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhlll


DSSP  -------------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-----LEE
Query -------------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-----LTI  249
ident                                         |         |         
Sbjct tgpeghalsrpeeLEAE-AVFRAITIAgrincPVYITKVMSKSAADIIALARkkgplVFG  257
DSSP  lllhhhhhhllhhHHHH-HHHHHHHHHhhhllLEEEEEELLHHHHHHHHHHHhhlllEEE


DSSP  EEELLLHH----------------------------HHHHHHHHHhhhLLLLlLEEEELL
Query ELRGSHDH----------------------------LLPEFVAALntlGHLPqTVTLCTD  281
ident |                                           |               
Sbjct EPIAASLGtdgthywsknwakaaafvtspplspdptTPDYLTSLL---ACGD-LQVTGSG  313
DSSP  EELHHHHHlllhhhhlllhhhhhhllllllllllllHHHHHHHHH---HHLL-LLLLLLL


DSSP  LLLHH----------------hhhhlLLHHHHHH-HHHHL-LLLHHHHHHHHLHHHHHHH
Query DVFPD----------------dllqgGGLDDVVR-RLVRY-GLKPEWALRAATLNAAQRL  323
ident                                ||    |                |||   
Sbjct HCPYStaqkavgkdnftlipegvngiEERMTVVWdKAVATgKMDENQFVAVTSTNAAKIF  373
DSSP  LLLLLhhhhhhhlllhhhllllllllLLHHHHHHhHHLLLlLLLHHHHHHHHLHHHHHHH


DSSP  LLL-LLLLLLLLLLLLEEEELL-----------------------lLLLLEEEEEELLEE
Query GRS-DLGLIAAGRRADIVVFED-----------------------lNGFSARHVLASGRA  359
ident       | || |  || |                               |   |   |  
Sbjct NLYpRKGRIAVGSDADVVIWDPdklktitakshksaveynifegmeCHGSPLVVISQGKI  433
DSSP  LLLlLLLLLLLLLLLLEEEEEEeeeeelllllllllllllllllleEEEEEEEEEELLEE


DSSP  EEELLEELLLLLllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeee
Query VAEGGRXLVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetea  419
ident | | |   |                                                   
Sbjct VFEDGNINVNKG------------------------------------------------  445
DSSP  EEELLEELLLLL------------------------------------------------


DSSP  eeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeel
Query dvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfgg  479
ident                                                             
Sbjct ------------------------------------------------------------  445
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhh
Query nagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgk  539
ident                                                             
Sbjct ------------------------------------------------------------  445
DSSP  ------------------------------------------------------------


DSSP  hlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query vvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                 
Sbjct ----------------mgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  ----------------lllllllllllhhhhhhhhhhhhhllllllll


No 14: Query=3nqbA Sbjct=3griA Z-score=26.8

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELllLLLEEELEEEEELLEEEEEELLl
Query epadlnddtlraravaaargdqrfDVLITGGTLVDvvTGELRPADIGIVGALIASVHEPa   60
ident                           ||  |       |||  ||| | |  |       
Sbjct ------------------------XKLIKNGKVLQ--NGELQQADILIDGKVIKQIAPA-   33
DSSP  ------------------------LEEEELLEEEE--LLEEEELEEEEELLEEEEEELL-


DSSP  LLLL-eEEEEELLLLEEEELEEEEEELHH----hhLLLHHHHHHHHHLLLEEEEEELLHH
Query SRRD-aAQVIDAGGAYVSPGLIDTHXHIE----ssXITPAAYAAAVVARGVTTIVWDPHE  115
ident          ||| |  ||||  | | |          |      |    | ||    |  
Sbjct IEPSngVDIIDAKGHFVSPGFVDVHVHLRepggeyKETIETGTKAAARGGFTTVCPXPNT   93
DSSP  LLLLllLEEEELLLLEEEELEEEEEELLLllllllLLLHHHHHHHHHHLLEEEEEELLLL


DSSP  HHHhhLHHHHHHHHHHHL-LLLLEEEEEELLLLLLLllllllllllLHHHHHHHHLLlLE
Query FGNvhGVDGVRWAAKAIE-NLPLRAILLAPSCVPSApglerggadfDAAILADLLSWpEI  174
ident       |       | |  |   |    |                        |      
Sbjct RPVpdSVEHFEALQKLIDdNAQVRVLPYASITTRQL--------gkELVDFPALVKE-GA  144
DSSP  LLLllLHHHHHHHHHHHHhHLLLEELLLEELLHHHL--------llLLLLHHHHHLL-LL


DSSP  EEEEEEL-LHHHHhlllHHHHHHHHHHHHHLLEEEELLL---------------------
Query GGIAEIX-NXRGVierdPRXSGIVQAGLAAEKLVCGHAR---------------------  212
ident                    |           |    |                       
Sbjct FAFTDDGvGVQTA----SXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgi  200
DSSP  LLEEELLlLLLLH----HHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhll


DSSP  ------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-----LEEEEELLLH
Query ------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-----LTIELRGSHD  256
ident                                    |       |       | |    | 
Sbjct pgipniCESV-QIARDVLLAeaagcHYHVCHVSTKESVRVIRDAKragihVTAEVTPHHL  259
DSSP  leellhHHHH-HHHHHHHHHhhhllLEEELLLLLHHHHHHHHHHHhllllEEEEELHHHH


DSSP  HH-----------------------HHHHHHHHhhhlLLLLLEEEELLLLLHH-------
Query HL-----------------------LPEFVAALntlgHLPQTVTLCTDDVFPD-------  286
ident  |                              |             ||            
Sbjct LLteddipgnnaiykxnpplrstedREALLEGL----LDGTIDCIATDHAPHArdekaqp  315
DSSP  HLlhhhlllllhhhllllllllhhhHHHHHHHH----HLLLLLEELLLLLLLLhhhhlll


DSSP  ----hhhHLLLhHHHHHHHHHLL-----LLHHHHHHHHLHHHHHHHLLLlLLLLLLLLLL
Query ----dllQGGGlDDVVRRLVRYG-----LKPEWALRAATLNAAQRLGRSdLGLIAAGRRA  337
ident          |        |                   |            |       |
Sbjct xekapfgIVGS-ETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLE-YGTLKENGYA  373
DSSP  lllllllLLLL-LLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLL


DSSP  LEEEELL-----------------------lLLLLEEEEEELLEEEEELleellllllll
Query DIVVFED-----------------------lNGFSARHVLASGRAVAEGgrxlvdiptcd  374
ident |                                         |    ||           
Sbjct DLTIIDLdseqeikgedflskadntpfigykVYGNPILTXVEGEVKFEG-----------  422
DSSP  LEEEEELllleellhhhllllllllllllleELLEEEEEEELLEEEEEL-----------


DSSP  lhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleee
Query ttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatx  434
ident                                                             
Sbjct ------------------------------------------------------------  422
DSSP  ------------------------------------------------------------


DSSP  eeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhl
Query isvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigt  494
ident                                                             
Sbjct ------------------------------------------------------------  422
DSSP  ------------------------------------------------------------


DSSP  lleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhh
Query gggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacf  554
ident                                                             
Sbjct ------------------------------------------------------------  422
DSSP  ------------------------------------------------------------


DSSP  lllllllllleelllleeelllleeellleeel
Query gatlacnigphqtdxgiadvltgkvxespviev  587
ident                                  
Sbjct ---------------------------------  422
DSSP  ---------------------------------


No 15: Query=3nqbA Sbjct=1j6pA Z-score=26.5

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLLLLEEELEEEEELLEEEEEELLL
Query epadlnddtlraravaaargdqrfDVLITGGTLVDVVTGELRPADIGIVGALIASVHEPA   60
ident                            |           |       |    |  |    
Sbjct -----------------------hHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGE   37
DSSP  -----------------------lEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEELL


DSSP  LLLleeeEEELLLLEEEELEEEEEELHHHHL-----------------------------
Query SRRdaaqVIDAGGAYVSPGLIDTHXHIESSX-----------------------------   91
ident          |  |  | | |  || |                                  
Sbjct VKV----DLDLSGKLVXPALFNTHTHAPXTLlrgvaedlsfeewlfskvlpiedrltekx   93
DSSP  LLL----LEELLLEEEEELEEEEEELHHHHHhllllllllhhhhhhllhhhhhllllhhh


DSSP  --LLHHHHHHHHHLLLEEEEEELLHhhhhhhlhhHHHHHHHHHLLLLLEEEEEELLLllL
Query --ITPAAYAAAVVARGVTTIVWDPHefgnvhgvdGVRWAAKAIENLPLRAILLAPSCvpS  149
ident                |    |                | |||      || |        
Sbjct ayYGTILAQXEXARHGIAGFVDXYF---------HEEWIAKAVRDFGXRALLTRGLV--D  142
DSSP  hhHHHHHHHHHHHLLLEEEEEEEEL---------LHHHHHHHHHHHLLEEEEEEEEL--L


DSSP  LLLlllllLLLLhHHHHHHHLLLL------EEEEEEEL--LHHHhhlllHHHHHHHHHHH
Query APGlerggADFDaAILADLLSWPE------IGGIAEIX--NXRGvierdPRXSGIVQAGL  201
ident   |               |             |                           
Sbjct SNG---ddGGRL-EENLKLYNEWNgfegriFVGFGPHSpyLCSE-----EYLKRVFDTAK  193
DSSP  LLL---llLLHH-HHHHHHHHHHLlhhhleEEEEEELLllLLLH-----HHHHHHHHHHH


DSSP  HHLLEEEELLL----LLLHhhHHHHHHLLL----LEELLL-LLHH-HHHHHHHLLLEEEE
Query AAEKLVCGHAR----GLKNadLNAFXAAGV----SSDHEL-VSGE-DLXAKLRAGLTIEL  251
ident      |  |            |      |               |               
Sbjct SLNAPVTIHLYetskEEYD--LEDILNIGLkevkTIAAHCvHLPErYFGVLKDIPFFVSH  251
DSSP  HHLLLEEEEELllllLLLL--LHHHHLLLLllllEEEEELlLLLHhHHHHHLLLLEEEEE


DSSP  E-LLLH----HHHHhHHHHHHHHlllllLEEEELLLLLHHHHhhlLLHHHHHHHHHHLL-
Query R-GSHD----HLLPeFVAALNTLghlpqTVTLCTDDVFPDDLlqgGGLDDVVRRLVRYG-  305
ident    |         |               ||| ||            |    |       
Sbjct NpASNLklgnGIAP-VQRXIEHG----xKVTLGTDGAASNNS---LNLFFEXRLASLLQk  303
DSSP  LhHHHHhlllLLLL-HHHHHHLL----lEEEELLLLLLLLLL---LLHHHHHHHHHHHHh


DSSP  ------LLHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEEEEL--------------LL
Query ------LKPEWALRAATLNAAQRLGRsDLGLIAAGRRADIVVFE--------------DL  345
ident       |     |   |   ||  |    | |  |  || ||                 |
Sbjct aqnprnLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVIDldlpexfpvqniknHL  362
DSSP  llllllLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEElllhhhllhhhhhhHH


DSSP  LL---LLEEEEEELLEEEEELLEELLLLL--LLLLhhhllllllllllhhhhllllllle
Query NG---FSARHVLASGRAVAEGGRXLVDIP--TCDTtvlkgsxklplrxandflvksqgak  400
ident               |      |                                      
Sbjct VHafsGEVFATXVAGKWIYFDGEYPTIDSeeVKRE-------------------------  397
DSSP  HHlllLLLLEEEELLEEEEELLLLLLLLHhhHHHH-------------------------


DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll
Query vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
ident                                                             
Sbjct ------------------------------------------------------------  397
DSSP  ------------------------------------------------------------


DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhlLLEEEeeelleeeeeeelllllllll
Query gafattvshdshnltvfggnagdxalaanavigtGGGXAvasegkvtailplplsglvsd  520
ident                                                             
Sbjct -----------------------------larieKELYS---------------------  407
DSSP  -----------------------------hhhhhHHHHL---------------------


DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee
Query apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
ident                                                             
Sbjct ------------------------------------------------------------  407
DSSP  ------------------------------------------------------------


DSSP  llleeel
Query espviev  587
ident        
Sbjct -------  407
DSSP  -------


No 16: Query=3nqbA Sbjct=4c5yA Z-score=25.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlLLLEEEEEELLEEELLLLlLEEE-LEEEEELLEEEEEELL
Query epadlnddtlraravaaargDQRFDVLITGGTLVDVVTgELRP-ADIGIVGALIASVHEP   59
ident                     |      |  | |      |    |   |    || |   
Sbjct --------------------DEAKVTIIYAGLLIPGDG-EPLRnAALVISDKIIAFVGSE   39
DSSP  --------------------LLLLEEEEEEEEELLLLL-LLEEeEEEEEELLEEEEEEEH


DSSP  LLLL-----LEEEEEELllLEEEELEEEEEELHHH------------------hLLLHHH
Query ASRR-----DAAQVIDAggAYVSPGLIDTHXHIES------------------sXITPAA   96
ident |                      ||| | | |                          | 
Sbjct ADIPkkylrSTQSTHRV--PVLMPGLWDCHMHFGGdddyyndytsglathpassGARLAR   97
DSSP  HHLLhhhhhHLLLEEEE--EEEEELEEEEEELLLLllllllllhhhhhllhhhhHHHHHH


DSSP  HHHHHHLLLEEEEEELLHhhhhhhlhhhhhhHHHHHLLL------LLEEEEE-ELLLLL-
Query YAAAVVARGVTTIVWDPHefgnvhgvdgvrwAAKAIENL------PLRAILL-APSCVP-  148
ident         | |                                          |      
Sbjct GCWEALQNGYTSYRDLAG------------yGCEVAKAIndgtivGPNVYSSgAALSQTa  145
DSSP  HHHHHHHLLEEEEEELLL------------lHHHHHHHHhlllllLLEEEELlLEEELLl


DSSP  --LLLL---LLLL--LLLL---------------------LHHHHHHHHLLlLEEEEEeE
Query --SAPG---LERG--GADF---------------------DAAILADLLSWpEIGGIAeI  180
ident                                                         |   
Sbjct ghGDIFalpAGEVlgSYGVmnprpgywgagplciadgveeVRRAVRLQIRR-GAKVIX-V  203
DSSP  llLLLLlllHHHHhhHHLLlllllllllllleeelllhhhHHHHHHHHHHH-LLLLEE-E


DSSP  LLH-------------HHHHlllHHHHHHHHHHHHHLLEEEELLLLLLhhhHHHHHHLLL
Query XNX-------------RGVIerdPRXSGIVQAGLAAEKLVCGHARGLKnadLNAFXAAGV  227
ident                             ||         |  |  |       |   || 
Sbjct MASggvmsrddnpnfaQFSP---EELKVIVEEAARQNRIVSAHVHGKA--gIMAAIKAGC  258
DSSP  ELLlllllllllllllLLLH---HHHHHHHHHHHHLLLLEEEEELLHH--hHHHHHHHLL


DSSP  LEELLLLLhhHHHHHHHLL----LEEEEE-LLLH-----------------------hHH
Query SSDHELVSgeDLXAKLRAG----LTIELR-GSHD-----------------------hLL  259
ident  |                                                         |
Sbjct KSLEHVSY--ADEEVWELMkekgILYVATrSVIEiflasngeglvkeswaklqaladsHL  316
DSSP  LEEEELLL--LLHHHHHHHhhhlLEEELLhHHHHhhhhhllllllllhhhlllhhhhhHH


DSSP  HHHHHHHHHHlllllLEEEELLLLlhhhhhhlLLHHHHHHHHHHL-LLLHHHHHHHHLHH
Query PEFVAALNTLghlpqTVTLCTDDVfpddllqgGGLDDVVRRLVRY-GLKPEWALRAATLN  318
ident      |         |  | ||          |         |   |  |  |  ||| |
Sbjct KAYQGAIKAG----vTIALGTDTA------pgGPTALELQFAVERgGMTPLEAIKAATAN  366
DSSP  HHHHHHHHLL----lLEELLLLLL------llLLLHHHHHHHHHLlLLLHHHHHHHHLLL


DSSP  HHHHHL--LLLLLLLLLLLLLLEEEELL-----LLLL----LEEEEEELLEEEEEL--lE
Query AAQRLG--RSDLGLIAAGRRADIVVFED-----LNGF----SARHVLASGRAVAEG--gR  365
ident |    |      |    |  ||    |         |       ||   |          
Sbjct APLSVGpqAPLTGQLREGYEADVIALEEnpledIKVFqepkAVTHVWKGGKLFKGPgigP  426
DSSP  HHHHHHhhLLLLLLLLLLLLLLEEEELLlllllHHHHhlhhHEEEEEELLEEEELLlllL


DSSP  ELLlllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelle
Query XLVdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgf  425
ident                                                             
Sbjct WGE---------------------------------------------------------  429
DSSP  LLL---------------------------------------------------------


DSSP  ellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhh
Query vvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxa  485
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllll
Query laanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqp  545
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhlllllllllleelllleeelllleeellleeel
Query pylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                           
Sbjct -----------------------------------darnpfl  436
DSSP  -----------------------------------lllllll


No 17: Query=3nqbA Sbjct=2uz9A Z-score=25.5

back to top
DSSP  llhhhllhhhhhhhhhhhhlllLEEEEEElLEEELLLL---LLEEE-LEEEEE-LLEEEE
Query epadlnddtlraravaaargdqRFDVLITgGTLVDVVT---GELRP-ADIGIV-GALIAS   55
ident                               || |        |       |      |  
Sbjct ----------------------PLAHIFR-GTFVHSTWtcpMEVLRdHLLGVSdSGKIVF   37
DSSP  ----------------------LLLEEEE-EEEEELLLlllLEEEEeEEEEELlLLLEEE


DSSP  EELLLLL--------lleeEEEELL-LLEEEELEEEEEELHHHHL---------------
Query VHEPASR--------rdaaQVIDAG-GAYVSPGLIDTHXHIESSX---------------   91
ident   |                            ||| ||| |                    
Sbjct LEEASQQeklakewcfkpcEIRELShHEFFMPGLVDTHIHASQYSfagssidlpllewlt   97
DSSP  EEEHHHHhhhhhhhlllhhHEEELLlLLEEEELEEEEEEEHHHHHhllllllllhhhhhh


DSSP  -----------------LLHHHHHHHHHLLLEEEEEELLHhhhhhhLHHHHHHHHHHHLL
Query -----------------ITPAAYAAAVVARGVTTIVWDPHefgnvhGVDGVRWAAKAIEN  134
ident                               | ||              |     |     
Sbjct kytfpaehrfqnidfaeEVYTRVVRRTLKNGTTTACYFAT-----iHTDSSLLLADITDK  152
DSSP  hlhhhhhhhhhlhhhhhHHHHHHHHHHHHLLEEEEEEELL-----lLHHHHHHHHHHHHH


DSSP  LLLEEEEEELLLllLLLLLLLLLLL---LLHHHHHHHHLLL-------LEEEEEEELLHh
Query LPLRAILLAPSCvpSAPGLERGGAD---FDAAILADLLSWP-------EIGGIAEIXNXr  184
ident    ||                                 |                     
Sbjct FGQRAFVGKVCM--DLNDTFPEYKEtteESIKETERFVSEMlqknysrVKPIVTPRFSL-  209
DSSP  HLLEEEEELEEL--LLLLLLLLLLLlhhHHHHHHHHHHHHHhhhllllEEEEEEELLHH-


DSSP  hhhlLLHHHHHHHHHHHHHLLEEEELLL-------------lllHHHHHHHHHLLL----
Query gvieRDPRXSGIVQAGLAAEKLVCGHAR-------------glkNADLNAFXAAGV----  227
ident                          |                                  
Sbjct --scSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsyKNYTSVYDKNNLltnk  267
DSSP  --hlLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhllllLLHHHHHHHLLLllll


DSSP  LEELLLLLhhHHHHHHHLL----LEEEEE-LLLH---HHHHhHHHHHHHHlllLLLEEEE
Query SSDHELVSgeDLXAKLRAG----LTIELR-GSHD---HLLPeFVAALNTLghlPQTVTLC  279
ident                |         |     |           |              | 
Sbjct TVMAHGCY--LSAEELNVFhergASIAHCpNSNLslsSGFL-NVLEVLKH---EVKIGLG  321
DSSP  EEEEELLL--LLHHHHHHHhhhlLEEEELhHHHHhllLLLL-LHHHHHHL---LLEEEEL


DSSP  LLLLLhhhhhhLLLHHHHHHHHHHLL------------LLHHHHHHHHLHHHHHHHLL-L
Query TDDVFpddllqGGGLDDVVRRLVRYG------------LKPEWALRAATLNAAQRLGR-S  326
ident ||              |  || |               |      | |||   | ||   
Sbjct TDVAG----gySYSMLDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQALGLdG  377
DSSP  LLLLL----llLLLHHHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHHLLLlL


DSSP  LLLLLLLLLLLLEEEEL--------------------------LLLLL---LEEEEEELL
Query DLGLIAAGRRADIVVFE--------------------------DLNGF---SARHVLASG  357
ident   |    |   |                                |          |   |
Sbjct EIGNFEVGKEFDAILINpkasdspidlfygdffgdiseaviqkFLYLGddrNIEEVYVGG  437
DSSP  LLLLLLLLLLLLEEEELllllllllllllhhhhlllllhhhhhHHHHLlhhHEEEEEELL


DSSP  EEEeelleELLLllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeee
Query RAVaeggrXLVDiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwget  417
ident   |                                                         
Sbjct KQV-----VPFS------------------------------------------------  444
DSSP  EEE-----ELLL------------------------------------------------


DSSP  eeeeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeee
Query eadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvf  477
ident                                                             
Sbjct ------------------------------------------------------------  444
DSSP  ------------------------------------------------------------


DSSP  ellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhh
Query ggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreav  537
ident                                                             
Sbjct ------------------------------------------------------------  444
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query gkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                   
Sbjct --------------------------------------------------  444
DSSP  --------------------------------------------------


No 18: Query=3nqbA Sbjct=2oofA Z-score=25.3

back to top
DSSP  llhhhllhhhhhhhhhhhhllLLEEEEEELLEEELLL----LLLEE-ELEEEEELLEEEE
Query epadlnddtlraravaaargdQRFDVLITGGTLVDVV----TGELR-PADIGIVGALIAS   55
ident                                |            |  |   |     |  
Sbjct ---------------------LNCERVWLNVTPATLRsdlaDYGLLePHALGVHEGRIHA   39
DSSP  ---------------------LLLLEEEEEEEELLLLllllLLLLLlLEEEEEELLEEEE


DSSP  EELLL-LLLLeeEEEELLLLEEEELEEEEEELHHH-------------------------
Query VHEPA-SRRDaaQVIDAGGAYVSPGLIDTHXHIES-------------------------   89
ident                |  |  | ||||| | |                            
Sbjct LVPXQdLKYP-aHWQDXKGKLVTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgg   98
DSSP  EEEHHhLLLL-lLLEELLLLEEEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhlll


DSSP  ----------------hlLLHHHHHHHHHLLLEEEEEELLHhHHHH--HLHHHHHHHHHH
Query ----------------sxITPAAYAAAVVARGVTTIVWDPHeFGNV--HGVDGVRWAAKA  131
ident                                ||||        |          | |   
Sbjct giistvratraasedqlfELALPRVKSLIREGVTTVEIKSG-YGLTleDELKXLRVARRL  157
DSSP  lhhhhhhhhhhllhhhhhHHHHHHHHHHHHHLEEEEEEELL-LLLLhhHHHHHHHHHHHH


DSSP  HLLLLLEEEEEELLLLLLL--LLLL-lllllLLHH-HHHHHHLLLLEEEEeEELL----H
Query IENLPLRAILLAPSCVPSA--PGLE-rggadFDAA-ILADLLSWPEIGGIaEIXN----X  183
ident  | || |                             |                       
Sbjct GEALPIRVKTTLLAAHAVPpeYRDDpdswveTICQeIIPAAAEAGLADAV-DVFCehigF  216
DSSP  HHHLLLEEEEEEEEELLLLhhHLLLhhhhhhHHHHlHHHHHHHLLLLLEE-EEEEllllL


DSSP  HHHhlllhHHHHHHHHHHHHLLEEEELLL--LLLHhhhHHHHHLLLLEELLLLLhhHHHH
Query RGVierdpRXSGIVQAGLAAEKLVCGHAR--GLKNadlNAFXAAGVSSDHELVSgeDLXA  241
ident                |       | ||                 |  |   |        
Sbjct SLA-----QTEQVYLAADQYGLAVKGHXDqlSNLG-gsTLAANFGALSVDHLEY--LDPE  268
DSSP  LHH-----HHHHHHHHHHHLLLEEEEEELllLLLL-hhHHHHHLLLLEEEELLL--LLHH


DSSP  HHHLL----LEEEEEL-LLHH---hhHHHHHHHHHHlllLLLEEEELLLLL--HHHHhhl
Query KLRAG----LTIELRG-SHDH---llPEFVAALNTLghlPQTVTLCTDDVF--PDDLlqg  291
ident    |         |               | ||              |            
Sbjct GIQALahrgVVATLLPtAFYFlketkLPPVVALRKA---GVPXAVSSDINPgtAPIV---  322
DSSP  HHHHHhhhlLEEEELHhHHHHlllllLLLHHHHHHL---LLLEEELLLLLLllLLLL---


DSSP  lLHHHHHHHHHH-LLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEELL--LLL
Query gGLDDVVRRLVR-YGLKPEWALRAATLNAAQRLGR-SDLGLIAAGRRADIVVFED--LNG  347
ident   |           || |  |    |  ||  ||    ||    |  ||  |        
Sbjct -SLRXAXNXACTlFGLTPVEAXAGVTRHAARALGEqEQLGQLRVGXLADFLVWNCghPAE  381
DSSP  -LHHHHHHHHHHhHLLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLLEEEELLllLLH


DSSP  L-------LEEEEEELLEEEEElleelllllllllhhhllllllllllhhhhllllllle
Query F-------SARHVLASGRAVAEggrxlvdiptcdttvlkgsxklplrxandflvksqgak  400
ident                 |                                           
Sbjct LsyligvdQLVSRVVNGEETLH--------------------------------------  403
DSSP  HhhlllllLEEEEEELLEELLL--------------------------------------


DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll
Query vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllll
Query gafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsd  520
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee
Query apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  llleeel
Query espviev  587
ident        
Sbjct -------  403
DSSP  -------


No 19: Query=3nqbA Sbjct=1k6wA Z-score=25.0

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEellllLLEE-ELEEEEELLEEEEEELL
Query epadlnddtlraravaaargdqrfDVLITGGTLvdvvtGELR-PADIGIVGALIASVHEP   59
ident                            |    |             |      |      
Sbjct -----------------------aLQTIINARL-----PGEEgLWQIHLQDGKISAIDAQ   32
DSSP  -----------------------lLLEEEEELL-----LLLLlEEEEEEELLEEEEEEEE


DSSP  --LLLLLeEEEEELLLLEEEELEEEEEELHHHHL--------------------------
Query --ASRRDaAQVIDAGGAYVSPGLIDTHXHIESSX--------------------------   91
ident             ||    | |     | |                               
Sbjct sgVMPIT-ENSLDAEQGLVIPPFVEPHIHLDTTQtagqpnwnqsgtlfegierwaerkal   91
DSSP  llLLLLL-LLEEELLLLEEELLEEEEEELLLLLLllllllllllllhhhhhhhhhllhhh


DSSP  -------LLHHHHHHHHHLLLEEEEEELLHhhHHHHLHHHHHHHHHHHLLL--LLEEEEE
Query -------ITPAAYAAAVVARGVTTIVWDPHefGNVHGVDGVRWAAKAIENL--PLRAILL  142
ident                   | |                                       
Sbjct lthddvkQRAWQTLKWQIANGIQHVRTHVD--VSDATLTALKAMLEVKQEVapWIDLQIV  149
DSSP  llhhhhhHHHHHHHHHHHHLLEEEEEEEEE--LLLLLLHHHHHHHHHHHHHllLLEEEEE


DSSP  ELLLLLLLLllllllLLLLhHHHHHHHLLLlEEEEEeELLH-----HHHHlllHHHHHHH
Query APSCVPSAPglerggADFDaAILADLLSWPeIGGIAeIXNX-----RGVIerdPRXSGIV  197
ident |                   | |   |                                 
Sbjct AFPQEGILS-----yPNGE-ALLEEALRLG-ADVVG-AIPHfeftrEYGV---ESLHKTF  198
DSSP  EELLLLLLL-----lLLHH-HHHHHHHHLL-LLEEE-ELHHhlllhHHHH---HHHHHHH


DSSP  HHHHHHLLEEEELLL---lllhhhHHHHHHLL-------lLEELLL-LLHH--------h
Query QAGLAAEKLVCGHAR---glknadLNAFXAAG-------vSSDHEL-VSGE--------d  238
ident         |   |                |                              
Sbjct ALAQKYDRLIDVHCDeiddeqsrfVETVAALAhhegmgarVTASHTtAMHSyngaytsrl  258
DSSP  HHHHHHLLEEEEEELllllllllhHHHHHHHHhhhllhhhEEEEELhHHHHllhhhhhhh


DSSP  hhHHHHLLLEEEEE-LLLH------------HHHHHHHhHHHHHlllLLLEEEELLLLLH
Query lxAKLRAGLTIELR-GSHD------------HLLPEFVaALNTLghlPQTVTLCTDDVFP  285
ident        |                                          |    |||| 
Sbjct frLLKMSGINFVANpLVNIhlqgrfdtypkrRGITRVK-EMLES---GINVCFGHDDVFD  314
DSSP  hhHHHHHLLEEEELhHHHHhhllllllllllLLLLLHH-HHHHL---LLLEEELLLLLLL


DSSP  ---HHHHhlLLHHHHHHHHH-HLLL----LHHHHHHHHLHHHHHHHLLLLLlLLLLLLLL
Query ---DDLLqgGGLDDVVRRLV-RYGL----KPEWALRAATLNAAQRLGRSDLgLIAAGRRA  337
ident               |         |         |   |   |  |   |   ||||  |
Sbjct pwyPLGT--ANMLQVLHMGLhVCQLmgygQINDGLNLITHHSARTLNLQDY-GIAAGNSA  371
DSSP  lllLLLL--LLHHHHHHHHHhHLLLllhhHHHHHHHHHLHHHHHHLLLLLL-LLLLLLLL


DSSP  LEEEEL-----LLLL--LLEEEEEELLEEEEELleelllllllllhhhllllllllllhh
Query DIVVFE-----DLNG--FSARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxan  390
ident            |        |     |   |                             
Sbjct NLIILPaengfDALRrqVPVRYSVRGGKVIAST---------------------------  404
DSSP  LEEEELlllhhHHHHhlLLLLEEEELLEEEEEL---------------------------


DSSP  hhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleee
Query dflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttkt  450
ident                                                             
Sbjct ------------------------------------------------------------  404
DSSP  ------------------------------------------------------------


DSSP  eeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeee
Query gfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtail  510
ident                                                             
Sbjct ------------------------------------------------------------  404
DSSP  ------------------------------------------------------------


DSSP  elllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellll
Query plplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxg  570
ident                                                             
Sbjct ----------------------------------------------------------qp  406
DSSP  ----------------------------------------------------------ll


DSSP  eeelllleeellleeel
Query iadvltgkvxespviev  587
ident                  
Sbjct aqttvyleqpeaidykr  423
DSSP  lleeeellleeeellll


No 20: Query=3nqbA Sbjct=2ogjA Z-score=24.3

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLL-lLEEELEEEEE-LLEEEEEEL
Query epadlnddtlraravaaargdqrfDVLITGGTLVDVVT-gELRPADIGIV-GALIASVHE   58
ident                           | |    |           || |     || |  
Sbjct ----------------------qaPILLTNVKPVGFGKgaSQSSTDILIGgDGKIAAVGS   38
DSSP  ----------------------llLEEEEEEEELLLLLllLLLLEEEEELlLLLEEEEEL


DSSP  lLLLLLEEEEEElLLLEEEELEEEEEELHH---hhLLLHhhHHHHHHLLLEEEEEELlHH
Query pASRRDAAQVIDaGGAYVSPGLIDTHXHIE---ssXITPaaYAAAVVARGVTTIVWDpHE  115
ident  |    |        |  |||  | | ||                   ||||| |     
Sbjct -ALQAPADTQRI-DAAFISPGWVDLHVHIWhggtdISIR--PSECGAERGVTTLVDA-GS   93
DSSP  -LLLLLLLEEEL-LLLEEEELEEEEEELLLlllllLLLL--HHHLLHHHLEEEEEEE-LL


DSSP  HHhhhlHHHHHHHHHH-HLLLLLEEEEEELLLL----------LLLLlllllllLLLHHH
Query FGnvhgVDGVRWAAKA-IENLPLRAILLAPSCV----------PSAPglerggaDFDAAI  164
ident  |               ||    |                              | |   
Sbjct AG----EANFHGFREYiIEPSRERIKAFLNLGSiglvacnrvpELRD-----ikDIDLDR  144
DSSP  LL----LLLHHHHHHHlLLLLLLEEEEEEELLLllllllllllLLLL-----hhHLLHHH


DSSP  HHHHHL--LLLEEEEEEEL-------lHHHHhlllhhHHHHHHHHHHHLLEEEELLLLLl
Query LADLLS--WPEIGGIAEIX-------nXRGVierdprXSGIVQAGLAAEKLVCGHARGLk  215
ident            | |                                        |     
Sbjct ILECYAenSEHIVGLXVRAshvitgswGVTP------VKLGKKIAKILKVPXXVHVGEP-  197
DSSP  HHHHHHllLLLEEEEEEEElhhhhlllLLHH------HHHHHHHHHHHLLLEEEEELLL-


DSSP  hhHHHHHHHLLL--LEELLL-------LLHH---hhhHHHHL-LLEEEEELL--LHHHhH
Query naDLNAFXAAGV--SSDHEL-------VSGE---dlxAKLRA-GLTIELRGS--HDHLlP  260
ident                               |         |  |                
Sbjct paLYDEVLEILGpgDVVTHCfngksgsSIXEdedlfnLAERCeGIRLDIGHGgaSFSF-K  256
DSSP  llLHHHHHHHLLllLEEELLlllllllLLLLlhhhhhHHHHLlLLEEELLLLllLLLH-H


DSSP  HHHHHHHHHllllllEEEELLL---LLHHHHhhlLLHHHHHHHHHHLLLLHHHHHHHHLH
Query EFVAALNTLghlpqtVTLCTDD---VFPDDLlqgGGLDDVVRRLVRYGLKPEWALRAATL  317
ident    ||              ||               |      |       |    | | 
Sbjct VAEAAIARG---llpFSISTDLhghSXNFPV---WDLATTXSKLLSVDXPFENVVEAVTR  310
DSSP  HHHHHHHLL---lllLLLLLLLlllLLLLLL---LLHHHHHHHHHHLLLLHHHHHHLLLH


DSSP  HHHHHHLLLLllLLLLLLLLLEEEELL-----------------lLLLLEEEEEELLEEe
Query NAAQRLGRSDlgLIAAGRRADIVVFED-----------------lNGFSARHVLASGRAv  360
ident | |             | |||  ||                      |  |       | 
Sbjct NPASVIRLDXenRLDVGQRADFTVFDLvdadleatdsngdvsrlkRLFEPRYAVIGAEA-  369
DSSP  HHHHHLLLLLllLLLLLLLLEEEEEEEeeeeeeeellllleeeeeEEEEEEEEEELLEE-


DSSP  EELLeelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeee
Query AEGGrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetead  420
ident                                                             
Sbjct IAAS--------------------------------------------------------  373
DSSP  EELL--------------------------------------------------------


DSSP  eelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeell
Query vkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggn  480
ident                                                             
Sbjct ------------------------------------------------------------  373
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllHHHHhhhhhhhhhhhhhh
Query agdxalaanavigtgggxavasegkvtailplplsglvsdapLEEVarafedlreavgkv  540
ident                                                             
Sbjct ----------------------------------------ryIPRA--------------  379
DSSP  ----------------------------------------llLLLL--------------


DSSP  lllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query vewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                
Sbjct -----------------------------------------------  379
DSSP  -----------------------------------------------


No 21: Query=3nqbA Sbjct=4rdvB Z-score=23.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELlEEELLLllLEEE-LEEEEEL-LEEEEEEL
Query epadlnddtlraravaaargdqrfDVLITGgTLVDVVtgELRP-ADIGIVG-ALIASVHE   58
ident                                                 |      |    
Sbjct ------------------------SAIFAE-RALLPE--GWARnVRFEISAdGVLAEIRP   33
DSSP  ------------------------LEEEEE-EEEELL--EEEEeEEEEELLlLLEEEEEL


DSSP  LLLLLLEeeEEELllLEEEELEEEEEELHHHHL---------------------------
Query PASRRDAaqVIDAggAYVSPGLIDTHXHIESSX---------------------------   91
ident  |    |          | ||    | |                                
Sbjct DANADGA--ERLG--GAVLPGMPNLHSHAFQRAmaglaevagnpndsfwtwrelmyrmva   89
DSSP  LLLLLLL--EELL--LLEEELEEEEEELHHHHHhlllllllllllllhhhhhhhhhhhhl


DSSP  --------LLHHHHHHHHHLLLEEEEEELLHhHHHH-------hlHHHHHHHHHHHLLLL
Query --------ITPAAYAAAVVARGVTTIVWDPHeFGNV-------hgVDGVRWAAKAIENLP  136
ident                      | |                              |     
Sbjct rlspeqieVIACQLYIEMLKAGYTAVAEFHY-VHHDldgrsyadpAELSLRISRAASAAG  148
DSSP  lllhhhhhHHHHHHHHHHHHHLEEEEEEEEL-LLLLlllllllllLHHHHHHHHHHHHHL


DSSP  LEEEEEELLLlLLLL-----LLLLLLL-LLLHHHHHHHHLLLL--------eEEEEEELL
Query LRAILLAPSCvPSAP-----GLERGGA-DFDAAILADLLSWPE--------iGGIAEIXN  182
ident     ||       |        |              ||              |      
Sbjct IGLTLLPVLY-SHAGfggqpASEGQRRfINGSEAYLELLQRLRapleaaghsLGLCFHSL  207
DSSP  LEEEEEELLL-LEEEllleeLLHHHLLlLLLHHHHHHHHHHHHhhhhhhlleELEEELLL


DSSP  HhhhhlLLHHHHHHHHhhHHHL-LEEEELLL----------------LLLHhHHHHHHhl
Query XrgvieRDPRXSGIVQagLAAE-KLVCGHAR----------------GLKNaDLNAFXaa  225
ident                          |  |                   |           
Sbjct R---avTPQQIATVLA--AGHDdLPVHIHIAeqqkevddcqawsgrrPLQW-LYENVAvd  261
DSSP  L---llLHHHHHHHHL--LLLLlLLEEEEELllhhhhhhhhhhhlllHHHH-HHHHLLll


DSSP  llLEEL-LLLLHH-HHHHHHHLLLEEEEE-LLLH---HHHHhHHHHHHHHlllLLLEEEE
Query gvSSDH-ELVSGE-DLXAKLRAGLTIELR-GSHD---HLLPeFVAALNTLghlPQTVTLC  279
ident                  |  | |    |                                
Sbjct qrWCLVhATHADPaEVAAMARSGAVAGLClSTEAnlgDGIF-PATDFLAQ---GGRLGIG  317
DSSP  llEEEEeLLLLLHhHHHHHHHHLLEEEELhHHHHhllLLLL-LHHHHHHL---LLEEEEL


DSSP  LLLLLhhhhhhLLLHHHHHHHHHHLL----------------lLHHHHHHHHLHHHHHHH
Query TDDVFpddllqGGGLDDVVRRLVRYG----------------lKPEWALRAATLNAAQRL  323
ident  |                 | |                            ||    || |
Sbjct SDSHV------SLSVVEELRWLEYGQrlrdrkrnrlyrddqpmIGRTLYDAALAGGAQAL  371
DSSP  LLLLL------LLLHHHHHHHHHHHHhhhhlllllllllllllHHHHHHHHHHHHHHHHH


DSSP  LLlLLLLLLLLLLLLEEEEL-------------LLLLL-------LEEEEEELLEEEEEL
Query GRsDLGLIAAGRRADIVVFE-------------DLNGF-------SARHVLASGRAVAEG  363
ident |    |  | |||||  |                ||           | |   || |   
Sbjct GQ-PIGSLAVGRRADLLVLDgndpylasaegdaLLNRWlfaggdrQVRDVMVAGRWVVRD  430
DSSP  LL-LLLLLLLLLLLLEEEELlllhhhhllllhhHHHHHhhhllhhHEEEEEELLEEEELL


DSSP  LEElLLLLLlllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeel
Query GRXlVDIPTcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkd  423
ident ||                                                          
Sbjct GRH-AGEER---------------------------------------------------  438
DSSP  LLL-LLHHH---------------------------------------------------


DSSP  leellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhh
Query gfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagd  483
ident                                                             
Sbjct ------------------------------------------------------------  438
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllleeeeeelleeeeeEELLlllllllllhhhhhhhhhhhhhhhhhhlll
Query xalaanavigtgggxavasegkvtaiLPLPlsglvsdapleevarafedlreavgkvvew  543
ident                             |                               
Sbjct -----------------sarafvqvlGELL------------------------------  451
DSSP  -----------------hhhhhhhhhHHHL------------------------------


DSSP  llllllhhhhhlllllllllleelllleeelllleeellleeel
Query qppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                             
Sbjct --------------------------------------------  451
DSSP  --------------------------------------------


No 22: Query=3nqbA Sbjct=3ooqA Z-score=22.0

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLLlLEEELEEEEELLEEEEEELLL
Query epadlnddtlraravaaargdqrfDVLITGGTLVDVVTgELRPADIGIVGALIASVHEPA   60
ident                           |    |            |          | |  
Sbjct ------------------------KILFKNATVFPITS-RPFKGDVLVSNGKVEKVGENI   35
DSSP  ------------------------LEEEEEEEELLLLL-LLEEEEEEEELLEEEEEELLL


DSSP  lLLLEEEEEELLLLEEEELEEEEEELHHHHLL--------------------------LH
Query sRRDAAQVIDAGGAYVSPGLIDTHXHIESSXI--------------------------TP   94
ident      |   |  |    ||  | | ||                                |
Sbjct -EDPDAEIVDLTGKFLFPGFVDAHSHIGLFEEgvgyyysdgneatdpvtphvkaldgfNP   94
DSSP  -LLLLLEEEELLLLEEEELEEEEEELLLLLLLlllhhhlllllllllllllllhhhhlLL


DSSP  HH-HHHHHHLLLEEEEEELLH-hhhhhhlhhhhhhhhhHHLLLlleeeeeelllllllll
Query AA-YAAAVVARGVTTIVWDPH-efgnvhgvdgvrwaakAIENLplraillapscvpsapg  152
ident          | |||     |                    |                   
Sbjct QDpAIERALAGGVTSVXIVPGsanpvggqgsvikfrsiIVEEC-----------------  137
DSSP  LLhHHHHHHLLLEEEEEELLLlllleeeeeeeeellllLHHHH-----------------


DSSP  lllllllllhhhhhhhhllLLEEEEEeELLH-----------------hhHHLL-LHHH-
Query lerggadfdaailadllswPEIGGIAeIXNX-----------------rgVIER-DPRX-  193
ident                        |                                    
Sbjct -----------------ivKDPAGLK-XAFGenpkrvygerkqtpstrxgTAGViRDYFt  179
DSSP  -----------------eeEEEEEEE-EELLhhhhhhhhhlllllllhhhHHHHhHHHHh


DSSP  -------------------------hHHHHHHHHHLLEEEELLLLLL-hhHHHHHHH--L
Query -------------------------sGIVQAGLAAEKLVCGHARGLK-naDLNAFXA--A  225
ident                                 |        ||                 
Sbjct kvknyxkkkelaqkegkeftetdlkxEVGEXVLRKKIPARXHAHRADdilTAIRIAEefG  239
DSSP  hhhhhhhhhhhhhhlllllllllhhhHHHHHHHLLLLLEEEEELLHHhhhHHHHHHHhhL


DSSP  LLLEE-LLLLLHHHHHHHHHLLLEEEEELLLH---------HHHHHHHHHHHHHlllllL
Query GVSSD-HELVSGEDLXAKLRAGLTIELRGSHD---------HLLPEFVAALNTLghlpqT  275
ident       |                                           |         
Sbjct FNLVIeHGTEAYKISKVLAEKKIPVVVGPLLTfrtklelkdLTXETIAKLLKDG----vL  295
DSSP  LLEEEeELLLHHHHHHHHHHHLLLEEELLLLLllllhhhllLLLLHHHHHHHLL----lL


DSSP  EEEELLLLLhhhhhhlLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLL
Query VTLCTDDVFpddllqgGGLDDVVRRLVRYGLKPEWALRAATLNAAQRLGR-SDLGLIAAG  334
ident   |  |                     ||| | |  |   | | |  ||     | |  |
Sbjct IALXCDHPV----iplEFATVQAATAXRYGAKEEDLLKILTVNPAKILGLeDRIGSIEPG  351
DSSP  EEELLLLLL----llhHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLLlLLLLLLLLL


DSSP  LLLLEEEEL-LLLL--LLEEEEEELLEEEEELleelllllllllhhhllllllllllhhh
Query RRADIVVFE-DLNG--FSARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxand  391
ident   || ||              |   |  |                               
Sbjct KDADLVVWSgHPFDxkSVVERVYIDGVEVFRR----------------------------  383
DSSP  LLLLEEEELlLLLLllLLEEEEEELLEEEEEL----------------------------


DSSP  hllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeee
Query flvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktg  451
ident                                                             
Sbjct ------------------------------------------------------------  383
DSSP  ------------------------------------------------------------


DSSP  eeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeee
Query fltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailp  511
ident                                                             
Sbjct ------------------------------------------------------------  383
DSSP  ------------------------------------------------------------


DSSP  lllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllle
Query lplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgi  571
ident                                                             
Sbjct ------------------------------------------------------------  383
DSSP  ------------------------------------------------------------


DSSP  eelllleeellleeel
Query advltgkvxespviev  587
ident                 
Sbjct ---------------e  384
DSSP  ---------------l


No 23: Query=3nqbA Sbjct=3icjA Z-score=21.7

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEE-LLLLLLeEELEEEEELLEEEEEELL
Query epadlnddtlraravaaargdqrfDVLITGGTLV-DVVTGElRPADIGIVGALIASVHEP   59
ident                               ||                |           
Sbjct -----------------------cMKALINGTIYtSFSPVK-KVSGLVISNERVLYAGDS   36
DSSP  -----------------------lEEEEELLEEEeEELLEE-EELEEEEELLEEEEEELH


DSSP  LL-LLLE----EEEEELLLLEEEELEEEEEELHHHHLL----------------------
Query AS-RRDA----AQVIDAGGAYVSPGLIDTHXHIESSXI----------------------   92
ident     | |       ||  |  | |   | | |                            
Sbjct STaLRIAelagGEIIDLKGKFVMPAFFDSHLHLDELGMslemvdlrgvksmeelvervkk   96
DSSP  HHhHHHHhhhlLEEEELLLLEEEELEEEEEELHHHHHHhhhleellllllhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct grgriifgfgwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdf  156
DSSP  llllleeeeeelhhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllle


DSSP  -------------------------------LHHHHHHHHHLLLEEEEEEL-LHHHhhhh
Query -------------------------------TPAAYAAAVVARGVTTIVWD-PHEFgnvh  120
ident                                            ||         |     
Sbjct destgivreraleesrkiinekiltvkdykhYIESAQEHLLSLGVHSVGFMsVGEK----  212
DSSP  elllleeehhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEEEeELHH----


DSSP  lhhHHHHHHHHH--LLLLLEEEEEELLllllllllllllllLLHHHHH--HHHLLL----
Query gvdGVRWAAKAI--ENLPLRAILLAPScvpsapglerggadFDAAILA--DLLSWP----  172
ident                 |                             |    |        
Sbjct ---ALKALFELEreGRLKMNVFAYLSP--------------ELLDKLEelNLGKFEgrrl  255
DSSP  ---HHHHHHHHHhlLLLLLEEEEEELH--------------HHHHHHHhhLLLLEEllle


DSSP  LEEEEEeELLH------------------------HHHHLLlhhHHHHHHHHHHHLLEEE
Query EIGGIAeIXNX------------------------RGVIERdprXSGIVQAGLAAEKLVC  208
ident  | |                                                      | 
Sbjct RIWGVX-LFVDgslgartallsepytdnpttsgelVMNKDE---IVEVIERAKPLGLDVA  311
DSSP  EEEEEE-EELLllllllllllllllllllllllllLLLHHH---HHHHHHHHLLLLLEEE


DSSP  ELLLLLLhhHHHHHHHLL-----lLEEL-LLLLHH-HHHHHHHLLLEEEEELLLHHH---
Query GHARGLKnaDLNAFXAAG-----vSSDH-ELVSGE-DLXAKLRAGLTIELRGSHDHL---  258
ident  || | |         |                    |         |            
Sbjct VHAIGDK--AVDVALDAFeeaefsGRIEhASLVRDdQLERIKELKVRISAQPHFIVSdww  369
DSSP  EEELLHH--HHHHHHHHHhhhlllLEEEeLLLLLHhHHHHHHHHLLEEEELLLHHHHlll


DSSP  -----------hhhHHHHHhhhllLLLLEEEELLLLLhhhhhhLLLHHHHHHHHHHL---
Query -----------lpeFVAALntlghLPQTVTLCTDDVFpddllqGGGLDDVVRRLVRY---  304
ident                   |             ||                    |     
Sbjct ivnrvgeerakwayRLKTL----sSITKLGFSTDSPI-----ePADPWVSIDAAVNRyvv  420
DSSP  hhhhhhhhhhhhllLHHHH----hHHLLEEELLLLLL-----lLLLHHHHHHHHHHLlll


DSSP  ----LLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEL-LLLLlleeeeeellee
Query ----GLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFE-DLNGfsarhvlasgra  359
ident         | ||   |   ||     |||    | ||       |               
Sbjct dpgeRVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDrDPLK------------  468
DSSP  lhhhLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELlLLLL------------


DSSP  eeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeee
Query vaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetea  419
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  eeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeel
Query dvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfgg  479
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhh
Query nagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgk  539
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  hlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query vvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                 
Sbjct ------------------------------------------------  468
DSSP  ------------------------------------------------


No 24: Query=3nqbA Sbjct=1a5kC Z-score=21.2

back to top
DSSP  -----------------------------------------llhhhllhhhhhhhhhhhh
Query -----------------------------------------epadlnddtlraravaaar   19
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  LLLLEEEEEELLEEELLLllLEEELEEEEELLEEEEEELLL--------LLLL--eEEEE
Query GDQRFDVLITGGTLVDVVtgELRPADIGIVGALIASVHEPA--------SRRD--aAQVI   69
ident      |   |    ||        ||||     |                        ||
Sbjct AADCVDLVLTNALIVDHW--GIVKADIGVKDGRIFAIGKAGnpdiqpnvTIPIgaaTEVI  118
DSSP  HHHLLLEEEEEEEEEELL--EEEEEEEEEELLEEEEEELEEllllllllLEELlllLEEE


DSSP  ELLLLEEEELEEEEEELHHhhlllHHHHHHHHHLLLEEEEEELLHH-------hhhhhLH
Query DAGGAYVSPGLIDTHXHIEssxitPAAYAAAVVARGVTTIVWDPHE-------fgnvhGV  122
ident  | |  |  | |||| |           |      |||| |                 | 
Sbjct AAEGKIVTAGGIDTHIHWI-----CPQQAEEALVSGVTTMVGGGTGpaagthattctpGP  173
DSSP  ELLLLEEEELEEEEEEELL-----LLLHHHHHHHHLEEEEEEELLLllhhhhhlllllHH


DSSP  HHHHHHHHHHLLLLLEEEEEELLLllllllllllllllLHHHHHHHHLLlLEEEeEEEL-
Query DGVRWAAKAIENLPLRAILLAPSCvpsapglerggadfDAAILADLLSWpEIGGiAEIX-  181
ident         |   ||    ||                      |          |  ||  
Sbjct WYISRMLQAADSLPVNIGLLGKGN------------vsQPDALREQVAA-GVIG-LEIHe  219
DSSP  HHHHHHHHHHLLLLLEEEEEEELL------------llLHHHHHHHHHH-LLLE-EEEEh


DSSP  --LHHHHhlllhhHHHHHHHHHHHLLEEEELLLL-----lLHHHHHHHHHlLLLEEL-LL
Query --NXRGVierdprXSGIVQAGLAAEKLVCGHARG-----lKNADLNAFXAaGVSSDH-EL  233
ident                            |  |             | |             
Sbjct dwGATPA-----aIDCALTVADEMDIQVALHSDTlnesgfVEDTLAAIGG-RTIHTFhTE  273
DSSP  hhLLLHH-----hHHHHHHHHHHHLLEEEEELLLllllllHHHHHHHHLL-LLEEELlLL


DSSP  LL-----HHHHhHHHHLL-LEEEEELLLHHH-----------------------------
Query VS-----GEDLxAKLRAG-LTIELRGSHDHL-----------------------------  258
ident                                                             
Sbjct GAggghaPDII-TACAHPnILPSSTNPTLPYtlntidehldmlmvchhldpdiaedvafa  332
DSSP  LLlllllLLHH-HHHHLLlEEEEEEHHHLLLlllhhhhhhhhhhhhhllllllhhhhhll


DSSP  --------HHHHHHHHhhhLLLLlLEEEELLLLLhhhhhhlLLHHHHHHHHHHLL-----
Query --------LPEFVAALntlGHLPqTVTLCTDDVFpddllqgGGLDDVVRRLVRYG-----  305
ident                               |          |                  
Sbjct esrirretIAAEDVLH---DLGA-FSLTSSDSQA---mgrvGEVILRTWQVAHRMkvqrg  385
DSSP  lllllhhhHHHHHHHH---HLLL-LLEEELLLLL---llllLLHHHHHHHHHHHHhhhhl


DSSP  -----------lLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEELLLLLL-LEEE
Query -----------lKPEWALRAATLNAAQRLGR-SDLGLIAAGRRADIVVFEDLNGF-SARH  352
ident                      | | |   |     | |  |  || ||            
Sbjct alaeetgdndnfRVKRYIAKYTINPALTHGIaHEVGSIEVGKLADLVVWSPAFFGvKPAT  445
DSSP  llllllllllhhHHHHHHHLLLHHHHHHLLLlLLLLLLLLLLLLLEEEELHHHLLlLLLE


DSSP  EEELLEEEEEL---------------LEEL--LLLLllllhhhllllllllllhhhhlll
Query VLASGRAVAEG---------------GRXL--VDIPtcdttvlkgsxklplrxandflvk  395
ident |   |                      |                                
Sbjct VIKGGMIAIAPmgdinasiptpqpvhYRPMfgALGS------------------------  481
DSSP  EEELLEEEEEEellllllllllllleEEELhhHLHH------------------------


DSSP  lllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeel
Query sqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltg  455
ident                                                             
Sbjct ------------------------------------------------------------  481
DSSP  ------------------------------------------------------------


DSSP  lllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeellll
Query wgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplpls  515
ident                                                             
Sbjct -----------------------------------------------arhhcrltflsqa  494
DSSP  -----------------------------------------------hhhhhleeeelhh


DSSP  lllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeell
Query glvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvl  575
ident                                                             
Sbjct aaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepa  554
DSSP  hhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllll


DSSP  lleeellleeel
Query tgkvxespviev  587
ident             
Sbjct dvlpmaqryflf  566
DSSP  llllllllllll


No 25: Query=3nqbA Sbjct=1bf6A Z-score=17.5

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeELEEEEEELHH------------hHLLL--HHHHHHHHHLLLE
Query srrdaaqvidaggayvsPGLIDTHXHIE------------sSXIT--PAAYAAAVVARGV  106
ident                   |    | |                               |||
Sbjct -------------sfdpTGYTLAHEHLHidlsgfknnvdcrLDQYafICQEMNDLMTRGV   47
DSSP  -------------llllLLEEEEEELLLeelhhhhllhhheELLHhhHHHHHHHHHHLLE


DSSP  EEEEELLHhhHHHHlhhHHHHHHHHHLL-LLLEEEEEELLL-llLLLLL-lllllllLHH
Query TTIVWDPHefGNVHgvdGVRWAAKAIEN-LPLRAILLAPSC-vpSAPGL-erggadfDAA  163
ident                                               |           | 
Sbjct RNVIEMTN--RYMG---RNAQFMLDVMReTGINVVACTGYYqdaFFPEHvatrsvqeLAQ  102
DSSP  EEEEELLL--HHHL---LLHHHHHHHHHhHLLEEEEEELLLlhhHLLLHhhhllhhhHHH


DSSP  HHHHHHLL------LLEEEEEEELLHhhhHLLL--HHHHHHHHHHHHHLLEEEELL--LL
Query ILADLLSW------PEIGGIAEIXNXrgvIERD--PRXSGIVQAGLAAEKLVCGHA--RG  213
ident    |             | ||||      |             |          |     
Sbjct EMVDEIEQgidgteLKAGIIAEIGTSegkITPLeeKVFIAAALAHNQTGRPISTHTsfST  162
DSSP  HHHHHHHLllllllLLEEEEEEEELLlllLLHHhhHHHHHHHHHHHHHLLLEEEELhhHL


DSSP  LLHHHHHHHHHLL----lLEEL-LLLL--HHHHHHHHHLLLEEEE-ELLL-----HHHHH
Query LKNADLNAFXAAG----vSSDH-ELVS--GEDLXAKLRAGLTIEL-RGSH-----DHLLP  260
ident      |    | |                          |               |    
Sbjct MGLEQLALLQAHGvdlsrVTVGhCDLKdnLDNILKMIDLGAYVQFdTIGKnsyypDEKRI  222
DSSP  LHHHHHHHHHHLLllhhhEEELlLLLLllHHHHHHHHHLLLEEEElLLLLlllllHHHHH


DSSP  HHHHHHHHHlLLLLLEEEELLLLLHHHHH---HLLLhHHHH-HHHHHLL---LLHHHHHH
Query EFVAALNTLgHLPQTVTLCTDDVFPDDLL---QGGGlDDVV-RRLVRYG---LKPEWALR  313
ident     ||     |   | |  |      |      |  |                      
Sbjct AMLHALRDR-GLLNRVMLSMDITRRSHLKangGYGY-DYLLtTFIPQLRqsgFSQADVDV  280
DSSP  HHHHHHHHL-LLHHHEEELLLLLLHHHLHhhlLLLL-LHHHhLHHHHHHhllLLHHHHHH


DSSP  HHLHHHHHHHLlllllllllllllleeeellllllleeeeeelleeeeelleelllllll
Query AATLNAAQRLGrsdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptc  373
ident     |  |                                                    
Sbjct MLRENPSQFFQ-------------------------------------------------  291
DSSP  HHLHHHHHHLL-------------------------------------------------


DSSP  llhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleelllllee
Query dttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegat  433
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  eeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhh
Query xisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavig  493
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  llleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhh
Query tgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkac  553
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hlllllllllleelllleeelllleeellleeel
Query fgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                   
Sbjct ----------------------------------  291
DSSP  ----------------------------------


No 26: Query=3nqbA Sbjct=3cjpA Z-score=17.3

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeLEEEEEELHHhhlLLHHHHHHHHHLLLEEEEEELLHH-----
Query srrdaaqvidaggayvspGLIDTHXHIEssxITPAAYAAAVVARGVTTIVWDPHE-----  115
ident                     || | |                  ||              
Sbjct ------------------LIIDGHTHVI---LPVEKHIKIMDEAGVDKTILFSTSihpet   39
DSSP  ------------------LLEEEEEELL---LLHHHHHHHHHHHLLLEEEEELLLllhhh


DSSP  -----------------------hhHHHLHHHHHHHHHHHLLLlLEEEEEELLLllllll
Query -----------------------fgNVHGVDGVRWAAKAIENLpLRAILLAPSCvpsapg  152
ident                                        |     |              
Sbjct avnlrdvkkemkklndvvngktnsmIDVRRNSIKELTNVIQAYpSRYVGFGNVP------   93
DSSP  lllhhhhhhhhhhhhhhhlllllllHHHHHHHHHHHHHHHHHLlLLEEEEELLL------


DSSP  lllllllLLHHHHHH-HHLLLlEEEEEEELLHHhHHLLlhhHHHHHHHHHHH-LLEEEEL
Query lerggadFDAAILAD-LLSWPeIGGIAEIXNXRgVIERdprXSGIVQAGLAA-EKLVCGH  210
ident                         || |       |        |              |
Sbjct -vglsenDTNSYIEEnIVNNK-LVGIGELTPASgQIKS---LKPIFKYSMDSgSLPIWIH  148
DSSP  -llllhhHHHHHHHHhLLLLL-LLEEEEELLLLlLHHH---HHHHHHHHHHLlLLLEEEL


DSSP  LLL-LLHHHHHHHHHLL------lLEEL-LLLLhhHHHHHHHLL-----LEEEEElLLHH
Query ARG-LKNADLNAFXAAG------vSSDH-ELVSgeDLXAKLRAG-----LTIELRgSHDH  257
ident |   |   |                       |                |          
Sbjct AFNpLVLQDIKEIAELCkafpkvpVILGhMGGS--NWMTAVELAkeiqnLYLDTS-AYFS  205
DSSP  LLLlLLHHHHHHHHHHHhhlllllEEEHhHHHH--HHHHHHHHHhhlllEEEELL-LLLL


DSSP  hHHHHHHHHHhhlLLLLLEEEELLLLLhhhhhhllLHHHHHHHHHhLLLL-HHHHHHHHL
Query lLPEFVAALNtlgHLPQTVTLCTDDVFpddllqggGLDDVVRRLVrYGLK-PEWALRAAT  316
ident          |    ||      ||  |         |                 |     
Sbjct -TFVLKIVIN---ELPLKCIFGTDMPF-------gDLQLSIEAIK-KMSNdSYVANAVLG  253
DSSP  -HHHHHHHHH---HLLLLEELLLLLLL-------lLHHHHHHHHH-HHLLlHHHHHHHHL


DSSP  HHHHHHHLLllllllllllllleeeellllllleeeeeelleeeeelleelllllllllh
Query LNAAQRLGRsdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdtt  376
ident  |    |                                                     
Sbjct DNISRLLNI---------------------------------------------------  262
DSSP  HHHHHHHLL---------------------------------------------------


DSSP  hhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeee
Query vlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxis  436
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  eellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlll
Query vthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgg  496
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  eeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhll
Query gxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfga  556
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lllllllleelllleeelllleeellleeel
Query tlacnigphqtdxgiadvltgkvxespviev  587
ident                                
Sbjct -------------------------------  262
DSSP  -------------------------------


No 27: Query=3nqbA Sbjct=1a4mA Z-score=16.7

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHHHHLL----------------------------
Query srrdaaqvidaggayvSPGLIDTHXHIESSXI----------------------------   92
ident                        | |                                  
Sbjct ------------tpafNKPKVELHVHLDGAIKpetilyfgkkrgialpadtveelrniig   48
DSSP  ------------llllLLLEEEEEEEHHHLLLhhhhhhhhhhhllllllllhhhhhhhhl


DSSP  ------------------------------LHHHHHHHHHLLLEEEEEELLHhHHHHH--
Query ------------------------------TPAAYAAAVVARGVTTIVWDPHeFGNVH--  120
ident                                           ||                
Sbjct mdkplslpgflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYS-PHLLAns  107
DSSP  llllllhhhhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEEL-LHHHLll


DSSP  ---------------LHHHHHHHHHHHLLL----LLEEEEEELLLllllllllllllLLL
Query ---------------GVDGVRWAAKAIENL----PLRAILLAPSCvpsapglerggaDFD  161
ident                  | |                                        
Sbjct kvdpmpwnqtegdvtPDDVVDLVNQGLQEGeqafGIKVRSILCCM--------rhqpSWS  159
DSSP  lllllhhhlllllllHHHHHHHHHHHHHHHhhhhLLEEEEEEEEE--------lllhHHH


DSSP  HhHHHHHH-LLLL--EEEEeEELL----hHHHHllLHHHHHHHHHHHHHLLEEEELL-LL
Query AaILADLL-SWPE--IGGIaEIXN----xRGVIerDPRXSGIVQAGLAAEKLVCGHA-RG  213
ident       |                             |                  ||   
Sbjct L-EVLELCkKYNQktVVAM-DLAGdetieGSSL--FPGHVEAYEGAVKNGIHRTVHAgEV  215
DSSP  H-HHHHHHhHLLLllEEEE-EEELlllllLHHH--LHHHHHHHHHHHHHLLEEEEEElLL


DSSP  LLHHHHHHHHHL-LLLEELLLLlhhHHHH-------HHHLLLEEEEEL-LLHH------h
Query LKNADLNAFXAA-GVSSDHELVsgeDLXA-------KLRAGLTIELRG-SHDH------l  258
ident                                      |      |    |          
Sbjct GSPEVVREAVDIlKTERVGHGY---HTIEdealynrLLKENMHFEVCPwSSYLtgawdpk  272
DSSP  LLHHHHHHHHHLlLLLEEEELH---HHHHlhhhhhhHHHLLLEEEELHhHHHHlllllll


DSSP  hHHHHHHHHhhLLLLlLEEEELLLLLHHHHhhllLHHHHHHHHHH-LLLLHHHHHHHhLH
Query lPEFVAALNtlGHLPqTVTLCTDDVFPDDLlqggGLDDVVRRLVR-YGLKPEWALRAaTL  317
ident     |              | |||           ||          |   |   |    
Sbjct tTHAVVRFK--NDKA-NYSLNTDDPLIFKS----TLDTDYQMTKKdMGFTEEEFKRL-NI  324
DSSP  lLLHHHHHH--HLLL-LEEELLLLLLLLLL----LHHHHHHHHHHlLLLLHHHHHHH-HH


DSSP  HHHHHH-----lLLLL--LLLLlllllleeeellllllleeeeeelleeeeelleellll
Query NAAQRL-----gRSDL--GLIAagrradivvfedlngfsarhvlasgravaeggrxlvdi  370
ident |||            |   |                                        
Sbjct NAAKSSflpeeeKKELleRLYR--------------------------------------  346
DSSP  HHHHLLlllhhhHHHHhhHHHH--------------------------------------


DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll
Query ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
ident                                                             
Sbjct ------------------------------------------------------------  346
DSSP  ------------------------------------------------------------


DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh
Query gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
ident                                                             
Sbjct ------------------------------------------------------------  346
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh
Query vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
ident                                                             
Sbjct ------------------------------------------------------------  346
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllleelllleeelllleeellleeel
Query kacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                      
Sbjct ----------------------------------eyq  349
DSSP  ----------------------------------hll


No 28: Query=3nqbA Sbjct=2y1hB Z-score=16.7

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHHH--HLLLHHHHHHHHHLLLEEEEEELLHhhhh
Query srrdaaqvidaggayvSPGLIDTHXHIES--SXITPAAYAAAVVARGVTTIVWDPHefgn  118
ident                   || | | |                     |   |        
Sbjct ----------------GVGLVDCHCHLSApdFDRDLDDVLEKAKKANVVALVAVAE----   40
DSSP  ----------------LLLEEEEEELLLLhhHLLLHHHHHHHHHHLLEEEEEELLL----


DSSP  hhLHHHHHHHHHHHLLLlLEEEEEELLL-------lLLLLlllllllLLLHHHHHHHHLL
Query vhGVDGVRWAAKAIENLpLRAILLAPSC-------vPSAPglerggaDFDAAILADLLSW  171
ident               |                                      |      
Sbjct --HSGEFEKIMQLSERYnGFVLPCLGVHpvqgldqrSVTL-------KDLDVALPIIENY   91
DSSP  --LHHHHHHHHHHHHHLlLLEEEEELLLleelllleELLH-------HHHHHHHHHHHHH


DSSP  -LLEEEEEEELLHH---------hhhllLHHHHHHHHHHHHHLLEEEELLL-LLLHhhHH
Query -PEIGGIAEIXNXR---------gvierDPRXSGIVQAGLAAEKLVCGHAR-GLKNadLN  220
ident       | |                           |        |  | |        |
Sbjct kDRLLAIGEVGLDFsprfagtgeqkeeqRQVLIRQIQLAKRLNLPVNVHSRsAGRP-tIN  150
DSSP  lLLLLEEEEEEEELlllllllhhhhhhhHHHHHHHHHHHHHHLLLEEEEEElLHHH-hHH


DSSP  HHHHLLL--LEEL-LLLLHHHHHHHHHLLLEEEEELLLH--HHHHHHHHHHhhhllLLLL
Query AFXAAGV--SSDH-ELVSGEDLXAKLRAGLTIELRGSHD--HLLPEFVAALntlghLPQT  275
ident      |      |             |||       |          |  |         
Sbjct LLQEQGAekVLLHaFDGRPSVAMEGVRAGYFFSIPPSIIrsGQKQKLVKQL-----PLTS  205
DSSP  HHHHLLLllEEEElLLLLHHHHHHHHHLLLEEEELHHHHllHHHHHHHHHL-----LHHH


DSSP  EEEELLLLL------HHHHhhlLLHHHHHHHHHHLL-LLHHHHHHHHLHHHHHHH-LLLL
Query VTLCTDDVF------PDDLlqgGGLDDVVRRLVRYG-LKPEWALRAATLNAAQRL-GRSD  327
ident   | ||                                  |      | ||         
Sbjct ICLETDSPAlgpekqVRNE--pWNISISAEYIAQVKgISVEEVIEVTTQNALKLFpKLRH  263
DSSP  EEELLLLLLllllllLLLL--hHHHHHHHHHHHHHHlLLHHHHHHHHHHHHHHHLlLHHH


DSSP  llllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhlllllllll
Query lgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplr  387
ident                                                             
Sbjct ------------------------------------------------------------  263
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllllllll
Query xandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaept  447
ident                                                             
Sbjct ------------------------------------------------------------  263
DSSP  ------------------------------------------------------------


DSSP  eeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleee
Query tktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvt  507
ident                                                             
Sbjct ------------------------------------------------------------  263
DSSP  ------------------------------------------------------------


DSSP  eeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleel
Query ailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqt  567
ident                                                             
Sbjct ------------------------------------------------------------  263
DSSP  ------------------------------------------------------------


DSSP  llleeelllleeellleeel
Query dxgiadvltgkvxespviev  587
ident                     
Sbjct ------------------ll  265
DSSP  ------------------hl


No 29: Query=3nqbA Sbjct=3k2gB Z-score=16.6

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ---------------------------------------------------slselspch    9
DSSP  ---------------------------------------------------lllllllll


DSSP  lllleeeeeelllleeeeLEEEEEELHHH-------------------------------
Query srrdaaqvidaggayvspGLIDTHXHIES-------------------------------   89
ident                   |    | |                                  
Sbjct vrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapisieilselr   69
DSSP  lllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhh


DSSP  -----------HLLL--HHHHHHHHHLLLEEEEEELL--HHHHhhhlhhhHHHHHHH-HL
Query -----------SXIT--PAAYAAAVVARGVTTIVWDP--HEFGnvhgvdgVRWAAKA-IE  133
ident                    |      | |   ||                          
Sbjct qdpfvnkhniaLDDLdlAIAEVKQFAAVGGRSIVDPTcrGIGR-------DPVKLRRiSA  122
DSSP  llhhhllllleELLHhhHHHHHHHHHHLLLLEEEELLllLLLL-------LHHHHHHhHH


DSSP  LLLLEEEEEeLLLL--LLLLLLLL-lllllLHHHHHHHHLL------LLEEEEEEELLHH
Query NLPLRAILLaPSCV--PSAPGLER-ggadfDAAILADLLSW------PEIGGIAEIXNXR  184
ident                  | |           |                 || | ||    
Sbjct ETGVQVVXG-AGYYlaSSXPETAArlsaddIADEIVAEALEgtdgtdARIGLIGEIGVSS  181
DSSP  HHLLEEEEL-LLLLlhHHLLHHHHlllhhhHHHHHHHHHHLllllllLLLLLEEEELLLL


DSSP  hhHLLL--HHHHHHHHHHHHHLLEEEELL-LLLLhhHHHHHHHLL--------lLEELLL
Query gvIERD--PRXSGIVQAGLAAEKLVCGHA-RGLKnaDLNAFXAAG--------vSSDHEL  233
ident             |   |          |                                
Sbjct -dFTAEeeKSLRGAARAQVRTGLPLXVHLpGWFR--LAHRVLDLVeeegadlrhTVLCHX  238
DSSP  -lLLHHhhHHHHHHHHHHHHHLLLEEELLlLLLL--LHHHHHHHHhhllllhhhEEELLL


DSSP  -LLHH---HHHHHHHLLLEEEEE-LLLH----------HHHHHHHHHHHH--HLLLLLLE
Query -VSGE---DLXAKLRAGLTIELR-GSHD----------HLLPEFVAALNT--LGHLPQTV  276
ident   |             |   |      |              |   |             
Sbjct nPSHXdpvYQATLAQRGAFLEFDxIGXDffyadqgvqcPSDDEVARAILGlaDHGYLDRI  298
DSSP  hHHLLlhhHHHHHHHHLLEEEELlLLLLleelllleelLLHHHHHHHHHHhhHLLLHHHE


DSSP  EEELLLLLHHHHH---HLLLhHHHH-HHHHHLL---LLHHHHHHHHLHHHHHHHLLLLll
Query TLCTDDVFPDDLL---QGGGlDDVV-RRLVRYG---LKPEWALRAATLNAAQRLGRSDlg  329
ident  |  |      |      |    |    | |     |           |       |   
Sbjct LLSHDVFVKXXLTrygGNGY-AFVTkHFLPRLRrhgLDDAALETLXVTNPRRVFDASI--  355
DSSP  EELLLLLLHHHLHhhlLLLL-LHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHHLLLL--


DSSP  llllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllllh
Query liaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxa  389
ident                                                             
Sbjct ------------------------------------------------------------  355
DSSP  ------------------------------------------------------------


DSSP  hhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllllllllee
Query ndflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttk  449
ident                                                             
Sbjct ------------------------------------------------------------  355
DSSP  ------------------------------------------------------------


DSSP  eeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeee
Query tgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtai  509
ident                                                             
Sbjct ------------------------------------------------------------  355
DSSP  ------------------------------------------------------------


DSSP  eelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelll
Query lplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdx  569
ident                                                             
Sbjct ------------------------------------------------------------  355
DSSP  ------------------------------------------------------------


DSSP  leeelllleeellleeel
Query giadvltgkvxespviev  587
ident                   
Sbjct ---------------egh  358
DSSP  ---------------lll


No 30: Query=3nqbA Sbjct=2ob3A Z-score=16.2

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeLEEEEEELHHH------------------hllLHHHHHHHHH
Query srrdaaqvidaggayvspGLIDTHXHIES------------------sxiTPAAYAAAVV  102
ident                   |   || ||                                 
Sbjct ---drintvrgpitiseaGFTLTHEHICGssagflrawpeffgsrkalaeKAVRGLRRAR   57
DSSP  ---lleeelleeelhhhhLLEEEEELLEEllllhhhhlhhhhllhhhhhhHHHHHHHHHH


DSSP  LLLEEEEEELL--HHHHhhhlhhHHHHHHHHHLLLLLEEEEEElLLLLLLLLL-llllll
Query ARGVTTIVWDP--HEFGnvhgvdGVRWAAKAIENLPLRAILLApSCVPSAPGL-erggad  159
ident | || |||                |   |                     |         
Sbjct AAGVRTIVDVStfDIGR------DVSLLAEVSRAADVHIVAAT-GLWFDPPLSmrlrsve  110
DSSP  HLLLLEEEELLlhHHLL------LHHHHHHHHHHHLLEEELEE-ELLLLLLHHhhlllhh


DSSP  lLHHHHHHHHLL------LLEEEEEeELLHHhhHLLL--HHHHHHHHHHHHHLLEEEELL
Query fDAAILADLLSW------PEIGGIAeIXNXRgvIERD--PRXSGIVQAGLAAEKLVCGHA  211
ident                      | |                       | ||    |  | 
Sbjct eLTQFFLREIQYgiedtgIRAGIIX-VATTG-kATPFqeLVLKAAARASLATGVPVTTHT  168
DSSP  hHHHHHHHHHHLllllllLLLLEEE-EELLL-lLLHHhhHHHHHHHHHHHHHLLLEEEEL


DSSP  -LLLLhhHHHHHHHLL--------lLEELLL--LLHH-HHHHHHHLLLEEEE-ELLL---
Query -RGLKnaDLNAFXAAG--------vSSDHEL--VSGE-DLXAKLRAGLTIEL-RGSH---  255
ident        |     |                         | |    |  | |        
Sbjct aASQR--DGEQQAAIFeseglspsrVCIGHSddTDDLsYLTALAARGYLIGLdHIPYsai  226
DSSP  lHHHL--HHHHHHHHHhhllllhhhEEELLHhhLLLHhHHHHHHHLLLEEEElLLLLlll


DSSP  -----------------HHHHHHHHHHHHHHllLLLLEEEELLL-------------lLH
Query -----------------DHLLPEFVAALNTLghLPQTVTLCTDD-------------vFP  285
ident                          |                |                 
Sbjct glednasasallgirswQTRALLIKALIDQG--YMKQILVSNDWtfgfssyvtnimdvMD  284
DSSP  lllllhhhhhhhllllhHHHHHHHHHHHHLL--LHHHEEELLLLlleellllllhhhhHH


DSSP  HHHHH-lLLHH-HHHHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleeeel
Query DDLLQ-gGGLD-DVVRRLVRYGLKPEWALRAATLNAAQRLGrsdlgliaagrradivvfe  343
ident              |   |   |   |        | |  |                    
Sbjct RVNPDgmAFIPlRVIPFLREKGVPQETLAGITVTNPARFLS-------------------  325
DSSP  HHLLLhhHHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL-------------------


DSSP  lllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeee
Query dlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrl  403
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  eeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeelllllllee
Query atidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngaf  463
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  eelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllh
Query attvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapl  523
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeelll
Query eevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxesp  583
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  eeel
Query viev  587
ident     
Sbjct ptlr  329
DSSP  llll


No 31: Query=3nqbA Sbjct=3gg7A Z-score=16.0

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeLEEEEEELHHHHLLlHHHHHHHHHLLLEeEEEELLHhhhhhh
Query srrdaaqvidaggayvspGLIDTHXHIESSXItPAAYAAAVVARGVtTIVWDPHefgnvh  120
ident                    ||| | |       | | | |   |   |            
Sbjct ------------------SLIDFHVHLDLYPD-PVAVARACEERQL-TVLSVTT------   34
DSSP  ------------------LLEEEEELHHHLLL-HHHHHHHHHHLLL-EEEELLL------


DSSP  lhhHHHHHHHHHLLLlLEEEEEELLLlLLLLllllLLLLLLhHHHHHHHLLllEEEEEEE
Query gvdGVRWAAKAIENLpLRAILLAPSCvPSAPglerGGADFDaAILADLLSWpeIGGIAEI  180
ident      |                               |          |         | 
Sbjct tpaAWRGTLALAAGR-PHVWTALGFHpEVVS----ERAADL-PWFDRYLPE--TRFVGEV   86
DSSP  lhhHHHHHHHHHLLL-LLEEELLLLLhHHLL----LLHHHL-HHHHHHHHH--LLEEEEE


DSSP  LLHH------hhhllLHHHHHHHHHHHHH-LLEEEELLL-LLLHhhHHHHHHLL---lLE
Query XNXR------gvierDPRXSGIVQAGLAA-EKLVCGHAR-GLKNadLNAFXAAG---vSS  229
ident                      |              | |       ||   |        
Sbjct GLDGspslrgtwtqqFAVFQHILRRCEDHgGRILSIHSRrAESE-vLNCLEANPrsgtPI  145
DSSP  ELLLlhhhhhhhhhhHHHHHHHHHHHHHLlLEEEEEELLlLHHH-hHHHHHHLHhheeEE


DSSP  ELLLL-LHHHHHHHHHLLLEEEEELLL--HHHHHHHHHHHhhhllLLLLEEEELLLL---
Query DHELV-SGEDLXAKLRAGLTIELRGSH--DHLLPEFVAALntlghLPQTVTLCTDDV---  283
ident  |    |   |      |                               |   ||     
Sbjct LHWYSgSVTELRRAISLGCWFSVGPTMvrTQKGAALIRSM-----PRDRVLTETDGPfle  200
DSSP  EELLLlLHHHHHHHHHLLLEEEELHHHhlLHHHHHHHHHL-----LHHHEEELLLLLlle


DSSP  --lHHHHhhlLLHHHHHHHHHHLL-LLHHHHHHHHLHHHHHHHLllllllllllllllee
Query --fPDDLlqgGGLDDVVRRLVRYG-LKPEWALRAATLNAAQRLGrsdlgliaagrradiv  340
ident       |        ||  |            |    |    ||                
Sbjct ldgQAAL--pWDVKSVVEGLSKIWqIPASEVERIVKENVSRLLG----------------  242
DSSP  ellEELL--hHHHHHHHHHHHHHHlLLHHHHHHHHHHHHHHHHH----------------


DSSP  eellllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllle
Query vfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgak  400
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll
Query vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllll
Query gafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsd  520
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee
Query apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  llleeel
Query espviev  587
ident        
Sbjct ------t  243
DSSP  ------l


No 32: Query=3nqbA Sbjct=3pnuA Z-score=15.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelLLLEEEELEEEEEELHHhhlLLHHHHHHHHHLlLEEEEEELLH--HHHH
Query srrdaaqvidaGGAYVSPGLIDTHXHIEssxITPAAYAAAVVArGVTTIVWDPH--EFGN  118
ident              |       | | |           |           |  |       
Sbjct -----enlyfqSNAMKLKNPLDMHLHLR-dnQMLELIAPLSAR-DFCAAVIMPNliPPLC   53
DSSP  -----llllllLLLEEEELLEEEEELLL-lhHHHHHHHHHHHL-LLLEEEELLLllLLLL


DSSP  hhLHHHHHHHHHHHLLL----LLEEEEEELLLlllllllllllllLLHHHHHHHHLLllE
Query vhGVDGVRWAAKAIENL----PLRAILLAPSCvpsapglerggadFDAAILADLLSWpeI  174
ident              |                                |   |        |
Sbjct --NLEDLKAYKMRILKAckdeNFTPLMTLFFK------------nYDEKFLYSAKDE--I   97
DSSP  --LHHHHHHHHHHHHHHhlllLLEEEEEEELL------------lLLHHHHHHHLLL--L


DSSP  EEEeEELL----------HHHHhLLLHhHHHHHHHHHHHLLEEEELLL----------LL
Query GGIaEIXN----------XRGViERDPrXSGIVQAGLAAEKLVCGHAR----------GL  214
ident  ||                               |          |              
Sbjct FGI-XLYPagittnsnggVSSF-DIEY-LKPTLEAMSDLNIPLLVHGEtndfvmdresNF  154
DSSP  LEE-EELLllllllllllLLLL-LHHH-HHHHHHHHHHLLLLEEELLLllllhhhllhHH


DSSP  LHhHHHHHHHL---LLLEELLLLLHHHHHHHHHLL-LEEEEELLLHH-------------
Query KNaDLNAFXAA---GVSSDHELVSGEDLXAKLRAG-LTIELRGSHDH-------------  257
ident                                     |       |               
Sbjct AK-IYEKLAKHfprLKIVMEHITTKTLCELLKDYEnLYATITLHHLIitlddviggkmnp  213
DSSP  HH-HHHHHHHHlllLLEEELLLLLHHHHHHHHHLLlEEEEELLHHHLllhhhhhlllllh


DSSP  ------------HHHHHHHHhhhhlLLLLLEEEELLLLL-------HHHHhhlLLHHHHH
Query ------------LLPEFVAAlntlgHLPQTVTLCTDDVF-------PDDLlqgGGLDDVV  298
ident                               |    |                      | 
Sbjct hlfckpiakryeDKEALCEL---afSGYEKVMFGSDSAPhpkgcaaGVFS--aPVILPVL  268
DSSP  hhllllllllhhHHHHHHHH---hhLLLLLEEELLLLLLlllllllLLLL--hHHHHHHH


DSSP  HHHHHLLLLHHHHHHHHLHHHHHHHLLLLlllllllLLLLEEEELL--------------
Query RRLVRYGLKPEWALRAATLNAAQRLGRSDlgliaagRRADIVVFED--------------  344
ident   |       |        |                    |   |               
Sbjct AELFKQNSSEENLQKFLSDNTCKIYDLKF-------KEDKILTLEEkewqvpnvyedkyn  321
DSSP  HHHHHHHLLHHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELlleelllleellll


DSSP  ---------llLLLEEEeeelleeeeelleelllllllllhhhllllllllllhhhhlll
Query ---------lnGFSARHvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvk  395
ident             |   |                                           
Sbjct qvvpymageilKFQLKH-------------------------------------------  338
DSSP  eellllllleeLLEELL-------------------------------------------


DSSP  lllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeel
Query sqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltg  455
ident                                                             
Sbjct ------------------------------------------------------------  338
DSSP  ------------------------------------------------------------


DSSP  lllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeellll
Query wgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplpls  515
ident                                                             
Sbjct ------------------------------------------------------------  338
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeell
Query glvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvl  575
ident                                                             
Sbjct ------------------------------------------------------------  338
DSSP  ------------------------------------------------------------


DSSP  lleeellleeel
Query tgkvxespviev  587
ident             
Sbjct ------------  338
DSSP  ------------


No 33: Query=3nqbA Sbjct=2imrA Z-score=15.9

back to top
DSSP  llhhhllhhhhhhhhhhhhllllEEEEEElLEEELLLlLLEEELeEEEELLEEEEE---e
Query epadlnddtlraravaaargdqrFDVLITgGTLVDVVtGELRPAdIGIVGALIASV---h   57
ident                           | |                   ||   |      
Sbjct ----------------------hTPRLLT-CDVLYTG-AQSPGG-VVVVGETVAAAghpd   35
DSSP  ----------------------lLEEEEE-ELEEELL-EELLEE-EEEELLEEEEEelhh


DSSP  LLLL-LLLEeEEEELLlLEEEELEEEEEELHHH-------------------------hl
Query EPAS-RRDAaQVIDAGgAYVSPGLIDTHXHIES-------------------------sx   91
ident |       |     || |   |     | |                              
Sbjct ELRRqYPHA-AEERAG-AVIAPPPVNAHTHLDMsayefqalpyfqwipevvirgrhlrgv   93
DSSP  HHHHhLLLL-EEEELL-LEELLLLLEEEEELLLlhhhhhhlhhhhllhhhhhhhllllhh


DSSP  LLHHHHHHHHHLLLEEEEEELLHHhhhhhlHHHHHHHHhhHLLLlLEEEEEELLLllLLL
Query ITPAAYAAAVVARGVTTIVWDPHEfgnvhgVDGVRWAAkaIENLpLRAILLAPSCvpSAP  151
ident     | |      |                               |   |          
Sbjct AAAQAGADTLTRLGAGGVGDIVWA------PEVMDALL--ARED-LSGTLYFEVL--NPF  142
DSSP  HHHHHHHHHHHHLLLLLEEEEELL------HHHHHHHH--LLLL-LLEEEEEEEL--LLL


DSSP  LLlllllllLHHHHHHHHLLLL-------eEEEEEELLHhhhhllLHHHHHHHHHHHHHL
Query GLerggadfDAAILADLLSWPE-------iGGIAEIXNXrgvierDPRXSGIVQAGLAAE  204
ident            |     |             |                            
Sbjct PD---kadeVFAAARTHLERWRrlerpglrLGLSPHTPF---tvsHRLMRLLSDYAAGEG  196
DSSP  HH---hhhhHHHHHHHHHHHHHlllllleeEEEEELLLL---lllHHHHHHHHHHHHHHL


DSSP  LEEEELLL-------------------------------------lllHHHHHHHH-HLL
Query KLVCGHAR-------------------------------------glkNADLNAFX-AAG  226
ident      |                                                      
Sbjct LPLQIHVAehptelemfrtgggplwdnrmpalyphtlaevigrepgpdLTPVRYLDeLGV  256
DSSP  LLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhhhlllllllLLHHHHHHhHLL


DSSP  L---LEELLLLLhhHHHHHHHLL----LEEEEE-LLLH---HHHHhHHHHHHHHlllLLL
Query V---SSDHELVSgeDLXAKLRAG----LTIELR-GSHD---HLLPeFVAALNTLghlPQT  275
ident           |                        |             |          
Sbjct LaarPTLVHMVN--VTPDDIARVaragCAVVTCpRSNHhleCGTF-DWPAFAAA---GVE  310
DSSP  HhhlLEEEELLL--LLHHHHHHHhhhlLLEEELhHHHHhllLLLL-LHHHHHHL---LLL


DSSP  EEEELLLLLhhhhhHLLLHHHHHHHHHHLL--LLHHHHHHHHLHHHHHHHLlllLLLLLL
Query VTLCTDDVFpddllQGGGLDDVVRRLVRYG--LKPEWALRAATLNAAQRLGrsdLGLIAA  333
ident | | || |              |         | |    |||        |         
Sbjct VALGTDSVA---sgETLNVREEVTFARQLYpgLDPRVLVRAAVKGGQRVVG---TPFLRR  364
DSSP  EEELLLLHH---hhLLLLLHHHHHHHHHHLllLLHHHHHHHHHHHHHHHHL---LLLLLL


DSSP  LLL-llEEEELlllllleeeeeelleeeeELLEElllllllllhhhllllllllllhhhh
Query GRR-adIVVFEdlngfsarhvlasgravaEGGRXlvdiptcdttvlkgsxklplrxandf  392
ident |         |                                                 
Sbjct GETwqeGFRWE------------------LSRDL--------------------------  380
DSSP  LLLllhHHLHH------------------HLLLL--------------------------


DSSP  llllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeee
Query lvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgf  452
ident                                                             
Sbjct ------------------------------------------------------------  380
DSSP  ------------------------------------------------------------


DSSP  eellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeel
Query ltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailpl  512
ident                                                             
Sbjct ------------------------------------------------------------  380
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellllee
Query plsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgia  572
ident                                                             
Sbjct ------------------------------------------------------------  380
DSSP  ------------------------------------------------------------


DSSP  elllleeellleeel
Query dvltgkvxespviev  587
ident                
Sbjct ---------------  380
DSSP  ---------------


No 34: Query=3nqbA Sbjct=2ffiA Z-score=15.2

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeELEEEEEELHH--------------hhLLLHHHHHHHHHLLLE
Query srrdaaqvidaggayvsPGLIDTHXHIE--------------ssXITPAAYAAAVVARGV  106
ident                     || | |                        |     | | 
Sbjct ---------------lhLTAIDSHAHVFsrglnlasqrryapnyDAPLGDYLGQLRAHGF   45
DSSP  ---------------llLLLEELLLLLLlhhhhhhlllllllllLLLHHHHHHHHHHLLL


DSSP  EEEEELLHHHHHhhlhhHHHHHHHHHLLLLLEEEEEELLllllllllllllllLLHHHhH
Query TTIVWDPHEFGNvhgvdGVRWAAKAIENLPLRAILLAPScvpsapglerggadFDAAIlA  166
ident    |     |         |    |    |                              
Sbjct SHGVLVQPSFLG----tDNRYLLSALQTVPGQLRGVVXL--------------ERDVE-Q   86
DSSP  LEELLLLLHHHL----lLLHHHHHHHHHLLLLLLLLLLL--------------LLLLL-H


DSSP  HHHLLL---LEEEEEEEL---lhHHHHlLLHHhHHHHHHHHHHLLEEEELLL--LLLHhH
Query DLLSWP---EIGGIAEIX---nxRGVIeRDPRxSGIVQAGLAAEKLVCGHAR--GLKNaD  218
ident   |         |                                 |  |          
Sbjct ATLAEXarlGVRGVRLNLxgqdxPDLT-GAQW-RPLLERIGEQGWHVELHRQvaDIPV-L  143
DSSP  HHHHHHhllLLLEEELLLlllllLLLL-LLLL-HHHHHHHHHHLLEEEELLLllLHHH-H


DSSP  HHHHHHL-LLLEEL--LLLL------hhHHHHHHHL----LLEEEEELLLH------HHH
Query LNAFXAA-GVSSDH--ELVS------geDLXAKLRA----GLTIELRGSHD------HLL  259
ident   |                              |             |           |
Sbjct VRALQPYgLDIVIDhfGRPDarrglgqpGFAELLTLsgrgKVWVKVSGIYRlqgspeENL  203
DSSP  HHHHLLLlLLEEELhhHLLLllllllllLHHHHLLLllllLEEEEEELHHHllllhhHHH


DSSP  HHHHHHHHH--hllLLLLEEEELLL-LLHHHhHHLLLhHHHHHHHHHLLLLHHHHHHHHL
Query PEFVAALNT--lghLPQTVTLCTDD-VFPDDlLQGGGlDDVVRRLVRYGLKPEWALRAAT  316
ident      ||                |                 |      |           
Sbjct AFARQALCAleahyGAERLXWGSDWpHTQHE-SEVSF-GSAVEQFEALGCSAQLRQALLL  261
DSSP  HHHHHHHHHhhhhlLHHHEEEELLLlLLLLL-LLLLH-HHHHHHHHHHLLLHHHHHHHHL


DSSP  HHHHHHHLLLLLlllllllllleeeellllllleeeeeelleeeeelleelllllllllh
Query LNAAQRLGRSDLgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdtt  376
ident   |    |                                                    
Sbjct DTARALFGFELE------------------------------------------------  273
DSSP  HHHHHHLLLLLL------------------------------------------------


DSSP  hhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeee
Query vlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxis  436
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  eellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlll
Query vthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgg  496
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  eeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhll
Query gxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfga  556
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  lllllllleelllleeelllleeellleeel
Query tlacnigphqtdxgiadvltgkvxespviev  587
ident                                
Sbjct -------------------------------  273
DSSP  -------------------------------


No 35: Query=3nqbA Sbjct=2vc5A Z-score=15.2

back to top
DSSP  --------LLHHhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelle
Query --------EPADlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgal   52
ident                                                             
Sbjct mriplvgkDSIE------------------------------------------------   12
DSSP  llllllllLLLL------------------------------------------------


DSSP  eeeeellllllleeeeeelllleeeeLEEEEEELHHH-----------------hlLLHH
Query iasvhepasrrdaaqvidaggayvspGLIDTHXHIES-----------------sxITPA   95
ident                           |    | |                          
Sbjct ----------------------skdiGFTLIHEHLRVfseavrqqwphlynedeefRNAV   50
DSSP  ----------------------hhhlLLEELLLLLLLllhhhhhhlhhhllhhhhhHHHH


DSSP  HHHHHHHLLLEEEEEELL--HHHHhhhlhhhHHHHHHHHLL-LLLEEEEEElLLLLL-LL
Query AYAAAVVARGVTTIVWDP--HEFGnvhgvdgVRWAAKAIEN-LPLRAILLApSCVPS-AP  151
ident          || |||                                             
Sbjct NEVKRAMQFGVKTIVDPTvmGLGR-------DIRFMEKVVKaTGINLVAGT-GIYIYiDL  102
DSSP  HHHHHHHHLLLLEEEELLllLLLL-------LHHHHHHHHHlLLLEEEELE-ELLLLlLL


DSSP  LLL--llllllLHHHHHHHHLL------LLEEEEEeELLHhhhHLLL--HHHHHHHHHHH
Query GLE--rggadfDAAILADLLSW------PEIGGIAeIXNXrgvIERD--PRXSGIVQAGL  201
ident             |                  |    |      |  |          |  
Sbjct PFYflnrsideIADLFIHDIKEgiqgtlNKAGFVX-IAADepgITKDveKVIRAAAIANK  161
DSSP  LHHhllllhhhHHHHHHHHHHLllllllLLLLLEE-EELLlllLLHHhhHHHHHHHHHHH


DSSP  HHLLEEEELL-LLLLhhhHHHHHHLL--------lLEELLL--LLHH-HHHHHHHLLLEE
Query AAEKLVCGHA-RGLKnadLNAFXAAG--------vSSDHEL--VSGE-DLXAKLRAGLTI  249
ident         |                               |               |  |
Sbjct ETKVPIITHSnAHNN--tGLEQQRILteegvdpgkILIGHLgdTDNIdYIKKIADKGSFI  219
DSSP  HHLLLEEEELlLLLL--hHHHHHHHHhhllllhhhEEELLHhhLLLHhHHHHHHHLLLEE


DSSP  EEE-LLLH------HHHHHHHHHHHHhlLLLLLEEEELLLLLH------------hhhhH
Query ELR-GSHD------HLLPEFVAALNTlgHLPQTVTLCTDDVFP------------ddllQ  290
ident  |     |                              |                     
Sbjct GLDrYGLDlflpvdKRNETTLRLIKD--GYSDKIMISHDYCCTidwgtakpeykpklapR  277
DSSP  EELlLLLLllllhhHHHHHHHHHHHL--LLLLLEEELLLLLLLlllllllhhhhhhhllL


DSSP  LLLhHHHHHHHHHLL----LLHHHHHHHHLHHHHHHHLlllllllllllllleeeellll
Query GGGlDDVVRRLVRYG----LKPEWALRAATLNAAQRLGrsdlgliaagrradivvfedln  346
ident                       |        |                            
Sbjct WSI-TLIFEDTIPFLkrngVNEEVIATIFKENPKKFFS----------------------  314
DSSP  LLL-LHHHHLHHHHHhlllLLHHHHHHHHLHHHHHHLL----------------------


DSSP  llleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeee
Query gfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlati  406
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  ellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeel
Query drprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafatt  466
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  llllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhh
Query vshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleev  526
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleee
Query arafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespvie  586
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  l
Query v  587
ident  
Sbjct -  314
DSSP  -


No 36: Query=3nqbA Sbjct=4hk5D Z-score=14.7

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHH--------------------------------
Query srrdaaqvidaggayvSPGLIDTHXHIE--------------------------------   88
ident                  |   | | |                                  
Sbjct ----------------TPVVVDIHTHMYppsyiamlekrqtiplvrtfpqadeprlills   44
DSSP  ----------------LLLLEEEEEEELlhhhhhhhhlllllleeeeelleeeeeeellh


DSSP  -----------------------hHLLLHHHHHHHHHLLLEEEEEELLHHHHH-------
Query -----------------------sSXITPAAYAAAVVARGVTTIVWDPHEFGN-------  118
ident                              |         |    |               
Sbjct selaaldaaladpaaklpgrplstHFASLAQKMHFMDTNGIRVSVISLANPWFdflapde  104
DSSP  hhhhhhhhhhhlllllllleellhHHLLHHHHHHHHHHLLLLEEEEEELLLLLlllllll


DSSP  --hHLHHHHHHHHHHHLLLLlEEEEEELlLLLLllllllllllLLHHHHHHHHLLLLEEE
Query --vHGVDGVRWAAKAIENLPlRAILLAPsCVPSapglerggadFDAAILADLLSWPEIGG  176
ident                      |    |     |             |            |
Sbjct apgIADAVNAEFSDMCAQHVgRLFFFAA-LPLS------apvdAVKASIERVKNLKYCRG  157
DSSP  hhhHHHHHHHHHHHHHHLLLlLEEEEEE-LLLL------llhhHHHHHHHHHHLLLLEEE


DSSP  EEeELLH---HHHHLLLhhHHHHHHHHHHHLLEEEEL-----------------------
Query IAeIXNX---RGVIERDprXSGIVQAGLAAEKLVCGH-----------------------  210
ident |          |             |   |  ||  |                       
Sbjct II-LGTSglgKGLDDPH--LLPVFEAVADAKLLVFLHphyglpnevygprseeyghvlpl  214
DSSP  EE-ELLLlllLLLLLHH--HHHHHHHHHHLLLEEEELllllllhhhhlllhhhlllhhhh


DSSP  -------LLLLlhHHHH--HHHH---lLLLEEL--LLLLHH-------------------
Query -------ARGLknADLN--AFXA---aGVSSDH--ELVSGE-------------------  237
ident              |                                              
Sbjct algfpmeTTIA-vARMYmaGVFDhvrnLQMLLAhsGGTLPFlagriescivhdghlvktg  273
DSSP  hlhhhhhHHHH-hHHHHhlLHHHhlllLLEEEHhhHLLHHHhhhhhhhhhhllhhhhhll


DSSP  -------hhHHHHHLLLEEEEELllhhHHHHHHHHHHhhllLLLLEEEELLL-LLHH---
Query -------dlXAKLRAGLTIELRGshdhLLPEFVAALNtlghLPQTVTLCTDD-VFPD---  286
ident             |                    ||              ||   ||    
Sbjct kvpkdrrtiWTVLKEQIYLDAVI---ySEVGLQAAIA--ssGADRLMFGTDHpFFPPiee  328
DSSP  llllllllhHHHHHHLEEEELLL---lLHHHHHHHHH--hhLHHHEELLLLLlLLLLlll


DSSP  --hhHHLLLhHHHHHHHHHlLLLH--HHHHHHHLHHHHHHHLLLLlllllllLLLLeeee
Query --dlLQGGGlDDVVRRLVRyGLKP--EWALRAATLNAAQRLGRSDlgliaagRRADivvf  342
ident                             |     |||   |                   
Sbjct dvqgPWDSS-RLNAQAVIK-AVGEgsSDAAAVMGLNAVRVLSLKA------eLEHH----  376
DSSP  llllLLHHH-HHHHHHHHH-HHLLllHHHHHHHLHHHHHHLLLHH------hHHHH----


DSSP  llllllleeeeeeLLEEeeelleelllllllllhhhllllllllllhhhhllllllleee
Query edlngfsarhvlaSGRAvaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvr  402
ident                                                             
Sbjct -------------HHHH-------------------------------------------  380
DSSP  -------------HHHL-------------------------------------------


DSSP  eeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllle
Query latidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwnga  462
ident                                                             
Sbjct ------------------------------------------------------------  380
DSSP  ------------------------------------------------------------


DSSP  eeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllll
Query fattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdap  522
ident                                                             
Sbjct ------------------------------------------------------------  380
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeell
Query leevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxes  582
ident                                                             
Sbjct ------------------------------------------------------------  380
DSSP  ------------------------------------------------------------


DSSP  leeel
Query pviev  587
ident      
Sbjct -----  380
DSSP  -----


No 37: Query=3nqbA Sbjct=3irsA Z-score=14.6

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeELEEEEEELHH------------------------------hh
Query srrdaaqvidaggayvsPGLIDTHXHIE------------------------------ss   90
ident                     ||                                      
Sbjct -----------------LKIIDFRLRPPamgflnariytrpdirnrftrqlgfepapsae   43
DSSP  -----------------LLLEELLLLLLlhhhhhlhhhhlhhhhhhhhhhhlllllhhhh


DSSP  lllHHHHHHHHHLLLEEEEEELLH-----HHHHhhlhhhHHHHHHHHLLLLLEEEEEELL
Query xitPAAYAAAVVARGVTTIVWDPH-----EFGNvhgvdgVRWAAKAIENLPLRAILLAPS  145
ident             | |    |                       |      |         
Sbjct eksLELMFEEMAAAGIEQGVCVGRnssvlGSVS------NADVAAVAKAYPDKFHPVGSI   97
DSSP  hllHHHHHHHHHHLLLLEEEEELLeelllEELL------HHHHHHHHHHLLLLEEEEEEL


DSSP  LLLlllllllllllLLHHHHHHHHLLLlEEEEEeELLH-----HHHHLLLhhHHHHHHHH
Query CVPsapglerggadFDAAILADLLSWPeIGGIAeIXNX-----RGVIERDprXSGIVQAG  200
ident                  |     |    |                |  |           
Sbjct EAA--------trkEAMAQMQEILDLG-IRIVN-LEPGvwatpMHVDDRR--LYPLYAFC  145
DSSP  LLL--------lhhHHHHHHHHHHHLL-LLLEE-ELHHhllllLLLLLHH--HHHHHHHH


DSSP  HHHLLEEEELLL---------LLLHhHHHHHHHLL---lLEELL--LLLHHHHHHHHHLL
Query LAAEKLVCGHAR---------GLKNaDLNAFXAAG---vSSDHE--LVSGEDLXAKLRAG  246
ident       |                                                     
Sbjct EDNGIPVIMMTGgnagpdityTNPE-HIDRVLGDFpdltVVSSHgnWPWVQEIIHVAFRR  204
DSSP  HHLLLLEEEELLllllllhhhHLHH-HHHHHHHHLllllEEEEHhhLLLHHHHHHHHHHL


DSSP  --LEEEEELLLHH--HHHHHHHHHHhhLLLLLLEEEELLLLLhhhHHHLllhHHHHHHHh
Query --LTIELRGSHDH--LLPEFVAALNtlGHLPQTVTLCTDDVFpddLLQGgglDDVVRRLv  302
ident   |                |  | |    |       |        |           | 
Sbjct pnLYLSPDMYLYNlpGHADFIQAAN--SFLADRMLFGTAYPM--cPLKE--yTEWFLTL-  257
DSSP  llEEEELHHHHLLllLHHHHHHHHL--LHHHHLLLLLLLLLL--lLHHH--hHHHHHLL-


DSSP  hlLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllllleeeeeelleeeee
Query ryGLKPEWALRAATLNAAQRLGRsdlgliaagrradivvfedlngfsarhvlasgravae  362
ident     ||         ||   |                                       
Sbjct --PIKPDAMEKILHGNAERLLAQ-------------------------------------  278
DSSP  --LLLHHHHHHHHLHHHHHHHHH-------------------------------------


DSSP  lleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeee
Query ggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvk  422
ident                                                             
Sbjct ------------------------------------------------------------  278
DSSP  ------------------------------------------------------------


DSSP  lleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhh
Query dgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnag  482
ident                                                             
Sbjct ------------------------------------------------------------  278
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhll
Query dxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvve  542
ident                                                             
Sbjct ------------------------------------------------------------  278
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhlllllllllleelllleeelllleeellleeel
Query wqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                              
Sbjct ------------------------------------------agr  281
DSSP  ------------------------------------------lll


No 38: Query=3nqbA Sbjct=4dlfA Z-score=14.4

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeELEEEEEELHH-----------------hhLLLHHHHHHHHHL
Query srrdaaqvidaggayvsPGLIDTHXHIE-----------------ssXITPAAYAAAVVA  103
ident                     || | |                        | |      |
Sbjct -----------------ALRIDSHQHFWryraadypwigagmgvlarDYLPDALHPLMHA   43
DSSP  -----------------LLLEEEEELLLlllhhhllllllllhhhllLLLHHHHHHHHHH


DSSP  LLEEEEEELLHHhhhhhLHHHHHHHHHHHLLLLLEEEEEELLllllllllllllllLLHH
Query RGVTTIVWDPHEfgnvhGVDGVRWAAKAIENLPLRAILLAPScvpsapglerggadFDAA  163
ident                  | |               |                       |
Sbjct QALGASIAVQAR----aGRDETAFLLELACDEARIAAVVGWE--------------DLRA   85
DSSP  LLLLEEEEELLL----lLHHHHHHHHHHHLLLLLEEEEEELL--------------LLLL


DSSP  -HHHHHHLL---LLEEEEeEELL------HHHHhlLLHHHHHHHHHHHHHLLEEEELLL-
Query -ILADLLSW---PEIGGIaEIXN------XRGVieRDPRXSGIVQAGLAAEKLVCGHAR-  212
ident   ||            |               |   |      |    |           
Sbjct pQLAERVAEwrgTKLRGF-RHQLqdeadvRAFV--DDADFARGVAWLQANDYVYDVLVFe  142
DSSP  lLHHHHHHLlllLLEEEE-EELHhhlllhHHHH--HLHHHHHHHHHHHHLLLEEEELLLh


DSSP  LLLHhHHHHHHHLL---lLEEL--LLLL--------------HHHHHHHHHLL-LEEEEE
Query GLKNaDLNAFXAAG---vSSDH--ELVS--------------GEDLXAKLRAG-LTIELR  252
ident      |  || |                                 |            | 
Sbjct RQLP-DVQAFCARHdahwLVLDhaGKPAlaefdrddtalarwRAALRELAALPhVVCKLS  201
DSSP  HHHH-HHHHHHHHLllllEEEHhhHLLLhhhllllllhhhhhHHHHHHHHLLLlEEEEEL


DSSP  LLL--------------hHHHHHHHHHHHhhllLLLLEEEELL--LLLHhhhhHLLLhHH
Query GSH--------------dHLLPEFVAALNtlghLPQTVTLCTD--DVFPddllQGGGlDD  296
ident |                 |      |||      ||      |               | 
Sbjct GLVteadwrrglrasdlrHIEQCLDAALD--afGPQRLMFGSDwpVCLL----AASY-DE  254
DSSP  LLLllllllllllhhhhhHHHHHHHHHHH--hhLHHHEEELLLllHHHH----LLLH-HH


DSSP  HHHHHHHL--LLLHH-HHHHHHLHHHHHHHLLLlllllllllllleeeellllllleeee
Query VVRRLVRY--GLKPE-WALRAATLNAAQRLGRSdlgliaagrradivvfedlngfsarhv  353
ident |     |                  ||                                 
Sbjct VASLVERWaeSRLSAaERSALWGGTAARCYALP---------------------------  287
DSSP  HHHHHHHHhhHHLLHhHHHHHLLHHHHHHLLLL---------------------------


DSSP  eelleeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllle
Query lasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftq  413
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeellllllll
Query wgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshn  473
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  eeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhh
Query ltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedl  533
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query reavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                       
Sbjct ------------------------------------------------------  287
DSSP  ------------------------------------------------------


No 39: Query=3nqbA Sbjct=2dvtA Z-score=14.2

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHH---------------------hHLLLHHH-HH
Query srrdaaqvidaggayvSPGLIDTHXHIE---------------------sSXITPAA-YA   98
ident                   |      |                                  
Sbjct ----------------MQGKVALEEHFAipetlqdsagfvpgdywkelqhRLLDIQDtRL   44
DSSP  ----------------LLLEEEEEEEELlhhhhhhhlllllllhhhhhhhHHHLLLLhHH


DSSP  HHHHLLLEEEEEELLHH----------hhhHHLHHHHHHHHHHHLLLLLEEEEEELLLLL
Query AAVVARGVTTIVWDPHE----------fgnVHGVDGVRWAAKAIENLPLRAILLAPSCVP  148
ident     | |  |                              |      | |    |     
Sbjct KLMDAHGIETMILSLNApavqaipdrrkaiEIARRANDVLAEECAKRPDRFLAFAALPLQ  104
DSSP  HHHHHLLEEEEEEEELLlhhhhlllhhhhhHHHHHHHHHHHHHHHHLLLLEEEEELLLLL


DSSP  lllllllllllLLHHHHHHHHLLLLEEEEEEELL--------hHHHHlLLHHhHHHHHHH
Query sapglerggadFDAAILADLLSWPEIGGIAEIXN--------xRGVIeRDPRxSGIVQAG  200
ident                 |          |                                
Sbjct --------dpdAATEELQRCVNDLGFVGALVNGFsqegdgqtpLYYD-LPQY-RPFWGEV  154
DSSP  --------lhhHHHHHHHHHHHLLLLLEEEEELLlllllllllLLLL-LHHH-HHHHHHH


DSSP  HHHLLEEEEL----------------------------LLLLlhhhHHHHHH--------
Query LAAEKLVCGH----------------------------ARGLknadLNAFXA--------  224
ident          |                                         |        
Sbjct EKLDVPFYLHprnplpqdsriydghpwllgptwafaqeTAVH----ALRLMAsglfdehp  210
DSSP  HHHLLLEEEElllllhhhlhhhlllhhhlhhhlhhhhhHHHH----HHHHHHllhhhhll


DSSP  lLLLEEL-LLLLhhHHHH-------------------------hHHLLLEEEEELLLhhh
Query aGVSSDH-ELVSgeDLXA-------------------------kLRAGLTIELRGSHdhl  258
ident                                                   |   |     
Sbjct rLNIILGhMGEG--LPYMmwridhrnawvklpprypakrrfmdyFNENFHITTSGNF---  265
DSSP  lLLEEELhHHLL--HHHHhhhhhhllllllllllllllllhhhhHHHHEEEELLLLL---


DSSP  HHHHHHHHHHHllLLLLEEEELLLLLhhhhhhllLHHHHHHHHHHLLLLHHHHHHHHLHH
Query LPEFVAALNTLghLPQTVTLCTDDVFpddllqggGLDDVVRRLVRYGLKPEWALRAATLN  318
ident                      ||  |          |                      |
Sbjct RTQTLIDAILE-iGADRILFSTDWPF-------eNIDHASDWFNATSIAEADRVKIGRTN  317
DSSP  LHHHHHHHHLL-lLHHHEELLLLLLL-------lLHHHHHHHHHHLLLLHHHHHHHHLHH


DSSP  HHHHHLLLlllllllllllleeeellllllleeeeeelleeeeelleelllllllllhhh
Query AAQRLGRSdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvl  378
ident |                                                           
Sbjct ARRLFKLD----------------------------------------------------  325
DSSP  HHHHLLLL----------------------------------------------------


DSSP  llllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeee
Query kgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvt  438
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  llllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlllee
Query hrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggx  498
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  eeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhllll
Query avasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatl  558
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  lllllleelllleeelllleeellleeel
Query acnigphqtdxgiadvltgkvxespviev  587
ident                              
Sbjct -----------------------------  325
DSSP  -----------------------------


No 40: Query=3nqbA Sbjct=2gwgA Z-score=14.1

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeLEEEEEELHH--------------------------------
Query srrdaaqvidaggayvspGLIDTHXHIE--------------------------------   88
ident                     || | |                                  
Sbjct ------------------XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkis   42
DSSP  ------------------LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllll


DSSP  --hhlLLHH-HHHHHHHLLLEEEEEELLHH----hhHHHLHHHHHHHHHHHLLLlLEEEE
Query --ssxITPA-AYAAAVVARGVTTIVWDPHE----fgNVHGVDGVRWAAKAIENLpLRAIL  141
ident                   ||    |  |                              | 
Sbjct ddelqASIIeNQLKKXQERGSDLTVFSPRAgdfnvsSTWAAICNELCYRVSQLFpDNFIG  102
DSSP  hhhhhHHHHlLHHHHHHHHLLLEEEEELLLllhhhhHHHHHHHHHHHHHHHHHLlLLEEE


DSSP  EELLlLLLLLLlllllllLLHHHHHHHHLLLLEEEEEeELLH--------HHHHLLLhhH
Query LAPScVPSAPGlerggadFDAAILADLLSWPEIGGIAeIXNX--------RGVIERDprX  193
ident  |     |               |           |                   |    
Sbjct AAXL-PQSPGV----dpkTCIPELEKCVKEYGFVAIN-LNPDpsgghwtsPPLTDRI--W  154
DSSP  EEEL-LLLLLL----lhhHHHHHHHHHHHLLLLLEEE-ELLLllllllllLLLLLHH--H


DSSP  HHHHHHHHHHLLEEEEL----------LLLL---LHHHhhHHHH---lLLLEEL--LLLL
Query SGIVQAGLAAEKLVCGH----------ARGL---KNADlnAFXA---aGVSSDH--ELVS  235
ident   |       |     |                   |                       
Sbjct YPIYEKXVELEIPAXIHvstgahylnaDTTAfxqCVAG--DLFKdfpeLKFVIPhgGGAV  212
DSSP  HHHHHHHHHHLLLEEELlllllhhhhhHHHHhhhHHHL--LHHHhlllLLEEELhhHLLL


DSSP  HHH---------------hhhhhHLLLEEEEELLLHHHHHHHHHHHhhhllLLLLEEEEL
Query GED---------------lxaklRAGLTIELRGSHDHLLPEFVAALntlghLPQTVTLCT  280
ident                                   |                    |    
Sbjct PYHwgrfrglaqexkkplledhvLNNIFFDTCVYHQPGIDLLNTVI-----PVDNVLFAS  267
DSSP  HHHhhhhhhhhhhlllllhhhhlLLLEEEELLLLLHHHHHHHHHHL-----LHHHEELLL


DSSP  LLL--LHHH---hhHLLLhhHHHHHHHHL-LLLHHHHHHHHLHHHHHHHL--LLLLllll
Query DDV--FPDD---llQGGGldDVVRRLVRY-GLKPEWALRAATLNAAQRLG--RSDLglia  332
ident                     |  |       | ||        ||          |    
Sbjct EXIgaVRGIdprtgFYYD--DTKRYIEAStILTPEEKQQIYEGNARRVYPrlDAAL----  321
DSSP  LLLllLLLEellllEELL--LLHHHHHHLlLLLHHHHHHHHLHHHHHHLHhhHHHH----


DSSP  lLLLLleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhh
Query aGRRAdivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandf  392
ident                                                             
Sbjct -KAKG-------------------------------------------------------  325
DSSP  -HHHH-------------------------------------------------------


DSSP  llllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeee
Query lvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgf  452
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  eellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeel
Query ltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailpl  512
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellllee
Query plsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgia  572
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  elllleeellleeel
Query dvltgkvxespviev  587
ident                
Sbjct -----------kleh  329
DSSP  -----------hhll


No 41: Query=3nqbA Sbjct=4mupB Z-score=14.1

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHH---------------hhLLLHHHHHHHHHLLL
Query srrdaaqvidaggayvSPGLIDTHXHIE---------------ssXITPAAYAAAVVARG  105
ident                   |  ||  |                      |  |       |
Sbjct --lvrklsgtapnpafPRGAVDTQMHMYlpgypalpggpglppgaLPGPEDYRRLMQWLG   58
DSSP  --llllllllllllllLLLLEELLLLLLlllllllllllllllllLLLHHHHHHHHHHHL


DSSP  EEEEEELLHHHHHhhLHHHHHHHHHHHLllllEEEEEELLLllllllllllllllLHHH-
Query VTTIVWDPHEFGNvhGVDGVRWAAKAIEnlplRAILLAPSCvpsapglerggadfDAAI-  164
ident                                  |                          
Sbjct IDRVIITQGNAHQ-rDNGNTLACVAEMG---eAAHAVVIID-------------aTTTEk  101
DSSP  LLEEEEELLHHHL-lLLHHHHHHHHHHH---hHEEEEELLL-------------lLLLHh


DSSP  HHHHHLLLLEEEEeEELL-------HHHHhlllhhhHHHHHHHHHHLLEEEELLLL-LLH
Query LADLLSWPEIGGIaEIXN-------XRGVierdprxSGIVQAGLAAEKLVCGHARG-LKN  216
ident     |      |   |                            ||   |     |    
Sbjct DMEKLTAAGTVGA-RIMDlpggavnLSEL-------DAVDERAHAADWMVAVQFDGnGLL  153
DSSP  HHHHHHHLLEEEE-EEELlllllllHHHH-------HHHHHHHHHLLLEEEEELLHhHHH


DSSP  HHHHHHHHLL-lLEEL--LLLL------hhHHHHHHHLL----LEEEEELLL--------
Query ADLNAFXAAG-vSSDH--ELVS------geDLXAKLRAG----LTIELRGSH--------  255
ident   |                              | |       |     |          
Sbjct DHLPRLQKIRsrWVFDhhGKFFkgirtdgpEMAALLKLIdrgnLWFKFAGVYessrkswp  213
DSSP  HHHHHHHLLLleEEELhhHHLLlllllllhHHHHHHHHHhhllEEEEELLHHhlllllll


DSSP  -hHHHHHHHHHHHhhlLLLLLEEEELLL-LLHH---hhHHLLlhHHHHHHHHHLlLLHHH
Query -dHLLPEFVAALNtlgHLPQTVTLCTDD-VFPD---dlLQGGglDDVVRRLVRYgLKPEW  310
ident                 | |      |                                  
Sbjct yaDVAAFSRVIAA---HAPERIVWGTNWpHNSVretaaYPDD--ARLAELTLGWlPDEAA  268
DSSP  lhHHHHHHHHHHH---HLHHHEEELLLLlLLLLllhhhLLLH--HHHHHHHHLLlLLHHH


DSSP  HHHHHLHHHHHHHLLLLLlllllllllleeeellllllleeeeeelleeeeelleellll
Query ALRAATLNAAQRLGRSDLgliaagrradivvfedlngfsarhvlasgravaeggrxlvdi  370
ident   ||   |       |                                            
Sbjct RHRALVENPEALFKLSPV------------------------------------------  286
DSSP  HHHHHLHHHHHHHLLLLL------------------------------------------


DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll
Query ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh
Query gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh
Query vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllleelllleeelllleeellleeel
Query kacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                      
Sbjct -------------------------------------  286
DSSP  -------------------------------------


No 42: Query=3nqbA Sbjct=2qpxA Z-score=13.5

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELhhHHLL----------------------------
Query srrdaaqvidaggayvSPGLIDTHXHieSSXI----------------------------   92
ident                    | | | |                                  
Sbjct ------gxddlsefvdQVPLLDHHCH--FLIDgkvpnrddrlaqvsteadkdypladtkn   52
DSSP  ------lllllhhhhhHLLEEEEEEL--LLLLlllllhhhhhhhhlllllllllhhhhll


DSSP  -----------------------------lhHHHHHHHHLLLEEEEEELLHHHhhhhlhh
Query -----------------------------tpAAYAAAVVARGVTTIVWDPHEFgnvhgvd  123
ident                                                 |           
Sbjct rlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFV-----pd  107
DSSP  lhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLL-----ll


DSSP  hhhHHHHHHLLL-LLEEEEEELLLL-LLLLLLLL----lllllLHHHHHHHHLLLlEEEE
Query gvrWAAKAIENL-PLRAILLAPSCV-PSAPGLER----ggadfDAAILADLLSWPeIGGI  177
ident            |                   ||                         | 
Sbjct dpiLDLDQTAELvGIPVKAIYRLEThAEDFXLEHdnfaawwqaFSNDVKQAKAHG-FVGF  166
DSSP  lllLLHHHHHHHhLLLEEEEEEHHHhHHHHHLLLllhhhhhhhHHHHHHLLLLLL-LLLE


DSSP  EeELLH------------------------------hhhhLLLHHHHHHHHHHHHHLLEE
Query AeIXNX------------------------------rgviERDPRXSGIVQAGLAAEKLV  207
ident                                           |           |     
Sbjct X-SIAAyrvglhlepvnvieaaagfdtwkhsgekrltskpLIDYXLYHVAPFIIAQDXPL  225
DSSP  E-ELHHhhlllllllllhhhhhhhhhhhhhhlllllllhhHHHHHHHHHHHHHHHHLLLE


DSSP  EELLL-----------LLLHhhHHHHHHL-----LLLEELLLLLhhHHHHHHHLL-----
Query CGHAR-----------GLKNadLNAFXAA-----GVSSDHELVSgeDLXAKLRAG-----  246
ident   |                         |                               
Sbjct QFHVGygdadtdxylgNPLL--XRDYLKAftkkgLKVVLLHCYP--YHREAGYLAsvfpn  281
DSSP  EEEELlllllllhhhlLHHH--HHHHHHHhhhhlLLEEEEELLL--LHHHHHHHHhhlll


DSSP  LEEEEE--LLLH--HHHHHHHHHHHhhllLLLLEEEELLLLLHHHHhhlLLHHHHHHHHH
Query LTIELR--GSHD--HLLPEFVAALNtlghLPQTVTLCTDDVFPDDLlqgGGLDDVVRRLV  302
ident |                  |  |               |          |          
Sbjct LYFDISllDNLGpsGASRVFNEAVE--laPYTRILFASDASTYPEX--yGLAARQFKQAL  337
DSSP  EEEELLlhHHHLhhHHHHHHHHHLL--llLHHHEELLLLLLLLHHH--hHHHHHHHHHHH


DSSP  HLLL----------lHHHHHHHHLHHHHHHHLLLLLLLLllllllleeeellllllleee
Query RYGL----------kPEWALRAATLNAAQRLGRSDLGLIaagrradivvfedlngfsarh  352
ident                  |         |                                
Sbjct VAHFnqlpfvdlaqkKAWINAICWQTSAKLYHQERELRV---------------------  376
DSSP  HHHHhllllllhhhhHHHHHHHHLHHHHHHLLLHHHHLL---------------------


DSSP  eeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeelllll
Query vlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprft  412
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllll
Query qwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdsh  472
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  leeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhh
Query nltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafed  532
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query lreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                        
Sbjct -------------------------------------------------------  376
DSSP  -------------------------------------------------------


No 43: Query=3nqbA Sbjct=4qrnA Z-score=13.3

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeellllEEEELEEEEEELHH--------------------------------
Query srrdaaqvidaggaYVSPGLIDTHXHIE--------------------------------   88
ident                     | |                                     
Sbjct ----smtqdlktggEQGYLRIATEEAFAtreiidvylrmirdgtadkgmvslwgfyaqsp   56
DSSP  ----llllllllllLLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhhhhhhhll


DSSP  --------hHLLLHH-HHHHHHHLLLEEEEEELLHH----------hhHHHLHHHHHHHH
Query --------sSXITPA-AYAAAVVARGVTTIVWDPHE----------fgNVHGVDGVRWAA  129
ident                    |   | |                                 |
Sbjct seratqileRLLDLGeRRIADMDATGIDKAILALTSpgvqplhdldeaRTLATRANDTLA  116
DSSP  lhhhhhhhhHHHLLLhHHHHHHHHLLLLEEEEEELLllllllllhhhhHHHHHHHHHHHH


DSSP  HHHLLLLLEEEEEELLLlllllllllllllLLHHHHHHHHLL----LLEEEEEEELL--h
Query KAIENLPLRAILLAPSCvpsapglerggadFDAAILADLLSW----PEIGGIAEIXN--x  183
ident  |    | | |                    |    |             ||        
Sbjct DACQKYPDRFIGMGTVA------------pQDPEWSAREIHRgareLGFKGIQINSHtqg  164
DSSP  HHHHHLLLLEEELLLLL------------lLLHHHHHHHHHHhhhlLLLLLEEELLLlll


DSSP  HHHHlLLHHhHHHHHHHHHHLLEEEEL---------------------------LLLLlh
Query RGVIeRDPRxSGIVQAGLAAEKLVCGH---------------------------ARGLkn  216
ident |           |  |          |                                 
Sbjct RYLD-EEFF-DPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgfgveTGMH-l  221
DSSP  LLLL-LHHH-HHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhhhhhHHHH-h


DSSP  hHHHH--HHHL---LLLEEL--LLLLHH--------------------------hhhHHH
Query aDLNA--FXAA---GVSSDH--ELVSGE--------------------------dlxAKL  243
ident   |                                                        |
Sbjct lRLITigIFDKypsLQIMVGhmGEALPYwlyrldymhqagvrsqryermkplkktieGYL  281
DSSP  hHHHHhlHHHHlllLLEEELhhHHLHHHhhhhhhhhhhhhhhlllllllllllllhhHHH


DSSP  HLLLEEEEElLLHHhHHHHHHHHHhhllLLLLEEEELLLLLhhHHHHLllhhhhHHHHHH
Query RAGLTIELRgSHDHlLPEFVAALNtlghLPQTVTLCTDDVFpdDLLQGgglddvVRRLVR  303
ident                 |               |    |                ||    
Sbjct KSNVLVTNS-GVAW-EPAIKFCQQ--vmGEDRVMYAMDYPY--QYVAD-----eVRAMDA  330
DSSP  HHLEEEELL-LLLL-HHHHHHHHH--hhLHHHEELLLLLLL--LLLHH-----hHHHHHL


DSSP  LLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllllleeeeeelleeeeel
Query YGLKPEWALRAATLNAAQRLGRsdlgliaagrradivvfedlngfsarhvlasgravaeg  363
ident               ||                                            
Sbjct MDMSAQTKKKFFQTNAEKWFKL--------------------------------------  352
DSSP  LLLLHHHHHHHHLHHHHHHLLL--------------------------------------


DSSP  leelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeel
Query grxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkd  423
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  leellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhh
Query gfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagd  483
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlll
Query xalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvew  543
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhhlllllllllleelllleeelllleeellleeel
Query qppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                             
Sbjct --------------------------------------------  352
DSSP  --------------------------------------------


No 44: Query=3nqbA Sbjct=4ofcA Z-score=13.1

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeLEEEEEELHH--------------------------------
Query srrdaaqvidaggayvspGLIDTHXHIE--------------------------------   88
ident                     || | ||                                 
Sbjct ------------------MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeakllkd   42
DSSP  ------------------LLEEEEEELLllllllhhhhhllllleeeeeeelleeeeeel


DSSP  --------hHLLLHHHHHHHHHLLLEEEEEELLH-HHHH---------hHLHHHHHHHHH
Query --------sSXITPAAYAAAVVARGVTTIVWDPH-EFGN---------vHGVDGVRWAAK  130
ident              |          |||                               | 
Sbjct gkvfrvvreNCWDPEVRIREMDQKGVTVQALSTVpVMFSywakpedtlnLCQLLNNDLAS  102
DSSP  leeeeeeehHHLLHHHHHHHHHHHLLLEEEEELLhHHHLllllhhhhhhHHHHHHHHHHH


DSSP  HHLLLlLEEEEEELLLlllllllllllllLLHHHHHHHHLL----LLEEEEEEELL--hH
Query AIENLpLRAILLAPSCvpsapglerggadFDAAILADLLSW----PEIGGIAEIXN--xR  184
ident        |   |                                     |          
Sbjct TVVSYpRRFVGLGTLP------------mQAPELAVKEMERcvkeLGFPGVQIGTHvneW  150
DSSP  HHHHLlLLEEEEELLL------------lLLHHHHHHHHHHhhhlLLLLEEEEELEellE


DSSP  HHHlLLHHhHHHHHHHHHHLLEEEEL------------------------LLLLlhhHHH
Query GVIeRDPRxSGIVQAGLAAEKLVCGH------------------------ARGLknaDLN  220
ident               |          |                                  
Sbjct DLN-AQEL-FPVYAAAERLKCSLFVHpwdmqmdgrmakywlpwlvgmpaeTTIA-icSMI  207
DSSP  ELL-LHHH-HHHHHHHHHHLLEEEEElllllllhhhhlllhhhhlhhhhhHHHH-hhHHH


DSSP  H--HHHLL---lLEEL-LLLLhhHHHH------------------------hhHLLLEEE
Query A--FXAAG---vSSDH-ELVSgeDLXA------------------------klRAGLTIE  250
ident                                                             
Sbjct MggVFEKFpklkVCFAhGGGA--FPFTvgrishgfsmrpdlcaqdnpmnpkkyLGSFYTD  265
DSSP  LllHHHHLllllEEELhHHLL--HHHHhhhhhhhhhhlhhhhlllllllhhhhLLLLEEE


DSSP  EElllhhHHHHHHHHHhhhllLLLLEEEELLLLLHhhhhhlllhhHHHHHHHHLL-LLHH
Query LRgshdhLLPEFVAALntlghLPQTVTLCTDDVFPddllqgggldDVVRRLVRYG-LKPE  309
ident          |     |         | | ||  ||                        |
Sbjct AL----vHDPLSLKLL-tdviGKDKVILGTDYPFP------lgelEPGKLIESMEeFDEE  314
DSSP  LL----lLLHHHHHHH-hhhhLLLLEELLLLLLLL------llllLLLHHHHHLLlLLHH


DSSP  HHHHHHLHHHHHHHLLLllllllllLLLLeeeellllllleeeeeelleeeeelleelll
Query WALRAATLNAAQRLGRSdlgliaagRRADivvfedlngfsarhvlasgravaeggrxlvd  369
ident         ||   ||          |                                  
Sbjct TKNKLKAGNALAFLGLE--------RKQF-------------------------------  335
DSSP  HHHHHHLHHHHHHHLLL--------HHHL-------------------------------


DSSP  llllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleelll
Query iptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvpp  429
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  lleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhh
Query egatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaan  489
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  hhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllll
Query avigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylv  549
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllllllllleelllleeelllleeellleeel
Query fkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                       
Sbjct --------------------------------------  335
DSSP  --------------------------------------


No 45: Query=3nqbA Sbjct=1itqA Z-score=12.9

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleEEELEEEEEELHHHHL------------------llhhhHHHHHH
Query srrdaaqvidaggayVSPGLIDTHXHIESSX------------------itpaaYAAAVV  102
ident                     || |                                    
Sbjct ----dffrdeaerimRDSPVIDGHNDLPWQLldmfnnrlqderanlttlagthtNIPKLR   56
DSSP  ----lhhhhhhhhhhLLLLEEEEEELHHHHHhhhhllllllhhhllllllllllLHHHHH


DSSP  LLLEEEEEELLHH------hhHHHL-HHHHHHHHHHH---LLLL----------------
Query ARGVTTIVWDPHE------fgNVHG-VDGVRWAAKAI---ENLP----------------  136
ident |  |    |             |                                     
Sbjct AGFVGGQFWSVYTpcdtqnkdAVRRtLEQMDVVHRMCrmyPETFlyvtssagirqafreg  116
DSSP  HLLEEEEEEEELLlhhhllllHHHHhHHHHHHHHHHHhhlLLLEeelllhhhhhhhhhll


DSSP  -LEEEEEELLLLLllllllllllLLLHHHHHHHHLLlLEEEeEEEL------LHHH----
Query -LRAILLAPSCVPsapglerggaDFDAAILADLLSWpEIGGiAEIX------NXRG----  185
ident                        |     |  |                           
Sbjct kVASLIGVEGGHS---------iDSSLGVLRALYQL-GMRY-LTLThscntpWADNwlvd  165
DSSP  lEEEEEEEELHHH---------lLLLHHHHHHHHHL-LEEE-EELLllllllLLLLhhhl


DSSP  --------hHLLLHhHHHHHHHHHHHLLEEEELLLLLlhHHHHHHHHLL--lLEEL-LLL
Query --------vIERDPrXSGIVQAGLAAEKLVCGHARGLknADLNAFXAAG--vSSDH-ELV  234
ident                    |        |          |   |                
Sbjct tgdsepqsqGLSPF-GQRVVKELNRLGVLIDLAHVSV--ATMKATLQLSrapVIFShSSA  222
DSSP  lllllllllLLLHH-HHHHHHHHHHHLLEEELLLLLH--HHHHHHHHHLlllLEELlLLL


DSSP  LHH------HHHHHHHLL----LEEEEELLL----------HHHHHHHHHHHHHHllLLL
Query SGE------DLXAKLRAG----LTIELRGSH----------DHLLPEFVAALNTLghLPQ  274
ident               ||                                            
Sbjct YSVcasrrnVPDDVLRLVkqtdSLVMVNFYNnyisctnkanLSQVADHLDHIKEV-aGAR  281
DSSP  LLLllllllLLHHHHHHHhhhlLEEEELLLHhhhlllllllHHHHHHHHHHHHHH-lLHH


DSSP  LEEEELLLL-LHHH-hhHLLLhhHHHHHHHHLL---LLHHHHHHHHLHHHHHHHLlllll
Query TVTLCTDDV-FPDD-llQGGGldDVVRRLVRYG---LKPEWALRAATLNAAQRLGrsdlg  329
ident  |    |    |                                |   |           
Sbjct AVGFGGDFDgVPRVpegLEDV-sKYPDLIAELLrrnWTEAEVKGALADNLLRVFE-----  335
DSSP  HEEELLLLLlLLLLlllLLLL-lLHHHHHHHHHhllLLHHHHHHHHLHHHHHHHH-----


DSSP  llllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllllh
Query liaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxa  389
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  hhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllLLLLllee
Query ndflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhGXAEpttk  449
ident                                                             
Sbjct ----------------------------aveqasnltqapeeepipldqlggSCRT----  363
DSSP  ----------------------------hhhhllllllllllllllhhhlllLLLL----


DSSP  eeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeee
Query tgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtai  509
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  eelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelll
Query lplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdx  569
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  leeellllEEELlleeel
Query giadvltgKVXEspviev  587
ident                   
Sbjct ------hyGYSS------  369
DSSP  ------llLLLL------


No 46: Query=3nqbA Sbjct=4dziC Z-score=12.0

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeellllEEEELEEEEEELHH--------------------------------
Query srrdaaqvidaggaYVSPGLIDTHXHIE--------------------------------   88
ident                     ||   |                                  
Sbjct --------------ALNYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavi   46
DSSP  --------------LLLLLEEEEEEELLlllllllllllhhhlllleeeeelllleeeee


DSSP  ------------------------------------------------hhLLLHHHHHHH
Query ------------------------------------------------ssXITPAAYAAA  100
ident                                                        |  | 
Sbjct gdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAV  106
DSSP  lleellllllllllleelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHH


DSSP  HHLLLEEEEEELLHHH-------------hhhHLHHHHHHHHHHH---LLLLlEEEEEEL
Query VVARGVTTIVWDPHEF-------------gnvHGVDGVRWAAKAI---ENLPlRAILLAP  144
ident        |    |                          |             | |    
Sbjct MDEQDIETAFMLPTFGcgveealkhdieatmaSVHAFNLWLDEDWgfdRPDH-RIIAAPI  165
DSSP  HHHHLEEEEEEELLHHhhhhhhllllhhhhhhHHHHHHHHHHHHLlllLLLL-LEEELLL


DSSP  LLlllllllllllllLLHHHHHHHHLLLlEEEEEEELLH-------HHHHlLLHHhHHHH
Query SCvpsapglerggadFDAAILADLLSWPeIGGIAEIXNX-------RGVIeRDPRxSGIV  197
ident                         |                     |             
Sbjct VS--------ladptRAVEEVDFVLARG-AKLVLVRPAPvpglvkpRSLG-DRSH-DPVW  214
DSSP  LL--------lllhhHHHHHHHHHHHLL-LLLEELLLLLlllllllLLLL-LHHH-HHHH


DSSP  HHHHHHLLEEEEL----------------------------LLLLlhhhHHHH--HHLL-
Query QAGLAAEKLVCGH----------------------------ARGLknadLNAF--XAAG-  226
ident      |   |  |                            |                  
Sbjct ARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllddrAIHD---tMASMivHGVFt  271
DSSP  HHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhllhHHHH---hHHHHhhLLHHh


DSSP  -----lLEEL-LLLLhhHHHH----------------------hHHLLLEEEEellLHHH
Query -----vSSDH-ELVSgeDLXA----------------------kLRAGLTIELrgsHDHL  258
ident                                             ||    |         
Sbjct rhpklkAVSIeNGSY--FVHRlikrlkkaantqpqyfpedpveqLRNNVWIAP---YYED  326
DSSP  hlllllEEEElLLLL--HHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEELL---LLLL


DSSP  hhHHHHHHHhhllLLLLEEEELLLLLHhhhhhlLLHHHHhHHHHHlLLLHHHHHHHHLHH
Query lpEFVAALNtlghLPQTVTLCTDDVFPddllqgGGLDDVvRRLVRyGLKPEWALRAATLN  318
ident                       |                       |            |
Sbjct --DLPELAR--viGVDKILFGSDWPHG---eglASPVSF-TAELK-GFSESDIRKIMRDN  377
DSSP  --LHHHHHH--hhLHHHLLLLLLLLLL---lllLLHHHH-HHHHL-LLLHHHHHHHHLHH


DSSP  HHHHHLLLlllllllllllleeeellllllleeeeeelleeeeelleelllllllllhhh
Query AAQRLGRSdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvl  378
ident |   ||                                                      
Sbjct ALDLLGVQ----------------------------------------------------  385
DSSP  HHHHHLLL----------------------------------------------------


DSSP  llllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeee
Query kgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvt  438
ident                                                             
Sbjct ------------------------------------------------------------  385
DSSP  ------------------------------------------------------------


DSSP  llllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlllee
Query hrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggx  498
ident                                                             
Sbjct ------------------------------------------------------------  385
DSSP  ------------------------------------------------------------


DSSP  eeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhllll
Query avasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatl  558
ident                                                             
Sbjct ------------------------------------------------------------  385
DSSP  ------------------------------------------------------------


DSSP  lllllleelllleeelllleeellleeel
Query acnigphqtdxgiadvltgkvxespviev  587
ident                              
Sbjct --------------------------vgs  388
DSSP  --------------------------lll


No 47: Query=3nqbA Sbjct=3qy6A Z-score=12.0

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeelEEEEEELHH-----HHLL--LHHHHHHHHHLLLEEEEEELL
Query srrdaaqvidaggayvspgLIDTHXHIE-----SSXI--TPAAYAAAVVARGVTTIVWDP  113
ident                     || | ||                 | | |  |  ||   |
Sbjct -------------------MIDIHCHILpamddGAGDsaDSIEMARAAVRQGIRTIIATP   41
DSSP  -------------------LEELLLLLLlllllLLLLhhHHHHHHHHHHHLLLLEEELLL


DSSP  H---hhHHHHlHHHHHHHHHHHLLL-----LLEEEEEellllllllllllllllllhhhh
Query H---efGNVHgVDGVRWAAKAIENL-----PLRAILLapscvpsapglerggadfdaail  165
ident |                |      |     ||                            
Sbjct HhnngvYKNEpAAVREAADQLNKRLikediPLHVLPG-----------------------   78
DSSP  EellllLLLLhHHHHHHHHHHHHHHhhlllLLEEELL-----------------------


DSSP  hhhhlllleeeeEEELLHHHhhlllhhHHHHHHHHH----hhlLEEEELLL--LLLHhHH
Query adllswpeiggiAEIXNXRGvierdprXSGIVQAGL----aaeKLVCGHAR--GLKNaDL  219
ident              ||                            |                
Sbjct ------------QEIRIYGE-------VEQDLAKRQllslndtKYILIEFPfdHVPR-YA  118
DSSP  ------------LEEELLLL-------HHHHHHLLLlllhhhlLEEEEELLllLLLL-LH


DSSP  HHHHHLL-----lLEELLLL-------lHHHHHHHHHLLLEEEEELLL---------HHH
Query NAFXAAG-----vSSDHELV-------sGEDLXAKLRAGLTIELRGSH---------DHL  258
ident                                |      |                     
Sbjct EQLFYDLqlkgyiPVIAHPErnreirenPSLLYHLVEKGAASQITSGSlagifgkqlKAF  178
DSSP  HHHHHHHhhllleEEEELHHhlhhhhhlLHHHHHHHHLLLEEEEEHHHhlllllhhhHHH


DSSP  HHHHHHHHhhhllllllEEEELLLLL-HHHHhhlLLHHHHHHHHHHlLLLHHHHHHHHlH
Query LPEFVAALntlghlpqtVTLCTDDVF-PDDLlqgGGLDDVVRRLVRyGLKPEWALRAAtL  317
ident     | |               |                    |       |        
Sbjct SLRLVEAN-------liHFVASDAHNvKTRN---FHTQEALYVLEK-EFGSELPYMLT-E  226
DSSP  HHHHHHLL-------llLEEELLLLLlLLLL---LLHHHHHHHHHH-HHLLHHHHHHH-H


DSSP  HHHHHHLLLlllllllllllleeeellllllleeeeeelleeeeelleelllllllllhh
Query NAAQRLGRSdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttv  377
ident ||   |                                                      
Sbjct NAELLLRNQ---------------------------------------------------  235
DSSP  HHHHHHLLL---------------------------------------------------


DSSP  hllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeee
Query lkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisv  437
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  ellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllle
Query thrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtggg  497
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  eeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlll
Query xavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgat  557
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  llllllleelllleeelllleeellleeel
Query lacnigphqtdxgiadvltgkvxespviev  587
ident                               
Sbjct ------------------tifrqppqpvkr  247
DSSP  ------------------llllllllllll


No 48: Query=3nqbA Sbjct=1j5sA Z-score=11.8

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleEELLlllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtLVDVvtgelrpadigivgaliasvhepa   60
ident                                    |                        
Sbjct --------------hmflgedylltnraavrlFNEV------------------------   22
DSSP  --------------llllllllllllhhhhhhHHHH------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHHhhlLLHH-------------------------
Query srrdaaqvidaggayvSPGLIDTHXHIEssxITPA-------------------------   95
ident                      | | |                                  
Sbjct ---------------kDLPIVDPHNHLD--aKDIVenkpwndiwevegatdhyvwelmrr   65
DSSP  ---------------lLLLEEELLLLLL--hHHHHhllllllhhhhhllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   95
ident                                                             
Sbjct cgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiw  125
DSSP  llllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhh


DSSP  ----------HHHHHHHLLLEEEEEELLHhhhhhhlHHHHhHHHHHHLL--LLLEEEEEE
Query ----------AYAAAVVARGVTTIVWDPHefgnvhgVDGVrWAAKAIEN--LPLRAILLA  143
ident                     |               |                       
Sbjct eetkkklpemTPQKLLRDMKVEILCTTDD------pVSTL-EHHRKAKEavEGVTILPTW  178
DSSP  hhhhhhllllLHHHHHHHLLEEEEELLLL------lLLLL-HHHHHHHHhlLLLEEELLL


DSSP  LLLLLLLLLLLL-LLLL---------------lLHHHHHHHHL---LLLEEEEeEELLHh
Query PSCVPSAPGLER-GGAD---------------fDAAILADLLS---WPEIGGIaEIXNXr  184
ident           |                          |                      
Sbjct RPDRAMNVDKEGwREYVekmgerygedtstldgFLNALWKSHEhfkEHGCVAS-DHALLe  237
DSSP  LLHHHHLLLLLLhHHHHhhhhhhhllllllhhhHHHHHHHHHHhhhLLLLLEE-EEEELl


DSSP  hhHLLL----------------------------HHHHHHHHHHHHHLLEEEELLL----
Query gvIERD----------------------------PRXSGIVQAGLAAEKLVCGHAR----  212
ident                                                      |      
Sbjct psVYYVdenraravhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHIGalrd  297
DSSP  llLLLLlhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEELeell


DSSP  ---------------------LLLHHHHHHHHHLL----lLEELLLLLhHHHHHHHHLL-
Query ---------------------GLKNADLNAFXAAG----vSSDHELVSgEDLXAKLRAG-  246
ident                            |  |              |     |        
Sbjct yrdslfktlgpdsggdistnfLRIAEGLRYFLNEFdgklkIVLYVLDP-THLPTISTIAr  356
DSSP  llhhhhhhlllllllleelllLLHHHHHHHHHHHLlllllEEEEELLH-HHHHHHHHHHh


DSSP  ----LEEEEE--lLLHH-HHHHHHHHHHHHLLLLLLEEEELLLLLhhhhhhlLLHHHHHH
Query ----LTIELR--gSHDH-LLPEFVAALNTLGHLPQTVTLCTDDVFpddllqgGGLDDVVR  299
ident                           |     |       ||                  
Sbjct afpnVYVGAPwwfNDSPfGMEMHLKYLASVDLLYNLAGMVTDSRK------lLSFGSRTE  410
DSSP  hlllEEELLLlllLLLHhHHHHHHHHHHLLLLHHHLLLLLLLLLL------lLHHHHHHH


DSSP  HHHHLLLL----------------hHHHHHHHLHHHHHHHLlllllllllllllleeeel
Query RLVRYGLK----------------pEWALRAATLNAAQRLGrsdlgliaagrradivvfe  343
ident    |                     |                                  
Sbjct MFRRVLSNvvgemvekgqipikearELVKHVSYDGPKALFF-------------------  451
DSSP  HHHHHHHHhhhhhhhlllllhhhhhHHHHHHHLHHHHHHHL-------------------


DSSP  lllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeee
Query dlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrl  403
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  eeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeelllllllee
Query atidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngaf  463
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  eelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllh
Query attvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapl  523
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeelll
Query eevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxesp  583
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  eeel
Query viev  587
ident     
Sbjct ----  451
DSSP  ----


No 49: Query=3nqbA Sbjct=1v77A Z-score=11.3

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeELEEEEEELHHHHlllhhhhhHHHHLLlEEEEEELLHhhhhhh
Query srrdaaqvidaggayvsPGLIDTHXHIESSxitpaayaAAVVARgVTTIVWDPHefgnvh  120
ident                     |                            |          
Sbjct -----------------VKFIEMDIRDKEA-------yELAKEW-FDEVVVSIK-fneev   34
DSSP  -----------------LLLEEEEELLHHH-------hHHHHHH-LLEEEEEEE-ellll


DSSP  LHHHHHHHHHHHllllleeEEEEllllllllllllllllllhhhhhhhhlllleeeeEEE
Query GVDGVRWAAKAIenlplraILLApscvpsapglerggadfdaailadllswpeiggiAEI  180
ident      | | |                                                  
Sbjct DKEKLREARKEY------gKVAI----------------------------------LLS   54
DSSP  LHHHHHHHHHHH------lLEEE----------------------------------EEE


DSSP  LLHHHHhlllhhhHHHHHHHHhhLLEEEELLLLLLhhHHHHHHHLLLLEELLLLL---HH
Query XNXRGVierdprxSGIVQAGLaaEKLVCGHARGLKnaDLNAFXAAGVSSDHELVS---GE  237
ident                 ||       |       |           ||             
Sbjct NPKPSL------vRDTVQKFK--SYLIYVESNDLR--VIRYSIEKGVDAIISPWVnrkDP  104
DSSP  LLLHHH------hHHHHHHLL--LLEEEEELLLHH--HHHHHHHLLLLEEELLLLlllLL


DSSP  HHH-hHHHLL----LEEEEELLLH---------HHHHHHHHHHHH-hLLLLlLEEEELLL
Query DLX-aKLRAG----LTIELRGSHD---------HLLPEFVAALNT-lGHLPqTVTLCTDD  282
ident                                   ||     |             |    
Sbjct GIDhvLAKLMvkknVALGFSLRPLlysnpyeraNLLRFMMKAWKLveKYKV-RRFLTSSA  163
DSSP  LLLhhHHHHHhhhlLEEEEELHHHhhllhhhhhHHHHHHHHHHHHhhHHLL-LEEEELLL


DSSP  LLHHHhhhlLLHH-HHHHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleee
Query VFPDDllqgGGLD-DVVRRLVRYGLKPEWALRAATLNAAQRLGrsdlgliaagrradivv  341
ident     |         |     |  |     |           |                  
Sbjct QEKWD----VRYPrDLISLGVVIGMEIPQAKASISMYPEIILK-----------------  202
DSSP  LLHHH----LLLHhHHHHHHHHLLLLHHHHHHLLLHHHHHHHL-----------------


DSSP  ellllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhlllllllee
Query fedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakv  401
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  eeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeelllllll
Query rlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwng  461
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  eeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeellllllllll
Query afattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsda  521
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeel
Query pleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxe  581
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  lleeel
Query spviev  587
ident       
Sbjct ------  202
DSSP  ------


No 50: Query=3nqbA Sbjct=2a3lA Z-score=11.1

back to top
DSSP  --------------------------------------------------------lLHH
Query --------------------------------------------------------ePAD    4
ident                                                          |  
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvaPWE   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhlllllllllLLL


DSSP  HL------------------------------------------------------lhhh
Query LN------------------------------------------------------ddtl   10
ident                                                             
Sbjct KEepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  LLlllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  hhhhhhhhhlllleeeeeelleeelllllLEEELeeeeelleeeeeellllllleeeeee
Query raravaaargdqrfdvlitggtlvdvvtgELRPAdigivgaliasvhepasrrdaaqvid   70
ident                                  |                          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKSA--------------------------  154
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHHL--------------------------


DSSP  llLLEE--EELEEEEEELHHHHL-------------------------------------
Query agGAYV--SPGLIDTHXHIESSX-------------------------------------   91
ident              ||| |                                          
Sbjct --PHRDfyNVRKVDTHVHHSACMnqkhllrfiksklrkepdevvifrdgtyltlrevfes  212
DSSP  --LLLLllLLLEEEEEEELLLLLlhhhhhhhhhhhhhllllllleeelleeelhhhhhhh


DSSP  ---------------------------------------------------------lLH
Query ---------------------------------------------------------iTP   94
ident                                                             
Sbjct ldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeIT  272
DSSP  hlllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHH


DSSP  HHHHHHHH-LLLEeEEEELLH-hhhhhHLHH-HHHHH-hHHHLllLLEEEEEELLLllLL
Query AAYAAAVV-ARGVtTIVWDPH-efgnvHGVD-GVRWA-aKAIEnlPLRAILLAPSCvpSA  150
ident                               |    |               |        
Sbjct KQVFSDLEaSKYQ-MAEYRISiygrkmSEWDqLASWIvnNDLY--SENVVWLIQLP--RL  327
DSSP  HHHHHHHLlLLLE-EEEEEEEllllllLHHHhHHHHHhlLLLL--LLLEEEEEEEE--LL


DSSP  LLLLL-----lllllLHHHHHH---------------hhlLLLEEEEeEELL--------
Query PGLER-----ggadfDAAILAD---------------llsWPEIGGIaEIXN--------  182
ident                                              |              
Sbjct YNIYKdmgivtsfqnILDNIFIplfeatvdpdshpqlhvfLKQVVGF-DLVDdeskperr  386
DSSP  HHHHLllllllllhhHHHHHLLhhhhhhhlhhhllllhhhHLLEEEE-EEELllllllll


DSSP  ------------------HHHHhlllhhHHHHHHHHHHHL----------LEEEELL-LL
Query ------------------XRGVierdprXSGIVQAGLAAE----------KLVCGHA-RG  213
ident                                                        |    
Sbjct ptkhmptpaqwtnafnpaFSYY------VYYCYANLYVLNklreskgmttITLRPHSgEA  440
DSSP  llllllllllllllllllHHHH------HHHHHHHHHHHHhhhlllllllLEELLLLlLL


DSSP  LLHHHHHHHHHlLLLEELLLLlhhHHHH---hHHLL----LEEEEE-LLLH----HHHHH
Query LKNADLNAFXAaGVSSDHELVsgeDLXA---kLRAG----LTIELR-GSHD----HLLPE  261
ident      | |       |         |                      |           
Sbjct GDIDHLAATFL-TCHSIAHGI---NLRKspvlQYLYylaqIGLAMSpLSNNslflDYHRN  496
DSSP  LLLHHHHHHHH-HLLLLLLLH---HHHHlhhhHHHHhhhlLLEEELhHHHLllllLLLLL


DSSP  -HHHHHhhhLLLLlLEEEELLLLLHhHHHHLLLHHHHHHHHHH-LLLLHHHHHHHHlHHH
Query -FVAALntlGHLPqTVTLCTDDVFPdDLLQGGGLDDVVRRLVR-YGLKPEWALRAAtLNA  319
ident  |             | | |||      |    |            |        |  | 
Sbjct pFPVFF---LRGL-NVSLSTDDPLQ-IHLTKEPLVEEYSIAASvWKLSACDLCEIA-RNS  550
DSSP  lHHHHH---HLLL-LEEELLLLHHH-HLLLLLHHHHHHHHHHHhHLLLHHHHHHHH-HHH


DSSP  HHHH-LLLLL--lLLLLLLllleeeellllllleeeeeelleeeeelleelllllllllh
Query AQRL-GRSDL--gLIAAGRradivvfedlngfsarhvlasgravaeggrxlvdiptcdtt  376
ident          |    |                                             
Sbjct VYQSgFSHALkshWIGKDY-----------------------------------------  569
DSSP  HHHLlLLHHHhhhHLLLLL-----------------------------------------


DSSP  hhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeee
Query vlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxis  436
ident                                                             
Sbjct ------------------------------------------------------------  569
DSSP  ------------------------------------------------------------


DSSP  eellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlll
Query vthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgg  496
ident                                                             
Sbjct ------------------------------------------------------------  569
DSSP  ------------------------------------------------------------


DSSP  eeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhll
Query gxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfga  556
ident                                                             
Sbjct --------------------------------------------ykrgpdgndihktnvp  585
DSSP  --------------------------------------------llllhhhllhhhhlll


DSSP  lllllllleelllleeelllleeellleeel
Query tlacnigphqtdxgiadvltgkvxespviev  587
ident                                
Sbjct hirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhhhhhlllllllllllll


No 51: Query=3nqbA Sbjct=3iacA Z-score=11.1

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeellEEELllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggTLVDvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------atfxtedfllkndiartlyHKYA-------------------------   23
DSSP  ------------llllllllllllhhhhhhhHHLL-------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHHhhlLLHHH------------------------
Query srrdaaqvidaggayvSPGLIDTHXHIEssxITPAA------------------------   96
ident                      | | |        |                         
Sbjct ---------------aPXPIYDFHCHLS--pQEIADdrrfdnlgqiwlegdhykwralrs   66
DSSP  ---------------lLLLEEELLLLLL--hHHHHHllllllhhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   96
ident                                                             
Sbjct agvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaes  126
DSSP  llllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhh


DSSP  ---------------HHHHHHLLLEEEEEELLHhhhhhhLHHHhHHHHHHHLL---LLLE
Query ---------------YAAAVVARGVTTIVWDPHefgnvhGVDGvRWAAKAIEN---LPLR  138
ident                         |                |        |         
Sbjct iwtqcneklatpafsARGIXQQXNVRXVGTTDD------PIDS-LEYHRQIAAddsIDIE  179
DSSP  hhhhhhhhhllhhhlHHHHHHHLLEEEEELLLL------LLLL-LHHHHHHHHlllLLLE


DSSP  EEEEELLLLLLLLLLLL-LLLL---------------lLHHHHHHHHL---LLLEEEEeE
Query AILLAPSCVPSAPGLER-GGAD---------------fDAAILADLLS---WPEIGGIaE  179
ident               |                           |   |             
Sbjct VAPSWRPDKVFKIELDGfVDYLrkleaaadvsitrfddLRQALTRRLDhfaACGCRAS-D  238
DSSP  EELLLLLHHHHLLLLLLhHHHHhhhhhhhllllllhhhHHHHHHHHHHhhhHLLLLEE-E


DSSP  ELLHH-----------------------------hhhlLLHHHHHHHHHHHHHLLEEEEL
Query IXNXR-----------------------------gvieRDPRXSGIVQAGLAAEKLVCGH  210
ident                                                    |       |
Sbjct HGIETlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLH  298
DSSP  EEELLllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEE


DSSP  LLL------------------------lLHHHHHHHHHLL-------lLEELLLLLhHHH
Query ARG------------------------lKNADLNAFXAAG-------vSSDHELVSgEDL  239
ident                                 |                    |    | 
Sbjct IGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXdvtnelpkTILYCLNP-RDN  357
DSSP  ELEellllhhhhhhhllllllleellllLHHHHHHHHHHHhlllllleEEEEELLH-HHH


DSSP  HHHHHLL-----------LEEEE---elLLHHHHHHHHHHHhhhlLLLLLEEEELLLLLh
Query XAKLRAG-----------LTIEL---rgSHDHLLPEFVAALntlgHLPQTVTLCTDDVFp  285
ident                                         |     | | |   ||    
Sbjct EVLATXIgnfqgpgiagkVQFGSgwwfnDQKDGXLRQLEQLsqxgLLSQFVGXLTDSRS-  416
DSSP  HHHHHHHhhlllllllllEEELLllhhhLLHHHHHHHHHHHhhhlLHHHLLLLLLLLLL-


DSSP  hhhhhlLLHHHHHHHHHHLL-----------------llhHHHHHHHLHHHHHHHLllll
Query ddllqgGGLDDVVRRLVRYG-----------------lkpEWALRAATLNAAQRLGrsdl  328
ident                                                  ||         
Sbjct -----fLSYTRHEYFRRILCnllgqwaqdgeipddeaxlsRXVQDICFNNAQRYFT----  467
DSSP  -----lLLLHHHHHHHHHHHhhhhhhhhlllllllhhhhhHHHHHHHLHHHHHHLL----


DSSP  lllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllll
Query gliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrx  388
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllle
Query andflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaeptt  448
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  eeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeee
Query ktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvta  508
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  eeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleell
Query ilplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtd  568
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  lleeelllleeellleeel
Query xgiadvltgkvxespviev  587
ident                    
Sbjct -----------------ik  469
DSSP  -----------------ll


No 52: Query=3nqbA Sbjct=3dcpA Z-score=8.5

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeLEEEEEELHH----HHLLLHHHHHHHHHLLLEEEEEELLH--
Query srrdaaqvidaggayvspGLIDTHXHIE----SSXITPAAYAAAVVARGVTTIVWDPH--  114
ident                      | | | |                             |  
Sbjct ------------------XKRDGHTHTEfcphGTHDDVEEXVLKAIELDFDEYSIVEHap   42
DSSP  ------------------LLEEEEELLLllllLLLLLHHHHHHHHHHLLLLEEEEEEEll


DSSP  -------------------hhhhHHLHHHHHHHHHHHLLL--LLEEEEEellllllllll
Query -------------------efgnVHGVDGVRWAAKAIENL--PLRAILLapscvpsapgl  153
ident                                            |                
Sbjct lssefxkntagdkeavttasxaxSDLPYYFKKXNHIKKKYasDLLIHIG-----------   91
DSSP  llhhhhhllllllhhhhlllllhHHHHHHHHHHHHHHHHLllLLEEEEE-----------


DSSP  llllllllhhhhhhhhlllleeeeEEELLHHhhhLLLHHHHHHHHHHhhhlleeEELLLL
Query erggadfdaailadllswpeiggiAEIXNXRgviERDPRXSGIVQAGlaaeklvCGHARG  213
ident                          |                                  
Sbjct ------------------------FEVDYLI---GYEDFTRDFLNEYgpqtddgVLSLHF  124
DSSP  ------------------------EEEELLL---LLHHHHHHHHHHHhhhlleeEEELLE


DSSP  ---------------------------------lLHHHHHHHHHL-----LLLEELLLL-
Query ---------------------------------lKNADLNAFXAA-----GVSSDHELV-  234
ident                                             |               
Sbjct legqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEAdlglfKPRRXGHISl  184
DSSP  eeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLlllllLLLEELLLLh


DSSP  ------------------lhhhhHHHHHLL----LEEEEELLL-----HHHHhhHHHHHH
Query ------------------sgedlXAKLRAG----LTIELRGSH-----DHLLpeFVAALN  267
ident                           |                                 
Sbjct cqkfqqffgedtsdfseevxekfRVILALVkkrdYELDFNTAGlfkplCGETypPKKIVT  244
DSSP  hhllhhhhlllhhhllhhhhhhhHHHHHHHhhhlLEEEEELHHhhlllLLLLllLHHHHH


DSSP  HhlLLLLLEEEELLLLLhhhhhhLLLHhHHHHHHHhLLLLhhhhhhhhlhhhhhhhllll
Query TlgHLPQTVTLCTDDVFpddllqGGGLdDVVRRLVrYGLKpewalraatlnaaqrlgrsd  327
ident     |        |                        |                     
Sbjct LasELQIPFVYGSDSHG-----vQDIG-RGYSTYC-QKLE--------------------  277
DSSP  HhhHLLLLEEEELLLLL-----hHHLL-LLHHHHH-HHLL--------------------


DSSP  llllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhlllllllll
Query lgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplr  387
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllllllll
Query xandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaept  447
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  eeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleee
Query tktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvt  507
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  eeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleel
Query ailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqt  567
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  llleeelllleeellleeel
Query dxgiadvltgkvxespviev  587
ident                     
Sbjct --------------------  277
DSSP  --------------------


No 53: Query=3nqbA Sbjct=1m65A Z-score=8.4

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeelEEEEeELHHH----HLLLHHHHHHHHHLLLEEEEEELLH--
Query srrdaaqvidaggayvspgLIDThXHIES----SXITPAAYAAAVVARGVTTIVWDPH--  114
ident                      |              |   | |     |        |  
Sbjct ------------------yPVDL-HMHTVasthAYSTLSDYIAQAKQKGIKLFAITDHgp   41
DSSP  ------------------lLEEL-LLLLLllllLLLLHHHHHHHHHHHLLLEEEEEEEll


DSSP  -hhhHHHLhHHHHHHHHhHLLLL--LEEEEEELLLllLLLLlllllllllhhHHHH-HHL
Query -efgNVHGvDGVRWAAKaIENLP--LRAILLAPSCvpSAPGlerggadfdaaILAD-LLS  170
ident       |                                                     
Sbjct dmedAPHH-WHFINMRI-WPRVVdgVGILRGIEAN--IKNV-------dgeiDCSGkMFD   90
DSSP  llllLLLL-HHHHHHHH-LLLEEllEEEEEEEEEE--LLLL-------llllLLLHhHHH


DSSP  LllEEEEEEELL------------hHHHHlllhhhhhhHHHHhhhllEEEE-LLLL----
Query WpeIGGIAEIXN------------xRGVIerdprxsgiVQAGlaaekLVCG-HARG----  213
ident       |                     |                       |       
Sbjct S--LDLIIAGFHepvfaphdkatntQAMI------atiASGN-----VHIIsHPGNpkye  137
DSSP  H--LLEEEEELLllllllllhhhhhHHHH------hhhHLLL-----LLEElLLLLllll


DSSP  -LLHHHHHHHHHlLLLEELL---lLLHHHHHHHHHLLLEEEEE----------LLLHhHH
Query -LKNADLNAFXAaGVSSDHE---lVSGEDLXAKLRAGLTIELR----------GSHDhLL  259
ident     |   |                  |   |   ||    |                 |
Sbjct iDVKAVAEAAAK-HQVALEInnssNCREVAAAVRDAGGWVALGsdshtaftmgEFEE-CL  195
DSSP  lLHHHHHHHHHH-HLLEEEEelllLHHHHHHHHHHHLLLEEEElllllhhhllLLHH-HH


DSSP  HHHHHHHhhhllLLLLEEEelllllhhhhhhlllhhhhhhhhhhllllhhhhhhHHLHHH
Query PEFVAALntlghLPQTVTLctddvfpddllqggglddvvrrlvryglkpewalrAATLNA  319
ident     |        |                                              
Sbjct KILDAVD----fPPERILN-----------------------------------VSPRRL  216
DSSP  HHHHHLL----lLHHHLHH-----------------------------------HLHHHH


DSSP  HHHHLlllllllllllLLLEeeellllllleeeeeelleeeeelleelllllllllhhhl
Query AQRLGrsdlgliaagrRADIvvfedlngfsarhvlasgravaeggrxlvdiptcdttvlk  379
ident    |             ||                                         
Sbjct LNFLE--srgmapiaeFADL----------------------------------------  234
DSSP  HHHHH--hllllllhhHLLL----------------------------------------


DSSP  lllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeel
Query gsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvth  439
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  lllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleee
Query rhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxa  499
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  eeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllll
Query vasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatla  559
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  llllleelllleeelllleeellleeel
Query cnigphqtdxgiadvltgkvxespviev  587
ident                             
Sbjct ----------------------------  234
DSSP  ----------------------------


No 54: Query=3nqbA Sbjct=1bksA Z-score=8.4

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeeleeeeeELHH---hhllLHHHHHHHHHLLLEeEEEELLHH--
Query srrdaaqvidaggayvspglidthXHIE---ssxiTPAAYAAAVVARGVtTIVWDPHE--  115
ident                                                |            
Sbjct ----meryenlfaqlndrregafvPFVTlgdpgieQSLKIIDTLIDAGA-DALELGVPfs   55
DSSP  ----lhhhhhhhhhhhhlllleeeEEEElllllhhHHHHHHHHHHHLLL-LLEEEELLll


DSSP  -----------------hhhHHLHHHHHHHHHHHLLLllEEEEEELLLLlllllllllll
Query -----------------fgnVHGVDGVRWAAKAIENLplRAILLAPSCVpsapglergga  158
ident                     |         |   |                         
Sbjct dpladgptiqnanlrafaagVTPAQCFEMLALIREKH-pTIPIGLLMYA-----------  103
DSSP  llllllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHL-lLLLEEEEELH-----------


DSSP  LLLH-HHHHHHHLL---LLEEEEEeELLHHHHhlllhhHHHHHHHHHHHLLEEEELLL-L
Query DFDA-AILADLLSW---PEIGGIAeIXNXRGVierdprXSGIVQAGLAAEKLVCGHAR-G  213
ident                                            || |             
Sbjct NLVFnNGIDAFYARceqVGVDSVLvADVPVEE------SAPFRQAALRHNIAPIFICPpN  157
DSSP  HHHHlLLHHHHHHHhhhHLLLEEEeLLLLHHH------LHHHHHHHHHLLLEEEEEELlL


DSSP  LLHHHHHHHHhLLLL--EELLlllhHHHHHHHHLL-----LEEEEE--LLLHHHHHHHHH
Query LKNADLNAFXaAGVS--SDHElvsgEDLXAKLRAG-----LTIELR--GSHDHLLPEFVA  264
ident      |                     |                     |        | 
Sbjct ADDDLLRQVA-SYGRgyTYLL---aLPLHHLIEKLkeyhaAPALQGfgISSPEQVSAAVR  213
DSSP  LLHHHHHHHH-HHLLllEEEL---lLLHHHHHHHHhhhllLLEEELllLLLHHHHHHHHH


DSSP  HHhhhllllllEEEELLL-LLHH-------------HHHHLLlhHHHHHHHHhllllhhh
Query ALntlghlpqtVTLCTDD-VFPD-------------DLLQGGglDDVVRRLVryglkpew  310
ident |                                    |                      
Sbjct AG--------aAGAISGSaIVKIieknlaspkqmlaELRSFV--SAMKAASR--------  255
DSSP  HL--------lLEEEELLhHHHHhhhllllhhhhhhHHHHHH--HHHHHLLL--------


DSSP  hhhhhlhhhhhhhllllllllllllllleeeellllllleeeeeelleeeeelleellll
Query alraatlnaaqrlgrsdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdi  370
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll
Query ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh
Query gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh
Query vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllleelllleeelllleeellleeel
Query kacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                      
Sbjct -------------------------------------  255
DSSP  -------------------------------------


No 55: Query=3nqbA Sbjct=3au2A Z-score=8.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  -----------------------------------------llhhhllHHHHHHHHHhhH
Query -----------------------------------------epadlndDTLRARAVAaaR   19
ident                                                   | |       
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarSLLEAIRAL--P  178
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhHHHHHHHLL--L


DSSP  LLLL--------------------------------------------------------
Query GDQR--------------------------------------------------------   23
ident |  |                                                        
Sbjct GVERaelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkn  238
DSSP  LLLEeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeell


DSSP  -----------------------eeeeeelleeelllllleeeleeeeelleeeeeeLLL
Query -----------------------fdvlitggtlvdvvtgelrpadigivgaliasvhEPA   60
ident                                                             
Sbjct glqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageTEE  298
DSSP  lleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeellLHH


DSSP  L--------------------llleeeeeelllleeEELEEEEEELHH--HHLLLHHHHH
Query S--------------------rrdaaqvidaggayvSPGLIDTHXHIE--SSXITPAAYA   98
ident                                          |   |        |     
Sbjct EvyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysDGQNTLEELW  358
DSSP  HhhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllLLLLLHHHHH


DSSP  HHHHLLLEEEEEELLH--------hhhhhhlHHHHHHHHHHHL-LLLLEEEEEellllll
Query AAVVARGVTTIVWDPH--------efgnvhgVDGVRWAAKAIE-NLPLRAILLapscvps  149
ident  |    |        |                  |       |   |             
Sbjct EAAKTMGYRYLAVTDHspavrvaggpspeeaLKRVGEIRRFNEtHGPPYLLAG-------  411
DSSP  HHHHHHLLLEEEEEEElhhhhllllllhhhhHHHHHHHHHHHHhHLLLEEEEE-------


DSSP  llllllllllllhhhhhhhhlllleeeeEEELLHHHHHlllhhhhhHHHHHhhhlleEEE
Query apglerggadfdaailadllswpeiggiAEIXNXRGVIerdprxsgIVQAGlaaeklVCG  209
ident                             ||                           |  
Sbjct ----------------------------AEVDIHPDGT------ldYPDWVlreldlVLV  437
DSSP  ----------------------------EEEELLLLLL------llLLHHHhlllleEEE


DSSP  LLLL-------lLHHHHHHHHHLL-LLEEL-LLLL--------hhhhHHHHHLL----LE
Query HARG-------lKNADLNAFXAAG-VSSDH-ELVS--------gedlXAKLRAG----LT  248
ident                 |        |                      |           
Sbjct SVHSrfnlpkadQTKRLLKALENPfVHVLAhPTARllgrrapieadwEAVFQKAkekgVA  497
DSSP  ELLLlllllhhhHHHHHHHHHLLLlLLEELlLLLLlllllllllllhHHHHHHHhhhlLE


DSSP  EEEELLlHHHHhhHHHHHHH-hLLLLlLEEEELLLLLhhhhhHLLLhHHHHHHHH-hLLL
Query IELRGShDHLLpeFVAALNT-lGHLPqTVTLCTDDVFpddllQGGGlDDVVRRLV-rYGL  306
ident  |  |                 |       | ||                          
Sbjct VEIDGY-YDRMdlPDDLARMayGMGL-WISLSTDAHQ-----TDHL-RFMELAVGtaQRA  549
DSSP  EEEELL-LLLLllLHHHHHHhhHLLL-LEEEELLLLL-----HHHH-HHHHHHHHhhHHL


DSSP  LHHHhhHHHLHhhhHHHLLllllllllllllleeeellllllleeeeeelleeeeellee
Query KPEWalRAATLnaaQRLGRsdlgliaagrradivvfedlngfsarhvlasgravaeggrx  366
ident          ||     |                                           
Sbjct WIGPerVLNTLdyeDLLSW-----------------------------------------  568
DSSP  LLLLllLHHHLlhhHHHHH-----------------------------------------


DSSP  lllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeellee
Query lvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfv  426
ident                                                             
Sbjct ------------------------------------------------------------  568
DSSP  ------------------------------------------------------------


DSSP  llllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhh
Query vppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxal  486
ident                                                             
Sbjct ------------------------------------------------------------  568
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhllllll
Query aanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqpp  546
ident                                                             
Sbjct ------------------------------------------------------------  568
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhlllllllllleelllleeelllleeellleeel
Query ylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                          
Sbjct ----------------------------------lkarrgv  575
DSSP  ----------------------------------hhlllll


No 56: Query=3nqbA Sbjct=3f2bA Z-score=8.0

back to top
DSSP  ------------------------------llhhhllhhhhhhhhhhhhlllleeeeeel
Query ------------------------------epadlnddtlraravaaargdqrfdvlitg   30
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  leeelllllleeeleeeeelleeeeeellllllleeeeeellllEEEELEEEEEELHH--
Query gtlvdvvtgelrpadigivgaliasvhepasrrdaaqvidaggaYVSPGLIDTHXHIE--   88
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtaPEGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllLLLLLLLLLLLLLLll


DSSP  --hHLLLHHHHHHHHHLLLEEEEEELLHhhhhhhlhhhHHHHHHHHLLL----LLEEEEE
Query --sSXITPAAYAAAVVARGVTTIVWDPHefgnvhgvdgVRWAAKAIENL----PLRAILL  142
ident                   |   |    |          |                  |  
Sbjct qmdAVTSVTKLIEQAKKWGHPAIAVTDH---------aVVQSFPEAYSAakkhGMKVIYG  171
DSSP  lllLLLLHHHHHHHHHHLLLLLEEELLL---------lLLLLHHHHHHHhhhhLLLEEEE


DSSP  ELLL------------------------lllllllllLLLLLLhhhhhhhhlllleeeee
Query APSC------------------------vpsapglerGGADFDaailadllswpeiggia  178
ident                                                             
Sbjct LEANivddpfhvtllaqnetglknlfklvslshiqyfHRVPRI-----------------  214
DSSP  EEEEeellleeeeeeellhhhhhhhhhhhhhhhllllLLLLLE-----------------


DSSP  eellhhhhhlllhHHHHHHHHHhhHLLEEEEL-----LLLLlhhhHHHHHHlLLLEELL-
Query eixnxrgvierdpRXSGIVQAGlaAEKLVCGH-----ARGLknadLNAFXAaGVSSDHE-  232
ident                |  |        ||                               
Sbjct -------------PRSVLVKHR--DGLLVGSGcdkgeLFDN----VEDIAR-FYDFLEVh  254
DSSP  -------------EHHHHHHLL--LLEEEELLlllllLLLL----LLLLHH-HLLLEEEl


DSSP  -------------llLHHHHHHHHHLL----LEEEEelllhhhhhhhhhhhhhhllllll
Query -------------lvSGEDLXAKLRAG----LTIELrgshdhllpefvaalntlghlpqt  275
ident                           |                                 
Sbjct ppdvykplyvkdeemIKNIIRSIVALGekldIPVVA------------------------  290
DSSP  lhhhhlllllllhhhHHHHHHHHHHHHhhllLLEEE------------------------


DSSP  eeeELLLLLHHH------------------------hhhlLLHH-HHHHHHHhlLLLHHH
Query vtlCTDDVFPDD------------------------llqgGGLD-DVVRRLVryGLKPEW  310
ident                                                        | || 
Sbjct ---TGNVHYLNPedkiyrkilihsqgganplnrhelpdvyFRTTnEMLDCFS--FLGPEK  345
DSSP  ---LLLLLLLLHhhhhhhhhhhhllhhhllllllllllllLLLHhHHHHHHH--HHHHHH


DSSP  HHHHHLHHHHHHHLL---------------------------------------------
Query ALRAATLNAAQRLGR---------------------------------------------  325
ident |      |                                                    
Sbjct AKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklvee  405
DSSP  HHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct rlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpp  465
DSSP  hhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlllllllllll


DSSP  ---------------------------------------llllllllllllleeeellll
Query ---------------------------------------sdlgliaagrradivvfedln  346
ident                                                             
Sbjct hyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdid  525
DSSP  eeelllllleeellllllllhhhllllllllllllleeellllllhhhhlllllllllee


DSSP  llleeeeeelleeeeelleelllllllllHHHLLllllllllhhhhllllllleeeeeee
Query gfsarhvlasgravaeggrxlvdiptcdtTVLKGsxklplrxandflvksqgakvrlati  406
ident                                                             
Sbjct lnfsgeyqprahnytkvlfgednvyragtIGTVA--------------------------  559
DSSP  eeeelllhhhhhhhhhhhhlllleeeeeeEEELL--------------------------


DSSP  ellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeel
Query drprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafatt  466
ident                                                             
Sbjct ------------------------------------------------------------  559
DSSP  ------------------------------------------------------------


DSSP  llllllleeeeellhhhhhhhhhhHHHLlleeeeeeLLEEE---EEEE---LLLLlllll
Query vshdshnltvfggnagdxalaanaVIGTgggxavasEGKVT---AILP---LPLSglvsd  520
ident                                                             
Sbjct --------------------dktaYGFV-kayasdhNLELRgaeIDRLaagCTGV-----  593
DSSP  --------------------hhhhHHHH-hhhhhhlLLLLLhhhHHHHhhhHLLL-----


DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleeLLLLEE--------
Query apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqTDXGIA--------  572
ident                                                             
Sbjct ---------------krttgqhpggiivvpdymeiydftpiqypadDTSSEWrtthfdfh  638
DSSP  ---------------eeeeeeeeeeeeellllllhhhllleelhhhLLLLLLleeeeehh


DSSP  elllleeelllEEEL---------------------------------------------
Query dvltgkvxespVIEV---------------------------------------------  587
ident                                                             
Sbjct sihdnllkldiLGHDdptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimc  698
DSSP  hhllllleeeeEEEHhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  587
ident                                                             
Sbjct nvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlse  758
DSSP  llllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  587
ident                                                             
Sbjct vigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkik  818
DSSP  llllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  587
ident                                                             
Sbjct ymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieei  878
DSSP  llllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  587
ident                                                             
Sbjct nakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipg  938
DSSP  hhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlll


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  587
ident                                                         
Sbjct lgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  llhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 57: Query=3nqbA Sbjct=3e38A Z-score=7.6

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeELLLLLleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlVDVVTGelrpadigivgaliasvhepa   60
ident                                  |    |                     
Sbjct -------------------------aqrrneiqVPDLDG---------------------   14
DSSP  -------------------------llllllllLLLLLL---------------------


DSSP  lllleeeeeelllleeeELEEEeEELHH---hhLLLHHHHHHHHHLLLEEEEEELLHhhH
Query srrdaaqvidaggayvsPGLIDtHXHIE---ssXITPAAYAAAVVARGVTTIVWDPHefG  117
ident                      |              |          |   |    |   
Sbjct ---------------ytTLKCD-FHXHSvfsdgLVWPTVRVDEAYRDGLDAISLTEHieY   58
DSSP  ---------------leEEEEE-LLLLLlllllLLLHHHHHHHHHHLLLLEELLEEEllL


DSSP  HHH---lhHHHHHHHHHHLLL----LLEEEEEELLLLllllllllllllllhhHHHHhhl
Query NVH---gvDGVRWAAKAIENL----PLRAILLAPSCVpsapglerggadfdaaILADlls  170
ident   |                          |                              
Sbjct RPHkqdvvSDHNRSFDLCREQaeklGILLIKGSEITR-axapghfnaiflsdsNPLE---  114
DSSP  LLLlllllLLLLHHHHHHHHHhhhhLLEELLEEEEEL-llllleeeeelllllHHHL---


DSSP  llleeeeeeellhhhhhlllHHHHHHHHHHHHHLLEEEELLL---------LLLHHHHHH
Query wpeiggiaeixnxrgvierdPRXSGIVQAGLAAEKLVCGHAR---------GLKNADLNA  221
ident                                                            |
Sbjct -------------------qKDYKDAFREAKKQGAFXFWNHPgwdsqqpdtTKWWPEHTA  155
DSSP  -------------------lLLHHHHHHHHHHLLLEEEELLLlllllllllLLLLHHHHH


DSSP  HHHL-LLLEELL-----LLLHhHHHHHHHLLLEEEeelllhhhhhhhhhhhhhhllllll
Query FXAA-GVSSDHE-----LVSGeDLXAKLRAGLTIElrgshdhllpefvaalntlghlpqt  275
ident                            |   ||                           
Sbjct LYQEgCXHGIEVanghlYXPE-AIQWCLDKNLTXI-------------------------  189
DSSP  HHHLlLLLEEEEeelleELLH-HHHHHHHHLLEEE-------------------------


DSSP  eeEELLLLL--HHHHHH---LLLHhhhhhhhhhllllhhhhhhhHLHH----hHHHHLL-
Query vtLCTDDVF--PDDLLQ---GGGLddvvrrlvryglkpewalraATLN----aAQRLGR-  325
ident      |       |                                              
Sbjct --GTSDIHQpiQTDYDFekgEHRT------------------xtFVFAkerslQGIREAl  229
DSSP  --EELLLLLlhHHHLLHhhlLLLL------------------eeEEEEllllhHHHHHHh


DSSP  -----------------------------llllllllllllleeeeLLLLLlleeeeeel
Query -----------------------------sdlgliaagrradivvfEDLNGfsarhvlas  356
ident                                                             
Sbjct dnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnVTDLV---------  280
DSSP  hllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeeLLLLL---------


DSSP  leeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeee
Query gravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwge  416
ident                                                             
Sbjct -------------------------------lklkktahdtllvyfrdxtlkphtrytvr  309
DSSP  -------------------------------eeeeelllllleellleeeellleeeeee


DSSP  eEEEEElleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleee
Query tEADVKdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltv  476
ident                                                             
Sbjct iGFKQG------------------------------------------------------  315
DSSP  eEELLL------------------------------------------------------


DSSP  eellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhh
Query fggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlrea  536
ident                                                             
Sbjct ------------------------------------------------------------  315
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel
Query vgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                                    
Sbjct ------------------------ikggdvnfevtnfivapdkglkytisl  342
DSSP  ------------------------lllleeeeeeeeeeeelleeeeeeeel


No 58: Query=3nqbA Sbjct=2anuA Z-score=7.1

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeEELEEEEEELHH--HHLLLHHHHHHHHHLLLEEEEEELLHH---
Query srrdaaqvidaggayvSPGLIDTHXHIE--SSXITPAAYAAAVVARGVTTIVWDPHE---  115
ident                    | | | |                    ||       |    
Sbjct ---------------tEWLLCDFHVHTNxsDGHLPLGEVVDLFGKHGVDVVSITDHIvdr   45
DSSP  ---------------lEEEEEEEEELLLllLLLLLHHHHHHHHHHLLLLEEEEEEEEelh


DSSP  --------------HHHH-HLHHHHHHHHHHHLLL----LLEEEEEELLLlLLLLlllll
Query --------------FGNV-HGVDGVRWAAKAIENL----PLRAILLAPSCvPSAPglerg  156
ident                       |                    |                
Sbjct rtleqrkrngeplgAITEdKFQDYLKRLWREQKRAweeyGXILIPGVEIT-NNTD-----   99
DSSP  hhhhhhhhllllllLLLLlLHHHHHHHHHHHHHHHhhhhLLEEEEEEEEE-ELLL-----


DSSP  lllllhhhhhhhhllllEEEEeeellhhhhhlllHHHHHHHHHHHHHLLEEEELL-----
Query gadfdaailadllswpeIGGIaeixnxrgvierdPRXSGIVQAGLAAEKLVCGHA-----  211
ident                                        ||        ||         
Sbjct -----------lyhivaVDVK-------eyvdpsLPVEEIVEKLKEQNALVIAAHpdrkk  141
DSSP  -----------leeeeeELLL-------llllllLLHHHHHHHHHHLLLEEEELLlllll


DSSP  --lLLLHhHHHHHHHlLLLEELLLllhhhHHHHHHLLLEEEEelllhhhhhhhhhhhhhh
Query --rGLKNaDLNAFXAaGVSSDHELvsgedLXAKLRAGLTIELrgshdhllpefvaalntl  269
ident     |       |                                               
Sbjct lswYLWA-NXERFKD-TFDAWEIAnrddlFNSVGVKKYRYVA------------------  181
DSSP  lllHHHH-LLLLLLL-LLLEEEEEelleeLHHHHHLLLLEEE------------------


DSSP  lllllleeeELLLLLHhhhhhlLLHHHHhhhhhhllllhhhhhhhHLHH---hhHHHLLl
Query ghlpqtvtlCTDDVFPddllqgGGLDDVvrrlvryglkpewalraATLN---aaQRLGRs  326
ident            |                                                
Sbjct ---------NSDFHEL------WHVYSW---------------ktLVKSeknieAIKEA-  210
DSSP  ---------ELLLLLH------HHHLLE---------------eeEEEElllhhHHHHH-


DSSP  lllllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllll
Query dlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklpl  386
ident                                                             
Sbjct ------------------------------------------------------------  210
DSSP  ------------------------------------------------------------


DSSP  llhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllll
Query rxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaep  446
ident                                                             
Sbjct ------------------------------------------------------------  210
DSSP  ------------------------------------------------------------


DSSP  leeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeellee
Query ttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkv  506
ident                                                             
Sbjct ------------------------------------------------------------  210
DSSP  ------------------------------------------------------------


DSSP  eeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhllllllllllee
Query tailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphq  566
ident                                                             
Sbjct ------------------------------------------------------------  210
DSSP  ------------------------------------------------------------


DSSP  lllleeelllleeellleeel
Query tdxgiadvltgkvxespviev  587
ident                      
Sbjct -------irkntdvaiylxrk  224
DSSP  -------hhhllleeeeelll


No 59: Query=3nqbA Sbjct=2yb1A Z-score=6.8

back to top
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll
Query epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeelllleeeelEEEEEELHH--HHLLLHHHHHHHHHLLLEEEEEELLHHHhh
Query srrdaaqvidaggayvspgLIDTHXHIE--SSXITPAAYAAAVVARGVTTIVWDPHEFgn  118
ident                     || | |        ||        ||         |    
Sbjct ------------------aNIDLHFHSRtsDGALTPTEVIDRAAARAPALLALTDHDC--   40
DSSP  ------------------lLEELLLLLLllLLLLLHHHHHHHHHLLLLLEEEELLLLL--


DSSP  hhlhhhhhHHHHH-HLLL---LLEEEEEELLL---------------------------l
Query vhgvdgvrWAAKA-IENL---PLRAILLAPSC---------------------------v  147
ident                                                             
Sbjct -------tGGLAEaAAAAarrGIPFLNGVEVSvswgrhtvhivglgidpaepalaaglks   93
DSSP  -------lLLHHHhHHHHhhlLLLEEEEEEEEeeelleeeeeeeellllllhhhhhhhhh


DSSP  LLLLLLLL----------------------------------------------------
Query PSAPGLER----------------------------------------------------  155
ident      |||                                                    
Sbjct IREGRLERarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvf  153
DSSP  HHLLHHHHhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhh


DSSP  -----------llLLLLhhhhhhhhlllleeeeeeellhhhhhlllhHHHHHHHHHHHHL
Query -----------ggADFDaailadllswpeiggiaeixnxrgvierdpRXSGIVQAGLAAE  204
ident                                                     |     | 
Sbjct rkyltpgkpgyvsHQWA------------------------------SLEDAVGWIVGAG  183
DSSP  hhlllllllllllLLLL------------------------------LHHHHHHHHHHLL


DSSP  LEEE-ELLL------llLHHHHHHHHHLLLLEELL-------lLLHHHHHHHHHLLLEEE
Query KLVC-GHAR------glKNADLNAFXAAGVSSDHE-------lVSGEDLXAKLRAGLTIE  250
ident       |                 | |||                        | ||   
Sbjct GMAViAHPGrydmgrtlIERLILDFQAAGGQGIEVasgshsldDMHKFALHADRHGLYAS  243
DSSP  LEEEeLLHHhllllhhhHHHHHHHHHHLLLLEEEEeellllhhHHHHHHHHHHHHLLEEE


DSSP  eelllhhhhhhhhhhhhhhlllllleeEELLLLLHHHhhhlLLHHhhhhhhhhllllhhh
Query lrgshdhllpefvaalntlghlpqtvtLCTDDVFPDDllqgGGLDdvvrrlvryglkpew  310
ident                               |   |                         
Sbjct ---------------------------SGSDFHAPGE----DVGH-------------te  259
DSSP  ---------------------------EELLLLLLLL----LLLL-------------ll


DSSP  hhhhhlhHHHHHHLLllllllllllllleeeellllllleeeeeELLEeeeelleellll
Query alraatlNAAQRLGRsdlgliaagrradivvfedlngfsarhvlASGRavaeggrxlvdi  370
ident             |                                               
Sbjct dlppicrPIWRELEA-------------------------rilrPADA------------  282
DSSP  lllllllLHHHHLHH-------------------------hlllLLHH------------


DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll
Query ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
ident                                                             
Sbjct ------------------------------------------------------------  282
DSSP  ------------------------------------------------------------


DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh
Query gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
ident                                                             
Sbjct ------------------------------------------------------------  282
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh
Query vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
ident                                                             
Sbjct ------------------------------------------------------------  282
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllleelllleeelllleeellleeel
Query kacfgatlacnigphqtdxgiadvltgkvxespviev  587
ident                                      
Sbjct -----------------------------------en  284
DSSP  -----------------------------------hl