Results: dupa

Query: 3mtwA

MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3mtw-A 78.4  0.0  404   404  100 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   2:  3mkv-A 53.7  1.9  395   414   31 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   3:  4c5y-A 47.2  2.4  387   436   29 PDB  MOLECULE: OCHRATOXINASE;                                             
   4:  2oof-A 34.6  3.3  337   403   20 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   5:  2paj-A 32.5  2.9  338   421   19 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   6:  1j6p-A 31.3  2.9  328   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   7:  4cqb-A 30.9  3.1  327   402   18 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  3ls9-A 30.5  3.0  346   453   20 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   9:  1k6w-A 30.5  3.2  331   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  10:  2vun-A 30.3  2.7  307   385   19 PDB  MOLECULE: ENAMIDASE;                                                 
  11:  3icj-A 30.1  3.1  315   468   20 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  12:  2uz9-A 29.4  3.5  338   444   17 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  13:  3nqb-A 27.8  3.1  307   587   23 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  1onx-A 27.7  3.0  309   390   18 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  15:  4rdv-B 26.6  2.9  331   451   17 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  16:  1yrr-B 26.0  3.2  298   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  17:  3ooq-A 26.0  3.1  295   384   23 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  18:  3giq-A 25.6  3.4  322   475   18 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  19:  3gri-A 25.2  3.7  319   422   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  2ogj-A 25.1  3.8  305   379   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  1gkp-A 24.8  3.6  329   458   19 PDB  MOLECULE: HYDANTOINASE;                                              
  22:  4b3z-D 23.5  3.6  326   477   15 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  23:  3e74-A 23.3  3.9  306   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  24:  2imr-A 20.3  4.3  275   380   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  25:  1a5k-C 19.5  3.3  312   566   19 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  26:  1a4m-A 18.5  3.3  251   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  27:  2ob3-A 18.4  3.7  245   329   14 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  28:  2y1h-B 18.0  3.1  224   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  29:  1bf6-A 17.6  3.5  234   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  3k2g-B 17.6  3.6  244   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  31:  1v77-A 17.2  2.8  188   202   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  32:  3cjp-A 16.7  2.7  206   262   15 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  33:  2vc5-A 16.5  4.1  234   314   16 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  34:  3gg7-A 16.0  3.4  210   243   17 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  35:  3irs-A 15.8  3.3  218   281   14 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  36:  2ffi-A 14.9  3.5  213   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  37:  4mup-B 14.7  3.3  211   286   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  38:  4dlf-A 14.4  3.7  218   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  39:  3pnu-A 14.3  3.8  235   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  40:  4ofc-A 13.7  3.5  205   335   16 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  41:  1itq-A 13.7  3.6  227   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  42:  4hk5-D 13.6  3.4  216   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  43:  2dvt-A 13.5  3.5  209   325   10 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  44:  4qrn-A 12.9  3.7  209   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  45:  2gwg-A 12.9  4.0  218   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  46:  2qpx-A 12.8  4.1  215   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  47:  4dzi-C 12.7  3.3  202   388   15 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  2a3l-A 12.0  3.7  245   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  49:  3qy6-A 12.0  3.5  186   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  3au2-A 10.8  7.8  187   575   15 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  51:  1m65-A 10.3  3.7  180   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  52:  3iac-A 10.1  4.0  214   469    7 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  53:  1j5s-A 10.0  3.4  201   451    8 PDB  MOLECULE: URONATE ISOMERASE;                                         
  54:  3dcp-A 10.0  3.6  166   277   13 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  8.8  6.8  175   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.4  3.6  164   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  3e38-A  5.6  3.9  157   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2yb1-A  5.6  4.1  157   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  2anu-A  4.7  3.9  149   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3mtwA Sbjct=3mtwA Z-score=78.4

back to top
DSSP  LLEEEEEEEEEEELLLLEEEELEEEEEELLEEEEEEELLLLLLLLLEEEEEEEEEEEELE
Query AEIKAVSAARLLDVASGKYVDNPLVIVTDGRITSIGKKGDAVPAGATAVDLPGVTLLPGL   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AEIKAVSAARLLDVASGKYVDNPLVIVTDGRITSIGKKGDAVPAGATAVDLPGVTLLPGL   60
DSSP  LLEEEEEEEEEEELLLLEEEELEEEEEELLEEEEEEELLLLLLLLLEEEEEEEEEEEELE


DSSP  EEEEELLLLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLLLHHHHHHH
Query IDMHVHLDSLAEVGGYNSLEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAADYDDVGLRE  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IDMHVHLDSLAEVGGYNSLEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAADYDDVGLRE  120
DSSP  EEEEELLLLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLLLHHHHHHH


DSSP  HHHLLLLLLLEEEELLLLEELLLLLLLLLLLLHHHLLLLLLLLLLHHHHHHHHHHHHHLL
Query AIDAGYVPGPRIVTAAISFGATGGHCDSTFFPPSMDQKNPFNSDSPDEARKAVRTLKKYG  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AIDAGYVPGPRIVTAAISFGATGGHCDSTFFPPSMDQKNPFNSDSPDEARKAVRTLKKYG  180
DSSP  HHHLLLLLLLEEEELLLLEELLLLLLLLLLLLHHHLLLLLLLLLLHHHHHHHHHHHHHLL


DSSP  LLEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEEEELLHHHHHHHHHLL
Query AQVIXICATGGVFSRGNEPGQQQLTYEEMKAVVDEAHMAGIKVAAHAHGASGIREAVRAG  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AQVIXICATGGVFSRGNEPGQQQLTYEEMKAVVDEAHMAGIKVAAHAHGASGIREAVRAG  240
DSSP  LLEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEEEELLHHHHHHHHHLL


DSSP  LLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHHHHHHHLLLHHHHHHHHHHHHHHH
Query VDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQAEGKKNGVLEDNLRKDRDIGELQR  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQAEGKKNGVLEDNLRKDRDIGELQR  300
DSSP  LLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHHHHHHHLLLHHHHHHHHHHHHHHH


DSSP  HHHHHHHHHLLEEELLLLLLLLLLLLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLLL
Query ENFRKALKAGVKMVYGTDAGIYPHGDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRSK  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ENFRKALKAGVKMVYGTDAGIYPHGDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRSK  360
DSSP  HHHHHHHHHLLEEELLLLLLLLLLLLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLLL


DSSP  LLLLLLLLLLLLEEEELLLLLLLHHHHHLLLEEEELLEEEELLL
Query DVGQVAVGRYGDMIAVAGDPLADVTTLEKPVFVMKGGAVVKAPX  404
ident ||||||||||||||||||||||||||||||||||||||||||||
Sbjct DVGQVAVGRYGDMIAVAGDPLADVTTLEKPVFVMKGGAVVKAPX  404
DSSP  LLLLLLLLLLLLEEEELLLLLLLHHHHHLLLEEEELLEEEELLL


No 2: Query=3mtwA Sbjct=3mkvA Z-score=53.7

back to top
DSSP  LLEEEEEEEEEEELLLLEEEELEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEELE
Query AEIKAVSAARLLDVASGKYVDNPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLPGL   60
ident           |||               || |             |   |  | |  |||
Sbjct LTTFLFRNGALLDPDHPDLLQGFEILIEDGFIREVSD-KPIKSSNAHVIDVKGKTIMPGL   59
DSSP  LLEEEEEEEEELLLLLLLLEEEEEEEEELLEEEEEEL-LLLLLLLLEEEELLLLEEEELE


DSSP  EEEEELLLLLLLlLHHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLlllHHHHHHH
Query IDMHVHLDSLAEvGGYNSLEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAadyDDVGLRE  120
ident || |||                               |  ||||||  |           
Sbjct IDLHVHVVAIEF-NLPRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGG---AGYPFKQ  115
DSSP  EEEEELLLLLLL-LHHHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLL---LLHHHHH


DSSP  HHHLLLLLLLEEEELLLLEELLLLLLLLLLLLHHHLLL-----------llLLLLLHHHH
Query AIDAGYVPGPRIVTAAISFGATGGHCDSTFFPPSMDQK-----------npFNSDSPDEA  169
ident |   | | |||          |||| |       |                   |  || 
Sbjct AVESGLVEGPRLFVSGRALSQTGGHADPRARSDYMPPDspcgccvrvgalgRVADGVDEV  175
DSSP  HHHLLLLLLLEEEELLLEEELLLLLLLLLLLLLLLLLLlllllllllllleEELLLHHHH


DSSP  HHHHHHHHHLLLLEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEEEELL
Query RKAVRTLKKYGAQVIXICATGGVFSRGNEPGQQQLTYEEMKAVVDEAHMAGIKVAAHAHG  229
ident | |||     ||  ||| | ||| |     |       |  | | ||   |  | |||  
Sbjct RRAVREELQMGADQIXIMASGGVASPTDPVGVFGYSEDEIRAIVAEAQGRGTYVLAHAYT  235
DSSP  HHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLEEEEELL


DSSP  HHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHHHHHHHLLLHHHH
Query ASGIREAVRAGVDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQAEGKKNGVLEDNL  289
ident    |  ||| || ||||  | |||   |    |||        |    || | |      
Sbjct PAAIARAVRCGVRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALASEGEKYGLPPESI  295
DSSP  HHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHHHLLLLLLLHHHH


DSSP  HHHHHHHHHHHHHHHHHHHHLLEEELLLLLLLLLLLLHHHHHHHHHHlLLLHHHHHHHLL
Query RKDRDIGELQRENFRKALKAGVKMVYGTDAGIYPHGDNAKQFAVMVRyGATPLQAIQSAT  349
ident  |  |              |||||  |||            |         |   | |||
Sbjct AKIADVHGAGLHSIEIMKRAGVKMGFGTDLLGEAQRLQSDEFRILAE-VLSPAEVIASAT  354
DSSP  LLHHHHHLLHHHHHHHHHHHLLLLLLLLLLLHHHHHHLLHHHHHHHL-LLLHHHHHHHLL


DSSP  HHHHHHHLLLLLLLLLLLLLLLLEEEELLLLLLLHHHHH----LLLEEEELLEEEELL-l
Query LTAAEALGRSKDVGQVAVGRYGDMIAVAGDPLADVTTLE----KPVFVMKGGAVVKAP-x  404
ident    || ||     |    |   |   | | ||  |  |         ||| |        
Sbjct IVSAEVLGMQDKLGRIVPGAHADVLVVDGNPLKSVDCLLgqgeHIPLVMKDGRLFVNEle  414
DSSP  HHHHHHLLLLLLLLLLLLLLLLLEEEELLLLLLLLLLLLllllLLLEEEELLEEEEELll


No 3: Query=3mtwA Sbjct=4c5yA Z-score=47.2

back to top
DSSP  --LLEEEEEEEEEEELLLlEEEELEEEEEELLEEEEEEELLLL---LLLLL-EEEEEeeE
Query --AEIKAVSAARLLDVASgKYVDNPLVIVTDGRITSIGKKGDA---VPAGA-TAVDLpgV   54
ident   |      |  |          |      |  |   |   |                  
Sbjct deAKVTIIYAGLLIPGDG-EPLRNAALVISDKIIAFVGSEADIpkkYLRSTqSTHRV--P   57
DSSP  llLLEEEEEEEEELLLLL-LLEEEEEEEEELLEEEEEEEHHHLlhhHHHHLlLEEEE--E


DSSP  EEEELEEEEEELLLLL-llLLHHHH-HHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLll
Query TLLPGLIDMHVHLDSL-aeVGGYNS-LEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAad  112
ident  | ||| | | |          | | |                  |  | |  |      
Sbjct VLMPGLWDCHMHFGGDddyYNDYTSgLATHPASSGARLARGCWEALQNGYTSYRDLAG--  115
DSSP  EEEELEEEEEELLLLLlllLLLLHHhHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLL--


DSSP  lHHHHHHHHHHLLLLLLLEEEELLLLEELLLLLLLLLLLlHHHL--LLLL----------
Query yDDVGLREAIDAGYVPGPRIVTAAISFGATGGHCDSTFFpPSMD--QKNP----------  160
ident         ||  |   ||           | || |     |                   
Sbjct -YGCEVAKAINDGTIVGPNVYSSGAALSQTAGHGDIFAL-PAGEvlGSYGvmnprpgywg  173
DSSP  -LHHHHHHHHHLLLLLLLEEEELLLEEELLLLLLLLLLL-LHHHhhHHHLllllllllll


DSSP  ----LLLLLHHHHHHHHHHHHHLLLLEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH
Query ----FNSDSPDEARKAVRTLKKYGAQVIXICATGGVFSRGNEPGQQQLTYEEMKAVVDEA  216
ident        |   | | |||     || |||  | ||| ||   |   |   || |  | ||
Sbjct agplCIADGVEEVRRAVRLQIRRGAKVIXVMASGGVMSRDDNPNFAQFSPEELKVIVEEA  233
DSSP  llleEELLLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH


DSSP  HHLLLEEEEEELLHHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHH
Query HMAGIKVAAHAHGASGIREAVRAGVDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQ  276
ident       | || ||  ||  |  ||    || |  | |   |   ||              
Sbjct ARQNRIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFL  293
DSSP  HHLLLLEEEEELLHHHHHHHHHHLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH


DSSP  -HHHHhhLLLHHHhHHHH-HHHHHHHHHHHHHHHHLLEEELLLLLLlllLLLHHHHHHHH
Query -AEGKknGVLEDNlRKDR-DIGELQRENFRKALKAGVKMVYGTDAGiypHGDNAKQFAVM  334
ident    |   |                       | ||||    |||      |  |      
Sbjct aSNGE--GLVKES-WAKLqALADSHLKAYQGAIKAGVTIALGTDTA--pGGPTALELQFA  348
DSSP  hHLLL--LLLLLH-HHLLlHHHHHHHHHHHHHHHLLLLEELLLLLL--lLLLLHHHHHHH


DSSP  HHL-LLLHHHHHHHLLHHHHHHH--LLLLlLLLLLLLLLLLEEEELLLLLLLHHHHHL--
Query VRY-GATPLQAIQSATLTAAEAL--GRSKdVGQVAVGRYGDMIAVAGDPLADVTTLEK--  389
ident |   | ||| ||  ||  |            ||   |   | ||    || |        
Sbjct VERgGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEENPLEDIKVFQEpk  407
DSSP  HHLlLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLLLLLLHHHHHLhh


DSSP  -LLEEEELLEEEELL-------------l
Query -PVFVMKGGAVVKAP-------------x  404
ident     | |||   | |              
Sbjct aVTHVWKGGKLFKGPgigpwgedarnpfl  436
DSSP  hEEEEEELLEEEELLllllllllllllll


No 4: Query=3mtwA Sbjct=2oofA Z-score=34.6

back to top
DSSP  -LLEEEEEEEEEEELL----LLEEEELEEEEEELLEEEEEEEL-LLLLLlllEEEEEEEE
Query -AEIKAVSAARLLDVA----SGKYVDNPLVIVTDGRITSIGKK-GDAVPagaTAVDLPGV   54
ident                                |  |||           |      |  | 
Sbjct lNCERVWLNVTPATLRsdlaDYGLLEPHALGVHEGRIHALVPXqDLKYP--aHWQDXKGK   58
DSSP  lLLLEEEEEEEELLLLllllLLLLLLLEEEEEELLEEEEEEEHhHLLLL--lLLEELLLL


DSSP  EEEELEEEEEELLLLlllLLHH---------------------------HHHHLLHHHHH
Query TLLPGLIDMHVHLDSlaeVGGY---------------------------NSLEYSDRFWS   87
ident    ||||| | ||                                         |     
Sbjct LVTPGLIDCHTHLIF--aGSRAeefelrqkgvpyaeiarkgggiistvrATRAASEDQLF  116
DSSP  EEEELEEEEEELLLL--lLLLHhhhhhhhhlllhhhhhhllllhhhhhhHHHHLLHHHHH


DSSP  HHHHHHHHHHHHLLEEEEEELL----------lLLLHHHHHHHHHhlllllLLEEEELlL
Query VVQTANAKKTLEAGFTTVRNVG----------aADYDDVGLREAIdagyvpGPRIVTAaI  137
ident        |     | |||                      | ||         |  |   
Sbjct ELALPRVKSLIREGVTTVEIKSgygltledelkXLRVARRLGEAL------PIRVKTT-L  169
DSSP  HHHHHHHHHHHHHLEEEEEEELlllllhhhhhhHHHHHHHHHHHL------LLEEEEE-E


DSSP  LEElllllLLLLLLlhhhllllllllLLHHHHH-HHHHHHH-HLLLLEEEEELLllllll
Query SFGatgghCDSTFFppsmdqknpfnsDSPDEAR-KAVRTLK-KYGAQVIXICATggvfsr  195
ident                                              |              
Sbjct LAA-----HAVPPE------yrddpdSWVETICqEIIPAAAeAGLADAVDVFCE------  212
DSSP  EEE-----LLLLHH------hlllhhHHHHHHHhLHHHHHHhLLLLLEEEEEEL------


DSSP  lllllLLLLLHHHHHHHHHHHHHLLLEEEEEEL---LHHHHHHHHHLLLLEEEELLLLLH
Query gnepgQQQLTYEEMKAVVDEAHMAGIKVAAHAH---GASGIREAVRAGVDTIEHASLVDD  252
ident                 |   |   |  |  |        |   |   |     |    | 
Sbjct -----HIGFSLAQTEQVYLAADQYGLAVKGHXDqlsNLGGSTLAANFGALSVDHLEYLDP  267
DSSP  -----LLLLLHHHHHHHHHHHHHLLLEEEEEELlllLLLHHHHHHHLLLLEEEELLLLLH


DSSP  HHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhHHHHHhhHHHHHHHHLLE
Query EGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdIGELQreNFRKALKAGVK  312
ident |||      |                                   |         |||| 
Sbjct EGIQALAHRGVVATLLPTAFYFLK------------------ETKLP--PVVALRKAGVP  307
DSSP  HHHHHHHHHLLEEEELHHHHHHLL------------------LLLLL--LHHHHHHLLLL


DSSP  EELLLLLL---LLLLlLHHHHHHHHHH-LLLLHHHHHHHLLHHHHHHHLLLLLLLLLLLL
Query MVYGTDAG---IYPHgDNAKQFAVMVR-YGATPLQAIQSATLTAAEALGRSKDVGQVAVG  368
ident      |                       | ||  |    |  || |||     ||  ||
Sbjct XAVSSDINpgtAPIV-SLRXAXNXACTlFGLTPVEAXAGVTRHAARALGEQEQLGQLRVG  366
DSSP  EEELLLLLlllLLLL-LHHHHHHHHHHhHLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLL


DSSP  LLLLEEEE-LLLLLLLHHH--hHLLLEEEELLEEEElll
Query RYGDMIAV-AGDPLADVTT--lEKPVFVMKGGAVVKapx  404
ident    |      | |            |     |       
Sbjct XLADFLVWnCGHPAELSYLigvDQLVSRVVNGEETL--h  403
DSSP  LLLLEEEElLLLLLHHHHLlllLLEEEEEELLEELL--l


No 5: Query=3mtwA Sbjct=2pajA Z-score=32.5

back to top
DSSP  lLEEEEE-EEEEEELL------LLEEEElEEEEEELLEEEEEEEllLLLLLLLEEEEEEE
Query aEIKAVS-AARLLDVA------SGKYVDnPLVIVTDGRITSIGKkgDAVPAGATAVDLPG   53
ident         ||                   |        |  ||    |   | | ||   
Sbjct -PSTLIRnAAAIMTGGrgtaddPSRVPG-PDIRIVGDTIDAIGA--LAPRPGETIVDATD   56
DSSP  -LEEEEElLLEELLLLllllllLLLLLL-LLEEEELLEEEEELL--LLLLLLLEEEELLL


DSSP  EEEEELEEEEEELLLL--LLLLLhhHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLL
Query VTLLPGLIDMHVHLDS--LAEVGgyNSLEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAA  111
ident     |     | ||    |             |                |  ||      
Sbjct CVIYPAWVNTHHHLFQslLKGEP--FRALFDERRFRLAARIGLIELARSGCATVADHNYV  114
DSSP  LEEEELEELLLLLHHHhhLLLLL--LHHHLLHHHHHHHHHHHHHHHHLLLEEEEEELLLL


DSSP  L------LHHHHHHHHHHlllLLLLEEEELLlLEELLLlllllLLLLhHHLL--LLLLLL
Query D------YDDVGLREAIDagyVPGPRIVTAAiSFGATGghcdsTFFPpSMDQ--KNPFNS  163
ident             | |        | | |                            |   
Sbjct YypgmpfDSSAILFEEAE---KLGLRFVLLR-GGATQT-----RQLE-ADLPtaLRPETL  164
DSSP  LllllllLHHHHHHHHHH---HLLLEEEEEE-LLLLLL-----LLLL-LLLLhhHLLLLH


DSSP  llhhhhHHHHHHHHHLL------------lLEEEE-ELLLllllllllllllLLLHHHHH
Query dspdeaRKAVRTLKKYG------------aQVIXI-CATGgvfsrgnepgqqQLTYEEMK  210
ident          |                     |                         || 
Sbjct ------DAYVADIERLAaryhdaspramrrVVMAPtTVLY------------SISPREMR  206
DSSP  ------HHHHHHHHHHHhhllllllllleeEEELLlLLLL------------LLLHHHHH


DSSP  HHHHHHHHLLLEEEEEELlhHHHHHHHHLLL----LEEEELLLLLHHHHHHHHHHLLEEE
Query AVVDEAHMAGIKVAAHAHgaSGIREAVRAGV----DTIEHASLVDDEGIKLAVQKGAYFS  266
ident      |   |     |    |                  |   ||   | |  | |    
Sbjct ETAAVARRLGLRMHSHLSgkSPVAFCGEHDWlgsdVWYAHLVKVDADEIALLAQTGTGVA  266
DSSP  HHHHHHHHLLLEEEEELLllLHHHHHHHLLLllllEEEELLLLLLHHHHHHHHHHLLEEE


DSSP  LLLLLHHHHhhhhhhhlllhhhhhhhhhhhhhhhhHHHHHHHHLLEEELLLLLL-LLLLL
Query MDIYNTDYTqaegkkngvlednlrkdrdigelqreNFRKALKAGVKMVYGTDAG-IYPHG  325
ident                                      |    |||    | |        
Sbjct HCPQSNGRL--------------------------PVREMADAGVPVSIGVDGAaSNEAA  300
DSSP  ELHHHHHLL--------------------------LLLLHHHHLLLEEELLLHHhHLLLL


DSSP  LHHHHHHHHHHLL----LLHHHHHHHLLHHHHHHHLLLlLLLLLLLLLLLLEEEELL---
Query DNAKQFAVMVRYG----ATPLQAIQSATLTAAEALGRSkDVGQVAVGRYGDMIAVAG---  378
ident |                |     |   |   |   |    || ||||   |         
Sbjct DMISEVHMTWLAQrarlASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIAVYRLddp  359
DSSP  LHHHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELllh


DSSP  -------LLLLLHHH-hHLLL-EEEELLEEEELL--------------------------
Query -------DPLADVTT-lEKPV-FVMKGGAVVKAP--------------------------  403
ident             |       |      |  |                             
Sbjct ryfglhdPAIGPVASggRPSVmALFSAGKRVVVDdliegvdikelggearrvvrellrev  419
DSSP  hhlllllHHHHHHHLllLLEEeEEEELLEEEEELlllllllhhhhhhhhhhhhhhhhhhh


DSSP  -l
Query -x  404
ident   
Sbjct vv  421
DSSP  hl


No 6: Query=3mtwA Sbjct=1j6pA Z-score=31.3

back to top
DSSP  lLEEEEEEEEEEELLLLEEEeLEEEEEELLEEEEEEELLLLllllleEEEEEEEEEEELE
Query aEIKAVSAARLLDVASGKYVdNPLVIVTDGRITSIGKKGDAvpagatAVDLPGVTLLPGL   60
ident            |   |        |    | |                 || |    | |
Sbjct -HHXIIGNCLILKDFSSEPF-WGAVEIENGTIKRVLQGEVK-----vDLDLSGKLVXPAL   53
DSSP  -LEEEEEEEEELLLLLLLLE-EEEEEEELLEEEEEEELLLL-----lLEELLLEEEEELE


DSSP  EEEEELLLL--LLLL-------------LHHHHHHLLHHHHHHHHHHHHHHHHHLLEEEE
Query IDMHVHLDS--LAEV-------------GGYNSLEYSDRFWSVVQTANAKKTLEAGFTTV  105
ident    | |     |  |                                        |    
Sbjct FNTHTHAPXtlLRGVaedlsfeewlfskVLPIEDRLTEKXAYYGTILAQXEXARHGIAGF  113
DSSP  EEEEELHHHhhHLLLlllllhhhhhhllHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEEE


DSSP  EELLLLLLHHHHHHHHHhlllllLLEEEELlLLEELLLlllllllllhhhllLLLLllll
Query RNVGAADYDDVGLREAIdagyvpGPRIVTAaISFGATGghcdstffppsmdqKNPFnsds  165
ident                        | |                                  
Sbjct VDXYFHEEWIAKAVRDF------GXRALLT-RGLVDSN------------gdDGGR----  150
DSSP  EEEELLHHHHHHHHHHH------LLEEEEE-EEELLLL------------llLLLH----


DSSP  hhhhhHHHHHHHHLLL-------LEEEEELLLllllllllllllLLLHHHHHHHHHHHHH
Query pdearKAVRTLKKYGA-------QVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHM  218
ident           |                                     |  | | | |  
Sbjct ----lEENLKLYNEWNgfegrifVGFGPHSPY------------LCSEEYLKRVFDTAKS  194
DSSP  ----hHHHHHHHHHHLlhhhleeEEEEELLLL------------LLLHHHHHHHHHHHHH


DSSP  LLLEEEEEEL-----LHHHhhHHHHLLL----LEEEELLLLLHHHHHHHHHHLLEEELLL
Query AGIKVAAHAH-----GASGirEAVRAGV----DTIEHASLVDDEGIKLAVQKGAYFSMDI  269
ident     |  |                  |         |                   |   
Sbjct LNAPVTIHLYetskeEYDL-eDILNIGLkevkTIAAHCVHLPERYFGVLKDIPFFVSHNP  253
DSSP  HLLLEEEEELlllllLLLL-hHHHLLLLllllEEEEELLLLLHHHHHHHLLLLEEEEELH


DSSP  LLHHHHHhhhhhhlllhhhhhhhhhhHHHHhhHHHHHHHHLLEEELLLLLL-LLLLLLHH
Query YNTDYTQaegkkngvlednlrkdrdiGELQreNFRKALKAGVKMVYGTDAG-IYPHGDNA  328
ident                                         | |   |||           
Sbjct ASNLKLG-------------------NGIA--PVQRXIEHGXKVTLGTDGAaSNNSLNLF  292
DSSP  HHHHHLL-------------------LLLL--LHHHHHHLLLEEEELLLLLlLLLLLLHH


DSSP  HHHHHHHHLL-------LLHHHHHHHLLHHHHHHHLLllLLLLLLLLLLLLEEEELL---
Query KQFAVMVRYG-------ATPLQAIQSATLTAAEALGRskDVGQVAVGRYGDMIAVAG---  378
ident                            |   | | |     |    |   |         
Sbjct FEXRLASLLQkaqnprnLDVNTCLKXVTYDGAQAXGF--KSGKIEEGWNADLVVIDLdlp  350
DSSP  HHHHHHHHHHhllllllLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELllh


DSSP  -------LLLLLHH-HHHLLLEEEELLEEEELL-----------------------l
Query -------DPLADVT-TLEKPVFVMKGGAVVKAP-----------------------x  404
ident             |             |                              
Sbjct exfpvqnIKNHLVHaFSGEVFATXVAGKWIYFDgeyptidseevkrelariekelys  407
DSSP  hhllhhhHHHHHHHlLLLLLLEEEELLEEEEELlllllllhhhhhhhhhhhhhhhhl


No 7: Query=3mtwA Sbjct=4cqbA Z-score=30.9

back to top
DSSP  --LLEEEEEEEEEEEllllEEEElEEEEEELLEEEEEEELlLLLLlLLEEEEEEEEEEEE
Query --AEIKAVSAARLLDvasgKYVDnPLVIVTDGRITSIGKKgDAVPaGATAVDLPGVTLLP   58
ident           | |      |            ||  |  |           |  |    |
Sbjct skDFDLIIRNAYLSE----KDSV-YDIGIVGDRIIKIEAK-IEGT-VKDEIDAKGNLVSP   53
DSSP  llLEEEEEEEEEELL----LLEE-EEEEEELLEEEEEELL-LLLL-EEEEEELLLLLEEE


DSSP  LEEEEEELLL-LLLLL--------------------lhHHHHHLLHHHHHHHHHHHHHHH
Query GLIDMHVHLD-SLAEV--------------------ggYNSLEYSDRFWSVVQTANAKKT   97
ident |  | | | | |                                            |   
Sbjct GFVDAHTHMDkSFTSTgerlpkfwsrpytrdaaiedglKYYKNATHEEIKRHVIEHAHMQ  113
DSSP  LEEEEEELHHhLLLLLlllllllllllllhhhhhhhhhHHHHHLLHHHHHHHHHHHHHHH


DSSP  HHLLEEEEEELLL--------LLLHHHHHHHHHHllllLLLEEEELlLLEELllllllll
Query LEAGFTTVRNVGA--------ADYDDVGLREAIDagyvPGPRIVTAaISFGAtgghcdst  149
ident    |    |            |        |           |                 
Sbjct VLHGTLYTRTHVDvdsvaktkAVEAVLEAKEELK----DLIDIQVV-AFAQS--------  160
DSSP  HHLLEEEEEEEEElllllllhHHHHHHHHHHHLL----LLLEEEEE-EELLL--------


DSSP  lllhhhllllllLLLLhhHHHHHHHHHHHLLLLEEEEELLlllllllllllLLLL--LHH
Query ffppsmdqknpfNSDSpdEARKAVRTLKKYGAQVIXICATggvfsrgnepgQQQL--TYE  207
ident                   |     |     |                             
Sbjct ------------GFFVdlESESLIRKSLDMGCDLVGGVDP-----------ATREnnVEG  197
DSSP  ------------LLLLllLHHHHHHHHHHHLLLEEELLLL-----------LLLLllHHH


DSSP  HHHHHHHHHHHLLLEEEEEEL-----LHHHHHHHHHLL-------lLEEEELLLL-----
Query EMKAVVDEAHMAGIKVAAHAH-----GASGIREAVRAG-------vDTIEHASLV-----  250
ident         |         | |     |   |                |  ||        
Sbjct SLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTiengykgrVTTSHAWCFadaps  257
DSSP  HHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHhhllllllEEEEELLHHhhllh


DSSP  --LHHHHHHHHHHLLEEELLLLLhhhhhhhhhhhlllhhhhhhhhhhHHHHhhHHHHHHH
Query --DDEGIKLAVQKGAYFSMDIYNtdytqaegkkngvlednlrkdrdiGELQreNFRKALK  308
ident    || | |    |  |                                       | | 
Sbjct ewLDEAIPLYKDSGMKFVTCFSS-----------------------tPPTM--PVIKLLE  292
DSSP  hhHHHHHHHHHHHLLEEEEELLL-----------------------lLLLL--LHHHHHH


DSSP  HLLEEELLLLLLL-----LLLLLHHHHHHHHHHLL-----lLHHHHHHHLLHHHHHHHLL
Query AGVKMVYGTDAGI-----YPHGDNAKQFAVMVRYG-----aTPLQAIQSATLTAAEALGR  358
ident ||       |           ||                           |   |  || 
Sbjct AGINLGCASDNIRdfwvpFGNGDMVQGALIETQRLelktnrDLGLIWKMITSEGARVLGI  352
DSSP  LLLEEEEELLLLLlllllLLLLLHHHHHHHHHHHHllllhhHHHHHHHHHLHHHHHHHLL


DSSP  LLLLlLLLLLLLLLEEEE-LLLLLLLHHHHHLLLEEEELLEEEELL----l
Query SKDVgQVAVGRYGDMIAV-AGDPLADVTTLEKPVFVMKGGAVVKAP----x  404
ident  |      ||   |        |        |   | | |           
Sbjct EKNY-GIEVGKKADLVVLnSLSPQWAIIDQAKRLCVIKNGRIIVKDeviva  402
DSSP  HHHL-LLLLLLLLLEEEElLLLHHHHHHHLLLEEEEEELLEEEEELleell


No 8: Query=3mtwA Sbjct=3ls9A Z-score=30.5

back to top
DSSP  llEEEEE-EEEEEELL-LLEEEELEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEE
Query aeIKAVS-AARLLDVA-SGKYVDNPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLP   58
ident           |                      |   ||            |  |   ||
Sbjct --MILIRgLTRVITFDdQERELEDADILIDGPKIVAVGK-DLSDRSVSRTIDGRGMIALP   57
DSSP  --LEEEEeEEEEELLLlLLLEEEEEEEEEELLEEEEEEL-LLLLLLLLEEEELLLEEEEE


DSSP  LEEEEEELLLL--LLLL--------------LHHHHH-----HLLH-HHHHHHHHHHHHH
Query GLIDMHVHLDS--LAEV--------------GGYNSL-----EYSD-RFWSVVQTANAKK   96
ident |||  | ||                          |                |  |    
Sbjct GLINSHQHLYEgaMRAIpqlervtmaswlegVLTRSAgwwrdGKFGpDVIREVARAVLLE  117
DSSP  LEEEEEELHHHhhHLLLhhhllllhhhhhhhHHHHHHhhhhlLLLLhHHHHHHHHHHHHH


DSSP  HHHLLEEEEEELLLL------LLHHHHHHHHHHlllLLLLEEEELLlLEELLL--lllLL
Query TLEAGFTTVRNVGAA------DYDDVGLREAIDagyVPGPRIVTAAiSFGATG--ghcDS  148
ident  |  | |||            |       ||       | |   |  |    |       
Sbjct SLLGGITTVADQHLFfpgataDSYIDATIEAAT---DLGIRFHAAR-SSMTLGkseggFC  173
DSSP  HHHLLEEEEEEEELLllllllLLHHHHHHHHHH---HHLLEEEEEE-LLLLLLhhhllLL


DSSP  LLllhhhlLLLLllllLHHHHHHHHHHHHHLLL---------LEEEEELLLlllllllll
Query TFfppsmdQKNPfnsdSPDEARKAVRTLKKYGA---------QVIXICATGgvfsrgnep  199
ident                   |        |                   |            
Sbjct DD------LFVE----PVDRVVQHCLGLIDQYHepepfgmvrIALGPCGVP---------  214
DSSP  LH------HHLL----LHHHHHHHHHHHHHHHLllllllleeEEELLLLLL---------


DSSP  lllLLLHHHHHHHHHHHHHLLLEEEEEELL------------hHHHHHHHHLLL----LE
Query gqqQLTYEEMKAVVDEAHMAGIKVAAHAHG------------aSGIREAVRAGV----DT  243
ident        |   |    |         |                   |     |       
Sbjct ---YDKPELFEAFAQMAADYDVRLHTHFYEpldagmsdhlygmTPWRFLEKHGWasdrVW  271
DSSP  ---LLLHHHHHHHHHHHHHHLLEEEEEELLllhhhhhhhhhllLHHHHHHHLLLllllEE


DSSP  EEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhhHHHHhhHH
Query IEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdiGELQreNF  303
ident   ||     | |      |      |                            |     
Sbjct LAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG-------------------WGLA--PI  310
DSSP  EEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL--LH


DSSP  HHHHHHLLEEELLLLLL-LLLLLLHHHHHHHHHHL-----------LLLHHHHHHHLLHH
Query RKALKAGVKMVYGTDAG-IYPHGDNAKQFAVMVRY-----------GATPLQAIQSATLT  351
ident |  | ||     ||        |                                 ||  
Sbjct REYLDAGITVGFGTTGSaSNDGGNLLGDLRLAALAhrpadpnepekWLSARELLRMATRG  370
DSSP  HHHHHLLLEEEELLLLLlLLLLLLHHHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHH


DSSP  HHHHHLLLlLLLLLLLLLLLLEEEELL----------LLLLLHH--hhHLLLEEEELLEE
Query AAEALGRSkDVGQVAVGRYGDMIAVAG----------DPLADVT--tlEKPVFVMKGGAV  399
ident  || |||  | |    ||  |                                |   | |
Sbjct SAECLGRP-DLGVLEEGRAADIACWRLdgvdrvgvhdPAIGLIMtglsDRASLVVVNGQV  429
DSSP  HHHHLLLL-LLLLLLLLLLLLEEEEELllhhhlllllHHHHHHHllllLLLLEEEELLEE


DSSP  EELL-------------------l
Query VKAP-------------------x  404
ident                         
Sbjct LVENerpvladlerivanttalip  453
DSSP  EEELleellllhhhhhhhhhhhll


No 9: Query=3mtwA Sbjct=1k6wA Z-score=30.5

back to top
DSSP  lLEEEEEEEEEEellllEEEELEEEEEELLEEEEEEELLlllllLLEEEEEEEEEEEELE
Query aEIKAVSAARLLdvasgKYVDNPLVIVTDGRITSIGKKGdavpaGATAVDLPGVTLLPGL   60
ident         |||                 || |  |              |       |  
Sbjct -ALQTIINARLP-----GEEGLWQIHLQDGKISAIDAQSgvmpiTENSLDAEQGLVIPPF   54
DSSP  -LLLEEEEELLL-----LLLLEEEEEEELLEEEEEEEELlllllLLLEEELLLLEEELLE


DSSP  EEEEELLLLLLLLL----------------HHHHHHLLH-HHHHHHHHHHHHHHHHLLEE
Query IDMHVHLDSLAEVG----------------GYNSLEYSD-RFWSVVQTANAKKTLEAGFT  103
ident    | |||     |                                     |     |  
Sbjct VEPHIHLDTTQTAGqpnwnqsgtlfegierWAERKALLThDDVKQRAWQTLKWQIANGIQ  114
DSSP  EEEEELLLLLLLLLlllllllllhhhhhhhHHLLHHHLLhHHHHHHHHHHHHHHHHLLEE


DSSP  EEEELLL-------LLLHHHHHHHHHHllllLLLEEEELlLLEELlllllllllllhhhl
Query TVRNVGA-------ADYDDVGLREAIDagyvPGPRIVTAaISFGAtgghcdstffppsmd  156
ident  ||           |                |                            
Sbjct HVRTHVDvsdatltALKAMLEVKQEVA----PWIDLQIV-AFPQE---------------  154
DSSP  EEEEEEEllllllhHHHHHHHHHHHHL----LLLEEEEE-EELLL---------------


DSSP  lllllLLLLHHHHHHHHHHHHHLLLLEEEEELLLllllllllllllLLLHhHHHHHHHHH
Query qknpfNSDSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqqQLTYeEMKAVVDEA  216
ident         |              || |                                |
Sbjct -----GILSYPNGEALLEEALRLGADVVGAIPHF-------eftreYGVE-SLHKTFALA  201
DSSP  -----LLLLLLLHHHHHHHHHHLLLLEEEELHHH-------lllhhHHHH-HHHHHHHHH


DSSP  HHLLLEEEEEEL-----lHHHHHHHHHLL-------lLEEEELLLL-------LHHHHHH
Query HMAGIKVAAHAH-----gASGIREAVRAG-------vDTIEHASLV-------DDEGIKL  257
ident          |                            |  |                 |
Sbjct QKYDRLIDVHCDeiddeqSRFVETVAALAhhegmgarVTASHTTAMhsyngayTSRLFRL  261
DSSP  HHHLLEEEEEELllllllLLHHHHHHHHHhhhllhhhEEEEELHHHhhllhhhHHHHHHH


DSSP  HHHHLLEEELLLLLHHHhhhhhhhhlllhhhhhHHHH-----hhHHHHhHHHHHHHHLLE
Query AVQKGAYFSMDIYNTDYtqaegkkngvlednlrKDRD-----igELQReNFRKALKAGVK  312
ident     |  |                                              |  |  
Sbjct LKMSGINFVANPLVNIH----------------LQGRfdtypkrRGIT-RVKEMLESGIN  304
DSSP  HHHHLLEEEELHHHHHH----------------HLLLlllllllLLLL-LHHHHHHLLLL


DSSP  EELLLLLLL-----LLLLLHHHHHHHHH-HLLL----LHHHHHHHLLHHHHHHHLlLLLL
Query MVYGTDAGI-----YPHGDNAKQFAVMV-RYGA----TPLQAIQSATLTAAEALGrSKDV  362
ident    | |                                        |   |  |    | 
Sbjct VCFGHDDVFdpwypLGTANMLQVLHMGLhVCQLmgygQINDGLNLITHHSARTLN-LQDY  363
DSSP  EEELLLLLLlllllLLLLLHHHHHHHHHhHLLLllhhHHHHHHHHHLHHHHHHLL-LLLL


DSSP  lLLLLLLLLLEEEELL-LLLLLHHHHHLLLEEEELLEEEELL------------------
Query gQVAVGRYGDMIAVAG-DPLADVTTLEKPVFVMKGGAVVKAP------------------  403
ident    | |     |                      || |                      
Sbjct -GIAAGNSANLIILPAeNGFDALRRQVPVRYSVRGGKVIASTqpaqttvyleqpeaidyk  422
DSSP  -LLLLLLLLLEEEELLlLHHHHHHHLLLLLEEEELLEEEEELlllleeeellleeeelll


DSSP  l
Query x  404
ident  
Sbjct r  423
DSSP  l


No 10: Query=3mtwA Sbjct=2vunA Z-score=30.3

back to top
DSSP  lLEEEEE-EEEEEELL--LLEEEElEEEEEELLEEEEEEELLL-LLLLLLEEEEEEEEEE
Query aEIKAVS-AARLLDVA--SGKYVDnPLVIVTDGRITSIGKKGD-AVPAGATAVDLPGVTL   56
ident                   |          | || |  ||          ||  |  | | 
Sbjct -SKTIIKnIGKIVSGDikSPVLQA-DTIVVEDGLIAAIGGEELmKDAGDATIIDAAGSTV   58
DSSP  -LEEEEElLLEEELLLllLLEELL-LEEEEELLEEEEEELHHHhLLLLLLEEEELLLLEE


DSSP  EELEEEEEELLL----LLLLLLhhhhhhllhhhhhhhhhHHHHHHHHLLEEEEEELLL--
Query LPGLIDMHVHLD----SLAEVGgynsleysdrfwsvvqtANAKKTLEAGFTTVRNVGA--  110
ident  ||| | |||                                   |  | ||    |   
Sbjct TPGLLDTHVHVSggdyAPRQKT----------------mDFISSALHGGVTTMISAGSph  102
DSSP  EELEEEEEELLLllleEHHHLE----------------eLHHHHHHLLLEEEEEELLLll


DSSP  --------------LLLHHHHHHHHHhlllLLLLEEEELLLLEellllllllllllhhhl
Query --------------ADYDDVGLREAIdagyVPGPRIVTAAISFgatgghcdstffppsmd  156
ident               |         |       |      |                    
Sbjct fpgrpkdaagtkalAITLSKSYYNAR----PAGVKVHGGAVIL-----------------  141
DSSP  lllllllhhhhhhhHHHHHHHHHHLL----HHHLEEELLEELL-----------------


DSSP  lllllLLLLhhhHHHHHHHHHHLLLLEEEEELllllllllllllllLLLHHHHHHHHHHH
Query qknpfNSDSpdeARKAVRTLKKYGAQVIXICAtggvfsrgnepgqqQLTYEEMKAVVDEA  216
ident                     || |                          |     |  |
Sbjct -----EKGL---TEEDFIEMKKEGVWIVGEVG-----------lgtIKNPEDAAPMVEWA  182
DSSP  -----LLLL---LHHHHHHHHHLLLLEEEEEL-----------lllLLLHHHHHHHHHHH


DSSP  HHLLLEEEEEELL------hHHHH-HHHHLLLLEEEELL----LLLHHHHHHHHH-HLLE
Query HMAGIKVAAHAHG------aSGIR-EAVRAGVDTIEHAS----LVDDEGIKLAVQ-KGAY  264
ident |  | ||  |  |                   |   |                       
Sbjct HKHGFKVQMHTGGtsipgssTVTAdDVIKTKPDVVSHINggptAISVQEVDRIMDeTDFA  242
DSSP  HHLLLEEEEELLLlllllllLLLHhHHHHHLLLEEELLLllllLLLHHHHHHHHHhLLLE


DSSP  EELLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHL------lEEELLLL
Query FSMDIYntdytqaegkkngvlednlrkdrdigelQRENFRKALKAG------vKMVYGTD  318
ident                                                          | |
Sbjct MEIVQC---------------------------gNPKIADYVARRAaekgqlgRVIFGND  275
DSSP  EEEELL---------------------------lLHHHHHHHHHHHhhhllhhHEEEELL


DSSP  LLL--LLLLLH-HHHHHHHH-HLLLLHHHHHHHLLHHHHHHHLLllLLLLLLLLLLLLEE
Query AGI--YPHGDN-AKQFAVMV-RYGATPLQAIQSATLTAAEALGRskDVGQVAVGRYGDMI  374
ident |                         |  |   ||       |     |  | |   | |
Sbjct APSgtGLIPLGiLRNMCQIAsMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADLI  333
DSSP  LLLllLLLLLHhHHHHHHHHhHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEE


DSSP  EELL-------LLLL----LHHHhhLLLEEEELLEEEELL-------------l
Query AVAG-------DPLA----DVTTleKPVFVMKGGAVVKAP-------------x  404
ident            |                 |   |  |                 
Sbjct IMDTplgsvaeDAMGaiaaGDIP--GISVVLIDGEAVVTKsrntppakraakil  385
DSSP  EEELlllllllLHHHhhhhLLLL--EEEEEEELLEEEELLllllllllllleel


No 11: Query=3mtwA Sbjct=3icjA Z-score=30.1

back to top
DSSP  lLEEEEEEEEEE-ELLLLEEEelEEEEEELLEEEEEEELL--LLLL--LLLEEEEEEEEE
Query aEIKAVSAARLL-DVASGKYVdnPLVIVTDGRITSIGKKG--DAVP--AGATAVDLPGVT   55
ident    ||             | |          |    |           ||    || |  
Sbjct -CMKALINGTIYtSFSPVKKV--SGLVISNERVLYAGDSStaLRIAelAGGEIIDLKGKF   57
DSSP  -LEEEEELLEEEeEELLEEEE--LEEEEELLEEEEEELHHhhHHHHhhHLLEEEELLLLE


DSSP  EEELEEEEEELLLL--LLLL----------------------------------------
Query LLPGLIDMHVHLDS--LAEV----------------------------------------   73
ident   |   | | |||                                               
Sbjct VMPAFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
DSSP  EEELEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllll


DSSP  -----------------------------------------------------lHHHH--
Query -----------------------------------------------------gGYNS--   78
ident                                                             
Sbjct redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIIne  177
DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHhh


DSSP  HHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLLLHhHHHHHHHHLLLLLLLEEEELLLl
Query LEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAADYDdVGLREAIDAGYVPGPRIVTAAIs  138
ident                    |  |   |                                 
Sbjct KILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGEKA-LKALFELEREGRLKMNVFAYLS-  235
DSSP  LLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELHHH-HHHHHHHHHLLLLLLEEEEEEL-


DSSP  eellllllllllllhhhllllllllllhhhhhhhhhHHHHL--------------lLLEE
Query fgatgghcdstffppsmdqknpfnsdspdearkavrTLKKY--------------gAQVI  184
ident                                      |                      
Sbjct -----------------------------------pELLDKleelnlgkfegrrlrIWGV  260
DSSP  -----------------------------------hHHHHHhhhhlllleellleeEEEE


DSSP  EEELLLLLLLllLLLL-------------LLLLLHHHHHHHHHHHHHLLLEEEEEELLHH
Query XICATGGVFSrgNEPG-------------QQQLTYEEMKAVVDEAHMAGIKVAAHAHGAS  231
ident |    |                              |   |   |   |  || || |  
Sbjct XLFVDGSLGA--RTALlsepytdnpttsgELVMNKDEIVEVIERAKPLGLDVAVHAIGDK  318
DSSP  EEELLLLLLL--LLLLlllllllllllllLLLLLHHHHHHHHHHHLLLLLEEEEEELLHH


DSSP  HHHHHHHLL-----LLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHhhhhhhhhlllh
Query GIREAVRAG-----VDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYtqaegkkngvle  286
ident     |  |         ||||||| |             |                    
Sbjct AVDVALDAFeeaefSGRIEHASLVRDDQLERIKELKVRISAQPHFIVS------------  366
DSSP  HHHHHHHHHhhhllLLEEEELLLLLHHHHHHHHHHLLEEEELLLHHHH------------


DSSP  hhhhhHHHH--------hHHHHhHHHHHHHhLLEEELLLLLLLLLlLLHHHHHHHHHH--
Query dnlrkDRDI--------gELQReNFRKALKaGVKMVYGTDAGIYPhGDNAKQFAVMVR--  336
ident      |  |                        |    ||  | |  |        |   
Sbjct -----DWWIvnrvgeeraKWAY-RLKTLSS-ITKLGFSTDSPIEP-ADPWVSIDAAVNry  418
DSSP  -----LLLHhhhhhhhhhHHLL-LHHHHHH-HLLEEELLLLLLLL-LLHHHHHHHHHHll


DSSP  -----LLLLHHHHHHHLLHHHHHHHLLLlLLLLLLLLLLLLEEEELLLLLLlhhhhhlll
Query -----YGATPLQAIQSATLTAAEALGRSkDVGQVAVGRYGDMIAVAGDPLAdvttlekpv  391
ident             |    |   |       | |    |     |    |||          
Sbjct vvdpgERVSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDRDPLK---------  468
DSSP  lllhhHLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELLLLLL---------


DSSP  eeeelleeeelll
Query fvmkggavvkapx  404
ident              
Sbjct -------------  468
DSSP  -------------


No 12: Query=3mtwA Sbjct=2uz9A Z-score=29.4

back to top
DSSP  LLEEEEEEeEEEELL---LLEEEELEEEEEEL-LEEEEEEELLLL-----LLLL--lEEE
Query AEIKAVSAaRLLDVA---SGKYVDNPLVIVTD-GRITSIGKKGDA-----VPAG--aTAV   49
ident                           |  | | | |                        
Sbjct PLAHIFRG-TFVHSTwtcPMEVLRDHLLGVSDsGKIVFLEEASQQeklakEWCFkpcEIR   59
DSSP  LLLEEEEE-EEEELLlllLLEEEEEEEEEELLlLLEEEEEEHHHHhhhhhHHLLlhhHEE


DSSP  EEE-EEEEEELEEEEEELLLL--LLLLL---------HHHH-----hhlLHHHHHHHHHH
Query DLP-GVTLLPGLIDMHVHLDS--LAEVG---------GYNS-----leySDRFWSVVQTA   92
ident  |       ||| | | |      |                           |   | | 
Sbjct ELShHEFFMPGLVDTHIHASQysFAGSSidlpllewlTKYTfpaehrfqNIDFAEEVYTR  119
DSSP  ELLlLLEEEELEEEEEEEHHHhhHLLLLllllhhhhhHHLHhhhhhhhhLHHHHHHHHHH


DSSP  HHHHHHHLLEEEEEELLL----LLLHHHHHHHHHHllllllLEEEELlLLEELLllllLL
Query NAKKTLEAGFTTVRNVGA----ADYDDVGLREAIDagyvpgPRIVTAaISFGATgghcDS  148
ident     ||  | ||                              |                 
Sbjct VVRRTLKNGTTTACYFATihtdSSLLLADITDKFG------QRAFVG-KVCMDL----ND  168
DSSP  HHHHHHHLLEEEEEEELLllhhHHHHHHHHHHHHL------LEEEEE-LEELLL----LL


DSSP  LLllhhhllllllLLLLhHHHHHHHHHHHHLL--------LLEEEEELLLllllllllll
Query TFfppsmdqknpfNSDSpDEARKAVRTLKKYG--------AQVIXICATGgvfsrgnepg  200
ident ||                 |  |                                     
Sbjct TF--------peyKETT-EESIKETERFVSEMlqknysrvKPIVTPRFSL----------  209
DSSP  LL--------lllLLLH-HHHHHHHHHHHHHHhhhlllleEEEEEELLHH----------


DSSP  llLLLHHHHHHHHHHHHHLLLEEEEEEL---------------lhHHHHHHHHLLL----
Query qqQLTYEEMKAVVDEAHMAGIKVAAHAH---------------gaSGIREAVRAGV----  241
ident         |      |         |                                  
Sbjct --SCSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsykNYTSVYDKNNLltnk  267
DSSP  --HLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllllLHHHHHHHLLLllll


DSSP  LEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhhHHHHhh
Query DTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdiGELQre  301
ident     |      |        ||                                      
Sbjct TVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS-------------------SGFL--  306
DSSP  EEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL--


DSSP  HHHHHHHHLLEEELLLLLL-LLLLlLHHHHHHHHHHLL------------LLHHHHHHHL
Query NFRKALKAGVKMVYGTDAG-IYPHgDNAKQFAVMVRYG------------ATPLQAIQSA  348
ident |    ||  ||   |||    |            |                |       |
Sbjct NVLEVLKHEVKIGLGTDVAgGYSY-SMLDAIRRAVMVSnillinkvneksLTLKEVFRLA  365
DSSP  LHHHHHHLLLEEEELLLLLlLLLL-LHHHHHHHHHHHHhhhhhlllllllLLHHHHHHHH


DSSP  LHHHHHHHLLLLLLLLLLLLLLLLEEEELL---------------------LLLLLHHHH
Query TLTAAEALGRSKDVGQVAVGRYGDMIAVAG---------------------DPLADVTTL  387
ident ||    |||     |   ||   | |                                  
Sbjct TLGGSQALGLDGEIGNFEVGKEFDAILINPkasdspidlfygdffgdiseaVIQKFLYLG  425
DSSP  LHHHHHHLLLLLLLLLLLLLLLLLEEEELLlllllllllllhhhhlllllhHHHHHHHHL


DSSP  HL--LLEEEELLEEEELll
Query EK--PVFVMKGGAVVKApx  404
ident        |  ||  |    
Sbjct DDrnIEEVYVGGKQVVPfs  444
DSSP  LHhhEEEEEELLEEEELll


No 13: Query=3mtwA Sbjct=3nqbA Z-score=27.8

back to top
DSSP  ----------------------llEEEEEEEEEEELLLLEEEElEEEEEELLEEEEEEEL
Query ----------------------aeIKAVSAARLLDVASGKYVDnPLVIVTDGRITSIGKK   38
ident                                 | ||  |              | |    
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDVVTGELRP-ADIGIVGALIASVHEP   59
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLLLLEEE-LEEEEELLEEEEEELL


DSSP  LLLLLlLLEEEEEEEEEEEELEEEEEELLLLLLlllhhhhhhllhhhhhHHHHHHHHHHH
Query GDAVPaGATAVDLPGVTLLPGLIDMHVHLDSLAevggynsleysdrfwsVVQTANAKKTL   98
ident        |   |  |    ||||| | |  |                      | |    
Sbjct ASRRD-AAQVIDAGGAYVSPGLIDTHXHIESSX----------------ITPAAYAAAVV  102
DSSP  LLLLL-EEEEEELLLLEEEELEEEEEELHHHHL----------------LLHHHHHHHHH


DSSP  HLLEEEEEELLL---------LLLHHHHHHHHHhlllllLLEEEELlLLEE--LLLLlll
Query EAGFTTVRNVGA---------ADYDDVGLREAIdagyvpGPRIVTAaISFG--ATGGhcd  147
ident   | ||                        |          |              |   
Sbjct ARGVTTIVWDPHefgnvhgvdGVRWAAKAIENL------PLRAILL-APSCvpSAPG---  152
DSSP  LLLEEEEEELLHhhhhhhlhhHHHHHHHHHLLL------LLEEEEE-ELLLllLLLL---


DSSP  lllllhhhLLLLLLllllhhhHHHHHHHHHHL-LLLEEE-EELLlllllllllllllLLL
Query stffppsmDQKNPFnsdspdeARKAVRTLKKY-GAQVIX-ICATggvfsrgnepgqqQLT  205
ident              |              |        |  |                   
Sbjct ------leRGGADF-------DAAILADLLSWpEIGGIAeIXNX-------------RGV  186
DSSP  ------llLLLLLL-------LHHHHHHHHLLlLEEEEEeELLH-------------HHH


DSSP  H---HHHHHHHHHHHHLLLEEEEEELLHH--hHHHHHHLLLLEEEELlLLLHhHHHHHHH
Query Y---EEMKAVVDEAHMAGIKVAAHAHGAS--gIREAVRAGVDTIEHAsLVDDeGIKLAVQ  260
ident           |     |   |  || |           |||                   
Sbjct IerdPRXSGIVQAGLAAEKLVCGHARGLKnadLNAFXAAGVSSDHEL-VSGE-DLXAKLR  244
DSSP  HlllHHHHHHHHHHHHHLLEEEELLLLLLhhhHHHHHHLLLLEELLL-LLHH-HHHHHHH


DSSP  HLLEEELLlLLHHhhhhhhhhhlllhhhhhhhhhhhhHHHHHHHHHHHHL----lEEELL
Query KGAYFSMDiYNTDytqaegkkngvlednlrkdrdigeLQRENFRKALKAG----vKMVYG  316
ident  |          |                             |  ||             
Sbjct AGLTIELR-GSHD------------------------HLLPEFVAALNTLghlpqTVTLC  279
DSSP  LLLEEEEE-LLLH------------------------HHHHHHHHHHHHHlllllLEEEE


DSSP  LLlLLLL-----lLLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLlLLLLLLLLLLLL
Query TDaGIYP-----hGDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRsKDVGQVAVGRYG  371
ident ||    |      |         ||||  |  |   ||| ||  |||  | |  | ||  
Sbjct TD-DVFPddllqgGGLDDVVRRLVRYGLKPEWALRAATLNAAQRLGR-SDLGLIAAGRRA  337
DSSP  LL-LLLHhhhhhlLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLL


DSSP  LEEEELLlllllHHHHhLLLEEEELLEEEELL----------------------------
Query DMIAVAGdpladVTTLeKPVFVMKGGAVVKAP----------------------------  403
ident |                    |   |  |                               
Sbjct DIVVFED-----LNGF-SARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxand  391
DSSP  LEEEELL-----LLLL-LEEEEEELLEEEEELleelllllllllhhhllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct flvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktg  451
DSSP  hllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct fltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailp  511
DSSP  eeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct lplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgi  571
DSSP  lllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllle


DSSP  ---------------l
Query ---------------x  404
ident                 
Sbjct advltgkvxespviev  587
DSSP  eelllleeellleeel


No 14: Query=3mtwA Sbjct=1onxA Z-score=27.7

back to top
DSSP  ------LLEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEELLLL-LLLLLEEEEEEE
Query ------AEIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKKGDA-VPAGATAVDLPG   53
ident       |       | |             | |  | |               | ||| |
Sbjct midytaAGFTLLQGAHLYAP--EDRGI-CDVLVANGKIIAVASNIPSdIVPNCTVVDLSG   57
DSSP  llllhhHLLEEEEEEEEELL--LEEEE-EEEEEELLEEEEEELLLLLlLLLLLEEEELLL


DSSP  EEEEELEEEEEELLLLLllLLHHHHHhllhhhhhhHHHHhHHHHHHLLEEEEEELL----
Query VTLLPGLIDMHVHLDSLaeVGGYNSLeysdrfwsvVQTAnAKKTLEAGFTTVRNVG----  109
ident   | || || ||||                        |      ||| | |        
Sbjct QILCPGFIDQHVHLIGG-gGEAGPTT-------rtPEVA-LSRLTEAGVTSVVGLLgtds  108
DSSP  LEEEELEEEEEELLLLL-lLLLLHHH-------llLLLL-HHHHHHLLEEEEEELLllll


DSSP  --lLLLHHHHHHHHHHLlllLLLEEEELLLLEELlllllllllllhhhllllllllllhh
Query --aADYDDVGLREAIDAgyvPGPRIVTAAISFGAtgghcdstffppsmdqknpfnsdspd  167
ident              |       |                                      
Sbjct isrHPESLLAKTRALNE---EGISAWMLTGAYHV-----------------------psr  142
DSSP  lllLHHHHHHHHHHHHH---HLLEEEEEEELLLL-----------------------lll


DSSP  hhhHHHHHHHHLL--LLEEEEELLLLlllllllllllLLLHHHHHHHHHHHHHLL-----
Query earKAVRTLKKYG--AQVIXICATGGvfsrgnepgqqQLTYEEMKAVVDEAHMAG-----  220
ident      |             |                             |    |     
Sbjct titGSVEKDVAIIdrVIGVXCAISDH--------rsaAPDVYHLANMAAESRVGGllggk  194
DSSP  lllLLHHHHHHHLllEEEEEEEELLL--------lllLLLHHHHHHHHHHHHHHHhhhll


DSSP  -LEEEEEELL-hHHHHHHHHLL--------LLEEEELL----LLLHhHHHHHHHhLLEEE
Query -IKVAAHAHG-aSGIREAVRAG--------VDTIEHAS----LVDDeGIKLAVQkGAYFS  266
ident       |                            |      |        |   |    
Sbjct pGVTVFHMGDskKALQPIYDLLencdvpisKLLPTHVNrnvpLFEQ-ALEFARK-GGTID  252
DSSP  lLEEEEEELLllLLLHHHHHHHhlllllhhHEEEELHHhlhhHHHH-HHHHHHL-LLLEE


DSSP  LLLLLHhhhhhhhhhhlllhhhhhhhhhhHHHHH-HHHHHHHHHLL---EEELLLLLLL-
Query MDIYNTdytqaegkkngvlednlrkdrdiGELQR-ENFRKALKAGV---KMVYGTDAGI-  321
ident                                    |    |  ||          |    
Sbjct ITSSID-----------------------EPVAPaEGIARAVQAGIplaRVTLSSDGNGs  289
DSSP  EELLLL-----------------------LLLLHhHHHHHHHHLLLlhhHEEEELLLLLe


DSSP  --------------LLLLL-HHHHHHHHH-HLLLLHHHHHHHLLHHHHHHHLLlLLLLLL
Query --------------YPHGD-NAKQFAVMV-RYGATPLQAIQSATLTAAEALGRsKDVGQV  365
ident                           | |  |      |    |   |  |      |  
Sbjct qpffddegnlthigVAGFEtLLETVQVLVkDYDFSISDALRPLTSSVAGFLNL-TGKGEI  348
DSSP  eeeellllleeeeeELLLHhHHHHHHHHHhHHLLLHHHHHHHHLHHHHHHLLL-LLLLLL


DSSP  LLLLLLLEEEELLLLlllhhhhhLLLEEEELLEEEELL-----------l
Query AVGRYGDMIAVAGDPladvttleKPVFVMKGGAVVKAP-----------x  404
ident   |   |                    |   |                  
Sbjct LPGNDADLLVMTPEL--------RIEQVYARGKLMVKDgkacvkgtfetd  390
DSSP  LLLLLLLEEEELLLL--------LEEEEEELLEEEEELleelllllllll


No 15: Query=3mtwA Sbjct=4rdvB Z-score=26.6

back to top
DSSP  lleEEEEEEEEEEllLLEEEELEEEEEE-LLEEEEEEE-LLLLLlllleEEEEEeEEEEE
Query aeiKAVSAARLLDvaSGKYVDNPLVIVT-DGRITSIGK-KGDAVpagatAVDLPgVTLLP   58
ident     |  | | |         |       ||    |             |  |     ||
Sbjct ---SAIFAERALL--PEGWARNVRFEISaDGVLAEIRPdANADG-----AERLG-GAVLP   49
DSSP  ---LEEEEEEEEE--LLEEEEEEEEEELlLLLEEEEELlLLLLL-----LEELL-LLEEE


DSSP  LEEEEEELLLL--LLLL-----------------LHHHHHHLLHHHHHHHHHHHHHHHHH
Query GLIDMHVHLDS--LAEV-----------------GGYNSLEYSDRFWSVVQTANAKKTLE   99
ident |    | |      |                           |     |         | 
Sbjct GMPNLHSHAFQraMAGLaevagnpndsfwtwrelMYRMVARLSPEQIEVIACQLYIEMLK  109
DSSP  LEEEEEELHHHhhHLLLllllllllllhhhhhhhHHHHHLLLLHHHHHHHHHHHHHHHHH


DSSP  LLEEEEEELLLLL------------LHHHHHHHHHHlllLLLLEEEELlLLEELLLL--l
Query AGFTTVRNVGAAD------------YDDVGLREAIDagyVPGPRIVTAaISFGATGG--h  145
ident || | |                           |       |              |   
Sbjct AGYTAVAEFHYVHhdldgrsyadpaELSLRISRAAS---AAGIGLTLL-PVLYSHAGfgg  165
DSSP  HLEEEEEEEELLLllllllllllllHHHHHHHHHHH---HHLLEEEEE-ELLLLEEElll


DSSP  llLLLLlhhhlLLLLLllllhhHHHHHHhHHHHLL---------lLEEEEELLLllllll
Query cdSTFFppsmdQKNPFnsdspdEARKAVrTLKKYG---------aQVIXICATGgvfsrg  196
ident                               |                             
Sbjct qpASEG----qRRFIN------GSEAYL-ELLQRLrapleaaghsLGLCFHSLR------  208
DSSP  eeLLHH----hLLLLL------LHHHHH-HHHHHHhhhhhhhlleELEEELLLL------


DSSP  llllllLLLHHHHHHHHHHhHHLLLEEEEEEL-------------lhHHHHHHH-HLLL-
Query nepgqqQLTYEEMKAVVDEaHMAGIKVAAHAH-------------gaSGIREAV-RAGV-  241
ident         |      |          |  |                            | 
Sbjct ------AVTPQQIATVLAA-GHDDLPVHIHIAeqqkevddcqawsgrRPLQWLYeNVAVd  261
DSSP  ------LLLHHHHHHHHLL-LLLLLLEEEEELllhhhhhhhhhhhllLHHHHHHhHLLLl


DSSP  --LEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhhHHHH
Query --DTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdiGELQ  299
ident       ||   |          ||                                    
Sbjct qrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLG-------------------DGIF  302
DSSP  llEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL


DSSP  hhHHHHHHHHLLEEELLLLlLLLLlLLHHHHHHHHHHLL----------------lLHHH
Query reNFRKALKAGVKMVYGTDaGIYPhGDNAKQFAVMVRYG----------------aTPLQ  343
ident        |  |     | |                                         
Sbjct --PATDFLAQGGRLGIGSD-SHVS-LSVVEELRWLEYGQrlrdrkrnrlyrddqpmIGRT  358
DSSP  --LHHHHHHLLLEEEELLL-LLLL-LLHHHHHHHHHHHHhhhhlllllllllllllHHHH


DSSP  HHHHLLHHHHHHHLLllLLLLLLLLLLLLEEEELL------------LLLLLHH-HHHL-
Query AIQSATLTAAEALGRskDVGQVAVGRYGDMIAVAG------------DPLADVT-TLEK-  389
ident     |    | |||     |  ||||  |     |                         
Sbjct LYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGndpylasaegdaLLNRWLFaGGDRq  416
DSSP  HHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLllhhhhllllhhHHHHHHHhLLHHh


DSSP  LLEEEELLEEEELL--------------------l
Query PVFVMKGGAVVKAP--------------------x  404
ident    ||  |  |                        
Sbjct VRDVMVAGRWVVRDgrhageersarafvqvlgell  451
DSSP  EEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl


No 16: Query=3mtwA Sbjct=1yrrB Z-score=26.0

back to top
DSSP  lleEEEEEEEEEELLllEEEELEEEEEELLEEEEEEELLLLLLLlLEEEEEEEEEEEELE
Query aeiKAVSAARLLDVAsgKYVDNPLVIVTDGRITSIGKKGDAVPAgATAVDLPGVTLLPGL   60
ident     |    |          |   |   || | |        |       | |  | || 
Sbjct ---YALTQGRIFTGH--EFLDDHAVVIADGLIKSVCPVAELPPE-IEQRSLNGAILSPGF   54
DSSP  ---LEEELLEEELLL--LEELLEEEEEELLEEEEEEEHHHLLLL-LLEEELLLLEEEELE


DSSP  EEEEELL----LLLLlllhhhhhhlLHHHHH-HHHHHHHHHHHHLLEEEEEELLL-----
Query IDMHVHL----DSLAevggynsleySDRFWS-VVQTANAKKTLEAGFTTVRNVGA-----  110
ident ||                            |        |     | |            
Sbjct IDVQLNGcggvQFND----------TAEAVSvETLEIMQKANEKSGCTNYLPTLIttsde  104
DSSP  EEEEELEelleELLL----------LLLLLLhHHHHHHHHHHHLLLEEEEEEEELlllhh


DSSP  ----LLLHHHHHHHHHHllllllLEEEELlLLEELlllllllllllhhhllllllllllh
Query ----ADYDDVGLREAIDagyvpgPRIVTAaISFGAtgghcdstffppsmdqknpfnsdsp  166
ident                                                             
Sbjct lmkqGVRVMREYLAKHP-----nQALGLH-LEGPW-----------------------ln  135
DSSP  hhhhHHHHHHHHHHHLL-----lLLLLEE-EELLL-----------------------ll


DSSP  HHHHHHHHHHHhLLLLEEEEELlllllllllllllllLLHHhhHHHHHHHHHLLLEEEEE
Query DEARKAVRTLKkYGAQVIXICAtggvfsrgnepgqqqLTYEemKAVVDEAHMAGIKVAAH  226
ident                                              |      ||| | | 
Sbjct AALVDFLCENA-DVITKVTLAP---------------EMVP--AEVISKLANAGIVVSAG  177
DSSP  LHHHHHHHHLH-HHEEEEEELH---------------HHLL--HHHHHHHHHHLLEEEEL


DSSP  E--llHHHHHHHHHLLLLEEEELL-------lllHHHHHHHHHH-LLEEELLLLLHHhhh
Query A--hgASGIREAVRAGVDTIEHAS-------lvdDEGIKLAVQK-GAYFSMDIYNTDytq  276
ident              |||     |                         |            
Sbjct HsnatLKEAKAGFRAGITFATHLYnampyitgrePGLAGAILDEaDIYCGIIADGLH---  234
DSSP  LllllHHHHHHHHHHLEEEELLLLllllllllllLHHHHHHHHLlLLEEEEELLLLL---


DSSP  hhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHLL-EEELLLLLL-LLLLlLHHHHHHHH
Query aegkkngvlednlrkdrdigelQRENFRKALKAGV-KMVYGTDAG-IYPHgDNAKQFAVM  334
ident                          | | |      |    |||                
Sbjct ---------------------vDYANIRNAKRLKGdKLCLVTDATsGSSL-TMIEGVRNL  272
DSSP  ---------------------lLHHHHHHHHHHHHhHEEEELLLLlLLLL-LHHHHHHHH


DSSP  H-HLLLLHHHHHHHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLLllllhhhhHLLLEE
Query V-RYGATPLQAIQSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGDpladvttlEKPVFV  393
ident |   |         |||  | | |  |  |  | |      |   |         |    
Sbjct VeHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPD--------FKITKT  324
DSSP  HhHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL--------LLEEEE


DSSP  EELLEEEELLl
Query MKGGAVVKAPx  404
ident    |  |    
Sbjct IVNGNEVVTQ-  334
DSSP  EELLEEEEEL-


No 17: Query=3mtwA Sbjct=3ooqA Z-score=26.0

back to top
DSSP  llEEEEEEEEEEELLLlEEEElEEEEEELLEEEEEEELlLLLLlLLEEEEEEEEEEEELE
Query aeIKAVSAARLLDVASgKYVDnPLVIVTDGRITSIGKKgDAVPaGATAVDLPGVTLLPGL   60
ident         |      |        | |  |     |      |  |  ||| |  | || 
Sbjct --KILFKNATVFPITS-RPFK-GDVLVSNGKVEKVGEN-IEDP-DAEIVDLTGKFLFPGF   54
DSSP  --LEEEEEEEELLLLL-LLEE-EEEEEELLEEEEEELL-LLLL-LLEEEELLLLEEEELE


DSSP  EEEEELL-LLLLLLLHHHH-----------hhllhhhHHHHhHHHHHHHHHLLEEEEEEL
Query IDMHVHL-DSLAEVGGYNS-----------leysdrfWSVVqTANAKKTLEAGFTTVRNV  108
ident  | | |       || | |                              |  | | |  |
Sbjct VDAHSHIgLFEEGVGYYYSdgneatdpvtphvkaldgFNPQ-DPAIERALAGGVTSVXIV  113
DSSP  EEEEELLlLLLLLLLHHHLllllllllllllllhhhhLLLL-LHHHHHHHLLLEEEEEEL


DSSP  LL---------lllhhhhHHHHHHlllllllEEEElllleellllllllllllhhhllll
Query GA---------adyddvgLREAIDagyvpgpRIVTaaisfgatgghcdstffppsmdqkn  159
ident                                                             
Sbjct PGsanpvggqgsvikfrsIIVEEC-------IVKD-------------------------  141
DSSP  LLlllleeeeeeeeelllLLHHHH-------EEEE-------------------------


DSSP  llllllhhhhhhhhhhhhhllLLEEEEELLLLLLLLLL-----llllllLLHHH------
Query pfnsdspdearkavrtlkkygAQVIXICATGGVFSRGN-----epgqqqLTYEE------  208
ident                                                             
Sbjct ---------------------PAGLKXAFGENPKRVYGerkqtpstrxgTAGVIrdyftk  180
DSSP  ---------------------EEEEEEELLHHHHHHHHhlllllllhhhHHHHHhhhhhh


DSSP  -----------------------hhhhhHHHHHLLLEEEEEELLHHHHHHHHHLL-----
Query -----------------------mkavvDEAHMAGIKVAAHAHGASGIREAVRAG-----  240
ident                                    |    ||| |  |  | |       
Sbjct vknyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAHRADDILTAIRIAeefgf  240
DSSP  hhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEELLHHHHHHHHHHHhhhll


DSSP  LLEEEELLLLLHhHHHHHHHHLLEEELL-LLLHhhhhhhhhhhlllhhhhhHHHH-HHHH
Query VDTIEHASLVDDeGIKLAVQKGAYFSMD-IYNTdytqaegkkngvlednlrKDRD-IGEL  298
ident    |||         |    |                                      |
Sbjct NLVIEHGTEAYK-ISKVLAEKKIPVVVGpLLTF------------------RTKLeLKDL  281
DSSP  LEEEEELLLHHH-HHHHHHHHLLLEEELlLLLL------------------LLLHhHLLL


DSSP  HHHHHHHHHHHLLEEELLLLLLLLLLLLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLL
Query QRENFRKALKAGVKMVYGTDAGIYPHGDNAKQFAVMVRYGATPLQAIQSATLTAAEALGR  358
ident   |   | || ||      |    |      | |   ||||         |   |  || 
Sbjct TXETIAKLLKDGVLIALXCDHPVIPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGL  341
DSSP  LLLHHHHHHHLLLLEEELLLLLLLLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLL


DSSP  LLLLLLLLLLLLLLEEEELLLLllLHHHhhLLLEEEELLEEEELLl
Query SKDVGQVAVGRYGDMIAVAGDPlaDVTTleKPVFVMKGGAVVKAPx  404
ident     |    |   |     | |            |   |  |    
Sbjct EDRIGSIEPGKDADLVVWSGHP--FDXK-sVVERVYIDGVEVFRRe  384
DSSP  LLLLLLLLLLLLLLEEEELLLL--LLLL-lLEEEEEELLEEEEELl


No 18: Query=3mtwA Sbjct=3giqA Z-score=25.6

back to top
DSSP  -llEEEEEEEEEEELLLLEEEElEEEEEELLEEEEEEELLLLLLllLEEEEEEEEEEEEL
Query -aeIKAVSAARLLDVASGKYVDnPLVIVTDGRITSIGKKGDAVPagATAVDLPGVTLLPG   59
ident              |             | ||||  ||  |        | |  |    ||
Sbjct eklDFKITGGWIIDGTGAPRRR-ADLGVRDGRIAAIGELGAHPA--RHAWDASGKIVAPG   57
DSSP  lleEEEEELLEELLLLLLLLEE-LEEEEELLEEEEEELLLLLLE--EEEEELLLLEEEEL


DSSP  EEEEEELLLLlllllhhhhhhllhhhhhHHHHHhHHHHHHLLEEEEEELL---LLLL---
Query LIDMHVHLDSlaevggynsleysdrfwsVVQTAnAKKTLEAGFTTVRNVG---AADY---  113
ident  || | | |                   |            | |||        |     
Sbjct FIDVHGHDDL----------------mfVEKPD-LRWKTSQGITTVVVGNcgvSAAPapl  100
DSSP  EEELLLLLLL----------------hhHHLLL-LHHHHLLLEEEEEELLlllLLLLlll


DSSP  ------------------hhhHHHHHHHLlLLLLLEEEELlLLEEllllllllllllhhh
Query ------------------ddvGLREAIDAgYVPGPRIVTAaISFGatgghcdstffppsm  155
ident                          | ||   |                           
Sbjct pgntaaalallgetplfadvpAYFAALDA-QRPMINVAAL-VGHA---------------  143
DSSP  lllllhhhhhhllllllllhhHHHHHHHH-LLLLLEEEEE-EEHH---------------


DSSP  lllLLLL---------llLHHHHHHHHHHHHHLLLLEEEEELLLlllllllllllLLLLH
Query dqkNPFN---------sdSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqQQLTY  206
ident                                  ||                         
Sbjct -nlRLAAmrdpqaaptaaEQQAMQDMLQAALEAGAVGFSTGLAY--------qpgAVAQA  194
DSSP  -hhHHHHlllllllllhhHHHHHHHHHHHHHHHLLLEEEEELLL--------llhHHLLH


DSSP  HHHHHHHHHHHHLLLEEEEEE-----lLHHHHHHHHHLL-----LLEEEELLL-------
Query EEMKAVVDEAHMAGIKVAAHA-----hGASGIREAVRAG-----VDTIEHASL-------  249
ident  |       |         |             |    |          |          
Sbjct AELEGLARVAAERRRLHTSHIrneadgVEAAVEEVLAIGrgtgcATVVSHHKCmmpqnwg  254
DSSP  HHHHHHHHHHHHLLLEEEEELllllllHHHHHHHHHHHHhhhllEEEELLLLLllhhhll


DSSP  lLHHHHHHHHHHL-----LEEELLLLlHHHH-----------hhhHHHH-------LLLH
Query vDDEGIKLAVQKG-----AYFSMDIYnTDYT-----------qaeGKKN-------GVLE  286
ident                          |                                  
Sbjct rSRATLANIDRAReqgveVALDIYPY-PGSStiliperaetiddiRITWstphpecSGEY  313
DSSP  lHHHHHHHHHHHHhllllEEEEELLL-LEEEeellhhhlllllllEEEEelllhhhLLLL


DSSP  H--------------------hhhhHHHHHHhhhHHHHHHHHhLLEEELLLLLL------
Query D--------------------nlrkDRDIGElqrENFRKALKaGVKMVYGTDAG------  320
ident                               |                  | |        
Sbjct LadiaarwgcdkttaarrlapagaiYFAMDE---DEVKRIFQ-HPCCMVGSDGLpndarp  369
DSSP  HhhhhhhhlllhhhhhhhhlleeeeEELLLH---HHHHHHHH-LLLEEELLLLLllllll


DSSP  LLLLLLHH-HHHHHHH--HLLLLHHHHHHHLLHHHHHHHLLlLLLLLLLLLLLLLEEEEL
Query IYPHGDNA-KQFAVMV--RYGATPLQAIQSATLTAAEALGRsKDVGQVAVGRYGDMIAVA  377
ident                |      |  ||    |   |   |     |    |   |     
Sbjct HPRLWGSFtRVLGRYVreARLMTLEQAVARMTALPARVFGF-AERGVLQPGAWADVVVFD  428
DSSP  LLHHHHHHhHHHHHHHhhLLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEEL


DSSP  LLllllhHHHH------------LLLEEEELLEEEEL-------------ll
Query GDpladvTTLE------------KPVFVMKGGAVVKA-------------px  404
ident  |     |                   |   || |                 
Sbjct PD-----TVADratwdeptlasvGIAGVLVNGAEVFPqppadgrpgqvlrax  475
DSSP  LL-----LLLLllllllllllllLEEEEEELLEEEELlllllllllllllll


No 19: Query=3mtwA Sbjct=3griA Z-score=25.2

back to top
DSSP  llEEEEEEEEEEEllLLEEEElEEEEEELLEEEEEEELlLLLLLLLEEEEEEEEEEEELE
Query aeIKAVSAARLLDvaSGKYVDnPLVIVTDGRITSIGKKgDAVPAGATAVDLPGVTLLPGL   60
ident    |       |    |              |  |         |    |  |    || 
Sbjct --XKLIKNGKVLQ--NGELQQ-ADILIDGKVIKQIAPA-IEPSNGVDIIDAKGHFVSPGF   54
DSSP  --LEEEELLEEEE--LLEEEE-LEEEEELLEEEEEELL-LLLLLLLEEEELLLLEEEELE


DSSP  EEEEELLLLlllllhhhhhhllhhHHHH--HHHHHHHHHHHLLEEEEEELLLLL------
Query IDMHVHLDSlaevggynsleysdrFWSV--VQTANAKKTLEAGFTTVRNVGAAD------  112
ident  | ||||                             |     |||||             
Sbjct VDVHVHLRE--------------pGGEYkeTIETGTKAAARGGFTTVCPXPNTRpvpdsv  100
DSSP  EEEEELLLL--------------lLLLLllLHHHHHHHHHHLLEEEEEELLLLLlllllh


DSSP  ---LHHHHHHHHHhllllLLLEEEELlLLEEllllllllllllhhhlllLLLLLLlhhHH
Query ---YDDVGLREAIdagyvPGPRIVTAaISFGatgghcdstffppsmdqkNPFNSDspdEA  169
ident         |            |      |                             | 
Sbjct ehfEALQKLIDDN-----AQVRVLPY-ASIT------------------TRQLGK---EL  133
DSSP  hhhHHHHHHHHHH-----LLLEELLL-EELL------------------HHHLLL---LL


DSSP  HHhHHHHHHLLLLEEEEEllllllllllllllllLLHHHHHHHHHHHHHLLLEEEEEEL-
Query RKaVRTLKKYGAQVIXICatggvfsrgnepgqqqLTYEEMKAVVDEAHMAGIKVAAHAH-  228
ident       | | ||                       |         ||        ||   
Sbjct VD-FPALVKEGAFAFTDD------------gvgvQTASXXYEGXIEAAKVNKAIVAHCEd  180
DSSP  LL-HHHHHLLLLLLEEEL------------llllLLHHHHHHHHHHHHHHLLLEEELLLl


DSSP  ---------------------------LHHHHHHHHHLL-----LLEEEELLL--LLHHH
Query ---------------------------GASGIREAVRAG-----VDTIEHASL--VDDEG  254
ident                                |   |             | |        
Sbjct nsliyggaxhegkrskelgipgipnicESVQIARDVLLAeaagcHYHVCHVSTkeSVRVI  240
DSSP  hhhllllleellhhhhhhllleellhhHHHHHHHHHHHHhhhllLEEELLLLLhhHHHHH


DSSP  HHHHH-HHLLEEELL--LLLHhhhHHHHHhhllLHHHHHHHhhHHHH--HHHHHHHHHHH
Query IKLAV-QKGAYFSMD--IYNTdytQAEGKkngvLEDNLRKDrdIGEL--QRENFRKALKA  309
ident                                        |          ||     |  
Sbjct RDAKRaGIHVTAEVTphHLLL--tEDDIP----GNNAIYKXnpPLRSteDREALLEGLLD  294
DSSP  HHHHHlLLLEEEEELhhHHHL--lHHHLL----LLLHHHLLllLLLLhhHHHHHHHHHHL


DSSP  LLEEELLLLLL----------------LLLL-LLHH-HHHHHHH-hlLLLHHHHHHHLLH
Query GVKMVYGTDAG----------------IYPH-GDNA-KQFAVMV-ryGATPLQAIQSATL  350
ident |      ||                                  |     |  |     | 
Sbjct GTIDCIATDHAphardekaqpxekapfGIVGsETAFpLLYTHFVkngDWTLQQLVDYLTI  354
DSSP  LLLLEELLLLLlllhhhhlllllllllLLLLlLLHHhHHHHHHLlllLLLHHHHHHHHLH


DSSP  HHHHHHLLLllLLLLLLLLLLLEEEELLL-------------------llllHHHHhlLL
Query TAAEALGRSkdVGQVAVGRYGDMIAVAGD-------------------pladVTTLekPV  391
ident    |        |      | |      |                       |     | 
Sbjct KPCETFNLE--YGTLKENGYADLTIIDLDseqeikgedflskadntpfigykVYGN--PI  410
DSSP  HHHHHLLLL--LLLLLLLLLLLEEEEELLlleellhhhllllllllllllleELLE--EE


DSSP  EEEELLEEEELLl
Query FVMKGGAVVKAPx  404
ident      | |     
Sbjct LTXVEGEVKFEG-  422
DSSP  EEEELLEEEEEL-


No 20: Query=3mtwA Sbjct=2ogjA Z-score=25.1

back to top
DSSP  LLEEEEEEEEEEELLLLEEEELEEEEEE-LLEEEEEEELlLLLLlLLEEEEEEeEEEEEL
Query AEIKAVSAARLLDVASGKYVDNPLVIVT-DGRITSIGKKgDAVPaGATAVDLPgVTLLPG   59
ident                 |            || |   |      |   |          ||
Sbjct QAPILLTNVKPVGFGKGASQSSTDILIGgDGKIAAVGSA-LQAP-ADTQRIDA-AFISPG   57
DSSP  LLLEEEEEEEELLLLLLLLLLLEEEEELlLLLEEEEELL-LLLL-LLEEELLL-LEEEEL


DSSP  EEEEEELLLLlllllhhhhhhllhhhHHHHhhhHHHH-HHHLLEEEEEELLLL----LLH
Query LIDMHVHLDSlaevggynsleysdrfWSVVqtaNAKK-TLEAGFTTVRNVGAA----DYD  114
ident   | |||                                 | | ||    | |       
Sbjct WVDLHVHIWH----------------GGTDisiRPSEcGAERGVTTLVDAGSAgeanFHG  101
DSSP  EEEEEELLLL----------------LLLLlllLHHHlLHHHLEEEEEEELLLllllHHH


DSSP  HHH-HHHHHhlllllLLEEEELlLLEE-lllllLLLLlllhhhllllllLLLLHHHHHH-
Query DVG-LREAIdagyvpGPRIVTAaISFG-atgghCDSTffppsmdqknpfNSDSPDEARK-  171
ident       |          ||       |      |                          
Sbjct FREyIIEPS------RERIKAF-LNLGsiglvaCNRV-----------pELRDIKDIDLd  143
DSSP  HHHhLLLLL------LLEEEEE-EELLllllllLLLL-----------lLLLLHHHLLHh


DSSP  HHHHHHHLL---LLEEEEELLlllllllllllLLLL---LHHHHHHHHHHHHHLLLEEEE
Query AVRTLKKYG---AQVIXICATggvfsrgnepgQQQL---TYEEMKAVVDEAHMAGIKVAA  225
ident                 |  |                        |     |         
Sbjct RILECYAENsehIVGLXVRAS-----------HVITgswGVTPVKLGKKIAKILKVPXXV  192
DSSP  HHHHHHHLLlllEEEEEEEEL-----------HHHHlllLLHHHHHHHHHHHHHLLLEEE


DSSP  EELLH-hHHHHHHHLL--lLEEEELL-----LLLH---HHHHHHHHH-LLEEELLLLLHh
Query HAHGA-sGIREAVRAG--vDTIEHAS-----LVDD---EGIKLAVQK-GAYFSMDIYNTd  273
ident |         |        |   |                  ||    |           
Sbjct HVGEPpaLYDEVLEILgpgDVVTHCFngksgSSIXedeDLFNLAERCeGIRLDIGHGGA-  251
DSSP  EELLLllLHHHHHHHLlllLEEELLLlllllLLLLllhHHHHHHHHLlLLEEELLLLLL-


DSSP  hhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHH-HLLEEELLLLL-LLLL---llLHH
Query ytqaegkkngvlednlrkdrdigelQRENFRKALK-AGVKMVYGTDA-GIYP---hgDNA  328
ident                                 |           ||  |        | |
Sbjct -----------------------sfSFKVAEAAIArGLLPFSISTDLhGHSXnfpvwDLA  288
DSSP  -----------------------llLHHHHHHHHHlLLLLLLLLLLLlLLLLlllllLHH


DSSP  HHHHHHHHLLLLHHHHHHHLLHHHHHHHLLLLlllLLLLLLLLLEEEELLL---------
Query KQFAVMVRYGATPLQAIQSATLTAAEALGRSKdvgQVAVGRYGDMIAVAGD---------  379
ident                     |   |             ||   |                
Sbjct TTXSKLLSVDXPFENVVEAVTRNPASVIRLDX-enRLDVGQRADFTVFDLVdadleatds  347
DSSP  HHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLL-llLLLLLLLLEEEEEEEEeeeeeeell


DSSP  -----lllLHHHhhlLLEEEELLEEEE-----lll
Query -----plaDVTTlekPVFVMKGGAVVK-----apx  404
ident                |     |             
Sbjct ngdvsrlkRLFE---PRYAVIGAEAIAasryipra  379
DSSP  llleeeeeEEEE---EEEEEELLEEEEllllllll


No 21: Query=3mtwA Sbjct=1gkpA Z-score=24.8

back to top
DSSP  llEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEELE
Query aeIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLPGL   60
ident                                || ||      | |    |  |    || 
Sbjct --PLLIKNGEIITA--DSRYK-ADIYAEGETITRIGQ-NLEAPPGTEVIDATGKYVFPGF   54
DSSP  --LEEEELLEEEEL--LEEEE-LEEEELLLLLLEEEL-LLLLLLLLEEEELLLLEEEELE


DSSP  EEEEELLLLlllllhhhHHHLlhhHHHHHHHHHHHHHHHLLEEEEEELLL----------
Query IDMHVHLDSlaevggynSLEYsdrFWSVVQTANAKKTLEAGFTTVRNVGA----------  110
ident || |||                  |         |  |  | ||                
Sbjct IDPHVHIYL-------pFMAT---FAKDTHETGSKAALMGGTTTYIEMCCpsrnddaleg  104
DSSP  EEEEELLLL-------eELLE---ELLLLHHHHHHHHHHLLEEEEEEEELllllllhhhh


DSSP  LLLHhHHHHHHHhllllLLLEEEELlLLEEllllllllllllhhhllllllLLLLhhHHH
Query ADYDdVGLREAIdagyvPGPRIVTAaISFGatgghcdstffppsmdqknpfNSDSpdEAR  170
ident          |                                           |      
Sbjct YQLW-KSKAEGN-----SYCDYTFH-MAVS---------------------KFDE--KTE  134
DSSP  HHHH-HHHHLLL-----LLLEEEEE-EELL---------------------LLLL--LHH


DSSP  HHHHHHHHLLLLEEEEELLLllllllllllllLLLHHHHHHHHHHHHHLLLEEEEEEL--
Query KAVRTLKKYGAQVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHMAGIKVAAHAH--  228
ident    |     |    ||                     ||      |   |  | ||    
Sbjct GQLREIVADGISSFXIFLSY--------knffGVDDGEMYQTLRLAKELGVIVTAHCEna  186
DSSP  HHHHHHHHLLLLEEEEEELL--------llllLLLHHHHHHHHHHHHHHLLEEEEEELlh


DSSP  -----------------------------LHHHHHHHHHLL-----LLEEEELLL--LLH
Query -----------------------------GASGIREAVRAG-----VDTIEHASL--VDD  252
ident                               | |                  | |     |
Sbjct elvgrlqqkllsegktgpewhepsrpeavEAEGTARFATFLettgaTGYVVHLSCkpALD  246
DSSP  hhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHHHHhhhllEEEELLLLLhhHHH


DSSP  HHHHHHH-HHLLEEELL--LLLHHhhHHHH----HHHLLlhhhhhhHHHHHHHhHHHHHH
Query EGIKLAV-QKGAYFSMD--IYNTDytQAEG----KKNGVlednlrkDRDIGELqRENFRK  305
ident             |          |                                    
Sbjct AAMAAKArGVPIYIESVipHFLLD--KTYAerggVEAMK--yimspPLRDKRN-QKVLWD  301
DSSP  HHHHHHHlLLLEEEEEEhhHHHLL--HHHHhllhHHHHL--lllllLLLLLHH-HHHHHH


DSSP  HHHHLLEEELLLLLL--------------------LLLLLLHH-HHHHHHH-HLLLLHHH
Query ALKAGVKMVYGTDAG--------------------IYPHGDNA-KQFAVMV-RYGATPLQ  343
ident ||  |     |||                      |    |         | |       
Sbjct ALAQGFIDTVGTDHCpfdteqkllgkeaftaipngIPAIEDRVnLLYTYGVsRGRLDIHR  361
DSSP  HHHLLLLLEEELLLLlllhhhhhhhlllhhhllllLLLLLLHHhHHHHHHLlLLLLLHHH


DSSP  HHHHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLL-------------------lllLH
Query AIQSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGD-------------------plaDV  384
ident     |   ||   |     |  |||   |                               
Sbjct FVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfEI  421
DSSP  HHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLlleellhhhlllllllllllllEE


DSSP  HHhhLLLEEEELLEEEELL-------------------l
Query TTleKPVFVMKGGAVVKAP-------------------x  404
ident      |  |   | |                        
Sbjct DG--RPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
DSSP  LL--EEEEEEELLEEEEELleelllllllllllllllll


No 22: Query=3mtwA Sbjct=4b3zD Z-score=23.5

back to top
DSSP  lLEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEELE
Query aEIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLPGL   60
ident          |              |   || |  ||     || |       |    || 
Sbjct -DRLLIKGGRIIND--DQSLY-ADVYLEDGLIKQIGE-NLIVPGGVKTIEANGRMVIPGG   55
DSSP  -LEEEEEEEEEELL--LLEEE-EEEEEELLEEEEEEL-LLLLLLLLEEEELLLLEEEELE


DSSP  EEEEELLLLlllllhhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELLL---------L
Query IDMHVHLDSlaevggynsleysdrFWSVVQTANAKKTLEAGFTTVRNVGA---------A  111
ident ||    |                              |  | |                 
Sbjct IDVNTYLQK---------------TAADDFFQGTRAALVGGTTMIIDHVVpepgsslltS  100
DSSP  EEEEELLLL---------------LLLLLHHHHHHHHHHLLEEEEEEEELllllllhhhH


DSSP  LLHHHHHHHHHhllllLLLEEEELlLLEEllllllllllllhhhllllllLLLLhhHHHH
Query DYDDVGLREAIdagyvPGPRIVTAaISFGatgghcdstffppsmdqknpfNSDSpdEARK  171
ident                                                           | 
Sbjct FEKWHEAADTK-----SCCDYSLH-VDIT---------------------SWYD--GVRE  131
DSSP  HHHHHHHHHLL-----LLLEEEEE-EELL---------------------LLLL--LHHH


DSSP  HHHHHHH-LLLLEEEEELLLllllllllllllLLLHHHHHHHHHHHHHLLLEEEEEEL--
Query AVRTLKK-YGAQVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHMAGIKVAAHAH--  228
ident     |    |                      |                |     ||   
Sbjct ELEVLVQdKGVNSFQVYMAY--------kdvyQMSDSQLYEAFTFLKGLGAVILVHAEng  183
DSSP  HHHHHHHlLLLLEEEEELLL--------llllLLLHHHHHHHHHHHHHHLLEEEEELLlh


DSSP  -----------------------------LHHHHHHHHHLL-----LLEEEELLL--LLH
Query -----------------------------GASGIREAVRAG-----VDTIEHASL--VDD  252
ident                               |     |            |         |
Sbjct dliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAgrincPVYITKVMSksAAD  243
DSSP  hhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHhhhllLEEEEEELLhhHHH


DSSP  HHHHHH-hHHLLEEELL--LLLHHhHHHH---hHHHLLlhhhhhHHHHHHHHhHHHHHHH
Query EGIKLA-vQKGAYFSMD--IYNTDyTQAE---gKKNGVlednlrKDRDIGELqRENFRKA  306
ident                       ||                                    
Sbjct IIALARkkGPLVFGEPIaaSLGTD-GTHYwsknWAKAAafvtspPLSPDPTT-PDYLTSL  301
DSSP  HHHHHHhhLLLEEEEELhhHHHLL-LHHHhlllHHHHHhlllllLLLLLLLH-HHHHHHH


DSSP  HHHLLEEELLLLLL-------------------LLLL-LLHH-HHHHHHH-HLLLLHHHH
Query LKAGVKMVYGTDAG-------------------IYPH-GDNA-KQFAVMV-RYGATPLQA  344
ident |  |   | |                                       |        | 
Sbjct LACGDLQVTGSGHCpystaqkavgkdnftlipeGVNGiEERMtVVWDKAVaTGKMDENQF  361
DSSP  HHHLLLLLLLLLLLlllhhhhhhhlllhhhlllLLLLlLLHHhHHHHHHLlLLLLLHHHH


DSSP  HHHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLL-------------------llllHH
Query IQSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGD-------------------pladVT  385
ident        ||         |  |||   |      |                         
Sbjct VAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDklktitakshksaveynifegmeCH  421
DSSP  HHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEeeeelllllllllllllllllleEE


DSSP  HHhlLLEEEELLEEEELL---------------------------------------l
Query TLekPVFVMKGGAVVKAP---------------------------------------x  404
ident     |  |   |  |                                           
Sbjct GS--PLVVISQGKIVFEDgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  EE--EEEEEELLEEEEELleellllllllllllllllhhhhhhhhhhhhhllllllll


No 23: Query=3mtwA Sbjct=3e74A Z-score=23.3

back to top
DSSP  LLEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEElLLLLLllLEEEEEEEEEEEELE
Query AEIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKkGDAVPagATAVDLPGVTLLPGL   60
ident                           |  | |  ||             |  |    || 
Sbjct SFDLIIKNGTVILE--NEARV-VDIAVKGGKIAAIGQ-DLGDA--KEVXDASGLVVSPGX   54
DSSP  LEEEEEELLEEELL--LLEEE-LEEEEELLEEEEEEL-LLLLE--EEEEELLLLEEEELE


DSSP  EEEEELLlllllllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-LLLL----hh
Query IDMHVHLdslaevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-AADY----dd  115
ident  | | |                                  | ||                
Sbjct VDAHTHI---------------------GYETGTRAAAKGGITTXIEXPlNQLPatvdra   93
DSSP  EEEEELL---------------------LHHHHHHHHHHLLEEEEEELLlLLLLllllhh


DSSP  hhhhhhhhlLLLLLLEEEELLlLEELlllllllllllhhhllllllllllhhHHHHHHHH
Query vglreaidaGYVPGPRIVTAAiSFGAtgghcdstffppsmdqknpfnsdspdEARKAVRT  175
ident                                                             
Sbjct sielkfdaaKGKLTIDAAQLG-GLVS--------------------------YNIDRLHE  126
DSSP  hhhhhhhhhLLLLLLEEEELE-ELLL--------------------------LLLLLHHH


DSSP  HHHLLLLEEEEELllllllllllllllLLLHHHHHHHHHHHHHLLLEEEEEEL-------
Query LKKYGAQVIXICAtggvfsrgnepgqqQLTYEEMKAVVDEAHMAGIKVAAHAH-------  228
ident |   |    |                                  |  |  |         
Sbjct LDEVGVVGFXCFV-------------rDVNDWQFFKGAQKLGELGQPVLVHCEnalicde  173
DSSP  HHHHLLLLEEEEL-------------lLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhh


DSSP  ------------------------LHHHHHHHHHLL-----LLEEEELLL--LLHHHHHH
Query ------------------------GASGIREAVRAG-----VDTIEHASL--VDDEGIKL  257
ident                             ||                | |      |    
Sbjct lgeeakregrvtahdyvasrpvftEVEAIRRVLYLAkvagcRLHVCHVSSpeGVEEVTRA  233
DSSP  hhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHhhhllLEEELLLLLhhHHHHHHHH


DSSP  HH-HHLLEEELlLLLH-HHHHHHHHHHLLlhhhhhHHHH--HHHHHHHHHHHHHhhllEE
Query AV-QKGAYFSMdIYNT-DYTQAEGKKNGVlednlrKDRD--IGELQRENFRKALkagvKM  313
ident                            |         ||        |            
Sbjct RQeGQDITCES-CPHYfVLDTDQFEEIGTlakcspPIRDleNQKGXWEKLFNGE----ID  288
DSSP  HHlLLLEEEEE-LLHHhHLLHHHHHHHLHhhllllLLLLhhHHHHHHHHHHLLL----LL


DSSP  ELLLLLL-----------------LLLLLLHH-HHHHHHH-HLLLLHHHHHHHLLHHHHH
Query VYGTDAG-----------------IYPHGDNA-KQFAVMV-RYGATPLQAIQSATLTAAE  354
ident     |                   |          |   |   |             || 
Sbjct CLVSDHSpcppexkagnixkawggIAGLQSCXdVXFDEAVqKRGXSLPXFGKLXATNAAD  348
DSSP  EELLLLLlllllllllllllllllLLLHHHHHhHHHHHHLlLLLLLHHHHHHHHLHHHHH


DSSP  HHLLLlLLLLLLLLLLLLEEEELL-------------------llllLHHHhhLLLEEEE
Query ALGRSkDVGQVAVGRYGDMIAVAG-------------------dplaDVTTleKPVFVMK  395
ident   |     |  | |   |                                          
Sbjct IFGLQ-QKGRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrTIGA--RITKTIL  405
DSSP  HLLLL-LLLLLLLLLLLLEEEEELllleellhhhlllllllllllllEELL--EEEEEEE


DSSP  LLEEEELL---------------l
Query GGAVVKAP---------------x  404
ident  | |                    
Sbjct RGDVIYDIeqgfpvapkgqfilkh  429
DSSP  LLEEEEELllllllllllleelll


No 24: Query=3mtwA Sbjct=2imrA Z-score=20.3

back to top
DSSP  llEEEEEEEE-eEELLLLEEEElEEEEeelleeEEEEE--------lLLLLlllleeeee
Query aeIKAVSAAR-lLDVASGKYVDnPLVIvtdgriTSIGK--------kGDAVpagatavdl   51
ident             |            |                                  
Sbjct --HTPRLLTCdvLYTGAQSPGG-VVVV-----gETVAAaghpdelrrQYPH------aae   46
DSSP  --LLEEEEEEleEELLEELLEE-EEEE-----lLEEEEeelhhhhhhHLLL------lee


DSSP  EEEE--EEELEEEEEELLLL-----------------llLLLHhhhhhllhhhHHHHHHH
Query PGVT--LLPGLIDMHVHLDS-----------------laEVGGynsleysdrfWSVVQTA   92
ident         |     | |||                                        |
Sbjct ERAGavIAPPPVNAHTHLDMsayefqalpyfqwipevviRGRH--------lrGVAAAQA   98
DSSP  EELLleELLLLLEEEEELLLlhhhhhhlhhhhllhhhhhHHLL--------llHHHHHHH


DSSP  HHHHHHHLLEEEEEELLLLLLHHHHHHHHHhlllllLLEEEELlLLEELLLlllllllll
Query NAKKTLEAGFTTVRNVGAADYDDVGLREAIdagyvpGPRIVTAaISFGATGghcdstffp  152
ident  |      |   |     |      |                                  
Sbjct GADTLTRLGAGGVGDIVWAPEVMDALLARE------DLSGTLY-FEVLNPF---------  142
DSSP  HHHHHHHLLLLLEEEEELLHHHHHHHHLLL------LLLEEEE-EEELLLL---------


DSSP  hhhllllllllLLHHHHHHHHHHHHHLL-------lLEEEEELLllllllllllllLLLL
Query psmdqknpfnsDSPDEARKAVRTLKKYG-------aQVIXICATggvfsrgnepgqQQLT  205
ident                    |   |                                    
Sbjct ---------pdKADEVFAAARTHLERWRrlerpglrLGLSPHTP------------FTVS  181
DSSP  ---------hhHHHHHHHHHHHHHHHHHlllllleeEEEEELLL------------LLLL


DSSP  HHHHHHHHHHHHHLLLEEEEEEL-------------------------------------
Query YEEMKAVVDEAHMAGIKVAAHAH-------------------------------------  228
ident    |    | |   |     |                                       
Sbjct HRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyphtlaevigrep  241
DSSP  HHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhhhllll


DSSP  --lhHHHHHHH-HLLL---LEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhh
Query --gaSGIREAV-RAGV---DTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkn  282
ident        |            |  |   |    |      |                    
Sbjct gpdlTPVRYLDeLGVLaarPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLE------  295
DSSP  llllLHHHHHHhHLLHhhlLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLL------


DSSP  lllhhhhhhhhhhHHHHhhHHHHHHHHLLEEELLLLLLLL-LLLLHHHHHHHHHHLL--L
Query gvlednlrkdrdiGELQreNFRKALKAGVKMVYGTDAGIY-PHGDNAKQFAVMVRYG--A  339
ident                           |||    |||                        
Sbjct -------------CGTF--DWPAFAAAGVEVALGTDSVASgETLNVREEVTFARQLYpgL  340
DSSP  -------------LLLL--LHHHHHHLLLLEEELLLLHHHhLLLLLHHHHHHHHHHLllL


DSSP  LHHHHHHHLLHHHHHHHLlllllLLLLL--lllllEEEElllllllhhhhhlLLEEeell
Query TPLQAIQSATLTAAEALGrskdvGQVAV--grygdMIAVagdpladvttlekPVFVmkgg  397
ident  |      |        |                                          
Sbjct DPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRW-------------ELSR----  378
DSSP  LHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLH-------------HHLL----


DSSP  eeeelll
Query avvkapx  404
ident        
Sbjct -----dl  380
DSSP  -----ll


No 25: Query=3mtwA Sbjct=1a5kC Z-score=19.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---llEEEEEEEEEEeLLLLeEEELeEEEEELLEEEEEEELL---------LLLLLLLEE
Query ---aeIKAVSAARLLdVASGkYVDNpLVIVTDGRITSIGKKG---------DAVPAGATA   48
ident            |       |  |      | ||||  ||| |             |    
Sbjct aadcvDLVLTNALIV-DHWG-IVKA-DIGVKDGRIFAIGKAGnpdiqpnvtIPIGAATEV  117
DSSP  hhhllLEEEEEEEEE-ELLE-EEEE-EEEEELLEEEEEELEElllllllllEELLLLLEE


DSSP  EEEEEEEEEELEEEEEELLLllllllhhhhhhllhhhhhhhHHHHHHHHHHLLEEEEEEl
Query VDLPGVTLLPGLIDMHVHLDslaevggynsleysdrfwsvvQTANAKKTLEAGFTTVRNv  108
ident     |     | || | |                           |   |  | ||    
Sbjct IAAEGKIVTAGGIDTHIHWI---------------------CPQQAEEALVSGVTTMVG-  155
DSSP  EELLLLEEEELEEEEEEELL---------------------LLLHHHHHHHHLEEEEEE-


DSSP  LLLL-----------------LHHHHHHHHHhlllllLLEEEELlLLEElllllllllll
Query GAAD-----------------YDDVGLREAIdagyvpGPRIVTAaISFGatgghcdstff  151
ident |                                       |                   
Sbjct GGTGpaagthattctpgpwyiSRMLQAADSL------PVNIGLL-GKGN-----------  197
DSSP  ELLLllhhhhhlllllhhhhhHHHHHHHLLL------LLEEEEE-EELL-----------


DSSP  lhhhlllllllllLHHHhhHHHHHHHHLLLLEEEEELllllllllllllllLLLHHHHHH
Query ppsmdqknpfnsdSPDEarKAVRTLKKYGAQVIXICAtggvfsrgnepgqqQLTYEEMKA  211
ident                     | |     |     |                  |      
Sbjct -------------VSQP--DALREQVAAGVIGLEIHE------------dwGATPAAIDC  230
DSSP  -------------LLLH--HHHHHHHHHLLLEEEEEH------------hhLLLHHHHHH


DSSP  HHHHHHHLLLEEEEEE-------lLHHHHHHHhHLLLLEEEELL--------LLLHhHHH
Query VVDEAHMAGIKVAAHA-------hGASGIREAvRAGVDTIEHAS--------LVDDeGIK  256
ident     |    | || |                          |                  
Sbjct ALTVADEMDIQVALHSdtlnesgfVEDTLAAI-GGRTIHTFHTEgaggghapDIIT-ACA  288
DSSP  HHHHHHHHLLEEEEELllllllllHHHHHHHH-LLLLEEELLLLllllllllLHHH-HHH


DSSP  HhhhHLLEEELLLLL-------hhHHHHHHHH-HLLL------HHHHHHHHHHhHHHHHh
Query LavqKGAYFSMDIYN-------tdYTQAEGKK-NGVL------EDNLRKDRDIgELQREn  302
ident          |                                            |     
Sbjct H---PNILPSSTNPTlpytlntidEHLDMLMVcHHLDpdiaedVAFAESRIRR-ETIAA-  343
DSSP  L---LLEEEEEEHHHllllllhhhHHHHHHHHhHLLLlllhhhHHLLLLLLLH-HHHHH-


DSSP  HHHHHHHLLEEELLLLLLL-LLLLLHHHHHHHHHHLL----------------lLHHHHH
Query FRKALKAGVKMVYGTDAGI-YPHGDNAKQFAVMVRYG----------------aTPLQAI  345
ident        |       |       |                                   |
Sbjct EDVLHDLGAFSLTSSDSQAmGRVGEVILRTWQVAHRMkvqrgalaeetgdndnfRVKRYI  403
DSSP  HHHHHHLLLLLEEELLLLLlLLLLLHHHHHHHHHHHHhhhhlllllllllllhhHHHHHH


DSSP  HHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLLllllhhHHHLLLEEEELLEEEELL--
Query QSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGDpladvtTLEKPVFVMKGGAVVKAP--  403
ident    |   |   |    ||   ||   |                ||  | |||    ||  
Sbjct AKYTINPALTHGIAHEVGSIEVGKLADLVVWSPA-----fFGVKPATVIKGGMIAIAPmg  458
DSSP  HLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHH-----hLLLLLLEEEELLEEEEEEel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct dinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrt  518
DSSP  lllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllll


DSSP  -----------------------------------------------l
Query -----------------------------------------------x  404
ident                                                 
Sbjct vqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  llhhhllllllllleeelllllleeelleellllllllllllllllll


No 26: Query=3mtwA Sbjct=1a4mA Z-score=18.5

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                             
Sbjct ----------------------------------------------------tpafNKPK    8
DSSP  ----------------------------------------------------llllLLLE


DSSP  EEEEELLL-LLLL---------------------------------------lLHHHHHH
Query IDMHVHLD-SLAE---------------------------------------vGGYNSLE   80
ident    |||||                                               |    
Sbjct VELHVHLDgAIKPetilyfgkkrgialpadtveelrniigmdkplslpgflakFDYYMPV   68
DSSP  EEEEEEHHhLLLHhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllHHHHHHH


DSSP  L--LHHHHHHHHHHHHHHHHHLLEEEEEELLLL-------------------------LL
Query Y--SDRFWSVVQTANAKKTLEAGFTTVRNVGAA-------------------------DY  113
ident                       |   |                                 
Sbjct IagCREAIKRIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqtegdvtpddvVD  128
DSSP  HllLHHHHHHHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlllllllhhhhHH


DSSP  HHHHHHHHHHLllLLLLEEEELlLLEELlllllllllllhhhllllllLLLLhhHHHHHH
Query DDVGLREAIDAgyVPGPRIVTAaISFGAtgghcdstffppsmdqknpfNSDSpdEARKAV  173
ident                |                                   |        
Sbjct LVNQGLQEGEQ--AFGIKVRSI-LCCMR--------------------HQPS--WSLEVL  163
DSSP  HHHHHHHHHHH--HHLLEEEEE-EEEEL--------------------LLHH--HHHHHH


DSSP  HHHHHLL---LLEEEEElLLLLllllllllLLLLLHHHHHHHHHHHHHLLLEEEEEEL--
Query RTLKKYG---AQVIXICaTGGVfsrgnepgQQQLTYEEMKAVVDEAHMAGIKVAAHAH--  228
ident    |||                                       |   ||    ||   
Sbjct ELCKKYNqktVVAMDLA-GDET-------iEGSSLFPGHVEAYEGAVKNGIHRTVHAGev  215
DSSP  HHHHHLLlllEEEEEEE-LLLL-------lLLHHHLHHHHHHHHHHHHHLLEEEEEELll


DSSP  -LHHHHHHHHHL-LLLEEEELLLLL--HHHHHHHHHHLLEEELLLLLHHhhhhhhhhhll
Query -GASGIREAVRA-GVDTIEHASLVD--DEGIKLAVQKGAYFSMDIYNTDytqaegkkngv  284
ident       ||||         |                    |                   
Sbjct gSPEVVREAVDIlKTERVGHGYHTIedEALYNRLLKENMHFEVCPWSSY-----------  264
DSSP  lLHHHHHHHHHLlLLLEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHH-----------


DSSP  lhhhhhhHHHHHH-hhhHHHHHHHHHLLEEELLLLL-LLLLllLHHHHHHHHH-HLLLLH
Query lednlrkDRDIGE-lqrENFRKALKAGVKMVYGTDA-GIYPhgDNAKQFAVMV-RYGATP  341
ident                                  ||   |                 | | 
Sbjct -------LTGAWDpkttHAVVRFKNDKANYSLNTDDpLIFK-sTLDTDYQMTKkDMGFTE  316
DSSP  -------HLLLLLllllLHHHHHHHLLLLEEELLLLlLLLL-lLHHHHHHHHHhLLLLLH


DSSP  HHHHHHlLHHHHHHHLL----LLLL--LLLLlllllleeeelllllllhhhhhllleeee
Query LQAIQSaTLTAAEALGR----SKDV--GQVAvgrygdmiavagdpladvttlekpvfvmk  395
ident           ||          |                                     
Sbjct EEFKRL-NINAAKSSFLpeeeKKELleRLYR-----------------------------  346
DSSP  HHHHHH-HHHHHHLLLLlhhhHHHHhhHHHH-----------------------------


DSSP  lleeeelll
Query ggavvkapx  404
ident          
Sbjct ------eyq  349
DSSP  ------hll


No 27: Query=3mtwA Sbjct=2ob3A Z-score=18.4

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                           | 
Sbjct -------------------------------------------drintvrgpitiseaGF   17
DSSP  -------------------------------------------lleeelleeelhhhhLL


DSSP  EEEEELLLL-lllllhhHHHH-LLHHHHHHHHHHHHHHHHHLLEEEEEELL-----LLLL
Query IDMHVHLDS-laevggyNSLE-YSDRFWSVVQTANAKKTLEAGFTTVRNVG-----AADY  113
ident    | |                 |                 ||  |   |          
Sbjct TLTHEHICGssagflraWPEFfGSRKALAEKAVRGLRRARAAGVRTIVDVStfdigRDVS   77
DSSP  EEEEELLEEllllhhhhLHHHhLLHHHHHHHHHHHHHHHHHLLLLEEEELLlhhhlLLHH


DSSP  HHHHHHHhhhlllLLLLEEEELlLLEElllllLLLLlllhhhllllllllLLHHHHHHHH
Query DDVGLREaidagyVPGPRIVTAaISFGatgghCDSTffppsmdqknpfnsDSPDEARKAV  173
ident                   || |           |                 |  |     
Sbjct LLAEVSR------AADVHIVAA-TGLW-----FDPP---------lsmrlRSVEELTQFF  116
DSSP  HHHHHHH------HHLLEEELE-EELL-----LLLL---------hhhhlLLHHHHHHHH


DSSP  HHHHH-------LLLLEEEEELLllllllllllllLLLL---HHHHHHHHHHHHHLLLEE
Query RTLKK-------YGAQVIXICATggvfsrgnepgqQQLT---YEEMKAVVDEAHMAGIKV  223
ident               |  ||   |               |       ||        |  |
Sbjct LREIQygiedtgIRAGIIXVATT------------GKATpfqELVLKAAARASLATGVPV  164
DSSP  HHHHHlllllllLLLLEEEEELL------------LLLLhhhHHHHHHHHHHHHHHLLLE


DSSP  EEEELLH-HHHHHHHHLL--------lLEEEELL-LLLHHHHHHHHHHLLEEELLLLLHh
Query AAHAHGA-SGIREAVRAG--------vDTIEHAS-LVDDEGIKLAVQKGAYFSMDIYNTd  273
ident   |                          | |     |          |     |     
Sbjct TTHTAASqRDGEQQAAIFeseglspsrVCIGHSDdTDDLSYLTALAARGYLIGLDHIPY-  223
DSSP  EEELLHHhLHHHHHHHHHhhllllhhhEEELLHHhLLLHHHHHHHHHLLLEEEELLLLL-


DSSP  hHHHHHHhhllLHHHHHHHHHH-HHHHHHHHHHHHHHLL--EEELLLLLL----------
Query yTQAEGKkngvLEDNLRKDRDI-GELQRENFRKALKAGV--KMVYGTDAG----------  320
ident                                      |         |            
Sbjct -SAIGLE---dNASASALLGIRsWQTRALLIKALIDQGYmkQILVSNDWTfgfssyvtni  279
DSSP  -LLLLLL---lLHHHHHHHLLLlHHHHHHHHHHHHHLLLhhHEEELLLLLleellllllh


DSSP  --------llLLLLHH-HHHHHHHHLLLLHHHHHHHLLHHHHHHHLllllllllllllll
Query --------iyPHGDNA-KQFAVMVRYGATPLQAIQSATLTAAEALGrskdvgqvavgryg  371
ident                           |              |  |               
Sbjct mdvmdrvnpdGMAFIPlRVIPFLREKGVPQETLAGITVTNPARFLS--------------  325
DSSP  hhhhhhhlllHHHHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL--------------


DSSP  leeeelllllllhhhhhllleeeelleeeelll
Query dmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                  
Sbjct -----------------------------ptlr  329
DSSP  -----------------------------llll


No 28: Query=3mtwA Sbjct=2y1hB Z-score=18.0

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                           ||
Sbjct --------------------------------------------------------GVGL    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEEELLLLLLlllhhhhhhllhhhHHHHHHHHHHHHHHLLEEEEEELL---lLLLHHHH
Query IDMHVHLDSLAevggynsleysdrfWSVVQTANAKKTLEAGFTTVRNVG---aADYDDVG  117
ident  | | ||                            |   |       |            
Sbjct VDCHCHLSAPD--------------FDRDLDDVLEKAKKANVVALVAVAehsgEFEKIMQ   50
DSSP  EEEEELLLLHH--------------HLLLHHHHHHHHHHLLEEEEEELLllhhHHHHHHH


DSSP  HHHHHHlllllllEEEELlLLEELllllLLLLLllhhhllllllLLLLhHHHHHHHHHHH
Query LREAIDagyvpgpRIVTAaISFGAtgghCDSTFfppsmdqknpfNSDSpDEARKAVRTLK  177
ident | |                                                   |     
Sbjct LSERYN------gFVLPC-LGVHP----VQGLD---------qrSVTL-KDLDVALPIIE   89
DSSP  HHHHLL------lLEEEE-ELLLL----EELLL---------leELLH-HHHHHHHHHHH


DSSP  HL--LLLEE-EEELLLllllLLLL--llllllLHHHHHHHHHHHHHLLLEEEEEELLhhH
Query KY--GAQVI-XICATGgvfsRGNE--pgqqqlTYEEMKAVVDEAHMAGIKVAAHAHGasG  232
ident  |      |                                  |      |  |      
Sbjct NYkdRLLAIgEVGLDF---sPRFAgtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSRS--A  144
DSSP  HHllLLLEEeEEEEEL---lLLLLllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEEL--L


DSSP  HHHHHHLL------lLEEEELLlLLHHHHHHHHHHLLEEELLlLLHHhhhhhhhhhlllh
Query IREAVRAG------vDTIEHASlVDDEGIKLAVQKGAYFSMDiYNTDytqaegkkngvle  286
ident  |                              |  |  ||                    
Sbjct GRPTINLLqeqgaekVLLHAFD-GRPSVAMEGVRAGYFFSIP-PSII-------------  189
DSSP  HHHHHHHHhhlllllEEEELLL-LLHHHHHHHHHLLLEEEEL-HHHH-------------


DSSP  hhhhhhhhhHHHHHHHHHHHHhhllEEELLLLLLL--------LLLLLHHHHHHHHHHLL
Query dnlrkdrdiGELQRENFRKALkagvKMVYGTDAGI--------YPHGDNAKQFAVMVRYG  338
ident                               ||                            
Sbjct --------rSGQKQKLVKQLP--ltSICLETDSPAlgpekqvrNEPWNISISAEYIAQVK  239
DSSP  --------lLHHHHHHHHHLL--hhHEEELLLLLLllllllllLLHHHHHHHHHHHHHHH


DSSP  --lLHHHHHHHlLHHHHHHHL-LLLLLlllllllllleeeelllllllhhhhhllleeee
Query --aTPLQAIQSaTLTAAEALG-RSKDVgqvavgrygdmiavagdpladvttlekpvfvmk  395
ident             |  |                                            
Sbjct gisVEEVIEVT-TQNALKLFPkLRHLL---------------------------------  265
DSSP  lllHHHHHHHH-HHHHHHHLLlHHHHL---------------------------------


DSSP  lleeeelll
Query ggavvkapx  404
ident          
Sbjct ---------  265
DSSP  ---------


No 29: Query=3mtwA Sbjct=1bf6A Z-score=17.6

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
ident                                                           | 
Sbjct -----------------------------------------------------sfdpTGY    7
DSSP  -----------------------------------------------------llllLLE


DSSP  EEEEELLLLlllllHHHHHhllhhhHHHH-HHHHHHHHHHLLEEEEEELL--lLLLHhHH
Query IDMHVHLDSlaevgGYNSLeysdrfWSVV-QTANAKKTLEAGFTTVRNVG--aADYDdVG  117
ident    | ||         |                        |   |              
Sbjct TLAHEHLHIdlsgfKNNVD---crlDQYAfICQEMNDLMTRGVRNVIEMTnryMGRN-AQ   63
DSSP  EEEEELLLEelhhhHLLHH---heeLLHHhHHHHHHHHHHLLEEEEEELLlhhHLLL-HH


DSSP  HHHHHHLllLLLLEEEELlLLEELllLLLLLllllhhhllllllllLLHHHHHHHHHHHH
Query LREAIDAgyVPGPRIVTAaISFGAtgGHCDStffppsmdqknpfnsDSPDEARKAVRTLK  177
ident            |   |                               |  |         
Sbjct FMLDVMR--ETGINVVAC-TGYYQ--DAFFP----------ehvatRSVQELAQEMVDEI  108
DSSP  HHHHHHH--HHLLEEEEE-ELLLL--HHHLL----------lhhhhLLHHHHHHHHHHHH


DSSP  HL-------LLLEEE-EELLllllllllllLLLL--lLHHHHHHHHHHHHHLLLEEEEEE
Query KY-------GAQVIX-ICATggvfsrgnepGQQQ--lTYEEMKAVVDEAHMAGIKVAAHA  227
ident           |  |  |                          |        |     | 
Sbjct EQgidgtelKAGIIAeIGTS----------EGKItplEEKVFIAAALAHNQTGRPISTHT  158
DSSP  HLlllllllLEEEEEeEELL----------LLLLlhhHHHHHHHHHHHHHHHLLLEEEEL


DSSP  LLHHHHHHHHHLL--------lLEEEELL--LLLHhHHHHHHHHLLEEELLLLLHHhhhh
Query HGASGIREAVRAG--------vDTIEHAS--LVDDeGIKLAVQKGAYFSMDIYNTDytqa  277
ident        |               |  |       |  |      |||   |         
Sbjct SFSTMGLEQLALLqahgvdlsrVTVGHCDlkDNLD-NILKMIDLGAYVQFDTIGKN----  213
DSSP  HHHLLHHHHHHHHhhllllhhhEEELLLLllLLHH-HHHHHHHLLLEEEELLLLLL----


DSSP  hhhhhlllhhhhhhhHHHH-HHHHHHHHHHHHHLL--EEELLLLLL---------lLLLL
Query egkkngvlednlrkdRDIG-ELQRENFRKALKAGV--KMVYGTDAG---------iYPHG  325
ident                     |            |         |            |   
Sbjct ---------------SYYPdEKRIAMLHALRDRGLlnRVMLSMDITrrshlkanggYGYD  258
DSSP  ---------------LLLLhHHHHHHHHHHHHLLLhhHEEELLLLLlhhhlhhhllLLLL


DSSP  LHH-HHHHHHHHLLLLHHHHHHHLLHHHHHHHLllllllllllllllleeeelllllllh
Query DNA-KQFAVMVRYGATPLQAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladv  384
ident              |                                              
Sbjct YLLtTFIPQLRQSGFSQADVDVMLRENPSQFFQ---------------------------  291
DSSP  HHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHLL---------------------------


DSSP  hhhhllleeeelleeeelll
Query ttlekpvfvmkggavvkapx  404
ident                     
Sbjct --------------------  291
DSSP  --------------------


No 30: Query=3mtwA Sbjct=3k2gB Z-score=17.6

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                           | 
Sbjct -------------------------------slselspchvrsgrixtvdgpipssalGH   29
DSSP  -------------------------------llllllllllllleeeelleeeehhhlLL


DSSP  EEEEELLLL-------------------------------lllllHHHHhhllhhHHHHH
Query IDMHVHLDS-------------------------------laevgGYNSleysdrFWSVV   89
ident    | ||                                                     
Sbjct TLXHEHLQNdcrcwwnppqeperqylaeapisieilselrqdpfvNKHN---ialDDLDL   86
DSSP  EELLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhhllhhhLLLL---leeLLHHH


DSSP  HHHHHHHHHHLLEEEEEELLL--LLLHhHHHHHHHHLllLLLLEEEELlLLEELllLLLL
Query QTANAKKTLEAGFTTVRNVGA--ADYDdVGLREAIDAgyVPGPRIVTAaISFGAtgGHCD  147
ident   |  |     |              |       | |    |   |              
Sbjct AIAEVKQFAAVGGRSIVDPTCrgIGRD-PVKLRRISA--ETGVQVVXG-AGYYL--ASSX  140
DSSP  HHHHHHHHHHLLLLEEEELLLllLLLL-HHHHHHHHH--HHLLEEEEL-LLLLL--HHHL


DSSP  LllllhhhllllllllLLHHHHHHHHHHHHH-------LLLLEEE-EELLllllllllll
Query StffppsmdqknpfnsDSPDEARKAVRTLKK-------YGAQVIX-ICATggvfsrgnep  199
ident                  | |                       |  |             
Sbjct P----------etaarLSADDIADEIVAEALegtdgtdARIGLIGeIGVS----------  180
DSSP  L----------hhhhlLLHHHHHHHHHHHHHlllllllLLLLLEEeELLL----------


DSSP  LLLL-lLHHHHHHHHHHHHHLLLEEEEEE-LLHHHHHHHHHLL--------lLEEEELLL
Query GQQQ-lTYEEMKAVVDEAHMAGIKVAAHA-HGASGIREAVRAG--------vDTIEHASL  249
ident                      |     |                            |   
Sbjct SDFTaeEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHRVLDLVeeegadlrhTVLCHXNP  240
DSSP  LLLLhhHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHHHHHHHhhllllhhhEEELLLHH


DSSP  L--LHHHHHHHHHHLLEEELLLLLHHHhhhhhhhhlllhHHHHHhhHHHH--HHHHHHHH
Query V--DDEGIKLAVQKGAYFSMDIYNTDYtqaegkkngvleDNLRKdrDIGE--LQRENFRK  305
ident    |        | ||    |    |                                  
Sbjct ShxDPVYQATLAQRGAFLEFDXIGXDF----------fyADQGV--QCPSddEVARAILG  288
DSSP  HllLHHHHHHHHHHLLEEEELLLLLLL----------eeLLLLE--ELLLhhHHHHHHHH


DSSP  HHHHLL--EEELLLLLLL---------LLLLLHH-HHHHHHHHLLLLHHHHHHHLLHHHH
Query ALKAGV--KMVYGTDAGI---------YPHGDNA-KQFAVMVRYGATPLQAIQSATLTAA  353
ident     |         |                           | |               
Sbjct LADHGYldRILLSHDVFVkxxltryggNGYAFVTkHFLPRLRRHGLDDAALETLXVTNPR  348
DSSP  HHHLLLhhHEEELLLLLLhhhlhhhllLLLLHHHhLHHHHHHHLLLLHHHHHHHHLHHHH


DSSP  HHHLLLLlllllllllllleeeelllllllhhhhhllleeeelleeeelll
Query EALGRSKdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident      |                                             
Sbjct RVFDASI-----------------------------------------egh  358
DSSP  HHHLLLL-----------------------------------------lll


No 31: Query=3mtwA Sbjct=1v77A Z-score=17.2

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
ident                                                             
Sbjct ---------------------------------------------------------VKF    3
DSSP  ---------------------------------------------------------LLL


DSSP  EEEEELLLLlllllhhhhhhllhhhhhhhhhhHHHHHHHLlEEEEEELLllllhhhhhhh
Query IDMHVHLDSlaevggynsleysdrfwsvvqtaNAKKTLEAgFTTVRNVGaadyddvglre  120
ident | |                                   |  |  |               
Sbjct IEMDIRDKE-----------------------AYELAKEW-FDEVVVSI-----------   28
DSSP  EEEEELLHH-----------------------HHHHHHHH-LLEEEEEE-----------


DSSP  hhhllllllleeeelllLEELlllllllllllhhhllllllllllhhhhhhHHHHHHHLL
Query aidagyvpgprivtaaiSFGAtgghcdstffppsmdqknpfnsdspdearkAVRTLKKYG  180
ident                   |                                         
Sbjct -----------------KFNE-----------------------------eVDKEKLREA   42
DSSP  -----------------EELL-----------------------------lLLHHHHHHH


DSSP  L-----LEEEEELlllllllllllllllLLHHHHHHHHHHHHhlLLEEEEEELLHHHHHH
Query A-----QVIXICAtggvfsrgnepgqqqLTYEEMKAVVDEAHmaGIKVAAHAHGASGIRE  235
ident         |                            |                   || 
Sbjct RkeygkVAILLSN---------------PKPSLVRDTVQKFK--SYLIYVESNDLRVIRY   85
DSSP  HhhhllEEEEEEL---------------LLHHHHHHHHHHLL--LLEEEEELLLHHHHHH


DSSP  HHHLLLLEEEELL------LLLHHHHHHHHHHLLEEELLlLLHHHHHhhhhhhlllhhHH
Query AVRAGVDTIEHAS------LVDDEGIKLAVQKGAYFSMDiYNTDYTQaegkkngvledNL  289
ident     ||| |            |    || | |                          | 
Sbjct SIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYS-----------NP  133
DSSP  HHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHL-----------LH


DSSP  HHHHHHHHHHHHHHHHHHHHLLEEELLLLLLLlLLLLHH-HHHHHHHHLLLLHHHHHHHL
Query RKDRDIGELQRENFRKALKAGVKMVYGTDAGIyPHGDNA-KQFAVMVRYGATPLQAIQSA  348
ident                   |  |       |                |  |    ||  | 
Sbjct YERANLLRFMMKAWKLVEKYKVRRFLTSSAQEkWDVRYPrDLISLGVVIGMEIPQAKASI  193
DSSP  HHHHHHHHHHHHHHHHHHHHLLLEEEELLLLLhHHLLLHhHHHHHHHHLLLLHHHHHHLL


DSSP  LHHHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeeelll
Query TLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident        |                                                
Sbjct SMYPEIILK-----------------------------------------------  202
DSSP  LHHHHHHHL-----------------------------------------------


No 32: Query=3mtwA Sbjct=3cjpA Z-score=16.7

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                             
Sbjct ----------------------------------------------------------LI    2
DSSP  ----------------------------------------------------------LL


DSSP  EEEEELLLllllllhhhhhhllhhhhhHHHHHHHHHHHHLLEEEEEELLL----------
Query IDMHVHLDslaevggynsleysdrfwsVVQTANAKKTLEAGFTTVRNVGA----------  110
ident || | |                            |   |||                   
Sbjct IDGHTHVI-------------------LPVEKHIKIMDEAGVDKTILFSTsihpetavnl   43
DSSP  EEEEEELL-------------------LLHHHHHHHHHHHLLLEEEEELLlllhhhlllh


DSSP  ---------------------------LLLHHHHHHHHHHlllllllEEEELlLLEELll
Query ---------------------------ADYDDVGLREAIDagyvpgpRIVTAaISFGAtg  143
ident                                      |         | |          
Sbjct rdvkkemkklndvvngktnsmidvrrnSIKELTNVIQAYP------sRYVGF-GNVPV--   94
DSSP  hhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHLL------lLEEEE-ELLLL--


DSSP  lllllllllhhhlllllllLLLHHHHHHHHHH-HHHLLLLEEE-EELLlllllllllllL
Query ghcdstffppsmdqknpfnSDSPDEARKAVRT-LKKYGAQVIX-ICATggvfsrgnepgQ  201
ident                      |                   |                  
Sbjct -------------------GLSENDTNSYIEEnIVNNKLVGIGeLTPA-----------S  124
DSSP  -------------------LLLHHHHHHHHHHhLLLLLLLEEEeELLL-----------L


DSSP  LLLLhhHHHHHHHHHHHLL-LEEEEEEL---LHHHHHHHHHLL------lLEEEE-LLLL
Query QQLTyeEMKAVVDEAHMAG-IKVAAHAH---GASGIREAVRAG------vDTIEH-ASLV  250
ident  |      |         |      ||        | |                |     
Sbjct GQIK--SLKPIFKYSMDSGsLPIWIHAFnplVLQDIKEIAELCkafpkvpVILGHmGGSN  182
DSSP  LLHH--HHHHHHHHHHHLLlLLEEELLLlllLHHHHHHHHHHHhhlllllEEEHHhHHHH


DSSP  LHHHHHHHHHH-LLEEELLLllhhhhhhhhhhhlllhhhhhhhhhhhhHHHHHHHHHHHH
Query DDEGIKLAVQK-GAYFSMDIyntdytqaegkkngvlednlrkdrdigeLQRENFRKALKA  309
ident       ||      |                                             
Sbjct WMTAVELAKEIqNLYLDTSA---------------------------yFSTFVLKIVINE  215
DSSP  HHHHHHHHHHLlLEEEELLL---------------------------lLLHHHHHHHHHH


DSSP  L-lEEELLLLLLLLlllLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLllllllllll
Query G-vKMVYGTDAGIYphgDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRskdvgqvavg  368
ident    |   |||       |                 |           |            
Sbjct LplKCIFGTDMPFG---DLQLSIEAIKKMSNDSYVANAVLGDNISRLLNI----------  262
DSSP  LllLEELLLLLLLL---LHHHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL----------


DSSP  lllleeeelllllllhhhhhllleeeelleeeelll
Query rygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                     
Sbjct ------------------------------------  262
DSSP  ------------------------------------


No 33: Query=3mtwA Sbjct=2vc5A Z-score=16.5

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                           | 
Sbjct ------------------------------------------mriplvgkdsieskdiGF   18
DSSP  ------------------------------------------llllllllllllhhhlLL


DSSP  EEEEELLLLlllllhHHHH----HLLHHHHHHHHHHHHHHHHHLLEEEEEELL-----LL
Query IDMHVHLDSlaevggYNSL----EYSDRFWSVVQTANAKKTLEAGFTTVRNVG-----AA  111
ident    | ||                 |             |     |  |            
Sbjct TLIHEHLRV---fseAVRQqwphLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTvmglgRD   75
DSSP  EELLLLLLL---llhHHHHhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEEELLlllllLL


DSSP  LLHHHHHHHHHHllllllLEEEELlLLEE-LLLLllllllllhhhlllllllllLHHHHH
Query DYDDVGLREAIDagyvpgPRIVTAaISFG-ATGGhcdstffppsmdqknpfnsdSPDEAR  170
ident          |           |                                | ||  
Sbjct IRFMEKVVKATG------INLVAG-TGIYiYIDL-------------pfyflnrSIDEIA  115
DSSP  HHHHHHHHHLLL------LEEEEL-EELLlLLLL-------------lhhhlllLHHHHH


DSSP  HHHHHHHH-------LLLLEEEEELLllllllllllLLLL--lLHHHHHHHHHHHHHLLL
Query KAVRTLKK-------YGAQVIXICATggvfsrgnepGQQQ--lTYEEMKAVVDEAHMAGI  221
ident        |         |   || |                        |          
Sbjct DLFIHDIKegiqgtlNKAGFVXIAAD----------EPGItkdVEKVIRAAAIANKETKV  165
DSSP  HHHHHHHHlllllllLLLLLEEEELL----------LLLLlhhHHHHHHHHHHHHHHHLL


DSSP  EEEEEELL-HHHHHHHHHLL--------lLEEEEL-LLLLHHHHHHHHHHLLEEELLLLL
Query KVAAHAHG-ASGIREAVRAG--------vDTIEHA-SLVDDEGIKLAVQKGAYFSMDIYN  271
ident     |         |  |             | |         ||    ||     | | 
Sbjct PIITHSNAhNNTGLEQQRILteegvdpgkILIGHLgDTDNIDYIKKIADKGSFIGLDRYG  225
DSSP  LEEEELLLlLLHHHHHHHHHhhllllhhhEEELLHhHLLLHHHHHHHHHLLLEEEELLLL


DSSP  HHhhhhhhhhhlllhhhhhhhHHHH-HHHHHHHHHHHHHLL--EEELLLLLL--------
Query TDytqaegkkngvlednlrkdRDIG-ELQRENFRKALKAGV--KMVYGTDAG--------  320
ident  |                            |      | |   |     |          
Sbjct LD-------------------LFLPvDKRNETTLRLIKDGYsdKIMISHDYCctidwgta  266
DSSP  LL-------------------LLLLhHHHHHHHHHHHHLLLllLEEELLLLLllllllll


DSSP  ----------LLLLlLHHH--HHHHHHHLLLLHHHHHHHLLHHHHHHHLlllllllllll
Query ----------IYPHgDNAK--QFAVMVRYGATPLQAIQSATLTAAEALGrskdvgqvavg  368
ident                            | |                              
Sbjct kpeykpklapRWSI-TLIFedTIPFLKRNGVNEEVIATIFKENPKKFFS-----------  314
DSSP  lhhhhhhhllLLLL-LHHHhlHHHHHHLLLLLHHHHHHHHLHHHHHHLL-----------


DSSP  lllleeeelllllllhhhhhllleeeelleeeelll
Query rygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                     
Sbjct ------------------------------------  314
DSSP  ------------------------------------


No 34: Query=3mtwA Sbjct=3gg7A Z-score=16.0

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                            |
Sbjct ----------------------------------------------------------SL    2
DSSP  ----------------------------------------------------------LL


DSSP  EEEEELLLLLllllhhhhhhllhhhhhHHHHHHHHHHHHLLEeEEEELL---lLLLHHHH
Query IDMHVHLDSLaevggynsleysdrfwsVVQTANAKKTLEAGFtTVRNVG---aADYDDVG  117
ident || |||||                       | |    |    ||  |     |      
Sbjct IDFHVHLDLY-----------------PDPVAVARACEERQL-TVLSVTttpaAWRGTLA   44
DSSP  EEEEELHHHL-----------------LLHHHHHHHHHHLLL-EEEELLllhhHHHHHHH


DSSP  HHHHHhllllllLEEEELlLLEELlllLLLLLlllhhhllLLLLLlllhhhhhHHHHHHH
Query LREAIdagyvpgPRIVTAaISFGAtggHCDSTffppsmdqKNPFNsdspdearKAVRTLK  177
ident |           |   ||   |        |                             
Sbjct LAAGR-------PHVWTA-LGFHP---EVVSE--------RAADL--------PWFDRYL   77
DSSP  HHLLL-------LLEEEL-LLLLH---HHLLL--------LHHHL--------HHHHHHH


DSSP  HlLLLEEE-EELLLllllLLLLllllllLHHHHHHHHHHHHHL-LLEEEEEELLhhHHHH
Query KyGAQVIX-ICATGgvfsRGNEpgqqqlTYEEMKAVVDEAHMA-GIKVAAHAHGasGIRE  235
ident              |                              |     |        |
Sbjct P-ETRFVGeVGLDG---sPSLR-gtwtqQFAVFQHILRRCEDHgGRILSIHSRR--AESE  130
DSSP  H-HLLEEEeEELLL---lHHHH-hhhhhHHHHHHHHHHHHHHLlLEEEEEELLL--LHHH


DSSP  HHHLL-------lLEEEELLlLLHHHHHHHHHHLLEEELLLLlhhhhhhhhhhhlllhhh
Query AVRAG-------vDTIEHASlVDDEGIKLAVQKGAYFSMDIYntdytqaegkkngvledn  288
ident                    |         |   |  ||                      
Sbjct VLNCLeanprsgtPILHWYS-GSVTELRRAISLGCWFSVGPT------------------  171
DSSP  HHHHHhhlhhheeEEEELLL-LLHHHHHHHHHLLLEEEELHH------------------


DSSP  hhhhhhhHHHHHHHHHHHHhhllEEELLLLLLL-------LLLLLHHHHHHHHHHLL-LL
Query lrkdrdiGELQRENFRKALkagvKMVYGTDAGI-------YPHGDNAKQFAVMVRYG-AT  340
ident                |            ||              |               
Sbjct ----mvrTQKGAALIRSMP--rdRVLTETDGPFleldgqaALPWDVKSVVEGLSKIWqIP  225
DSSP  ----hhlLHHHHHHHHHLL--hhHEEELLLLLLleelleeLLHHHHHHHHHHHHHHHlLL


DSSP  HHHHHHHLLHHHHHhHLLLllllllllllllleeeelllllllhhhhhllleeeelleee
Query PLQAIQSATLTAAEaLGRSkdvgqvavgrygdmiavagdpladvttlekpvfvmkggavv  400
ident                |                                            
Sbjct ASEVERIVKENVSR-LLGT-----------------------------------------  243
DSSP  HHHHHHHHHHHHHH-HHHL-----------------------------------------


DSSP  elll
Query kapx  404
ident     
Sbjct ----  243
DSSP  ----


No 35: Query=3mtwA Sbjct=3irsA Z-score=15.8

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
ident                                                             
Sbjct ---------------------------------------------------------LKI    3
DSSP  ---------------------------------------------------------LLL


DSSP  EEEEELLL-------lLLLLLHH-------hhhhllhhhhhHHHHHHHHHHHHLLEEEEE
Query IDMHVHLD-------sLAEVGGY-------nsleysdrfwsVVQTANAKKTLEAGFTTVR  106
ident ||                                                   ||     
Sbjct IDFRLRPPamgflnarIYTRPDIrnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGV   63
DSSP  EELLLLLLlhhhhhlhHHHLHHHhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEE


DSSP  ELLL-------LLLH-HHHHHHHHHlllllllEEEELlLLEEllllllllllllhhhlll
Query NVGA-------ADYD-DVGLREAIDagyvpgpRIVTAaISFGatgghcdstffppsmdqk  158
ident  ||                   |                |                    
Sbjct CVGRnssvlgsVSNAdVAAVAKAYP------dKFHPV-GSIE------------------   98
DSSP  EELLeellleeLLHHhHHHHHHHLL------lLEEEE-EELL------------------


DSSP  llllLLLHHHHHHHHHHHHHLLLLEEEEELLLllllllllllllLLLHHHHHHHHHHHHH
Query npfnSDSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHM  218
ident          ||          |                                      
Sbjct ----AATRKEAMAQMQEILDLGIRIVNLEPGV-------watpmHVDDRRLYPLYAFCED  147
DSSP  ----LLLHHHHHHHHHHHHHLLLLLEEELHHH-------lllllLLLLHHHHHHHHHHHH


DSSP  LLLEEEEEEL----------LHHHHHHHHH---lLLLEEEE-LLLLLHHHHHHHHHHL-L
Query AGIKVAAHAH----------GASGIREAVR---aGVDTIEH-ASLVDDEGIKLAVQKG-A  263
ident  || |                   |               |       | |  |      
Sbjct NGIPVIMMTGgnagpditytNPEHIDRVLGdfpdLTVVSSHgNWPWVQEIIHVAFRRPnL  207
DSSP  LLLLEEEELLllllllhhhhLHHHHHHHHHhlllLLEEEEHhHLLLHHHHHHHHHHLLlE


DSSP  EEELL-LLLHhhhhhhhhhhlllhhhhhhhhhhhHHHHHHHHHHHHHLL--EEELLLLLL
Query YFSMD-IYNTdytqaegkkngvlednlrkdrdigELQRENFRKALKAGV--KMVYGTDAG  320
ident | | |                                   |  |        |  ||   
Sbjct YLSPDmYLYN------------------------LPGHADFIQAANSFLadRMLFGTAYP  243
DSSP  EEELHhHHLL------------------------LLLHHHHHHHHLLHHhhLLLLLLLLL


DSSP  LLLLLLHH-HHHHHhhhlLLLHHHHHHHLLHHHHHHHLLlllllllllllllleeeelll
Query IYPHGDNA-KQFAVmvryGATPLQAIQSATLTAAEALGRskdvgqvavgrygdmiavagd  379
ident   |                  |          |   |                       
Sbjct MCPLKEYTeWFLTL----PIKPDAMEKILHGNAERLLAQ---------------------  278
DSSP  LLLHHHHHhHHHLL----LLLHHHHHHHHLHHHHHHHHH---------------------


DSSP  llllhhhhhllleeeelleeeelll
Query pladvttlekpvfvmkggavvkapx  404
ident                          
Sbjct ----------------------agr  281
DSSP  ----------------------lll


No 36: Query=3mtwA Sbjct=2ffiA Z-score=14.9

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
ident                                                             
Sbjct -------------------------------------------------------lhLTA    5
DSSP  -------------------------------------------------------llLLL


DSSP  EEEEELLLllllllhhhHHHLLH---hhhhhHHHHHHHHHHHLLEEEEEELLL-----LL
Query IDMHVHLDslaevggynSLEYSD---rfwsvVQTANAKKTLEAGFTTVRNVGA-----AD  112
ident || | |            |                        ||     |         
Sbjct IDSHAHVF-----srglNLASQRryapnydaPLGDYLGQLRAHGFSHGVLVQPsflgtDN   60
DSSP  EELLLLLL-----lhhhHHHLLLllllllllLHHHHHHHHHHLLLLEELLLLLhhhllLL


DSSP  LHHHHHHHHHHlllllllEEEELlLLEEllllllllllllhhhllllllllllhhhHHHH
Query YDDVGLREAIDagyvpgpRIVTAaISFGatgghcdstffppsmdqknpfnsdspdeARKA  172
ident                                                             
Sbjct RYLLSALQTVP------gQLRGV-VXLE----------------------------RDVE   85
DSSP  HHHHHHHHHLL------lLLLLL-LLLL----------------------------LLLL


DSSP  hHHHHHLL---LLEEEEELLLllllllllllllLLLHH--hhHHHHHHHHHLLLEEEEEE
Query vRTLKKYG---AQVIXICATGgvfsrgnepgqqQLTYE--emKAVVDEAHMAGIKVAAHA  227
ident   ||                |                               |  |  | 
Sbjct qATLAEXArlgVRGVRLNLXG----------qdXPDLTgaqwRPLLERIGEQGWHVELHR  135
DSSP  hHHHHHHHlllLLEEELLLLL----------llLLLLLllllHHHHHHHHHHLLEEEELL


DSSP  lLHHHHHHHHHLL-----lLEEE-ELLL---------lLHHHHHHhHHHLLEEELLLLLH
Query hGASGIREAVRAG-----vDTIE-HASL---------vDDEGIKLaVQKGAYFSMDIYNT  272
ident      |   |||         |                  |   |               
Sbjct -QVADIPVLVRALqpygldIVIDhFGRPdarrglgqpgFAELLTLsGRGKVWVKVSGIYR  194
DSSP  -LLLLHHHHHHHHllllllEEELhHHLLllllllllllHHHHLLLlLLLLEEEEEELHHH


DSSP  hhhhhhhhhhlllhhhhhHHHH--HHHHHHHHHHHHHHHLL--EEELLLLLLL------L
Query dytqaegkkngvlednlrKDRD--IGELQRENFRKALKAGV--KMVYGTDAGI------Y  322
ident                              |                 | |          
Sbjct -----------------lQGSPeeNLAFARQALCALEAHYGaeRLXWGSDWPHtqheseV  237
DSSP  -----------------lLLLHhhHHHHHHHHHHHHHHHLLhhHEEEELLLLLllllllL


DSSP  LLLLHHHHHHHHHhllLLHHHHHHHLLHHHHHHHlLLLLllllllllllleeeellllll
Query PHGDNAKQFAVMVrygATPLQAIQSATLTAAEALgRSKDvgqvavgrygdmiavagdpla  382
ident   |    ||                   ||                              
Sbjct SFGSAVEQFEALG---CSAQLRQALLLDTARALF-GFEL---------------------  272
DSSP  LHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHL-LLLL---------------------


DSSP  lhhhhhllleeeelleeeelll
Query dvttlekpvfvmkggavvkapx  404
ident                       
Sbjct ---------------------e  273
DSSP  ---------------------l


No 37: Query=3mtwA Sbjct=4mupB Z-score=14.7

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                           | 
Sbjct ------------------------------------------lvrklsgtapnpafPRGA   18
DSSP  ------------------------------------------llllllllllllllLLLL


DSSP  EEEEELLLllllllhhhhhhlLHHH---------hhHHHHHHHHHHHH-LLEEEEEELLL
Query IDMHVHLDslaevggynsleySDRF---------wsVVQTANAKKTLE-AGFTTVRNVGA  110
ident  |   |                                            |   |     
Sbjct VDTQMHMY-----------lpGYPAlpggpglppgaLPGPEDYRRLMQwLGIDRVIITQG   67
DSSP  EELLLLLL-----------llLLLLlllllllllllLLLHHHHHHHHHhHLLLEEEEELL


DSSP  -----LLLHHHHHHHHHHlllllllEEEELLLleellllllllllllhhhllllllllll
Query -----ADYDDVGLREAIDagyvpgpRIVTAAIsfgatgghcdstffppsmdqknpfnsds  165
ident                                |                            
Sbjct nahqrDNGNTLACVAEMG------eAAHAVVI----------------------------   93
DSSP  hhhllLLHHHHHHHHHHH------hHEEEEEL----------------------------


DSSP  hhhHHHH----HHHHHHLLLLEEEEELLLlllllllllllllllHHHHHHHHHHHHHLLL
Query pdeARKA----VRTLKKYGAQVIXICATGgvfsrgnepgqqqltYEEMKAVVDEAHMAGI  221
ident               |   |     |                     |  ||   || |  
Sbjct --iDATTtekdMEKLTAAGTVGARIMDLP----------ggavnLSELDAVDERAHAADW  141
DSSP  --lLLLLlhhhHHHHHHLLEEEEEEELLL----------lllllHHHHHHHHHHHHHLLL


DSSP  EEEEEELLHHH--hHHHHHLL--lLEEE-ELLL---------lLHHHHHHHHHHLLEEEL
Query KVAAHAHGASG--iREAVRAG--vDTIE-HASL---------vDDEGIKLAVQKGAYFSM  267
ident  ||    |                     |                  ||       |  
Sbjct MVAVQFDGNGLldhLPRLQKIrsrWVFDhHGKFfkgirtdgpeMAALLKLIDRGNLWFKF  201
DSSP  EEEEELLHHHHhhhHHHHHLLlleEEELhHHHLllllllllhhHHHHHHHHHHLLEEEEE


DSSP  LLLLHhhhhhhhhhhlllhhhhhHHHH--hHHHHHHHHHHHHHHL-lEEELLLLLLLL--
Query DIYNTdytqaegkkngvlednlrKDRD--iGELQRENFRKALKAG-vKMVYGTDAGIY--  322
ident                          |            |          | ||       
Sbjct AGVYE------------------SSRKswpYADVAAFSRVIAAHApeRIVWGTNWPHNsv  243
DSSP  LLHHH------------------LLLLlllLHHHHHHHHHHHHHLhhHEEELLLLLLLll


DSSP  ----lllLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLLLLllllllllllleeeell
Query ----phgDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRSKDvgqvavgrygdmiavag  378
ident        | |                              |                   
Sbjct retaaypDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV-----------------  286
DSSP  llhhhllLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL-----------------


DSSP  lllllhhhhhllleeeelleeeelll
Query dpladvttlekpvfvmkggavvkapx  404
ident                           
Sbjct --------------------------  286
DSSP  --------------------------


No 38: Query=3mtwA Sbjct=4dlfA Z-score=14.4

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
ident                                                             
Sbjct ---------------------------------------------------------ALR    3
DSSP  ---------------------------------------------------------LLL


DSSP  EEEEELLL------------lllLLLHhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEEL
Query IDMHVHLD------------slaEVGGynsleysdrfwsvVQTANAKKTLEAGFTTVRNV  108
ident || | |                                     |               |
Sbjct IDSHQHFWryraadypwigagmgVLAR-----------dyLPDALHPLMHAQALGASIAV   52
DSSP  EEEEELLLlllhhhllllllllhHHLL-----------llLHHHHHHHHHHLLLLEEEEE


DSSP  LL-----LLLHHHHHHHHHHllllllLEEEELLLleellllllllllllhhhllllllll
Query GA-----ADYDDVGLREAIDagyvpgPRIVTAAIsfgatgghcdstffppsmdqknpfns  163
ident  |            |                                             
Sbjct QAragrdETAFLLELACDEA------RIAAVVGW--------------------------   80
DSSP  LLlllhhHHHHHHHHHLLLL------LEEEEEEL--------------------------


DSSP  llhhHHHH-hHHHHHHLL----LLEEEEELLLlllllllllllLLLLHHH--hHHHHHHH
Query dspdEARK-aVRTLKKYG----AQVIXICATGgvfsrgnepgqQQLTYEE--mKAVVDEA  216
ident       |                                                 |   
Sbjct ---eDLRApqLAERVAEWrgtkLRGFRHQLQD--------eadVRAFVDDadfARGVAWL  129
DSSP  ---lLLLLllHHHHHHLLllllEEEEEELHHH--------lllHHHHHHLhhhHHHHHHH


DSSP  HHLLLEEEEEELLHHhHHHHHHLL------lLEEE-ELLL-------------lLHHHHH
Query HMAGIKVAAHAHGASgIREAVRAG------vDTIE-HASL-------------vDDEGIK  256
ident                                                             
Sbjct QANDYVYDVLVFERQ-LPDVQAFCarhdahwLVLDhAGKPalaefdrddtalarWRAALR  188
DSSP  HHLLLEEEELLLHHH-HHHHHHHHhhlllllEEEHhHHLLlhhhllllllhhhhHHHHHH


DSSP  HHHHHL-LEEELL-LLLHHhHHHHhhhhlllhhhhhhhHHHHHHHHHHHHHHHHHLL--E
Query LAVQKG-AYFSMD-IYNTDyTQAEgkkngvlednlrkdRDIGELQRENFRKALKAGV--K  312
ident                                                    || |     
Sbjct ELAALPhVVCKLSgLVTEAdWRRG------------lrASDLRHIEQCLDAALDAFGpqR  236
DSSP  HHHLLLlEEEEELlLLLLLlLLLL------------llHHHHHHHHHHHHHHHHHHLhhH


DSSP  EELLLLLLLLL----LLLHHH-HHHHHHHlLLLHHHHHHHLLHHHHHHHLLLllllllll
Query MVYGTDAGIYP----HGDNAK-QFAVMVRyGATPLQAIQSATLTAAEALGRSkdvgqvav  367
ident    | |             |                       |||              
Sbjct LMFGSDWPVCLlaasYDEVASlVERWAES-RLSAAERSALWGGTAARCYALP--------  287
DSSP  EEELLLLLHHHhlllHHHHHHhHHHHHHH-HLLHHHHHHHLLHHHHHHLLLL--------


DSSP  llllleeeelllllllhhhhhllleeeelleeeelll
Query grygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                      
Sbjct -------------------------------------  287
DSSP  -------------------------------------


No 39: Query=3mtwA Sbjct=3pnuA Z-score=14.3

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeEEEEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgVTLLPGL   60
ident                                                         |   
Sbjct ---------------------------------------------enlyfqsnAMKLKNP   15
DSSP  ---------------------------------------------llllllllLEEEELL


DSSP  EEEEELLLllllllhhhhhhllhhhHHHHHHHHHHHHHHlLEEEEEELLLL---------
Query IDMHVHLDslaevggynsleysdrfWSVVQTANAKKTLEaGFTTVRNVGAA---------  111
ident  ||| ||                          |       |                  
Sbjct LDMHLHLR-----------------DNQMLELIAPLSAR-DFCAAVIMPNLipplcnled   57
DSSP  EEEEELLL-----------------LHHHHHHHHHHHHL-LLLEEEELLLLllllllhhh


DSSP  LLHHHHHHHHHhllLLLLLEEEELlLLEEllllllllllllhhhllllllllllhhHHHH
Query DYDDVGLREAIdagYVPGPRIVTAaISFGatgghcdstffppsmdqknpfnsdspdEARK  171
ident                            |                               |
Sbjct LKAYKMRILKA--cKDENFTPLMT-LFFK--------------------------nYDEK   88
DSSP  HHHHHHHHHHH--hLLLLLEEEEE-EELL--------------------------lLLHH


DSSP  HHHHHHHlLLLEEEEELlLLLLLllllllllLLLHH--hhHHHHHHHHHLLLEEEEEEL-
Query AVRTLKKyGAQVIXICAtGGVFSrgnepgqqQLTYE--emKAVVDEAHMAGIKVAAHAH-  228
ident      |      ||    |                     |          |    |   
Sbjct FLYSAKD-EIFGIXLYPaGITTN----snggVSSFDieylKPTLEAMSDLNIPLLVHGEt  143
DSSP  HHHHHLL-LLLEEEELLlLLLLL----llllLLLLLhhhhHHHHHHHHHLLLLEEELLLl


DSSP  -------LHHHHHHHHHLL------LLEEEELLLLLhhHHHHHHHHL-LEEELLLL----
Query -------GASGIREAVRAG------VDTIEHASLVDdeGIKLAVQKG-AYFSMDIY----  270
ident                              ||          |       |          
Sbjct ndfvmdrESNFAKIYEKLAkhfprlKIVMEHITTKT--LCELLKDYEnLYATITLHhlii  201
DSSP  lllhhhlLHHHHHHHHHHHhhllllLEEELLLLLHH--HHHHHHHLLlEEEEELLHhhll


DSSP  -----lhhhhHHHHhhhlllhhhhhhhhhHHHH--hHHHHHHHH-hhLLEEELLLLLL--
Query -----ntdytQAEGkkngvlednlrkdrdIGEL--qRENFRKAL-kaGVKMVYGTDAG--  320
ident                              |       |           |   | |    
Sbjct tlddviggkmNPHL-----------fckpIAKRyedKEALCELAfsgYEKVMFGSDSAph  250
DSSP  lhhhhhllllLHHH-----------llllLLLLhhhHHHHHHHHhllLLLEEELLLLLll


DSSP  -------LLLLLLHH-HHHHHHHHlLLLHHHHHHHLLHHHHHHhLLLLLlllllllLLLL
Query -------IYPHGDNA-KQFAVMVRyGATPLQAIQSATLTAAEAlGRSKDvgqvavgRYGD  372
ident                                                |            
Sbjct pkgcaagVFSAPVILpVLAELFKQ-NSSEENLQKFLSDNTCKI-YDLKF-------KEDK  301
DSSP  lllllllLLLHHHHHhHHHHHHHH-HLLHHHHHHHHLHHHHHH-HLLLL-------LLLL


DSSP  EEEELLL-----------------llllhhhhhLLLEeeelleeeelll
Query MIAVAGD-----------------pladvttleKPVFvmkggavvkapx  404
ident                                                  
Sbjct ILTLEEKewqvpnvyedkynqvvpymageilkfQLKH------------  338
DSSP  EEEEELLleelllleelllleellllllleellEELL------------


No 40: Query=3mtwA Sbjct=4ofcA Z-score=13.7

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                             
Sbjct ----------------------------------------------------------MK    2
DSSP  ----------------------------------------------------------LL


DSSP  EEEEELLL----------------------lllLLLHHH--hhhllhhhhhHHHHHHHHH
Query IDMHVHLD----------------------slaEVGGYN--sleysdrfwsVVQTANAKK   96
ident || | |                           |                          
Sbjct IDIHSHILpkewpdlkkrfgyggwvqlqhhskgEAKLLKdgkvfrvvrencWDPEVRIRE   62
DSSP  EEEEEELLllllllhhhhhllllleeeeeeellEEEEEElleeeeeeehhhLLHHHHHHH


DSSP  HHHLLEEEEEELLL-------------------LLLHHHHHHHHHHlllllllEEEELLL
Query TLEAGFTTVRNVGA-------------------ADYDDVGLREAIDagyvpgpRIVTAAI  137
ident     | |                             |                | |    
Sbjct MDQKGVTVQALSTVpvmfsywakpedtlnlcqlLNNDLASTVVSYP------rRFVGLGT  116
DSSP  HHHHLLLEEEEELLhhhhlllllhhhhhhhhhhHHHHHHHHHHHLL------lLEEEEEL


DSSP  leellllllllllllhhhlllllLLLLLHHHHHHHHHHHHH-LLLLEEEEELLlllllll
Query sfgatgghcdstffppsmdqknpFNSDSPDEARKAVRTLKK-YGAQVIXICATggvfsrg  196
ident                             |  | |      |  |     |          
Sbjct -----------------------LPMQAPELAVKEMERCVKeLGFPGVQIGTH-------  146
DSSP  -----------------------LLLLLHHHHHHHHHHHHHlLLLLEEEEELE-------


DSSP  lllllLLLLHHHhHHHHHHHHHLLLEEEEEE----------------------LLHHHHH
Query nepgqQQLTYEEmKAVVDEAHMAGIKVAAHA----------------------HGASGIR  234
ident           |    |   |         |                            | 
Sbjct -vnewDLNAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgmpaETTIAIC  204
DSSP  -elleELLLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhhhhHHHHHHH


DSSP  HH--------hhlllLEEEE-LLLLLHH----------------------hhHHHHhhLL
Query EA--------vragvDTIEH-ASLVDDE----------------------giKLAVqkGA  263
ident                    |                                |       
Sbjct SMimggvfekfpklkVCFAHgGGAFPFTvgrishgfsmrpdlcaqdnpmnpkKYLG--SF  262
DSSP  HHhlllhhhhlllllEEELHhHLLHHHHhhhhhhhhhhlhhhhlllllllhhHHLL--LL


DSSP  EEELLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLLL
Query YFSMDIYntdytqaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAGI  321
ident |                                                 |   |||   
Sbjct YTDALVH----------------------------dPLSLKLLTDVIGkdKVILGTDYPF  294
DSSP  EEELLLL----------------------------lHHHHHHHHHHHLllLEELLLLLLL


DSSP  L-lllLHHHHHHHhhHLLLLHHHHHHHLLHHHHHHHLL-LLLLlllllllllleeeelll
Query Y-phgDNAKQFAVmvRYGATPLQAIQSATLTAAEALGR-SKDVgqvavgrygdmiavagd  379
ident         |                      |   ||   |                   
Sbjct PlgelEPGKLIES--MEEFDEETKNKLKAGNALAFLGLeRKQF-----------------  335
DSSP  LllllLLLHHHHH--LLLLLHHHHHHHHLHHHHHHHLLlHHHL-----------------


DSSP  llllhhhhhllleeeelleeeelll
Query pladvttlekpvfvmkggavvkapx  404
ident                          
Sbjct -------------------------  335
DSSP  -------------------------


No 41: Query=3mtwA Sbjct=1itqA Z-score=13.7

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                             
Sbjct --------------------------------------------dffrdeaerimrDSPV   16
DSSP  --------------------------------------------lhhhhhhhhhhlLLLE


DSSP  EEEEELLLLLllllhhhhhhLLHHH---hhHHHH------hHHHHHHHLLEEEEEELLL-
Query IDMHVHLDSLaevggynsleYSDRF---wsVVQT------aNAKKTLEAGFTTVRNVGA-  110
ident || |  |                          |       |  |               
Sbjct IDGHNDLPWQ-------lldMFNNRlqderANLTtlagthtNIPKLRAGFVGGQFWSVYt   69
DSSP  EEEEELHHHH-------hhhHHLLLlllhhHLLLlllllllLHHHHHHLLEEEEEEEELl


DSSP  ---------------LLLHHHHHHHHHhllLLLL-----------------LEEEELlLL
Query ---------------ADYDDVGLREAIdagYVPG-----------------PRIVTAaIS  138
ident                                                             
Sbjct pcdtqnkdavrrtleQMDVVHRMCRMY---PETFlyvtssagirqafregkVASLIG-VE  125
DSSP  lhhhllllhhhhhhhHHHHHHHHHHHL---LLLEeelllhhhhhhhhhlllEEEEEE-EE


DSSP  EELlllllllllllhhhlllllLLLLlhhhHHHHHHHHHHLLLLEEEEE-------LLLL
Query FGAtgghcdstffppsmdqknpFNSDspdeARKAVRTLKKYGAQVIXIC-------ATGG  191
ident  |                                 | |   |              |   
Sbjct GGH-------------------SIDS----SLGVLRALYQLGMRYLTLThscntpwADNW  162
DSSP  LHH-------------------HLLL----LHHHHHHHHHLLEEEEELLlllllllLLLH


DSSP  llllllLLLL------lllLHHHHHHHHHHHHHLLLEEEEEElLHHHHHHHHHLL--lLE
Query vfsrgnEPGQ------qqlTYEEMKAVVDEAHMAGIKVAAHAhGASGIREAVRAG--vDT  243
ident                           || |    |                         
Sbjct ------LVDTgdsepqsqgLSPFGQRVVKELNRLGVLIDLAHvSVATMKATLQLSrapVI  216
DSSP  ------HHLLlllllllllLLHHHHHHHHHHHHHLLEEELLLlLHHHHHHHHHHLlllLE


DSSP  EE-ELLL--------LLHHHHHHHHHHLLEEELLlLLHH--hhHHHHhhhlllhhhhhhh
Query IE-HASL--------VDDEGIKLAVQKGAYFSMDiYNTD--ytQAEGkkngvlednlrkd  292
ident                | |    |  |                                  
Sbjct FShSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN-FYNNyiscTNKA-------------  262
DSSP  ELlLLLLllllllllLLHHHHHHHHHHLLEEEEL-LLHHhhllLLLL-------------


DSSP  hhhhhhhHHHHHHHHHHLL--EEELLLLLLLL--------LLLLHHHHHHHHHHLLLLHH
Query rdigelqRENFRKALKAGV--KMVYGTDAGIY--------PHGDNAKQFAVMVRYGATPL  342
ident                          | |                     |   |   |  
Sbjct --nlsqvADHLDHIKEVAGarAVGFGGDFDGVprvpegleDVSKYPDLIAELLRRNWTEA  320
DSSP  --lhhhhHHHHHHHHHHLLhhHEEELLLLLLLllllllllLLLLHHHHHHHHHHLLLLHH


DSSP  HHHHHLLHHHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeeel
Query QAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvka  402
ident                                                             
Sbjct EVKGALADNLLRVFE-------------aveqasnltqapeeepipldqlggscrthygy  367
DSSP  HHHHHHLHHHHHHHH-------------hhhhllllllllllllllhhhlllllllllll


DSSP  ll
Query px  404
ident   
Sbjct ss  369
DSSP  ll


No 42: Query=3mtwA Sbjct=4hk5D Z-score=13.6

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                          |  
Sbjct --------------------------------------------------------TPVV    4
DSSP  --------------------------------------------------------LLLL


DSSP  EEEEELLLL------------------lllllHHHHH---------------------hl
Query IDMHVHLDS------------------laevgGYNSL---------------------ey   81
ident  | | |                                                      
Sbjct VDIHTHMYPpsyiamlekrqtiplvrtfpqadEPRLIllsselaaldaaladpaaklpgr   64
DSSP  EEEEEEELLhhhhhhhhlllllleeeeelleeEEEEEllhhhhhhhhhhhhlllllllle


DSSP  lhhhhhHHHHHHHHHHHHLLEEEEEELLL------------------LLLHHHHHHHHHH
Query sdrfwsVVQTANAKKTLEAGFTTVRNVGA------------------ADYDDVGLREAID  123
ident                    |        |                               
Sbjct plsthfASLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiadaVNAEFSDMCAQHV  124
DSSP  ellhhhLLHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhhhhHHHHHHHHHHLLL


DSSP  lllllllEEEELlLLEEllllllllllllhhhllllllLLLLHHHHHHHHHHHHHLL-LL
Query agyvpgpRIVTAaISFGatgghcdstffppsmdqknpfNSDSPDEARKAVRTLKKYG-AQ  182
ident        |                               |   |         |      
Sbjct ------gRLFFF-AALP---------------------LSAPVDAVKASIERVKNLKyCR  156
DSSP  ------lLEEEE-EELL---------------------LLLLHHHHHHHHHHHHLLLlEE


DSSP  EEEEELLlllllllllllllLLLHHhHHHHHHHHHHLLLEEEEEE---------------
Query VIXICATggvfsrgnepgqqQLTYEeMKAVVDEAHMAGIKVAAHA---------------  227
ident  |                   |       |      |   |  |                
Sbjct GIILGTS---------glgkGLDDPhLLPVFEAVADAKLLVFLHPhyglpnevygprsee  207
DSSP  EEEELLL---------llllLLLLHhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhh


DSSP  -------------LLHHHHHH--------hhhlLLLEEE-ELLL-LLHH-----------
Query -------------HGASGIRE--------avraGVDTIE-HASL-VDDE-----------  253
ident                                                             
Sbjct yghvlplalgfpmETTIAVARmymagvfdhvrnLQMLLAhSGGTlPFLAgriescivhdg  267
DSSP  lllhhhhhlhhhhHHHHHHHHhhhllhhhhlllLLEEEHhHHLLhHHHHhhhhhhhhllh


DSSP  --------------HHHHHHhHLLEEELLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhh
Query --------------GIKLAVqKGAYFSMDIYntdytqaegkkngvlednlrkdrdigelq  299
ident                         |    ||                             
Sbjct hlvktgkvpkdrrtIWTVLK-EQIYLDAVIY----------------------------s  298
DSSP  hhhhllllllllllHHHHHH-HLEEEELLLL----------------------------l


DSSP  HHHHHHHHhHLLE---EELLLLLLLLL---------llLHHHHHHHHHHlLLLH--HHHH
Query RENFRKALkAGVK---MVYGTDAGIYP---------hgDNAKQFAVMVRyGATP--LQAI  345
ident       |  |         |||    |                               | 
Sbjct EVGLQAAI-ASSGadrLMFGTDHPFFPpieedvqgpwdSSRLNAQAVIK-AVGEgsSDAA  356
DSSP  HHHHHHHH-HHHLhhhEELLLLLLLLLllllllllllhHHHHHHHHHHH-HHLLllHHHH


DSSP  HHLLHHHHHHHLLLLLLlllllLLLLleeeelllllllhhhhhllleeeelleeeelll
Query QSATLTAAEALGRSKDVgqvavGRYGdmiavagdpladvttlekpvfvmkggavvkapx  404
ident     | |   |                                                
Sbjct AVMGLNAVRVLSLKAEL-----EHHH------------------------------hhh  380
DSSP  HHHLHHHHHHLLLHHHH-----HHHH------------------------------hhl


No 43: Query=3mtwA Sbjct=2dvtA Z-score=13.5

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                           | 
Sbjct --------------------------------------------------------MQGK    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEEELLL-----lllllLHHH-HHHLlhhhhhHHHHH-HHHHHHHLLEEEEEELLL---
Query IDMHVHLD-----slaevGGYN-SLEYsdrfwsVVQTA-NAKKTLEAGFTTVRNVGA---  110
ident      |                                   |     |  |         
Sbjct VALEEHFAipetlqdsagFVPGdYWKE-lqhrlLDIQDtRLKLMDAHGIETMILSLNapa   63
DSSP  EEEEEEELlhhhhhhhllLLLLlHHHH-hhhhhHLLLLhHHHHHHHLLEEEEEEEELllh


DSSP  ----------------LLLHHHHHHHHHHlllllllEEEELlLLEEllllllllllllhh
Query ----------------ADYDDVGLREAIDagyvpgpRIVTAaISFGatgghcdstffpps  154
ident                 |                   |                       
Sbjct vqaipdrrkaieiarrANDVLAEECAKRP------dRFLAF-AALP--------------  102
DSSP  hhhlllhhhhhhhhhhHHHHHHHHHHHLL------lLEEEE-ELLL--------------


DSSP  hlllllllLLLHHHHHHHHHHHHH-LLLLEEEEELLlllllllllllllLLLHH-hHHHH
Query mdqknpfnSDSPDEARKAVRTLKK-YGAQVIXICATggvfsrgnepgqqQLTYE-eMKAV  212
ident            || |           |                                 
Sbjct --------LQDPDAATEELQRCVNdLGFVGALVNGF----sqegdgqtpLYYDLpqYRPF  150
DSSP  --------LLLHHHHHHHHHHHHHlLLLLEEEEELL----lllllllllLLLLLhhHHHH


DSSP  HHHHHHLLLEEEEEE--------------------------lLHHHHHHH--------hh
Query VDEAHMAGIKVAAHA--------------------------hGASGIREA--------vr  238
ident   |          |                             |                
Sbjct WGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALRLmasglfdehp  210
DSSP  HHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHHHhhllhhhhll


DSSP  lLLLEEEE-LLLLLHH----------------------hhHHHHhHLLEEELLLLLhhhh
Query aGVDTIEH-ASLVDDE----------------------giKLAVqKGAYFSMDIYNtdyt  275
ident        |                                                    
Sbjct rLNIILGHmGEGLPYMmwridhrnawvklpprypakrrfmDYFN-ENFHITTSGNF----  265
DSSP  lLLEEELHhHLLHHHHhhhhhhllllllllllllllllhhHHHH-HHEEEELLLLL----


DSSP  hhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLLLLLLLLHHH-HHH
Query qaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAGIYPHGDNAK-QFA  332
ident                               |            ||              |
Sbjct -----------------------rTQTLIDAILEIGadRILFSTDWPFENIDHASDwFNA  302
DSSP  -----------------------lHHHHHHHHLLLLhhHEELLLLLLLLLHHHHHHhHHH


DSSP  HhhhlLLLHHHHHHHLLHHHHHHHLLLllllllllllllleeeelllllllhhhhhllle
Query VmvryGATPLQAIQSATLTAAEALGRSkdvgqvavgrygdmiavagdpladvttlekpvf  392
ident                    |                                        
Sbjct T----SIAEADRVKIGRTNARRLFKLD---------------------------------  325
DSSP  L----LLLHHHHHHHHLHHHHHHLLLL---------------------------------


DSSP  eeelleeeelll
Query vmkggavvkapx  404
ident             
Sbjct ------------  325
DSSP  ------------


No 44: Query=3mtwA Sbjct=4qrnA Z-score=12.9

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeEEEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvTLLPGL   60
ident                                                             
Sbjct --------------------------------------------smtqdlktggEQGYLR   16
DSSP  --------------------------------------------llllllllllLLLLLL


DSSP  EEEEELLL------------------lllllLHHHHHHL------lhhhhhHHHH-HHHH
Query IDMHVHLD------------------slaevGGYNSLEY------sdrfwsVVQT-ANAK   95
ident |                                                           
Sbjct IATEEAFAtreiidvylrmirdgtadkgmvsLWGFYAQSpseratqilerlLDLGeRRIA   76
DSSP  EEEEEEELlhhhhhhhhhhhhhllllhhhhhHHHHHHHLllhhhhhhhhhhHLLLhHHHH


DSSP  HHHHLLEEEEEELLL-------------------LLLHHHHHHHHHHlllllllEEEELl
Query KTLEAGFTTVRNVGA-------------------ADYDDVGLREAIDagyvpgpRIVTAa  136
ident      |                            |                   |     
Sbjct DMDATGIDKAILALTspgvqplhdldeartlatrANDTLADACQKYP------dRFIGM-  129
DSSP  HHHHLLLLEEEEEELlllllllllhhhhhhhhhhHHHHHHHHHHHLL------lLEEEL-


DSSP  LLEEllllllllllllhhhlllllllLLLHHHHHHHHHHHHH-LLLLEEEEELLllllll
Query ISFGatgghcdstffppsmdqknpfnSDSPDEARKAVRTLKK-YGAQVIXICATggvfsr  195
ident                              |              |   | |         
Sbjct GTVA----------------------PQDPEWSAREIHRGAReLGFKGIQINSH------  161
DSSP  LLLL----------------------LLLHHHHHHHHHHHHHlLLLLLEEELLL------


DSSP  lllllllLLLHHHHHHHHHHHHHLLLEEEEEE-------------------------lLH
Query gnepgqqQLTYEEMKAVVDEAHMAGIKVAAHA-------------------------hGA  230
ident         |  |                  |                             
Sbjct ---tqgrYLDEEFFDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgfgveTG  218
DSSP  ---llllLLLLHHHHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhhhhhHH


DSSP  HHHHH--------hhhlLLLEEEE-LLLLLHH--------------------------hh
Query SGIRE--------avraGVDTIEH-ASLVDDE--------------------------gi  255
ident                        |                                    
Sbjct MHLLRlitigifdkypsLQIMVGHmGEALPYWlyrldymhqagvrsqryermkplkktie  278
DSSP  HHHHHhhhhlhhhhlllLLEEELHhHHLHHHHhhhhhhhhhhhhhlllllllllllllhh


DSSP  HHHHhHLLEEEL-LLLLhhhhhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--E
Query KLAVqKGAYFSM-DIYNtdytqaegkkngvlednlrkdrdigelqRENFRKALKAGV--K  312
ident                                                             
Sbjct GYLK-SNVLVTNsGVAW----------------------------EPAIKFCQQVMGedR  309
DSSP  HHHH-HLEEEELlLLLL----------------------------HHHHHHHHHHHLhhH


DSSP  EELLLLLLLlLLLL-hHHHHHHHHhllLLHHHHHHHLLHHHHHHHLLlllllllllllll
Query MVYGTDAGIyPHGD-nAKQFAVMVrygATPLQAIQSATLTAAEALGRskdvgqvavgryg  371
ident   |  |                |                 |                   
Sbjct VMYAMDYPY-QYVAdeVRAMDAMD---MSAQTKKKFFQTNAEKWFKL-------------  352
DSSP  EELLLLLLL-LLLHhhHHHHHLLL---LLHHHHHHHHLHHHHHHLLL-------------


DSSP  leeeelllllllhhhhhllleeeelleeeelll
Query dmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                  
Sbjct ---------------------------------  352
DSSP  ---------------------------------


No 45: Query=3mtwA Sbjct=2gwgA Z-score=12.9

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                             
Sbjct ----------------------------------------------------------XI    2
DSSP  ----------------------------------------------------------LL


DSSP  EEEEELLLLlllllhhHHHHL----------------------lhHHHHHHHH-HHHHHH
Query IDMHVHLDSlaevggyNSLEY----------------------sdRFWSVVQT-ANAKKT   97
ident || | |                                                   || 
Sbjct IDIHGHYTT----apkALEDWrnrqiagikdpsvxpkvselkisdDELQASIIeNQLKKX   58
DSSP  EEEEEELLL----llhHHHHHhhhhhhhhhlhhhlllhhhllllhHHHHHHHHlLHHHHH


DSSP  HHLLEEEEEELLL-------------LLLHHHHHHHHHHllllllLEEEELlLLEELLLl
Query LEAGFTTVRNVGA-------------ADYDDVGLREAIDagyvpgPRIVTAaISFGATGg  144
ident  | |                                              |         
Sbjct QERGSDLTVFSPRagdfnvsstwaaiCNELCYRVSQLFP------DNFIGA-AXLPQSP-  110
DSSP  HHHLLLEEEEELLlllhhhhhhhhhhHHHHHHHHHHHLL------LLEEEE-EELLLLL-


DSSP  llllllllhhhllllllllLLHHHHHHHHHHHHHLL-LLEEEEELLlllllLLLLlllll
Query hcdstffppsmdqknpfnsDSPDEARKAVRTLKKYG-AQVIXICATggvfsRGNEpgqqq  203
ident                      |           |      |           |       
Sbjct ------------------gVDPKTCIPELEKCVKEYgFVAINLNPD---psGGHW-tspp  148
DSSP  ------------------lLLHHHHHHHHHHHHHLLlLLEEEELLL---llLLLL-llll


DSSP  LLHHHHHHHHHHHHHLLLEEEEE--------eLLHHHHHH--------hhhlLLLEEEE-
Query LTYEEMKAVVDEAHMAGIKVAAH--------aHGASGIRE--------avraGVDTIEH-  246
ident ||               |    |                                 | | 
Sbjct LTDRIWYPIYEKXVELEIPAXIHvstgahylnADTTAFXQcvagdlfkdfpeLKFVIPHg  208
DSSP  LLLHHHHHHHHHHHHHLLLEEELlllllhhhhHHHHHHHHhhhllhhhhlllLLEEELHh


DSSP  LLLL---------------lhhhhHHHHhHLLEEELLLLLhhhhhhhhhhhlllhhhhhh
Query ASLV---------------ddegiKLAVqKGAYFSMDIYNtdytqaegkkngvlednlrk  291
ident    |                             |    |                     
Sbjct GGAVpyhwgrfrglaqexkkplleDHVL-NNIFFDTCVYH--------------------  247
DSSP  HLLLhhhhhhhhhhhhhlllllhhHHLL-LLEEEELLLLL--------------------


DSSP  hhhhhHHHHHHHHHHHhhllEEELLLLLLLLL----------llLHHHHHHHhhHLLLLH
Query drdigELQRENFRKALkagvKMVYGTDAGIYP----------hgDNAKQFAVmvRYGATP  341
ident                                             |             ||
Sbjct ----qPGIDLLNTVIP--vdNVLFASEXIGAVrgidprtgfyydDTKRYIEA--STILTP  299
DSSP  ----hHHHHHHHHHLL--hhHEELLLLLLLLLlleelllleellLLHHHHHH--LLLLLH


DSSP  HHHHHHLLHHHHHHHL-LLLLLlllllLLLLleeeelllllllhhhhhllleeeelleee
Query LQAIQSATLTAAEALG-RSKDVgqvavGRYGdmiavagdpladvttlekpvfvmkggavv  400
ident     |     |                   |                             
Sbjct EEKQQIYEGNARRVYPrLDAAL-----KAKG-----------------------------  325
DSSP  HHHHHHHLHHHHHHLHhHHHHH-----HHHH-----------------------------


DSSP  elll
Query kapx  404
ident     
Sbjct kleh  329
DSSP  hhll


No 46: Query=3mtwA Sbjct=2qpxA Z-score=12.8

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                            |
Sbjct ----------------------------------------------gxddlsefvdQVPL   14
DSSP  ----------------------------------------------lllllhhhhhHLLE


DSSP  EEEEELLL-------lllLLLH---hhHHHL-----------------------------
Query IDMHVHLD-------slaEVGG---ynSLEY-----------------------------   81
ident  | | |                        |                             
Sbjct LDHHCHFLidgkvpnrddRLAQvsteaDKDYpladtknrlayhgflalakefaldannpl   74
DSSP  EEEEELLLlllllllhhhHHHHhllllLLLLlhhhhlllhhhhhhhhhhhhhllllllll


DSSP  lhhhhhhhhhhhhHHHHHLLEEEEEELLLLL-lhhhHHHHHHHLllLLLLEEEELlLLEE
Query sdrfwsvvqtanaKKTLEAGFTTVRNVGAAD-yddvGLREAIDAgyVPGPRIVTAaISFG  140
ident                     |                           |           
Sbjct aaxndpgyatynhRIFGHFHFKELLIDTGFVpddpiLDLDQTAE--LVGIPVKAI-YRLE  131
DSSP  llllhhhhhhhhhHHHHHLLEEEEEEELLLLlllllLLHHHHHH--HHLLLEEEE-EEHH


DSSP  llllllllllllhhhllllLLLL----------llhHHHHHHHHHHHHLLLLEEEEELLL
Query atgghcdstffppsmdqknPFNS----------dspDEARKAVRTLKKYGAQVIXICATG  190
ident                                           |   |  |    |  |  
Sbjct -------------------THAEdfxlehdnfaawwQAFSNDVKQAKAHGFVGFXSIAAY  172
DSSP  -------------------HHHHhhhlllllhhhhhHHHHHHHHLLLLLLLLLEEELHHH


DSSP  llllllllllLLLL----------------------------LHHHHHHHHHHHHHLLLE
Query gvfsrgnepgQQQL----------------------------TYEEMKAVVDEAHMAGIK  222
ident              |                                   |          
Sbjct --------rvGLHLepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXP  224
DSSP  --------hlLLLLllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLL


DSSP  EEEEEL----------LHHH------hhhhhhlLLLEEEELL-LLLHhHHHHHHHH-LLE
Query VAAHAH----------GASG------ireavraGVDTIEHAS-LVDDeGIKLAVQK-GAY  264
ident    |            |                      |           ||      |
Sbjct LQFHVGygdadtdxylGNPLlxrdylkaftkkgLKVVLLHCYpYHRE-AGYLASVFpNLY  283
DSSP  EEEEELlllllllhhhLLHHhhhhhhhhhhhhlLLEEEEELLlLHHH-HHHHHHHLlLEE


DSSP  EELL-LLLHHHhhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLL-
Query FSMD-IYNTDYtqaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAG-  320
ident |      |                               |  |             ||  
Sbjct FDISlLDNLGP----------------------sgaSRVFNEAVELAPytRILFASDASt  321
DSSP  EELLlHHHHLH----------------------hhhHHHHHHHLLLLLhhHEELLLLLLl


DSSP  -llLLLLHHH-HHHHHHHLL---------lLHHHHHHHLLHHHHHHHLLLlLLLLLllll
Query -iyPHGDNAK-QFAVMVRYG---------aTPLQAIQSATLTAAEALGRSkDVGQVavgr  369
ident      |  |       |                        | |           |    
Sbjct ypeXYGLAARqFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQE-RELRV----  376
DSSP  lhhHHHHHHHhHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLH-HHHLL----


DSSP  llleeeelllllllhhhhhllleeeelleeeelll
Query ygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                    
Sbjct -----------------------------------  376
DSSP  -----------------------------------


No 47: Query=3mtwA Sbjct=4dziC Z-score=12.7

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                             
Sbjct ------------------------------------------------------alNYRV    6
DSSP  ------------------------------------------------------llLLLE


DSSP  EEEEELLLL---------------------------------llllLHHHHHHLL-----
Query IDMHVHLDS---------------------------------laevGGYNSLEYS-----   82
ident ||   |                                           |          
Sbjct IDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhFIPNPTFDPiivpg   66
DSSP  EEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellLLLLLLLLLeelll


DSSP  --------------------------hhhhhHHHHHHHHHHHHLLEEEEEELL-------
Query --------------------------drfwsVVQTANAKKTLEAGFTTVRNVG-------  109
ident                                    |      |    |            
Sbjct cldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgve  126
DSSP  llhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhh


DSSP  -------------------lLLLHHHhhHHHHhlllllllEEEELlLLEEllllllllll
Query -------------------aADYDDVglREAIdagyvpgpRIVTAaISFGatgghcdstf  150
ident                      | |                ||  |               
Sbjct ealkhdieatmasvhafnlwLDEDWG-fDRPD-------hRIIAA-PIVS----------  167
DSSP  hhllllhhhhhhhhhhhhhhHHHHLL-lLLLL-------lLEEEL-LLLL----------


DSSP  llhhhlllllllLLLHHHHHHHHHHHHHLLLLEEEEELLLlllllllllllllLLHH-hh
Query fppsmdqknpfnSDSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqqqLTYE-em  209
ident                |  |   |      ||                             
Sbjct ------------LADPTRAVEEVDFVLARGAKLVLVRPAP-----vpglvkprSLGDrsh  210
DSSP  ------------LLLHHHHHHHHHHHHHLLLLLEELLLLL-----llllllllLLLLhhh


DSSP  HHHHHHHHHLLLEEEEE---------------------------eLLHHHHHHH------
Query KAVVDEAHMAGIKVAAH---------------------------aHGASGIREA------  236
ident   |      ||  |  |                                           
Sbjct DPVWARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllddrAIHDTMASMivhgvf  270
DSSP  HHHHHHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhllhHHHHHHHHHhhllhh


DSSP  --hhlLLLEEEELL-LLLHHH-------------------hHHHHhHLLEEELLLllhhh
Query --vraGVDTIEHAS-LVDDEG-------------------iKLAVqKGAYFSMDIyntdy  274
ident                                                             
Sbjct trhpkLKAVSIENGsYFVHRLikrlkkaantqpqyfpedpvEQLR-NNVWIAPYY-----  324
DSSP  hhlllLLEEEELLLlLHHHHHhhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL-----


DSSP  hhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLLLL-lllLHHHHH
Query tqaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAGIY-phgDNAKQF  331
ident                                        |   | |              
Sbjct -------------------------EDDLPELARVIGvdKILFGSDWPHGeglaSPVSFT  359
DSSP  -------------------------LLLHHHHHHHHLhhHLLLLLLLLLLllllLHHHHH


DSSP  HHHHhlLLLHHHHHHHLLHHHHHHHLllllllllllllllleeeelllllllhhhhhlll
Query AVMVryGATPLQAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpv  391
ident |     |             |   ||                                  
Sbjct AELK--GFSESDIRKIMRDNALDLLG----------------------------------  383
DSSP  HHHL--LLLHHHHHHHHLHHHHHHHL----------------------------------


DSSP  eeeelleeeelll
Query fvmkggavvkapx  404
ident              
Sbjct --------vqvgs  388
DSSP  --------lllll


No 48: Query=3mtwA Sbjct=2a3lA Z-score=12.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------------------lleeeeeEEEEEElllleeeeleeeeeelleeeee
Query -------------------------aeikavsAARLLDvasgkyvdnplvivtdgritsi   35
ident                                  |   |                      
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  eellllllllleeeeeeeeeeEELEEEEEELLL-LLLL----------------------
Query gkkgdavpagatavdlpgvtlLPGLIDMHVHLD-SLAE----------------------   72
ident                           | |||                             
Sbjct -------------------fyNVRKVDTHVHHSaCMNQkhllrfiksklrkepdevvifr  199
DSSP  -------------------llLLLEEEEEEELLlLLLHhhhhhhhhhhhhllllllleee


DSSP  ---------------------lLHHHH-------------------------HHLLH---
Query ---------------------vGGYNS-------------------------LEYSD---   83
ident                                                     |       
Sbjct dgtyltlrevfesldltgydlnVDLLDvhadkstfhrfdkfnlkynpcgqsrLREIFlkq  259
DSSP  lleeelhhhhhhhhllllllllLLLLLllllllllllllllhhhhllllllhHHHHHlll


DSSP  ------HHHHHHHHHHHHHHH-HLLEeEEEELLL-------------lllhhhHHHHhhh
Query ------RFWSVVQTANAKKTL-EAGFtTVRNVGA-------------adyddvGLREaid  123
ident       ||                                              |     
Sbjct dnliqgRFLGEITKQVFSDLEaSKYQ-MAEYRISiygrkmsewdqlaswivnnDLYS---  315
DSSP  llllllLLHHHHHHHHHHHHLlLLLE-EEEEEEElllllllhhhhhhhhhhllLLLL---


DSSP  llllllLEEEELlLLEELLLlllllllllHHHLllllllllLHHHHHHHHHH--------
Query agyvpgPRIVTAaISFGATGghcdstffpPSMDqknpfnsdSPDEARKAVRT--------  175
ident          |   |                                              
Sbjct ------ENVVWL-IQLPRLY-----niykDMGI-----vtsFQNILDNIFIPlfeatvdp  358
DSSP  ------LLEEEE-EEEELLH-----hhhlLLLL-----lllLHHHHHHHLLHhhhhhhlh


DSSP  -----hHHLL--LLEEEEElLLLL-----------llllllllllllLHHHHHHHHHHHH
Query -----lKKYG--AQVIXICaTGGV-----------fsrgnepgqqqlTYEEMKAVVDEAH  217
ident                                                             
Sbjct dshpqlHVFLkqVVGFDLV-DDESkperrptkhmptpaqwtnafnpaFSYYVYYCYANLY  417
DSSP  hhllllHHHHllEEEEEEE-LLLLlllllllllllllllllllllllHHHHHHHHHHHHH


DSSP  HL----------LLEEEEEELL---HHHHHHHHHlLLLEEEELLLL--LHHHHHHHHHHL
Query MA----------GIKVAAHAHG---ASGIREAVRaGVDTIEHASLV--DDEGIKLAVQKG  262
ident              |    |                    | |            |     
Sbjct VLnklreskgmtTITLRPHSGEagdIDHLAATFL-TCHSIAHGINLrkSPVLQYLYYLAQ  476
DSSP  HHhhhhllllllLLEELLLLLLlllLHHHHHHHH-HLLLLLLLHHHhhLHHHHHHHHHHL


DSSP  LEEELLLLLHHhhhhhhhhhlllhhhhhhHHHH-HHHHhhHHHHHHHHLLEEELLLLL-L
Query AYFSMDIYNTDytqaegkkngvlednlrkDRDI-GELQreNFRKALKAGVKMVYGTDA-G  320
ident     |                                    |      |      ||   
Sbjct IGLAMSPLSNN------------------SLFLdYHRN--PFPVFFLRGLNVSLSTDDpL  516
DSSP  LLEEELHHHHL------------------LLLLlLLLL--LHHHHHHLLLLEEELLLLhH


DSSP  LLL--lLLHHHHHHHHHH-LLLLHHHHHHHLlHHHHHHHLL-LLLL--LLLLL-------
Query IYP--hGDNAKQFAVMVR-YGATPLQAIQSAtLTAAEALGR-SKDV--GQVAV-------  367
ident                               |        |                    
Sbjct QIHltkEPLVEEYSIAASvWKLSACDLCEIA-RNSVYQSGFsHALKshWIGKDyykrgpd  575
DSSP  HHLlllLHHHHHHHHHHHhHLLLHHHHHHHH-HHHHHHLLLlHHHHhhHLLLLlllllhh


DSSP  ----llllleeeelllllllhhhhhllleeeelleeeelll
Query ----grygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                          
Sbjct gndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 49: Query=3mtwA Sbjct=3qy6A Z-score=12.0

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeelE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgL   60
ident                                                             
Sbjct -----------------------------------------------------------M    1
DSSP  -----------------------------------------------------------L


DSSP  EEEEELLLLlllllhhhhhhllhhHHHHHHHHHHHHHHHLLEEEEEELL-----------
Query IDMHVHLDSlaevggynsleysdrFWSVVQTANAKKTLEAGFTTVRNVG-----------  109
ident || | |                    |      |      |  |                
Sbjct IDIHCHILP---------amddgaGDSADSIEMARAAVRQGIRTIIATPhhnngvyknep   52
DSSP  EELLLLLLL---------llllllLLHHHHHHHHHHHHHLLLLEEELLLeellllllllh


DSSP  -lLLLHHHHHHHHHHlLLLLLLEEEELllleellllllllllllhhhllllllllllhhh
Query -aADYDDVGLREAIDaGYVPGPRIVTAaisfgatgghcdstffppsmdqknpfnsdspde  168
ident          |                                                  
Sbjct aaVREAADQLNKRLI-KEDIPLHVLPG---------------------------------   78
DSSP  hhHHHHHHHHHHHHH-HLLLLLEEELL---------------------------------


DSSP  hhhhhhhhhhlllleeEEELlllllllllllllllllhhhHHHHHHHHHHL-------lL
Query arkavrtlkkygaqviXICAtggvfsrgnepgqqqltyeeMKAVVDEAHMA-------gI  221
ident                  |                         |                
Sbjct ---------------qEIRI--------------------YGEVEQDLAKRqllslndtK  103
DSSP  ---------------lEEEL--------------------LLLHHHHHHLLllllhhhlL


DSSP  EEEEEElLHHHhhHHHHLL--------lLEEEELLLL-----LHHHHHHHHHHLLEEELL
Query KVAAHAhGASGirEAVRAG--------vDTIEHASLV-----DDEGIKLAVQKGAYFSMD  268
ident               |               | |                 | |||     
Sbjct YILIEFpFDHVprYAEQLFydlqlkgyiPVIAHPERNreireNPSLLYHLVEKGAASQIT  163
DSSP  EEEEELlLLLLllLHHHHHhhhhhllleEEEELHHHLhhhhhLLHHHHHHHHLLLEEEEE


DSSP  LLL-HHHHhhhhhhhlllhhhhhhHHHHHHHHHHHHHHHhhhlLEEELLLLLL---LLLL
Query IYN-TDYTqaegkkngvlednlrkDRDIGELQRENFRKAlkagVKMVYGTDAG---IYPH  324
ident                                                   ||        
Sbjct SGSlAGIF----------------GKQLKAFSLRLVEAN----LIHFVASDAHnvkTRNF  203
DSSP  HHHhLLLL----------------LHHHHHHHHHHHHLL----LLLEEELLLLlllLLLL


DSSP  lLHHHHHHHHHHLLlLHHHHHHHLlHHHHHHHLLLllllllllllllleeeelllllllh
Query gDNAKQFAVMVRYGaTPLQAIQSAtLTAAEALGRSkdvgqvavgrygdmiavagdpladv  384
ident         |                  |   |                            
Sbjct -HTQEALYVLEKEF-GSELPYMLT-ENAELLLRNQ-------------------------  235
DSSP  -LHHHHHHHHHHHH-LLHHHHHHH-HHHHHHHLLL-------------------------


DSSP  hhhhllleeeelleeeelll
Query ttlekpvfvmkggavvkapx  404
ident                     
Sbjct --------tifrqppqpvkr  247
DSSP  --------llllllllllll


No 50: Query=3mtwA Sbjct=3au2A Z-score=10.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  -----------------lleeeeeeeeeeelllleeeeleeeeeelleeeeeeELLLLL-
Query -----------------aeikavsaarlldvasgkyvdnplvivtdgritsigKKGDAV-   42
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   42
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   42
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------lllleeeeeeeeeeEELEEEEEELLLllllllhhhhhhll
Query --------------------pagatavdlpgvtlLPGLIDMHVHLDslaevggynsleys   82
ident                                        |  ||                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHST--------------  346
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLL--------------


DSSP  hhhhhhHHHHHHHHHHHLLEEEEEELlllllhhhhhhhhhhllllllleeeelLLLEell
Query drfwsvVQTANAKKTLEAGFTTVRNVgaadyddvglreaidagyvpgprivtaAISFgat  142
ident                   |                                    |    
Sbjct ysdgqnTLEELWEAAKTMGYRYLAVT---------------------------DHSP---  376
DSSP  llllllLHHHHHHHHHHHLLLEEEEE---------------------------EELH---


DSSP  llLLLLllllhhhllLLLLllllhhhhhhHHHHHHHLL---------------lLEEEEE
Query ggHCDStffppsmdqKNPFnsdspdearkAVRTLKKYG---------------aQVIXIC  187
ident                                    |                        
Sbjct --AVRV---------AGGP----------SPEEALKRVgeirrfnethgppyllAGAEVD  415
DSSP  --HHHL---------LLLL----------LHHHHHHHHhhhhhhhhhhllleeeEEEEEE


DSSP  LllllllllllllllLLLHhhHHHHHHHHHhLLLE-EEEEE---------lLHHHHHHHH
Query AtggvfsrgnepgqqQLTYeeMKAVVDEAHmAGIK-VAAHA---------hGASGIREAV  237
ident                           |         |                     | 
Sbjct I--------------HPDG--TLDYPDWVL-RELDlVLVSVhsrfnlpkadQTKRLLKAL  458
DSSP  L--------------LLLL--LLLLLHHHH-LLLLeEEEELlllllllhhhHHHHHHHHH


DSSP  HLL-LLEEEELL-----------LLLHHHHHHHHHHLLEEELLlLLHHhhhhhhhhhlll
Query RAG-VDTIEHAS-----------LVDDEGIKLAVQKGAYFSMDiYNTDytqaegkkngvl  285
ident     |    |                      |  ||     |    |            
Sbjct ENPfVHVLAHPTarllgrrapieADWEAVFQKAKEKGVAVEID-GYYD------------  505
DSSP  LLLlLLEELLLLlllllllllllLLHHHHHHHHHHHLLEEEEE-LLLL------------


DSSP  hhhhhhhhhhhhhHHHHHHHHHHHLLEEELLLLLLLlLLLLHHH-HHHHHHHLLLLHHHh
Query ednlrkdrdigelQRENFRKALKAGVKMVYGTDAGIyPHGDNAK-QFAVMVRYGATPLQa  344
ident                   | |   |      |||    |            |    |   
Sbjct ---------rmdlPDDLARMAYGMGLWISLSTDAHQtDHLRFMElAVGTAQRAWIGPER-  555
DSSP  ---------llllLHHHHHHHHHLLLLEEEELLLLLhHHHHHHHhHHHHHHHLLLLLLL-


DSSP  hHHLLH---hHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeee
Query iQSATL---tAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvk  401
ident     ||        |                                             
Sbjct -VLNTLdyedLLSWLK------------------------------------------ar  572
DSSP  -LHHHLlhhhHHHHHH------------------------------------------ll


DSSP  lll
Query apx  404
ident    
Sbjct rgv  575
DSSP  lll


No 51: Query=3mtwA Sbjct=1m65A Z-score=10.3

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeelE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgL   60
ident                                                             
Sbjct ----------------------------------------------------------yP    2
DSSP  ----------------------------------------------------------lL


DSSP  EEEEELL----LLLLlllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-------
Query IDMHVHL----DSLAevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-------  109
ident  | | |                                      |               
Sbjct VDLHMHTvastHAYS-----------------TLSDYIAQAKQKGIKLFAITDhgpdmed   45
DSSP  EELLLLLllllLLLL-----------------LHHHHHHHHHHHLLLEEEEEEellllll


DSSP  -----lLLLHhHHHHhhhhlllLLLLEEEELllleellllllllllllhhhlllllllll
Query -----aADYDdVGLReaidagyVPGPRIVTAaisfgatgghcdstffppsmdqknpfnsd  164
ident               |       | |  |                                
Sbjct aphhwhFINMrIWPR------vVDGVGILRG-----------------------------   70
DSSP  llllhhHHHHhHLLL------eELLEEEEEE-----------------------------


DSSP  lhhhhhhhhhhhhhlllleEEEELllllllllllllllLLLHhhHHHHhhhHHHLLL---
Query spdearkavrtlkkygaqvIXICAtggvfsrgnepgqqQLTYeeMKAVvdeAHMAGI---  221
ident                    |                                        
Sbjct -------------------IEANI--------------KNVD--GEID---CSGKMFdsl   92
DSSP  -------------------EEEEL--------------LLLL--LLLL---LLHHHHhhl


DSSP  -eEEEEE-----------lLHHHHHHHHHLL-LLEEEELLL-----lLHHHHHHHHHHLL
Query -kVAAHA-----------hGASGIREAVRAG-VDTIEHASL-----vDDEGIKLAVQKGA  263
ident     |                         | |  | |                |     
Sbjct dlIIAGFhepvfaphdkatNTQAMIATIASGnVHIISHPGNpkyeidVKAVAEAAAKHQV  152
DSSP  leEEEELlllllllllhhhHHHHHHHHHHLLlLLEELLLLLllllllHHHHHHHHHHHLL


DSSP  EEELlLLLHhhhhhhhhhhlllhhhhhhhhhhhhHHHHHHHHHHHHLLEEELLLLLLllL
Query YFSMdIYNTdytqaegkkngvlednlrkdrdigeLQRENFRKALKAGVKMVYGTDAGiyP  323
ident                                     ||       ||     | |     
Sbjct ALEI-NNSS-------------------------NCREVAAAVRDAGGWVALGSDSH--T  184
DSSP  EEEE-ELLL-------------------------LHHHHHHHHHHHLLLEEEELLLL--L


DSSP  LLLHHHHHHHHHHLL---LLHHHHhhHLLH--HHHHHHL---LLLLlllllllLLLLeee
Query HGDNAKQFAVMVRYG---ATPLQAiqSATL--TAAEALG---RSKDvgqvavgRYGDmia  375
ident                     |                |                      
Sbjct AFTMGEFEECLKILDavdFPPERI--LNVSprRLLNFLEsrgMAPI-----aeFADL---  234
DSSP  HHHLLLLHHHHHHHHhllLLHHHL--HHHLhhHHHHHHHhllLLLL-----hhHLLL---


DSSP  elllllllhhhhhllleeeelleeeelll
Query vagdpladvttlekpvfvmkggavvkapx  404
ident                              
Sbjct -----------------------------  234
DSSP  -----------------------------


No 52: Query=3mtwA Sbjct=3iacA Z-score=10.1

back to top
DSSP  ---------lleeeeeeeeEEELllleeeeleeeeeelleeeeeeellllllllleeeee
Query ---------aeikavsaarLLDVasgkyvdnplvivtdgritsigkkgdavpagatavdl   51
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eeeeeEELEEEEEELLL------------------lLLLLLHHH----------------
Query pgvtlLPGLIDMHVHLD------------------sLAEVGGYN----------------   77
ident           | | ||                                            
Sbjct ----aPXPIYDFHCHLSpqeiaddrrfdnlgqiwleGDHYKWRAlrsagvdeslitgket   79
DSSP  ----lLLLEEELLLLLLhhhhhhllllllhhhhhhlLLLHHHHHhhhllllhhhllllll


DSSP  -----------------------------------------------hhhllhhhhhhhh
Query -----------------------------------------------sleysdrfwsvvq   90
ident                                                             
Sbjct sdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpa  139
DSSP  lhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhh


DSSP  hHHHHHHHHLLEEEEEELLLLLLhhHHHHHHHHLLLLLLLEEEELlLLEEllllllllll
Query tANAKKTLEAGFTTVRNVGAADYddVGLREAIDAGYVPGPRIVTAaISFGatgghcdstf  150
ident               |                | |                          
Sbjct fSARGIXQQXNVRXVGTTDDPID-sLEYHRQIAADDSIDIEVAPS-WRPD----------  187
DSSP  hLHHHHHHHLLEEEEELLLLLLL-lLHHHHHHHHLLLLLLEEELL-LLLH----------


DSSP  llhhhlllllLLLLL----------------------hhhhhhhhHHHHHLL----LLEE
Query fppsmdqknpFNSDS----------------------pdearkavRTLKKYG----AQVI  184
ident                                                             
Sbjct ----------KVFKIeldgfvdylrkleaaadvsitrfddlrqalTRRLDHFaacgCRAS  237
DSSP  ----------HHHLLllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHhhllLLEE


DSSP  EEELLllllllllllllLLLL-------------------------------HHHHHHHH
Query XICATggvfsrgnepgqQQLT-------------------------------YEEMKAVV  213
ident                                                             
Sbjct DHGIE------------TLRFapvpddaqldailgkrlagetlseleiaqftTAVLVWLG  285
DSSP  EEEEL------------LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHH


DSSP  HHHHHLLLEEEEEEL-----------------------lhhhhhHHHHLL----------
Query DEAHMAGIKVAAHAH-----------------------gasgirEAVRAG----------  240
ident       |     |                                  |            
Sbjct RQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnniswALSRLLdsxdvtnelp  345
DSSP  HHHHHHLLEEEEEELeellllhhhhhhhllllllleelllllhhHHHHHHhhhhllllll


DSSP  LLEEeELLL--LLHHHHHHHHHH-------LLEEELlLLLHhhhhhhhhhhlllhhhhhh
Query VDTIeHASL--VDDEGIKLAVQK-------GAYFSMdIYNTdytqaegkkngvlednlrk  291
ident                                  |                          
Sbjct KTIL-YCLNprDNEVLATXIGNFqgpgiagKVQFGS-GWWF-------------------  384
DSSP  EEEE-EELLhhHHHHHHHHHHHLlllllllLEEELL-LLHH-------------------


DSSP  hhhHHHHHHHHHHHHHHHLL--EEEL-LLLLLllLLLLHHH---HHHHHHHLL-------
Query drdIGELQRENFRKALKAGV--KMVY-GTDAGiyPHGDNAK---QFAVMVRYG-------  338
ident                   |     |   ||                              
Sbjct -ndQKDGXLRQLEQLSQXGLlsQFVGxLTDSR--SFLSYTRheyFRRILCNLLgqwaqdg  441
DSSP  -hlLHHHHHHHHHHHHHHLLhhHLLLlLLLLL--LLLLLHHhhhHHHHHHHHHhhhhhll


DSSP  -------lLHHHHHHHLLHHHHHHHLllllllllllllllleeeelllllllhhhhhlll
Query -------aTPLQAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpv  391
ident                     |                                       
Sbjct eipddeaxLSRXVQDICFNNAQRYFT----------------------------------  467
DSSP  lllllhhhHHHHHHHHHLHHHHHHLL----------------------------------


DSSP  eeeelleeeelll
Query fvmkggavvkapx  404
ident              
Sbjct -----------ik  469
DSSP  -----------ll


No 53: Query=3mtwA Sbjct=1j5sA Z-score=10.0

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                             
Sbjct ---------------------------------hmflgedylltnraavrlfnevkDLPI   27
DSSP  ---------------------------------llllllllllllhhhhhhhhhhlLLLE


DSSP  EEEEELLLllllllhhhhhhllhhhhhHHHHH----------------------------
Query IDMHVHLDslaevggynsleysdrfwsVVQTA----------------------------   92
ident  | | |||                                                    
Sbjct VDPHNHLD------------------aKDIVEnkpwndiwevegatdhyvwelmrrcgvs   69
DSSP  EELLLLLL------------------hHHHHHllllllhhhhhllllhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   92
ident                                                             
Sbjct eeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetk  129
DSSP  hhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhh


DSSP  -------hhhHHHHLLEEEEEELLLLLLhhHHHHHHHHLLlLLLLEEEELlLLEE--LLL
Query -------nakKTLEAGFTTVRNVGAADYddVGLREAIDAGyVPGPRIVTAaISFG--ATG  143
ident                                          | |  |             
Sbjct kklpemtpqkLLRDMKVEILCTTDDPVS-tLEHHRKAKEA-VEGVTILPT-WRPDraMNV  186
DSSP  hhlllllhhhHHHHLLEEEEELLLLLLL-lLHHHHHHHHH-LLLLEEELL-LLLHhhHLL


DSSP  LllllllllhhhlLLLL--------lllllhhhhHHHHHHHHHLL----LLEEEEELLll
Query GhcdstffppsmdQKNP--------fnsdspdeaRKAVRTLKKYG----AQVIXICATgg  191
ident                                     |                       
Sbjct D--------kegwREYVekmgerygedtstldgfLNALWKSHEHFkehgCVASDHALL--  236
DSSP  L--------lllhHHHHhhhhhhhllllllhhhhHHHHHHHHHHHhlllLLEEEEEEL--


DSSP  llllllllllLLLL------------------------------HHHHHHHHHHHHHLLL
Query vfsrgnepgqQQLT------------------------------YEEMKAVVDEAHMAGI  221
ident                                                |            
Sbjct ----------EPSVyyvdenraravhekafsgekltqdeindykAFMMVQFGKMNQETNW  286
DSSP  ----------LLLLllllhhhhhhhhhhhlllllllhhhhhhhhHHHHHHHHHHHHHHLL


DSSP  EEEEEELL-------------------------------hhhhhhhhhlLLLEEEeLLLL
Query KVAAHAHG-------------------------------asgireavraGVDTIEhASLV  250
ident     |                                                       
Sbjct VTQLHIGAlrdyrdslfktlgpdsggdistnflriaeglryflnefdgkLKIVLY-VLDP  345
DSSP  EEEEEELEellllhhhhhhlllllllleelllllhhhhhhhhhhhllllLLEEEE-ELLH


DSSP  --LHHHHHHHHHHL-LEEELLlllhhhhhhhhhhhlllhhhhhhhhhhHHHHHHHHHHHH
Query --DDEGIKLAVQKG-AYFSMDiyntdytqaegkkngvlednlrkdrdiGELQRENFRKAL  307
ident          |      |                                           
Sbjct thLPTISTIARAFPnVYVGAP---------------------wwfndsPFGMEMHLKYLA  384
DSSP  hhHHHHHHHHHHLLlEEELLL---------------------llllllHHHHHHHHHHHH


DSSP  HHLL---EEELLLLLLllLLLLH---HHHH-HHHHHLL------------lLHHHHHHHL
Query KAGV---KMVYGTDAGiyPHGDN---AKQF-AVMVRYG------------aTPLQAIQSA  348
ident             ||               |  |                           
Sbjct SVDLlynLAGMVTDSR--KLLSFgsrTEMFrRVLSNVVgemvekgqipikeARELVKHVS  442
DSSP  LLLLhhhLLLLLLLLL--LLLHHhhhHHHHhHHHHHHHhhhhhlllllhhhHHHHHHHHH


DSSP  LHHHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeeelll
Query TLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                                         
Sbjct YDGPKALFF-----------------------------------------------  451
DSSP  LHHHHHHHL-----------------------------------------------


No 54: Query=3mtwA Sbjct=3dcpA Z-score=10.0

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
ident                                                             
Sbjct ----------------------------------------------------------XK    2
DSSP  ----------------------------------------------------------LL


DSSP  EEEEELLLL---LLLLlhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL--------
Query IDMHVHLDS---LAEVggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG--------  109
ident  | | |                                |  |  |     |         
Sbjct RDGHTHTEFcphGTHD---------------DVEEXVLKAIELDFDEYSIVEhaplssef   47
DSSP  EEEEELLLLlllLLLL---------------LHHHHHHHHHHLLLLEEEEEEellllhhh


DSSP  ----------------------lLLLHHHHHHHHHHllllLLLEEEELllleelllllll
Query ----------------------aADYDDVGLREAIDagyvPGPRIVTAaisfgatgghcd  147
ident                                             |               
Sbjct xkntagdkeavttasxaxsdlpyYFKKXNHIKKKYA----SDLLIHIG------------   91
DSSP  hhllllllhhhhlllllhhhhhhHHHHHHHHHHHLL----LLLEEEEE------------


DSSP  lllllhhhllllllllllhhhhhhhhhhhhhlllleeEEELllllllllllllllllLHH
Query stffppsmdqknpfnsdspdearkavrtlkkygaqviXICAtggvfsrgnepgqqqlTYE  207
ident                                                             
Sbjct ------------------------------------fEVDY---------------lIGY  100
DSSP  ------------------------------------eEEEL---------------lLLL


DSSP  HhHHHHHHHHHLLL---eeEEEE-----------------------------------lL
Query EmKAVVDEAHMAGI---kvAAHA-----------------------------------hG  229
ident |     |     |                                               
Sbjct E-DFTRDFLNEYGPqtddgVLSLhflegqggfrsidfsaedynegivqfyggfeqaqlaY  159
DSSP  H-HHHHHHHHHHHHhlleeEEELleeeelleeeellllhhhhhhhlhhhhllhhhhhhhH


DSSP  HHHHHHHHHL-----lLLEEEELL---------------------llLHHHHHHHHHHLL
Query ASGIREAVRA-----gVDTIEHAS---------------------lvDDEGIKLAVQKGA  263
ident   |      |           | |                             |      
Sbjct LEGVKQSIEAdlglfkPRRXGHISlcqkfqqffgedtsdfseevxekFRVILALVKKRDY  219
DSSP  HHHHHHHHHLllllllLLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLL


DSSP  EEELLlLLHHHHhhhhhhhlllhhhHHHHhhhhhhHHHHHHHHHHHLLEEELLLLLLllL
Query YFSMDiYNTDYTqaegkkngvlednLRKDrdigelQRENFRKALKAGVKMVYGTDAGiyP  323
ident                                           |       ||| |     
Sbjct ELDFN-TAGLFK-------------PLCG--etypPKKIVTLASELQIPFVYGSDSH--G  261
DSSP  EEEEE-LHHHHL-------------LLLL--llllLHHHHHHHHHLLLLEEEELLLL--L


DSSP  LLL-HHHHHHHHHHLLllhhhhhhhllhhhhhhhlllllllllllllllleeeellllll
Query HGD-NAKQFAVMVRYGatplqaiqsatltaaealgrskdvgqvavgrygdmiavagdpla  382
ident   |                                                         
Sbjct VQDiGRGYSTYCQKLE--------------------------------------------  277
DSSP  HHHlLLLHHHHHHHLL--------------------------------------------


DSSP  lhhhhhllleeeelleeeelll
Query dvttlekpvfvmkggavvkapx  404
ident                       
Sbjct ----------------------  277
DSSP  ----------------------


No 55: Query=3mtwA Sbjct=3f2bA Z-score=8.8

back to top
DSSP  -----------------------------------------------lleeeeeeeeeee
Query -----------------------------------------------aeikavsaarlld   13
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  lllleeeeleeeeeelleeeeeeellllllLLLEEE---eeeeeeEEELEEEEEELLLll
Query vasgkyvdnplvivtdgritsigkkgdavpAGATAV---dlpgvtLLPGLIDMHVHLDsl   70
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtapEGEKRVELHLHTP--  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELlllllllllLLLLLLLLLLLLL--


DSSP  llllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-lLLLHHHHHHHHHHllLLLL
Query aevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-aADYDDVGLREAIDagYVPG  129
ident                     |         |                    |        
Sbjct ----------msqmdavtSVTKLIEQAKKWGHPAIAVTDhaVVQSFPEAYSAAK--KHGM  166
DSSP  ----------llllllllLHHHHHHHHHHLLLLLEEELLllLLLLHHHHHHHHH--HHLL


DSSP  lEEEELllleellllllllllllhhhllllllllllhhhhhhhhhhhhhlllleEEEEll
Query pRIVTAaisfgatgghcdstffppsmdqknpfnsdspdearkavrtlkkygaqvIXICat  189
ident                                                             
Sbjct -KVIYG------------------------------------------------LEAN--  175
DSSP  -LEEEE------------------------------------------------EEEE--


DSSP  llllllllllllllLLHH-----------------------------------HHHHHHH
Query ggvfsrgnepgqqqLTYE-----------------------------------EMKAVVD  214
ident                                                           | 
Sbjct --------------IVDDpfhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVK  221
DSSP  --------------EELLleeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHH


DSSP  HHHhlLLEEEeeellhhhhhhhhhlllleEEEL--llLLHHhhHHHHHHLLEEELLL-LL
Query EAHmaGIKVAahahgasgireavragvdtIEHA--slVDDEgiKLAVQKGAYFSMDI-YN  271
ident      |  |                             |                     
Sbjct HRD--GLLVG-------------------SGCDkgelFDNV--EDIARFYDFLEVHPpDV  258
DSSP  LLL--LEEEE-------------------LLLLllllLLLL--LLLHHHLLLEEELLhHH


DSSP  HHhhhhhhhhhlllhhhhhhHHHH--HHHHHHHHHHHHHHL----LEEELLLLLL-----
Query TDytqaegkkngvlednlrkDRDI--GELQRENFRKALKAG----VKMVYGTDAG-----  320
ident                            |      |     |       |           
Sbjct YK------------------PLYVkdEEMIKNIIRSIVALGekldIPVVATGNVHylnpe  300
DSSP  HL------------------LLLLllHHHHHHHHHHHHHHHhhllLLEEELLLLLlllhh


DSSP  ------------------------LLLLlLHHH-HHHHHHHllLLHHHHHHHLLHHHHHH
Query ------------------------IYPHgDNAK-QFAVMVRygATPLQAIQSATLTAAEA  355
ident                                              |  |           
Sbjct dkiyrkilihsqgganplnrhelpDVYF-RTTNeMLDCFSF--LGPEKAKEIVVDNTQKI  357
DSSP  hhhhhhhhhhllhhhlllllllllLLLL-LLHHhHHHHHHH--HHHHHHHHHHLHHHHHH


DSSP  HLL---------------------------------------------------------
Query LGR---------------------------------------------------------  358
ident                                                             
Sbjct ASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiigh  417
DSSP  HHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct gfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhsef  477
DSSP  llhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct fndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprah  537
DSSP  llllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct nytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrtt  597
DSSP  hhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct gqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptv  657
DSSP  eeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct irmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqml  717
DSSP  hhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct eetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglep  777
DSSP  hhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct slafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavria  837
DSSP  hhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct yfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvle  897
DSSP  hhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhh


DSSP  ---------------------------------------------------lllllllll
Query ---------------------------------------------------skdvgqvav  367
ident                                                             
Sbjct valemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefl  957
DSSP  hhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhlllll


DSSP  llllleeeelllllllhhhhhllleeeelleeeelll
Query grygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                      
Sbjct skedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  lhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=3mtwA Sbjct=1bksA Z-score=6.4

back to top
DSSP  lleeeeeeeeeEELLlleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeele
Query aeikavsaarlLDVAsgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgl   60
ident             |                                               
Sbjct meryenlfaqlNDRR-------------------------------------------eg   17
DSSP  lhhhhhhhhhhHHLL-------------------------------------------ll


DSSP  EEEEELLLllllllhhhhhhllhhHHHHHHHHHHHHHHHLLEeEEEElLLLL--------
Query IDMHVHLDslaevggynsleysdrFWSVVQTANAKKTLEAGFtTVRNvGAAD--------  112
ident                                        ||                   
Sbjct AFVPFVTL--------------gdPGIEQSLKIIDTLIDAGA-DALE-LGVPfsdpladg   61
DSSP  EEEEEEEL--------------llLLHHHHHHHHHHHHHLLL-LLEE-EELLllllllll


DSSP  -----------------lhHHHHHHHHHLLlllllEEEELlLLEEllllllllllllhhh
Query -----------------ydDVGLREAIDAGyvpgpRIVTAaISFGatgghcdstffppsm  155
ident                           |                                 
Sbjct ptiqnanlrafaagvtpaqCFEMLALIREK--hptIPIGL-LMYA---------------  103
DSSP  hhhhhhhhhhhhhlllhhhHHHHHHHHHHH--lllLLEEE-EELH---------------


DSSP  lllLLLLlllhhhhhhHHHHHHHLL----LLEEEEEllllllllllllllllllHHHHHH
Query dqkNPFNsdspdearkAVRTLKKYG----AQVIXICatggvfsrgnepgqqqltYEEMKA  211
ident    |                                                   ||   
Sbjct ---NLVF-------nnGIDAFYARCeqvgVDSVLVA---------------dvpVEESAP  138
DSSP  ---HHHH-------llLHHHHHHHHhhhlLLEEEEL---------------lllHHHLHH


DSSP  HHHHHHHLLLEEEEEELLHH---HHHHHHhLLLL-EEEELlllLHHHHHHHHH-HLLEEE
Query VVDEAHMAGIKVAAHAHGAS---GIREAVrAGVD-TIEHAslvDDEGIKLAVQ-KGAYFS  266
ident     |    |               |                     |        |   
Sbjct FRQAALRHNIAPIFICPPNAdddLLRQVA-SYGRgYTYLLalpLHHLIEKLKEyHAAPAL  197
DSSP  HHHHHHHLLLEEEEEELLLLlhhHHHHHH-HHLLlLEEELlllHHHHHHHHHHhLLLLEE


DSSP  LL-LLLHhhhhhhhhhhlllhhhhhhhhhhhhhhhhhHHHHhhhlleEELLLLL-LLLL-
Query MD-IYNTdytqaegkkngvlednlrkdrdigelqrenFRKAlkagvkMVYGTDA-GIYP-  323
ident                                       |                     
Sbjct QGfGISS-----------------------peqvsaaVRAG-----aAGAISGSaIVKIi  229
DSSP  ELlLLLL-----------------------hhhhhhhHHHL-----lLEEEELLhHHHHh


DSSP  --------------lLLHH-HHHHhhhhllllhhhhhhhllhhhhhhhllllllllllll
Query --------------hGDNA-KQFAvmvrygatplqaiqsatltaaealgrskdvgqvavg  368
ident                        |                                    
Sbjct eknlaspkqmlaelrSFVSaMKAA------------------------------------  253
DSSP  hhllllhhhhhhhhhHHHHhHHHL------------------------------------


DSSP  lllleeeelllllllhhhhhllleeeelleeeelll
Query rygdmiavagdpladvttlekpvfvmkggavvkapx  404
ident                                     
Sbjct ----------------------------------sr  255
DSSP  ----------------------------------ll


No 57: Query=3mtwA Sbjct=3e38A Z-score=5.6

back to top
DSSP  lleeeeeeeeeEELLLleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlLDVASgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident             |                                               
Sbjct --aqrrneiqvPDLDG---------------------------------------yTTLK   19
DSSP  --lllllllllLLLLL---------------------------------------lEEEE


DSSP  EEEEELL--LLLLlllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL---------
Query IDMHVHL--DSLAevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG---------  109
ident  | | |                          |         |                 
Sbjct CDFHXHSvfSDGL----------------vWPTVRVDEAYRDGLDAISLTEhieyrphkq   63
DSSP  EELLLLLllLLLL----------------lLHHHHHHHHHHLLLLEELLEEellllllll


DSSP  ----lLLLHHHHHHHHHHlllLLLLEEEELllleellllllllllllhhhllllllllll
Query ----aADYDDVGLREAIDagyVPGPRIVTAaisfgatgghcdstffppsmdqknpfnsds  165
ident              ||        |                                    
Sbjct dvvsdHNRSFDLCREQAE---KLGILLIKG------------------------------   90
DSSP  lllllLLHHHHHHHHHHH---HHLLEELLE------------------------------


DSSP  hhhhhhhhhhhhhlllleEEEELLL--lllllllllllllllhHHHHHHHHHHHHLLLEe
Query pdearkavrtlkkygaqvIXICATG--gvfsrgnepgqqqltyEEMKAVVDEAHMAGIKv  223
ident                     |                         |    ||   |   
Sbjct ------------------SEITRAXapghfnaiflsdsnpleqKDYKDAFREAKKQGAF-  131
DSSP  ------------------EEEELLLllleeeeelllllhhhllLLHHHHHHHHHHLLLE-


DSSP  eeeellhhhhhhhhhlllLEEEELLL-------LLHHhhhHHHHHL-----LEEE-LLLL
Query aahahgasgireavragvDTIEHASL-------VDDEgikLAVQKG-----AYFS-MDIY  270
ident                       |                                     
Sbjct ------------------XFWNHPGWdsqqpdtTKWW--pEHTALYqegcxHGIEvANGH  171
DSSP  ------------------EEELLLLLlllllllLLLL--hHHHHHHhllllLEEEeEELL


DSSP  lhhhhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHL-LEEELLLLLLlLLLL----
Query ntdytqaegkkngvlednlrkdrdigelQRENFRKALKAG-VKMVYGTDAGiYPHG----  325
ident                                                 |    |      
Sbjct ---------------------------lYXPEAIQWCLDKnLTXIGTSDIH-QPIQtdyd  203
DSSP  ---------------------------eELLHHHHHHHHHlLEEEEELLLL-LLHHhhll


DSSP  ---lhHHHHhhhhhllllhhhhhhHLLH---hhhhhHLLL--------------------
Query ---dnAKQFavmvrygatplqaiqSATL---taaeaLGRS--------------------  359
ident                                                             
Sbjct fekgeHRTX---------------TFVFakerslqgIREAldnrrtaayfhelligredl  248
DSSP  hhhllLLLE---------------EEEEellllhhhHHHHhhllleeeeelleeellhhh


DSSP  ---------llllllllllllleeeeLLLLLLL---------------------------
Query ---------kdvgqvavgrygdmiavAGDPLAD---------------------------  383
ident                               |                             
Sbjct lrpffekcvkieevsrneqgvtlsitNVTDLVLklkktahdtllvyfrdxtlkphtrytv  308
DSSP  hhhhhhhheeeeeeeeelleeeeeeeELLLLLEeeeelllllleellleeeellleeeee


DSSP  -------------hhhhhllleeeelleeeelll
Query -------------vttlekpvfvmkggavvkapx  404
ident                                   
Sbjct rigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeeellllllleeeeeeeeeeeelleeeeeeeel


No 58: Query=3mtwA Sbjct=2yb1A Z-score=5.6

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeelE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgL   60
ident                                                             
Sbjct ----------------------------------------------------------aN    2
DSSP  ----------------------------------------------------------lL


DSSP  EEEEELLLllllllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-lllLHHHHHH
Query IDMHVHLDslaevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-aadYDDVGLR  119
ident || | |                        |                             
Sbjct IDLHFHSR--------------tsdgalTPTEVIDRAAARAPALLALTDhdctGGLAEAA   48
DSSP  EELLLLLL--------------llllllLHHHHHHHHHLLLLLEEEELLllllLLHHHHH


DSSP  HHHHLlllllLEEEELllleellllllllllllhhhllllllllllhhhhhhhhhhhhhl
Query EAIDAgyvpgPRIVTAaisfgatgghcdstffppsmdqknpfnsdspdearkavrtlkky  179
ident  |                                                          
Sbjct AAAAR---rgIPFLNG--------------------------------------------   61
DSSP  HHHHH---llLLEEEE--------------------------------------------


DSSP  llleEEEEL---------------------------------------------------
Query gaqvIXICA---------------------------------------------------  188
ident                                                             
Sbjct ----VEVSVswgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagc  117
DSSP  ----EEEEEeelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllh


DSSP  ------------llLLLL--------------------LLLL----llLLLLLhhHHHHH
Query ------------tgGVFS--------------------RGNE----pgQQQLTyeEMKAV  212
ident                                                   |         
Sbjct fdgamrwcdnpemiSRTHfarhlvdsgavkdmrtvfrkYLTPgkpgyvSHQWA--SLEDA  175
DSSP  hhhhhlllllhhhlLHHHhhhhhhhllllllhhhhhhhLLLLllllllLLLLL--LHHHH


DSSP  HHHHHHLLLEEeeeellhhhhhhhhhllllEEEELLLL--LHHHHHHHHHHL-----LEE
Query VDEAHMAGIKVaahahgasgireavragvdTIEHASLV--DDEGIKLAVQKG-----AYF  265
ident |     ||                       | |          |               
Sbjct VGWIVGAGGMA-------------------VIAHPGRYdmGRTLIERLILDFqaaggQGI  216
DSSP  HHHHHHLLLEE-------------------EELLHHHLllLHHHHHHHHHHHhhlllLEE


DSSP  E--LLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHL----lEEELLLLL
Query S--MDIYntdytqaegkkngvlednlrkdrdigelQRENFRKALKAG----vKMVYGTDA  319
ident                                          |              | | 
Sbjct EvaSGSH----------------------------SLDDMHKFALHAdrhglYASSGSDF  248
DSSP  EeeELLL----------------------------LHHHHHHHHHHHhhhllEEEEELLL


DSSP  LL--LLLLlhHHHHhhhhhlllLHHHhhhhllhHHHHhhLLLLLllllllllllleeeel
Query GI--YPHGdnAKQFavmvrygaTPLQaiqsatlTAAEalGRSKDvgqvavgrygdmiava  377
ident        |               |                                    
Sbjct HApgEDVG--HTED-------lPPIC------rPIWR--ELEAR----------------  275
DSSP  LLllLLLL--LLLL-------lLLLL------lLHHH--HLHHH----------------


DSSP  llllllhhhhhllleeeeLLEEeelll
Query gdpladvttlekpvfvmkGGAVvkapx  404
ident                     |      
Sbjct --------------ilrpADAE----n  284
DSSP  --------------llllLHHH----l


No 59: Query=3mtwA Sbjct=2anuA Z-score=4.7

back to top
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE
Query aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
ident                                                            |
Sbjct -------------------------------------------------------tEWLL    5
DSSP  -------------------------------------------------------lEEEE


DSSP  EEEEELlLLLLlllhhhhhhllhhhHHHHHHHHHHHHHhllEEEEEELL-----------
Query IDMHVHlDSLAevggynsleysdrfWSVVQTANAKKTLeagFTTVRNVG-----------  109
ident  | |||                             |        |               
Sbjct CDFHVH-TNXS----------dghlPLGEVVDLFGKHG---VDVVSITDhivdrrtleqr   51
DSSP  EEEEEL-LLLL----------llllLHHHHHHHHHHLL---LLEEEEEEeeelhhhhhhh


DSSP  ----------------lLLLHHHHHHHHHHLllLLLLEEEELlLLEELLLLllllllllh
Query ----------------aADYDDVGLREAIDAgyVPGPRIVTAaISFGATGGhcdstffpp  153
ident                                    |                        
Sbjct krngeplgaitedkfqdYLKRLWREQKRAWE--EYGXILIPG-VEITNNTD---------   99
DSSP  hhllllllllllllhhhHHHHHHHHHHHHHH--HHLLEEEEE-EEEEELLL---------


DSSP  hhllllllllllhhhhhHHHHhhhhlllleeeeellllllllllllllllllhHHHHHHH
Query smdqknpfnsdspdearKAVRtlkkygaqvixicatggvfsrgnepgqqqltyEEMKAVV  213
ident                    |                                       |
Sbjct -------lyhivavdvkEYVD------------------------------psLPVEEIV  122
DSSP  -------leeeeeelllLLLL------------------------------llLLHHHHH


DSSP  HHHHHLLLEEEEEEL-----LHHHHHH--hHHLLLLEEeelllllhhhhhhhhhhlleEE
Query DEAHMAGIKVAAHAH-----GASGIRE--aVRAGVDTIehaslvddegiklavqkgayFS  266
ident          | |                       |                        
Sbjct EKLKEQNALVIAAHPdrkklSWYLWANxerFKDTFDAW--------------------EI  162
DSSP  HHHHHLLLEEEELLLlllllLLHHHHLlllLLLLLLEE--------------------EE


DSSP  LLlllhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhHHHHHHHLLEEELLLLLLLLLllL
Query MDiyntdytqaegkkngvlednlrkdrdigelqrenFRKALKAGVKMVYGTDAGIYPhgD  326
ident                                     |          |   |        
Sbjct AN------------------------------rddlFNSVGVKKYRYVANSDFHELW--H  190
DSSP  EE------------------------------lleeLHHHHHLLLLEEEELLLLLHH--H


DSSP  HHHHhhhhhhllllhhhhhhhLLHH----hhhhHLLLllllllllllllleeeellllll
Query NAKQfavmvrygatplqaiqsATLT----aaeaLGRSkdvgqvavgrygdmiavagdpla  382
ident                       ||                                    
Sbjct VYSW-----------------KTLVkseknieaIKEA-----------------irkntd  216
DSSP  HLLE-----------------EEEEeelllhhhHHHH-----------------hhhlll


DSSP  lhhhHHLLleeeelleeeelll
Query dvttLEKPvfvmkggavvkapx  404
ident     |                 
Sbjct vaiyLXRK--------------  224
DSSP  eeeeELLL--------------