Results: dupa

Query: 3mkvA

MOLECULE: PUTATIVE AMIDOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3mkv-A 77.1  0.0  414   414  100 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   2:  3mtw-A 53.7  1.9  395   404   31 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   3:  4c5y-A 48.1  2.2  399   436   29 PDB  MOLECULE: OCHRATOXINASE;                                             
   4:  2oof-A 35.3  2.9  345   403   21 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   5:  2paj-A 32.4  2.7  332   421   20 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   6:  4cqb-A 30.6  2.8  323   402   19 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   7:  1j6p-A 30.4  2.8  326   407   18 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   8:  2uz9-A 29.9  3.1  339   444   18 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   9:  3ls9-A 29.8  2.7  339   453   21 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  10:  2vun-A 29.7  3.0  311   385   22 PDB  MOLECULE: ENAMIDASE;                                                 
  11:  3icj-A 28.7  3.0  309   468   19 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  12:  1k6w-A 28.7  3.1  327   423   17 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  13:  3nqb-A 27.9  2.9  301   587   20 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  1onx-A 27.3  3.0  306   390   20 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  15:  3giq-A 26.8  3.3  327   475   17 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  16:  3ooq-A 26.7  2.8  288   384   20 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  17:  4rdv-B 26.4  2.7  325   451   19 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  18:  1yrr-B 25.0  3.0  289   334   17 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  19:  2ogj-A 24.6  3.9  302   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  3gri-A 23.9  3.0  304   422   20 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  1gkp-A 23.6  3.4  324   458   20 PDB  MOLECULE: HYDANTOINASE;                                              
  22:  3e74-A 22.6  3.4  301   429   16 PDB  MOLECULE: ALLANTOINASE;                                              
  23:  4b3z-D 22.5  3.4  315   477   17 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  24:  2imr-A 20.3  4.1  267   380   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  25:  2ob3-A 19.1  3.7  249   329   16 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  26:  1a4m-A 18.8  3.2  251   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  27:  1bf6-A 18.5  3.7  241   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  28:  3k2g-B 18.4  3.4  243   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  1a5k-C 18.3  3.0  307   566   20 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  30:  2vc5-A 17.6  3.6  232   314   15 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  31:  2y1h-B 17.4  3.0  224   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  32:  1v77-A 16.5  2.8  185   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  33:  3cjp-A 15.9  2.6  200   262   16 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  34:  3irs-A 15.0  3.5  216   281   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  35:  3gg7-A 15.0  3.3  204   243   16 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  2ffi-A 14.7  3.3  211   273   16 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  37:  4dlf-A 14.3  3.9  222   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  38:  3pnu-A 14.1  3.7  235   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  39:  4mup-B 14.0  3.4  211   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  40:  4hk5-D 13.8  3.6  214   380   16 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  41:  2qpx-A 13.4  4.1  224   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  42:  1itq-A 13.2  3.6  226   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  43:  4ofc-A 12.9  3.6  208   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  44:  2dvt-A 12.9  3.6  208   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  45:  2gwg-A 12.9  4.2  218   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  46:  4qrn-A 12.5  3.9  210   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  47:  2a3l-A 12.3  3.4  238   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  48:  4dzi-C 12.2  3.9  209   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3qy6-A 11.9  3.4  186   247   16 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  3iac-A 10.7  3.8  224   469    8 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  1j5s-A 10.6  4.1  225   451    6 PDB  MOLECULE: URONATE ISOMERASE;                                         
  52:  1m65-A 10.2  3.7  173   234   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  53:  3au2-A 10.1  7.0  175   575   14 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3dcp-A  9.9  3.0  168   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  8.0  9.9  183   994    5 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  7.6  3.6  166   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.4  4.1  142   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  2anu-A  5.2  3.6  145   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  4.8  3.8  146   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3mkvA Sbjct=3mkvA Z-score=77.1

back to top
DSSP  LLEEEEEEEEELLLLLLLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEE
Query LTTFLFRNGALLDPDHPDLLQGFEILIEDGFIREVSDKPIKSSNAHVIDVKGKTIMPGLI   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LTTFLFRNGALLDPDHPDLLQGFEILIEDGFIREVSDKPIKSSNAHVIDVKGKTIMPGLI   60
DSSP  LLEEEEEEEEELLLLLLLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEE


DSSP  EEEELLLLLLLLHHHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHLL
Query DLHVHVVAIEFNLPRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGGAGYPFKQAVESG  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DLHVHVVAIEFNLPRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGGAGYPFKQAVESG  120
DSSP  EEEELLLLLLLLHHHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHLL


DSSP  LLLLLEEEELLLEEELLLLLLLLLLLLLLLLLLLLLLLLLLLLLLEEELLLHHHHHHHHH
Query LVEGPRLFVSGRALSQTGGHADPRARSDYMPPDSPCGCCVRVGALGRVADGVDEVRRAVR  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LVEGPRLFVSGRALSQTGGHADPRARSDYMPPDSPCGCCVRVGALGRVADGVDEVRRAVR  180
DSSP  LLLLLEEEELLLEEELLLLLLLLLLLLLLLLLLLLLLLLLLLLLLEEELLLHHHHHHHHH


DSSP  HHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLEEEEELLHHHHH
Query EELQMGADQIXIMASGGVASPTDPVGVFGYSEDEIRAIVAEAQGRGTYVLAHAYTPAAIA  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EELQMGADQIXIMASGGVASPTDPVGVFGYSEDEIRAIVAEAQGRGTYVLAHAYTPAAIA  240
DSSP  HHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLEEEEELLHHHHH


DSSP  HHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHHHLLLLLLLHHHHLLHHH
Query RAVRCGVRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALASEGEKYGLPPESIAKIAD  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RAVRCGVRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALASEGEKYGLPPESIAKIAD  300
DSSP  HHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHHHLLLLLLLHHHHLLHHH


DSSP  HHLLHHHHHHHHHHHLLLLLLLLLLLHHHHHHLLHHHHHHHLLLLHHHHHHHLLHHHHHH
Query VHGAGLHSIEIMKRAGVKMGFGTDLLGEAQRLQSDEFRILAEVLSPAEVIASATIVSAEV  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VHGAGLHSIEIMKRAGVKMGFGTDLLGEAQRLQSDEFRILAEVLSPAEVIASATIVSAEV  360
DSSP  HHLLHHHHHHHHHHHLLLLLLLLLLLHHHHHHLLHHHHHHHLLLLHHHHHHHLLHHHHHH


DSSP  LLLLLLLLLLLLLLLLLEEEELLLLLLLLLLLLLLLLLLLEEEELLEEEEELLL
Query LGMQDKLGRIVPGAHADVLVVDGNPLKSVDCLLGQGEHIPLVMKDGRLFVNELE  414
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LGMQDKLGRIVPGAHADVLVVDGNPLKSVDCLLGQGEHIPLVMKDGRLFVNELE  414
DSSP  LLLLLLLLLLLLLLLLLEEEELLLLLLLLLLLLLLLLLLLEEEELLEEEEELLL


No 2: Query=3mkvA Sbjct=3mtwA Z-score=53.7

back to top
DSSP  LLEEEEEEEEELLLLLLLLEEEEEEEEELLEEEEEEL-LLLLLLLLEEEELLLLEEEELE
Query LTTFLFRNGALLDPDHPDLLQGFEILIEDGFIREVSD-KPIKSSNAHVIDVKGKTIMPGL   59
ident           |||               || |             |   |  | |  |||
Sbjct AEIKAVSAARLLDVASGKYVDNPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLPGL   60
DSSP  LLEEEEEEEEEEELLLLEEEELEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEELE


DSSP  EEEEELLLLLLL-LHHHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLL---LLHHHHH
Query IDLHVHVVAIEF-NLPRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGG---AGYPFKQ  115
ident || |||                               |  ||||||  |           
Sbjct IDMHVHLDSLAEvGGYNSLEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAadyDDVGLRE  120
DSSP  EEEEELLLLLLLlLHHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLlllHHHHHHH


DSSP  HHHLLLLLLLEEEELLLEEELLLLLLLLLLLLLLLLLLlllllllllllleEELLLHHHH
Query AVESGLVEGPRLFVSGRALSQTGGHADPRARSDYMPPDspcgccvrvgalgRVADGVDEV  175
ident |   | | |||          |||| |       |                   |  || 
Sbjct AIDAGYVPGPRIVTAAISFGATGGHCDSTFFPPSMDQK-----------npFNSDSPDEA  169
DSSP  HHHLLLLLLLEEEELLLLEELLLLLLLLLLLLHHHLLL-----------llLLLLLHHHH


DSSP  HHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLEEEEELL
Query RRAVREELQMGADQIXIMASGGVASPTDPVGVFGYSEDEIRAIVAEAQGRGTYVLAHAYT  235
ident | |||     ||  ||| | ||| |     |       |  | | ||   |  | |||  
Sbjct RKAVRTLKKYGAQVIXICATGGVFSRGNEPGQQQLTYEEMKAVVDEAHMAGIKVAAHAHG  229
DSSP  HHHHHHHHHLLLLEEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEEEELL


DSSP  HHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHHHLLLLLLLHHHH
Query PAAIARAVRCGVRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALASEGEKYGLPPESI  295
ident    |  ||| || ||||  | |||   |    |||        |    || | |      
Sbjct ASGIREAVRAGVDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQAEGKKNGVLEDNL  289
DSSP  HHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHHHHHHHLLLHHHH


DSSP  LLHHHHHLLHHHHHHHHHHHLLLLLLLLLLLHHHHHHLLHHHHHHHL-LLLHHHHHHHLL
Query AKIADVHGAGLHSIEIMKRAGVKMGFGTDLLGEAQRLQSDEFRILAE-VLSPAEVIASAT  354
ident  |  |              |||||  |||            |         |   | |||
Sbjct RKDRDIGELQRENFRKALKAGVKMVYGTDAGIYPHGDNAKQFAVMVRyGATPLQAIQSAT  349
DSSP  HHHHHHHHHHHHHHHHHHHHLLEEELLLLLLLLLLLLHHHHHHHHHHlLLLHHHHHHHLL


DSSP  HHHHHHLLLLLLLLLLLLLLLLLEEEELLLLLLLLLLLLllllLLLEEEELLEEEEELll
Query IVSAEVLGMQDKLGRIVPGAHADVLVVDGNPLKSVDCLLgqgeHIPLVMKDGRLFVNEle  414
ident    || ||     |    |   |   | | ||  |  |         ||| |        
Sbjct LTAAEALGRSKDVGQVAVGRYGDMIAVAGDPLADVTTLE----KPVFVMKGGAVVKAP-x  404
DSSP  HHHHHHHLLLLLLLLLLLLLLLLEEEELLLLLLLHHHHH----LLLEEEELLEEEELL-l


No 3: Query=3mkvA Sbjct=4c5yA Z-score=48.1

back to top
DSSP  --LLEEEEEEEEELLLLLlLLEEEEEEEEELLEEEEEEL-LLLL---LLLL-EEEELllL
Query --LTTFLFRNGALLDPDHpDLLQGFEILIEDGFIREVSD-KPIK---SSNA-HVIDVkgK   53
ident           | |   |    |      | |  |  |     |             |   
Sbjct deAKVTIIYAGLLIPGDG-EPLRNAALVISDKIIAFVGSeADIPkkyLRSTqSTHRV--P   57
DSSP  llLLEEEEEEEEELLLLL-LLEEEEEEEEELLEEEEEEEhHHLLhhhHHHLlLEEEE--E


DSSP  EEEELEEEEEELLLLL---lLLHHHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLL
Query TIMPGLIDLHVHVVAI---eFNLPRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGGAG  110
ident   |||| | | |                        |        |  | |  ||  | |
Sbjct VLMPGLWDCHMHFGGDddyyNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYG  117
DSSP  EEEELEEEEEELLLLLllllLLLHHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLH


DSSP  HHHHHHHHLLLLLLLEEEELLLEEELLLLLLLLLLLllLLLLLLL--------LLLLLLl
Query YPFKQAVESGLVEGPRLFVSGRALSQTGGHADPRARsdYMPPDSP--------CGCCVRv  162
ident      |   |   ||    || ||||| || |  |                   |     
Sbjct CEVAKAINDGTIVGPNVYSSGAALSQTAGHGDIFAL--PAGEVLGsygvmnprPGYWGA-  174
DSSP  HHHHHHHHLLLLLLLEEEELLLEEELLLLLLLLLLL--LHHHHHHhhllllllLLLLLL-


DSSP  lLLEEELLLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH
Query gALGRVADGVDEVRRAVREELQMGADQIXIMASGGVASPTDPVGVFGYSEDEIRAIVAEA  222
ident       |||| |||||||     ||  || |||||| |  |       |  |   || ||
Sbjct -GPLCIADGVEEVRRAVRLQIRRGAKVIXVMASGGVMSRDDNPNFAQFSPEELKVIVEEA  233
DSSP  -LLEEELLLHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLLLLLLLLLLHHHHHHHHHHH


DSSP  HLLLLLEEEEELLHHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH
Query QGRGTYVLAHAYTPAAIARAVRCGVRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALA  282
ident       | ||    | |  |   |    ||    | |   |  | |   | |        
Sbjct ARQNRIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFL  293
DSSP  HHLLLLEEEEELLHHHHHHHHHHLLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH


DSSP  HHLLLlLLLHHHhLLHH-HHHLLHHHHHHHHHHHLLLLLLLLLLLhhhHHHLLHHHHHHH
Query SEGEKyGLPPESiAKIA-DVHGAGLHSIEIMKRAGVKMGFGTDLLgeaQRLQSDEFRILA  341
ident       ||  ||            |        |||    |||           |     
Sbjct ASNGE-GLVKES-WAKLqALADSHLKAYQGAIKAGVTIALGTDTA--pGGPTALELQFAV  349
DSSP  HHLLL-LLLLLH-HHLLlHHHHHHHHHHHHHHHLLLLEELLLLLL--lLLLLHHHHHHHH


DSSP  L--LLLHHHHHHHLLHHHHHHL--LLLLlLLLLLLLLLLLEEEELLLLLLLLLLLLLlLL
Query E--VLSPAEVIASATIVSAEVL--GMQDkLGRIVPGAHADVLVVDGNPLKSVDCLLGqGE  397
ident |     | | |  ||               |    |  |||     |||           
Sbjct ErgGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEENPLEDIKVFQE-PK  407
DSSP  HllLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLLLLLLHHHHHL-HH


DSSP  LLLEEEELLEEEEELLL------------
Query HIPLVMKDGRLFVNELE------------  414
ident     | | | ||                 
Sbjct AVTHVWKGGKLFKGPGIgpwgedarnpfl  436
DSSP  HEEEEEELLEEEELLLLllllllllllll


No 4: Query=3mkvA Sbjct=2oofA Z-score=35.3

back to top
DSSP  -LLEEEEEEEEELLLL----LLLLEEEEEEEEELLEEEEEEL-LLLLLLLlEEEELLLLE
Query -LTTFLFRNGALLDPD----HPDLLQGFEILIEDGFIREVSD-KPIKSSNaHVIDVKGKT   54
ident         |              ||         | |         |    |  | ||| 
Sbjct lNCERVWLNVTPATLRsdlaDYGLLEPHALGVHEGRIHALVPxQDLKYPA-HWQDXKGKL   59
DSSP  lLLLEEEEEEEELLLLllllLLLLLLLEEEEEELLEEEEEEEhHHLLLLL-LLEELLLLE


DSSP  EEELEEEEEELLLLLLL-------------------------LHHH-HLLLLHHHHHHHH
Query IMPGLIDLHVHVVAIEF-------------------------NLPR-VATLPNVLVTLRA   88
ident   ||||| | |                                  |             |
Sbjct VTPGLIDCHTHLIFAGSraeefelrqkgvpyaeiarkgggiiSTVRaTRAASEDQLFELA  119
DSSP  EEELEEEEEELLLLLLLlhhhhhhhhhlllhhhhhhllllhhHHHHhHHHLLHHHHHHHH


DSSP  HHHHHHHHHLLEEEEEELLL----------LLHHHHHHHHlllLLLLEEEELlLEEElll
Query VPIMRAMLRRGFTTVRDAGG----------AGYPFKQAVEsglVEGPRLFVSgRALSqtg  138
ident  |      | | |||    |                   |       |            
Sbjct LPRVKSLIREGVTTVEIKSGygltledelkXLRVARRLGE---ALPIRVKTT-LLAA---  172
DSSP  HHHHHHHHHHLEEEEEEELLllllhhhhhhHHHHHHHHHH---HLLLEEEEE-EEEE---


DSSP  lLLLLLLlllllllllllllllllllleeeLLLHHHHHH-HHHHHHHH-LLLLEEEELLl
Query gHADPRArsdymppdspcgccvrvgalgrvADGVDEVRR-AVREELQM-GADQIXIMASg  196
ident  || |                            |                ||        
Sbjct -HAVPPE------------------yrddpDSWVETICQeIIPAAAEAgLADAVDVFCE-  212
DSSP  -LLLLHH------------------hlllhHHHHHHHHHlHHHHHHHLlLLLEEEEEEL-


DSSP  llllllllllLLLLLHHHHHHHHHHHHLLLLLEEEEEL---LHHHHHHHHHLLLLEEEEL
Query gvasptdpvgVFGYSEDEIRAIVAEAQGRGTYVLAHAY---TPAAIARAVRCGVRTIEHG  253
ident             | |          |   |  |  |            |   |     | 
Sbjct ----------HIGFSLAQTEQVYLAADQYGLAVKGHXDqlsNLGGSTLAANFGALSVDHL  262
DSSP  ----------LLLLLHHHHHHHHHHHHHLLLEEEEEELlllLLLHHHHHHHLLLLEEEEL


DSSP  LLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhhllhhhhHLLHhHHHHHHH
Query NLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesiakiadvHGAGlHSIEIMK  313
ident    | |     |  |            |                                
Sbjct EYLDPEGIQALAHRGVVATLLPTAFYFLK-------------------ETKL-PPVVALR  302
DSSP  LLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL-LLHHHHH


DSSP  HHLLLLLLLLLLLH--hHHHHLLHHHHHHHL--LLLHHHHHHHLLHHHHHHLLLLLLLLL
Query RAGVKMGFGTDLLG--eAQRLQSDEFRILAE--VLSPAEVIASATIVSAEVLGMQDKLGR  369
ident  |||      |                       | | |  |  |   |  || |  || 
Sbjct KAGVPXAVSSDINPgtaPIVSLRXAXNXACTlfGLTPVEAXAGVTRHAARALGEQEQLGQ  362
DSSP  HLLLLEEELLLLLLlllLLLLHHHHHHHHHHhhLLLHHHHHHHLLHHHHHHLLLLLLLLL


DSSP  LLLLLLLLEEEELL-LLLLLLLLlLLLLlLLLEEEELLEEEEElll
Query IVPGAHADVLVVDG-NPLKSVDClLGQGeHIPLVMKDGRLFVNele  414
ident    |  || ||     |        |           |        
Sbjct LRVGXLADFLVWNCgHPAELSYL-IGVD-QLVSRVVNGEETLH---  403
DSSP  LLLLLLLLEEEELLlLLLHHHHL-LLLL-LEEEEEELLEELLL---


No 5: Query=3mkvA Sbjct=2pajA Z-score=32.4

back to top
DSSP  lLEEEEEEE-EELLLL------LLLLEEeEEEEEELLEEEEEELlLLLLLLLEEEELLLL
Query lTTFLFRNG-ALLDPD------HPDLLQgFEILIEDGFIREVSDkPIKSSNAHVIDVKGK   53
ident     | ||  |                    | |    |                |    
Sbjct -PSTLIRNAaAIMTGGrgtaddPSRVPG-PDIRIVGDTIDAIGA-LAPRPGETIVDATDC   57
DSSP  -LEEEEELLlEELLLLllllllLLLLLL-LLEEEELLEEEEELL-LLLLLLLEEEELLLL


DSSP  EEEELEEEEEELLLL-LLLLhhHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLL----
Query TIMPGLIDLHVHVVA-IEFNlpRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGG----  108
ident  | |     | |            |        | |        | |  || |       
Sbjct VIYPAWVNTHHHLFQsLLKGepFRALFDERRFRLAARIGLIELARSGCATVADHNYvyyp  117
DSSP  EEEELEELLLLLHHHhHLLLllLHHHLLHHHHHHHHHHHHHHHHLLLEEEEEELLLllll


DSSP  -----lLHHHHHHHHlllLLLLEEEELLlEEELLLlllllLLLLllLLLLLlllllllll
Query -----aGYPFKQAVEsglVEGPRLFVSGrALSQTGghadpRARSdyMPPDSpcgccvrvg  163
ident               |     | |                         |           
Sbjct gmpfdsSAILFEEAE---KLGLRFVLLR-GGATQT----rQLEA--DLPTA---------  158
DSSP  lllllhHHHHHHHHH---HLLLEEEEEE-LLLLLL----lLLLL--LLLHH---------


DSSP  lleeELLLhhhhHHHHHHHHHHL------------lLLEE-EELLllllllllllllLLL
Query algrVADGvdevRRAVREELQMG------------aDQIX-IMASggvasptdpvgvFGY  210
ident                |                                            
Sbjct --lrPETL----DAYVADIERLAaryhdaspramrrVVMApTTVL------------YSI  200
DSSP  --hlLLLH----HHHHHHHHHHHhhllllllllleeEEELlLLLL------------LLL


DSSP  LHHHHHHHHHHHHLLLLLEEEEELlhHHHHHHHHLLL----LEEEELLLLLHHHHHHHHH
Query SEDEIRAIVAEAQGRGTYVLAHAYtpAAIARAVRCGV----RTIEHGNLIDDETARLVAE  266
ident |  | |   | |   |     |       |               |    |     | | 
Sbjct SPREMRETAAVARRLGLRMHSHLSgkSPVAFCGEHDWlgsdVWYAHLVKVDADEIALLAQ  260
DSSP  LHHHHHHHHHHHHHLLLEEEEELLllLHHHHHHHLLLllllEEEELLLLLLHHHHHHHHH


DSSP  HLLEEELLHHHHHHHhhhlllllllhhhhllhhhhhllhhhHHHHHHHHLLLLLLLLLLL
Query HGAYVVPTLVTYDALasegekyglppesiakiadvhgaglhSIEIMKRAGVKMGFGTDLL  326
ident  |  |         |                              |  |||    | |  
Sbjct TGTGVAHCPQSNGRL--------------------------PVREMADAGVPVSIGVDGA  294
DSSP  HLLEEEELHHHHHLL--------------------------LLLLHHHHLLLEEELLLHH


DSSP  HhHHHHL--LHHHHHHHLL-----LLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEE
Query GeAQRLQ--SDEFRILAEV-----LSPAEVIASATIVSAEVLGMQdKLGRIVPGAHADVL  379
ident            |             | ||||   |   | | |     |    |  ||  
Sbjct A-SNEAAdmISEVHMTWLAqrarlASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIA  352
DSSP  H-HLLLLlhHHHHHHHHHHhhhllLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEE


DSSP  EEL-----------LLLLlLLLLlLLLLlLLLEEEELLEEEEEL----------------
Query VVD-----------GNPLkSVDClLGQGeHIPLVMKDGRLFVNE----------------  412
ident |                   |    |           |   |                  
Sbjct VYRlddpryfglhdPAIG-PVAS-GGRP-SVMALFSAGKRVVVDdliegvdikelggear  409
DSSP  EEElllhhhlllllHHHH-HHHL-LLLL-EEEEEEELLEEEEELlllllllhhhhhhhhh


DSSP  ----------ll
Query ----------le  414
ident             
Sbjct rvvrellrevvv  421
DSSP  hhhhhhhhhhhl


No 6: Query=3mkvA Sbjct=4cqbA Z-score=30.6

back to top
DSSP  --LLEEEEEEEEELLlllllLEEEEEEEEELLEEEEEELlLLLLLLLEEEELLLLEEEEL
Query --LTTFLFRNGALLDpdhpdLLQGFEILIEDGFIREVSDkPIKSSNAHVIDVKGKTIMPG   58
ident         ||  |             | |    |       |       || ||    ||
Sbjct skDFDLIIRNAYLSE-----KDSVYDIGIVGDRIIKIEA-KIEGTVKDEIDAKGNLVSPG   54
DSSP  llLEEEEEEEEEELL-----LLEEEEEEEELLEEEEEEL-LLLLLEEEEEELLLLLEEEL


DSSP  EEEEEELLL-LLLL--------------------LHHHHL-LLLHHHHHHHHHHHHHHHH
Query LIDLHVHVV-AIEF--------------------NLPRVA-TLPNVLVTLRAVPIMRAML   96
ident   | | |                                                     
Sbjct FVDAHTHMDkSFTStgerlpkfwsrpytrdaaieDGLKYYkNATHEEIKRHVIEHAHMQV  114
DSSP  EEEEEELHHhLLLLllllllllllllllhhhhhhHHHHHHhHLLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEELLL-----------lLHHHHHHHHllllLLLEEEELlLEEEllllllllll
Query RRGFTTVRDAGG-----------aGYPFKQAVEsglvEGPRLFVSgRALSqtgghadpra  145
ident   |    |                    |              |                
Sbjct LHGTLYTRTHVDvdsvaktkaveaVLEAKEELK----DLIDIQVV-AFAQ----------  159
DSSP  HLLEEEEEEEEElllllllhhhhhHHHHHHHLL----LLLEEEEE-EELL----------


DSSP  lllllllllllllllllllleEELLlhHHHHHHHHHHHHHLLLLEEEELLllllllllll
Query rsdymppdspcgccvrvgalgRVADgvDEVRRAVREELQMGADQIXIMASggvasptdpv  205
ident                             |     |  | || |                 
Sbjct ---------------------SGFFvdLESESLIRKSLDMGCDLVGGVDP----------  188
DSSP  ---------------------LLLLllLLHHHHHHHHHHHLLLEEELLLL----------


DSSP  lLLLL--LHHHHHHHHHHHHLLLLLEEEEEL-----LHHHHHHHHHLL-------lLEEE
Query gVFGY--SEDEIRAIVAEAQGRGTYVLAHAY-----TPAAIARAVRCG-------vRTIE  251
ident         |         |         |           | |              |  
Sbjct -ATREnnVEGSLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTiengykgrVTTS  247
DSSP  -LLLLllHHHHHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHhhllllllEEEE


DSSP  ELLLL-------LHHHHHHHHHHLLEEELLHHHhhhhhhhlllllllhhhhllhhhhhll
Query HGNLI-------DDETARLVAEHGAYVVPTLVTydalasegekyglppesiakiadvhga  304
ident |            ||   |    |   |                                
Sbjct HAWCFadapsewLDEAIPLYKDSGMKFVTCFSS--------------------------t  281
DSSP  ELLHHhhllhhhHHHHHHHHHHHLLEEEEELLL--------------------------l


DSSP  HHHH-HHHHHHHLLLLLLLLLLLH----HHHHHLL-HHHHHHHLLL------LHHHHHHH
Query GLHS-IEIMKRAGVKMGFGTDLLG----EAQRLQS-DEFRILAEVL------SPAEVIAS  352
ident            ||   |   |                   |    |              
Sbjct PPTMpVIKLLEAGINLGCASDNIRdfwvPFGNGDMvQGALIETQRLelktnrDLGLIWKM  341
DSSP  LLLLlHHHHHHLLLEEEEELLLLLllllLLLLLLHhHHHHHHHHHHllllhhHHHHHHHH


DSSP  LLHHHHHHLLLLLLLlLLLLLLLLLEEEELL-LLLLLLLLLllllLLLLEEEELLEEEEE
Query ATIVSAEVLGMQDKLgRIVPGAHADVLVVDG-NPLKSVDCLlgqgEHIPLVMKDGRLFVN  411
ident  |   | |||       |  |  ||  |     |                | | ||  | 
Sbjct ITSEGARVLGIEKNY-GIEVGKKADLVVLNSlSPQWAIIDQ----AKRLCVIKNGRIIVK  396
DSSP  HLHHHHHHHLLHHHL-LLLLLLLLLEEEELLlLHHHHHHHL----LLEEEEEELLEEEEE


DSSP  L---ll
Query E---le  414
ident       
Sbjct Deviva  402
DSSP  Lleell


No 7: Query=3mkvA Sbjct=1j6pA Z-score=30.4

back to top
DSSP  lLEEEEEEEEEL-LLLLllLEEEEEEEEELLEEEEEELLLLLlllleEEELLLLEEEELE
Query lTTFLFRNGALL-DPDHpdLLQGFEILIEDGFIREVSDKPIKssnahVIDVKGKTIMPGL   59
ident        |   | |             || | |  |     |       |  ||   | |
Sbjct -HHXIIGNCLILkDFSS--EPFWGAVEIENGTIKRVLQGEVK----vDLDLSGKLVXPAL   53
DSSP  -LEEEEEEEEELlLLLL--LLEEEEEEEELLEEEEEEELLLL----lLEELLLEEEEELE


DSSP  EEEEELLLL-LLLL--------------HHHHLLLLHHHHHHHH-HHHHHHHHHLLEEEE
Query IDLHVHVVA-IEFN--------------LPRVATLPNVLVTLRA-VPIMRAMLRRGFTTV  103
ident    | |                                               | |    
Sbjct FNTHTHAPXtLLRGvaedlsfeewlfskVLPIEDRLTEKXAYYGtILAQXEXARHGIAGF  113
DSSP  EEEEELHHHhHHLLllllllhhhhhhllHHHHHLLLLHHHHHHHhHHHHHHHHLLLEEEE


DSSP  EELLLLLHHHHHHHHlllLLLLEEEELLlEEELlllllllllllllllllllllllllll
Query RDAGGAGYPFKQAVEsglVEGPRLFVSGrALSQtgghadprarsdymppdspcgccvrvg  163
ident  |          ||      | |       |                             
Sbjct VDXYFHEEWIAKAVR---DFGXRALLTR-GLVD---------------------------  142
DSSP  EEEELLHHHHHHHHH---HHLLEEEEEE-EELL---------------------------


DSSP  lleeelLLHHHhhHHHHHHHHHL----------lLLEEEELLllllllllllllLLLLHH
Query algrvaDGVDEvrRAVREELQMG----------aDQIXIMASggvasptdpvgvFGYSED  213
ident          |       | |                                     || 
Sbjct ------SNGDD-gGRLEENLKLYnewngfegrifVGFGPHSP------------YLCSEE  183
DSSP  ------LLLLL-lLHHHHHHHHHhhhllhhhleeEEEEELLL------------LLLLHH


DSSP  HHHHHHHHHHLLLLLEEEEEL----LHHHHHHHHHLLL----LEEEELLLLLHHHHHHHH
Query EIRAIVAEAQGRGTYVLAHAY----TPAAIARAVRCGV----RTIEHGNLIDDETARLVA  265
ident         |      |  | |               |         |             
Sbjct YLKRVFDTAKSLNAPVTIHLYetskEEYDLEDILNIGLkevkTIAAHCVHLPERYFGVLK  243
DSSP  HHHHHHHHHHHHLLLEEEEELllllLLLLLHHHHLLLLllllEEEEELLLLLHHHHHHHL


DSSP  HHLLEEELLHHHHHHHHhhlllllllhhhhllhhhhHLLHhhHHHHHHHHLLLLLLLLLL
Query EHGAYVVPTLVTYDALAsegekyglppesiakiadvHGAGlhSIEIMKRAGVKMGFGTDL  325
ident      |         |                     |            | |   ||| 
Sbjct DIPFFVSHNPASNLKLG-------------------NGIA--PVQRXIEHGXKVTLGTDG  282
DSSP  LLLEEEEELHHHHHHLL-------------------LLLL--LHHHHHHLLLEEEELLLL


DSSP  LHHHHHHL-LHHHHHHHL--------LLLHHHHHHHLLHHHHHHLLLllLLLLLLLLLLL
Query LGEAQRLQ-SDEFRILAE--------VLSPAEVIASATIVSAEVLGMqdKLGRIVPGAHA  376
ident       |    | |             |         |   |   |   | | |  |  |
Sbjct AASNNSLNlFFEXRLASLlqkaqnprNLDVNTCLKXVTYDGAQAXGF--KSGKIEEGWNA  340
DSSP  LLLLLLLLhHHHHHHHHHhhhlllllLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLL


DSSP  LEEEELL----------LLLLLLLLlLLLLllLLEEEELLEEEEEL--------------
Query DVLVVDG----------NPLKSVDClLGQGehIPLVMKDGRLFVNE--------------  412
ident |  | |                |                |                    
Sbjct DLVVIDLdlpexfpvqnIKNHLVHA-FSGE--VFATXVAGKWIYFDgeyptidseevkre  397
DSSP  LEEEEELllhhhllhhhHHHHHHHL-LLLL--LLEEEELLEEEEELlllllllhhhhhhh


DSSP  --------ll
Query --------le  414
ident           
Sbjct lariekelys  407
DSSP  hhhhhhhhhl


No 8: Query=3mkvA Sbjct=2uz9A Z-score=29.9

back to top
DSSP  LLEEEEEeEEELLLL---LLLLEEEEEEEEE-LLEEEEEE-LLLL-----LLLL--lEEE
Query LTTFLFRnGALLDPD---HPDLLQGFEILIE-DGFIREVS-DKPI-----KSSN--aHVI   48
ident      || |             |          | |                        
Sbjct PLAHIFR-GTFVHSTwtcPMEVLRDHLLGVSdSGKIVFLEeASQQeklakEWCFkpcEIR   59
DSSP  LLLEEEE-EEEEELLlllLLEEEEEEEEEELlLLLEEEEEeHHHHhhhhhHHLLlhhHEE


DSSP  ELLL-LEEEELEEEEEELLLLLLL---------------LHHHHLLL--LHHHHHHHHHH
Query DVKG-KTIMPGLIDLHVHVVAIEF---------------NLPRVATL--PNVLVTLRAVP   90
ident         |||| | | |     |                                    
Sbjct ELSHhEFFMPGLVDTHIHASQYSFagssidlpllewltkYTFPAEHRfqNIDFAEEVYTR  119
DSSP  ELLLlLEEEELEEEEEEEHHHHHHllllllllhhhhhhhLHHHHHHHhhLHHHHHHHHHH


DSSP  HHHHHHHLLEEEEEELLL----lLHHHHHHHHlllLLLLEEEELlLEEELLLllllllll
Query IMRAMLRRGFTTVRDAGG----aGYPFKQAVEsglVEGPRLFVSgRALSQTGghadprar  146
ident   |  |  | ||                         | | ||                 
Sbjct VVRRTLKNGTTTACYFATihtdsSLLLADITD---KFGQRAFVG-KVCMDLN--------  167
DSSP  HHHHHHHLLEEEEEEELLllhhhHHHHHHHHH---HHLLEEEEE-LEELLLL--------


DSSP  llllLLLLllllllllllleeELLLhHHHHHHHHHHHHHL--------LLLEEEELLlll
Query sdymPPDSpcgccvrvgalgrVADGvDEVRRAVREELQMG--------ADQIXIMASggv  198
ident                            |                            |   
Sbjct ---dTFPE------------yKETT-EESIKETERFVSEMlqknysrvKPIVTPRFS---  208
DSSP  ---lLLLL------------lLLLH-HHHHHHHHHHHHHHhhhlllleEEEEEELLH---


DSSP  lllllllllLLLLHHHHHHHHHHHHLLLLLEEEEEL---------------lhHHHHHHH
Query asptdpvgvFGYSEDEIRAIVAEAQGRGTYVLAHAY---------------tpAAIARAV  243
ident             ||         |  |      |                          
Sbjct ---------LSCSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsykNYTSVYD  259
DSSP  ---------HHLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllllLHHHHHH


DSSP  HLLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhhllhh
Query RCGV----RTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesiakia  299
ident             ||     |      | ||           |                  
Sbjct KNNLltnkTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS-----------------  302
DSSP  HLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-----------------


DSSP  hhHLLHhhHHHHHHHHLLLLLLLLLLLhhHHHHLLHHHHHHHLL-------------LLH
Query dvHGAGlhSIEIMKRAGVKMGFGTDLLgeAQRLQSDEFRILAEV-------------LSP  346
ident    |             || | |||          |  |    |             |  
Sbjct --SGFL--NVLEVLKHEVKIGLGTDVAggYSYSMLDAIRRAVMVsnillinkvneksLTL  358
DSSP  --LLLL--LHHHHHHLLLEEEELLLLLllLLLLHHHHHHHHHHHhhhhhhlllllllLLH


DSSP  HHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELL---------------------LL
Query AEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDG---------------------NP  385
ident  ||   ||      ||     |    |   |                             
Sbjct KEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPkasdspidlfygdffgdiseaVI  418
DSSP  HHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLlllllllllllhhhhlllllhHH


DSSP  LLLLLLLllLLLLLLEEEELLEEEEElll
Query LKSVDCLlgQGEHIPLVMKDGRLFVNele  414
ident  |           |  |   |   |    
Sbjct QKFLYLG--DDRNIEEVYVGGKQVVP-fs  444
DSSP  HHHHHHL--LHHHEEEEEELLEEEEL-ll


No 9: Query=3mkvA Sbjct=3ls9A Z-score=29.8

back to top
DSSP  llEEEEEEE-EELLLL-LLLLEEEEEEEEELLEEEEEELlLLLLLLL-EEEELLLLEEEE
Query ltTFLFRNG-ALLDPD-HPDLLQGFEILIEDGFIREVSDkPIKSSNA-HVIDVKGKTIMP   57
ident     | |        |     |    |||    |  |             ||  |    |
Sbjct --MILIRGLtRVITFDdQERELEDADILIDGPKIVAVGK-DLSDRSVsRTIDGRGMIALP   57
DSSP  --LEEEEEEeEEELLLlLLLEEEEEEEEEELLEEEEEEL-LLLLLLLlEEEELLLEEEEE


DSSP  LEEEEEELLLLLLL----------------LHHH-HLLL------LHHHHHHHHHHHHHH
Query GLIDLHVHVVAIEF----------------NLPR-VATL------PNVLVTLRAVPIMRA   94
ident |||  | |                            |                |      
Sbjct GLINSHQHLYEGAMraipqlervtmaswleGVLTrSAGWwrdgkfGPDVIREVARAVLLE  117
DSSP  LEEEEEELHHHHHHlllhhhllllhhhhhhHHHHhHHHHhhllllLHHHHHHHHHHHHHH


DSSP  HHHLLEEEEEELLL---------lLHHHHHHHHlllLLLLEEEELLlEEELLL---lllL
Query MLRRGFTTVRDAGG---------aGYPFKQAVEsglVEGPRLFVSGrALSQTG---ghaD  142
ident  |  | ||| |                   |       | |           |       
Sbjct SLLGGITTVADQHLffpgatadsyIDATIEAAT---DLGIRFHAAR-SSMTLGkseggfC  173
DSSP  HHHLLEEEEEEEELlllllllllhHHHHHHHHH---HHLLEEEEEE-LLLLLLhhhlllL


DSSP  LLLlllllllllllllllllllleeELLLhHHHHHHHHHHHHHLL---------LLEEEE
Query PRArsdymppdspcgccvrvgalgrVADGvDEVRRAVREELQMGA---------DQIXIM  193
ident                          |    | |                           
Sbjct DDL---------------------fVEPV-DRVVQHCLGLIDQYHepepfgmvrIALGPC  211
DSSP  LHH---------------------hLLLH-HHHHHHHHHHHHHHLllllllleeEEELLL


DSSP  LLLllllllllllllLLLHHHHHHHHHHHHLLLLLEEEEELL------------hHHHHH
Query ASGgvasptdpvgvfGYSEDEIRAIVAEAQGRGTYVLAHAYT------------pAAIAR  241
ident                        |    |         | |                   
Sbjct GVP------------YDKPELFEAFAQMAADYDVRLHTHFYEpldagmsdhlygmTPWRF  259
DSSP  LLL------------LLLHHHHHHHHHHHHHHLLEEEEEELLllhhhhhhhhhllLHHHH


DSSP  HHHLLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhhll
Query AVRCGV----RTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesiak  297
ident     |         |      |     |  |                             
Sbjct LEKHGWasdrVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG---------------  304
DSSP  HHHLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL---------------


DSSP  hhhhHLLHhhHHHHHHHHLLLLLLLLLLLH-hHHHHLLHHHHHHHL------------LL
Query iadvHGAGlhSIEIMKRAGVKMGFGTDLLG-eAQRLQSDEFRILAE------------VL  344
ident      |     |     ||   ||||               |  |              |
Sbjct ----WGLA--PIREYLDAGITVGFGTTGSAsnDGGNLLGDLRLAALahrpadpnepekWL  358
DSSP  ----LLLL--LHHHHHHLLLEEEELLLLLLllLLLLHHHHHHHHHHhlhhhllllhhhLL


DSSP  LHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL----------LLLLLLLLlLL
Query SPAEVIASATIVSAEVLGMQdKLGRIVPGAHADVLVVDG----------NPLKSVDClLG  394
ident |  |    ||  ||| ||    ||    |  ||                         | 
Sbjct SARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvdrvgvhdPAIGLIMTgLS  417
DSSP  LHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhhhlllllHHHHHHHLlLL


DSSP  LLllLLEEEELLEEEEEL------------------ll
Query QGehIPLVMKDGRLFVNE------------------le  414
ident       ||   |   |                      
Sbjct DR--ASLVVVNGQVLVENerpvladlerivanttalip  453
DSSP  LL--LLEEEELLEEEEELleellllhhhhhhhhhhhll


No 10: Query=3mkvA Sbjct=2vunA Z-score=29.7

back to top
DSSP  lLEEEEEEE-EELL-LLLLLLEEEEEEEEELLEEEEEELLLLL--LLLLEEEELLLLEEE
Query lTTFLFRNG-ALLD-PDHPDLLQGFEILIEDGFIREVSDKPIK--SSNAHVIDVKGKTIM   56
ident        |             ||   |  ||| |              |  ||  | |  
Sbjct -SKTIIKNIgKIVSgDIKSPVLQADTIVVEDGLIAAIGGEELMkdAGDATIIDAAGSTVT   59
DSSP  -LEEEEELLlEEELlLLLLLEELLLEEEEELLEEEEEELHHHHllLLLLEEEELLLLEEE


DSSP  ELEEEEEELLL----LLLLlhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELLL----
Query PGLIDLHVHVV----AIEFnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG----  108
ident ||| | ||||     |                           |  | ||   ||     
Sbjct PGLLDTHVHVSggdyAPRQ---------------KTMDFISSALHGGVTTMISAGSphfp  104
DSSP  ELEEEEEELLLllleEHHH---------------LEELHHHHHHLLLEEEEEELLLllll


DSSP  ---------------LLHHHHHHHhlllLLLLEEEElLLEEELlllllllllllllllll
Query ---------------AGYPFKQAVesglVEGPRLFVsGRALSQtgghadprarsdymppd  153
ident                       |       |      |                      
Sbjct grpkdaagtkalaitLSKSYYNAR----PAGVKVHG-GAVILE-----------------  142
DSSP  lllllhhhhhhhhhhHHHHHHHLL----HHHLEEEL-LEELLL-----------------


DSSP  lllllllllllleeelLLHHhhHHHHHHHHHHLLLLEEEELllllllllllllllLLLHH
Query spcgccvrvgalgrvaDGVDevRRAVREELQMGADQIXIMAsggvasptdpvgvfGYSED  213
ident                  |         |    |                           
Sbjct ----------------KGLT--EEDFIEMKKEGVWIVGEVG-----------lgtIKNPE  173
DSSP  ----------------LLLL--HHHHHHHHHLLLLEEEEEL-----------lllLLLHH


DSSP  HHHHHHHHHHLLLLLEEEEELL------hHHHH-HHHHLLLLEEEELL----LLLHHHHH
Query EIRAIVAEAQGRGTYVLAHAYT------pAAIA-RAVRCGVRTIEHGN----LIDDETAR  262
ident      |  |   |  |  |             |            | |     |      
Sbjct DAAPMVEWAHKHGFKVQMHTGGtsipgssTVTAdDVIKTKPDVVSHINggptAISVQEVD  233
DSSP  HHHHHHHHHHHLLLEEEEELLLlllllllLLLHhHHHHHLLLEEELLLllllLLLHHHHH


DSSP  HHHH-HLLEEELLhHHHHhhhhhlllllllhhhhllhhhhHLLHHHHHHHHHHHLL--LL
Query LVAE-HGAYVVPTlVTYDalasegekyglppesiakiadvHGAGLHSIEIMKRAGV--KM  319
ident                                                       |     
Sbjct RIMDeTDFAMEIV-QCGN----------------------PKIADYVARRAAEKGQlgRV  270
DSSP  HHHHhLLLEEEEE-LLLL----------------------HHHHHHHHHHHHHHLLhhHE


DSSP  LLLLLLLH--HHHHHL-LHHHHHHHL--LLLHHHHHHHLLHHHHHHLLLllLLLLLLLLL
Query GFGTDLLG--EAQRLQ-SDEFRILAE--VLSPAEVIASATIVSAEVLGMqdKLGRIVPGA  374
ident  || |         |         |      |      ||  |  | |     | | || 
Sbjct IFGNDAPSgtGLIPLGiLRNMCQIASmsDIDPEVAVCMATGNSTAVYGL--NTGVIAPGK  328
DSSP  EEELLLLLllLLLLLHhHHHHHHHHHhlLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLL


DSSP  LLLEEEELL-------LLLLL---LLLLlllllLLLEEEELLEEEEEL------------
Query HADVLVVDG-------NPLKS---VDCLlgqgeHIPLVMKDGRLFVNE------------  412
ident  ||    |                 |        |  |  ||   |              
Sbjct EADLIIMDTplgsvaeDAMGAiaaGDIP-----GISVVLIDGEAVVTKsrntppakraak  383
DSSP  LLLEEEEELlllllllLHHHHhhhLLLL-----EEEEEEELLEEEELLllllllllllle


DSSP  ll
Query le  414
ident   
Sbjct il  385
DSSP  el


No 11: Query=3mkvA Sbjct=3icjA Z-score=28.7

back to top
DSSP  lLEEEEEEEEEL-LLLLLLLEeeEEEEEELLEEEEEELLLL---LLLL--LEEEELLLLE
Query lTTFLFRNGALL-DPDHPDLLqgFEILIEDGFIREVSDKPI---KSSN--AHVIDVKGKT   54
ident        ||                  |         |               || ||| 
Sbjct -CMKALINGTIYtSFSPVKKV--SGLVISNERVLYAGDSSTalrIAELagGEIIDLKGKF   57
DSSP  -LEEEEELLEEEeEELLEEEE--LEEEEELLEEEEEELHHHhhhHHHHhlLEEEELLLLE


DSSP  EEELEEEEEELLLLL---------------------------------------------
Query IMPGLIDLHVHVVAI---------------------------------------------   69
ident  ||   | | |                                                 
Sbjct VMPAFFDSHLHLDELgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
DSSP  EEELEEEEEELHHHHhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll


DSSP  ---------------------------------------------------lllHHHHL-
Query ---------------------------------------------------efnLPRVA-   77
ident                                                             
Sbjct redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIINe  177
DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHHh


DSSP  -LLLHHHHHHHHHHHHHHHHHLLEEEEEELLLL--LHHHHHHHHLLLLLLLEEEELLLee
Query -TLPNVLVTLRAVPIMRAMLRRGFTTVRDAGGA--GYPFKQAVESGLVEGPRLFVSGRal  134
ident   |                |  |   |                |         |      
Sbjct kILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGekALKALFELEREGRLKMNVFAYLS--  235
DSSP  lLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELhhHHHHHHHHHHLLLLLLEEEEEEL--


DSSP  elllllllllllllllllllllllllllllleeelllhhhhhhhhhHHHHH---------
Query sqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravrEELQM---------  185
ident                                               | |           
Sbjct ---------------------------------------------pELLDKleelnlgkf  250
DSSP  ---------------------------------------------hHHHHHhhhhlllle


DSSP  -----lLLLEEEELLLLLLLllLLLL-------------LLLLLHHHHHHHHHHHHLLLL
Query -----gADQIXIMASGGVASptDPVG-------------VFGYSEDEIRAIVAEAQGRGT  227
ident           |    |                             |||      |   | 
Sbjct egrrlrIWGVXLFVDGSLGA--RTALlsepytdnpttsgELVMNKDEIVEVIERAKPLGL  308
DSSP  ellleeEEEEEEELLLLLLL--LLLLlllllllllllllLLLLLHHHHHHHHHHHLLLLL


DSSP  LEEEEELLHHHHHHHHHLL-----LLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH
Query YVLAHAYTPAAIARAVRCG-----VRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALA  282
ident  |  ||    |   |            |||  |  |       |                
Sbjct DVAVHAIGDKAVDVALDAFeeaefSGRIEHASLVRDDQLERIKELKVRISAQPHFIVSDW  368
DSSP  EEEEEELLHHHHHHHHHHHhhhllLLEEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLL


DSSP  hhlllllllhhhhlLHHH-----hHLLHHhHHHHHHHhLLLLLLLLLLLhhhHHHLL--H
Query segekyglppesiaKIAD-----vHGAGLhSIEIMKRaGVKMGFGTDLLgeaQRLQS--D  335
ident                |                        | || ||             
Sbjct --------------WIVNrvgeerAKWAY-RLKTLSS-ITKLGFSTDSP---IEPADpwV  409
DSSP  --------------LHHHhhhhhhHHHLL-LHHHHHH-HLLEEELLLLL---LLLLLhhH


DSSP  HHHHHHL--------LLLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELLLLLL
Query EFRILAE--------VLSPAEVIASATIVSAEVLGMQdKLGRIVPGAHADVLVVDGNPLK  387
ident                  |  |     |  || |      ||    |  |     |  |||
Sbjct SIDAAVNryvvdpgeRVSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDRDPLK  468
DSSP  HHHHHHHlllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELLLLLL


DSSP  llllllllllllleeeelleeeeelll
Query svdcllgqgehiplvmkdgrlfvnele  414
ident                            
Sbjct ---------------------------  468
DSSP  ---------------------------


No 12: Query=3mkvA Sbjct=1k6wA Z-score=28.7

back to top
DSSP  lLEEEEEEEEELlllllLLEEEEEEEEELLEEEEEELLL-llllLLEEEELLLLEEEELE
Query lTTFLFRNGALLdpdhpDLLQGFEILIEDGFIREVSDKP-ikssNAHVIDVKGKTIMPGL   59
ident        |  |             |   || |                 |       |  
Sbjct -ALQTIINARLP-----GEEGLWQIHLQDGKISAIDAQSgvmpiTENSLDAEQGLVIPPF   54
DSSP  -LLLEEEEELLL-----LLLLEEEEEEELLEEEEEEEELlllllLLLEEELLLLEEELLE


DSSP  EEEEELLL-LLLL-------------LHHHHL----LLLHHHHHHHHHHHHHHHHHLLEE
Query IDLHVHVV-AIEF-------------NLPRVA----TLPNVLVTLRAVPIMRAMLRRGFT  101
ident    | |                       | |     |    |  ||          |  
Sbjct VEPHIHLDtTQTAgqpnwnqsgtlfeGIERWAerkaLLTHDDVKQRAWQTLKWQIANGIQ  114
DSSP  EEEEELLLlLLLLllllllllllhhhHHHHHHllhhHLLHHHHHHHHHHHHHHHHHLLEE


DSSP  EEEELLL----------lLHHHHHHHHllllLLLEEEELlLEEELlllllllllllllll
Query TVRDAGG----------aGYPFKQAVEsglvEGPRLFVSgRALSQtgghadprarsdymp  151
ident  ||                   || |         |                        
Sbjct HVRTHVDvsdatltalkaMLEVKQEVA----PWIDLQIV-AFPQE---------------  154
DSSP  EEEEEEEllllllhhhhhHHHHHHHHL----LLLEEEEE-EELLL---------------


DSSP  lllllllllllllleeELLLHHHHHHHHHHHHHHLLLLEEEELLLlllllllllllllLL
Query pdspcgccvrvgalgrVADGVDEVRRAVREELQMGADQIXIMASGgvasptdpvgvfgYS  211
ident                              | |  |||                     | 
Sbjct ----------------GILSYPNGEALLEEALRLGADVVGAIPHF--------eftreYG  190
DSSP  ----------------LLLLLLLHHHHHHHHHHLLLLEEEELHHH--------lllhhHH


DSSP  HHHHHHHHHHHHLLLLLEEEEEL-----lHHHHHHHHHLL-------lLEEEELLLL---
Query EDEIRAIVAEAQGRGTYVLAHAY-----tPAAIARAVRCG-------vRTIEHGNLI---  256
ident         | ||        |                            |  |       
Sbjct VESLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALAhhegmgarVTASHTTAMhsy  250
DSSP  HHHHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHHhhhllhhhEEEEELHHHhhl


DSSP  ----LHHHHHHHHHHLLEEELLHHHHHHHhhhlllllllhhhhlLHHH----hHLLHhhH
Query ----DDETARLVAEHGAYVVPTLVTYDALasegekyglppesiaKIAD----vHGAGlhS  308
ident          ||    |   |        |                               
Sbjct ngayTSRLFRLLKMSGINFVANPLVNIHL---------------QGRFdtypkRRGI-tR  294
DSSP  lhhhHHHHHHHHHHHLLEEEELHHHHHHH---------------LLLLlllllLLLL-lL


DSSP  HHHHHHHLLLLLLLLLLLH----HHHHHLL-HHHHHHHLLL------LHHHHHHHLLHHH
Query IEIMKRAGVKMGFGTDLLG----EAQRLQS-DEFRILAEVL------SPAEVIASATIVS  357
ident    |   |    || |                       |                |  |
Sbjct VKEMLESGINVCFGHDDVFdpwyPLGTANMlQVLHMGLHVCqlmgygQINDGLNLITHHS  354
DSSP  HHHHHHLLLLEEELLLLLLllllLLLLLLHhHHHHHHHHHLllllhhHHHHHHHHHLHHH


DSSP  HHHLLLLLllLLLLLLLLLLEEEELL-LLLLLLLLLllllLLLLEEEELLEEEEELL---
Query AEVLGMQDklGRIVPGAHADVLVVDG-NPLKSVDCLlgqgEHIPLVMKDGRLFVNEL---  413
ident |  |  ||    |  |  |        |                     |          
Sbjct ARTLNLQD--YGIAAGNSANLIILPAeNGFDALRRQ----VPVRYSVRGGKVIASTQpaq  408
DSSP  HHHLLLLL--LLLLLLLLLLEEEELLlLHHHHHHHL----LLLLEEEELLEEEEELLlll


DSSP  --------------l
Query --------------e  414
ident                
Sbjct ttvyleqpeaidykr  423
DSSP  eeeellleeeellll


No 13: Query=3mkvA Sbjct=3nqbA Z-score=27.9

back to top
DSSP  ----------------------LLEEEEEEEEELLLLLLLLEEeEEEEEELLEEEEEEL-
Query ----------------------LTTFLFRNGALLDPDHPDLLQgFEILIEDGFIREVSD-   37
ident                           |   | | |     |     | |    |  |   
Sbjct epadlnddtlraravaaargdqRFDVLITGGTLVDVVTGELRP-ADIGIVGALIASVHEp   59
DSSP  llhhhllhhhhhhhhhhhhlllLEEEEEELLEEELLLLLLEEE-LEEEEELLEEEEEELl


DSSP  LLLLLlLLEEEELLLLEEEELEEEEEELLLLLLllhhhhllllhhhhhHHHHHHHHHHHH
Query KPIKSsNAHVIDVKGKTIMPGLIDLHVHVVAIEfnlprvatlpnvlvtLRAVPIMRAMLR   97
ident        | |||  |    ||||| | |                            |   
Sbjct ASRRD-AAQVIDAGGAYVSPGLIDTHXHIESSX---------------ITPAAYAAAVVA  103
DSSP  LLLLL-EEEEEELLLLEEEELEEEEEELHHHHL---------------LLHHHHHHHHHL


DSSP  LLEEEEEELLL------------lLHHHHHHHhlllllLLEEEELlLEEEllllllllll
Query RGFTTVRDAGG------------aGYPFKQAVesglveGPRLFVSgRALSqtgghadpra  145
ident || ||                                   |                   
Sbjct RGVTTIVWDPHefgnvhgvdgvrwAAKAIENL------PLRAILL-APSC----------  146
DSSP  LLEEEEEELLHhhhhhhlhhhhhhHHHHHLLL------LLEEEEE-ELLL----------


DSSP  lllllllllllllllllllleEELLL------hhHHHHHHHHHHHHL-LLLEEEELllll
Query rsdymppdspcgccvrvgalgRVADG------vdEVRRAVREELQMG-ADQIXIMAsggv  198
ident                                            |       |        
Sbjct ---------------------VPSAPglerggadFDAAILADLLSWPeIGGIAEIX----  181
DSSP  ---------------------LLLLLllllllllLLHHHHHHHHLLLlEEEEEEEL----


DSSP  llllllllllLLLH----HHHHHHHHHHHLLLLLEEEEELLHH--HHHHHHHLLLLEEEE
Query asptdpvgvfGYSE----DEIRAIVAEAQGRGTYVLAHAYTPA--AIARAVRCGVRTIEH  252
ident                        ||         |  ||              ||     
Sbjct ---------nXRGVierdPRXSGIVQAGLAAEKLVCGHARGLKnaDLNAFXAAGVSSDHE  232
DSSP  ---------lHHHHhlllHHHHHHHHHHHHHLLEEEELLLLLLhhHHHHHHHLLLLEELL


DSSP  LLLLLhhHHHHHHHHLLEEELLhHHHHhhhhhlllllllhhhhllhhhhhLLHHHHHHHH
Query GNLIDdeTARLVAEHGAYVVPTlVTYDalasegekyglppesiakiadvhGAGLHSIEIM  312
ident                |          |                                 
Sbjct LVSGE--DLXAKLRAGLTIELR-GSHD-----------------------HLLPEFVAAL  266
DSSP  LLLHH--HHHHHHHLLLEEEEE-LLLH-----------------------HHHHHHHHHH


DSSP  HHH---llLLLLLLL-LLHHHH--HHLL-HHHHHHH-LLLLHHHHHHHLLHHHHHHLLLL
Query KRA---gvKMGFGTD-LLGEAQ--RLQS-DEFRILA-EVLSPAEVIASATIVSAEVLGMQ  364
ident              ||              |  | |    | |      ||   |  ||  
Sbjct NTLghlpqTVTLCTDdVFPDDLlqGGGLdDVVRRLVrYGLKPEWALRAATLNAAQRLGRS  326
DSSP  HHHlllllLEEEELLlLLHHHHhhLLLHhHHHHHHHhLLLLHHHHHHHHLHHHHHHHLLL


DSSP  lLLLLLLLLLLLLEEEELLlllllLLLLlllllLLLEEEELLEEEEEL------------
Query dKLGRIVPGAHADVLVVDGnplksVDCLlgqgeHIPLVMKDGRLFVNE------------  412
ident   || |  |  ||  |                     |   ||                 
Sbjct -DLGLIAAGRRADIVVFED-----LNGF-----SARHVLASGRAVAEGgrxlvdiptcdt  375
DSSP  -LLLLLLLLLLLLEEEELL-----LLLL-----LEEEEEELLEEEEELleelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  412
ident                                                             
Sbjct tvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxi  435
DSSP  hhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  412
ident                                                             
Sbjct svthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtg  495
DSSP  eeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  412
ident                                                             
Sbjct ggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfg  555
DSSP  leeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhl


DSSP  ------------------------------ll
Query ------------------------------le  414
ident                                 
Sbjct atlacnigphqtdxgiadvltgkvxespviev  587
DSSP  llllllllleelllleeelllleeellleeel


No 14: Query=3mkvA Sbjct=1onxA Z-score=27.3

back to top
DSSP  ------LLEEEEEEEEELLLLlllLEEEEEEEEELLEEEEEELLLL--LLLLLEEEELLL
Query ------LTTFLFRNGALLDPDhpdLLQGFEILIEDGFIREVSDKPI--KSSNAHVIDVKG   52
ident           |     |  |           |   | |  |          |  | |  |
Sbjct midytaAGFTLLQGAHLYAPE---DRGICDVLVANGKIIAVASNIPsdIVPNCTVVDLSG   57
DSSP  llllhhHLLEEEEEEEEELLL---EEEEEEEEEELLEEEEEELLLLllLLLLLEEEELLL


DSSP  LEEEELEEEEEELLLLlLLLH--HHHLlllhhhhhHHHHhHHHHHHHLLEEEEEELL---
Query KTIMPGLIDLHVHVVAiEFNL--PRVAtlpnvlvtLRAVpIMRAMLRRGFTTVRDAG---  107
ident     || || |||          |              |         | | |       
Sbjct QILCPGFIDQHVHLIG-GGGEagPTTR--------TPEV-ALSRLTEAGVTSVVGLLgtd  107
DSSP  LEEEELEEEEEELLLL-LLLLllHHHL--------LLLL-LHHHHHHLLEEEEEELLlll


DSSP  ------llLHHHHHHHHLlllLLLEEEELLLEEELlllllllllllllllllllllllll
Query ------gaGYPFKQAVESglvEGPRLFVSGRALSQtgghadprarsdymppdspcgccvr  161
ident               |      ||        |                            
Sbjct sisrhpesLLAKTRALNE---EGISAWMLTGAYHV-------------------------  139
DSSP  lllllhhhHHHHHHHHHH---HLLEEEEEEELLLL-------------------------


DSSP  lllleeelllhhhhhHHHHHHHHHL--LLLEEEELLLlllllllllLLLL-LLHHHHHHH
Query vgalgrvadgvdevrRAVREELQMG--ADQIXIMASGgvasptdpvGVFG-YSEDEIRAI  218
ident                  |             |   |                        
Sbjct ---------psrtitGSVEKDVAIIdrVIGVXCAISD---------HRSAaPDVYHLANM  181
DSSP  ---------llllllLLHHHHHHHLllEEEEEEEELL---------LLLLlLLHHHHHHH


DSSP  HHHHHLLL------LLEEEEELL-hHHHHHHHHLL--------LLEEEELL---LLLHhH
Query VAEAQGRG------TYVLAHAYT-pAAIARAVRCG--------VRTIEHGN---LIDDeT  260
ident  ||    |           |      |                     | |         
Sbjct AAESRVGGllggkpGVTVFHMGDskKALQPIYDLLencdvpisKLLPTHVNrnvPLFE-Q  240
DSSP  HHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHHhlllllhhHEEEELHHhlhHHHH-H


DSSP  HHHHHHHLLEEELLHHHHhhhhhhlllllllhhhhllhhhhHLLH-HHHHHHHH-HHLL-
Query ARLVAEHGAYVVPTLVTYdalasegekyglppesiakiadvHGAG-LHSIEIMK-RAGV-  317
ident |   |  |     |                                   |          
Sbjct ALEFARKGGTIDITSSID-----------------------EPVApAEGIARAVqAGIPl  277
DSSP  HHHHHHLLLLEEEELLLL-----------------------LLLLhHHHHHHHHhLLLLh


DSSP  -LLLLLLLLLH--------------HHHHhLLHHHHHHHLL-----LLHHHHHHHLLHHH
Query -KMGFGTDLLG--------------EAQRlQSDEFRILAEV-----LSPAEVIASATIVS  357
ident        |  |                                    |        |   
Sbjct aRVTLSSDGNGsqpffddegnlthiGVAG-FETLLETVQVLvkdydFSISDALRPLTSSV  336
DSSP  hHEEEELLLLLeeeeellllleeeeEELL-LHHHHHHHHHHhhhhlLLHHHHHHHHLHHH


DSSP  HHHLLLLlLLLLLLLLLLLLEEEELLLLllllllllllllLLLEEEELLEEEEEL-----
Query AEVLGMQdKLGRIVPGAHADVLVVDGNPlksvdcllgqgeHIPLVMKDGRLFVNE-----  412
ident |  |      | | ||  || ||                  |  |   | | |       
Sbjct AGFLNLT-GKGEILPGNDADLLVMTPEL------------RIEQVYARGKLMVKDgkacv  383
DSSP  HHHLLLL-LLLLLLLLLLLLEEEELLLL------------LEEEEEELLEEEEELleell


DSSP  -----ll
Query -----le  414
ident        
Sbjct kgtfetd  390
DSSP  lllllll


No 15: Query=3mkvA Sbjct=3giqA Z-score=26.8

back to top
DSSP  -LLEEEEEEEEELLLLLLLLEEeEEEEEELLEEEEEELlLLLLLLLEEEELLLLEEEELE
Query -LTTFLFRNGALLDPDHPDLLQgFEILIEDGFIREVSDkPIKSSNAHVIDVKGKTIMPGL   59
ident     |    |   |               || |             |  |  ||   || 
Sbjct eKLDFKITGGWIIDGTGAPRRR-ADLGVRDGRIAAIGE-LGAHPARHAWDASGKIVAPGF   58
DSSP  lLEEEEEELLEELLLLLLLLEE-LEEEEELLEEEEEEL-LLLLLEEEEEELLLLEEEELE


DSSP  EEEEELLLLLlllhhhhllllhhhhhHHHHHhHHHHHHLLEEEEEEL---LLLL------
Query IDLHVHVVAIefnlprvatlpnvlvtLRAVPiMRAMLRRGFTTVRDA---GGAG------  110
ident || | |                           |     | |||        |       
Sbjct IDVHGHDDLM---------------fVEKPD-LRWKTSQGITTVVVGncgVSAApaplpg  102
DSSP  EELLLLLLLH---------------hHHLLL-LHHHHLLLEEEEEELlllLLLLllllll


DSSP  ------------------HHHHHHHHLlLLLLLEEEELlLEEElllllllllllllllll
Query ------------------YPFKQAVESgLVEGPRLFVSgRALSqtgghadprarsdympp  152
ident                        |                                    
Sbjct ntaaalallgetplfadvPAYFAALDA-QRPMINVAAL-VGHA-----------------  143
DSSP  lllhhhhhhllllllllhHHHHHHHHH-LLLLLEEEEE-EEHH-----------------


DSSP  lllllllllllllEEEL------------lLHHHHHHHHHHHHHHLLLLEEEELLLllll
Query dspcgccvrvgalGRVA------------dGVDEVRRAVREELQMGADQIXIMASGgvas  200
ident                                           |  ||             
Sbjct -------------NLRLaamrdpqaaptaaEQQAMQDMLQAALEAGAVGFSTGLAY----  186
DSSP  -------------HHHHhhlllllllllhhHHHHHHHHHHHHHHHLLLEEEEELLL----


DSSP  lllllllLLLLHHHHHHHHHHHHLLLLLEEEEE-----lLHHHHHHHHHLL-----LLEE
Query ptdpvgvFGYSEDEIRAIVAEAQGRGTYVLAHA-----yTPAAIARAVRCG-----VRTI  250
ident              |       |  |      |         ||       |         
Sbjct ----qpgAVAQAAELEGLARVAAERRRLHTSHIrneadgVEAAVEEVLAIGrgtgcATVV  242
DSSP  ----llhHHLLHHHHHHHHHHHHHLLLEEEEELllllllHHHHHHHHHHHHhhhllEEEE


DSSP  EELLL-------lLHHHHHHHHHHL-----LEEELLHHhHHHH----------hhhlLLL
Query EHGNL-------iDDETARLVAEHG-----AYVVPTLVtYDAL----------asegEKY  288
ident  |              |                                           
Sbjct SHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYPY-PGSStiliperaetiddiRIT  301
DSSP  LLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELLL-LEEEeellhhhlllllllEEE


DSSP  L-----------------------------lLHHHHllHHHHHL-LHHHHHHhhhhhLLL
Query G-----------------------------lPPESIakIADVHG-AGLHSIEimkraGVK  318
ident                                 |                           
Sbjct WstphpecsgeyladiaarwgcdkttaarrlAPAGA-iYFAMDEdEVKRIFQ-----HPC  355
DSSP  EelllhhhllllhhhhhhhhlllhhhhhhhhLLEEE-eEELLLHhHHHHHHH-----LLL


DSSP  LLLLLLLLHH------hHHHLL-HHHHHHH---LLLLHHHHHHHLLHHHHHHLLLLlLLL
Query MGFGTDLLGE------aQRLQS-DEFRILA---EVLSPAEVIASATIVSAEVLGMQdKLG  368
ident    | | |                                  |  |   | | |     |
Sbjct CMVGSDGLPNdarphprLWGSFtRVLGRYVreaRLMTLEQAVARMTALPARVFGFA-ERG  414
DSSP  EEELLLLLLLllllllhHHHHHhHHHHHHHhhlLLLLHHHHHHHHLHHHHHHHLLL-LLL


DSSP  LLLLLLLLLEEEELLLlllllLLLLL--------LLLLLLEEEELLEEEEEL--------
Query RIVPGAHADVLVVDGNplksvDCLLG--------QGEHIPLVMKDGRLFVNE--------  412
ident    ||| ||| | |                        |  |   |              
Sbjct VLQPGAWADVVVFDPD-----TVADRatwdeptlASVGIAGVLVNGAEVFPQppadgrpg  469
DSSP  LLLLLLLLLEEEELLL-----LLLLLllllllllLLLLEEEEEELLEEEELLllllllll


DSSP  ----ll
Query ----le  414
ident       
Sbjct qvlrax  475
DSSP  llllll


No 16: Query=3mkvA Sbjct=3ooqA Z-score=26.7

back to top
DSSP  llEEEEEEEEELLLLLlLLEEeEEEEEELLEEEEEELlLLLLLLLEEEELLLLEEEELEE
Query ltTFLFRNGALLDPDHpDLLQgFEILIEDGFIREVSDkPIKSSNAHVIDVKGKTIMPGLI   60
ident     || |                 |   |    |    |    |   |  ||   ||  
Sbjct --KILFKNATVFPITS-RPFK-GDVLVSNGKVEKVGE-NIEDPDAEIVDLTGKFLFPGFV   55
DSSP  --LEEEEEEEELLLLL-LLEE-EEEEEELLEEEEEEL-LLLLLLLEEEELLLLEEEELEE


DSSP  EEEELL-LLLLllhHHHL------------lllhhhhHHHHhHHHHHHHHLLEEEEEELL
Query DLHVHV-VAIEfnlPRVA------------tlpnvlvTLRAvPIMRAMLRRGFTTVRDAG  107
ident | | |     |                               |     |  | | |    
Sbjct DAHSHIgLFEEgvgYYYSdgneatdpvtphvkaldgfNPQD-PAIERALAGGVTSVXIVP  114
DSSP  EEEELLlLLLLlllHHHLllllllllllllllhhhhlLLLL-HHHHHHHLLLEEEEEELL


DSSP  L------------llhhhhHHHHlllllllEEEEllleeellllllllllllllllllll
Query G------------agypfkQAVEsglvegpRLFVsgralsqtgghadprarsdymppdsp  155
ident |                                                           
Sbjct GsanpvggqgsvikfrsiiVEEC-------IVKD--------------------------  141
DSSP  LlllleeeeeeeeelllllHHHH-------EEEE--------------------------


DSSP  lllllllllleeelllhhhhhhhhhhhhhhlLLLEEEELLLLllLLLL-----llllllL
Query cgccvrvgalgrvadgvdevrravreelqmgADQIXIMASGGvaSPTD-----pvgvfgY  210
ident                                                             
Sbjct -------------------------------PAGLKXAFGENpkRVYGerkqtpstrxgT  170
DSSP  -------------------------------EEEEEEELLHHhhHHHHhlllllllhhhH


DSSP  LHHHHHHH-----------------------------hHHHHLLLLLEEEEELLHHHHHH
Query SEDEIRAI-----------------------------vAEAQGRGTYVLAHAYTPAAIAR  241
ident                                                   ||     |  
Sbjct AGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAHRADDILT  230
DSSP  HHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEELLHHHHHH


DSSP  HHHLL-----LLEEEELLLLLHhHHHHHHHHLLEEELL-HHHHhhhhhhlllllllhhhh
Query AVRCG-----VRTIEHGNLIDDeTARLVAEHGAYVVPT-LVTYdalasegekyglppesi  295
ident | |          ||||           ||    ||   | |                  
Sbjct AIRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGpLLTF-----------------  272
DSSP  HHHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEELlLLLL-----------------


DSSP  lLHHHHHLLHHHHHHHHHHHLLLLLLLLLLlhHHHH--HLLHHHHHHHL-LLLHHHHHHH
Query aKIADVHGAGLHSIEIMKRAGVKMGFGTDLlgEAQR--LQSDEFRILAE-VLSPAEVIAS  352
ident              |      ||      |                               
Sbjct rTKLELKDLTXETIAKLLKDGVLIALXCDH--PVIPleFATVQAATAXRyGAKEEDLLKI  330
DSSP  lLLHHHLLLLLLHHHHHHHLLLLEEELLLL--LLLLhhHHHHHHHHHHHhLLLHHHHHHL


DSSP  LLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLlllLLLLlllllLLLLEEEELLEEEEEL
Query ATIVSAEVLGMQDKLGRIVPGAHADVLVVDGNplkSVDCllgqgEHIPLVMKDGRLFVNE  412
ident  |   |  ||  |  | | ||  ||  |  |      |           |  ||      
Sbjct LTVNPAKILGLEDRIGSIEPGKDADLVVWSGH---PFDX----kSVVERVYIDGVEVFRR  383
DSSP  LLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL---LLLL----lLLEEEEEELLEEEEEL


DSSP  ll
Query le  414
ident   
Sbjct -e  384
DSSP  -l


No 17: Query=3mkvA Sbjct=4rdvB Z-score=26.4

back to top
DSSP  lleEEEEEEEELLLLLllLEEEEEEEEE-LLEEEEEEL-LLLLLllleEEELLlLEEEEL
Query lttFLFRNGALLDPDHpdLLQGFEILIE-DGFIREVSD-KPIKSsnahVIDVKgKTIMPG   58
ident            | |            |  ||   |                       ||
Sbjct ---SAIFAERALLPEG--WARNVRFEISaDGVLAEIRPdANADG----AERLG-GAVLPG   50
DSSP  ---LEEEEEEEEELLE--EEEEEEEEELlLLLEEEEELlLLLLL----LEELL-LLEEEL


DSSP  EEEEEELLLLLLL-------------------LHHHHLLLLH-HHHHHHHHHHHHHHHHL
Query LIDLHVHVVAIEF-------------------NLPRVATLPN-VLVTLRAVPIMRAMLRR   98
ident    || |                            |             |      ||  
Sbjct MPNLHSHAFQRAMaglaevagnpndsfwtwreLMYRMVARLSpEQIEVIACQLYIEMLKA  110
DSSP  EEEEEELHHHHHHlllllllllllllhhhhhhHHHHHHLLLLhHHHHHHHHHHHHHHHHH


DSSP  LEEEEEELLL---------------lLHHHHHHHHlllLLLLEEEELLlEEELLLL---l
Query GFTTVRDAGG---------------aGYPFKQAVEsglVEGPRLFVSGrALSQTGG---h  140
ident | | |                           |       |  |      |    |    
Sbjct GYTAVAEFHYvhhdldgrsyadpaelSLRISRAAS---AAGIGLTLLP-VLYSHAGfggq  166
DSSP  LEEEEEEEELllllllllllllllhhHHHHHHHHH---HHLLEEEEEE-LLLLEEEllle


DSSP  lLLLLlllllllllllllllllllleEELLlhhhHHHHHHHHHHHL--------lLLEEE
Query aDPRArsdymppdspcgccvrvgalgRVADgvdeVRRAVREELQMG--------aDQIXI  192
ident                                                             
Sbjct pASEG------------------qrrFING----SEAYLELLQRLRapleaaghsLGLCF  204
DSSP  eLLHH------------------hllLLLL----HHHHHHHHHHHHhhhhhhlleELEEE


DSSP  ELLLllllllllllllLLLHHHHHHHHHHhHLLLLLEEEEEL-------------lhHHH
Query MASGgvasptdpvgvfGYSEDEIRAIVAEaQGRGTYVLAHAY-------------tpAAI  239
ident                       |    |        |  |                    
Sbjct HSLR------------AVTPQQIATVLAA-GHDDLPVHIHIAeqqkevddcqawsgrRPL  251
DSSP  LLLL------------LLLHHHHHHHHLL-LLLLLLEEEEELllhhhhhhhhhhhllLHH


DSSP  HHHH-HLLL---LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhh
Query ARAV-RCGV---RTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesi  295
ident         |       |    |       |  ||     | |   |              
Sbjct QWLYeNVAVdqrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLG-------------  298
DSSP  HHHHhHLLLlllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------


DSSP  llhhhhHLLHhhHHHHHHHHLLLLLLLLLLLhhhHHHLL-HHHHHHHLL-----------
Query akiadvHGAGlhSIEIMKRAGVKMGFGTDLLgeaQRLQS-DEFRILAEV-----------  343
ident        |            |   | | |       |    | | |              
Sbjct ------DGIF--PATDFLAQGGRLGIGSDSH---VSLSVvEELRWLEYGqrlrdrkrnrl  347
DSSP  ------LLLL--LHHHHHHLLLEEEELLLLL---LLLLHhHHHHHHHHHhhhhhllllll


DSSP  ------lLHHHHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELL------------LL
Query ------lSPAEVIASATIVSAEVLGMqdKLGRIVPGAHADVLVVDG------------NP  385
ident                |    |  ||     |    |  || || ||              
Sbjct yrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGndpylasaegdaLL  405
DSSP  lllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLllhhhhllllhhHH


DSSP  LLLLLLLLllLLLLLEEEELLEEEEEL-------------------ll
Query LKSVDCLLgqGEHIPLVMKDGRLFVNE-------------------le  414
ident                 ||  ||  |                       
Sbjct NRWLFAGG--DRQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
DSSP  HHHHHHLL--HHHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl


No 18: Query=3mkvA Sbjct=1yrrB Z-score=25.0

back to top
DSSP  lleEEEEEEEELLLLLllLEEEEEEEEELLEEEEEEL-LLLLlLLLEEEELLLLEEEELE
Query lttFLFRNGALLDPDHpdLLQGFEILIEDGFIREVSD-KPIKsSNAHVIDVKGKTIMPGL   59
ident         |          |      | || |  |                 |    || 
Sbjct ---YALTQGRIFTGHE--FLDDHAVVIADGLIKSVCPvAELP-PEIEQRSLNGAILSPGF   54
DSSP  ---LEEELLEEELLLL--EELLEEEEEELLEEEEEEEhHHLL-LLLLEEELLLLEEEELE


DSSP  EEEEELL----LLLLllhhhhllllHHHH-HHHH-HHHHHHHHHLLEEEEEELLL-----
Query IDLHVHV----VAIEfnlprvatlpNVLV-TLRA-VPIMRAMLRRGFTTVRDAGG-----  108
ident ||                                      |    | |            
Sbjct IDVQLNGcggvQFND----------TAEAvSVETlEIMQKANEKSGCTNYLPTLIttsde  104
DSSP  EEEEELEelleELLL----------LLLLlLHHHhHHHHHHHHLLLEEEEEEEELlllhh


DSSP  -------lLHHHHHHHHlllllllEEEELLLEEELlllllllllllllllllllllllll
Query -------aGYPFKQAVEsglvegpRLFVSGRALSQtgghadprarsdymppdspcgccvr  161
ident                                                             
Sbjct lmkqgvrvMREYLAKHP------nQALGLHLEGPW-------------------------  133
DSSP  hhhhhhhhHHHHHHHLL------lLLLLEEEELLL-------------------------


DSSP  lllleeelllhHHHHHHHHHHHhhLLLLEEEELLllllllllllllLLLLHHHHHHHHHH
Query vgalgrvadgvDEVRRAVREELqmGADQIXIMASggvasptdpvgvFGYSEDEIRAIVAE  221
ident                    |            |                    |      
Sbjct ---------lnAALVDFLCENA--DVITKVTLAP------------EMVPAEVISKLANA  170
DSSP  ---------llLHHHHHHHHLH--HHEEEEEELH------------HHLLHHHHHHHHHH


DSSP  HhlllLLEEEEE--lLHHHHHHHHHLLLLEEEELL----------lllhHHHHHHHhhLL
Query AqgrgTYVLAHA--yTPAAIARAVRCGVRTIEHGN----------liddETARLVAehGA  269
ident        | |     |        | |     |                      |    
Sbjct G----IVVSAGHsnaTLKEAKAGFRAGITFATHLYnampyitgrepglaGAILDEA--DI  224
DSSP  L----LEEEELLlllLHHHHHHHHHHLEEEELLLLlllllllllllhhhHHHHHLL--LL


DSSP  EEELLHHHHHhhhhhlllllllhhhhllhhhhhlLHHHHHHHHHHHLL-LLLLLLLLLhh
Query YVVPTLVTYDalasegekyglppesiakiadvhgAGLHSIEIMKRAGV-KMGFGTDLLge  328
ident |                                      |   ||    |    ||    
Sbjct YCGIIADGLH------------------------VDYANIRNAKRLKGdKLCLVTDAT-s  259
DSSP  EEEEELLLLL------------------------LLHHHHHHHHHHHHhHEEEELLLL-l


DSSP  HHHHLL-HHHHHHH--LLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLL
Query AQRLQS-DEFRILA--EVLSPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGNP  385
ident    |      | |         ||   ||   |   |    ||    |  |         
Sbjct GSSLTMiEGVRNLVehCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDF  319
DSSP  LLLLLHhHHHHHHHhhHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLL


DSSP  llllllllllllLLLEEEELLEEEEELll
Query lksvdcllgqgeHIPLVMKDGRLFVNEle  414
ident              |      |   |    
Sbjct ------------KITKTIVNGNEVVTQ--  334
DSSP  ------------LEEEEEELLEEEEEL--


No 19: Query=3mkvA Sbjct=2ogjA Z-score=24.6

back to top
DSSP  LLEEEEEEEEELLLLLLLLEEEEEEEEE-LLEEEEEELlLLLLLLLEEEELLlLEEEELE
Query LTTFLFRNGALLDPDHPDLLQGFEILIE-DGFIREVSDkPIKSSNAHVIDVKgKTIMPGL   59
ident     |  |                |||  || |  |                   | || 
Sbjct QAPILLTNVKPVGFGKGASQSSTDILIGgDGKIAAVGS-ALQAPADTQRIDA-AFISPGW   58
DSSP  LLLEEEEEEEELLLLLLLLLLLEEEEELlLLLEEEEEL-LLLLLLLEEELLL-LEEEELE


DSSP  EEEEELLLLllllhhhhllllhhhHHHHhhhHHHH-HHHLLEEEEEELLLL-------LH
Query IDLHVHVVAiefnlprvatlpnvlVTLRavpIMRA-MLRRGFTTVRDAGGA-------GY  111
ident  |||||                                 || ||  ||| |         
Sbjct VDLHVHIWH---------------GGTDisiRPSEcGAERGVTTLVDAGSAgeanfhgFR  103
DSSP  EEEEELLLL---------------LLLLlllLHHHlLHHHLEEEEEEELLLllllhhhHH


DSSP  HH-HHHHhlllllLLEEEELlLEEE-lllllLLLLllllllllllllllllllllleeEL
Query PF-KQAVesglveGPRLFVSgRALS-qtgghADPRarsdymppdspcgccvrvgalgrVA  169
ident                |       |                                    
Sbjct EYiIEPS------RERIKAF-LNLGsiglvaCNRV----------------------pEL  134
DSSP  HHlLLLL------LLEEEEE-EELLllllllLLLL----------------------lLL


DSSP  LLHHHHHH-HHHHHHHHL---LLLEEEELLlllllllllllLLLL---LHHHHHHHHHHH
Query DGVDEVRR-AVREELQMG---ADQIXIMASggvasptdpvgVFGY---SEDEIRAIVAEA  222
ident             |            |  ||                             |
Sbjct RDIKDIDLdRILECYAENsehIVGLXVRAS-----------HVITgswGVTPVKLGKKIA  183
DSSP  LLHHHLLHhHHHHHHHLLlllEEEEEEEEL-----------HHHHlllLLHHHHHHHHHH


DSSP  HLLLLLEEEEEL-lhhHHHHHHHLL--lLEEEELL------LLLHH--HHHHHHHH-LLE
Query QGRGTYVLAHAY-tpaAIARAVRCG--vRTIEHGN------LIDDE--TARLVAEH-GAY  270
ident          |                      |         |        |     |  
Sbjct KILKVPXXVHVGeppaLYDEVLEILgpgDVVTHCFngksgsSIXEDedLFNLAERCeGIR  243
DSSP  HHHLLLEEEEELllllLHHHHHHHLlllLEEELLLllllllLLLLLhhHHHHHHHLlLLE


DSSP  EELLhHHHHhhhhhlllllllhhhhllhhhhhllHHHHHHHHH-HHLLLLLLLLLLLHHH
Query VVPTlVTYDalasegekyglppesiakiadvhgaGLHSIEIMK-RAGVKMGFGTDLLGEA  329
ident                                        |    |        ||| |  
Sbjct LDIG-HGGA-----------------------sfSFKVAEAAIaRGLLPFSISTDLHGHS  279
DSSP  EELL-LLLL-----------------------llLHHHHHHHHhLLLLLLLLLLLLLLLL


DSSP  H---HHLL-HHHHHHHLL-LLHHHHHHHLLHHHHHHLLLLLLllLLLLLLLLLEEEELLL
Query Q---RLQS-DEFRILAEV-LSPAEVIASATIVSAEVLGMQDKlgRIVPGAHADVLVVDGN  384
ident               |  |      |    |   | |        |   |  ||  | |  
Sbjct XnfpVWDLaTTXSKLLSVdXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRADFTVFDLV  338
DSSP  LlllLLLHhHHHHHHHHLlLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLLEEEEEEEE


DSSP  -------------llllLLLLllllllLLEEEELLEEEE----elll
Query -------------plksVDCLlgqgehIPLVMKDGRLFV----nele  414
ident                                                
Sbjct dadleatdsngdvsrlkRLFE------PRYAVIGAEAIAasryipra  379
DSSP  eeeeeeellllleeeeeEEEE------EEEEEELLEEEEllllllll


No 20: Query=3mkvA Sbjct=3griA Z-score=23.9

back to top
DSSP  llEEEEEEEEELLllLLLLEEeEEEEEELLEEEEEELlLLLLL-LLEEEELLLLEEEELE
Query ltTFLFRNGALLDpdHPDLLQgFEILIEDGFIREVSDkPIKSS-NAHVIDVKGKTIMPGL   59
ident     |  ||  |      | |   |||    |       |  |     || ||    || 
Sbjct --XKLIKNGKVLQ--NGELQQ-ADILIDGKVIKQIAP-AIEPSnGVDIIDAKGHFVSPGF   54
DSSP  --LEEEELLEEEE--LLEEEE-LEEEEELLEEEEEEL-LLLLLlLLEEEELLLLEEEELE


DSSP  EEEEELLLlllllhhhhllllhhHHHHHHH--HHHHHHHHLLEEEEEELLL---------
Query IDLHVHVVaiefnlprvatlpnvLVTLRAV--PIMRAMLRRGFTTVRDAGG---------  108
ident  | |||                              |  | |||||              
Sbjct VDVHVHLR-------------epGGEYKETieTGTKAAARGGFTTVCPXPNtrpvpdsve  101
DSSP  EEEEELLL-------------llLLLLLLLhhHHHHHHHHLLEEEEEELLLlllllllhh


DSSP  lLHHHHHHHHllLLLLLEEEELlLEEEllllllllllllllllllllllllllllllEEE
Query aGYPFKQAVEsgLVEGPRLFVSgRALSqtgghadprarsdymppdspcgccvrvgalGRV  168
ident                  |                                          
Sbjct hFEALQKLID--DNAQVRVLPY-ASIT-----------------------------tRQL  129
DSSP  hHHHHHHHHH--HHLLLEELLL-EELL-----------------------------hHHL


DSSP  LLlhhHHHHhHHHHHHHLLLLEEEElllllllllllllllLLLHHHHHHHHHHHHLLLLL
Query ADgvdEVRRaVREELQMGADQIXIMasggvasptdpvgvfGYSEDEIRAIVAEAQGRGTY  228
ident      |           ||                                 ||      
Sbjct GK---ELVD-FPALVKEGAFAFTDD------------gvgVQTASXXYEGXIEAAKVNKA  173
DSSP  LL---LLLL-HHHHHLLLLLLEEEL------------lllLLLHHHHHHHHHHHHHHLLL


DSSP  EEEEEL----------------------------LHHHHHHHHHLL-----LLEEEELLL
Query VLAHAY----------------------------TPAAIARAVRCG-----VRTIEHGNL  255
ident   ||                                  ||| |             |   
Sbjct IVAHCEdnsliyggaxhegkrskelgipgipnicESVQIARDVLLAeaagcHYHVCHVST  233
DSSP  EEELLLlhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHhhhllLEEELLLLL


DSSP  LL-HHHHHHHHH--HLLEEELLHH--------hhhhhHHHLllllllhhhhllhhhHHLL
Query ID-DETARLVAE--HGAYVVPTLV--------tydalASEGekyglppesiakiadVHGA  304
ident        |             |               |                      
Sbjct KEsVRVIRDAKRagIHVTAEVTPHhlllteddipgnnAIYK------------xnpPLRS  281
DSSP  HHhHHHHHHHHHllLLEEEEELHHhhhllhhhlllllHHHL------------lllLLLL


DSSP  --hHHHHHHHHHHLLLLLLLLLLLH---------------HHHHhLLHHHHHH-HLLL--
Query --gLHSIEIMKRAGVKMGFGTDLLG---------------EAQRlQSDEFRIL-AEVL--  344
ident              |      ||                           |  |       
Sbjct tedREALLEGLLDGTIDCIATDHAPhardekaqpxekapfGIVG-SETAFPLLyTHFVkn  340
DSSP  hhhHHHHHHHHHLLLLLEELLLLLLllhhhhlllllllllLLLL-LLLHHHHHhHHHLll


DSSP  ---LHHHHHHHLLHHHHHHLLLLllLLLLLLLLLLLEEEELLL-----------------
Query ---SPAEVIASATIVSAEVLGMQdkLGRIVPGAHADVLVVDGN-----------------  384
ident             ||   |        |       ||    |                   
Sbjct gdwTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDseqeikgedflskadnt  398
DSSP  lllLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLlleellhhhllllllll


DSSP  --llllLLLLllllllLLEEEELLEEEEELll
Query --plksVDCLlgqgehIPLVMKDGRLFVNEle  414
ident       |           |    |        
Sbjct pfigykVYGN------PILTXVEGEVKFEG--  422
DSSP  llllleELLE------EEEEEELLEEEEEL--


No 21: Query=3mkvA Sbjct=1gkpA Z-score=23.6

back to top
DSSP  llEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEELlLLLLL-LLEEEELLLLEEEELE
Query ltTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSDkPIKSS-NAHVIDVKGKTIMPGL   59
ident     |  ||     |         |  |   |               |||  ||   || 
Sbjct --PLLIKNGEIITAD--SRYK-ADIYAEGETITRIGQ-NLEAPpGTEVIDATGKYVFPGF   54
DSSP  --LEEEELLEEEELL--EEEE-LEEEELLLLLLEEEL-LLLLLlLLEEEELLLLEEEELE


DSSP  EEEEELLLLllllhhhHLLLlhhhHHHHHH-HHHHHHHHLLEEEEEELLL----------
Query IDLHVHVVAiefnlprVATLpnvlVTLRAV-PIMRAMLRRGFTTVRDAGG----------  108
ident || |||                             | |  | ||                
Sbjct IDPHVHIYL------pFMAT----FAKDTHeTGSKAALMGGTTTYIEMCCpsrnddaleg  104
DSSP  EEEEELLLL------eELLE----ELLLLHhHHHHHHHHLLEEEEEEEELllllllhhhh


DSSP  --lLHHHHHHhhlllLLLLEEEELlLEEELllllllllllllllllllllllllllllle
Query --aGYPFKQAvesglVEGPRLFVSgRALSQtgghadprarsdymppdspcgccvrvgalg  166
ident                           | |                               
Sbjct yqlWKSKAEG-----NSYCDYTFH-MAVSK------------------------------  128
DSSP  hhhHHHHHLL-----LLLLEEEEE-EELLL------------------------------


DSSP  eellLHHHHHHHHHHHHHHLLLLEEEELLLllllllllllllLLLHHHHHHHHHHHHLLL
Query rvadGVDEVRRAVREELQMGADQIXIMASGgvasptdpvgvfGYSEDEIRAIVAEAQGRG  226
ident              ||    |    ||  |             |    |       |   |
Sbjct ----FDEKTEGQLREIVADGISSFXIFLSY--------knffGVDDGEMYQTLRLAKELG  176
DSSP  ----LLLLHHHHHHHHHHLLLLEEEEEELL--------llllLLLHHHHHHHHHHHHHHL


DSSP  LLEEEEEL-------------------------------LHHHHHHHHHLL-----LLEE
Query TYVLAHAY-------------------------------TPAAIARAVRCG-----VRTI  250
ident   | ||                                      ||              
Sbjct VIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGTARFATFLettgaTGYV  236
DSSP  LEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHHHHhhhllEEEE


DSSP  EELLL--LLHHHHHHHH-HHLLEEELLHHHHHHHHHHL----LLLLLlhhhhlLHHHhHL
Query EHGNL--IDDETARLVA-EHGAYVVPTLVTYDALASEG----EKYGLppesiaKIADvHG  303
ident  |       |      |     |                                 |   
Sbjct VHLSCkpALDAAMAAKArGVPIYIESVIPHFLLDKTYAerggVEAMK-yimspPLRD-KR  294
DSSP  LLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLHHHHhllhHHHHL-lllllLLLL-LH


DSSP  LHHHHHHHHHHhLLLLLLLLLLL-------------------HHHH-HHLL-HHHHHHH-
Query AGLHSIEIMKRaGVKMGFGTDLL-------------------GEAQ-RLQS-DEFRILA-  341
ident             |     |||                     |                 
Sbjct NQKVLWDALAQ-GFIDTVGTDHCpfdteqkllgkeaftaipnGIPAiEDRVnLLYTYGVs  353
DSSP  HHHHHHHHHHL-LLLLEEELLLLlllhhhhhhhlllhhhlllLLLLlLLHHhHHHHHHLl


DSSP  -LLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL----------------
Query -EVLSPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGN----------------  384
ident    |        |    |   |     | |  |  ||  | |                  
Sbjct rGRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQyrgtisvktqhvnndy  413
DSSP  lLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLlleellhhhlllllll


DSSP  ---llllLLLLllllllLLEEEELLEEEEEL------------------ll
Query ---plksVDCLlgqgehIPLVMKDGRLFVNE------------------le  414
ident         |           |   |   |                      
Sbjct ngfegfeIDGR------PSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
DSSP  lllllleELLE------EEEEEELLEEEEELleelllllllllllllllll


No 22: Query=3mkvA Sbjct=3e74A Z-score=22.6

back to top
DSSP  LLEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEELlLLLLlLLEEEELLLLEEEELEE
Query LTTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSDkPIKSsNAHVIDVKGKTIMPGLI   60
ident        ||               |    | |              | |  |    ||  
Sbjct SFDLIIKNGTVILEN--EARV-VDIAVKGGKIAAIGQ-DLGD-AKEVXDASGLVVSPGXV   55
DSSP  LEEEEEELLEEELLL--LEEE-LEEEEELLEEEEEEL-LLLL-EEEEEELLLLEEEELEE


DSSP  EEEELLllllllhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELLL----------lL
Query DLHVHVvaiefnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG----------aG  110
ident | | |                           ||    | ||                  
Sbjct DAHTHI--------------------GYETGTRAAAKGGITTXIEXPLnqlpatvdrasI   95
DSSP  EEEELL--------------------LHHHHHHHHHHLLEEEEEELLLllllllllhhhH


DSSP  HHHHHHHhlLLLLLLEEEELLlEEELllllllllllllllllllllllllllllleeell
Query YPFKQAVesGLVEGPRLFVSGrALSQtgghadprarsdymppdspcgccvrvgalgrvad  170
ident      |              |  |                                    
Sbjct ELKFDAA--KGKLTIDAAQLG-GLVS----------------------------------  118
DSSP  HHHHHHH--LLLLLLEEEELE-ELLL----------------------------------


DSSP  lhhHHHHHHHHHHHHLLLLEEEELllllllllllllllLLLHHHHHHHHHHHHLLLLLEE
Query gvdEVRRAVREELQMGADQIXIMAsggvasptdpvgvfGYSEDEIRAIVAEAQGRGTYVL  230
ident           |    |    |                                  |  ||
Sbjct ---YNIDRLHELDEVGVVGFXCFV-------------rDVNDWQFFKGAQKLGELGQPVL  162
DSSP  ---LLLLLHHHHHHHLLLLEEEEL-------------lLLLHHHHHHHHHHHHHHLLLEE


DSSP  EEEL-------------------------------LHHHHHHHHHLL-----LLEEEELL
Query AHAY-------------------------------TPAAIARAVRCG-----VRTIEHGN  254
ident  |                                    || |               |  
Sbjct VHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAkvagcRLHVCHVS  222
DSSP  EELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHhhhllLEEELLLL


DSSP  LLLhhHHHHHHHHL-----LEEELLHH------hhhhhHHHLllllllhhhhllhhHHHL
Query LIDdeTARLVAEHG-----AYVVPTLV------tydalASEGekyglppesiakiaDVHG  303
ident          |                                                  
Sbjct SPE--GVEEVTRARqegqdITCESCPHyfvldtdqfeeIGTL---------akcspPIRD  271
DSSP  LHH--HHHHHHHHHhllllEEEEELLHhhhllhhhhhhHLHH---------hllllLLLL


DSSP  --LHHHHHHHHHHhLLLLLLLLLLLHH--------------HHHHLL----HHHHHHH-L
Query --AGLHSIEIMKRaGVKMGFGTDLLGE--------------AQRLQS----DEFRILA-E  342
ident         |     |       |                              |      
Sbjct leNQKGXWEKLFN-GEIDCLVSDHSPCppexkagnixkawgGIAGLQscxdVXFDEAVqK  330
DSSP  hhHHHHHHHHHHL-LLLLEELLLLLLLllllllllllllllLLLLHHhhhhHHHHHHLlL


DSSP  LLLH-HHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL------------------
Query VLSP-AEVIASATIVSAEVLGMQdKLGRIVPGAHADVLVVDG------------------  383
ident                 |   | |   ||| ||  ||                        
Sbjct RGXSlPXFGKLXATNAADIFGLQ-QKGRIAPGKDADFVFIQPnssyvltnddleyrhkvs  389
DSSP  LLLLhHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllleellhhhllllllll


DSSP  -llllLLLLllllllLLLEEEELLEEEEELLL--------------
Query -nplkSVDCllgqgeHIPLVMKDGRLFVNELE--------------  414
ident                 |      |                      
Sbjct pyvgrTIGA------RITKTILRGDVIYDIEQgfpvapkgqfilkh  429
DSSP  lllllEELL------EEEEEEELLEEEEELLLllllllllleelll


No 23: Query=3mkvA Sbjct=4b3zD Z-score=22.5

back to top
DSSP  lLEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEELlLLLLL-LLEEEELLLLEEEELE
Query lTTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSDkPIKSS-NAHVIDVKGKTIMPGL   59
ident     |   |     |    |       ||| |                |   |    || 
Sbjct -DRLLIKGGRIINDD--QSLY-ADVYLEDGLIKQIGE-NLIVPgGVKTIEANGRMVIPGG   55
DSSP  -LEEEEEEEEEELLL--LEEE-EEEEEELLEEEEEEL-LLLLLlLLEEEELLLLEEEELE


DSSP  EEEEELLLLllllhhhhllllhhHHHHHHHHHHHHHHHLLEEEEEELLL-----------
Query IDLHVHVVAiefnlprvatlpnvLVTLRAVPIMRAMLRRGFTTVRDAGG-----------  108
ident ||                               || |  | |   |              
Sbjct IDVNTYLQK--------------TAADDFFQGTRAALVGGTTMIIDHVVpepgsslltsf  101
DSSP  EEEEELLLL--------------LLLLLHHHHHHHHHHLLEEEEEEEELllllllhhhhh


DSSP  -lLHHHHHHhhlllLLLLEEEELlLEEEllllllllllllllllllllllllllllllee
Query -aGYPFKQAvesglVEGPRLFVSgRALSqtgghadprarsdymppdspcgccvrvgalgr  167
ident                                                             
Sbjct ekWHEAADT-----KSCCDYSLH-VDIT--------------------------------  123
DSSP  hhHHHHHHL-----LLLLEEEEE-EELL--------------------------------


DSSP  ELLLhhHHHHHHHHHHH-HLLLLEEEELLLllllllllllllLLLHHHHHHHHHHHHLLL
Query VADGvdEVRRAVREELQ-MGADQIXIMASGgvasptdpvgvfGYSEDEIRAIVAEAQGRG  226
ident        ||       |  |                        |            | |
Sbjct SWYD--GVREELEVLVQdKGVNSFQVYMAY--------kdvyQMSDSQLYEAFTFLKGLG  173
DSSP  LLLL--LHHHHHHHHHHlLLLLEEEEELLL--------llllLLLHHHHHHHHHHHHHHL


DSSP  LLEEEEEL-------------------------------LHHHHHHHHHLL-----LLEE
Query TYVLAHAY-------------------------------TPAAIARAVRCG-----VRTI  250
ident    | ||                                   |  ||            |
Sbjct AVILVHAEngdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAgrincPVYI  233
DSSP  LEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHhhhllLEEE


DSSP  EELLL--LLHHHHHHH-hHHLLEEELLHHH-hHHHHH----hlLLLLLlhhhhllhhHHH
Query EHGNL--IDDETARLV-aEHGAYVVPTLVT-yDALAS----egEKYGLppesiakiaDVH  302
ident          |  |            |                  |               
Sbjct TKVMSksAADIIALARkkGPLVFGEPIAASlgTDGTHywsknwAKAAA----fvtspPLS  289
DSSP  EEELLhhHHHHHHHHHhhLLLEEEEELHHHhhLLLHHhhlllhHHHHH----lllllLLL


DSSP  L---LHHHHHHHHHHhLLLLLLLLLLLHH-----------------hHHHL----LHHHH
Query G---AGLHSIEIMKRaGVKMGFGTDLLGE-----------------aQRLQ----SDEFR  338
ident                 |     |                                     
Sbjct PdptTPDYLTSLLAC-GDLQVTGSGHCPYstaqkavgkdnftlipegVNGIeermTVVWD  348
DSSP  LlllHHHHHHHHHHH-LLLLLLLLLLLLLlhhhhhhhlllhhhllllLLLLllhhHHHHH


DSSP  HHH--LLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL------------
Query ILA--EVLSPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGN------------  384
ident               |      |         |||  |  |||   |              
Sbjct KAVatGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDklktitakshks  408
DSSP  HHLllLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEeeeellllllll


DSSP  -------llllLLLLllllllLLEEEELLEEEEEL-------------------------
Query -------plksVDCLlgqgehIPLVMKDGRLFVNE-------------------------  412
ident                         |   |                               
Sbjct aveynifegmeCHGS------PLVVISQGKIVFEDgninvnkgmgrfiprkafpehlyqr  462
DSSP  lllllllllleEEEE------EEEEEELLEEEEELleellllllllllllllllhhhhhh


DSSP  -------------ll
Query -------------le  414
ident                
Sbjct vkirnkvfglqgvsr  477
DSSP  hhhhhhhllllllll


No 24: Query=3mkvA Sbjct=2imrA Z-score=20.3

back to top
DSSP  lleeeEEEEE--eLLLLLLLLEeeEEEEeelleeEEEEL--------lLLLLllleeeel
Query lttflFRNGA--lLDPDHPDLLqgFEILiedgfiREVSD--------kPIKSsnahvidv   50
ident                                     |                       
Sbjct --htpRLLTCdvlYTGAQSPGG--VVVV-----gETVAAaghpdelrrQYPH-----aae   46
DSSP  --lleEEEEEleeELLEELLEE--EEEE-----lLEEEEeelhhhhhhHLLL-----lee


DSSP  LLLE--EEELEEEEEELLLL------------------lLLLHhhhllllhhhHHHHHHH
Query KGKT--IMPGLIDLHVHVVA------------------iEFNLprvatlpnvlVTLRAVP   90
ident       | |     | |                                        |  
Sbjct ERAGavIAPPPVNAHTHLDMsayefqalpyfqwipevviRGRH--------lrGVAAAQA   98
DSSP  EELLleELLLLLEEEEELLLlhhhhhhlhhhhllhhhhhHHLL--------llHHHHHHH


DSSP  HHHHHHHLLEEEEEELLL---LLHHHHHHHhlllllLLEEEELlLEEELLLlllllllll
Query IMRAMLRRGFTTVRDAGG---AGYPFKQAVesglveGPRLFVSgRALSQTGghadprars  147
ident       | |   | |                                             
Sbjct GADTLTRLGAGGVGDIVWapeVMDALLARE------DLSGTLY-FEVLNPF---------  142
DSSP  HHHHHHHLLLLLEEEEELlhhHHHHHHLLL------LLLEEEE-EEELLLL---------


DSSP  lllllllllllllllllleeellLHHHHHHHHHHHHHHL--------lLLEEEELLLlll
Query dymppdspcgccvrvgalgrvadGVDEVRRAVREELQMG--------aDQIXIMASGgva  199
ident                          |||  | |  |                        
Sbjct ---------------------pdKADEVFAAARTHLERWrrlerpglrLGLSPHTPF---  178
DSSP  ---------------------hhHHHHHHHHHHHHHHHHhlllllleeEEEEELLLL---


DSSP  lllllllllLLLHHHHHHHHHHHHLLLLLEEEEEL-------------------------
Query sptdpvgvfGYSEDEIRAIVAEAQGRGTYVLAHAY-------------------------  234
ident            |    |     | | |     |                           
Sbjct ---------TVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpaly  229
DSSP  ---------LLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhl


DSSP  --------------lhHHHHHHH-HLLL---LEEEELLLLLHHHHHHHHHHLLEEELLHH
Query --------------tpAAIARAV-RCGV---RTIEHGNLIDDETARLVAEHGAYVVPTLV  276
ident                                 |  |           ||  |  ||    
Sbjct phtlaevigrepgpdlTPVRYLDeLGVLaarPTLVHMVNVTPDDIARVARAGCAVVTCPR  289
DSSP  lllhhhhhllllllllLHHHHHHhHLLHhhlLEEEELLLLLHHHHHHHHHHLLLEEELHH


DSSP  HHHHHHhhlllllllhhhhllhhhhHLLHhhHHHHHHHHLLLLLLLLLLLHhHHHHLL--
Query TYDALAsegekyglppesiakiadvHGAGlhSIEIMKRAGVKMGFGTDLLGeAQRLQS--  334
ident     |                     |           |||    |||            
Sbjct SNHHLE-------------------CGTF--DWPAFAAAGVEVALGTDSVA-SGETLNvr  327
DSSP  HHHHLL-------------------LLLL--LHHHHHHLLLLEEELLLLHH-HHLLLLlh


DSSP  HHHHHHHLL---LLHHHHHHHLLHHHHHHLLlllllLLLLL--lllllEEEELLllllll
Query DEFRILAEV---LSPAEVIASATIVSAEVLGmqdklGRIVP--gahadVLVVDGnplksv  389
ident  |          | |      |      | |                             
Sbjct EEVTFARQLypgLDPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRWEL------  376
DSSP  HHHHHHHHHlllLLHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLHHH------


DSSP  llllLLLLllleeeelleeeeelll
Query dcllGQGEhiplvmkdgrlfvnele  414
ident                          
Sbjct ----SRDL-----------------  380
DSSP  ----LLLL-----------------


No 25: Query=3mkvA Sbjct=2ob3A Z-score=19.1

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                          |  
Sbjct ------------------------------------------drintvrgpitiseaGFT   18
DSSP  ------------------------------------------lleeelleeelhhhhLLE


DSSP  EEEELLLLllllHHHHLL------LLHHHHHHHHHHHHHHHHHLLEEEEEELLL----LL
Query DLHVHVVAiefnLPRVAT------LPNVLVTLRAVPIMRAMLRRGFTTVRDAGG----AG  110
ident   | |                            ||   |     |  |  |         
Sbjct LTHEHICG---sSAGFLRawpeffGSRKALAEKAVRGLRRARAAGVRTIVDVSTfdigRD   75
DSSP  EEEELLEE---lLLLHHHhlhhhhLLHHHHHHHHHHHHHHHHHLLLLEEEELLLhhhlLL


DSSP  HHHHHHHHllLLLLLEEEELlLEEEllllLLLLlllllllllllllllllllllleeelL
Query YPFKQAVEsgLVEGPRLFVSgRALSqtggHADPrarsdymppdspcgccvrvgalgrvaD  170
ident       |                |        |                           
Sbjct VSLLAEVS--RAADVHIVAA-TGLW----FDPP---------------------lsmrlR  107
DSSP  HHHHHHHH--HHHLLEEELE-EELL----LLLL---------------------hhhhlL


DSSP  LHHHHHHHHHHHHH-------HLLLLEEEELLlllllllllllLLLL--LHHHHHHHHHH
Query GVDEVRRAVREELQ-------MGADQIXIMASggvasptdpvgVFGY--SEDEIRAIVAE  221
ident  | |       | |         |  ||                      |    |    
Sbjct SVEELTQFFLREIQygiedtgIRAGIIXVATT-----------GKATpfQELVLKAAARA  156
DSSP  LHHHHHHHHHHHHHlllllllLLLLEEEEELL-----------LLLLhhHHHHHHHHHHH


DSSP  HHLLLLLEEEEE-LLHHHHHHHHHLL--------lLEEEELL-LLLHHHHHHHHHHLLEE
Query AQGRGTYVLAHA-YTPAAIARAVRCG--------vRTIEHGN-LIDDETARLVAEHGAYV  271
ident     |  |  |                          | |     |       |  |   
Sbjct SLATGVPVTTHTaASQRDGEQQAAIFeseglspsrVCIGHSDdTDDLSYLTALAARGYLI  216
DSSP  HHHHLLLEEEELlHHHLHHHHHHHHHhhllllhhhEEELLHHhLLLHHHHHHHHHLLLEE


DSSP  ELLHHHHHhhHHHLLllllLHHHHLLHHHHHL-LHHHHHHHHHHHLL--LLLLLLLLLH-
Query VPTLVTYDalASEGEkyglPPESIAKIADVHG-AGLHSIEIMKRAGV--KMGFGTDLLG-  327
ident       |   |   |         |             |      |         |    
Sbjct GLDHIPYS--AIGLE---dNASASALLGIRSWqTRALLIKALIDQGYmkQILVSNDWTFg  271
DSSP  EELLLLLL--LLLLL---lLHHHHHHHLLLLHhHHHHHHHHHHHLLLhhHEEELLLLLLe


DSSP  --------------hHHHHLLHHH-HHHHLL----LLHHHHHHHLLHHHHHHLLllllll
Query --------------eAQRLQSDEF-RILAEV----LSPAEVIASATIVSAEVLGmqdklg  368
ident                          |                       |  |       
Sbjct fssyvtnimdvmdrvNPDGMAFIPlRVIPFLrekgVPQETLAGITVTNPARFLS------  325
DSSP  ellllllhhhhhhhhLLLHHHHHHhLHHHHHhhllLLHHHHHHHHLHHHHHHHL------


DSSP  llllllllleeeellllllllllllllllllleeeelleeeeelll
Query rivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                               
Sbjct ------------------------------------------ptlr  329
DSSP  ------------------------------------------llll


No 26: Query=3mkvA Sbjct=1a4mA Z-score=18.8

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                             
Sbjct ---------------------------------------------------tpafNKPKV    9
DSSP  ---------------------------------------------------llllLLLEE


DSSP  EEEELLL-LLLL---------------------------------------LHHHHLLL-
Query DLHVHVV-AIEF---------------------------------------NLPRVATL-   79
ident  ||||   ||                                                  
Sbjct ELHVHLDgAIKPetilyfgkkrgialpadtveelrniigmdkplslpgflaKFDYYMPVi   69
DSSP  EEEEEHHhLLLHhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhlLHHHHHHHh


DSSP  --LHHHHHHHHHHHHHHHHHLLEEEEEELLL----------------------------l
Query --PNVLVTLRAVPIMRAMLRRGFTTVRDAGG----------------------------a  109
ident           |          |   |                                  
Sbjct agCREAIKRIAYEFVEMKAKEGVVYVEVRYSphllanskvdpmpwnqtegdvtpddvvdl  129
DSSP  llLHHHHHHHHHHHHHHHHHLLEEEEEEEELlhhhllllllllhhhlllllllhhhhhhh


DSSP  LHHHHHHHHLllLLLLEEEELlLEEELllllllllllllllllllllllllllllleeEL
Query GYPFKQAVESglVEGPRLFVSgRALSQtgghadprarsdymppdspcgccvrvgalgrVA  169
ident      |  |     |                                             
Sbjct VNQGLQEGEQ--AFGIKVRSI-LCCMR-------------------------------HQ  155
DSSP  HHHHHHHHHH--HHLLEEEEE-EEEEL-------------------------------LL


DSSP  LLhhHHHHHHHHHHHHL---LLLEEEELLLllllllllLLLLLLLHHHHHHHHHHHHLLL
Query DGvdEVRRAVREELQMG---ADQIXIMASGgvasptdpVGVFGYSEDEIRAIVAEAQGRG  226
ident                                                        |   |
Sbjct PS--WSLEVLELCKKYNqktVVAMDLAGDE--------TIEGSSLFPGHVEAYEGAVKNG  205
DSSP  HH--HHHHHHHHHHHLLlllEEEEEEELLL--------LLLLHHHLHHHHHHHHHHHHHL


DSSP  LLEEEEEL---LHHHHHHHHHL-LLLEEEELLLLL--HHHHHHHHHHLLEEELLHHHHHH
Query TYVLAHAY---TPAAIARAVRC-GVRTIEHGNLID--DETARLVAEHGAYVVPTLVTYDA  280
ident      ||     |     ||         ||                             
Sbjct IHRTVHAGevgSPEVVREAVDIlKTERVGHGYHTIedEALYNRLLKENMHFEVCPWSSYL  265
DSSP  LEEEEEELlllLHHHHHHHHHLlLLLEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHHH


DSSP  HhhhlllllllhhhhllhhHHHL-lhHHHHHHHHHHLLLLLLLLLLLHHHHHHLLHHHHH
Query LasegekyglppesiakiaDVHG-agLHSIEIMKRAGVKMGFGTDLLGEAQRLQSDEFRI  339
ident                            |     |         ||               
Sbjct T------------------GAWDpktTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQM  307
DSSP  L------------------LLLLlllLLHHHHHHHLLLLEEELLLLLLLLLLLHHHHHHH


DSSP  HH--LLLLHHHHHHHLlHHHHHHLLL----LLLLL--LLLLllllleeeellllllllll
Query LA--EVLSPAEVIASAtIVSAEVLGM----QDKLG--RIVPgahadvlvvdgnplksvdc  391
ident           |      |  |            |                          
Sbjct TKkdMGFTEEEFKRLN-INAAKSSFLpeeeKKELLerLYRE-------------------  347
DSSP  HHhlLLLLHHHHHHHH-HHHHHLLLLlhhhHHHHHhhHHHH-------------------


DSSP  llllllllleeeelleeeeelll
Query llgqgehiplvmkdgrlfvnele  414
ident                        
Sbjct ---------------------yq  349
DSSP  ---------------------ll


No 27: Query=3mkvA Sbjct=1bf6A Z-score=18.5

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
ident                                                          |  
Sbjct ----------------------------------------------------sfdpTGYT    8
DSSP  ----------------------------------------------------llllLLEE


DSSP  EEEELLLLlllLHHHHLLLL--hhhHHHHHHHHHHHHHHLLEEEEEELLL----LLHHHH
Query DLHVHVVAiefNLPRVATLP--nvlVTLRAVPIMRAMLRRGFTTVRDAGG----AGYPFK  114
ident   | |       |                    |     ||   |             | 
Sbjct LAHEHLHI---DLSGFKNNVdcrldQYAFICQEMNDLMTRGVRNVIEMTNrymgRNAQFM   65
DSSP  EEEELLLE---ELHHHHLLHhheelLHHHHHHHHHHHHHLLEEEEEELLLhhhlLLHHHH


DSSP  HHHHllLLLLLEEEELlLEEELLLllLLLLllllllllllllllllllllleeelLLHHH
Query QAVEsgLVEGPRLFVSgRALSQTGghADPRarsdymppdspcgccvrvgalgrvaDGVDE  174
ident   |      |           |      |                            | |
Sbjct LDVM--RETGINVVAC-TGYYQDA--FFPE---------------------hvatRSVQE   99
DSSP  HHHH--HHHLLEEEEE-ELLLLHH--HLLL---------------------hhhhLLHHH


DSSP  HHHHHHHHHHH-------LLLLEEEELLLllllllllLLLL-lLLHHHHHHHHHHHHLLL
Query VRRAVREELQM-------GADQIXIMASGgvasptdpVGVF-gYSEDEIRAIVAEAQGRG  226
ident        |           |  |               |      |    |        |
Sbjct LAQEMVDEIEQgidgtelKAGIIAEIGTS--------EGKItpLEEKVFIAAALAHNQTG  151
DSSP  HHHHHHHHHHLlllllllLEEEEEEEELL--------LLLLlhHHHHHHHHHHHHHHHHL


DSSP  LLEEEEELLHHHHHHHHHLL--------lLEEEELL-LLLHHHHHHHHHHLLEEELLHHH
Query TYVLAHAYTPAAIARAVRCG--------vRTIEHGN-LIDDETARLVAEHGAYVVPTLVT  277
ident      |                        |  |                ||||      
Sbjct RPISTHTSFSTMGLEQLALLqahgvdlsrVTVGHCDlKDNLDNILKMIDLGAYVQFDTIG  211
DSSP  LLEEEELHHHLLHHHHHHHHhhllllhhhEEELLLLlLLLHHHHHHHHHLLLEEEELLLL


DSSP  HHhhhhhlllllllhhhhllhHHHH-LLHHHHHHHHH-HHLL-LLLLLLLLLH-------
Query YDalasegekyglppesiakiADVH-GAGLHSIEIMK-RAGV-KMGFGTDLLG-------  327
ident                                       |          |          
Sbjct KN-------------------SYYPdEKRIAMLHALRdRGLLnRVMLSMDITRrshlkan  252
DSSP  LL-------------------LLLLhHHHHHHHHHHHhLLLHhHEEELLLLLLhhhlhhh


DSSP  -HHHH-HLLH-HHHHHH-LLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeell
Query -EAQR-LQSD-EFRILA-EVLSPAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdg  383
ident                |     | | |                                  
Sbjct gGYGYdYLLTtFIPQLRqSGFSQADVDVMLRENPSQFFQ---------------------  291
DSSP  lLLLLlHHHHlHHHHHHhLLLLHHHHHHHHLHHHHHHLL---------------------


DSSP  llllllllllllllllleeeelleeeeelll
Query nplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                
Sbjct -------------------------------  291
DSSP  -------------------------------


No 28: Query=3mkvA Sbjct=3k2gB Z-score=18.4

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                          |  
Sbjct ------------------------------slselspchvrsgrixtvdgpipssalGHT   30
DSSP  ------------------------------llllllllllllleeeelleeeehhhlLLE


DSSP  EEEELLLL-------------------------------------lLLLHhhhllllhhh
Query DLHVHVVA-------------------------------------iEFNLprvatlpnvl   83
ident   | |                                                       
Sbjct LXHEHLQNdcrcwwnppqeperqylaeapisieilselrqdpfvnkHNIA--------ld   82
DSSP  ELLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllLLLE--------el


DSSP  HHHHHHHHHHHHHHLLEEEEEELL----LLLHHHHHHHHllLLLLLEEEELlLEEELLLl
Query VTLRAVPIMRAMLRRGFTTVRDAG----GAGYPFKQAVEsgLVEGPRLFVSgRALSQTGg  139
ident     |          |     |      |               |               
Sbjct DLDLAIAEVKQFAAVGGRSIVDPTcrgiGRDPVKLRRIS--AETGVQVVXG-AGYYLAS-  138
DSSP  LHHHHHHHHHHHHHLLLLEEEELLllllLLLHHHHHHHH--HHHLLEEEEL-LLLLLHH-


DSSP  lLLLLllllllllllllllllllllleeelLLHHHHHHHHHHHHH-------HLLLLEE-
Query hADPRarsdymppdspcgccvrvgalgrvaDGVDEVRRAVREELQ-------MGADQIX-  191
ident    |                             |        |              |  
Sbjct -SXPE---------------------taarLSADDIADEIVAEALegtdgtdARIGLIGe  176
DSSP  -HLLH---------------------hhhlLLHHHHHHHHHHHHHlllllllLLLLLEEe


DSSP  EELLllllllllllLLLL-LLHHHHHHHHHHHHLLLLLEEEEE-LLHHHHHHHHHLL---
Query IMASggvasptdpvGVFG-YSEDEIRAIVAEAQGRGTYVLAHA-YTPAAIARAVRCG---  246
ident |  |            |    |   |         |     |         |        
Sbjct IGVS----------SDFTaEEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHRVLDLVeee  226
DSSP  ELLL----------LLLLhHHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHHHHHHHhhl


DSSP  -----lLEEEELLLL--LHHHHHHHHHHLLEEELLHHHHHHhhhhlllllllhhHHLLHH
Query -----vRTIEHGNLI--DDETARLVAEHGAYVVPTLVTYDAlasegekyglppeSIAKIA  299
ident           | |    |       |  ||         |                    
Sbjct gadlrhTVLCHXNPShxDPVYQATLAQRGAFLEFDXIGXDF------------fYADQGV  274
DSSP  lllhhhEEELLLHHHllLHHHHHHHHHHLLEEEELLLLLLL------------eELLLLE


DSSP  HHHL--LHHHHHHHHHHHLL--LLLLLLLLL-HHHH-----HHLLHHH-HHHHLL----L
Query DVHG--AGLHSIEIMKRAGV--KMGFGTDLL-GEAQ-----RLQSDEF-RILAEV----L  344
ident            |      |         |                      |       |
Sbjct QCPSddEVARAILGLADHGYldRILLSHDVFvKXXLtryggNGYAFVTkHFLPRLrrhgL  334
DSSP  ELLLhhHHHHHHHHHHHLLLhhHEEELLLLLlHHHLhhhllLLLLHHHhLHHHHHhhllL


DSSP  LHHHHHHHLLHHHHHHLLLLLlllllllllllleeeellllllllllllllllllleeee
Query SPAEVIASATIVSAEVLGMQDklgrivpgahadvlvvdgnplksvdcllgqgehiplvmk  404
ident   |            |                                            
Sbjct DDAALETLXVTNPRRVFDASI---------------------------------------  355
DSSP  LHHHHHHHHLHHHHHHHLLLL---------------------------------------


DSSP  lleeeeelll
Query dgrlfvnele  414
ident           
Sbjct -------egh  358
DSSP  -------lll


No 29: Query=3mkvA Sbjct=1a5kC Z-score=18.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---llEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEEL---------LLLLLL-LLEE
Query ---ltTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSD---------KPIKSS-NAHV   47
ident           |    |           |   || |                |       |
Sbjct aadcvDLVLTNALIVDHW--GIVK-ADIGVKDGRIFAIGKagnpdiqpnVTIPIGaATEV  117
DSSP  hhhllLEEEEEEEEEELL--EEEE-EEEEEELLEEEEEELeelllllllLLEELLlLLEE


DSSP  EELLLLEEEELEEEEEELLLlllllhhhhllllhhhhhhhHHHHHHHHHHLLEEEEEeLL
Query IDVKGKTIMPGLIDLHVHVVaiefnlprvatlpnvlvtlrAVPIMRAMLRRGFTTVRdAG  107
ident |   ||    | || | |                              |  | ||    |
Sbjct IAAEGKIVTAGGIDTHIHWI--------------------CPQQAEEALVSGVTTMV-GG  156
DSSP  EELLLLEEEELEEEEEEELL--------------------LLLHHHHHHHHLEEEEE-EE


DSSP  LL-----------------LHHHHHHHHlllLLLLEEEELlLEEElllllllllllllll
Query GA-----------------GYPFKQAVEsglVEGPRLFVSgRALSqtgghadprarsdym  150
ident |                       ||                                  
Sbjct GTgpaagthattctpgpwyISRMLQAAD---SLPVNIGLL-GKGN---------------  197
DSSP  LLlllhhhhhlllllhhhhHHHHHHHHL---LLLLEEEEE-EELL---------------


DSSP  llllllllllllllleeelllhhHHHHHHHHHHHHLLLLEEEELLlllllllllllllLL
Query ppdspcgccvrvgalgrvadgvdEVRRAVREELQMGADQIXIMASggvasptdpvgvfGY  210
ident                            | ||    |     |                | 
Sbjct ----------------------vSQPDALREQVAAGVIGLEIHED------------wGA  223
DSSP  ----------------------lLLHHHHHHHHHHLLLEEEEEHH------------hLL


DSSP  LHHHHHHHHHHHHLLLLLEEEEE------llHHHHHHHHHLLLLEEEELL--------LL
Query SEDEIRAIVAEAQGRGTYVLAHA------ytPAAIARAVRCGVRTIEHGN--------LI  256
ident     |      |      |  |               |         |           |
Sbjct TPAAIDCALTVADEMDIQVALHSdtlnesgfVEDTLAAIGGRTIHTFHTEgaggghapDI  283
DSSP  LHHHHHHHHHHHHHHLLEEEEELllllllllHHHHHHHHLLLLEEELLLLllllllllLH


DSSP  LHhHHHHhhhHLLEEELLHH-------hhhHHHHHLLL-lLLLH---HHHLLHHHHHL--
Query DDeTARLvaeHGAYVVPTLV-------tydALASEGEK-yGLPP---ESIAKIADVHG--  303
ident                  |                       | |   |  |         
Sbjct IT-ACAH---PNILPSSTNPtlpytlntidEHLDMLMVchHLDPdiaEDVAFAESRIRre  339
DSSP  HH-HHHL---LLEEEEEEHHhllllllhhhHHHHHHHHhhLLLLllhHHHHLLLLLLLhh


DSSP  LHHHHHHHHHHhLLLLLLLLLLLHhhhhHLLHHHHHHHLLL-------------------
Query AGLHSIEIMKRaGVKMGFGTDLLGeaqrLQSDEFRILAEVL-------------------  344
ident             |       |                  |                    
Sbjct TIAAEDVLHDL-GAFSLTSSDSQA--mgRVGEVILRTWQVAhrmkvqrgalaeetgdndn  396
DSSP  HHHHHHHHHHL-LLLLEEELLLLL--llLLLLHHHHHHHHHhhhhhhhlllllllllllh


DSSP  -LHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLlllllLLLLllllLLLEEE
Query -SPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGNplksvDCLLgqgeHIPLVM  403
ident       ||  ||  |   |     | |  |  ||  |                     | 
Sbjct fRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPA-----FFGV----KPATVI  447
DSSP  hHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHH-----HLLL----LLLEEE


DSSP  ELLEEEEEL---------------------------------------------------
Query KDGRLFVNE---------------------------------------------------  412
ident | |                                                         
Sbjct KGGMIAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlr  507
DSSP  ELLEEEEEEellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllll


DSSP  ---------------------------------------------------------ll
Query ---------------------------------------------------------le  414
ident                                                            
Sbjct saiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  leeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 30: Query=3mkvA Sbjct=2vc5A Z-score=17.6

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                          |  
Sbjct -----------------------------------------mriplvgkdsieskdiGFT   19
DSSP  -----------------------------------------llllllllllllhhhlLLE


DSSP  EEEELLLLlllLHHHHLL-----LLHHHHHHHHHHHHHHHHHLLEEEEEELLL----LLH
Query DLHVHVVAiefNLPRVAT-----LPNVLVTLRAVPIMRAMLRRGFTTVRDAGG----AGY  111
ident   | |          |                ||         |  |  |          
Sbjct LIHEHLRV---FSEAVRQqwphlYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVmglgRDI   76
DSSP  ELLLLLLL---LLHHHHHhlhhhLLHHHHHHHHHHHHHHHHHLLLLEEEELLLllllLLH


DSSP  HHHHHHHllLLLLLEEEELlLEEE-LLLLlllllllllllllllllllllllllleeell
Query PFKQAVEsgLVEGPRLFVSgRALS-QTGGhadprarsdymppdspcgccvrvgalgrvad  170
ident  |   |      |  |                                            
Sbjct RFMEKVV--KATGINLVAG-TGIYiYIDL------------------------pfyflnr  109
DSSP  HHHHHHH--HLLLLEEEEL-EELLlLLLL------------------------lhhhlll


DSSP  LHHHHHHHHHHHHH-------HLLLLEEEELLllllllllllLLLL--LLHHHHHHHHHH
Query GVDEVRRAVREELQ-------MGADQIXIMASggvasptdpvGVFG--YSEDEIRAIVAE  221
ident   ||                   |   || |                   |  |||    
Sbjct SIDEIADLFIHDIKegiqgtlNKAGFVXIAAD----------EPGItkDVEKVIRAAAIA  159
DSSP  LHHHHHHHHHHHHHlllllllLLLLLEEEELL----------LLLLlhHHHHHHHHHHHH


DSSP  HHLLLLLEEEEELLH-HHHHHHHHLL--------lLEEEELLL-lLHHHHHHHHHHLLEE
Query AQGRGTYVLAHAYTP-AAIARAVRCG--------vRTIEHGNL-iDDETARLVAEHGAYV  271
ident           |            |             | |             |  |   
Sbjct NKETKVPIITHSNAHnNTGLEQQRILteegvdpgkILIGHLGDtdNIDYIKKIADKGSFI  219
DSSP  HHHHLLLEEEELLLLlLHHHHHHHHHhhllllhhhEEELLHHHllLHHHHHHHHHLLLEE


DSSP  ELLHHHHHhhhhhlllllllhhhhllhhHHHL--LHHHHHHHHHHHLL--LLLLLLLLLH
Query VPTLVTYDalasegekyglppesiakiaDVHG--AGLHSIEIMKRAGV--KMGFGTDLLG  327
ident        |                                      |   |     |   
Sbjct GLDRYGLD--------------------LFLPvdKRNETTLRLIKDGYsdKIMISHDYCC  259
DSSP  EELLLLLL--------------------LLLLhhHHHHHHHHHHHLLLllLEEELLLLLL


DSSP  ---------------hhhhHLLHHH-HHHHLL----LLHHHHHHHLLHHHHHHLLlllll
Query ---------------eaqrLQSDEF-RILAEV----LSPAEVIASATIVSAEVLGmqdkl  367
ident                         |                                   
Sbjct tidwgtakpeykpklaprwSITLIFeDTIPFLkrngVNEEVIATIFKENPKKFFS-----  314
DSSP  llllllllhhhhhhhllllLLLHHHhLHHHHHhlllLLHHHHHHHHLHHHHHHLL-----


DSSP  lllllllllleeeellllllllllllllllllleeeelleeeeelll
Query grivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                                
Sbjct -----------------------------------------------  314
DSSP  -----------------------------------------------


No 31: Query=3mkvA Sbjct=2y1hB Z-score=17.4

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                          || 
Sbjct -------------------------------------------------------GVGLV    5
DSSP  -------------------------------------------------------LLLEE


DSSP  EEEELLLLLLllhhhhllllhhhHHHHHHHHHHHHHHLLEEEEEELL------lLLHHHH
Query DLHVHVVAIEfnlprvatlpnvlVTLRAVPIMRAMLRRGFTTVRDAG------gAGYPFK  114
ident | | |  |                                                    
Sbjct DCHCHLSAPD-------------FDRDLDDVLEKAKKANVVALVAVAehsgefeKIMQLS   52
DSSP  EEEELLLLHH-------------HLLLHHHHHHHHHHLLEEEEEELLllhhhhhHHHHHH


DSSP  HHHHlllllllEEEELLlEEELllllLLLLLlllllllllllllllllllleeELLLhHH
Query QAVEsglvegpRLFVSGrALSQtgghADPRArsdymppdspcgccvrvgalgrVADGvDE  174
ident                                                             
Sbjct ERYN------gFVLPCL-GVHP----VQGLD--------------------qrSVTL-KD   80
DSSP  HHLL------lLEEEEE-LLLL----EELLL--------------------leELLH-HH


DSSP  HHHHHHHHHHH--LLLLE-EEELLLllllLLLL--lllllLLHHHHHHHHHHHHLLLLLE
Query VRRAVREELQM--GADQI-XIMASGgvasPTDP--vgvfgYSEDEIRAIVAEAQGRGTYV  229
ident    |             |           |                      |      |
Sbjct LDVALPIIENYkdRLLAIgEVGLDF---sPRFAgtgeqkeEQRQVLIRQIQLAKRLNLPV  137
DSSP  HHHHHHHHHHHllLLLEEeEEEEEL---lLLLLllhhhhhHHHHHHHHHHHHHHHHLLLE


DSSP  EEEELLhhHHHHHHHLL------lLEEEELLlLLHHHHHHHHHHLLEEELLhHHHHHhhh
Query LAHAYTpaAIARAVRCG------vRTIEHGNlIDDETARLVAEHGAYVVPTlVTYDAlas  283
ident   |     |                            |      |               
Sbjct NVHSRS--AGRPTINLLqeqgaekVLLHAFD-GRPSVAMEGVRAGYFFSIP-PSIIR---  190
DSSP  EEEEEL--LHHHHHHHHhhlllllEEEELLL-LLHHHHHHHHHLLLEEEEL-HHHHL---


DSSP  hlllllllhhhhllhhhhHLLHHHHHHHHHhhllLLLLLLLLL-------HHHH-HHLLH
Query egekyglppesiakiadvHGAGLHSIEIMKragvKMGFGTDLL-------GEAQ-RLQSD  335
ident                    |                   ||                 | 
Sbjct ------------------SGQKQKLVKQLP--ltSICLETDSPalgpekqVRNEpWNISI  230
DSSP  ------------------LHHHHHHHHHLL--hhHEEELLLLLlllllllLLLLhHHHHH


DSSP  HHHHHHLLL--LHHHHHHHLLHHHHHHLL-LLLLLlllllllllleeeelllllllllll
Query EFRILAEVL--SPAEVIASATIVSAEVLG-MQDKLgrivpgahadvlvvdgnplksvdcl  392
ident      | |   |  |||   |             |                         
Sbjct SAEYIAQVKgiSVEEVIEVTTQNALKLFPkLRHLL-------------------------  265
DSSP  HHHHHHHHHllLHHHHHHHHHHHHHHHLLlHHHHL-------------------------


DSSP  lllllllleeeelleeeeelll
Query lgqgehiplvmkdgrlfvnele  414
ident                       
Sbjct ----------------------  265
DSSP  ----------------------


No 32: Query=3mkvA Sbjct=1v77A Z-score=16.5

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
ident                                                            |
Sbjct --------------------------------------------------------VKFI    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEELLLlllllhhhhllllhhhhhhhhhhHHHHHHHLlEEEEEELLlllhhhhhhhhll
Query DLHVHVVaiefnlprvatlpnvlvtlravpIMRAMLRRgFTTVRDAGgagypfkqavesg  120
ident                                        |  |                 
Sbjct EMDIRDK----------------------eAYELAKEW-FDEVVVSI-------------   28
DSSP  EEEELLH----------------------hHHHHHHHH-LLEEEEEE-------------


DSSP  llllleeeelllEEELllllllllllllllllllllllllllllleeelllhhhhhhHHH
Query lvegprlfvsgrALSQtgghadprarsdymppdspcgccvrvgalgrvadgvdevrrAVR  180
ident                                                             
Sbjct ------------KFNE----------------------------------------eVDK   36
DSSP  ------------EELL----------------------------------------lLLH


DSSP  HHHHHLL-----LLEEEELllllllllllllllLLLHhHHHHHHHHHHllLLLEEEEELL
Query EELQMGA-----DQIXIMAsggvasptdpvgvfGYSEdEIRAIVAEAQgrGTYVLAHAYT  235
ident | |           |                         |  |                
Sbjct EKLREARkeygkVAILLSN--------------PKPS-LVRDTVQKFK--SYLIYVESND   79
DSSP  HHHHHHHhhhllEEEEEEL--------------LLHH-HHHHHHHHLL--LLEEEEELLL


DSSP  HHHHHHHHHLLLLEEEELL------LLLHHHHHHHHHHLLEEELLhHHHHHHHhhlllll
Query PAAIARAVRCGVRTIEHGN------LIDDETARLVAEHGAYVVPTlVTYDALAsegekyg  289
ident    |      ||  |           ||   | |                          
Sbjct LRVIRYSIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYS-------  131
DSSP  HHHHHHHHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHL-------


DSSP  llhhHHLLHHHHHLLHHHHHHHHHHHLLLLLLLLLLLHhhHHHLL---HHHHHHHL-LLL
Query lppeSIAKIADVHGAGLHSIEIMKRAGVKMGFGTDLLGeaQRLQS---DEFRILAE-VLS  345
ident          |                 |                    |           
Sbjct ----NPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQE--KWDVRyprDLISLGVViGME  185
DSSP  ----LHHHHHHHHHHHHHHHHHHHHHLLLEEEELLLLL--HHHLLlhhHHHHHHHHlLLL


DSSP  HHHHHHHLLHHHHHHLLllllllllllllllleeeellllllllllllllllllleeeel
Query PAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkd  405
ident      ||        |                                            
Sbjct IPQAKASISMYPEIILK-------------------------------------------  202
DSSP  HHHHHHLLLHHHHHHHL-------------------------------------------


DSSP  leeeeelll
Query grlfvnele  414
ident          
Sbjct ---------  202
DSSP  ---------


No 33: Query=3mkvA Sbjct=3cjpA Z-score=15.9

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                            |
Sbjct ---------------------------------------------------------LII    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELLLlllllhhhhllllhhhhhHHHHHHHHHHHHLLEEEEEELLL------------
Query DLHVHVVaiefnlprvatlpnvlvtLRAVPIMRAMLRRGFTTVRDAGG------------  108
ident | | ||                   |        |   |                     
Sbjct DGHTHVI------------------LPVEKHIKIMDEAGVDKTILFSTsihpetavnlrd   45
DSSP  EEEEELL------------------LLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhh


DSSP  ----------------------------lLHHHHHHHHlllllllEEEELLlEEELLlll
Query ----------------------------aGYPFKQAVEsglvegpRLFVSGrALSQTggh  140
ident                                   ||         |    |         
Sbjct vkkemkklndvvngktnsmidvrrnsikeLTNVIQAYP------sRYVGFG-NVPVG---   95
DSSP  hhhhhhhhhhhhlllllllhhhhhhhhhhHHHHHHHLL------lLEEEEE-LLLLL---


DSSP  llllllllllllllllllllllllleeelLLHHHHHHHHHH-HHHHLLLLEE-EELLlll
Query adprarsdymppdspcgccvrvgalgrvaDGVDEVRRAVRE-ELQMGADQIX-IMASggv  198
ident                                         |         |         
Sbjct -----------------------------LSENDTNSYIEEnIVNNKLVGIGeLTPA---  123
DSSP  -----------------------------LLHHHHHHHHHHhLLLLLLLEEEeELLL---


DSSP  llllllllLLLLLHhhHHHHHHHHHLLL-LLEEEEEL---LHHHHHHHHHLL------LL
Query asptdpvgVFGYSEdeIRAIVAEAQGRG-TYVLAHAY---TPAAIARAVRCG------VR  248
ident                    |       |      ||        |               
Sbjct --------SGQIKS--LKPIFKYSMDSGsLPIWIHAFnplVLQDIKEIAELCkafpkvPV  173
DSSP  --------LLLHHH--HHHHHHHHHHLLlLLEEELLLlllLHHHHHHHHHHHhhllllLE


DSSP  EEEE-LLLLLHHHHHHHHHHL-LEEELLHhhhhhhhhhlllllllhhhhllhhhhhlLHH
Query TIEH-GNLIDDETARLVAEHG-AYVVPTLvtydalasegekyglppesiakiadvhgAGL  306
ident    | |         |  |    |                                    
Sbjct ILGHmGGSNWMTAVELAKEIQnLYLDTSA---------------------------yFST  206
DSSP  EEHHhHHHHHHHHHHHHHHLLlEEEELLL---------------------------lLLH


DSSP  HHHHHHHHHL-lLLLLLLLLLhhhhhHLLHHHHHHHLLL-LHHHHHHHLLHHHHHHLLLl
Query HSIEIMKRAG-vKMGFGTDLLgeaqrLQSDEFRILAEVL-SPAEVIASATIVSAEVLGMq  364
ident     |       |  ||||                           |         |   
Sbjct FVLKIVINELplKCIFGTDMP---fgDLQLSIEAIKKMSnDSYVANAVLGDNISRLLNI-  262
DSSP  HHHHHHHHHLllLEELLLLLL---llLHHHHHHHHHHHLlLHHHHHHHHLHHHHHHHLL-


DSSP  llllllllllllleeeellllllllllllllllllleeeelleeeeelll
Query dklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                                   
Sbjct --------------------------------------------------  262
DSSP  --------------------------------------------------


No 34: Query=3mkvA Sbjct=3irsA Z-score=15.0

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
ident                                                            |
Sbjct --------------------------------------------------------LKII    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEELLL-llllLHHHHLLL--------------lhhhHHHHHHHHHHHHHHLLEEEEEE
Query DLHVHVV-aiefNLPRVATL--------------pnvlVTLRAVPIMRAMLRRGFTTVRD  105
ident |           |                                    |   |      
Sbjct DFRLRPPamgflNARIYTRPdirnrftrqlgfepapsaEEKSLELMFEEMAAAGIEQGVC   64
DSSP  ELLLLLLlhhhhHLHHHHLHhhhhhhhhhhlllllhhhHHLLHHHHHHHHHHLLLLEEEE


DSSP  LLL-----------lLHHHHHHHHlllllllEEEELlLEEElllllllllllllllllll
Query AGG-----------aGYPFKQAVEsglvegpRLFVSgRALSqtgghadprarsdymppds  154
ident  |                   |                                      
Sbjct VGRnssvlgsvsnadVAAVAKAYP------dKFHPV-GSIE-------------------   98
DSSP  ELLeellleellhhhHHHHHHHLL------lLEEEE-EELL-------------------


DSSP  llllllllllleeeLLLHHHHHHHHHHHHHHLLLLEEEELLLllllllllllLLLLLHHH
Query pcgccvrvgalgrvADGVDEVRRAVREELQMGADQIXIMASGgvasptdpvgVFGYSEDE  214
ident               |    |      | |  |                            
Sbjct --------------AATRKEAMAQMQEILDLGIRIVNLEPGV------watpMHVDDRRL  138
DSSP  --------------LLLHHHHHHHHHHHHHLLLLLEEELHHH------llllLLLLLHHH


DSSP  hHHHHHHHHLLLLLEEEEEL----------LHHHHHHHHHLL---LLEEEE-LLLL---L
Query iRAIVAEAQGRGTYVLAHAY----------TPAAIARAVRCG---VRTIEH-GNLI---D  257
ident      |     |  |                |  | |             |         
Sbjct -YPLYAFCEDNGIPVIMMTGgnagpditytNPEHIDRVLGDFpdlTVVSSHgNWPWvqeI  197
DSSP  -HHHHHHHHHLLLLEEEELLllllllhhhhLHHHHHHHHHHLlllLEEEEHhHLLLhhhH


DSSP  HHHHHHHhhHLLEEELLhHHHHhhhhhlllllllhhhhllhhhhHLLHHHHHHHHHHHL-
Query DETARLVaeHGAYVVPTlVTYDalasegekyglppesiakiadvHGAGLHSIEIMKRAG-  316
ident    |        |  |                                   |        
Sbjct IHVAFRR--PNLYLSPD-MYLY---------------------nLPGHADFIQAANSFLa  233
DSSP  HHHHHHL--LLEEEELH-HHHL---------------------lLLLHHHHHHHHLLHHh


DSSP  lLLLLLLLLLHhHHHHLL-HHHHHhhlLLLHHHHHHHLLHHHHHHLLLllllllllllll
Query vKMGFGTDLLGeAQRLQS-DEFRIlaeVLSPAEVIASATIVSAEVLGMqdklgrivpgah  375
ident   | |||                       |              |              
Sbjct dRMLFGTAYPMcPLKEYTeWFLTL---PIKPDAMEKILHGNAERLLAQ------------  278
DSSP  hLLLLLLLLLLlLHHHHHhHHHLL---LLLHHHHHHHHLHHHHHHHHH------------


DSSP  lleeeellllllllllllllllllleeeelleeeeelll
Query advlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                        
Sbjct ------------------------------------agr  281
DSSP  ------------------------------------lll


No 35: Query=3mkvA Sbjct=3gg7A Z-score=15.0

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                           ||
Sbjct ---------------------------------------------------------SLI    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELLLLLLllhhhhllllhhhhhhHHHHHHHHHHHLLEeEEEELL------llLHHHH
Query DLHVHVVAIEfnlprvatlpnvlvtlRAVPIMRAMLRRGFtTVRDAG------gaGYPFK  114
ident | |||                       |   ||   |   ||                 
Sbjct DFHVHLDLYP----------------DPVAVARACEERQL-TVLSVTttpaawrgTLALA   46
DSSP  EEEELHHHLL----------------LHHHHHHHHHHLLL-EEEELLllhhhhhhHHHHH


DSSP  HHHHlllllllEEEELlLEEElllLLLLllllllllllllllllllllllleeELLLhhH
Query QAVEsglvegpRLFVSgRALSqtgGHADprarsdymppdspcgccvrvgalgrVADGvdE  174
ident                                                             
Sbjct AGRP-------HVWTA-LGFH---PEVV------------------------sERAA--D   69
DSSP  LLLL-------LEEEL-LLLL---HHHL------------------------lLLHH--H


DSSP  HHHhHHHHHHhLLLLEE-EELLLllllLLLLlllllLLHHHHHHHHHHHHLLLLL-EEEE
Query VRRaVREELQmGADQIX-IMASGgvasPTDPvgvfgYSEDEIRAIVAEAQGRGTY-VLAH  232
ident         |             |    |                |       |      |
Sbjct LPW-FDRYLP-ETRFVGeVGLDG---sPSLR-gtwtQQFAVFQHILRRCEDHGGRiLSIH  123
DSSP  LHH-HHHHHH-HLLEEEeEELLL---lHHHH-hhhhHHHHHHHHHHHHHHHLLLEeEEEE


DSSP  ELLhhHHHHHHHLL-------lLEEEELLlLLHHHHHHHHHHLLEEELLHHhhhhhhhhl
Query AYTpaAIARAVRCG-------vRTIEHGNlIDDETARLVAEHGAYVVPTLVtydalaseg  285
ident      |      |                       |     |                 
Sbjct SRR--AESEVLNCLeanprsgtPILHWYS-GSVTELRRAISLGCWFSVGPT---------  171
DSSP  LLL--LHHHHHHHHhhlhhheeEEEELLL-LLHHHHHHHHHLLLEEEELHH---------


DSSP  llllllhhhhllhhhhHLLHHHHHHHHHhhllLLLLLLLLL-----hHHHH--HLLHHHH
Query ekyglppesiakiadvHGAGLHSIEIMKragvKMGFGTDLL-----gEAQR--LQSDEFR  338
ident                    |   |  |          ||         |           
Sbjct -------------mvrTQKGAALIRSMP--rdRVLTETDGPfleldgQAALpwDVKSVVE  216
DSSP  -------------hhlLHHHHHHHHHLL--hhHEEELLLLLlleellEELLhhHHHHHHH


DSSP  HHHLLL--LHHHHHHHLLHHHHHhLLLLllllllllllllleeeelllllllllllllll
Query ILAEVL--SPAEVIASATIVSAEvLGMQdklgrivpgahadvlvvdgnplksvdcllgqg  396
ident  |         ||           |                                   
Sbjct GLSKIWqiPASEVERIVKENVSR-LLGT--------------------------------  243
DSSP  HHHHHHllLHHHHHHHHHHHHHH-HHHL--------------------------------


DSSP  lllleeeelleeeeelll
Query ehiplvmkdgrlfvnele  414
ident                   
Sbjct ------------------  243
DSSP  ------------------


No 36: Query=3mkvA Sbjct=2ffiA Z-score=14.7

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
ident                                                            |
Sbjct ------------------------------------------------------lhLTAI    6
DSSP  ------------------------------------------------------llLLLE


DSSP  EEEELLL-------llllLHHHHllllhhhhhhHHHHHHHHHHHLLEEEEEELLL-----
Query DLHVHVV-------aiefNLPRVatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG-----  108
ident | | ||              |                        ||             
Sbjct DSHAHVFsrglnlasqrrYAPNY--------daPLGDYLGQLRAHGFSHGVLVQPsflgt   58
DSSP  ELLLLLLlhhhhhhllllLLLLL--------llLHHHHHHHHHHLLLLEELLLLLhhhll


DSSP  ---lLHHHHHHHHlllllllEEEELlLEEEllllllllllllllllllllllllllllll
Query ---aGYPFKQAVEsglvegpRLFVSgRALSqtgghadprarsdymppdspcgccvrvgal  165
ident          | |         |      |                               
Sbjct dnryLLSALQTVP------gQLRGV-VXLE------------------------------   81
DSSP  llhhHHHHHHHLL------lLLLLL-LLLL------------------------------


DSSP  eeelllhhhHHHHhHHHHHHL---LLLEEEELLLllllllllllLLLLLHH--hHHHHHH
Query grvadgvdeVRRAvREELQMG---ADQIXIMASGgvasptdpvgVFGYSED--eIRAIVA  220
ident                                  |                     |    
Sbjct ---------RDVEqATLAEXArlgVRGVRLNLXG----------QDXPDLTgaqWRPLLE  122
DSSP  ---------LLLLhHHHHHHHlllLLEEELLLLL----------LLLLLLLlllLHHHHH


DSSP  HHHLLLLLEEEEELLhHHHHHHHHLL-----lLEEE-ELLL---------lLHHHHHHhH
Query EAQGRGTYVLAHAYTpAAIARAVRCG-----vRTIE-HGNL---------iDDETARLvA  265
ident      |  |  |    | |   ||          |   |              |   |  
Sbjct RIGEQGWHVELHRQV-ADIPVLVRALqpygldIVIDhFGRPdarrglgqpgFAELLTLsG  181
DSSP  HHHHHLLEEEELLLL-LLHHHHHHHHllllllEEELhHHLLllllllllllHHHHLLLlL


DSSP  HHLLEEELLHHHHhhhhhhlllllllhhhhlLHHH--HHLLHHHHHHHHHHHLL--LLLL
Query EHGAYVVPTLVTYdalasegekyglppesiaKIAD--VHGAGLHSIEIMKRAGV--KMGF  321
ident      |                                                      
Sbjct RGKVWVKVSGIYR-----------------lQGSPeeNLAFARQALCALEAHYGaeRLXW  224
DSSP  LLLEEEEEELHHH-----------------lLLLHhhHHHHHHHHHHHHHHHLLhhHEEE


DSSP  LLLLLH-----hHHHH-LLHHHHHHHllLLHHHHHHHLLHHHHHHLLLLLLlllllllll
Query GTDLLG-----eAQRL-QSDEFRILAevLSPAEVIASATIVSAEVLGMQDKlgrivpgah  375
ident | |                  |  |    |     |          |             
Sbjct GSDWPHtqheseVSFGsAVEQFEALG--CSAQLRQALLLDTARALFGFELE---------  273
DSSP  ELLLLLllllllLLHHhHHHHHHHHL--LLHHHHHHHHLHHHHHHLLLLLL---------


DSSP  lleeeellllllllllllllllllleeeelleeeeelll
Query advlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                        
Sbjct ---------------------------------------  273
DSSP  ---------------------------------------


No 37: Query=3mkvA Sbjct=4dlfA Z-score=14.3

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
ident                                                            |
Sbjct --------------------------------------------------------ALRI    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEELLLlllllhHHHLL------llhHHHHhhHHHHHHHHHH-LLEEEEEELLL-----
Query DLHVHVVaiefnlPRVAT------lpnVLVTlrAVPIMRAMLR-RGFTTVRDAGG-----  108
ident | | |                                                       
Sbjct DSHQHFW---ryrAADYPwigagmgvlARDY--LPDALHPLMHaQALGASIAVQAragrd   59
DSSP  EEEELLL---lllHHHLLllllllhhhLLLL--LHHHHHHHHHhLLLLEEEEELLlllhh


DSSP  ---lLHHHHHHHHllllllLEEEELlLEEEllllllllllllllllllllllllllllll
Query ---aGYPFKQAVEsglvegPRLFVSgRALSqtgghadprarsdymppdspcgccvrvgal  165
ident                        |                                    
Sbjct etafLLELACDEA------RIAAVV-GWED------------------------------   82
DSSP  hhhhHHHHHLLLL------LEEEEE-ELLL------------------------------


DSSP  eeellLHHHHHHHHHHhHHHL-LLLEEEELLLlllllllllLLLL--LLHH-HHHHHHHH
Query grvadGVDEVRRAVREeLQMG-ADQIXIMASGgvasptdpvGVFG--YSED-EIRAIVAE  221
ident              | |                                  |      || 
Sbjct ----lRAPQLAERVAE-WRGTkLRGFRHQLQD---------EADVraFVDDaDFARGVAW  128
DSSP  ----lLLLLHHHHHHL-LLLLlEEEEEELHHH---------LLLHhhHHHLhHHHHHHHH


DSSP  HHLLLLLEEEEEL--LHHHHHHHHHLL---lLEEE-ELLL-------------lLHHHHH
Query AQGRGTYVLAHAY--TPAAIARAVRCG---vRTIE-HGNL-------------iDDETAR  262
ident  |                                   |                     |
Sbjct LQANDYVYDVLVFerQLPDVQAFCARHdahwLVLDhAGKPalaefdrddtalarWRAALR  188
DSSP  HHHLLLEEEELLLhhHHHHHHHHHHHLllllEEEHhHHLLlhhhllllllhhhhHHHHHH


DSSP  HHHHHL-LEEELL-HHHHHhHHHHLllllllhhhhllhhhhhLLHHHHHHHHHHHLL--L
Query LVAEHG-AYVVPT-LVTYDaLASEGekyglppesiakiadvhGAGLHSIEIMKRAGV--K  318
ident   |           |||       |                             |     
Sbjct ELAALPhVVCKLSgLVTEA-DWRRG-----------lrasdlRHIEQCLDAALDAFGpqR  236
DSSP  HHHLLLlEEEEELlLLLLL-LLLLL-----------llhhhhHHHHHHHHHHHHHHLhhH


DSSP  LLLLLLL--LHHHhhHLLHHHHHHHLLLL----HHHHHHHLLHHHHHHLLLLllllllll
Query MGFGTDL--LGEAqrLQSDEFRILAEVLS----PAEVIASATIVSAEVLGMQdklgrivp  372
ident   || |      |                     ||  |      |              
Sbjct LMFGSDWpvCLLA-aSYDEVASLVERWAEsrlsAAERSALWGGTAARCYALP--------  287
DSSP  EEELLLLlhHHHL-lLHHHHHHHHHHHHHhhllHHHHHHHLLHHHHHHLLLL--------


DSSP  llllleeeellllllllllllllllllleeeelleeeeelll
Query gahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                           
Sbjct ------------------------------------------  287
DSSP  ------------------------------------------


No 38: Query=3mkvA Sbjct=3pnuA Z-score=14.1

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllLEEEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgKTIMPGLI   60
ident                                                             
Sbjct --------------------------------------------enlyfqsnAMKLKNPL   16
DSSP  --------------------------------------------llllllllLEEEELLE


DSSP  EEEELLLlllllhhhhllllhhhHHHHHHHHHHHHHHlLEEEEEELLL---------lLH
Query DLHVHVVaiefnlprvatlpnvlVTLRAVPIMRAMLRrGFTTVRDAGG---------aGY  111
ident | | |                         |     |  |                    
Sbjct DMHLHLR----------------DNQMLELIAPLSAR-DFCAAVIMPNlipplcnledLK   59
DSSP  EEEELLL----------------LHHHHHHHHHHHHL-LLLEEEELLLlllllllhhhHH


DSSP  HHHHHhhllLLLL---LEEEELlLEEElllllllllllllllllllllllllllllleee
Query PFKQAvesgLVEG---PRLFVSgRALSqtgghadprarsdymppdspcgccvrvgalgrv  168
ident   |                                                         
Sbjct AYKMR--ilKACKdenFTPLMT-LFFK---------------------------------   83
DSSP  HHHHH--hhHHHLlllLEEEEE-EELL---------------------------------


DSSP  lllhhHHHH-HHHHHHHhLLLLEEEELLLLLLLllllllllLLLHHH--HHHHHHHHHLL
Query adgvdEVRR-AVREELQmGADQIXIMASGGVASptdpvgvfGYSEDE--IRAIVAEAQGR  225
ident                       ||    |              | |              
Sbjct -----NYDEkFLYSAKD-EIFGIXLYPAGITTN----snggVSSFDIeyLKPTLEAMSDL  133
DSSP  -----LLLHhHHHHHLL-LLLEEEELLLLLLLL----llllLLLLLHhhHHHHHHHHHHL


DSSP  LLLEEEEEL--------LHHHHHHHHHLL------lLEEEELLLLLhhHHHHHHHHL-LE
Query GTYVLAHAY--------TPAAIARAVRCG------vRTIEHGNLIDdeTARLVAEHG-AY  270
ident     | |                                ||          |       |
Sbjct NIPLLVHGEtndfvmdrESNFAKIYEKLAkhfprlkIVMEHITTKT--LCELLKDYEnLY  191
DSSP  LLLEEELLLllllhhhlLHHHHHHHHHHHhhlllllEEELLLLLHH--HHHHHHHLLlEE


DSSP  EELLHH---------hhhhhHHHLllllllhhhhllhhhHHLL--hHHHHHHHH-hhLLL
Query VVPTLV---------tydalASEGekyglppesiakiadVHGA--gLHSIEIMK-raGVK  318
ident    ||                                                      |
Sbjct ATITLHhliitlddviggkmNPHL-----------fckpIAKRyedKEALCELAfsgYEK  240
DSSP  EEELLHhhlllhhhhhllllLHHH-----------llllLLLLhhhHHHHHHHHhllLLL


DSSP  LLLLLLLLHH---------HHHHLL-HHHHHHHLLLLHHHHHHHLLHHHHHHlLLLLLll
Query MGFGTDLLGE---------AQRLQS-DEFRILAEVLSPAEVIASATIVSAEVlGMQDKlg  368
ident   || |                              |                       
Sbjct VMFGSDSAPHpkgcaagvfSAPVILpVLAELFKQNSSEENLQKFLSDNTCKI-YDLKF--  297
DSSP  EEELLLLLLLlllllllllLHHHHHhHHHHHHHHHLLHHHHHHHHLHHHHHH-HLLLL--


DSSP  lllllLLLLEEEELL-------------------llllLLLLllllllLLLEeeelleee
Query rivpgAHADVLVVDG-------------------nplkSVDCllgqgeHIPLvmkdgrlf  409
ident           |                                                 
Sbjct -----KEDKILTLEEkewqvpnvyedkynqvvpymageILKF------QLKH--------  338
DSSP  -----LLLLEEEEELlleelllleelllleelllllllEELL------EELL--------


DSSP  eelll
Query vnele  414
ident      
Sbjct -----  338
DSSP  -----


No 39: Query=3mkvA Sbjct=4mupB Z-score=14.0

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                          |  
Sbjct -----------------------------------------lvrklsgtapnpafPRGAV   19
DSSP  -----------------------------------------llllllllllllllLLLLE


DSSP  EEEELLL----lllllHHHHllllHHHHhhHHHHHHHHHHH-LLEEEEEELLL-------
Query DLHVHVV----aiefnLPRVatlpNVLVtlRAVPIMRAMLR-RGFTTVRDAGG-------  108
ident |   |            |                  |      |   |    |       
Sbjct DTQMHMYlpgypalpgGPGL---pPGAL--PGPEDYRRLMQwLGIDRVIITQGnahqrdn   74
DSSP  ELLLLLLlllllllllLLLL---lLLLL--LLHHHHHHHHHhHLLLEEEEELLhhhllll


DSSP  -lLHHHHHHHHlllllllEEEELLLeeellllllllllllllllllllllllllllllee
Query -aGYPFKQAVEsglvegpRLFVSGRalsqtgghadprarsdymppdspcgccvrvgalgr  167
ident                                                             
Sbjct gnTLACVAEMG------eAAHAVVI-----------------------------------   93
DSSP  hhHHHHHHHHH------hHEEEEEL-----------------------------------


DSSP  elllhhhHHHHhHHHHHHL----LLLEEEELLLllllllllllllLLLHhhHHHHHHHHH
Query vadgvdeVRRAvREELQMG----ADQIXIMASGgvasptdpvgvfGYSEdeIRAIVAEAQ  223
ident                             ||                 ||    |    | 
Sbjct ------iDATTtEKDMEKLtaagTVGARIMDLP--------ggavNLSE--LDAVDERAH  137
DSSP  ------lLLLLlHHHHHHHhhllEEEEEEELLL--------llllLHHH--HHHHHHHHH


DSSP  LLLLLEEEEELLHHH--hHHHHHLL--lLEEE-ELLL--------lLHHHHHHHHHHL-L
Query GRGTYVLAHAYTPAA--iARAVRCG--vRTIE-HGNL--------iDDETARLVAEHG-A  269
ident      |                           ||                      |  
Sbjct AADWMVAVQFDGNGLldhLPRLQKIrsrWVFDhHGKFfkgirtdgpEMAALLKLIDRGnL  197
DSSP  HLLLEEEEELLHHHHhhhHHHHHLLlleEEELhHHHLllllllllhHHHHHHHHHHHLlE


DSSP  EEELLhhHHHHhhhhlllllllhhhhlLHHH--hHLLHHHHHHHHHHHL-lLLLLLLLL-
Query YVVPTlvTYDAlasegekyglppesiaKIAD--vHGAGLHSIEIMKRAG-vKMGFGTDL-  325
ident                                                        ||   
Sbjct WFKFA--GVYE----------------SSRKswpYADVAAFSRVIAAHApeRIVWGTNWp  239
DSSP  EEEEL--LHHH----------------LLLLlllLHHHHHHHHHHHHHLhhHEEELLLLl


DSSP  LHHH-----hHHLL-HHHHHHHLLLLHHHHHHHLLHHHHHHLLLLLLlllllllllllee
Query LGEA-----qRLQS-DEFRILAEVLSPAEVIASATIVSAEVLGMQDKlgrivpgahadvl  379
ident                     |      |                                
Sbjct HNSVretaayPDDArLAELTLGWLPDEAARHRALVENPEALFKLSPV-------------  286
DSSP  LLLLllhhhlLLHHhHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL-------------


DSSP  eellllllllllllllllllleeeelleeeeelll
Query vvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                    
Sbjct -----------------------------------  286
DSSP  -----------------------------------


No 40: Query=3mkvA Sbjct=4hk5D Z-score=13.8

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                         |   
Sbjct -------------------------------------------------------TPVVV    5
DSSP  -------------------------------------------------------LLLLE


DSSP  EEEELLLlllllhHHHLLLL----------------------------------------
Query DLHVHVVaiefnlPRVATLP----------------------------------------   80
ident | | |        |                                              
Sbjct DIHTHMY-----pPSYIAMLekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  EEEEEEL-----lHHHHHHHhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  -----hhhhhhHHHHHHHHHHHLLEEEEEELLL---------------------lLHHHH
Query -----nvlvtlRAVPIMRAMLRRGFTTVRDAGG---------------------aGYPFK  114
ident                 |  |   |                                    
Sbjct lpgrplsthfaSLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiadavnaeFSDMC  120
DSSP  llleellhhhlLHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhhhhhhhhHHHHH


DSSP  HHHHlllllllEEEELLlEEELLlllllllllllllllllllllllllllleeelLLHHH
Query QAVEsglvegpRLFVSGrALSQTgghadprarsdymppdspcgccvrvgalgrvaDGVDE  174
ident            |||    ||                                     || 
Sbjct AQHV------gRLFFFA-ALPLS--------------------------------APVDA  141
DSSP  HLLL------lLEEEEE-ELLLL--------------------------------LLHHH


DSSP  HHHHHHHHHHHL-LLLEEEELllllllllllllllLLLH-----hhHHHHHHHHHLLLLL
Query VRRAVREELQMG-ADQIXIMAsggvasptdpvgvfGYSE-----deIRAIVAEAQGRGTY  228
ident |               |                                           
Sbjct VKASIERVKNLKyCRGIILGT--------------SGLGkglddphLLPVFEAVADAKLL  187
DSSP  HHHHHHHHHLLLlEEEEEELL--------------LLLLlllllhhHHHHHHHHHHLLLE


DSSP  EEEEE----------------------------LLHHHHHHH--------hhlLLLEEEE
Query VLAHA----------------------------YTPAAIARA--------vrcGVRTIEH  252
ident |  |                              |  | ||                  |
Sbjct VFLHPhyglpnevygprseeyghvlplalgfpmETTIAVARMymagvfdhvrnLQMLLAH  247
DSSP  EEELLlllllhhhhlllhhhlllhhhhhlhhhhHHHHHHHHHhhllhhhhlllLLEEEHH


DSSP  -LLLLLHHH--------------------------hHHHHhHLLEEELLHHhhhhhhhhl
Query -GNLIDDET--------------------------aRLVAeHGAYVVPTLVtydalaseg  285
ident  |                                          |               
Sbjct sGGTLPFLAgriescivhdghlvktgkvpkdrrtiwTVLK-EQIYLDAVIY---------  297
DSSP  hHLLHHHHHhhhhhhhhllhhhhhllllllllllhhHHHH-HLEEEELLLL---------


DSSP  llllllhhhhllhhhhhllHHHHHHHHHHHLL--LLLLLLLLLHHH---------HHHLL
Query ekyglppesiakiadvhgaGLHSIEIMKRAGV--KMGFGTDLLGEA---------QRLQS  334
ident                                      ||||                   
Sbjct -------------------SEVGLQAAIASSGadRLMFGTDHPFFPpieedvqgpWDSSR  338
DSSP  -------------------LHHHHHHHHHHHLhhHEELLLLLLLLLlllllllllLHHHH


DSSP  HHHHHHHLLLL--HHHHHHHLLHHHHHHLLLLLLLlllllLLLLleeeelllllllllll
Query DEFRILAEVLS--PAEVIASATIVSAEVLGMQDKLgrivpGAHAdvlvvdgnplksvdcl  392
ident                   |        ||     |       |                 
Sbjct LNAQAVIKAVGegSSDAAAVMGLNAVRVLSLKAEL-----EHHH----------------  377
DSSP  HHHHHHHHHHLllLHHHHHHHLHHHHHHLLLHHHH-----HHHH----------------


DSSP  lllllllleeeelleeeeelll
Query lgqgehiplvmkdgrlfvnele  414
ident                       
Sbjct -------------------hhh  380
DSSP  -------------------hhl


No 41: Query=3mkvA Sbjct=2qpxA Z-score=13.4

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                           | 
Sbjct ---------------------------------------------gxddlsefvdQVPLL   15
DSSP  ---------------------------------------------lllllhhhhhHLLEE


DSSP  EEEELLLlllllhhhhlllLHHH-------------------------------------
Query DLHVHVVaiefnlprvatlPNVL-------------------------------------   83
ident | | |                                                       
Sbjct DHHCHFL-----------iDGKVpnrddrlaqvsteadkdypladtknrlayhgflalak   64
DSSP  EEEELLL-----------lLLLLllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhh


DSSP  --------------hhhhhHHHHHHHHHLLEEEEEELLL----llhhHHHHHHlllLLLL
Query --------------vtlraVPIMRAMLRRGFTTVRDAGG----agypFKQAVEsglVEGP  125
ident                        |      |       |                   | 
Sbjct efaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGfvpddpilDLDQTA--eLVGI  122
DSSP  hhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLllllllllLHHHHH--hHHLL


DSSP  EEEELLlEEELllllllllllllllllllllllllllllleEELL---------LHHHHH
Query RLFVSGrALSQtgghadprarsdymppdspcgccvrvgalgRVAD---------GVDEVR  176
ident         |                                                   
Sbjct PVKAIY-RLET-----------------------------hAEDFxlehdnfaaWWQAFS  152
DSSP  LEEEEE-EHHH-----------------------------hHHHHhlllllhhhHHHHHH


DSSP  HHHHHHHHHLLLLEEEELLLlllllllllLLLL---------------------------
Query RAVREELQMGADQIXIMASGgvasptdpvGVFG---------------------------  209
ident   |      |    |  |            |                             
Sbjct NDVKQAKAHGFVGFXSIAAY---------RVGLhlepvnvieaaagfdtwkhsgekrlts  203
DSSP  HHHHLLLLLLLLLEEELHHH---------HLLLllllllhhhhhhhhhhhhhhlllllll


DSSP  --lLHHHHHHHHHHHHLLLLLEEEEEL--------lhHHHHHH---HHLL-----lLEEE
Query --ySEDEIRAIVAEAQGRGTYVLAHAY--------tpAAIARA---VRCG-----vRTIE  251
ident                         |                                   
Sbjct kplIDYXLYHVAPFIIAQDXPLQFHVGygdadtdxylGNPLLXrdyLKAFtkkglkVVLL  263
DSSP  hhhHHHHHHHHHHHHHHHLLLEEEEELlllllllhhhLLHHHHhhhHHHHhhhlllEEEE


DSSP  ELLLLLHHHHHHHHHH-LLEEELL-HHHHHhhhhhlllllllhhhhllhhhhHLLHHHHH
Query HGNLIDDETARLVAEH-GAYVVPT-LVTYDalasegekyglppesiakiadvHGAGLHSI  309
ident |      |   |       |     |                                  
Sbjct HCYPYHREAGYLASVFpNLYFDISlLDNLG----------------------PSGASRVF  301
DSSP  ELLLLHHHHHHHHHHLlLEEEELLlHHHHL----------------------HHHHHHHH


DSSP  HHHHHHLL--LLLLLLLLL-HHHH-HHLLH-HHHHHHLLL----------LHHHHHHHLL
Query EIMKRAGV--KMGFGTDLL-GEAQ-RLQSD-EFRILAEVL----------SPAEVIASAT  354
ident              |  |         |        |                |   |   
Sbjct NEAVELAPytRILFASDAStYPEXyGLAARqFKQALVAHFnqlpfvdlaqKKAWINAICW  361
DSSP  HHHLLLLLhhHEELLLLLLlLHHHhHHHHHhHHHHHHHHHhllllllhhhHHHHHHHHHL


DSSP  HHHHHHLLLLlLLLLLllllllleeeellllllllllllllllllleeeelleeeeelll
Query IVSAEVLGMQdKLGRIvpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident   ||          |                                             
Sbjct QTSAKLYHQE-RELRV--------------------------------------------  376
DSSP  HHHHHHLLLH-HHHLL--------------------------------------------


No 42: Query=3mkvA Sbjct=1itqA Z-score=13.2

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                            |
Sbjct -------------------------------------------dffrdeaerimrDSPVI   17
DSSP  -------------------------------------------lhhhhhhhhhhlLLLEE


DSSP  EEEELLLLLlllhhhHLLLLHHH--hhHHHHH------HHHHHHHLLEEEEEELLL----
Query DLHVHVVAIefnlprVATLPNVL--vtLRAVP------IMRAMLRRGFTTVRDAGG----  108
ident | |                 | |                                     
Sbjct DGHNDLPWQ-----lLDMFNNRLqderANLTTlagthtNIPKLRAGFVGGQFWSVYtpcd   72
DSSP  EEEELHHHH-----hHHHHLLLLllhhHLLLLllllllLHHHHHHLLEEEEEEEELllhh


DSSP  ------------LLHHHHHHHHLLLLLL-----------------LEEEELlLEEELlll
Query ------------AGYPFKQAVESGLVEG-----------------PRLFVSgRALSQtgg  139
ident                                                             
Sbjct tqnkdavrrtleQMDVVHRMCRMYPETFlyvtssagirqafregkVASLIG-VEGGH---  128
DSSP  hllllhhhhhhhHHHHHHHHHHHLLLLEeelllhhhhhhhhhlllEEEEEE-EELHH---


DSSP  lllllllllllllllllllllllllleEELLlhhhHHHHHHHHHHHLLLLEEEE------
Query hadprarsdymppdspcgccvrvgalgRVADgvdeVRRAVREELQMGADQIXIM------  193
ident                                         |   | |             
Sbjct ---------------------------SIDS----SLGVLRALYQLGMRYLTLThscntp  157
DSSP  ---------------------------HLLL----LHHHHHHHHHLLEEEEELLllllll


DSSP  -LLLLllllllLLLL-------llLLHHHhHHHHHHHHLLLLLEEEEEllHHHHHHHHHL
Query -ASGGvasptdPVGV-------fgYSEDEiRAIVAEAQGRGTYVLAHAytPAAIARAVRC  245
ident  |          |            |       | |    |          |        
Sbjct wADNW------LVDTgdsepqsqgLSPFG-QRVVKELNRLGVLIDLAHvsVATMKATLQL  210
DSSP  lLLLH------HHLLlllllllllLLHHH-HHHHHHHHHHLLEEELLLllHHHHHHHHHH


DSSP  L--LLEE-EELLL--------LLHHHHHHHHHHLLEEELLHHhhhhhhhhlllllllhhh
Query G--VRTI-EHGNL--------IDDETARLVAEHGAYVVPTLVtydalasegekyglppes  294
ident                        |   |||      |                       
Sbjct SraPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDSLVMVNFY------------------  252
DSSP  LllLLEElLLLLLllllllllLLHHHHHHHHHHLLEEEELLL------------------


DSSP  hllhhHHHL--------LHHHHHHHHHHHLL--LLLLLLLLL-----hhhhHHLLHHHHH
Query iakiaDVHG--------AGLHSIEIMKRAGV--KMGFGTDLL-----geaqRLQSDEFRI  339
ident                           |        ||| |              |     
Sbjct ----nNYISctnkanlsQVADHLDHIKEVAGarAVGFGGDFDgvprvpeglEDVSKYPDL  308
DSSP  ----hHHHLllllllhhHHHHHHHHHHHHLLhhHEEELLLLLlllllllllLLLLLHHHH


DSSP  HHLL----LLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllllllllllll
Query LAEV----LSPAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplksvdcllgq  395
ident  ||        |||          |                                   
Sbjct IAELlrrnWTEAEVKGALADNLLRVFE------------------aveqasnltqapeee  350
DSSP  HHHHhhllLLHHHHHHHHLHHHHHHHH------------------hhhhlllllllllll


DSSP  llllleeeelleeeeelll
Query gehiplvmkdgrlfvnele  414
ident                    
Sbjct pipldqlggscrthygyss  369
DSSP  lllhhhlllllllllllll


No 43: Query=3mkvA Sbjct=4ofcA Z-score=12.9

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
ident                                                            |
Sbjct ---------------------------------------------------------mKI    3
DSSP  ---------------------------------------------------------lLE


DSSP  EEEELLL-------lllllhhhhLLLLH--------------hhhHHHH----HHHHHHH
Query DLHVHVV-------aiefnlprvATLPN--------------vlvTLRA----VPIMRAM   95
ident | | |                    |                               | |
Sbjct DIHSHILpkewpdlkkrfgyggwVQLQHhskgeakllkdgkvfrvVRENcwdpEVRIREM   63
DSSP  EEEEELLllllllhhhhhlllllEEEEEeelleeeeeelleeeeeEEHHhllhHHHHHHH


DSSP  HHLLEEEEEELLL----------------------lLHHHHHHHHlllllllEEEELlLE
Query LRRGFTTVRDAGG----------------------aGYPFKQAVEsglvegpRLFVSgRA  133
ident    | |                                              |       
Sbjct DQKGVTVQALSTVpvmfsywakpedtlnlcqllnndLASTVVSYP------rRFVGL-GT  116
DSSP  HHHLLLEEEEELLhhhhlllllhhhhhhhhhhhhhhHHHHHHHLL------lLEEEE-EL


DSSP  EElllllllllllllllllllllllllllllleeeLLLHHHHHHHHHHHHH-HLLLLEEE
Query LSqtgghadprarsdymppdspcgccvrvgalgrvADGVDEVRRAVREELQ-MGADQIXI  192
ident |                                                    |     |
Sbjct LP---------------------------------MQAPELAVKEMERCVKeLGFPGVQI  143
DSSP  LL---------------------------------LLLHHHHHHHHHHHHHlLLLLEEEE


DSSP  ELLlllllllllllLLLLLHHHhHHHHHHHHLLLLLEEEEE-------------------
Query MASggvasptdpvgVFGYSEDEiRAIVAEAQGRGTYVLAHA-------------------  233
ident                            | |         |                    
Sbjct GTH--------vneWDLNAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvg  194
DSSP  ELE--------ellEELLLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlh


DSSP  ---LLHHHHHHHHH--------lLLLEEEE-LLLLLHHH---------------------
Query ---YTPAAIARAVR--------cGVRTIEH-GNLIDDET---------------------  260
ident     |  ||                    | |                            
Sbjct mpaETTIAICSMIMggvfekfpkLKVCFAHgGGAFPFTVgrishgfsmrpdlcaqdnpmn  254
DSSP  hhhHHHHHHHHHHLllhhhhlllLLEEELHhHLLHHHHHhhhhhhhhhlhhhhlllllll


DSSP  -hHHHHhhLLEEELLHHhhhhhhhhlllllllhhhhllhhhhhllHHHHHHHHHHHLL--
Query -aRLVAehGAYVVPTLVtydalasegekyglppesiakiadvhgaGLHSIEIMKRAGV--  317
ident           |                                     |           
Sbjct pkKYLG--SFYTDALVH----------------------------DPLSLKLLTDVIGkd  284
DSSP  hhHHLL--LLEEELLLL----------------------------LHHHHHHHHHHHLll


DSSP  LLLLLLLLLHHHhhhLLHHHHHHHLL--LLHHHHHHHLLHHHHHHLLLLLLLllllllll
Query KMGFGTDLLGEAqrlQSDEFRILAEV--LSPAEVIASATIVSAEVLGMQDKLgrivpgah  375
ident |   |||                                      ||   |         
Sbjct KVILGTDYPFPL--gELEPGKLIESMeeFDEETKNKLKAGNALAFLGLERKQ--------  334
DSSP  LEELLLLLLLLL--lLLLLLHHHHHLllLLHHHHHHHHLHHHHHHHLLLHHH--------


DSSP  lleeeellllllllllllllllllleeeelleeeeelll
Query advlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                        
Sbjct --------------------------------------f  335
DSSP  --------------------------------------l


No 44: Query=3mkvA Sbjct=2dvtA Z-score=12.9

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
ident                                                          |  
Sbjct -------------------------------------------------------mQGKV    5
DSSP  -------------------------------------------------------lLLEE


DSSP  EEEELLLllllLHHHHLLL--------lhhhhhhHHHH-HHHHHHHLLEEEEEELLL---
Query DLHVHVVaiefNLPRVATL--------pnvlvtlRAVP-IMRAMLRRGFTTVRDAGG---  108
ident  |  |                                      |   |  |         
Sbjct ALEEHFA--ipETLQDSAGfvpgdywkelqhrllDIQDtRLKLMDAHGIETMILSLNapa   63
DSSP  EEEEEEL--lhHHHHHHLLlllllhhhhhhhhhhLLLLhHHHHHHHLLEEEEEEEELllh


DSSP  -------------------lLHHHHHHHHlllllllEEEELlLEEEllllllllllllll
Query -------------------aGYPFKQAVEsglvegpRLFVSgRALSqtgghadprarsdy  149
ident                                     |      ||               
Sbjct vqaipdrrkaieiarrandvLAEECAKRP------dRFLAF-AALP--------------  102
DSSP  hhhlllhhhhhhhhhhhhhhHHHHHHHLL------lLEEEE-ELLL--------------


DSSP  lllllllllllllllleeeLLLHHHHHHHHHHHHH-HLLLLEEEELLlllllllllllLL
Query mppdspcgccvrvgalgrvADGVDEVRRAVREELQ-MGADQIXIMASggvasptdpvgVF  208
ident                        |             |                      
Sbjct -------------------LQDPDAATEELQRCVNdLGFVGALVNGF---sqegdgqtPL  140
DSSP  -------------------LLLHHHHHHHHHHHHHlLLLLEEEEELL---llllllllLL


DSSP  LL-LHHHhHHHHHHHHLLLLLEEEEE--------------------------lLHHHHHH
Query GY-SEDEiRAIVAEAQGRGTYVLAHA--------------------------yTPAAIAR  241
ident  |      |    |          |                            |     |
Sbjct YYdLPQY-RPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALR  199
DSSP  LLlLHHH-HHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHH


DSSP  HHH--------lLLLEEEE-LLLLLHHH----------------------hHHHHhHLLE
Query AVR--------cGVRTIEH-GNLIDDET----------------------aRLVAeHGAY  270
ident                   | |                                       
Sbjct LMAsglfdehprLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFH  258
DSSP  HHHllhhhhlllLLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEE


DSSP  EELLHHhhhhhhhhlllllllhhhhllhhhhhllHHHHHHHHHHHLL--LLLLLLLLLhh
Query VVPTLVtydalasegekyglppesiakiadvhgaGLHSIEIMKRAGV--KMGFGTDLLge  328
ident                                                     | ||    
Sbjct ITTSGN---------------------------fRTQTLIDAILEIGadRILFSTDWP--  289
DSSP  EELLLL---------------------------lLHHHHHHHHLLLLhhHEELLLLLL--


DSSP  hHHHLLHHHHHH-HLLLLHHHHHHHLLHHHHHHLLLLllllllllllllleeeellllll
Query aQRLQSDEFRIL-AEVLSPAEVIASATIVSAEVLGMQdklgrivpgahadvlvvdgnplk  387
ident              |     |                                        
Sbjct -FENIDHASDWFnATSIAEADRVKIGRTNARRLFKLD-----------------------  325
DSSP  -LLLHHHHHHHHhHLLLLHHHHHHHHLHHHHHHLLLL-----------------------


DSSP  llllllllllllleeeelleeeeelll
Query svdcllgqgehiplvmkdgrlfvnele  414
ident                            
Sbjct ---------------------------  325
DSSP  ---------------------------


No 45: Query=3mkvA Sbjct=2gwgA Z-score=12.9

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                            |
Sbjct ---------------------------------------------------------XII    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELLLLLlllhhHHLL----------------------LLHHHHHHHHHHHH-HHHHH
Query DLHVHVVAIefnlpRVAT----------------------LPNVLVTLRAVPIM-RAMLR   97
ident | | |                                                       
Sbjct DIHGHYTTA---pkALEDwrnrqiagikdpsvxpkvselkISDDELQASIIENQlKKXQE   60
DSSP  EEEEELLLL---lhHHHHhhhhhhhhhhlhhhlllhhhllLLHHHHHHHHHLLHhHHHHH


DSSP  LLEEEEEELLL----------------lLHHHHHHHHlllllllEEEELLlEEELLLlll
Query RGFTTVRDAGG----------------aGYPFKQAVEsglvegpRLFVSGrALSQTGgha  141
ident ||                           |   |                  | |     
Sbjct RGSDLTVFSPRagdfnvsstwaaicnelCYRVSQLFP------dNFIGAA-XLPQSP---  110
DSSP  HLLLEEEEELLlllhhhhhhhhhhhhhhHHHHHHHLL------lLEEEEE-ELLLLL---


DSSP  lllllllllllllllllllllllleeelLLHHHHHHHHHHHHHHL-LLLEEEELLlllll
Query dprarsdymppdspcgccvrvgalgrvaDGVDEVRRAVREELQMG-ADQIXIMASggvas  200
ident                                                  |          
Sbjct ---------------------------gVDPKTCIPELEKCVKEYgFVAINLNPD-----  138
DSSP  ---------------------------lLLHHHHHHHHHHHHHLLlLLEEEELLL-----


DSSP  llLLLLL---lllLHHHhHHHHHHHHLLLLLEEEE---------ELLHhHHHH-------
Query ptDPVGV---fgySEDEiRAIVAEAQGRGTYVLAH---------AYTPaAIAR-------  241
ident                     |             |         | |  |          
Sbjct -pSGGHWtsppltDRIW-YPIYEKXVELEIPAXIHvstgahylnADTT-AFXQcvagdlf  195
DSSP  -lLLLLLllllllLHHH-HHHHHHHHHHLLLEEELlllllhhhhHHHH-HHHHhhhllhh


DSSP  -hhhlLLLEEEE-LLLLLHH---------------hhHHHHhHLLEEELLHHhhhhhhhh
Query -avrcGVRTIEH-GNLIDDE---------------taRLVAeHGAYVVPTLVtydalase  284
ident          | | |                         |                    
Sbjct kdfpeLKFVIPHgGGAVPYHwgrfrglaqexkkplleDHVL-NNIFFDTCVY--------  246
DSSP  hhlllLLEEELHhHLLLHHHhhhhhhhhhhlllllhhHHLL-LLEEEELLLL--------


DSSP  lllllllhhhhllhhhhhLLHHHHHHHHHhhlLLLLLLLLL-LHHH-------hHHLLhH
Query gekyglppesiakiadvhGAGLHSIEIMKragVKMGFGTDL-LGEA-------qRLQSdE  336
ident                                     |                       
Sbjct ----------------hqPGIDLLNTVIP--vDNVLFASEXiGAVRgidprtgfYYDD-T  287
DSSP  ----------------lhHHHHHHHHHLL--hHHEELLLLLlLLLLleelllleELLL-L


DSSP  HHHHHLL--LLHHHHHHHLLHHHHHHLL----LLLLllllLLLLllleeeelllllllll
Query FRILAEV--LSPAEVIASATIVSAEVLG----MQDKlgriVPGAhadvlvvdgnplksvd  390
ident  |       | | |           |                                  
Sbjct KRYIEAStiLTPEEKQQIYEGNARRVYPrldaALKA---kGKLE----------------  328
DSSP  HHHHHHLllLLHHHHHHHHLHHHHHHLHhhhhHHHH---hHHHL----------------


DSSP  lllllllllleeeelleeeeelll
Query cllgqgehiplvmkdgrlfvnele  414
ident                         
Sbjct -----------------------h  329
DSSP  -----------------------l


No 46: Query=3mkvA Sbjct=4qrnA Z-score=12.5

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeellllEEEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgkTIMPGLI   60
ident                                                            |
Sbjct -------------------------------------------smtqdlktggEQGYLRI   17
DSSP  -------------------------------------------llllllllllLLLLLLE


DSSP  EEEELLLlllllHHHHLLLLH-------------------------------hhhhhhHH
Query DLHVHVVaiefnLPRVATLPN-------------------------------vlvtlrAV   89
ident                                                             
Sbjct ATEEAFA-----TREIIDVYLrmirdgtadkgmvslwgfyaqspseratqilerlldlGE   72
DSSP  EEEEEEL-----LHHHHHHHHhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhhllLH


DSSP  HHHHHHHHLLEEEEEELLL----------------------lLHHHHHHHHllllllLEE
Query PIMRAMLRRGFTTVRDAGG----------------------aGYPFKQAVEsglvegPRL  127
ident      |   |      |                              |          | 
Sbjct RRIADMDATGIDKAILALTspgvqplhdldeartlatrandtLADACQKYP------DRF  126
DSSP  HHHHHHHHLLLLEEEEEELlllllllllhhhhhhhhhhhhhhHHHHHHHLL------LLE


DSSP  EELLlEEELllllllllllllllllllllllllllllleeelLLHHHHHHHHHHHHH-HL
Query FVSGrALSQtgghadprarsdymppdspcgccvrvgalgrvaDGVDEVRRAVREELQ-MG  186
ident    |                                             |         |
Sbjct IGMG-TVAP---------------------------------QDPEWSAREIHRGAReLG  152
DSSP  EELL-LLLL---------------------------------LLHHHHHHHHHHHHHlLL


DSSP  LLLEEEELLlllllllllllLLLL-LHHHhHHHHHHHHLLLLLEEEEE------------
Query ADQIXIMASggvasptdpvgVFGY-SEDEiRAIVAEAQGRGTYVLAHA------------  233
ident    | |                    |     |             |             
Sbjct FKGIQINSH---------tqGRYLdEEFF-DPIFRALVEVDQPLYIHPatspdsmidpml  202
DSSP  LLLEEELLL---------llLLLLlLHHH-HHHHHHHHHHLLLEEELLllllllllhhhh


DSSP  -------------lLHHHHHHHHH--------lLLLEEEE-LLLLLHH------------
Query -------------yTPAAIARAVR--------cGVRTIEH-GNLIDDE------------  259
ident               |     |                  | |                  
Sbjct eagldgaifgfgveTGMHLLRLITigifdkypsLQIMVGHmGEALPYWlyrldymhqagv  262
DSSP  hhlllllllhhhhhHHHHHHHHHHhlhhhhlllLLEEELHhHHLHHHHhhhhhhhhhhhh


DSSP  --------------hhHHHHhHLLEEELLHHhhhhhhhhlllllllhhhhllhhhhhllH
Query --------------taRLVAeHGAYVVPTLVtydalasegekyglppesiakiadvhgaG  305
ident                          |    |                             
Sbjct rsqryermkplkktieGYLK-SNVLVTNSGV---------------------------aW  294
DSSP  hlllllllllllllhhHHHH-HLEEEELLLL---------------------------lL


DSSP  HHHHHHHHHHLL--LLLLLLLLLhhHHHHlLHHHHHH-HLLLLHHHHHHHLLHHHHHHLL
Query LHSIEIMKRAGV--KMGFGTDLLgeAQRLqSDEFRIL-AEVLSPAEVIASATIVSAEVLG  362
ident    |                |     |    || |   |   |                 
Sbjct EPAIKFCQQVMGedRVMYAMDYP--YQYV-ADEVRAMdAMDMSAQTKKKFFQTNAEKWFK  351
DSSP  HHHHHHHHHHHLhhHEELLLLLL--LLLL-HHHHHHHhLLLLLHHHHHHHHLHHHHHHLL


DSSP  Llllllllllllllleeeellllllllllllllllllleeeelleeeeelll
Query Mqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                                     
Sbjct L---------------------------------------------------  352
DSSP  L---------------------------------------------------


No 47: Query=3mkvA Sbjct=2a3lA Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------------------lleeeeeEEEELLLllllleeeeeeeeelleeeee
Query -------------------------lttflfrNGALLDPdhpdllqgfeiliedgfirev   35
ident                                      |                      
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRDF---------------------  159
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLLL---------------------


DSSP  ellllllllleeeelllleeEELEEEEEELLL-LLLL-----------------------
Query sdkpikssnahvidvkgktiMPGLIDLHVHVV-AIEF-----------------------   71
ident                          | |||                              
Sbjct -------------------yNVRKVDTHVHHSaCMNQkhllrfiksklrkepdevvifrd  200
DSSP  -------------------lLLLEEEEEEELLlLLLHhhhhhhhhhhhhllllllleeel


DSSP  -----------------------------------------------lhhhhLLLL----
Query -----------------------------------------------nlprvATLP----   80
ident                                                             
Sbjct gtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlREIFlkqd  260
DSSP  leeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhHHHHllll


DSSP  ----HHHHHHHHHHHHHHHHHLLEEEEEELLL-------------llhhhhHHHHlllll
Query ----NVLVTLRAVPIMRAMLRRGFTTVRDAGG-------------agypfkQAVEsglve  123
ident                                                             
Sbjct nliqGRFLGEITKQVFSDLEASKYQMAEYRISiygrkmsewdqlaswivnnDLYS-----  315
DSSP  llllLLLHHHHHHHHHHHHLLLLLEEEEEEEElllllllhhhhhhhhhhllLLLL-----


DSSP  lLEEEELLlEEELLLllllllllllLLLLllllllllllllleeellLHHHHHHHHHH--
Query gPRLFVSGrALSQTGghadprarsdYMPPdspcgccvrvgalgrvadGVDEVRRAVRE--  181
ident           |               |                                 
Sbjct -ENVVWLI-QLPRLY------niykDMGI---------------vtsFQNILDNIFIPlf  352
DSSP  -LLEEEEE-EEELLH------hhhlLLLL---------------lllLHHHHHHHLLHhh


DSSP  -------------hhhhLLLLEEEEllllllllllLLLL-------------------ll
Query -------------elqmGADQIXIMasggvasptdPVGV-------------------fg  209
ident                                                             
Sbjct eatvdpdshpqlhvflkQVVGFDLV---------dDESKperrptkhmptpaqwtnafnp  403
DSSP  hhhhlhhhllllhhhhlLEEEEEEE---------lLLLLlllllllllllllllllllll


DSSP  LLHHHHHHHHHHHHLLL----------LLEEEEEL---lHHHHHHHHHlLLLEEEELLLL
Query YSEDEIRAIVAEAQGRG----------TYVLAHAY---tPAAIARAVRcGVRTIEHGNLI  256
ident           |                     |          |         | ||   
Sbjct AFSYYVYYCYANLYVLNklreskgmttITLRPHSGeagdIDHLAATFL-TCHSIAHGINL  462
DSSP  LHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLllllLHHHHHHHH-HLLLLLLLHHH


DSSP  L--HHHHHHHHHHLLEEELLHHHHHHhhhhlllllllhhhhllhhHHHLLhHHHHHHHHH
Query D--DETARLVAEHGAYVVPTLVTYDAlasegekyglppesiakiaDVHGAgLHSIEIMKR  314
ident         |                                                   
Sbjct RksPVLQYLYYLAQIGLAMSPLSNNS-------------------LFLDYhRNPFPVFFL  503
DSSP  HhlHHHHHHHHHHLLLEEELHHHHLL-------------------LLLLLlLLLHHHHHH


DSSP  HLLLLLLLLLLLHHHH---HHLLHHHHHHH--LLLLHHHHHHHLLhHHHHHLLL----LL
Query AGVKMGFGTDLLGEAQ---RLQSDEFRILA--EVLSPAEVIASATiVSAEVLGM----QD  365
ident  |      ||              |  | |    ||       |   |    |       
Sbjct RGLNVSLSTDDPLQIHltkEPLVEEYSIAAsvWKLSACDLCEIAR-NSVYQSGFshalKS  562
DSSP  LLLLEEELLLLHHHHLlllLHHHHHHHHHHhhHLLLHHHHHHHHH-HHHHHLLLlhhhHH


DSSP  LLlLLLL------llllleeeellllllllllllllllllleeeelleeeeelll
Query KLgRIVP------gahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                                        
Sbjct HW-IGKDyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  HH-LLLLlllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 48: Query=3mkvA Sbjct=4dziC Z-score=12.2

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                            |
Sbjct -----------------------------------------------------alNYRVI    7
DSSP  -----------------------------------------------------llLLLEE


DSSP  EEEELLL----------------------------------llllLHHHhLLLL------
Query DLHVHVV----------------------------------aiefNLPRvATLP------   80
ident |   |                                          |   |        
Sbjct DVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhFIPN-PTFDpiivpg   66
DSSP  EEEEELLlllllllllllhhhlllleeeeelllleeeeelleellLLLL-LLLLleelll


DSSP  -----------------------HHHHhHHHH----HHHHHHHHLLEEEEEELLL-----
Query -----------------------NVLVtLRAV----PIMRAMLRRGFTTVRDAGG-----  108
ident                                          |      |           
Sbjct cldllfrgeipdgvdpaslmkveRLAD-HPEYqnrdARIAVMDEQDIETAFMLPTfgcgv  125
DSSP  llhhhhhllllllllhhhllleeLHHH-LHHHllhhHHHHHHHHHLEEEEEEELLhhhhh


DSSP  --------------------lLHHH---HHHHhlllllllEEEELlLEEEllllllllll
Query --------------------aGYPF---KQAVesglvegpRLFVSgRALSqtgghadpra  145
ident                                         |        |          
Sbjct eealkhdieatmasvhafnlwLDEDwgfDRPD-------hRIIAA-PIVS----------  167
DSSP  hhhllllhhhhhhhhhhhhhhHHHHlllLLLL-------lLEEEL-LLLL----------


DSSP  lllllllllllllllllllleeeLLLHHHHHHHHHHHHHHLLLLEEEELLLlllllllll
Query rsdymppdspcgccvrvgalgrvADGVDEVRRAVREELQMGADQIXIMASGgvasptdpv  205
ident                                  |   |  ||                  
Sbjct -----------------------LADPTRAVEEVDFVLARGAKLVLVRPAP---vpglvk  201
DSSP  -----------------------LLLHHHHHHHHHHHHHLLLLLEELLLLL---llllll


DSSP  llllLLHHHhHHHHHHHHLLLLLEEEE---------------------------eLLHHH
Query gvfgYSEDEiRAIVAEAQGRGTYVLAH---------------------------aYTPAA  238
ident               |     |  |  |                                 
Sbjct prslGDRSH-DPVWARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllddrAIHDT  260
DSSP  llllLLHHH-HHHHHHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhllhHHHHH


DSSP  HHHHHH--------lLLLEEEELL-LLLHHH-------------------hHHHHhHLLE
Query IARAVR--------cGVRTIEHGN-LIDDET-------------------aRLVAeHGAY  270
ident  |                                                          
Sbjct MASMIVhgvftrhpkLKAVSIENGsYFVHRLikrlkkaantqpqyfpedpvEQLR-NNVW  319
DSSP  HHHHHHllhhhhlllLLEEEELLLlLHHHHHhhhhhhhhhhlhhhllllhhHHHH-HHEE


DSSP  EELLHhhhhhhhhhlllllllhhhhllhhhhhllhHHHHHHHHHHLL--LLLLLLLLLHH
Query VVPTLvtydalasegekyglppesiakiadvhgagLHSIEIMKRAGV--KMGFGTDLLGE  328
ident   |                                        |     |  || |    
Sbjct IAPYY------------------------------EDDLPELARVIGvdKILFGSDWPHG  349
DSSP  ELLLL------------------------------LLLHHHHHHHHLhhHLLLLLLLLLL


DSSP  HH-HHLLHHHHHHhLLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllll
Query AQ-RLQSDEFRILaEVLSPAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplk  387
ident             |    |               ||                         
Sbjct EGlASPVSFTAEL-KGFSESDIRKIMRDNALDLLG-------------------------  383
DSSP  LLlLLHHHHHHHH-LLLLHHHHHHHHLHHHHHHHL-------------------------


DSSP  llllllllllllleeeelleeeeelll
Query svdcllgqgehiplvmkdgrlfvnele  414
ident                            
Sbjct ----------------------vqvgs  388
DSSP  ----------------------lllll


No 49: Query=3mkvA Sbjct=3qy6A Z-score=11.9

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
ident                                                            |
Sbjct ----------------------------------------------------------MI    2
DSSP  ----------------------------------------------------------LE


DSSP  EEEELL-----LLLLllhhhhllllhhhHHHHHHHHHHHHHHLLEEEEEELL--------
Query DLHVHV-----VAIEfnlprvatlpnvlVTLRAVPIMRAMLRRGFTTVRDAG--------  107
ident | | |                                ||  | |  |             
Sbjct DIHCHIlpamdDGAG-------------DSADSIEMARAAVRQGIRTIIATPhhnngvyk   49
DSSP  ELLLLLlllllLLLL-------------LHHHHHHHHHHHHHLLLLEEELLLeellllll


DSSP  -------lLLHHHHHHHHLLlLLLLEEEELlleeelllllllllllllllllllllllll
Query -------gAGYPFKQAVESGlVEGPRLFVSgralsqtgghadprarsdymppdspcgccv  160
ident         |                                                   
Sbjct nepaavreAADQLNKRLIKE-DIPLHVLPG------------------------------   78
DSSP  llhhhhhhHHHHHHHHHHHL-LLLLEEELL------------------------------


DSSP  llllleeelllhhhhhhhhhhhhhhllllEEEElllllllllllllllLLLHhhHHHHHH
Query rvgalgrvadgvdevrravreelqmgadqIXIMasggvasptdpvgvfGYSEdeIRAIVA  220
ident                                |                 | |       |
Sbjct -----------------------------QEIR---------------IYGE--VEQDLA   92
DSSP  -----------------------------LEEE---------------LLLL--HHHHHH


DSSP  HHH----lllLLEEEEE--lLHHH-hHHHHHLL-----LLEEEELL-----llLHHHHHH
Query EAQ----grgTYVLAHA--yTPAA-iARAVRCG-----VRTIEHGN-----liDDETARL  263
ident   |        | |                           | |                
Sbjct KRQllslndtKYILIEFpfdHVPRyaEQLFYDLqlkgyIPVIAHPErnreireNPSLLYH  152
DSSP  LLLlllhhhlLEEEEELlllLLLLlhHHHHHHHhhlllEEEEELHHhlhhhhhLLHHHHH


DSSP  HHHHLLEEELLHHH-hHHHHhhlllllllhhhhllhHHHHLLHHHHHHHHhhhlLLLLLL
Query VAEHGAYVVPTLVT-yDALAsegekyglppesiakiADVHGAGLHSIEIMkragVKMGFG  322
ident   | ||    |                                |   |            
Sbjct LVEKGAASQITSGSlaGIFG----------------KQLKAFSLRLVEAN----LIHFVA  192
DSSP  HHHLLLEEEEEHHHhlLLLL----------------HHHHHHHHHHHHLL----LLLEEE


DSSP  LLL-LHHH-HHHLLHHHHHHHLLLLHHHHHHHLlHHHHHHLLLLllllllllllllleee
Query TDL-LGEA-QRLQSDEFRILAEVLSPAEVIASAtIVSAEVLGMQdklgrivpgahadvlv  380
ident  |                 |                    |  |                
Sbjct SDAhNVKTrNFHTQEALYVLEKEFGSELPYMLT-ENAELLLRNQ----------------  235
DSSP  LLLlLLLLlLLLHHHHHHHHHHHHLLHHHHHHH-HHHHHHHLLL----------------


DSSP  ellllllllllllllllllleeeelleeeeelll
Query vdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                   
Sbjct ----------------------tifrqppqpvkr  247
DSSP  ----------------------llllllllllll


No 50: Query=3mkvA Sbjct=3iacA Z-score=10.7

back to top
DSSP  ---------lleeeeeeeeELLLllllleeeeeeeeelleeeeeellllllllleeeell
Query ---------lttflfrngaLLDPdhpdllqgfeiliedgfirevsdkpikssnahvidvk   51
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  lleeEELEEEEEELLLlllllhhhhllllhhhhhhHHHH---------------------
Query gktiMPGLIDLHVHVVaiefnlprvatlpnvlvtlRAVP---------------------   90
ident          | | |                                              
Sbjct ---aPXPIYDFHCHLS-----------------pqEIADdrrfdnlgqiwlegdhykwra   63
DSSP  ---lLLLEEELLLLLL-----------------hhHHHHllllllhhhhhhllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   90
ident                                                             
Sbjct lrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdt  123
DSSP  hhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhh


DSSP  ------------------HHHHHHHLLEEEEEELLL--llHHHHHHHHLLLLLLLEEEEL
Query ------------------IMRAMLRRGFTTVRDAGG--agYPFKQAVESGLVEGPRLFVS  130
ident                               |                            |
Sbjct aesiwtqcneklatpafsARGIXQQXNVRXVGTTDDpidsLEYHRQIAADDSIDIEVAPS  183
DSSP  hhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLLllllLHHHHHHHHLLLLLLEEELL


DSSP  lLEEELLLLllLLLLlllllLLLLLL-LLLLllllleeelllhHHHHHHhHHHHHHL---
Query gRALSQTGGhaDPRArsdymPPDSPC-GCCVrvgalgrvadgvDEVRRAvREELQMG---  186
ident                                            |         |      
Sbjct -WRPDKVFK--IELD---gfVDYLRKlEAAA----dvsitrfdDLRQAL-TRRLDHFaac  232
DSSP  -LLLHHHHL--LLLL---lhHHHHHHhHHHH----llllllhhHHHHHH-HHHHHHHhhl


DSSP  -LLLEEEELlllllllllllLLLL------------------------------lLHHHH
Query -ADQIXIMAsggvasptdpvGVFG------------------------------ySEDEI  215
ident                                                             
Sbjct gCRASDHGI-----------ETLRfapvpddaqldailgkrlagetlseleiaqfTTAVL  281
DSSP  lLLEEEEEE-----------LLLLllllllhhhhhhhhhhhhllllllhhhhhhhHHHHH


DSSP  HHHHHHHHLLLLLEEEEEL--------------------------LHHHHHHHHHLL---
Query RAIVAEAQGRGTYVLAHAY--------------------------TPAAIARAVRCG---  246
ident          ||     |                               |  |        
Sbjct VWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXdvt  341
DSSP  HHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleellllLHHHHHHHHHHHhll


DSSP  ----lLEEEeLLLL--LHHHHHHHHHHL-------LEEELLHhhhhhhhhhlllllllhh
Query ----vRTIEhGNLI--DDETARLVAEHG-------AYVVPTLvtydalasegekyglppe  293
ident                     |                                       
Sbjct nelpkTILY-CLNPrdNEVLATXIGNFQgpgiagkVQFGSGW------------------  382
DSSP  lllleEEEE-ELLHhhHHHHHHHHHHLLlllllllEEELLLL------------------


DSSP  hhllhhhhhLLHHHHHHHHHHHL--lLLLL-LLLLLhhHHHHLLHHHHHHHLLLL-----
Query siakiadvhGAGLHSIEIMKRAG--vKMGF-GTDLLgeAQRLQSDEFRILAEVLS-----  345
ident             |   |     |         ||                          
Sbjct ---wfndqkDGXLRQLEQLSQXGllsQFVGxLTDSR--SFLSYTRHEYFRRILCNllgqw  437
DSSP  ---hhhllhHHHHHHHHHHHHHLlhhHLLLlLLLLL--LLLLLHHHHHHHHHHHHhhhhh


DSSP  -------------hHHHHHHLLHHHHHHLLllllllllllllllleeeelllllllllll
Query -------------pAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplksvdcl  392
ident                 |                                           
Sbjct aqdgeipddeaxlsRXVQDICFNNAQRYFT------------------------------  467
DSSP  hhlllllllhhhhhHHHHHHHLHHHHHHLL------------------------------


DSSP  lllllllleeeelleeeeelll
Query lgqgehiplvmkdgrlfvnele  414
ident                       
Sbjct --------------------ik  469
DSSP  --------------------ll


No 51: Query=3mkvA Sbjct=1j5sA Z-score=10.6

back to top
DSSP  lleeeeeeeeellllLLLLeeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdHPDLlqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                             
Sbjct --hmflgedylltnrAAVR------------------------------lfnevkDLPIV   28
DSSP  --llllllllllllhHHHH------------------------------hhhhhlLLLEE


DSSP  EEEELLL-----------------llLLLH------------------------------
Query DLHVHVV-----------------aiEFNL------------------------------   73
ident | | |                                                       
Sbjct DPHNHLDakdivenkpwndiwevegaTDHYvwelmrrcgvseeyitgsrsnkekwlalak   88
DSSP  ELLLLLLhhhhhhllllllhhhhhllLLHHhhhhhhhllllhhhllllllhhhhhhhhhh


DSSP  -------------------------------hhhllllhhhhhhhhhHHHHHHHHLLEEE
Query -------------------------------prvatlpnvlvtlravPIMRAMLRRGFTT  102
ident                                                             
Sbjct vfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEI  148
DSSP  hhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEE


DSSP  EEELL--lllHHHHHHHHLLlLLLLEEEELlLEEE--LLLLllllllllllLLLL--LLL
Query VRDAG--gagYPFKQAVESGlVEGPRLFVSgRALS--QTGGhadprarsdyMPPD--SPC  156
ident                      |||                                    
Sbjct LCTTDdpvstLEHHRKAKEA-VEGVTILPT-WRPDraMNVD----------KEGWreYVE  196
DSSP  EELLLlllllLHHHHHHHHH-LLLLEEELL-LLLHhhHLLL----------LLLHhhHHH


DSSP  LL-llllllleeellLHHHHHHHHHHHHHHLLLLEEEELLL------------------l
Query GC-cvrvgalgrvadGVDEVRRAVREELQMGADQIXIMASG------------------g  197
ident                               |                             
Sbjct KMgerygedtstldgFLNALWKSHEHFKEHGCVASDHALLEpsvyyvdenraravhekaf  256
DSSP  HHhhhhllllllhhhHHHHHHHHHHHHHLLLLLEEEEEELLlllllllhhhhhhhhhhhl


DSSP  lllllllllllllLHHHHHHHHHHHHLLLLLEEEEEL-----------------------
Query vasptdpvgvfgySEDEIRAIVAEAQGRGTYVLAHAY-----------------------  234
ident                          |        |                         
Sbjct sgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdist  316
DSSP  llllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleel


DSSP  ----LHHHHHHHHHLL----LLEEeELLL--LLHHHHHHHHHHL-LEEELLHhhhhhhhh
Query ----TPAAIARAVRCG----VRTIeHGNL--IDDETARLVAEHG-AYVVPTLvtydalas  283
ident                                               ||            
Sbjct nflrIAEGLRYFLNEFdgklKIVL-YVLDptHLPTISTIARAFPnVYVGAPW--------  367
DSSP  llllHHHHHHHHHHHLllllLEEE-EELLhhHHHHHHHHHHHLLlEEELLLL--------


DSSP  hlllllllhhhhllhhHHHL--LHHHHHHHHHHHLL--LLLL-LLLLLhhHHHHLL-HHH
Query egekyglppesiakiaDVHG--AGLHSIEIMKRAGV--KMGF-GTDLLgeAQRLQS-DEF  337
ident                                             ||              
Sbjct ---------------wFNDSpfGMEMHLKYLASVDLlyNLAGmVTDSR--KLLSFGsRTE  410
DSSP  ---------------lLLLLhhHHHHHHHHHHLLLLhhHLLLlLLLLL--LLLHHHhHHH


DSSP  HHHHLLL----------------LHHHHHHHLLHHHHHHLLllllllllllllllleeee
Query RILAEVL----------------SPAEVIASATIVSAEVLGmqdklgrivpgahadvlvv  381
ident                            |                                
Sbjct MFRRVLSnvvgemvekgqipikeARELVKHVSYDGPKALFF-------------------  451
DSSP  HHHHHHHhhhhhhhhlllllhhhHHHHHHHHHLHHHHHHHL-------------------


DSSP  llllllllllllllllllleeeelleeeeelll
Query dgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                  
Sbjct ---------------------------------  451
DSSP  ---------------------------------


No 52: Query=3mkvA Sbjct=1m65A Z-score=10.2

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
ident                                                             
Sbjct ---------------------------------------------------------yPV    3
DSSP  ---------------------------------------------------------lLE


DSSP  EEEELllLLLLLHhhhllllhhhhhhhHHHHHHHHHHLLEEEEEELL-------------
Query DLHVHvvAIEFNLprvatlpnvlvtlrAVPIMRAMLRRGFTTVRDAG-------------  107
ident ||| |                                 |                     
Sbjct DLHMH--TVASTH----------aystLSDYIAQAKQKGIKLFAITDhgpdmedaphhwh   51
DSSP  ELLLL--LLLLLL----------llllHHHHHHHHHHHLLLEEEEEEellllllllllhh


DSSP  -llLHHHhHHHHllllLLLEEEELlleeelllllllllllllllllllllllllllllle
Query -gaGYPFkQAVEsglvEGPRLFVSgralsqtgghadprarsdymppdspcgccvrvgalg  166
ident           |      |                                          
Sbjct finMRIW-PRVV----DGVGILRG------------------------------------   70
DSSP  hhhHHHL-LLEE----LLEEEEEE------------------------------------


DSSP  eelllhhhhhhhhhhhhhhllllEEEELllllllllllllllLLLHhhhhhhhhhHHLLL
Query rvadgvdevrravreelqmgadqIXIMAsggvasptdpvgvfGYSEdeiraivaeAQGRG  226
ident                        |                                 |  
Sbjct -----------------------IEANI--------------KNVD-----geidCSGKM   88
DSSP  -----------------------EEEEL--------------LLLL-----llllLLHHH


DSSP  L----lEEEEE-----------lLHHHHHHHHHLL-LLEEEELLL-----lLHHHHHHHH
Query T----yVLAHA-----------yTPAAIARAVRCG-VRTIEHGNL-----iDDETARLVA  265
ident         |                 |       | |  | |             |   |
Sbjct FdsldlIIAGFhepvfaphdkatNTQAMIATIASGnVHIISHPGNpkyeidVKAVAEAAA  148
DSSP  HhhlleEEEELlllllllllhhhHHHHHHHHHHLLlLLEELLLLLllllllHHHHHHHHH


DSSP  HHLLEEELlHHHHhhhhhhlllllllhhhhllhhhhhlLHHHHHHHHHHHLLLLLLLLLL
Query EHGAYVVPtLVTYdalasegekyglppesiakiadvhgAGLHSIEIMKRAGVKMGFGTDL  325
ident  |                                               ||     | | 
Sbjct KHQVALEI-NNSS-------------------------NCREVAAAVRDAGGWVALGSDS  182
DSSP  HHLLEEEE-ELLL-------------------------LHHHHHHHHHHHLLLEEEELLL


DSSP  LhhHHHHLLHHhHHHHLLL----LHHHhhHHLLH--HHHHHLL---LLLLllllllllLL
Query LgeAQRLQSDEfRILAEVL----SPAEviASATI--VSAEVLG---MQDKlgrivpgaHA  376
ident                   |     | |              |    |            |
Sbjct H--TAFTMGEF-EECLKILdavdFPPE-rILNVSprRLLNFLEsrgMAPI------aeFA  232
DSSP  L--LHHHLLLL-HHHHHHHhhllLLHH-hLHHHLhhHHHHHHHhllLLLL------hhHL


DSSP  LEeeellllllllllllllllllleeeelleeeeelll
Query DVlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident |                                     
Sbjct DL------------------------------------  234
DSSP  LL------------------------------------


No 53: Query=3mkvA Sbjct=3au2A Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ---------------------lleeeeeeeeelllllllleeeeeeeeelleeeeeelLL
Query ---------------------lttflfrngalldpdhpdllqgfeiliedgfirevsdKP   39
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpGV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllLL


DSSP  LL----------------------------------------------------------
Query IK----------------------------------------------------------   41
ident                                                             
Sbjct ERaelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  LEeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   41
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------lllleeeelllleeEELEEEEEELL--LLLLllhhhhlll
Query --------------------ssnahvidvkgktiMPGLIDLHVHV--VAIEfnlprvatl   79
ident                                        || ||                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStySDGQ---------  351
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLllLLLL---------


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEELL-----------------llLHHHHHHHHLllL
Query pnvlvtlRAVPIMRAMLRRGFTTVRDAG-----------------gaGYPFKQAVESglV  122
ident               |    |                                   |    
Sbjct ------nTLEELWEAAKTMGYRYLAVTDhspavrvaggpspeealkrVGEIRRFNET--H  403
DSSP  ------lLHHHHHHHHHHHLLLEEEEEEelhhhhllllllhhhhhhhHHHHHHHHHH--H


DSSP  LLLEEEELlleeelllllllllllllllllllllllllllllleeelllhhhhhhhhhhh
Query EGPRLFVSgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravree  182
ident   | |                                                       
Sbjct GPPYLLAG----------------------------------------------------  411
DSSP  LLLEEEEE----------------------------------------------------


DSSP  hhhllllEEEELLlllllllllllLLLLlhhhhhhHHHHHHLLlllEEEEE---------
Query lqmgadqIXIMASggvasptdpvgVFGYsedeiraIVAEAQGRgtyVLAHA---------  233
ident                           |                   ||            
Sbjct -------AEVDIH-----------PDGT-----ldYPDWVLREldlVLVSVhsrfnlpka  448
DSSP  -------EEEELL-----------LLLL-----llLLHHHHLLlleEEEELlllllllhh


DSSP  lLHHHHHHHHHLL-LLEEEELL-----------llLHHHHHHHHHHLLEEELLhHHHHhh
Query yTPAAIARAVRCG-VRTIEHGN-----------liDDETARLVAEHGAYVVPTlVTYDal  281
ident         |     |    |                        | |  |      ||  
Sbjct dQTKRLLKALENPfVHVLAHPTarllgrrapieadWEAVFQKAKEKGVAVEID-GYYD--  505
DSSP  hHHHHHHHHHLLLlLLEELLLLlllllllllllllHHHHHHHHHHHLLEEEEE-LLLL--


DSSP  hhhlllllllhhhhllhhhhhllHHHHHHHHHHHLLLLLLLLLLLhhHHHHLLHHHHHHH
Query asegekyglppesiakiadvhgaGLHSIEIMKRAGVKMGFGTDLLgeAQRLQSDEFRILA  341
ident                                   |      ||                 
Sbjct -------------------rmdlPDDLARMAYGMGLWISLSTDAH--QTDHLRFMELAVG  544
DSSP  -------------------llllLHHHHHHHHHLLLLEEEELLLL--LHHHHHHHHHHHH


DSSP  --LLLLHHHhhHHLLHhhhhhLLLLllllllllllllleeeellllllllllllllllll
Query --EVLSPAEviASATIvsaevLGMQdklgrivpgahadvlvvdgnplksvdcllgqgehi  399
ident               |      |                                      
Sbjct taQRAWIGPerVLNTL-dyedLLSW-----------------------------------  568
DSSP  hhHHLLLLLllLHHHL-lhhhHHHH-----------------------------------


DSSP  leeeelleeeeelll
Query plvmkdgrlfvnele  414
ident                
Sbjct --------lkarrgv  575
DSSP  --------hhlllll


No 54: Query=3mkvA Sbjct=3dcpA Z-score=9.9

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
ident                                                             
Sbjct ---------------------------------------------------------XKR    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELLL----LLLLlhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELL---------
Query DLHVHVV----AIEFnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAG---------  107
ident | | |                                      |                
Sbjct DGHTHTEfcphGTHD---------------DVEEXVLKAIELDFDEYSIVEhaplssefx   48
DSSP  EEEELLLllllLLLL---------------LHHHHHHHHHHLLLLEEEEEEellllhhhh


DSSP  ------------------------llLHHHHHHHHlllllLLEEEELlleeellllllll
Query ------------------------gaGYPFKQAVEsglveGPRLFVSgralsqtgghadp  143
ident                               |                             
Sbjct kntagdkeavttasxaxsdlpyyfkkXNHIKKKYA----sDLLIHIG-------------   91
DSSP  hllllllhhhhlllllhhhhhhhhhhHHHHHHHLL----lLLEEEEE-------------


DSSP  lllllllllllllllllllllleeelllhhhhhhhhhhhhhhllllEEEELlllllllll
Query rarsdymppdspcgccvrvgalgrvadgvdevrravreelqmgadqIXIMAsggvasptd  203
ident                                                             
Sbjct ----------------------------------------------FEVDY---------   96
DSSP  ----------------------------------------------EEEEL---------


DSSP  llllLLLLHHHHHHHHHHHhLLLL-leEEEE-----------------------------
Query pvgvFGYSEDEIRAIVAEAqGRGT-yvLAHA-----------------------------  233
ident         ||  |    |  |  |                                    
Sbjct ----LIGYEDFTRDFLNEY-GPQTddgVLSLhflegqggfrsidfsaedynegivqfygg  151
DSSP  ----LLLLHHHHHHHHHHH-HHHLleeEEELleeeelleeeellllhhhhhhhlhhhhll


DSSP  ------lLHHHHHHHHHLL-----LLEEEELLL---------------------lLHHHH
Query ------yTPAAIARAVRCG-----VRTIEHGNL---------------------iDDETA  261
ident                          |   |  |                           
Sbjct feqaqlaYLEGVKQSIEADlglfkPRRXGHISLcqkfqqffgedtsdfseevxekFRVIL  211
DSSP  hhhhhhhHHHHHHHHHHLLlllllLLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHH


DSSP  HHHHHHLLEEELLHhHHHHHHhhlllllllhhhhllhHHHH-llHHHHHHHHHHHLLLLL
Query RLVAEHGAYVVPTLvTYDALAsegekyglppesiakiADVH-gaGLHSIEIMKRAGVKMG  320
ident  ||                                                         
Sbjct ALVKKRDYELDFNT-AGLFKP----------------LCGEtypPKKIVTLASELQIPFV  254
DSSP  HHHHHHLLEEEEEL-HHHHLL----------------LLLLlllLHHHHHHHHHLLLLEE


DSSP  LLLLLLHhhHHHLLHHHHHHHLLLLhhhhhhhllhhhhhhllllllllllllllllleee
Query FGTDLLGeaQRLQSDEFRILAEVLSpaeviasativsaevlgmqdklgrivpgahadvlv  380
ident  | |  |                |                                    
Sbjct YGSDSHG--VQDIGRGYSTYCQKLE-----------------------------------  277
DSSP  EELLLLL--HHHLLLLHHHHHHHLL-----------------------------------


DSSP  ellllllllllllllllllleeeelleeeeelll
Query vdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                   
Sbjct ----------------------------------  277
DSSP  ----------------------------------


No 55: Query=3mkvA Sbjct=3f2bA Z-score=8.0

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeelLLLL-------------------
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdKPIK-------------------   41
ident                                                             
Sbjct -------------------------vrrletiveeerRVVVqgyvfdaevselksgrtll   35
DSSP  -------------------------lllhhhlllleeEEEEeeeeeeeeeeellllleee


DSSP  ------------------------------------------------------lLLLEE
Query ------------------------------------------------------sSNAHV   47
ident                                                             
Sbjct tmkitdytnsilvkmfsrdkedaelmsgvkkgmwvkvrgsvqndtfvrdlviianDLNEI   95
DSSP  eeeeelllleeeeeeelllhhhhhhhhlllllleeeeeeeeeeelllleeeeeeeEEEEE


DSSP  E---elllleeEELEEEEEELL-----LLLLllhhhhllllhhhhhhHHHHHHHHHHHLL
Query I---dvkgktiMPGLIDLHVHV-----VAIEfnlprvatlpnvlvtlRAVPIMRAMLRRG   99
ident                  || |       |                              |
Sbjct AanerqdtapeGEKRVELHLHTpmsqmDAVT----------------SVTKLIEQAKKWG  139
DSSP  LllllllllllLLLLLLLLLLLlllllLLLL----------------LHHHHHHHHHHLL


DSSP  EEEEEELL----lLLHHHHHHHHllLLLLlEEEELlleeellllllllllllllllllll
Query FTTVRDAG----gAGYPFKQAVEsgLVEGpRLFVSgralsqtgghadprarsdymppdsp  155
ident                     |                                       
Sbjct HPAIAVTDhavvqSFPEAYSAAK--KHGM-KVIYG-------------------------  171
DSSP  LLLEEELLlllllLHHHHHHHHH--HHLL-LEEEE-------------------------


DSSP  lllllllllleeelllhhhhhhhhhhhhhhllllEEEElllllllllllllllLLLH---
Query cgccvrvgalgrvadgvdevrravreelqmgadqIXIMasggvasptdpvgvfGYSE---  212
ident                                                             
Sbjct ----------------------------------LEAN---------------IVDDpfh  182
DSSP  ----------------------------------EEEE---------------EELLlee


DSSP  -------------------------------hHHHHHHHHHHlllLLEEeeellhhhhhh
Query -------------------------------dEIRAIVAEAQgrgTYVLahaytpaaiar  241
ident                                      |                      
Sbjct vtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKHRD---GLLV-----------  228
DSSP  eeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHLLL---LEEE-----------


DSSP  hhhllllEEEE----LLLLlhhHHHHHHhHLLEEELLHhhHHHHHhhlllllllhhHHLL
Query avrcgvrTIEH----GNLIddeTARLVAeHGAYVVPTLvtYDALAsegekyglppeSIAK  297
ident                                          |                  
Sbjct -------GSGCdkgeLFDN---VEDIAR-FYDFLEVHP--PDVYK-----------PLYV  264
DSSP  -------ELLLllllLLLL---LLLLHH-HLLLEEELL--HHHHL-----------LLLL


DSSP  -hHHHHL-LHHHHHHHHHHHLLLLLLLLLLLHH---------------------------
Query -iADVHG-AGLHSIEIMKRAGVKMGFGTDLLGE---------------------------  328
ident                                                             
Sbjct kdEEMIKnIIRSIVALGEKLDIPVVATGNVHYLnpedkiyrkilihsqgganplnrhelp  324
DSSP  llHHHHHhHHHHHHHHHHHLLLLEEELLLLLLLlhhhhhhhhhhhhllhhhlllllllll


DSSP  -HHHHLL-HHHHHHHLlLLHHHHHHHLLHHHHHHLLL-----------------------
Query -AQRLQS-DEFRILAEvLSPAEVIASATIVSAEVLGM-----------------------  363
ident                  | |                                        
Sbjct dVYFRTTnEMLDCFSF-LGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeei  383
DSSP  lLLLLLHhHHHHHHHH-HHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct remsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsr  443
DSSP  hhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct gsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykk  503
DSSP  hhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct dghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadkta  563
DSSP  ellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct ygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypa  623
DSSP  hhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct ddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgif  683
DSSP  hllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct ssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlg  743
DSSP  lllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct naqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrk  803
DSSP  lhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct hdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdlda  863
DSSP  llllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct mikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefv  923
DSSP  hhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllle


DSSP  --------------------lllllllllllllleeeellllllllllllllllllleee
Query --------------------qdklgrivpgahadvlvvdgnplksvdcllgqgehiplvm  403
ident                                                             
Sbjct idgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcld  983
DSSP  eelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllll


DSSP  elleeeeelll
Query kdgrlfvnele  414
ident            
Sbjct slpdhnqlslf  994
DSSP  lllllllllll


No 56: Query=3mkvA Sbjct=1bksA Z-score=7.6

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                             
Sbjct -------------------------------------------meryenlfaqlnDRREG   17
DSSP  -------------------------------------------lhhhhhhhhhhhHLLLL


DSSP  EeEELLLlllllhhhhLLLLHHHHHHHHHHHHHHHhhlleeeEEELLL------------
Query DlHVHVVaiefnlprvATLPNVLVTLRAVPIMRAMlrrgfttVRDAGG------------  108
ident      |                           |             |            
Sbjct AfVPFVT--------lGDPGIEQSLKIIDTLIDAG------aDALELGvpfsdpladgpt   63
DSSP  EeEEEEE--------lLLLLHHHHHHHHHHHHHLL------lLLEEEEllllllllllhh


DSSP  --------------------lLHHHHHHHHlllllllEEEELlLEEELLlllllllllll
Query --------------------aGYPFKQAVEsglvegpRLFVSgRALSQTgghadprarsd  148
ident                                                             
Sbjct iqnanlrafaagvtpaqcfemLALIREKHP-------TIPIG-LLMYAN-----------  104
DSSP  hhhhhhhhhhhlllhhhhhhhHHHHHHHLL-------LLLEE-EEELHH-----------


DSSP  llllllllllllllllleeELLLhHHHHHHHHHHHHHLLLLEEEElllllllllllllll
Query ymppdspcgccvrvgalgrVADGvDEVRRAVREELQMGADQIXIMasggvasptdpvgvf  208
ident                                    | | |                    
Sbjct -------------------LVFN-NGIDAFYARCEQVGVDSVLVA---------------  129
DSSP  -------------------HHHL-LLHHHHHHHHHHHLLLEEEEL---------------


DSSP  LLLHHHHHHHHHHHHLLLLLEEEEELLHH---HHHHHHhLLLL-EEEELlllLHHHHHHH
Query GYSEDEIRAIVAEAQGRGTYVLAHAYTPA---AIARAVrCGVR-TIEHGnliDDETARLV  264
ident      |       |              |             |                 
Sbjct DVPVEESAPFRQAALRHNIAPIFICPPNAdddLLRQVA-SYGRgYTYLLalpLHHLIEKL  188
DSSP  LLLHHHLHHHHHHHHHLLLEEEEEELLLLlhhHHHHHH-HHLLlLEEELlllHHHHHHHH


DSSP  HHHLL-EEELLHHHHHhhhhhlllllllhhhhllhhhhhllhhhhhhhhhhhlllLLLL-
Query AEHGA-YVVPTLVTYDalasegekyglppesiakiadvhgaglhsieimkragvkMGFG-  322
ident  |  |                                                       
Sbjct KEYHAaPALQGFGISS----------------------------peqvsaavragAAGAi  220
DSSP  HHHLLlLEEELLLLLL----------------------------hhhhhhhhhhlLLEEe


DSSP  LLLLH-------------------hHHHHL-LHHHhhhhllllhhhhhhhllhhhhhhll
Query TDLLG-------------------eAQRLQ-SDEFrilaevlspaeviasativsaevlg  362
ident                                                             
Sbjct SGSAIvkiieknlaspkqmlaelrsFVSAMkAASR-------------------------  255
DSSP  ELLHHhhhhhhllllhhhhhhhhhhHHHHHhHLLL-------------------------


DSSP  llllllllllllllleeeellllllllllllllllllleeeelleeeeelll
Query mqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                                     
Sbjct ----------------------------------------------------  255
DSSP  ----------------------------------------------------


No 57: Query=3mkvA Sbjct=2yb1A Z-score=5.4

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
ident                                                            |
Sbjct ---------------------------------------------------------aNI    3
DSSP  ---------------------------------------------------------lLE


DSSP  EEEEL---lLLLLllhhhhllllhhhhhhhhhHHHHHHHHLLEEEEEELL----lLLHHH
Query DLHVH---vVAIEfnlprvatlpnvlvtlravPIMRAMLRRGFTTVRDAG----gAGYPF  113
ident ||| |                                   |                   
Sbjct DLHFHsrtsDGAL----------------tptEVIDRAAARAPALLALTDhdctgGLAEA   47
DSSP  ELLLLllllLLLL----------------lhhHHHHHHHLLLLLEEEELLlllllLHHHH


DSSP  HHHHHlllLLLLEEEELlleeelllllllllllllllllllllllllllllleeelllhh
Query KQAVEsglVEGPRLFVSgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvd  173
ident   |       |                                                 
Sbjct AAAAA---RRGIPFLNG-------------------------------------------   61
DSSP  HHHHH---HLLLLEEEE-------------------------------------------


DSSP  hhhhhhhhhhhhllllEEEELLllllllllllLLLL--llhhhhhhhhHHHHL-------
Query evrravreelqmgadqIXIMASggvasptdpvGVFG--ysedeiraivAEAQG-------  224
ident                      |          |                           
Sbjct ----------------VEVSVS---------wGRHTvhivglgidpaePALAAglksire   96
DSSP  ----------------EEEEEE---------eLLEEeeeeeellllllHHHHHhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  224
ident                                                             
Sbjct grlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrky  156
DSSP  lhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhl


DSSP  ------------------------LLLLeeeeellhhhhhhhhhlllLEEEELL---llL
Query ------------------------RGTYvlahaytpaaiaravrcgvRTIEHGN---liD  257
ident                                                  | |        
Sbjct ltpgkpgyvshqwasledavgwivGAGG------------------mAVIAHPGrydmgR  198
DSSP  lllllllllllllllhhhhhhhhhHLLL------------------eEEELLHHhllllH


DSSP  HHHHHHHHHHL----LEEELLHHHHhhhhhhlllllllhhhhllhhhhHLLH-HHHHHHH
Query DETARLVAEHG----AYVVPTLVTYdalasegekyglppesiakiadvHGAG-LHSIEIM  312
ident     ||                                                      
Sbjct TLIERLILDFQaaggQGIEVASGSH-----------------------SLDDmHKFALHA  235
DSSP  HHHHHHHHHHHhlllLEEEEEELLL-----------------------LHHHhHHHHHHH


DSSP  HHHLLLLLLLLLLL-HHHHhhlLHHHhhHHLLLlhhhhhhhllhHHHHhLLLLlllllll
Query KRAGVKMGFGTDLL-GEAQrlqSDEFriLAEVLspaeviasatiVSAEvLGMQdklgriv  371
ident  | |     | |            |   |                  | |          
Sbjct DRHGLYASSGSDFHaPGED-vgHTED--LPPIC---------rpIWRE-LEAR-------  275
DSSP  HHHLLEEEEELLLLlLLLL-llLLLL--LLLLL---------llHHHH-LHHH-------


DSSP  lllllleeeellllllllllllllllllleeeelleeeeelll
Query pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
ident                                            
Sbjct ----------------------------------ilrpadaen  284
DSSP  ----------------------------------lllllhhhl


No 58: Query=3mkvA Sbjct=2anuA Z-score=5.2

back to top
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                           | 
Sbjct ------------------------------------------------------tEWLLC    6
DSSP  ------------------------------------------------------lEEEEE


DSSP  EEEELL--LLLLllhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELLL----------
Query DLHVHV--VAIEfnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG----------  108
ident | |||                                   |   |               
Sbjct DFHVHTnxSDGH---------------lPLGEVVDLFGKHGVDVVSITDHivdrrtleqr   51
DSSP  EEEELLllLLLL---------------lLHHHHHHHHHHLLLLEEEEEEEeelhhhhhhh


DSSP  ----------------lLHHHHHHHHllLLLL----LEEEELLLEEELLLLLLLllllll
Query ----------------aGYPFKQAVEsgLVEG----PRLFVSGRALSQTGGHADprarsd  148
ident                                       |         |           
Sbjct krngeplgaitedkfqdYLKRLWREQ--KRAWeeygXILIPGVEITNNTDLYHI------  103
DSSP  hhllllllllllllhhhHHHHHHHHH--HHHHhhhlLEEEEEEEEEELLLLEEE------


DSSP  llllllllllllllllleeelllhhhhhhhhhhHHHHlllleeeelllllllllllllll
Query ymppdspcgccvrvgalgrvadgvdevrravreELQMgadqiximasggvasptdpvgvf  208
ident                                                             
Sbjct ----------------------------vavdvKEYV-----------------------  112
DSSP  ----------------------------eeellLLLL-----------------------


DSSP  lllhhHHHHHHHHHHLLLLLEEEEE--------llhHHHHHHHHlLLLEEEE----lLLL
Query gysedEIRAIVAEAQGRGTYVLAHA--------ytpAAIARAVRcGVRTIEH----gNLI  256
ident          ||         | |             |   |         |         
Sbjct -dpslPVEEIVEKLKEQNALVIAAHpdrkklswylwANXERFKD-TFDAWEIanrddLFN  170
DSSP  -llllLHHHHHHHHHHLLLEEEELLllllllllhhhHLLLLLLL-LLLEEEEeelleELH


DSSP  LhhhHHHHhhhllEEELlhhhhhhhhhhlllllllhhhhllhhhhhllhhhhhhhhhhhl
Query DdetARLVaehgaYVVPtlvtydalasegekyglppesiakiadvhgaglhsieimkrag  316
ident                |                                            
Sbjct S-vgVKKY-----RYVA-------------------------------------------  181
DSSP  H-hhHLLL-----LEEE-------------------------------------------


DSSP  lllllLLLLLhhHHHHLLHHhhhhhllllhhhhhhhLLHH---hhHHLLLllllllllll
Query vkmgfGTDLLgeAQRLQSDEfrilaevlspaeviasATIV---saEVLGMqdklgrivpg  373
ident        |                                                    
Sbjct -----NSDFH--ELWHVYSW--------------ktLVKSeknieAIKEA----------  210
DSSP  -----ELLLL--LHHHHLLE--------------eeEEEElllhhHHHHH----------


DSSP  lllleeeellllllllllLLLLllllleeeelleeeeelll
Query ahadvlvvdgnplksvdcLLGQgehiplvmkdgrlfvnele  414
ident                   |                      
Sbjct --------irkntdvaiyLXRK-------------------  224
DSSP  --------hhhllleeeeELLL-------------------


No 59: Query=3mkvA Sbjct=3e38A Z-score=4.8

back to top
DSSP  lleeeeeeeeeLLLLLllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE
Query lttflfrngalLDPDHpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
ident                                                             
Sbjct ---aqrrneiqVPDLD-------------------------------------gyTTLKC   20
DSSP  ---llllllllLLLLL-------------------------------------llEEEEE


DSSP  EEEELL----LLLLllhhhhllllhhhhhhhhHHHHHHHHHLLEEEEEELL---------
Query DLHVHV----VAIEfnlprvatlpnvlvtlraVPIMRAMLRRGFTTVRDAG---------  107
ident | | |                                   | |                 
Sbjct DFHXHSvfsdGLVW-----------------pTVRVDEAYRDGLDAISLTEhieyrphkq   63
DSSP  ELLLLLllllLLLL-----------------hHHHHHHHHHLLLLEELLEEellllllll


DSSP  -------lLLHHHHHHHHlllLLLLEEEELlleeelllllllllllllllllllllllll
Query -------gAGYPFKQAVEsglVEGPRLFVSgralsqtgghadprarsdymppdspcgccv  160
ident                  |     |  |                                 
Sbjct dvvsdhnrSFDLCREQAE---KLGILLIKG------------------------------   90
DSSP  lllllllhHHHHHHHHHH---HHLLEELLE------------------------------


DSSP  llllleeelllhhhhhhhhhhhhhhllllEEEELLL--lllllllllllllllHHHHHHH
Query rvgalgrvadgvdevrravreelqmgadqIXIMASG--gvasptdpvgvfgysEDEIRAI  218
ident                                |                            
Sbjct -----------------------------SEITRAXapghfnaiflsdsnpleQKDYKDA  121
DSSP  -----------------------------EEEELLLllleeeeelllllhhhlLLLHHHH


DSSP  HHHHHLLLLLeeeeellhhhhhhhhhlllLEEEELL-------lLLHH-hhhhhHHHL--
Query VAEAQGRGTYvlahaytpaaiaravrcgvRTIEHGN-------lIDDE-tarlvAEHG--  268
ident   ||   |                         |                       |  
Sbjct FREAKKQGAF-------------------XFWNHPGwdsqqpdtTKWWpehtalYQEGcx  162
DSSP  HHHHHHLLLE-------------------EEELLLLllllllllLLLLhhhhhhHHLLll


DSSP  LEEE-LLHHhhhhhhhhlllllllhhhhllhhhhhllHHHHHHHHHHHLLLLLLLLLLLH
Query AYVV-PTLVtydalasegekyglppesiakiadvhgaGLHSIEIMKRAGVKMGFGTDLLG  327
ident                                          |              |   
Sbjct HGIEvANGH--------------------------lyXPEAIQWCLDKNLTXIGTSDIHQ  196
DSSP  LEEEeEELL--------------------------eeLLHHHHHHHHHLLEEEEELLLLL


DSSP  hHHHHllhhhhhhhllllhhhhhhhLLHH----hhhhLLLL-------------------
Query eAQRLqsdefrilaevlspaeviasATIV----saevLGMQ-------------------  364
ident                                                             
Sbjct -PIQT--------dydfekgehrtxTFVFakerslqgIREAldnrrtaayfhelligred  247
DSSP  -LHHH--------hllhhhllllleEEEEellllhhhHHHHhhllleeeeelleeellhh


DSSP  ----------llllllllllllleeeelLLLLLL--------------------------
Query ----------dklgrivpgahadvlvvdGNPLKS--------------------------  388
ident                                |                            
Sbjct llrpffekcvkieevsrneqgvtlsitnVTDLVLklkktahdtllvyfrdxtlkphtryt  307
DSSP  hhhhhhhhheeeeeeeeelleeeeeeeeLLLLLEeeeelllllleellleeeellleeee


DSSP  ---------lllllllllllleeeelleeeeelll
Query ---------vdcllgqgehiplvmkdgrlfvnele  414
ident                                    
Sbjct vrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeeeellllllleeeeeeeeeeeelleeeeeeeel