Results: dupa

Query: 3ls9A

MOLECULE: TRIAZINE HYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3ls9-A 74.2  0.0  453   453  100 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   2:  1j6p-A 48.3  2.0  398   407   21 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   3:  2paj-A 47.5  2.1  399   421   29 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   4:  4rdv-B 43.0  2.5  418   451   21 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   5:  2uz9-A 42.5  2.3  403   444   19 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   6:  2oof-A 36.0  2.8  367   403   19 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   7:  4cqb-A 34.4  2.4  355   402   19 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  1k6w-A 32.9  2.8  358   423   16 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   9:  3mtw-A 30.5  3.0  346   404   20 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  10:  3mkv-A 29.8  2.7  339   414   21 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  11:  3icj-A 29.6  2.7  326   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  12:  2vun-A 28.4  3.4  336   385   19 PDB  MOLECULE: ENAMIDASE;                                                 
  13:  3nqb-A 28.2  3.2  326   587   20 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  2imr-A 28.2  3.8  306   380   21 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  15:  4c5y-A 27.8  2.9  345   436   19 PDB  MOLECULE: OCHRATOXINASE;                                             
  16:  1onx-A 27.4  3.2  327   390   19 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  17:  1yrr-B 26.7  3.5  308   334   15 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  3ooq-A 24.2  2.7  279   384   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  19:  2ogj-A 23.7  4.0  311   379   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  3giq-A 23.6  3.7  328   475   19 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  21:  1a4m-A 23.4  3.0  280   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  22:  1gkp-A 23.3  3.4  330   458   17 PDB  MOLECULE: HYDANTOINASE;                                              
  23:  3gri-A 22.3  3.5  317   422   20 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  3e74-A 22.0  3.6  311   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  25:  4b3z-D 21.3  3.7  324   477   14 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  26:  3k2g-B 18.2  3.4  247   358   11 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  27:  1bf6-A 17.8  3.3  234   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  28:  1a5k-C 17.8  3.7  316   566   16 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  29:  2ob3-A 17.3  4.2  244   329   16 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  30:  2y1h-B 17.0  3.2  232   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  31:  2vc5-A 16.6  4.3  247   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  32:  3gg7-A 15.9  2.9  208   243   14 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  33:  3cjp-A 15.5  3.3  219   262    8 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  34:  4mup-B 14.9  3.1  216   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  35:  2ffi-A 14.7  3.4  220   273    8 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  36:  3irs-A 14.6  3.9  226   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  37:  4hk5-D 14.3  3.7  236   380   11 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  38:  2dvt-A 14.2  3.7  223   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  39:  4ofc-A 14.2  3.9  228   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  40:  3pnu-A 14.1  4.2  249   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  41:  2a3l-A 14.0  3.6  275   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  42:  4dlf-A 13.9  3.8  223   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  43:  4qrn-A 13.9  3.6  228   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  44:  2gwg-A 13.6  4.3  234   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  45:  1v77-A 13.5  2.8  180   202    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  46:  2qpx-A 13.3  4.3  232   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  47:  1itq-A 12.8  3.5  224   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  48:  4dzi-C 12.8  3.8  221   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3qy6-A 11.5  3.5  186   247   10 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1j5s-A 11.4  3.8  228   451    7 PDB  MOLECULE: URONATE ISOMERASE;                                         
  51:  3iac-A 11.2  3.9  230   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3dcp-A 10.2  3.1  172   277    7 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3f2b-A  9.5  6.3  180   994    8 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  3au2-A  9.0  3.8  181   575   14 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  1m65-A  7.9  3.8  180   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  7.6  3.9  185   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  6.2  3.4  148   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  6.2  4.0  159   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  6.0  3.8  167   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3ls9A Sbjct=3ls9A Z-score=74.2

back to top
DSSP  LEEEEEEEEEELLLLLLLEEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELEE
Query MILIRGLTRVITFDDQERELEDADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGLI   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MILIRGLTRVITFDDQERELEDADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGLI   60
DSSP  LEEEEEEEEEELLLLLLLEEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELEE


DSSP  EEEELHHHHHHLLLHHHLLLLHHHHHHHHHHHHHHHHHLLLLLHHHHHHHHHHHHHHHHH
Query NSHQHLYEGAMRAIPQLERVTMASWLEGVLTRSAGWWRDGKFGPDVIREVARAVLLESLL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NSHQHLYEGAMRAIPQLERVTMASWLEGVLTRSAGWWRDGKFGPDVIREVARAVLLESLL  120
DSSP  EEEELHHHHHHLLLHHHLLLLHHHHHHHHHHHHHHHHHLLLLLHHHHHHHHHHHHHHHHH


DSSP  LLEEEEEEEELLLLLLLLLLHHHHHHHHHHHHLLEEEEEELLLLLLHHHLLLLLHHHLLL
Query GGITTVADQHLFFPGATADSYIDATIEAATDLGIRFHAARSSMTLGKSEGGFCDDLFVEP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GGITTVADQHLFFPGATADSYIDATIEAATDLGIRFHAARSSMTLGKSEGGFCDDLFVEP  180
DSSP  LLEEEEEEEELLLLLLLLLLHHHHHHHHHHHHLLEEEEEELLLLLLHHHLLLLLHHHLLL


DSSP  HHHHHHHHHHHHHHHLLLLLLLLEEEEELLLLLLLLLHHHHHHHHHHHHHHLLEEEEEEL
Query VDRVVQHCLGLIDQYHEPEPFGMVRIALGPCGVPYDKPELFEAFAQMAADYDVRLHTHFY  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VDRVVQHCLGLIDQYHEPEPFGMVRIALGPCGVPYDKPELFEAFAQMAADYDVRLHTHFY  240
DSSP  HHHHHHHHHHHHHHHLLLLLLLLEEEEELLLLLLLLLHHHHHHHHHHHHHHLLEEEEEEL


DSSP  LLLHHHHHHHHHLLLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHH
Query EPLDAGMSDHLYGMTPWRFLEKHGWASDRVWLAHAVVPPREEIPEFADAGVAIAHLIAPD  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EPLDAGMSDHLYGMTPWRFLEKHGWASDRVWLAHAVVPPREEIPEFADAGVAIAHLIAPD  300
DSSP  LLLHHHHHHHHHLLLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHH


DSSP  HHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHLHHHLLLLHHHLLLH
Query LRMGWGLAPIREYLDAGITVGFGTTGSASNDGGNLLGDLRLAALAHRPADPNEPEKWLSA  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LRMGWGLAPIREYLDAGITVGFGTTGSASNDGGNLLGDLRLAALAHRPADPNEPEKWLSA  360
DSSP  HHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHLHHHLLLLHHHLLLH


DSSP  HHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHHLLLLLLL
Query RELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLDGVDRVGVHDPAIGLIMTGLSDRA  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLDGVDRVGVHDPAIGLIMTGLSDRA  420
DSSP  HHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHHLLLLLLL


DSSP  LEEEELLEEEEELLEELLLLHHHHHHHHHHHLL
Query SLVVVNGQVLVENERPVLADLERIVANTTALIP  453
ident |||||||||||||||||||||||||||||||||
Sbjct SLVVVNGQVLVENERPVLADLERIVANTTALIP  453
DSSP  LEEEELLEEEEELLEELLLLHHHHHHHHHHHLL


No 2: Query=3ls9A Sbjct=1j6pA Z-score=48.3

back to top
DSSP  -LEEEEEEeEEELLLllLLEEEEEEEEEELLEEEEEEL-LLLLlllleEEELLLEEEEEL
Query -MILIRGLtRVITFDdqERELEDADILIDGPKIVAVGK-DLSDrsvsrTIDGRGMIALPG   58
ident     |              |       |    |  |              |  |    | 
Sbjct hHXIIGNC-LILKDF--SSEPFWGAVEIENGTIKRVLQgEVKV-----DLDLSGKLVXPA   52
DSSP  lEEEEEEE-EELLLL--LLLLEEEEEEEELLEEEEEEElLLLL-----LEELLLEEEEEL


DSSP  EEEEEELHHHHHHLLLhhHLLLLHHHHHH-HHHHHHHHhhhlllLLHHHHHHHHHHHHHH
Query LINSHQHLYEGAMRAIpqLERVTMASWLE-GVLTRSAGwwrdgkFGPDVIREVARAVLLE  117
ident | | | |      |     |      ||   ||                          |
Sbjct LFNTHTHAPXTLLRGV--AEDLSFEEWLFsKVLPIEDR------LTEKXAYYGTILAQXE  104
DSSP  EEEEEELHHHHHHLLL--LLLLLHHHHHHlLHHHHHLL------LLHHHHHHHHHHHHHH


DSSP  HHHLLEEEEEEEELlllllllllHHHHHHHHHHHHLLEEEEEELLLLLLhhhlllllhhh
Query SLLGGITTVADQHLffpgatadsYIDATIEAATDLGIRFHAARSSMTLGkseggfcddlf  177
ident     ||    |                   |  | | |    |                 
Sbjct XARHGIAGFVDXYF---------HEEWIAKAVRDFGXRALLTRGLVDSN-----------  144
DSSP  HHLLLEEEEEEEEL---------LHHHHHHHHHHHLLEEEEEEEELLLL-----------


DSSP  llLHHHHHHHHHHHHHHHLLLLllLLEEEEELLLLLLLLLHHHHHHHHHHHHHHLLEEEE
Query vePVDRVVQHCLGLIDQYHEPEpfGMVRIALGPCGVPYDKPELFEAFAQMAADYDVRLHT  237
ident            | |       |  |      ||        |        |         
Sbjct -gDDGGRLEENLKLYNEWNGFE--GRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTI  201
DSSP  -lLLLLHHHHHHHHHHHHLLHH--HLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLEEE


DSSP  EELL-LLHHhhhhhhhllLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEEL
Query HFYE-PLDAgmsdhlygmTPWRFLEKHGWASDRVWLAHAVVPPREEIPEFADAGVAIAHL  296
ident | ||                       |        || |  |        |      | 
Sbjct HLYEtSKEE---------YDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHN  252
DSSP  EELLlLLLL---------LLLHHHHLLLLLLLLEEEEELLLLLHHHHHHHLLLLEEEEEL


DSSP  HHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHLHHHllllHHH
Query IAPDLRMGWGLAPIREYLDAGITVGFGTTGSASNDGGNLLGDLRLAALAHRPAdpnePEK  356
ident  |  |  | | ||       |  |  || | |||   ||    ||| |            
Sbjct PASNLKLGNGIAPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASLLQKAQ----NPR  308
DSSP  HHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHHHLL----LLL


DSSP  LLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHHLLl
Query WLSARELLRMATRGSAECLGRpDLGVLEEGRAADIACWRLDGVDRVGVHDPAIGLIMTGl  416
ident  |     |   |   |   |    |  |||  ||     ||      |      |     
Sbjct NLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVIDLDLPEXFPVQNIKNHLVHAF-  366
DSSP  LLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELLLHHHLLHHHHHHHHHHLL-


DSSP  LLLLLEEEELLEEEEELLEELLLLHHHHHHHHHHHLL----
Query SDRASLVVVNGQVLVENERPVLADLERIVANTTALIP----  453
ident |       | |            | |               
Sbjct SGEVFATXVAGKWIYFDGEYPTIDSEEVKRELARIEKelys  407
DSSP  LLLLLEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHhhhl


No 3: Query=3ls9A Sbjct=2pajA Z-score=47.5

back to top
DSSP  -LEEEEEEEEEELLLL----LLLEEEEEEEEEELLEEEEEELlLLLLLLLEEEELLLEEE
Query -MILIRGLTRVITFDD----QERELEDADILIDGPKIVAVGKdLSDRSVSRTIDGRGMIA   55
ident    |||      |               || | |  | | |  |  |      |      
Sbjct pSTLIRNAAAIMTGGRgtadDPSRVPGPDIRIVGDTIDAIGA-LAPRPGETIVDATDCVI   59
DSSP  lEEEEELLLEELLLLLllllLLLLLLLLLEEEELLEEEEELL-LLLLLLLEEEELLLLEE


DSSP  EELEEEEEELHHHHHHLLLhhhllllhhhhhhhhhhHHHHhhhlllLLHHHHHHHHHHHH
Query LPGLINSHQHLYEGAMRAIpqlervtmaswlegvltRSAGwwrdgkFGPDVIREVARAVL  115
ident  |   | | ||                           |       |     |  ||  |
Sbjct YPAWVNTHHHLFQSLLKGE----------------pFRAL------FDERRFRLAARIGL   97
DSSP  EELEELLLLLHHHHHLLLL----------------lLHHH------LLHHHHHHHHHHHH


DSSP  HHHHHLLEEEEEEEELLLLLLLLLLHHHHHHHHHHHHLLEEEEEELLLLLLHHH-lllll
Query LESLLGGITTVADQHLFFPGATADSYIDATIEAATDLGIRFHAARSSMTLGKSE-ggfcd  174
ident  |    |  ||||                  | |  || ||   |   |           
Sbjct IELARSGCATVADHNYVYYPGMPFDSSAILFEEAEKLGLRFVLLRGGATQTRQLeadlpt  157
DSSP  HHHHLLLEEEEEELLLLLLLLLLLLHHHHHHHHHHHLLLEEEEEELLLLLLLLLlllllh


DSSP  hHHLLLHHHHHHHHHHHHHHHLLLLLLLLEEEEELLLL-LLLLLHHHHHHHHHHHHHHLL
Query dLFVEPVDRVVQHCLGLIDQYHEPEPFGMVRIALGPCG-VPYDKPELFEAFAQMAADYDV  233
ident  |  |  |  |     |   ||   |  | |    |        |      |  |     
Sbjct aLRPETLDAYVADIERLAARYHDASPRAMRRVVMAPTTvLYSISPREMRETAAVARRLGL  217
DSSP  hHLLLLHHHHHHHHHHHHHHLLLLLLLLLEEEEELLLLlLLLLLHHHHHHHHHHHHHLLL


DSSP  EEEEEELlllhhhhhhhhhLLLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEE
Query RLHTHFYepldagmsdhlyGMTPWRFLEKHGWASDRVWLAHAVVPPREEIPEFADAGVAI  293
ident | | |              |  |  |   | |    || || |     ||   |  |   
Sbjct RMHSHLS------------GKSPVAFCGEHDWLGSDVWYAHLVKVDADEIALLAQTGTGV  265
DSSP  EEEEELL------------LLLHHHHHHHLLLLLLLEEEELLLLLLHHHHHHHHHHLLEE


DSSP  EELHHHHHHLlllllLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHLHHHLlll
Query AHLIAPDLRMgwglaPIREYLDAGITVGFGTTGSASNDGGNLLGDLRLAALAHRPADpne  353
ident ||      |      | ||  |||  |  |  | |||             || |      
Sbjct AHCPQSNGRL-----PVREMADAGVPVSIGVDGAASNEAADMISEVHMTWLAQRARL---  317
DSSP  EELHHHHHLL-----LLLLHHHHLLLEEELLLHHHHLLLLLHHHHHHHHHHHHHHLL---


DSSP  hhhlLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHH
Query pekwLSARELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLDGVDRVGVHDPAIGLIM  413
ident      |  |     | | |   |    |    | |||||  |||     | ||||||   
Sbjct ----ASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRLDDPRYFGLHDPAIGPVA  373
DSSP  ----LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHH


DSSP  LLLLLLLLEEEELLEEEEELLEELLLLHHHHHHHHHHHLL--------
Query TGLSDRASLVVVNGQVLVENERPVLADLERIVANTTALIP--------  453
ident  |           |   |        |                     
Sbjct SGGRPSVMALFSAGKRVVVDDLIEGVDIKELGGEARRVVRellrevvv  421
DSSP  LLLLLEEEEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHhhhhhhhl


No 4: Query=3ls9A Sbjct=4rdvB Z-score=43.0

back to top
DSSP  lEEEEeEEEEELLlllLLEEEEEEEEEE-LLEEEEEE--LLLLLlllleEEELlLEEEEE
Query mILIRgLTRVITFddqERELEDADILID-GPKIVAVG--KDLSDrsvsrTIDGrGMIALP   57
ident    |    |       |         |                           |   ||
Sbjct -SAIF-AERALLP---EGWARNVRFEISaDGVLAEIRpdANADG-----AERL-GGAVLP   49
DSSP  -LEEE-EEEEEEL---LEEEEEEEEEELlLLLEEEEEllLLLLL-----LEEL-LLLEEE


DSSP  LEEEEEELHHHHHHLLlhHHLL-----LLHHHHHHHHHHHHHHhhhlllLLHHHHHHHHH
Query GLINSHQHLYEGAMRAipQLER-----VTMASWLEGVLTRSAGwwrdgkFGPDVIREVAR  112
ident |  | | |    ||      |           | |      |         |  |   | 
Sbjct GMPNLHSHAFQRAMAG--LAEVagnpnDSFWTWRELMYRMVAR------LSPEQIEVIAC  101
DSSP  LEEEEEELHHHHHHLL--LLLLlllllLLHHHHHHHHHHHHLL------LLHHHHHHHHH


DSSP  HHHHHHHHLLEEEEEEEELLLL---LLLL---LLHHHHHHHHHHHHLLEEEEEELLLLLL
Query AVLLESLLGGITTVADQHLFFP---GATA---DSYIDATIEAATDLGIRFHAARSSMTLG  166
ident     | |  | | ||  |       |               ||   ||            
Sbjct QLYIEMLKAGYTAVAEFHYVHHdldGRSYadpAELSLRISRAASAAGIGLTLLPVLYSHA  161
DSSP  HHHHHHHHHLEEEEEEEELLLLlllLLLLlllLHHHHHHHHHHHHHLLEEEEEELLLLEE


DSSP  HhHLLLLLHHH---LLLHHHHHHHHHHHHhHHLLllllLLEEEEELLLLLLLLLHHHHHH
Query KsEGGFCDDLF---VEPVDRVVQHCLGLIdQYHEpepfGMVRIALGPCGVPYDKPELFEA  223
ident    |                       |     |          |         |     
Sbjct GfGGQPASEGQrrfINGSEAYLELLQRLR-APLE---aAGHSLGLCFHSLRAVTPQQIAT  217
DSSP  ElLLEELLHHHlllLLLHHHHHHHHHHHH-HHHH---hHLLEELEEELLLLLLLHHHHHH


DSSP  HHHHhHHHLLEEEEEELLL-LHHHHHHHHHLLLHHHHHHHLLLLLLLEEEEELLLLLHHH
Query FAQMaADYDVRLHTHFYEP-LDAGMSDHLYGMTPWRFLEKHGWASDRVWLAHAVVPPREE  282
ident         |   | |  |            |  |   |        |  | ||      |
Sbjct VLAA-GHDDLPVHIHIAEQqKEVDDCQAWSGRRPLQWLYENVAVDQRWCLVHATHADPAE  276
DSSP  HHLL-LLLLLLEEEEELLLhHHHHHHHHHHLLLHHHHHHHHLLLLLLEEEEELLLLLHHH


DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLlllLLLLHHHHHHHH
Query IPEFADAGVAIAHLIAPDLRMGWGLAPIREYLDAGITVGFGTTGSasnDGGNLLGDLRLA  342
ident     |  |             | |  |    |  |   | |               ||  
Sbjct VAAMARSGAVAGLCLSTEANLGDGIFPATDFLAQGGRLGIGSDSH---VSLSVVEELRWL  333
DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL---LLLLHHHHHHHH


DSSP  HHHLHHHLLllHHHLL-------LHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEEE
Query ALAHRPADPnePEKWL-------SARELLRMATRGSAECLGRpDLGVLEEGRAADIACWR  395
ident     |  |       |         | |   |  | |  ||    | |  || ||     
Sbjct EYGQRLRDR--KRNRLyrddqpmIGRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLD  390
DSSP  HHHHHHHHL--LLLLLlllllllHHHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEEL


DSSP  LLLHHHLLLL--LHHHHHHHLlLLLL-LLEEEELLEEEEELLEEllLLHHHHHHHHHHHL
Query LDGVDRVGVH--DPAIGLIMTgLSDR-ASLVVVNGQVLVENERPvlADLERIVANTTALI  452
ident                         ||    | | |   |   |   |  ||         
Sbjct GNDPYLASAEgdALLNRWLFA-GGDRqVRDVMVAGRWVVRDGRH--AGEERSARAFVQVL  447
DSSP  LLLHHHHLLLlhHHHHHHHHH-LLHHhEEEEEELLEEEELLLLL--LLHHHHHHHHHHHH


DSSP  L---
Query P---  453
ident     
Sbjct Gell  451
DSSP  Hhhl


No 5: Query=3ls9A Sbjct=2uz9A Z-score=42.5

back to top
DSSP  --LEEEEEeeEEELLLLLL--LEEEEEEEEEE-LLEEEEEELL----lLLLLL----lEE
Query --MILIRGltRVITFDDQE--RELEDADILID-GPKIVAVGKD----lSDRSV----sRT   47
ident       ||               | |         |||                      
Sbjct plAHIFRG--TFVHSTWTCpmEVLRDHLLGVSdSGKIVFLEEAsqqekLAKEWcfkpcEI   58
DSSP  llLEEEEE--EEEELLLLLllEEEEEEEEEELlLLLEEEEEEHhhhhhHHHHHlllhhHE


DSSP  EELL-LEEEEELEEEEEELHHHHHHLLLhhHLLLLHHHHHHHH-HHHHHhhhhlllLLHH
Query IDGR-GMIALPGLINSHQHLYEGAMRAIpqLERVTMASWLEGV-LTRSAgwwrdgkFGPD  105
ident           |||   | |                   ||                   |
Sbjct RELShHEFFMPGLVDTHIHASQYSFAGS--SIDLPLLEWLTKYtFPAEH-----rfQNID  111
DSSP  EELLlLLEEEELEEEEEEEHHHHHHLLL--LLLLLHHHHHHHLhHHHHH-----hhHLHH


DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELLLlllllLLHHHHHHHHHHHHLLEEEEEELLLLL
Query VIREVARAVLLESLLGGITTVADQHLFFpgataDSYIDATIEAATDLGIRFHAARSSMTL  165
ident    ||   |    |  | ||                           | |       | |
Sbjct FAEEVYTRVVRRTLKNGTTTACYFATIH-----TDSSLLLADITDKFGQRAFVGKVCMDL  166
DSSP  HHHHHHHHHHHHHHHLLEEEEEEELLLL-----HHHHHHHHHHHHHHLLEEEEELEELLL


DSSP  LHhhlllLLHHHLLLHHHHHHHHHHHHHHHLlllllLLEEEEELLLLLLLLLHHHHHHHH
Query GKseggfCDDLFVEPVDRVVQHCLGLIDQYHepepfGMVRIALGPCGVPYDKPELFEAFA  225
ident              |                        |     |         |     
Sbjct ND-----TFPEYKETTEESIKETERFVSEML-qknySRVKPIVTPRFSLSCSETLMGELG  220
DSSP  LL-----LLLLLLLLHHHHHHHHHHHHHHHH-hhllLLEEEEEEELLHHHLLHHHHHHHH


DSSP  HHHHHHLLEEEEEELLL-LHHHHHHHHHL--LLHHHHHHHLLLLLLLEEEEELLLLLHHH
Query QMAADYDVRLHTHFYEP-LDAGMSDHLYG--MTPWRFLEKHGWASDRVWLAHAVVPPREE  282
ident   |   |     |  |          ||           |          ||      ||
Sbjct NIAKTRDLHIQSHISENrDEVEAVKNLYPsyKNYTSVYDKNNLLTNKTVMAHGCYLSAEE  280
DSSP  HHHHHHLLEEEEEELLLhHHHHHHHHHLLllLLHHHHHHHLLLLLLLEEEEELLLLLHHH


DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLlLLLLLLHHHHHHHH
Query IPEFADAGVAIAHLIAPDLRMGWGLAPIREYLDAGITVGFGTTGSaSNDGGNLLGDLRLA  342
ident    |   |  |||     |    |     | |      | ||           |   | |
Sbjct LNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVA-GGYSYSMLDAIRRA  339
DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL-LLLLLLHHHHHHHH


DSSP  HHHLHHHLLLL-HHHLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELLL--
Query ALAHRPADPNE-PEKWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLDG--  398
ident          |   || |   |  | || |    ||     |  | |   |          
Sbjct VMVSNILLINKvNEKSLTLKEVFRLATLGGSQALGLDgEIGNFEVGKEFDAILINPKAsd  399
DSSP  HHHHHHHHHLLlLLLLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELLLLll


DSSP  HHHLL---------LLLHHHHHHHllLLLL--LLEEEELLEEEeellEELLllhhhhhhh
Query VDRVG---------VHDPAIGLIMtgLSDR--ASLVVVNGQVLveneRPVLadlerivan  447
ident                           | |      | | |        |           
Sbjct SPIDLfygdffgdiSEAVIQKFLY--LGDDrnIEEVYVGGKQV----VPFS---------  444
DSSP  LLLLLllhhhhlllLLHHHHHHHH--HLLHhhEEEEEELLEEE----ELLL---------


DSSP  hhhhll
Query ttalip  453
ident       
Sbjct ------  444
DSSP  ------


No 6: Query=3ls9A Sbjct=2oofA Z-score=36.0

back to top
DSSP  ---LEEEEEEeEEELLLLLL---LEEEEEEEEEELLEEEEEELL--LLLLllLEEEELLL
Query ---MILIRGLtRVITFDDQE---RELEDADILIDGPKIVAVGKD--LSDRsvSRTIDGRG   52
ident               |          ||          | |      |         |  |
Sbjct lncERVWLNV-TPATLRSDLadyGLLEPHALGVHEGRIHALVPXqdLKYP--AHWQDXKG   57
DSSP  lllLEEEEEE-EELLLLLLLlllLLLLLEEEEEELLEEEEEEEHhhLLLL--LLLEELLL


DSSP  EEEEELEEEEEELHHHhHHLLLHHHLLL-------lhhhhhHHHHHHHHHHHhllLLLHH
Query MIALPGLINSHQHLYEgAMRAIPQLERV-------tmaswlEGVLTRSAGWWrdgKFGPD  105
ident     ||||  | ||   |       |                |                |
Sbjct KLVTPGLIDCHTHLIF-AGSRAEEFELRqkgvpyaeiarkgGGIISTVRATR---AASED  113
DSSP  LEEEELEEEEEELLLL-LLLLHHHHHHHhhlllhhhhhhllLLHHHHHHHHH---HLLHH


DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELLLLlLLLL--LHHHHHHHHHHHHLLEEEEEEL-L
Query VIREVARAVLLESLLGGITTVADQHLFFPgATAD--SYIDATIEAATDLGIRFHAARS-S  162
ident    | |          | |||            |              | ||        
Sbjct QLFELALPRVKSLIREGVTTVEIKSGYGL-TLEDelKXLRVARRLGEALPIRVKTTLLaA  172
DSSP  HHHHHHHHHHHHHHHHLEEEEEEELLLLL-LHHHhhHHHHHHHHHHHHLLLEEEEEEEeE


DSSP  LLLlhhhllllLHHH---llLHHHHH-HHHHHHHHHHLllllllleEEEELLLLLL-LLL
Query MTLgkseggfcDDLF---vePVDRVV-QHCLGLIDQYHepepfgmvRIALGPCGVP-YDK  217
ident                      |                          |           
Sbjct HAV-------pPEYRddpdsWVETICqEIIPAAAEAGL--------ADAVDVFCEHiGFS  217
DSSP  LLL-------lHHHLllhhhHHHHHHhLHHHHHHHLLL--------LLEEEEEELLlLLL


DSSP  HHHHHHHHHHHHHHLLEEEEEELLLLHHhhhhhhhllLHHHhhhhlLLLL-LLEEEEELL
Query PELFEAFAQMAADYDVRLHTHFYEPLDAgmsdhlygmTPWRflekhGWAS-DRVWLAHAV  276
ident     |     |  |      |                           |        |  
Sbjct LAQTEQVYLAADQYGLAVKGHXDQLSNL---------GGST-----LAANfGALSVDHLE  263
DSSP  HHHHHHHHHHHHHLLLEEEEEELLLLLL---------LHHH-----HHHHlLLLEEEELL


DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLL-LLLLHHHHHHLLLEEEELLLLLL-LLLLLL
Query VPPREEIPEFADAGVAIAHLIAPDLRMGW-GLAPIREYLDAGITVGFGTTGSA-SNDGGN  334
ident     | |   |  ||    |           | |      ||                  
Sbjct YLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKAGVPXAVSSDINPgTAPIVS  323
DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHLLLLEEELLLLLLlLLLLLL


DSSP  HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHHHHHHLLL-LLLLLLLLLLLLLEEE
Query LLGDLRLAALAHrpadpnepekWLSARELLRMATRGSAECLGR-PDLGVLEEGRAADIAC  393
ident |      |               |   |     ||  |  ||    || |  |  ||   
Sbjct LRXAXNXACTLF----------GLTPVEAXAGVTRHAARALGEqEQLGQLRVGXLADFLV  373
DSSP  HHHHHHHHHHHH----------LLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLLEEE


DSSP  EELllhhhllllLHHHHHHHLLLLLLLLEEEELLEEEEElleellllhhhhhhhhhhhll
Query WRLdgvdrvgvhDPAIGLIMTGLSDRASLVVVNGQVLVEnerpvladlerivanttalip  453
ident |                |      |     ||||                          
Sbjct WNC---------GHPAELSYLIGVDQLVSRVVNGEETLH---------------------  403
DSSP  ELL---------LLLLHHHHLLLLLLEEEEEELLEELLL---------------------


No 7: Query=3ls9A Sbjct=4cqbA Z-score=34.4

back to top
DSSP  ----LEEEEEeEEEElllllLLEEEeEEEEEELLEEEEEELLLLlLLLLEEEELLLEEEE
Query ----MILIRGlTRVItfddqERELEdADILIDGPKIVAVGKDLSdRSVSRTIDGRGMIAL   56
ident        ||           |      || | |  |           |   ||  |    
Sbjct skdfDLIIRN-AYLS-----EKDSV-YDIGIVGDRIIKIEAKIE-GTVKDEIDAKGNLVS   52
DSSP  llleEEEEEE-EEEL-----LLLEE-EEEEEELLEEEEEELLLL-LLEEEEEELLLLLEE


DSSP  ELEEEEEELHHHHHHL------LLHHhLLLLHHHHHHHHHHHHHhhhhllLLLHHHHHHH
Query PGLINSHQHLYEGAMR------AIPQlERVTMASWLEGVLTRSAgwwrdgKFGPDVIREV  110
ident ||    | |                     |     |  |                |   
Sbjct PGFVDAHTHMDKSFTStgerlpKFWS-RPYTRDAAIEDGLKYYK------NATHEEIKRH  105
DSSP  ELEEEEEELHHHLLLLllllllLLLL-LLLLHHHHHHHHHHHHH------HLLHHHHHHH


DSSP  HHHHHHHHHHLLEEEEEEEELLLLLllLLLHHHHHHHHHHHH--LLEEEEEELL--LLLL
Query ARAVLLESLLGGITTVADQHLFFPGatADSYIDATIEAATDL--GIRFHAARSS--MTLG  166
ident          | |                     |  ||   |   |              
Sbjct VIEHAHMQVLHGTLYTRTHVDVDSV-aKTKAVEAVLEAKEELkdLIDIQVVAFAqsGFFV  164
DSSP  HHHHHHHHHHLLEEEEEEEEELLLL-lLLHHHHHHHHHHHHLllLLEEEEEEELllLLLL


DSSP  hhhlllllhhHLLLHHHHHHHHHHHHhhhlllllllleeEEELlLLLL--------lLLH
Query kseggfcddlFVEPVDRVVQHCLGLIdqyhepepfgmvrIALGpCGVP--------yDKP  218
ident             |                             |    |            
Sbjct ----------DLESESLIRKSLDMGC-------------DLVG-GVDPatrennvegSLD  200
DSSP  ----------LLLHHHHHHHHHHHLL-------------LEEE-LLLLllllllhhhHHH


DSSP  HHHHHHHHHHhhhlLEEEEEElLLLHHHhhhhhhllLHHHHHHHLL---lLLLLEEEEEL
Query ELFEAFAQMAadydVRLHTHFyEPLDAGmsdhlygmTPWRFLEKHG---wASDRVWLAHA  275
ident   |           |    |                     |           ||   ||
Sbjct LCFKLAKEYD----VDIDYHI-HDIGTV------gvYSINRLAQKTiengYKGRVTTSHA  249
DSSP  HHHHHHHHLL----LEEEEEE-LLLHHH------hhHHHHHHHHHHhhllLLLLEEEEEL


DSSP  LLL-------LHHHHHHHHHHLLEEEELHHHHhhllLLLLLHHHHHHLLLEEEELLLLLL
Query VVP-------PREEIPEFADAGVAIAHLIAPDlrmgWGLAPIREYLDAGITVGFGTTGSA  328
ident             | ||   | |                  |    | |||  |       
Sbjct WCFadapsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCASDNIR  305
DSSP  LHHhhllhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEELLLLL


DSSP  ---LLLL-LLHHHHHHHHHHHLHhhllllhhhllLHHHHHHHLLHHHHHHLL-LLLLlLL
Query ---SNDG-GNLLGDLRLAALAHRpadpnepekwlSARELLRMATRGSAECLG-RPDLgVL  383
ident       | |                                | |   |  ||        
Sbjct dfwVPFGnGDMVQGALIETQRLE------lktnrDLGLIWKMITSEGARVLGiEKNY-GI  358
DSSP  lllLLLLlLLHHHHHHHHHHHHL------lllhhHHHHHHHHHLHHHHHHHLlHHHL-LL


DSSP  LLLLLLLEEEEELllhhhllllLHHHHHHHLllLLLLLEEEELLEEEEELLEELLllhhh
Query EEGRAADIACWRLdgvdrvgvhDPAIGLIMTglSDRASLVVVNGQVLVENERPVLadler  443
ident | |  ||                     |          |  ||   |  |  |      
Sbjct EVGKKADLVVLNS---------LSPQWAIID--QAKRLCVIKNGRIIVKDEVIVA-----  402
DSSP  LLLLLLLEEEELL---------LLHHHHHHH--LLLEEEEEELLEEEEELLEELL-----


DSSP  hhhhhhhhll
Query ivanttalip  453
ident           
Sbjct ----------  402
DSSP  ----------


No 8: Query=3ls9A Sbjct=1k6wA Z-score=32.9

back to top
DSSP  -LEEEEEeEEEEllllllLEEEEEEEEEELLEEEEEELL-lllllLLEEEELLLEEEEEL
Query -MILIRGlTRVItfddqeRELEDADILIDGPKIVAVGKD-lsdrsVSRTIDGRGMIALPG   58
ident     |    |         |     |     || |               |       | 
Sbjct aLQTIIN-ARLP------GEEGLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPP   53
DSSP  lLLEEEE-ELLL------LLLLEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELL


DSSP  EEEEEELHHHHHHLLL-HHHLLLLHHHHHHHHhHHHHHHhhlllLLHHHHHHHHHHHHHH
Query LINSHQHLYEGAMRAI-PQLERVTMASWLEGVlTRSAGWwrdgkFGPDVIREVARAVLLE  117
ident     | ||               |     |                 |     |   |  
Sbjct FVEPHIHLDTTQTAGQpNWNQSGTLFEGIERW-AERKAL-----LTHDDVKQRAWQTLKW  107
DSSP  EEEEEELLLLLLLLLLlLLLLLLLHHHHHHHH-HLLHHH-----LLHHHHHHHHHHHHHH


DSSP  HHHLLEEEEEEEELLLLlLLLL--LHHHHHHHHHHhHLLEEEEEELL--LLLLhhhllll
Query SLLGGITTVADQHLFFPgATAD--SYIDATIEAATdLGIRFHAARSS--MTLGkseggfc  173
ident     ||  |         ||                  |            |        
Sbjct QIANGIQHVRTHVDVSD-ATLTalKAMLEVKQEVA-PWIDLQIVAFPqeGILS-------  158
DSSP  HHHLLEEEEEEEEELLL-LLLHhhHHHHHHHHHHL-LLLEEEEEEELllLLLL-------


DSSP  lhhhLLLH-HHHHHHHHHHHhhhlllllllleeEEELLlLLLLL-----LHHHHHHHHHH
Query ddlfVEPV-DRVVQHCLGLIdqyhepepfgmvrIALGPcGVPYD-----KPELFEAFAQM  227
ident                                     |              |        
Sbjct ----YPNGeALLEEALRLGA-------------DVVGA-IPHFEftreyGVESLHKTFAL  200
DSSP  ----LLLHhHHHHHHHHLLL-------------LEEEE-LHHHLllhhhHHHHHHHHHHH


DSSP  HHHHLLEEEEEELLLLhHHHHhhhhllLHHHHHHhLLLL----LLLEEEEELLLL-----
Query AADYDVRLHTHFYEPLdAGMSdhlygmTPWRFLEkHGWA----SDRVWLAHAVVP-----  278
ident |  ||     |  |      |                        ||   |         
Sbjct AQKYDRLIDVHCDEID-DEQS------RFVETVA-ALAHhegmGARVTASHTTAMhsyng  252
DSSP  HHHHLLEEEEEELLLL-LLLL------LHHHHHH-HHHHhhllHHHEEEEELHHHhhllh


DSSP  --LHHHHHHHHHHLLEEEELHHHHHHLLL---------LLLLHHHHHHLLLEEEELLLLL
Query --PREEIPEFADAGVAIAHLIAPDLRMGW---------GLAPIREYLDAGITVGFGTTGS  327
ident              |                        |     | |  || | ||    
Sbjct ayTSRLFRLLKMSGINFVANPLVNIHLQGrfdtypkrrGITRVKEMLESGINVCFGHDDV  312
DSSP  hhHHHHHHHHHHHLLEEEELHHHHHHHLLlllllllllLLLLHHHHHHLLLLEEELLLLL


DSSP  L---LLLL-LLHHHHHHHHHHHLHhhllllhhhllLHHHHHHHLLHHHHHHLLLLLLlLL
Query A---SNDG-GNLLGDLRLAALAHRpadpnepekwlSARELLRMATRGSAECLGRPDLgVL  383
ident        |  | |  |                        |   |  ||  |   |    
Sbjct FdpwYPLGtANMLQVLHMGLHVCQ------lmgygQINDGLNLITHHSARTLNLQDY-GI  365
DSSP  LlllLLLLlLLHHHHHHHHHHHLL------lllhhHHHHHHHHHLHHHHHHLLLLLL-LL


DSSP  LLLLLLLEEEEELllhhhllllLHHHHHHHLllLLLLLEEEELLEEEEELLeellllhhh
Query EEGRAADIACWRLdgvdrvgvhDPAIGLIMTglSDRASLVVVNGQVLVENErpvladler  443
ident   |  |                                  |  | |              
Sbjct AAGNSANLIILPA---------ENGFDALRR--QVPVRYSVRGGKVIASTQ-paqttvyl  413
DSSP  LLLLLLLEEEELL---------LLHHHHHHH--LLLLLEEEELLEEEEELL-llleeeel


DSSP  hhhhhhhhll
Query ivanttalip  453
ident           
Sbjct eqpeaidykr  423
DSSP  lleeeellll


No 9: Query=3ls9A Sbjct=3mtwA Z-score=30.5

back to top
DSSP  --LEEEEeEEEEELLLlLLLEEEEEEEEEELLEEEEEEL-LLLLLLLLEEEELLLEEEEE
Query --MILIRgLTRVITFDdQERELEDADILIDGPKIVAVGK-DLSDRSVSRTIDGRGMIALP   57
ident           |                      |   ||            |  |   ||
Sbjct aeIKAVS-AARLLDVA-SGKYVDNPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLP   58
DSSP  llEEEEE-EEEEEELL-LLEEEELEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEE


DSSP  LEEEEEELHHHhhHLLLhhhllllhhhhhhhHHHHHHhhhhlLLLLhHHHHHHHHHHHHH
Query GLINSHQHLYEgaMRAIpqlervtmaswlegVLTRSAgwwrdGKFGpDVIREVARAVLLE  117
ident |||  | ||                          |                |  |    
Sbjct GLIDMHVHLDS--LAEV--------------GGYNSL-----EYSD-RFWSVVQTANAKK   96
DSSP  LEEEEEELLLL--LLLL--------------LHHHHH-----HLLH-HHHHHHHHHHHHH


DSSP  HHHLLEEEEEEEELLllllllLLHHHHHHHHHH---HHLLEEEEEE-LLLLLLhhhllLL
Query SLLGGITTVADQHLFfpgataDSYIDATIEAAT---DLGIRFHAAR-SSMTLGkseggFC  173
ident  |  | |||            |       ||       | |   |  |    |       
Sbjct TLEAGFTTVRNVGAA------DYDDVGLREAIDagyVPGPRIVTAAiSFGATG--ghcDS  148
DSSP  HHHLLEEEEEELLLL------LLHHHHHHHHHHlllLLLLEEEELLlLEELLL--lllLL


DSSP  LH------HHLL----LHHHHHHHHHHHHHHHLllllllleeEEELLLLLL---------
Query DD------LFVE----PVDRVVQHCLGLIDQYHepepfgmvrIALGPCGVP---------  214
ident                   |        |                   |            
Sbjct TFfppsmdQKNPfnsdSPDEARKAVRTLKKYGA---------QVIXICATGgvfsrgnep  199
DSSP  LLllhhhlLLLLllllLHHHHHHHHHHHHHLLL---------LEEEEELLLlllllllll


DSSP  ---LLLHHHHHHHHHHHHHHLLEEEEEELLllhhhhhhhhhllLHHHHHHHLLLllllEE
Query ---YDKPELFEAFAQMAADYDVRLHTHFYEpldagmsdhlygmTPWRFLEKHGWasdrVW  271
ident        |   |    |         |                   |     |       
Sbjct gqqQLTYEEMKAVVDEAHMAGIKVAAHAHG------------aSGIREAVRAGV----DT  243
DSSP  lllLLLHHHHHHHHHHHHHLLLEEEEEELL------------hHHHHHHHHLLL----LE


DSSP  EEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL--LH
Query LAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG-------------------WGLA--PI  310
ident   ||     | |      |      |                            |     
Sbjct IEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdiGELQreNF  303
DSSP  EEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhhHHHHhhHH


DSSP  HHHHHLLLEEEELLLLLlLLLLLLHHHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHH
Query REYLDAGITVGFGTTGSaSNDGGNLLGDLRLAALAhrpadpnepekWLSARELLRMATRG  370
ident |  | ||     ||        |                                 ||  
Sbjct RKALKAGVKMVYGTDAG-IYPHGDNAKQFAVMVRY-----------GATPLQAIQSATLT  351
DSSP  HHHHHHLLEEELLLLLL-LLLLLLHHHHHHHHHHL-----------LLLHHHHHHHLLHH


DSSP  HHHHLLLL-LLLLLLLLLLLLEEEEELllhhhlllllHHHHHHHllllLLLLEEEELLEE
Query SAECLGRP-DLGVLEEGRAADIACWRLdgvdrvgvhdPAIGLIMtglsDRASLVVVNGQV  429
ident  || |||  | |    ||  |                                |   | |
Sbjct AAEALGRSkDVGQVAVGRYGDMIAVAG----------DPLADVT--tlEKPVFVMKGGAV  399
DSSP  HHHHHLLLlLLLLLLLLLLLLEEEELL----------LLLLLHH--hhHLLLEEEELLEE


DSSP  EEELleellllhhhhhhhhhhhll
Query LVENerpvladlerivanttalip  453
ident                         
Sbjct VKAP-------------------x  404
DSSP  EELL-------------------l


No 10: Query=3ls9A Sbjct=3mkvA Z-score=29.8

back to top
DSSP  --LEEEEEEeEEELLLlLLLEEEEEEEEEELLEEEEEEL-LLLLLLLlEEEELLLEEEEE
Query --MILIRGLtRVITFDdQERELEDADILIDGPKIVAVGK-DLSDRSVsRTIDGRGMIALP   57
ident     | |        |     |    |||    |  |             ||  |    |
Sbjct ltTFLFRNG-ALLDPD-HPDLLQGFEILIEDGFIREVSDkPIKSSNA-HVIDVKGKTIMP   57
DSSP  llEEEEEEE-EELLLL-LLLLEEEEEEEEELLEEEEEELlLLLLLLL-EEEELLLLEEEE


DSSP  LEEEEEELHHHHHHlllhhhllllhhhhhhHHHHhHHHHhhllllLHHHHHHHHHHHHHH
Query GLINSHQHLYEGAMraipqlervtmaswleGVLTrSAGWwrdgkfGPDVIREVARAVLLE  117
ident |||  | |                            |                |      
Sbjct GLIDLHVHVVAIEF----------------NLPR-VATL------PNVLVTLRAVPIMRA   94
DSSP  LEEEEEELLLLLLL----------------LHHH-HLLL------LHHHHHHHHHHHHHH


DSSP  HHHLLEEEEEEEELlllllllllhHHHHHHHHH---HHLLEEEEEE-LLLLLLhhhlllL
Query SLLGGITTVADQHLffpgatadsyIDATIEAAT---DLGIRFHAAR-SSMTLGkseggfC  173
ident  |  | ||| |                   |       | |           |       
Sbjct MLRRGFTTVRDAGG---------aGYPFKQAVEsglVEGPRLFVSGrALSQTG---ghaD  142
DSSP  HHHLLEEEEEELLL---------lLHHHHHHHHlllLLLLEEEELLlEEELLL---lllL


DSSP  LHH---------------------hLLLH-HHHHHHHHHHHHHHLllllllleeEEELLL
Query DDL---------------------fVEPV-DRVVQHCLGLIDQYHepepfgmvrIALGPC  211
ident                          |    | |                           
Sbjct PRArsdymppdspcgccvrvgalgrVADGvDEVRRAVREELQMGA---------DQIXIM  193
DSSP  LLLlllllllllllllllllllleeELLLhHHHHHHHHHHHHHLL---------LLEEEE


DSSP  LLL------------LLLHHHHHHHHHHHHHHLLEEEEEELLllhhhhhhhhhllLHHHH
Query GVP------------YDKPELFEAFAQMAADYDVRLHTHFYEpldagmsdhlygmTPWRF  259
ident                        |    |         | |                   
Sbjct ASGgvasptdpvgvfGYSEDEIRAIVAEAQGRGTYVLAHAYT------------pAAIAR  241
DSSP  LLLllllllllllllLLLHHHHHHHHHHHHLLLLLEEEEELL------------hHHHHH


DSSP  HHHLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL---------------
Query LEKHGWasdrVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG---------------  304
ident     |         |      |     |  |                             
Sbjct AVRCGV----RTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesiak  297
DSSP  HHHLLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhhll


DSSP  ----LLLL--LHHHHHHLLLEEEELLLLLLllLLLLHHHHHHHHHHhlhhhllllhhhLL
Query ----WGLA--PIREYLDAGITVGFGTTGSAsnDGGNLLGDLRLAALahrpadpnepekWL  358
ident      |     |     ||   ||||               |  |              |
Sbjct iadvHGAGlhSIEIMKRAGVKMGFGTDLLG-eAQRLQSDEFRILAE------------VL  344
DSSP  hhhhHLLHhhHHHHHHHHLLLLLLLLLLLH-hHHHHLLHHHHHHHL------------LL


DSSP  LHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhhhlllllHHHHHHHLlLL
Query SARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvdrvgvhdPAIGLIMTgLS  417
ident |  |    ||  ||| ||    ||    |  ||                         | 
Sbjct SPAEVIASATIVSAEVLGMQdKLGRIVPGAHADVLVVDG----------NPLKSVDClLG  394
DSSP  LHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL----------LLLLLLLLlLL


DSSP  LL--LLEEEELLEEEEELleellllhhhhhhhhhhhll
Query DR--ASLVVVNGQVLVENerpvladlerivanttalip  453
ident       ||   |   |                      
Sbjct QGehIPLVMKDGRLFVNE------------------le  414
DSSP  LLllLLEEEELLEEEEEL------------------ll


No 11: Query=3ls9A Sbjct=3icjA Z-score=29.6

back to top
DSSP  -LEEEEEEeEEELLLLLLLEEeeEEEEEELLEEEEEEL--LLLL---LLLLEEEELLLEE
Query -MILIRGLtRVITFDDQERELedADILIDGPKIVAVGK--DLSD---RSVSRTIDGRGMI   54
ident  |          |              |        |                ||  |  
Sbjct cMKALING-TIYTSFSPVKKV--SGLVISNERVLYAGDssTALRiaeLAGGEIIDLKGKF   57
DSSP  lEEEEELL-EEEEEELLEEEE--LEEEEELLEEEEEELhhHHHHhhhHHLLEEEELLLLE


DSSP  EEELEEEEEELHHH-HHHL-----------------------------------------
Query ALPGLINSHQHLYE-GAMR-----------------------------------------   72
ident   |    || || | |                                            
Sbjct VMPAFFDSHLHLDElGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
DSSP  EEELEEEEEELHHHhHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll


DSSP  -------------llHHHL---------------------lllhhhhhhhhHHHHHHHHh
Query -------------aiPQLE---------------------rvtmaswlegvLTRSAGWWr   98
ident                                                             
Sbjct redldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIIN-  176
DSSP  hhhhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHH-


DSSP  lLLLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLLllllllLHHHHHHHHH--HHHLLEE
Query dGKFGPDVIREVARAVLLESLLGGITTVADQHLFFpgatadSYIDATIEAA--TDLGIRF  156
ident                     |  |   |                 |  |      |    
Sbjct eKILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE------KALKALFELEreGRLKMNV  230
DSSP  hLLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH------HHHHHHHHHHhlLLLLLEE


DSSP  EEEELLllllhhhlllllhhhlllhhHHHHHH--HHHHhhHLLLlllLLEE-EEELlLLL
Query HAARSSmtlgkseggfcddlfvepvdRVVQHC--LGLIdqYHEPepfGMVR-IALGpCGV  213
ident  |  |                             | |     |       |        |
Sbjct FAYLSP--------------------ELLDKLeeLNLG--KFEG---RRLRiWGVX-LFV  264
DSSP  EEEELH--------------------HHHHHHhhHLLL--LEEL---LLEEeEEEE-EEL


DSSP  L------------------------LLLHHHHHHHHHHHHHHLLEEEEEELLllhhhhhh
Query P------------------------YDKPELFEAFAQMAADYDVRLHTHFYEpldagmsd  249
ident                                       |         |           
Sbjct DgslgartallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAIG--------  316
DSSP  LllllllllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEELL--------


DSSP  hhhllLHHHHHHHL---LLLLllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL--
Query hlygmTPWRFLEKH---GWASdrVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG--  304
ident                     |      ||               | |             
Sbjct ----dKAVDVALDAfeeAEFS--GRIEHASLVRDDQLERIKELKVRISAQPHFIVSDWwi  370
DSSP  ----hHHHHHHHHHhhhHLLL--LEEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLLlh


DSSP  ---------llLLLHHHHHHlLLEEEELLLLLllLLLLLHHHHHHHHHHHLHHHLlllhH
Query ---------wgLAPIREYLDaGITVGFGTTGSasNDGGNLLGDLRLAALAHRPADpnepE  355
ident                          || |                 |             
Sbjct vnrvgeerakwAYRLKTLSS-ITKLGFSTDSP--IEPADPWVSIDAAVNRYVVDP----G  423
DSSP  hhhhhhhhhhhLLLHHHHHH-HLLEEELLLLL--LLLLLHHHHHHHHHHLLLLLH----H


DSSP  HLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELllhhhlllllHHHHhhhll
Query KWLSARELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLdgvdrvgvhdPAIGlimtg  415
ident    |  | |   | |||      ||| || |  |                          
Sbjct ERVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDR----------DPLK-----  468
DSSP  HLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELL----------LLLL-----


DSSP  lllllleeeelleeeeelleellllhhhhhhhhhhhll
Query lsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                       
Sbjct --------------------------------------  468
DSSP  --------------------------------------


No 12: Query=3ls9A Sbjct=2vunA Z-score=28.4

back to top
DSSP  -LEEEEEEEEEELLL-LLLLEEEeEEEEEELLEEEEEEL-LLLL-LLLLEEEELLLEEEE
Query -MILIRGLTRVITFD-DQERELEdADILIDGPKIVAVGK-DLSD-RSVSRTIDGRGMIAL   56
ident     |         |           |      | | |   |         ||  |    
Sbjct sKTIIKNIGKIVSGDiKSPVLQA-DTIVVEDGLIAAIGGeELMKdAGDATIIDAAGSTVT   59
DSSP  lEEEEELLLEEELLLlLLLEELL-LEEEEELLEEEEEELhHHHLlLLLLEEEELLLLEEE


DSSP  ELEEEEEELHH---hHHHLLlhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhH
Query PGLINSHQHLY---eGAMRAipqlervtmaswlegvltrsagwwrdgkfgpdvirevarA  113
ident |||   | |                                                   
Sbjct PGLLDTHVHVSggdyAPRQK-------------------------------------tmD   82
DSSP  ELEEEEEELLLllleEHHHL-------------------------------------eeL


DSSP  HHHHHHHLLEEEEEEEELL----LLLLLLL------LHHHHHHHHHHhHLLEEEE-EELL
Query VLLESLLGGITTVADQHLF----FPGATAD------SYIDATIEAATdLGIRFHA-ARSS  162
ident      | || ||            |   |               |    |   |  |   
Sbjct FISSALHGGVTTMISAGSPhfpgRPKDAAGtkalaiTLSKSYYNARP-AGVKVHGgAVIL  141
DSSP  HHHHHHLLLEEEEEELLLLllllLLLLHHHhhhhhhHHHHHHHHLLH-HHLEEELlEELL


DSSP  LlllhhhlllllhhhlLLHHhhHHHHHHHHHHHLllllllleeEEELLLL-llLLLHHHH
Query MtlgkseggfcddlfvEPVDrvVQHCLGLIDQYHepepfgmvrIALGPCG-vpYDKPELF  221
ident                                               |  |      ||  
Sbjct E---------------KGLT--EEDFIEMKKEGV---------WIVGEVGlgtIKNPEDA  175
DSSP  L---------------LLLL--HHHHHHHHHLLL---------LEEEEELlllLLLHHHH


DSSP  HHHHHHHHHHLLEEEEEELLLLhhHHHHhhhllLHHHHHHhLLLLlllEEEEELL----L
Query EAFAQMAADYDVRLHTHFYEPLdaGMSDhlygmTPWRFLEkHGWAsdrVWLAHAV----V  277
ident       |         |         |                         |       
Sbjct APMVEWAHKHGFKVQMHTGGTS-iPGSS----tVTADDVI-KTKP---DVVSHINggptA  226
DSSP  HHHHHHHHHLLLEEEEELLLLL-lLLLL----lLLHHHHH-HHLL---LEEELLLllllL


DSSP  LLHHHHHHHH-HHLLEEEELhHHHHhllLLLL--LHHHHHHLLL--EEEELLLLLL-LLL
Query PPREEIPEFA-DAGVAIAHLiAPDLrmgWGLA--PIREYLDAGI--TVGFGTTGSA-SND  331
ident     |          |               |    |     |    | ||         
Sbjct ISVQEVDRIMdETDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPSgTGL  282
DSSP  LLHHHHHHHHhHLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLLlLLL


DSSP  LLL-HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLL
Query GGN-LLGDLRLAALAHrpadpnepekWLSARELLRMATRGSAECLGRpDLGVLEEGRAAD  390
ident      |      |                      |||  |    |    ||   |  ||
Sbjct IPLgILRNMCQIASMS----------DIDPEVAVCMATGNSTAVYGL-NTGVIAPGKEAD  331
DSSP  LLLhHHHHHHHHHHHL----------LLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLL


DSSP  EEEEELLLHhhLLLLlHHHHHHHLLLLLLLLEEEELLEEEEELLEellllhhhhhhhhhh
Query IACWRLDGVdrVGVHdPAIGLIMTGLSDRASLVVVNGQVLVENERpvladlerivantta  450
ident                  | | |  |     | |   |   |   |               
Sbjct LIIMDTPLG--SVAE-DAMGAIAAGDIPGISVVLIDGEAVVTKSR------ntppakraa  382
DSSP  EEEEELLLL--LLLL-LHHHHHHHLLLLEEEEEEELLEEEELLLL------lllllllll


DSSP  hll
Query lip  453
ident    
Sbjct kil  385
DSSP  eel


No 13: Query=3ls9A Sbjct=3nqbA Z-score=28.2

back to top
DSSP  ------------------------LEEEEEEeEEELLLlLLLEEEeEEEEEELLEEEEEE
Query ------------------------MILIRGLtRVITFDdQERELEdADILIDGPKIVAVG   36
ident                           || |                ||| | |  |  | 
Sbjct epadlnddtlraravaaargdqrfDVLITGG-TLVDVV-TGELRP-ADIGIVGALIASVH   57
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELL-EEELLL-LLLEEE-LEEEEELLEEEEEE


DSSP  L-LLLLLlLLEEEELLLEEEEELEEEEEELHHHHHhlllhhhllllhhhhhhhhhhhhhh
Query K-DLSDRsVSRTIDGRGMIALPGLINSHQHLYEGAmraipqlervtmaswlegvltrsag   95
ident             ||  |    ||||  | |                              
Sbjct EpASRRD-AAQVIDAGGAYVSPGLIDTHXHIESSX-------------------------   91
DSSP  LlLLLLL-EEEEEELLLLEEEELEEEEEELHHHHL-------------------------


DSSP  hhhlllllhhhhhHHHHHHHHHHHHLLEEEEEEEEL--LLLLllLLLHHHHHHHHHHHHL
Query wwrdgkfgpdvirEVARAVLLESLLGGITTVADQHL--FFPGatADSYIDATIEAATDLG  153
ident                  |        | ||                        |   | 
Sbjct -------------ITPAAYAAAVVARGVTTIVWDPHefGNVH--GVDGVRWAAKAIENLP  136
DSSP  -------------LLHHHHHHHHHLLLEEEEEELLHhhHHHH--LHHHHHHHHHHHLLLL


DSSP  LEEEEEELLLL-LLHHhllllLHHH--LLLHHHHHHhHHHHHhhhllllllllEEEEELL
Query IRFHAARSSMT-LGKSeggfcDDLF--VEPVDRVVQhCLGLIdqyhepepfgmVRIALGP  210
ident  |      |                             |                     
Sbjct LRAILLAPSCVpSAPG-----LERGgaDFDAAILAD-LLSWP-----------EIGGIAE  179
DSSP  LEEEEEELLLLlLLLL-----LLLLllLLLHHHHHH-HHLLL-----------LEEEEEE


DSSP  LLLL-------llLHHHHHHHHHHHhhhlLEEEEEELllLHHHhhhhhhllLHHHHHHHL
Query CGVP-------ydKPELFEAFAQMAadydVRLHTHFYepLDAGmsdhlygmTPWRFLEKH  263
ident                    |              |                         
Sbjct IXNXrgvierdprXSGIVQAGLAAE----KLVCGHAR--GLKN--------ADLNAFXAA  225
DSSP  ELLHhhhhlllhhHHHHHHHHHHHL----LEEEELLL--LLLH--------HHHHHHHHL


DSSP  LLllllEEEEELLLllhhhHHHHHHHLLEEEELhHHHHhllLLLLLHH-HHHHL---LLE
Query GWasdrVWLAHAVVppreeIPEFADAGVAIAHLiAPDLrmgWGLAPIR-EYLDA---GIT  319
ident |           |            ||  |             |               |
Sbjct GV----SSDHELVS--gedLXAKLRAGLTIELR-GSHD---HLLPEFVaALNTLghlPQT  275
DSSP  LL----LEELLLLL--hhhHHHHHHLLLEEEEE-LLLH---HHHHHHHhHHHHHlllLLL


DSSP  EEELLLLLLLLLL---LLHHHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHHLL
Query VGFGTTGSASNDG---GNLLGDLRLAALAhrpadpnepekWLSARELLRMATRGSAECLG  376
ident |   |      |    | |    |                 |     || ||   |  ||
Sbjct VTLCTDDVFPDDLlqgGGLDDVVRRLVRY-----------GLKPEWALRAATLNAAQRLG  324
DSSP  EEEELLLLLHHHHhhlLLHHHHHHHHHHL-----------LLLHHHHHHHHLHHHHHHHL


DSSP  LLLLLLLLLLLLLLEEEEElllhhhlllllhhhHHHHllllLLLLEEEELLEEEEELLEE
Query RPDLGVLEEGRAADIACWRldgvdrvgvhdpaiGLIMtglsDRASLVVVNGQVLVENERP  436
ident | |||    || |||                   |        |  |   |    |  | 
Sbjct RSDLGLIAAGRRADIVVFE--------------DLNG----FSARHVLASGRAVAEGGRX  366
DSSP  LLLLLLLLLLLLLLEEEEL--------------LLLL----LLEEEEEELLEEEEELLEE


DSSP  LLLLH-------------------------------------------------------
Query VLADL-------------------------------------------------------  441
ident                                                             
Sbjct LVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfv  426
DSSP  LLLLLllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  441
ident                                                             
Sbjct vppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxal  486
DSSP  llllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhh


DSSP  ---------------------------hhhhhHHHH------------------------
Query ---------------------------erivaNTTA------------------------  450
ident                                                             
Sbjct aanavigtgggxavasegkvtailplplsglvSDAPleevarafedlreavgkvvewqpp  546
DSSP  hhhhhhhllleeeeeelleeeeeeelllllllLLLLhhhhhhhhhhhhhhhhhhllllll


DSSP  --------------------------------------hll
Query --------------------------------------lip  453
ident                                          
Sbjct ylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllhhhhhlllllllllleelllleeelllleeellleeel


No 14: Query=3ls9A Sbjct=2imrA Z-score=28.2

back to top
DSSP  leeeEEEEE--EELLlllLLEEEeEEEEeelleeEEEE----LLLLLlllleeeelLLEE
Query miliRGLTR--VITFddqERELEdADILidgpkiVAVG----KDLSDrsvsrtidgRGMI   54
ident     | ||     |                     | |                      
Sbjct -htpRLLTCdvLYTG---AQSPG-GVVV-vgetvAAAGhpdeLRRQY----phaaeERAG   50
DSSP  -lleEEEEEleEELL---EELLE-EEEE-elleeEEEElhhhHHHHL----llleeEELL


DSSP  --EEELEEEEEELHHHhhhlllhhhllLLHHHH--HHHHHHHhhhhhhlllllhhhHHHH
Query --ALPGLINSHQHLYEgamraipqlerVTMASW--LEGVLTRsagwwrdgkfgpdvIREV  110
ident     |   | | ||                                              
Sbjct avIAPPPVNAHTHLDM---sayefqalPYFQWIpeVVIRGRH------------lrGVAA   95
DSSP  leELLLLLEEEEELLL---lhhhhhhlHHHHLLhhHHHHHLL------------llHHHH


DSSP  HHHHHHHHHHLLEEEEEEEELLllllllLLHHHHHHHHhhhHLLEEEEEELLLLLLhhhl
Query ARAVLLESLLGGITTVADQHLFfpgataDSYIDATIEAatdLGIRFHAARSSMTLGkseg  170
ident | |        |   | |              ||                          
Sbjct AQAGADTLTRLGAGGVGDIVWA------PEVMDALLAR---EDLSGTLYFEVLNPF----  142
DSSP  HHHHHHHHHHLLLLLEEEEELL------HHHHHHHHLL---LLLLEEEEEEELLLL----


DSSP  llllhhhllLHHHHHHHHHHHHhHHLLllllLLEEEEELLLLLLLLLHHHHHHHHHHHHH
Query gfcddlfvePVDRVVQHCLGLIdQYHEpepfGMVRIALGPCGVPYDKPELFEAFAQMAAD  230
ident                 |                 |  | |         |       || 
Sbjct ---pdkadeVFAAARTHLERWR-RLER----PGLRLGLSPHTPFTVSHRLMRLLSDYAAG  194
DSSP  ---hhhhhhHHHHHHHHHHHHH-LLLL----LLEEEEEEELLLLLLLHHHHHHHHHHHHH


DSSP  HLLEEEEEELLL-LHHHHHH------------------------HHHL--LLHHHHHHHL
Query YDVRLHTHFYEP-LDAGMSD------------------------HLYG--MTPWRFLEKH  263
ident     |  |  |      |                             |   || | |   
Sbjct EGLPLQIHVAEHpTELEMFRtgggplwdnrmpalyphtlaevigREPGpdLTPVRYLDEL  254
DSSP  HLLLLEEEELLLhHHHHHHHhlllllhhhllhhhllllhhhhhlLLLLllLLHHHHHHHH


DSSP  LLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEEL
Query GWASDRVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMGWGLAPIREYLDAGITVGFG  323
ident |    |  | | |      |   | || |             |         ||  |  |
Sbjct GVLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGVEVALG  314
DSSP  LLHHHLLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLLHHHHHHLLLLEEEL


DSSP  LLLLLLLLLLLHHHHHHHHHHHLHhhllllhhhLLLHHHHHHHLLHHHHHHLLllllLLL
Query TTGSASNDGGNLLGDLRLAALAHRpadpnepekWLSARELLRMATRGSAECLGrpdlGVL  383
ident |   ||    |       |               |  | | | |  |     |       
Sbjct TDSVASGETLNVREEVTFARQLYP---------GLDPRVLVRAAVKGGQRVVG----TPF  361
DSSP  LLLHHHHLLLLLHHHHHHHHHHLL---------LLLHHHHHHHHHHHHHHHHL----LLL


DSSP  LL--lllllEEEEElllhhhlllllhhhhhhhlllLLLLleeeelleeeeelleellllh
Query EE--graadIACWRldgvdrvgvhdpaiglimtglSDRAslvvvngqvlvenerpvladl  441
ident             |                        |                      
Sbjct LRrgetwqeGFRWE---------------------LSRD---------------------  379
DSSP  LLllllllhHHLHH---------------------HLLL---------------------


DSSP  hhhhhhhhhhll
Query erivanttalip  453
ident             
Sbjct -----------l  380
DSSP  -----------l


No 15: Query=3ls9A Sbjct=4c5yA Z-score=27.8

back to top
DSSP  ----LEEEEeEEEEELLLllLLEEEEEEEEEELLEEEEEE--LLLL---LLLLLEEEELl
Query ----MILIRgLTRVITFDdqERELEDADILIDGPKIVAVG--KDLS---DRSVSRTIDGr   51
ident        |      |  |     |  |   |    |  ||   |      ||   |    
Sbjct deakVTIIY-AGLLIPGD--GEPLRNAALVISDKIIAFVGseADIPkkyLRSTQSTHRV-   56
DSSP  llllEEEEE-EEEELLLL--LLLEEEEEEEEELLEEEEEEehHHLLhhhHHHLLLEEEE-


DSSP  lEEEEELEEEEEELHhHHHHlllhhhllllhhhhhhHHHHHHHHhhhlllLLHHHHHHHH
Query gMIALPGLINSHQHLyEGAMraipqlervtmaswleGVLTRSAGwwrdgkFGPDVIREVA  111
ident      |||   | |   |                     |            |       
Sbjct -PVLMPGLWDCHMHF-GGDD-------------dyyNDYTSGLA------THPASSGARL   95
DSSP  -EEEEELEEEEEELL-LLLL-------------lllLLLHHHHH------LLHHHHHHHH


DSSP  HHHHHHHHHLLEEEEEEEEllllllllllHHHHHHHHHH---HHLLEEEEEE-LLLLLlh
Query RAVLLESLLGGITTVADQHlffpgatadsYIDATIEAAT---DLGIRFHAAR-SSMTLgk  167
ident      | |  | |   |            |      |       |               
Sbjct ARGCWEALQNGYTSYRDLA---------gYGCEVAKAINdgtIVGPNVYSSGaALSQT--  144
DSSP  HHHHHHHHHLLEEEEEELL---------lLHHHHHHHHHlllLLLLEEEELLlEEELL--


DSSP  hhLLLL---------LHHHLLL---------------------HHHHHHHHHHHHhhhll
Query seGGFC---------DDLFVEP---------------------VDRVVQHCLGLIdqyhe  197
ident    |                                       | | |            
Sbjct --AGHGdifalpageVLGSYGVmnprpgywgagplciadgveeVRRAVRLQIRRG-----  197
DSSP  --LLLLllllllhhhHHHHHLLlllllllllllleeelllhhhHHHHHHHHHHHL-----


DSSP  lllllleEEEELLLLLL------------LLLHHHHHHHHHHHHHHLLEEEEEELLllhh
Query pepfgmvRIALGPCGVP------------YDKPELFEAFAQMAADYDVRLHTHFYEplda  245
ident                                 ||        ||        |       
Sbjct -------AKVIXVMASGgvmsrddnpnfaQFSPEELKVIVEEAARQNRIVSAHVHG----  246
DSSP  -------LLLEEEELLLllllllllllllLLLHHHHHHHHHHHHHLLLLEEEEELL----


DSSP  hhhhhhhllLHHHHHHHLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-
Query gmsdhlygmTPWRFLEKHGWasdrVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG-  304
ident                 | |       | |      |        |               
Sbjct --------kAGIMAAIKAGC----KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLa  294
DSSP  --------hHHHHHHHHHLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHh


DSSP  -----------------LLLL--LHHHHHHLLLEEEELLLLLllllLLLHHHHHHHHHHH
Query -----------------WGLA--PIREYLDAGITVGFGTTGSasndGGNLLGDLRLAALA  345
ident                               || |   ||       ||     |  |   
Sbjct sngeglvkeswaklqalADSHlkAYQGAIKAGVTIALGTDTA---pGGPTALELQFAVER  351
DSSP  hllllllllhhhlllhhHHHHhhHHHHHHHLLLLEELLLLLL---lLLLLHHHHHHHHHL


DSSP  LhhhllllhhhLLLHHHHHHHLLHHHHHHLL--LLLLLLLLLLLLLLEEEEELllhhhll
Query HrpadpnepekWLSARELLRMATRGSAECLG--RPDLGVLEEGRAADIACWRLdgvdrvg  403
ident                 |    ||       |   |  | | ||  ||             
Sbjct G----------GMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEE-------  394
DSSP  L----------LLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELL-------


DSSP  lllHHHHHHHLlLLLL-LLEEEELLEEEEELleELLL---LHHHhhhhhhhhll
Query vhdPAIGLIMTgLSDR-ASLVVVNGQVLVENerPVLA---DLERivanttalip  453
ident         |           |   |                             
Sbjct ---NPLEDIKVfQEPKaVTHVWKGGKLFKGP-gIGPWgedARNP--------fl  436
DSSP  ---LLLLLHHHhHLHHhEEEEEELLEEEELL-lLLLLlllLLLL--------ll


No 16: Query=3ls9A Sbjct=1onxA Z-score=27.4

back to top
DSSP  --------LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLLLL--LEEEEL
Query --------MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDRSV--SRTIDG   50
ident           |  |          |      | |    || ||        |      | 
Sbjct midytaagFTLLQGA-HLYAP---EDRGI-CDVLVANGKIIAVASNIPSDIVpnCTVVDL   55
DSSP  llllhhhlLEEEEEE-EEELL---LEEEE-EEEEEELLEEEEEELLLLLLLLllLEEEEL


DSSP  LLEEEEELEEEEEELHHHhhhlllhhhllllhhhhhhhHHHHhHHHHhlllllhhhhhhH
Query RGMIALPGLINSHQHLYEgamraipqlervtmaswlegVLTRsAGWWrdgkfgpdvireV  110
ident  | |  || |  | ||                                            
Sbjct SGQILCPGFIDQHVHLIG------------------ggGEAG-PTTR-----------tP   85
DSSP  LLLEEEELEEEEEELLLL------------------llLLLL-HHHL-----------lL


DSSP  HHHhHHHHHHLLEEEEEEEEL-LLLLllllLHHHHHHHHHHHHLLEEEEEE-LLLLllhh
Query ARAvLLESLLGGITTVADQHL-FFPGatadSYIDATIEAATDLGIRFHAAR-SSMTlgks  168
ident   | |      | | |                  |   |    ||               
Sbjct EVA-LSRLTEAGVTSVVGLLGtDSIS-rhpESLLAKTRALNEEGISAWMLTgAYHV----  139
DSSP  LLL-HHHHHHLLEEEEEELLLlLLLL-llhHHHHHHHHHHHHHLLEEEEEEeLLLL----


DSSP  hlllllhhhlllHHHH-hHHHHHHH-HHHLllllllleEEEELLLLLL--LLLH--HHHH
Query eggfcddlfvepVDRV-vQHCLGLI-DQYHepepfgmvRIALGPCGVP--YDKP--ELFE  222
ident               |                        |             |      
Sbjct ------------PSRTitGSVEKDVaIIDR--------VIGVXCAISDhrSAAPdvYHLA  179
DSSP  ------------LLLLllLLHHHHHhHLLL--------EEEEEEEELLllLLLLlhHHHH


DSSP  HHHHHHHHHL------LEEEEEEllllHHHHhhhhhlllHHHHHHHLL----lLLLLEEE
Query AFAQMAADYD------VRLHTHFyeplDAGMsdhlygmtPWRFLEKHG----wASDRVWL  272
ident   |                  |     |                                
Sbjct NMAAESRVGGllggkpGVTVFHM---gDSKK--------ALQPIYDLLencdvPISKLLP  228
DSSP  HHHHHHHHHHhhhlllLEEEEEE---lLLLL--------LLHHHHHHHhllllLHHHEEE


DSSP  EEL-LLLL-hHHHHHHHHHLLEEEELhHHHHhlLLLL--LLHHHHH-HLLL--EEEELLL
Query AHA-VVPP-rEEIPEFADAGVAIAHLiAPDLrmGWGL--APIREYL-DAGI--TVGFGTT  325
ident  |     |  |   |||  |  |                  |            |     
Sbjct THVnRNVPlfEQALEFARKGGTIDIT-SSID--EPVApaEGIARAVqAGIPlaRVTLSSD  285
DSSP  ELHhHLHHhhHHHHHHHHLLLLEEEE-LLLL--LLLLhhHHHHHHHhLLLLhhHEEEELL


DSSP  LLLL--------------LLLLL-HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHH
Query GSAS--------------NDGGN-LLGDLRLAALAHrpadpnepekWLSARELLRMATRG  370
ident |  |                |   ||                      |    ||  |  
Sbjct GNGSqpffddegnlthigVAGFEtLLETVQVLVKDY----------DFSISDALRPLTSS  335
DSSP  LLLEeeeellllleeeeeELLLHhHHHHHHHHHHHH----------LLLHHHHHHHHLHH


DSSP  HHHHLLLLLLLLLLLLLLLLEEEEELllhhhlllllhhhhhhhlllllLLLEEEELLEEE
Query SAECLGRPDLGVLEEGRAADIACWRLdgvdrvgvhdpaiglimtglsdRASLVVVNGQVL  430
ident  |  |     |    |  ||                            |   |   |   
Sbjct VAGFLNLTGKGEILPGNDADLLVMTP--------------------elRIEQVYARGKLM  375
DSSP  HHHHLLLLLLLLLLLLLLLLEEEELL--------------------llLEEEEEELLEEE


DSSP  EELLEELLLLhhHHHHhhhhhll
Query VENERPVLADleRIVAnttalip  453
ident |                      
Sbjct VKDGKACVKG--TFET------d  390
DSSP  EELLEELLLL--LLLL------l


No 17: Query=3ls9A Sbjct=1yrrB Z-score=26.7

back to top
DSSP  lEEEEEEeEEELLlllLLEEEEEEEEEELLEEEEEELL-LLLLLLlEEEELLLEEEEELE
Query mILIRGLtRVITFddqERELEDADILIDGPKIVAVGKD-LSDRSVsRTIDGRGMIALPGL   59
ident         |  |       | |    |    |  |                 | |  || 
Sbjct -YALTQG-RIFTG---HEFLDDHAVVIADGLIKSVCPVaELPPEI-EQRSLNGAILSPGF   54
DSSP  -LEEELL-EEELL---LLEELLEEEEEELLEEEEEEEHhHLLLLL-LEEELLLLEEEELE


DSSP  EEEEELHhHHHHlllhhhllllhhhhhhhhhhhhhhhhhllLLLHhHHHHHHHHHHHHHH
Query INSHQHLyEGAMraipqlervtmaswlegvltrsagwwrdgKFGPdVIREVARAVLLESL  119
ident |        |                                    |  |          
Sbjct IDVQLNG-CGGV-------------------------qfndTAEA-VSVETLEIMQKANE   87
DSSP  EEEEELE-ELLE-------------------------elllLLLL-LLHHHHHHHHHHHH


DSSP  HLLEEEEEEEELLLllLLLL--LHHHHHHHHHHHHLLE-EEEEELLLLllhhhlllllhh
Query LGGITTVADQHLFFpgATAD--SYIDATIEAATDLGIR-FHAARSSMTlgkseggfcddl  176
ident   | |                        |                              
Sbjct KSGCTNYLPTLITT--SDELmkQGVRVMREYLAKHPNQaLGLHLEGPW------------  133
DSSP  LLLEEEEEEEELLL--LHHHhhHHHHHHHHHHHHLLLLlLLEEEELLL------------


DSSP  hlllhHHHHHHHHHHHhhhlllllllleEEEELLLLLLLLLHHHHHHHHHHHhhhllEEE
Query fvepvDRVVQHCLGLIdqyhepepfgmvRIALGPCGVPYDKPELFEAFAQMAadydvRLH  236
ident         |                    |            |     |           
Sbjct ---lnAALVDFLCENA-----------dVITKVTLAPEMVPAEVISKLANAG-----IVV  174
DSSP  ---llLHHHHHHHHLH-----------hHEEEEEELHHHLLHHHHHHHHHHL-----LEE


DSSP  EEElLLLHHhhhhhhhllLHHHHHHHLLLllllEEEEELL--LLLH--------HHHHHH
Query THFyEPLDAgmsdhlygmTPWRFLEKHGWasdrVWLAHAV--VPPR--------EEIPEF  286
ident                            |         |     |            |   
Sbjct SAG-HSNAT--------lKEAKAGFRAGI----TFATHLYnaMPYItgrepglaGAILDE  221
DSSP  EEL-LLLLL--------hHHHHHHHHHLE----EEELLLLllLLLLlllllhhhHHHHHL


DSSP  HhhLLEEEELHHhhHHLLL-LLLL--HHHHHhllLEEEELLLLLLLLLLlLHHHHHHHHH
Query AdaGVAIAHLIApdLRMGW-GLAP--IREYLdagITVGFGTTGSASNDGgNLLGDLRLAA  343
ident |                          |            |               |   
Sbjct A--DIYCGIIAD--GLHVDyANIRnaKRLKG---DKLCLVTDATSGSSL-TMIEGVRNLV  273
DSSP  L--LLEEEEELL--LLLLLhHHHHhhHHHHH---HHEEEELLLLLLLLL-LHHHHHHHHH


DSSP  HHLhhhllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhhhl
Query LAHrpadpnepekWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvdrv  402
ident                   | |||||   |   |    || |  |  |             
Sbjct EHC----------GIALDEVLRMATLYPARAIGVEkRLGTLAAGKVANLTAFTP------  317
DSSP  HHH----------LLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELL------


DSSP  llllhhhhhhhlllLLLLLEEEELLEEEEELleellllhhhhhhhhhhhll
Query gvhdpaiglimtglSDRASLVVVNGQVLVENerpvladlerivanttalip  453
ident                       |||   |                      
Sbjct --------------DFKITKTIVNGNEVVTQ--------------------  334
DSSP  --------------LLLEEEEEELLEEEEEL--------------------


No 18: Query=3ls9A Sbjct=3ooqA Z-score=24.2

back to top
DSSP  LEEEEEEeEEELLLllLLEEEeEEEEEELLEEEEEELLLLLLLLlEEEELLLEEEEELEE
Query MILIRGLtRVITFDdqERELEdADILIDGPKIVAVGKDLSDRSVsRTIDGRGMIALPGLI   60
ident  ||      |       |     | |    |   ||    |       |  |    ||  
Sbjct KILFKNA-TVFPIT--SRPFK-GDVLVSNGKVEKVGENIEDPDA-EIVDLTGKFLFPGFV   55
DSSP  LEEEEEE-EELLLL--LLLEE-EEEEEELLEEEEEELLLLLLLL-EEEELLLLEEEELEE


DSSP  EEEELH-HHHHHlllhhhllllhhhhhhhHHHHH------hhhhhlllllhhhHHHHhhH
Query NSHQHL-YEGAMraipqlervtmaswlegVLTRS------agwwrdgkfgpdvIREVarA  113
ident   | |                            |                          
Sbjct DAHSHIgLFEEG----------------vGYYYSdgneatdpvtphvkaldgfNPQD--P   97
DSSP  EEEELLlLLLLL----------------lLHHHLllllllllllllllhhhhlLLLL--H


DSSP  HHHHHHHLLEEEEEEEEL----lllllllllhhhhhHHHHHhhlleeeeeellllllhhh
Query VLLESLLGGITTVADQHL----ffpgatadsyidatIEAATdlgirfhaarssmtlgkse  169
ident      | || | |                        |                      
Sbjct AIERALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEECI-------------------  138
DSSP  HHHHHHLLLEEEEEELLLlllleeeeeeeeelllllHHHHE-------------------


DSSP  lllllhhhlllhhhhhhhhhhhhhhhlllllllLEEE-EELLLLLLLL------------
Query ggfcddlfvepvdrvvqhclglidqyhepepfgMVRI-ALGPCGVPYD------------  216
ident                                        |                    
Sbjct ---------------------------------VKDPaGLKXAFGENPkrvygerkqtps  165
DSSP  ---------------------------------EEEEeEEEEELLHHHhhhhhhllllll


DSSP  ----LHHHHH------------------------------hhHHHHHHHLLEEEEEELLl
Query ----KPELFE------------------------------afAQMAADYDVRLHTHFYEp  242
ident                                                        |    
Sbjct trxgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAHR-  224
DSSP  lhhhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEELL-


DSSP  lhhhhhhhhhllLHHHHHHHLL-llllLEEEEELLLLlhHHHHHHHHHLLEEEELHHhhH
Query ldagmsdhlygmTPWRFLEKHG-wasdRVWLAHAVVPprEEIPEFADAGVAIAHLIApdL  301
ident                                 |            |             |
Sbjct -----------aDDILTAIRIAeefgfNLVIEHGTEA-yKISKVLAEKKIPVVVGPL--L  270
DSSP  -----------hHHHHHHHHHHhhhllLEEEEELLLH-hHHHHHHHHHLLLEEELLL--L


DSSP  HLL------LLLL-LHHHHHHLLLEEEELLLLLllLLLL-LHHHHHHHHHHHlhhhllll
Query RMG------WGLA-PIREYLDAGITVGFGTTGSasNDGG-NLLGDLRLAALAhrpadpne  353
ident                |   |  |                         |           
Sbjct TFRtklelkDLTXeTIAKLLKDGVLIALXCDHP--VIPLeFATVQAATAXRY--------  320
DSSP  LLLllhhhlLLLLlHHHHHHHLLLLEEELLLLL--LLLHhHHHHHHHHHHHH--------


DSSP  hhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhhhlllllhhhHHH
Query pekWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvdrvgvhdpaiGLI  412
ident          ||   |   |  ||     |  | |  ||   |                  
Sbjct ---GAKEEDLLKILTVNPAKILGLEdRIGSIEPGKDADLVVWSG-------------HPF  364
DSSP  ---LLLHHHHHHLLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL-------------LLL


DSSP  HLLllLLLLEEEELLEEEEELleellllhhhhhhhhhhhll
Query MTGlsDRASLVVVNGQVLVENerpvladlerivanttalip  453
ident           |   |                          
Sbjct DXK--SVVERVYIDGVEVFRR-------------------e  384
DSSP  LLL--LLEEEEEELLEEEEEL-------------------l


No 19: Query=3ls9A Sbjct=2ogjA Z-score=23.7

back to top
DSSP  --LEEEEEEeEEELLLLLlLEEEEEEEEEE-LLEEEEEELLLLLLLLlEEEElLLEEEEE
Query --MILIRGLtRVITFDDQeRELEDADILID-GPKIVAVGKDLSDRSVsRTIDgRGMIALP   57
ident    ||         |          ||||    || |||  |                 |
Sbjct qaPILLTNV-KPVGFGKG-ASQSSTDILIGgDGKIAAVGSALQAPAD-TQRI-DAAFISP   56
DSSP  llLEEEEEE-EELLLLLL-LLLLLEEEEELlLLLEEEEELLLLLLLL-EEEL-LLLEEEE


DSSP  LEEEEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHH-hhhHHH
Query GLINSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvIREV-araVLL  116
ident |    | |                                                    
Sbjct GWVDLHVHIW---------------------------------------HGGTdisiRPS   77
DSSP  LEEEEEELLL---------------------------------------LLLLllllLHH


DSSP  H-HHHLLEEEEEEEELLlllllllLHHHHHHH-HHHHHLLEEEEEELL------------
Query E-SLLGGITTVADQHLFfpgatadSYIDATIE-AATDLGIRFHAARSS------------  162
ident |     | ||  |                  |        |  |                
Sbjct EcGAERGVTTLVDAGSA-----geANFHGFREyIIEPSRERIKAFLNLgsiglvacnrvp  132
DSSP  HlLHHHLEEEEEEELLL-----llLLHHHHHHhLLLLLLLEEEEEEELllllllllllll


DSSP  LLLLhhhlllllhhhlLLHHHhHHHHHHHHHHHLLllllllEEEEELLLLL-LLLL---H
Query MTLGkseggfcddlfvEPVDRvVQHCLGLIDQYHEpepfgmVRIALGPCGV-PYDK---P  218
ident                           |       |          |              
Sbjct ELRD------------IKDID-LDRILECYAENSE------HIVGLXVRAShVITGswgV  173
DSSP  LLLL------------HHHLL-HHHHHHHHHLLLL------LEEEEEEEELhHHHLlllL


DSSP  HHHHHHHHHHHHHLLEEEEEEllllHHHHHhhhhlllHHHHHHHllLLLLLEEEEELL--
Query ELFEAFAQMAADYDVRLHTHFyeplDAGMSdhlygmtPWRFLEKhgWASDRVWLAHAV--  276
ident          |    |    |                                   |    
Sbjct TPVKLGKKIAKILKVPXXVHV----GEPPA-------LYDEVLE--ILGPGDVVTHCFng  220
DSSP  HHHHHHHHHHHHHLLLEEEEE----LLLLL-------LHHHHHH--HLLLLLEEELLLll


DSSP  ----LLLH-----HHHHHHhhHLLEEEELHHHHhhlllLLLLHHHHH-HLLLEEEELLLL
Query ----VPPR-----EEIPEFadAGVAIAHLIAPDlrmgwGLAPIREYL-DAGITVGFGTTG  326
ident                       |                                  |  
Sbjct ksgsSIXEdedlfNLAERC--EGIRLDIGHGGA---sfSFKVAEAAIaRGLLPFSISTDL  275
DSSP  llllLLLLlhhhhHHHHHL--LLLEEELLLLLL---llLHHHHHHHHhLLLLLLLLLLLL


DSSP  LLLLL---LLLHHHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHHLLLLLllLL
Query SASND---GGNLLGDLRLAALAhrpadpnepekWLSARELLRMATRGSAECLGRPDlgVL  383
ident            |                                ||  |          |
Sbjct HGHSXnfpVWDLATTXSKLLSV-----------DXPFENVVEAVTRNPASVIRLDXenRL  324
DSSP  LLLLLlllLLLHHHHHHHHHHL-----------LLLHHHHHHLLLHHHHHHLLLLLllLL


DSSP  LLLLLLLEEEEElllhhhlllllhhhhhhHLLL----------------LLLLLEEEELL
Query EEGRAADIACWRldgvdrvgvhdpaigliMTGL----------------SDRASLVVVNG  427
ident   |  ||                                                 |   
Sbjct DVGQRADFTVFD-----------------LVDAdleatdsngdvsrlkrLFEPRYAVIGA  367
DSSP  LLLLLLEEEEEE-----------------EEEEeeeeellllleeeeeeEEEEEEEEELL


DSSP  EEeEELLeellllhhhhhhhhhhhll
Query QVlVENErpvladlerivanttalip  453
ident                           
Sbjct EA-IAAS-------------ryipra  379
DSSP  EE-EELL-------------llllll


No 20: Query=3ls9A Sbjct=3giqA Z-score=23.6

back to top
DSSP  ---LEEEEEEeEEELLLLlLLEEEeEEEEEELLEEEEEElLLLLLLLLEEEELLLEEEEE
Query ---MILIRGLtRVITFDDqERELEdADILIDGPKIVAVGkDLSDRSVSRTIDGRGMIALP   57
ident       | |    |           ||       | | |  |         |  | |  |
Sbjct eklDFKITGG-WIIDGTG-APRRR-ADLGVRDGRIAAIG-ELGAHPARHAWDASGKIVAP   56
DSSP  lleEEEEELL-EELLLLL-LLLEE-LEEEEELLEEEEEE-LLLLLLEEEEEELLLLEEEE


DSSP  LEEEEEELHHHHhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHhHHH
Query GLINSHQHLYEGamraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAvLLE  117
ident | |  | |                                                 |  
Sbjct GFIDVHGHDDLM--------------------------------------fVEKPD-LRW   77
DSSP  LEEELLLLLLLH--------------------------------------hHHLLL-LHH


DSSP  HHHLLEEEEEEE-----ELLLLLL-------------llLLHHHHHHHHHH--HHLLEEE
Query SLLGGITTVADQ-----HLFFPGA-------------taDSYIDATIEAAT--DLGIRFH  157
ident     |||||            |                      |   |       |   
Sbjct KTSQGITTVVVGncgvsAAPAPLPgntaaalallgetplFADVPAYFAALDaqRPMINVA  137
DSSP  HHLLLEEEEEELlllllLLLLLLLllllhhhhhhlllllLLLHHHHHHHHHhlLLLLEEE


DSSP  EEELLL-------llLHHHlllllhhhlllHHHHHHHHHHHHHHHlllllllleEEEELL
Query AARSSM-------tlGKSEggfcddlfvepVDRVVQHCLGLIDQYhepepfgmvRIALGP  210
ident |                                                           
Sbjct ALVGHAnlrlaamrdPQAA------ptaaeQQAMQDMLQAALEAG---------AVGFST  182
DSSP  EEEEHHhhhhhhlllLLLL------llhhhHHHHHHHHHHHHHHL---------LLEEEE


DSSP  lLLLL-----LLHHHHHHHHHHHHHHLLEEEEEE-LLLLHHhhhhhhhllLHHHHHHhLL
Query cGVPY-----DKPELFEAFAQMAADYDVRLHTHF-YEPLDAgmsdhlygmTPWRFLEkHG  264
ident  |  |           |  |  ||        |   |                       
Sbjct -GLAYqpgavAQAAELEGLARVAAERRRLHTSHIrNEADGV--------eAAVEEVL-AI  232
DSSP  -ELLLllhhhLLHHHHHHHHHHHHHLLLEEEEELlLLLLLH--------hHHHHHHH-HH


DSSP  LL--llLEEEEELLL-------LLHHHHHHHHHHL-----LEEEELHHhHHHL-------
Query WA--sdRVWLAHAVV-------PPREEIPEFADAG-----VAIAHLIApDLRM-------  303
ident            |            |        |      ||                  
Sbjct GRgtgcATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDIYPY-PGSStiliper  291
DSSP  HHhhllEEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEELLL-LEEEeellhhh


DSSP  -------------------------------------------------LLLL---LLHH
Query -------------------------------------------------GWGL---APIR  311
ident                                                           | 
Sbjct aetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEdevKRIF  351
DSSP  llllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHhhhHHHH


DSSP  HHHhlllEEEELLLLL-----LLLLLLLHHHHH-HHHHHHLHhhllllhhhLLLHHHHHH
Query EYLdagiTVGFGTTGS-----ASNDGGNLLGDL-RLAALAHRpadpnepekWLSARELLR  365
ident            |  |                          |                  
Sbjct QHP----CCMVGSDGLpndarPHPRLWGSFTRVlGRYVREAR---------LMTLEQAVA  398
DSSP  HLL----LEEELLLLLlllllLLLHHHHHHHHHhHHHHHHLL---------LLLHHHHHH


DSSP  HLLHHHHHHLLLLLLLLLLLLLLLLEEEEElllhhhlllllhHHHHH------hllLLLL
Query MATRGSAECLGRPDLGVLEEGRAADIACWRldgvdrvgvhdpAIGLI------mtgLSDR  419
ident   |   |   |    |||  |  ||                               |   
Sbjct RMTALPARVFGFAERGVLQPGAWADVVVFD------------PDTVAdratwdeptLASV  446
DSSP  HHLHHHHHHHLLLLLLLLLLLLLLLEEEEL------------LLLLLlllllllllLLLL


DSSP  -LLEEEELLEEEEElleELLLLHhhhhhhhhhhll
Query -ASLVVVNGQVLVEnerPVLADLerivanttalip  453
ident     | |||           ||             
Sbjct gIAGVLVNGAEVFP---QPPADG---rpgqvlrax  475
DSSP  lEEEEEELLEEEEL---LLLLLL---lllllllll


No 21: Query=3ls9A Sbjct=1a4mA Z-score=23.4

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                             
Sbjct ---------------------------------------------------tpafNKPKV    9
DSSP  ---------------------------------------------------llllLLLEE


DSSP  EEEELHHHHHHL---------------------LLHHHLL---LLHHHHHHHHHHHHHHH
Query NSHQHLYEGAMR---------------------AIPQLER---VTMASWLEGVLTRSAGW   96
ident   | ||                                           |          
Sbjct ELHVHLDGAIKPetilyfgkkrgialpadtveeLRNIIGMdkpLSLPGFLAKFDYYMPVI   69
DSSP  EEEEEHHHLLLHhhhhhhhhhhllllllllhhhHHHHHLLlllLLHHHHHLLHHHHHHHH


DSSP  HhlllLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLL---LLLL-------------LLL
Query WrdgkFGPDVIREVARAVLLESLLGGITTVADQHLFF---PGAT-------------ADS  140
ident           |   |          |   |                            | 
Sbjct A----GCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllaNSKVdpmpwnqtegdvtPDD  125
DSSP  L----LLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhlLLLLlllhhhlllllllHHH


DSSP  HHHHHHHHHHHHL----LEEEEEELLLLLlhhhlllllhhhllLHHHHHhHHHHHHHHHL
Query YIDATIEAATDLG----IRFHAARSSMTLgkseggfcddlfvePVDRVVqHCLGLIDQYH  196
ident   |              |        |                         | |   | 
Sbjct VVDLVNQGLQEGEqafgIKVRSILCCMRH--------------QPSWSL-EVLELCKKYN  170
DSSP  HHHHHHHHHHHHHhhhlLEEEEEEEEELL--------------LHHHHH-HHHHHHHHLL


DSSP  LllllllEEEEELLL-LLLL--LLHH-HHHHHHHHHHHHLLEEEEEELLLLHHhhhhhhh
Query EpepfgmVRIALGPC-GVPY--DKPE-LFEAFAQMAADYDVRLHTHFYEPLDAgmsdhly  252
ident           |                        |         |  |           
Sbjct Q-----kTVVAMDLAgDETIegSSLFpGHVEAYEGAVKNGIHRTVHAGEVGSP-------  218
DSSP  L-----lLEEEEEEElLLLLllHHHLhHHHHHHHHHHHHLLEEEEEELLLLLH-------


DSSP  llLHHHHHHHLLLlllLEEEEELLL-LLHH-HHHHHHHHLLEEEELHHHHHHLLLL----
Query gmTPWRFLEKHGWasdRVWLAHAVV-PPRE-EIPEFADAGVAIAHLIAPDLRMGWG----  306
ident      |               |       |                       |      
Sbjct --EVVREAVDILK---TERVGHGYHtIEDEaLYNRLLKENMHFEVCPWSSYLTGAWdpkt  273
DSSP  --HHHHHHHHLLL---LLEEEELHHhHHLHhHHHHHHHLLLEEEELHHHHHHLLLLllll


DSSP  lLLHHHHHHLLLEEEELLLLLLLLLLlLHHHHHHHHHHHLhhhllllhhhLLLHHHHHHH
Query lAPIREYLDAGITVGFGTTGSASNDGgNLLGDLRLAALAHrpadpnepekWLSARELLRM  366
ident                  |          |  |                       |  | 
Sbjct tHAVVRFKNDKANYSLNTDDPLIFKS-TLDTDYQMTKKDM----------GFTEEEFKRL  322
DSSP  lLHHHHHHHLLLLEEELLLLLLLLLL-LHHHHHHHHHHLL----------LLLHHHHHHH


DSSP  lLHHHHHHLL-----LLLLL--LLLLllllleeeeelllhhhlllllhhhhhhhllllll
Query aTRGSAECLG-----RPDLG--VLEEgraadiacwrldgvdrvgvhdpaiglimtglsdr  419
ident      |            |      |                                  
Sbjct -NINAAKSSFlpeeeKKELLerLYRE----------------------------------  347
DSSP  -HHHHHHLLLllhhhHHHHHhhHHHH----------------------------------


DSSP  lleeeelleeeeelleellllhhhhhhhhhhhll
Query aslvvvngqvlvenerpvladlerivanttalip  453
ident                                   
Sbjct --------------------------------yq  349
DSSP  --------------------------------ll


No 22: Query=3ls9A Sbjct=1gkpA Z-score=23.3

back to top
DSSP  LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELEE
Query MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGLI   60
ident   ||      ||          |||   |  |   |  |        ||  |    || |
Sbjct PLLIKNG-EIITA---DSRYK-ADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFI   55
DSSP  LEEEELL-EEEEL---LEEEE-LEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEE


DSSP  EEEELHHHhhhlllhhhllllhhhhhhhHHHHHhhhhhlllllhhhhhHHHHHHHHHHHH
Query NSHQHLYEgamraipqlervtmaswlegVLTRSagwwrdgkfgpdvirEVARAVLLESLL  120
ident   | | |                                                   | 
Sbjct DPHVHIYL--------------------PFMAT------------fakDTHETGSKAALM   83
DSSP  EEEELLLL--------------------EELLE------------ellLLHHHHHHHHHH


DSSP  LLEEEEEEEELLL-LLLLLL--LHHH-HHHHHHhhhLLEEEEEELLLLllhhhlllllhh
Query GGITTVADQHLFF-PGATAD--SYID-ATIEAAtdlGIRFHAARSSMTlgkseggfcddl  176
ident || ||                                                       
Sbjct GGTTTYIEMCCPSrNDDALEgyQLWKsKAEGNS---YCDYTFHMAVSK------------  128
DSSP  LLEEEEEEEELLLlLLLHHHhhHHHHhHHLLLL---LLEEEEEEELLL------------


DSSP  hllLHHHHHHHHHHHHHHHlllllllleEEEELlLLLL-----LLLHHHHHHHHHHHHHH
Query fvePVDRVVQHCLGLIDQYhepepfgmvRIALGpCGVP-----YDKPELFEAFAQMAADY  231
ident                                                         |   
Sbjct ---FDEKTEGQLREIVADG---------ISSFX-IFLSyknffGVDDGEMYQTLRLAKEL  175
DSSP  ---LLLLHHHHHHHHHHLL---------LLEEE-EEELlllllLLLHHHHHHHHHHHHHH


DSSP  LLEEEEEE---------------------------llLLHHhhhhhhhllLHHHHHHhLL
Query DVRLHTHF---------------------------yePLDAgmsdhlygmTPWRFLEkHG  264
ident  |    |                                                     
Sbjct GVIVTAHCenaelvgrlqqkllsegktgpewhepsrpEAVE--------aEGTARFA-TF  226
DSSP  LLEEEEEEllhhhhhhhhhhhhhlllllhhhllllllHHHH--------hHHHHHHH-HH


DSSP  LL--llLEEEEELLLLL--HHHHHHHH-HHLLEEEELHHHHHH-----------------
Query WA--sdRVWLAHAVVPP--REEIPEFA-DAGVAIAHLIAPDLR-----------------  302
ident            |    |         |      |   |   |                  
Sbjct LEttgaTGYVVHLSCKPalDAAMAAKArGVPIYIESVIPHFLLdktyaerggveamkyim  286
DSSP  HHhhllEEEELLLLLHHhhHHHHHHHHlLLLEEEEEEHHHHHLlhhhhhllhhhhhllll


DSSP  --LLLL---LLLHHHHHhLLLEEEELLLLLL------------------LLLLL-LHHHH
Query --MGWG---LAPIREYLdAGITVGFGTTGSA------------------SNDGG-NLLGD  338
ident                 |  |     ||                                 
Sbjct spPLRDkrnQKVLWDALaQGFIDTVGTDHCPfdteqkllgkeaftaipnGIPAIeDRVNL  346
DSSP  llLLLLlhhHHHHHHHHhLLLLLEEELLLLLllhhhhhhhlllhhhlllLLLLLlLHHHH


DSSP  H-HHHHHhlhhhllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEEL
Query L-RLAALahrpadpnepekWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRL  396
ident |                   |        |    |   |     |    |  ||      
Sbjct LyTYGVS----------rgRLDIHRFVDAASTKAAKLFGLFpRKGTIAVGSDADLVVYDP  396
DSSP  HhHHHLL----------llLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEEEL


DSSP  LLhhhlllllhhhhhhhLLLL--------------------LLLLEEEELLEEEEELLEE
Query DGvdrvgvhdpaiglimTGLS--------------------DRASLVVVNGQVLVENERP  436
ident                   |                       | | | | | | |     
Sbjct QY---------------RGTIsvktqhvnndyngfegfeidGRPSVVTVRGKVAVRDGQF  441
DSSP  LL---------------LEELlhhhllllllllllllleelLEEEEEEELLEEEEELLEE


DSSP  LLLLhhhhhhhhhhhll
Query VLADlerivanttalip  453
ident |                
Sbjct VGEKgwgkllrrepmyf  458
DSSP  LLLLlllllllllllll


No 23: Query=3ls9A Sbjct=3griA Z-score=22.3

back to top
DSSP  LEEEEEeEEEEllllLLLEEEeEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELEE
Query MILIRGlTRVItfddQERELEdADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGLI   60
ident   ||     |            |||||||  |               ||  |    ||  
Sbjct XKLIKN-GKVL---qNGELQQ-ADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFV   55
DSSP  LEEEEL-LEEE---eLLEEEE-LEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllHHHH-hHHHHHHHHHHH
Query NSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgPDVI-rEVARAVLLESL  119
ident   | ||                                     |     |          
Sbjct DVHVHLR-----------------------------------ePGGEykETIETGTKAAA   80
DSSP  EEEELLL-----------------------------------lLLLLllLLHHHHHHHHH


DSSP  HLLEEEEEEEELLLLlllLLLHHHHHHHHHH-HHLLEEEEEELL---LLLLhhhlllllh
Query LGGITTVADQHLFFPgatADSYIDATIEAAT-DLGIRFHAARSS---MTLGkseggfcdd  175
ident  || |||       |         |           |     |                 
Sbjct RGGFTTVCPXPNTRPvpdSVEHFEALQKLIDdNAQVRVLPYASIttrQLGK---------  131
DSSP  HLLEEEEEELLLLLLlllLHHHHHHHHHHHHhHLLLEELLLEELlhhHLLL---------


DSSP  hhlllhhHHHHhHHHHHHHHLllllllleeEEELLLLlLLLL-HHHHHHHHHHHHHHLLE
Query lfvepvdRVVQhCLGLIDQYHepepfgmvrIALGPCGvPYDK-PELFEAFAQMAADYDVR  234
ident          |     |               |    |                ||     
Sbjct -------ELVD-FPALVKEGA---------FAFTDDG-VGVQtASXXYEGXIEAAKVNKA  173
DSSP  -------LLLL-HHHHHLLLL---------LLEEELL-LLLLlHHHHHHHHHHHHHHLLL


DSSP  EEEEE------------------------llLLHHhhhhhhhllLHHHHHHhLLLL--ll
Query LHTHF------------------------yePLDAgmsdhlygmTPWRFLEkHGWA--sd  268
ident    |                                                        
Sbjct IVAHCednsliyggaxhegkrskelgipgipNICE--------sVQIARDV-LLAEaagc  224
DSSP  EEELLllhhhllllleellhhhhhhllleelLHHH--------hHHHHHHH-HHHHhhll


DSSP  LEEEEELLLLL-hHHHHHHHH--HLLEEEELHHHHHH----------------LLLL---
Query RVWLAHAVVPP-rEEIPEFAD--AGVAIAHLIAPDLR----------------MGWG---  306
ident      |         |         |         |                        
Sbjct HYHVCHVSTKEsvRVIRDAKRagIHVTAEVTPHHLLLteddipgnnaiykxnpPLRSted  284
DSSP  LEEELLLLLHHhhHHHHHHHHllLLEEEEELHHHHHLlhhhlllllhhhllllLLLLhhh


DSSP  LLLHHHHHHLLLEEEELLLLLL---------------LLLLL-LHHHHHH-HHHHhlhhh
Query LAPIREYLDAGITVGFGTTGSA---------------SNDGG-NLLGDLR-LAALahrpa  349
ident      | |  |      |                      |       |           
Sbjct REALLEGLLDGTIDCIATDHAPhardekaqpxekapfGIVGSeTAFPLLYtHFVK-----  339
DSSP  HHHHHHHHHLLLLLEELLLLLLllhhhhlllllllllLLLLLlLHHHHHHhHHLL-----


DSSP  llllhhhLLLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLEEEEELLLhhhlllllhhh
Query dpnepekWLSARELLRMATRGSAECLGRPdLGVLEEGRAADIACWRLDGvdrvgvhdpai  409
ident              |    |    |       | | |   ||     ||            
Sbjct -----ngDWTLQQLVDYLTIKPCETFNLE-YGTLKENGYADLTIIDLDS-----------  382
DSSP  -----llLLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLEEEEELLL-----------


DSSP  hhhhLLLL--------------------LLLLEEEELLEEEEELleellllhhhhhhhhh
Query glimTGLS--------------------DRASLVVVNGQVLVENerpvladlerivantt  449
ident                                 |  | | |  |                 
Sbjct ----EQEIkgedflskadntpfigykvyGNPILTXVEGEVKFEG----------------  422
DSSP  ----LEELlhhhllllllllllllleelLEEEEEEELLEEEEEL----------------


DSSP  hhll
Query alip  453
ident     
Sbjct ----  422
DSSP  ----


No 24: Query=3ls9A Sbjct=3e74A Z-score=22.0

back to top
DSSP  --LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLllLLEEEELLLEEEEEL
Query --MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDrsVSRTIDGRGMIALPG   58
ident      |     ||            ||   | || | | || |       |  |    ||
Sbjct sfDLIIKNG-TVILE---NEARV-VDIAVKGGKIAAIGQDLGD--AKEVXDASGLVVSPG   53
DSSP  leEEEEELL-EEELL---LLEEE-LEEEEELLEEEEEELLLLL--EEEEEELLLLEEEEL


DSSP  EEEEEELHhhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHH
Query LINSHQHLyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLES  118
ident     | |                                                     
Sbjct XVDAHTHI-------------------------------------------GYETGTRAA   70
DSSP  EEEEEELL-------------------------------------------LHHHHHHHH


DSSP  HHLLEEEEEEEELLLL-lllLLLHHHHHH-HHHHHHLLEEEEEELLLLllhhhlllllhh
Query LLGGITTVADQHLFFP-gatADSYIDATI-EAATDLGIRFHAARSSMTlgkseggfcddl  176
ident   |||||     |           |      |   | |                      
Sbjct AKGGITTXIEXPLNQLpatvDRASIELKFdAAKGKLTIDAAQLGGLVS------------  118
DSSP  HHLLEEEEEELLLLLLllllLHHHHHHHHhHHLLLLLLEEEELEELLL------------


DSSP  hlllhhHHHHHHHHHHHHHlllllllleEEEELLlLLLLLLHHHHHHHHHHHHHHLLEEE
Query fvepvdRVVQHCLGLIDQYhepepfgmvRIALGPcGVPYDKPELFEAFAQMAADYDVRLH  236
ident               |                     |       |   ||          
Sbjct ------YNIDRLHELDEVG---------VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVL  162
DSSP  ------LLLLLHHHHHHHL---------LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEE


DSSP  EEEllllHHHHHHH-----------------------hhllLHHHHHHHLLL-lllLEEE
Query THFyeplDAGMSDH-----------------------lygmTPWRFLEKHGW-asdRVWL  272
ident  |                                          |           |   
Sbjct VHC----ENALICDelgeeakregrvtahdyvasrpvftevEAIRRVLYLAKvagcRLHV  218
DSSP  EEL----LLHHHHHhhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHhhllLEEE


DSSP  EELLLLL-hHHHHHHHH--HLLEEEELHHH----------------hhhLLLL----llL
Query AHAVVPP-rEEIPEFAD--AGVAIAHLIAP----------------dlrMGWG----laP  309
ident  |   |   ||                                                 
Sbjct CHVSSPEgvEEVTRARQegQDITCESCPHYfvldtdqfeeigtlakcspPIRDlenqkgX  278
DSSP  LLLLLHHhhHHHHHHHHllLLEEEEELLHHhhllhhhhhhhlhhhllllLLLLhhhhhhH


DSSP  HHHHHHlLLEEEELLLLLL---------------LLLLL-LHHHHH-HHHHhhlhhhlll
Query IREYLDaGITVGFGTTGSA---------------SNDGG-NLLGDL-RLAAlahrpadpn  352
ident        |         |                   |           |          
Sbjct WEKLFN-GEIDCLVSDHSPcppexkagnixkawgGIAGLqSCXDVXfDEAV---------  328
DSSP  HHHHHL-LLLLEELLLLLLlllllllllllllllLLLLHhHHHHHHhHHHL---------


DSSP  lhhhLLLHH-HHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLhhhlllllhhhhh
Query epekWLSAR-ELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLDGvdrvgvhdpaigl  411
ident                     |   |    |    |  ||                     
Sbjct --qkRGXSLpXFGKLXATNAADIFGLQQKGRIAPGKDADFVFIQPNS-------------  373
DSSP  --llLLLLHhHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEELLL-------------


DSSP  hhLLLL--------------------lLLLEEEELLEEEEELL-EELLLlhhhhhhhhhh
Query imTGLS--------------------dRASLVVVNGQVLVENE-RPVLAdlerivantta  450
ident                            |       | |    |     |           
Sbjct --SYVLtnddleyrhkvspyvgrtigaRITKTILRGDVIYDIEqGFPVA-----pkgqfi  426
DSSP  --LEELlhhhllllllllllllleellEEEEEEELLEEEEELLlLLLLL-----llllee


DSSP  hll
Query lip  453
ident    
Sbjct lkh  429
DSSP  lll


No 25: Query=3ls9A Sbjct=4b3zD Z-score=21.3

back to top
DSSP  -LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELE
Query -MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGL   59
ident    || |  | |        |  ||       |   |  |       ||   |    || 
Sbjct dRLLIKGG-RIIND---DQSLY-ADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGG   55
DSSP  lEEEEEEE-EEELL---LLEEE-EEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELE


DSSP  EEEEELHHHhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHHHHHHH
Query INSHQHLYEgamraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAVLLESL  119
ident |     |                                                    |
Sbjct IDVNTYLQK-------------------------------------taaDDFFQGTRAAL   78
DSSP  EEEEELLLL-------------------------------------lllLLHHHHHHHHH


DSSP  HLLEEEEEEEELLLlLLLL-LLHHHHHHHHHHH-HLLEEEEEELLLLllhhhlllllhhh
Query LGGITTVADQHLFFpGATA-DSYIDATIEAATD-LGIRFHAARSSMTlgkseggfcddlf  177
ident  || |   |                   |||                             
Sbjct VGGTTMIIDHVVPE-PGSSlLTSFEKWHEAADTkSCCDYSLHVDITS-------------  124
DSSP  HLLEEEEEEEELLL-LLLLhHHHHHHHHHHHHLlLLLEEEEEEELLL-------------


DSSP  lLLHHHhHHHHHHHHHHHLllllllleEEEELlLLLL-----LLLHHHHHHHHHHHHHHL
Query vEPVDRvVQHCLGLIDQYHepepfgmvRIALGpCGVP-----YDKPELFEAFAQMAADYD  232
ident              |                                              
Sbjct -WYDGV-REELEVLVQDKG--------VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLG  173
DSSP  -LLLLH-HHHHHHHHHLLL--------LLEEE-EELLlllllLLLHHHHHHHHHHHHHHL


DSSP  LEEEEEE---------------------------llLLHHhhhhhhhllLHHHHHHHLL-
Query VRLHTHF---------------------------yePLDAgmsdhlygmTPWRFLEKHG-  264
ident      |                                                      
Sbjct AVILVHAengdliaqeqkrilemgitgpeghalsrpEELE--------aEAVFRAITIAg  225
DSSP  LEEEEELllhhhhhhhhhhhhhllllllhhhhhhllHHHH--------hHHHHHHHHHHh


DSSP  llllLEEEEELLLLL--HHHHHHHH-HHLLEEEELHHHHHH-------------------
Query wasdRVWLAHAVVPP--REEIPEFA-DAGVAIAHLIAPDLR-------------------  302
ident      |                       |      |                       
Sbjct rincPVYITKVMSKSaaDIIALARKkGPLVFGEPIAASLGTdgthywsknwakaaafvts  285
DSSP  hhllLEEEEEELLHHhhHHHHHHHHhLLLEEEEELHHHHHLllhhhhlllhhhhhhllll


DSSP  -LLLL-----LLLHHHHHHlLLEEEELLLLLL------------------LLLLL-LHHH
Query -MGWG-----LAPIREYLDaGITVGFGTTGSA------------------SNDGG-NLLG  337
ident                     |     |                          |      
Sbjct pPLSPdpttpDYLTSLLAC-GDLQVTGSGHCPystaqkavgkdnftlipeGVNGIeERMT  344
DSSP  lLLLLlllhhHHHHHHHHH-LLLLLLLLLLLLllhhhhhhhlllhhhlllLLLLLlLHHH


DSSP  HHHHHHhhlhhhllllhhhLLLH-HHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEE
Query DLRLAAlahrpadpnepekWLSA-RELLRMATRGSAECLGRP-DLGVLEEGRAADIACWR  395
ident      |                             |         |    |  ||   | 
Sbjct VVWDKA----------vatGKMDeNQFVAVTSTNAAKIFNLYpRKGRIAVGSDADVVIWD  394
DSSP  HHHHHH----------lllLLLLhHHHHHHHLHHHHHHHLLLlLLLLLLLLLLLLEEEEE


DSSP  LllhhhlllllhhhhhhhLLLL----------------------LLLLEEEELLEEEEEL
Query LdgvdrvgvhdpaiglimTGLS----------------------DRASLVVVNGQVLVEN  433
ident                     |                            |   |    | 
Sbjct P-----------------DKLKtitakshksaveynifegmechGSPLVVISQGKIVFED  437
DSSP  E-----------------EEEEelllllllllllllllllleeeEEEEEEEELLEEEEEL


DSSP  LEELLLL--------------------hhhhhhhhhhhll
Query ERPVLAD--------------------lerivanttalip  453
ident                                         
Sbjct GNINVNKgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  LEELLLLllllllllllllhhhhhhhhhhhhhllllllll


No 26: Query=3ls9A Sbjct=3k2gB Z-score=18.2

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                          |  
Sbjct ------------------------------slselspchvrsgrixtvdgpipssalGHT   30
DSSP  ------------------------------llllllllllllleeeelleeeehhhlLLE


DSSP  EEEELHHH---------------------hhhllLHHHLLLlhhhHHHHhHHHHhhhhhl
Query NSHQHLYE---------------------gamraIPQLERVtmasWLEGvLTRSagwwrd   99
ident   | ||                               |                      
Sbjct LXHEHLQNdcrcwwnppqeperqylaeapisieiLSELRQD----PFVN-KHNI------   79
DSSP  ELLLLLLEelhhhllllllhhhhhhhhllllhhhHHHHHLL----HHHL-LLLL------


DSSP  llllhhHHHHHHHHHHHHHHHLLEEEEEEEELLLlllllllHHHHHHHHHHHHLLEEEEE
Query gkfgpdVIREVARAVLLESLLGGITTVADQHLFFpgatadsYIDATIEAATDLGIRFHAA  159
ident            | |        |     |                        |      
Sbjct ----alDDLDLAIAEVKQFAAVGGRSIVDPTCRG----igrDPVKLRRISAETGVQVVXG  131
DSSP  ----eeLLHHHHHHHHHHHHHLLLLEEEELLLLL----lllLHHHHHHHHHHHLLEEEEL


DSSP  ELLLLLLhhhlllllhhHLLL------HHHHHHHHHHHHH------HHLLlllllleeEE
Query RSSMTLGkseggfcddlFVEP------VDRVVQHCLGLID------QYHEpepfgmvrIA  207
ident                             |                               
Sbjct AGYYLAS----------SXPEtaarlsADDIADEIVAEALegtdgtDARI--------GL  173
DSSP  LLLLLHH----------HLLHhhhlllHHHHHHHHHHHHHllllllLLLL--------LL


DSSP  ELLLLLL----llLHHHHHHHHHHHHHHLLEEEEEELLLLHhhhhhhhhlllHHHHHHHL
Query LGPCGVP----ydKPELFEAFAQMAADYDVRLHTHFYEPLDagmsdhlygmtPWRFLEKH  263
ident  |  ||               |         |  |                         
Sbjct IGEIGVSsdftaeEEKSLRGAARAQVRTGLPLXVHLPGWFR-----------LAHRVLDL  222
DSSP  EEEELLLllllhhHHHHHHHHHHHHHHHLLLEEELLLLLLL-----------LHHHHHHH


DSSP  LL----lLLLEEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHL------LLLL----
Query GW----aSDRVWLAHAVVP--PREEIPEFADAGVAIAHLIAPDLRM------GWGL----  307
ident             | |              |  |                           
Sbjct VEeegadLRHTVLCHXNPShxDPVYQATLAQRGAFLEFDXIGXDFFyadqgvQCPSddev  282
DSSP  HHhllllHHHEEELLLHHHllLHHHHHHHHHHLLEEEELLLLLLLEelllleELLLhhhh


DSSP  -lLHHHHHHLLL--EEEELLLLLL-------llLLLL-HHHH-HHHHHHhlhhhllllhh
Query -aPIREYLDAGI--TVGFGTTGSA-------snDGGN-LLGD-LRLAALahrpadpnepe  355
ident    |    | |                       |        |                
Sbjct arAILGLADHGYldRILLSHDVFVkxxltryggNGYAfVTKHfLPRLRR-----------  331
DSSP  hhHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLhHHHLhHHHHHH-----------


DSSP  HLLLHHHHHHHLLHHHHHhLLLLLLlllllllllleeeeelllhhhlllllhhhhhhhll
Query KWLSARELLRMATRGSAEcLGRPDLgvleegraadiacwrldgvdrvgvhdpaiglimtg  415
ident   |    |                                                    
Sbjct HGLDDAALETLXVTNPRR-VFDASI-----------------------------------  355
DSSP  LLLLHHHHHHHHLHHHHH-HHLLLL-----------------------------------


DSSP  lllllleeeelleeeeelleellllhhhhhhhhhhhll
Query lsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                       
Sbjct -----------------------------------egh  358
DSSP  -----------------------------------lll


No 27: Query=3ls9A Sbjct=1bf6A Z-score=17.8

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
ident                                                          |  
Sbjct ----------------------------------------------------sfdpTGYT    8
DSSP  ----------------------------------------------------llllLLEE


DSSP  EEEELHHHhhhlllhhhllllhhhhhhhHHHHHHHHHhlllllhhHHHHHHHHHHHHHHH
Query NSHQHLYEgamraipqlervtmaswlegVLTRSAGWWrdgkfgpdVIREVARAVLLESLL  120
ident   | ||                       |                              
Sbjct LAHEHLHI--------------------DLSGFKNNV----dcrlDQYAFICQEMNDLMT   44
DSSP  EEEELLLE--------------------ELHHHHLLH----hheeLLHHHHHHHHHHHHH


DSSP  LLEEEEEEEELLLlllllllHHHHHHHHHHHHLLEEEEEELLLLLLhhhlllllhhHLLL
Query GGITTVADQHLFFpgatadsYIDATIEAATDLGIRFHAARSSMTLGkseggfcddlFVEP  180
ident  |   |                          ||   |                  |   
Sbjct RGVRNVIEMTNRY----mgrNAQFMLDVMRETGINVVACTGYYQDA----------FFPE   90
DSSP  LLEEEEEELLLHH----hllLHHHHHHHHHHHLLEEEEEELLLLHH----------HLLL


DSSP  ------HHHHHHHHHHHHHHHlllllllleEEEELLLLLL-----llLHHHHHHHHHHHH
Query ------VDRVVQHCLGLIDQYhepepfgmvRIALGPCGVP-----ydKPELFEAFAQMAA  229
ident       |    |     | |                 |             | | |    
Sbjct hvatrsVQELAQEMVDEIEQG--idgtelkAGIIAEIGTSegkitplEEKVFIAAALAHN  148
DSSP  hhhhllHHHHHHHHHHHHHLL--lllllllEEEEEEEELLlllllhhHHHHHHHHHHHHH


DSSP  HHLLEEEEEELLllhhhhhhhhhllLHHHHHHHLLL----lLLLEEEEELL-LLLHHHHH
Query DYDVRLHTHFYEpldagmsdhlygmTPWRFLEKHGW----aSDRVWLAHAV-VPPREEIP  284
ident        ||                |                 ||   |         | 
Sbjct QTGRPISTHTSF------------sTMGLEQLALLQahgvdLSRVTVGHCDlKDNLDNIL  196
DSSP  HHLLLEEEELHH------------hLLHHHHHHHHHhllllHHHEEELLLLlLLLHHHHH


DSSP  HHHHHLLEEEE-LHHHhhHLLLLL----lLHHHHH-HLLL-EEEELLLLLL-------ll
Query EFADAGVAIAH-LIAPdlRMGWGL----aPIREYL-DAGI-TVGFGTTGSA-------sn  330
ident    | |       |                            |                 
Sbjct KMIDLGAYVQFdTIGK--NSYYPDekriaMLHALRdRGLLnRVMLSMDITRrshlkangg  254
DSSP  HHHHLLLEEEElLLLL--LLLLLHhhhhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhll


DSSP  LLLL-HHHH-HHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHHLLllllllllllll
Query DGGN-LLGD-LRLAALAhrpadpnepekWLSARELLRMATRGSAECLGrpdlgvleegra  388
ident  |   ||                       |      |                      
Sbjct YGYDyLLTTfIPQLRQS-----------GFSQADVDVMLRENPSQFFQ------------  291
DSSP  LLLLhHHHLhHHHHHHL-----------LLLHHHHHHHHLHHHHHHLL------------


DSSP  lleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhh
Query adiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivant  448
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hhhll
Query talip  453
ident      
Sbjct -----  291
DSSP  -----


No 28: Query=3ls9A Sbjct=1a5kC Z-score=17.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -----LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELL----------LLLLLLL
Query -----MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKD----------LSDRSVS   45
ident                            |||      | | ||                  
Sbjct aadcvDLVLTNA-LIVDH---WGIVK-ADIGVKDGRIFAIGKAgnpdiqpnvtIPIGAAT  115
DSSP  hhhllLEEEEEE-EEEEL---LEEEE-EEEEEELLEEEEEELEelllllllllEELLLLL


DSSP  EEEELLLEEEEELEEEEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhh
Query RTIDGRGMIALPGLINSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpd  105
ident   |   | |   | |  | |                                        
Sbjct EVIAAEGKIVTAGGIDTHIHWI--------------------------------------  137
DSSP  EEEELLLLEEEELEEEEEEELL--------------------------------------


DSSP  hhhhhHHHHHHHHHHLLEEEEEE------------EELLLlllllLLHHHHHHHHHHHHL
Query virevARAVLLESLLGGITTVAD------------QHLFFpgataDSYIDATIEAATDLG  153
ident            | |  | ||                           ||     ||  | 
Sbjct -----CPQQAEEALVSGVTTMVGggtgpaagthatTCTPG-----PWYISRMLQAADSLP  187
DSSP  -----LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLLH-----HHHHHHHHHHHLLLL


DSSP  LEEEEEELLLLllhhhlllllhhhlllhhhHHHHHHHHHHHHLllllllleeEEELLLlL
Query IRFHAARSSMTlgkseggfcddlfvepvdrVVQHCLGLIDQYHepepfgmvrIALGPCgV  213
ident                                                     | |     
Sbjct VNIGLLGKGNV------------------sQPDALREQVAAGV---------IGLEIH-E  219
DSSP  LEEEEEEELLL------------------lLHHHHHHHHHHLL---------LEEEEE-H


DSSP  LLL-LHHHHHHHHHHHHHHLLEEEEEEllllHHHHhhhhhLLLHhHHHHHLLLLLlLEEE
Query PYD-KPELFEAFAQMAADYDVRLHTHFyeplDAGMsdhlyGMTPwRFLEKHGWASdRVWL  272
ident      |         |   |     |                                  
Sbjct DWGaTPAAIDCALTVADEMDIQVALHS---dTLNE-----SGFV-EDTLAAIGGR-TIHT  269
DSSP  HHLlLHHHHHHHHHHHHHHLLEEEEEL---lLLLL-----LLLH-HHHHHHHLLL-LEEE


DSSP  EELLL----lLHHHHhHHHHH-LLEEEELhHHHH--------------------------
Query AHAVV----pPREEIpEFADA-GVAIAHLiAPDL--------------------------  301
ident  |            |                | |                          
Sbjct FHTEGaggghAPDII-TACAHpNILPSST-NPTLpytlntidehldmlmvchhldpdiae  327
DSSP  LLLLLlllllLLLHH-HHHHLlLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhh


DSSP  ----------hllLLLL--LHHHHHhlllEEEELLLLLLLlLLLL-HHHHHHHHHHHLHH
Query ----------rmgWGLA--PIREYLdagiTVGFGTTGSASnDGGN-LLGDLRLAALAHRP  348
ident                                       |               |     
Sbjct dvafaesrirretIAAEdvLHDLGA----FSLTSSDSQAM-GRVGeVILRTWQVAHRMKV  382
DSSP  hhhlllllllhhhHHHHhhHHHLLL----LLEEELLLLLL-LLLLlHHHHHHHHHHHHHH


DSSP  HLllLHHH-------llLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhh
Query ADpnEPEK-------wlSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvd  400
ident                           |   |   |     |  | |  ||   |      
Sbjct QR--GALAeetgdndnfRVKRYIAKYTINPALTHGIAhEVGSIEVGKLADLVVWSP----  436
DSSP  HH--LLLLlllllllhhHHHHHHHLLLHHHHHHLLLLlLLLLLLLLLLLLEEEELH----


DSSP  hlllllhhHHHHhllllLLLLEEEELLEEEEEL---------------LEEL--LLLH--
Query rvgvhdpaIGLImtglsDRASLVVVNGQVLVEN---------------ERPV--LADL--  441
ident                       |   |                      ||         
Sbjct --------AFFG-----VKPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfgALGSar  483
DSSP  --------HHLL-----LLLLEEEELLEEEEEEellllllllllllleEEELhhHLHHhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  441
ident                                                             
Sbjct hhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevr  543
DSSP  hhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellllllee


DSSP  -----------hhhhhhhhhhll
Query -----------erivanttalip  453
ident                        
Sbjct vdgelitsepadvlpmaqryflf  566
DSSP  elleellllllllllllllllll


No 29: Query=3ls9A Sbjct=2ob3A Z-score=17.3

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                          |  
Sbjct ------------------------------------------drintvrgpitiseaGFT   18
DSSP  ------------------------------------------lleeelleeelhhhhLLE


DSSP  EEEELHHHhhhlllhhhllllhhhhhhhHHHHHHHHhhLLLL-LHHHHHHHHHHHHHHHH
Query NSHQHLYEgamraipqlervtmaswlegVLTRSAGWwrDGKF-GPDVIREVARAVLLESL  119
ident   | |                              |     |       | |   |    
Sbjct LTHEHICG-------------------sSAGFLRAW--PEFFgSRKALAEKAVRGLRRAR   57
DSSP  EEEELLEE-------------------lLLLHHHHL--HHHHlLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEEEELlllllllllHHHHHHHHHHHHLLEEEEEELLLLllhhhllLLLHH-hl
Query LGGITTVADQHLffpgatadsYIDATIEAATDLGIRFHAARSSMTlgkseggFCDDL-fv  178
ident   |  |  |                  |          ||                    
Sbjct AAGVRTIVDVST----fdigrDVSLLAEVSRAADVHIVAATGLWF-------DPPLSmrl  106
DSSP  HLLLLEEEELLL----hhhllLHHHHHHHHHHHLLEEELEEELLL-------LLLHHhhl


DSSP  LLHHHHHHHHHHHHH------HHLLlllllleeEEELlLLLL----llLHHHHHHHHHHH
Query EPVDRVVQHCLGLID------QYHEpepfgmvrIALGpCGVP----ydKPELFEAFAQMA  228
ident   |    |  |  |                                        | |   
Sbjct RSVEELTQFFLREIQygiedtGIRA--------GIIX-VATTgkatpfQELVLKAAARAS  157
DSSP  LLHHHHHHHHHHHHHllllllLLLL--------LEEE-EELLllllhhHHHHHHHHHHHH


DSSP  HHHLLEEEEEELLLLhhhhhhhhhllLHHHHHHHLL----LLLLLEEEEEL-LLLLHHHH
Query ADYDVRLHTHFYEPLdagmsdhlygmTPWRFLEKHG----WASDRVWLAHA-VVPPREEI  283
ident     |   ||                                  ||   |          
Sbjct LATGVPVTTHTAASQ-----------RDGEQQAAIFesegLSPSRVCIGHSdDTDDLSYL  206
DSSP  HHHLLLEEEELLHHH-----------LHHHHHHHHHhhllLLHHHEEELLHhHLLLHHHH


DSSP  HHHHHHLLEEEELHHHHH-------------HLLLL----LLLHHHHHHLLL--EEEELL
Query PEFADAGVAIAHLIAPDL-------------RMGWG----LAPIREYLDAGI--TVGFGT  324
ident    |  |  |     |                           |    | |         
Sbjct TALAARGYLIGLDHIPYSaiglednasasalLGIRSwqtrALLIKALIDQGYmkQILVSN  266
DSSP  HHHHHLLLEEEELLLLLLlllllllhhhhhhHLLLLhhhhHHHHHHHHHLLLhhHEEELL


DSSP  LLL----------------lllLLLL-HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHL
Query TGS----------------asnDGGN-LLGDLRLAALAHrpadpnepekWLSARELLRMA  367
ident                       ||                               |    
Sbjct DWTfgfssyvtnimdvmdrvnpDGMAfIPLRVIPFLREK----------GVPQETLAGIT  316
DSSP  LLLleellllllhhhhhhhhllLHHHhHHHLHHHHHHHL----------LLLHHHHHHHH


DSSP  LHHHHHHLLlllllllllllllleeeeelllhhhlllllhhhhhhhlllllllleeeell
Query TRGSAECLGrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvng  427
ident     |  |                                                    
Sbjct VTNPARFLS---------------------------------------------------  325
DSSP  LHHHHHHHL---------------------------------------------------


DSSP  eeeeelleellllhhhhhhhhhhhll
Query qvlvenerpvladlerivanttalip  453
ident                           
Sbjct ----------------------ptlr  329
DSSP  ----------------------llll


No 30: Query=3ls9A Sbjct=2y1hB Z-score=17.0

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                          || 
Sbjct -------------------------------------------------------GVGLV    5
DSSP  -------------------------------------------------------LLLEE


DSSP  EEEELHHHHHHlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHHHHHHHH
Query NSHQHLYEGAMraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAVLLESLL  120
ident   | ||                                               ||     
Sbjct DCHCHLSAPDF------------------------------------dRDLDDVLEKAKK   29
DSSP  EEEELLLLHHH------------------------------------lLLHHHHHHHHHH


DSSP  LLEEEEEEEELLLllllllLHHHHHHHHHHHHLLEEEEEE-LLLLllhhhlllLLHHHLL
Query GGITTVADQHLFFpgatadSYIDATIEAATDLGIRFHAAR-SSMTlgkseggfCDDLFVE  179
ident                                                        |    
Sbjct ANVVALVAVAEHS------GEFEKIMQLSERYNGFVLPCLgVHPV-------qGLDQRSV   76
DSSP  LLEEEEEELLLLH------HHHHHHHHHHHHLLLLEEEEElLLLE-------eLLLLEEL


DSSP  LHHHHHHHhHHHHHHHLLllllllEEEEE-LLLLLLL-----------lLHHHHHHHHHH
Query PVDRVVQHcLGLIDQYHEpepfgmVRIAL-GPCGVPY-----------dKPELFEAFAQM  227
ident          |  |  |           |                              | 
Sbjct TLKDLDVA-LPIIENYKD------RLLAIgEVGLDFSprfagtgeqkeeQRQVLIRQIQL  129
DSSP  LHHHHHHH-HHHHHHHLL------LLLEEeEEEEELLllllllhhhhhhHHHHHHHHHHH


DSSP  HHHHLLEEEEEELlllhhhhhhhhhlllHHHHHHhLLLL---LLLEEEEELLLLLHhHHH
Query AADYDVRLHTHFYepldagmsdhlygmtPWRFLEkHGWA---SDRVWLAHAVVPPReEIP  284
ident |         |                   |              | |      |     
Sbjct AKRLNLPVNVHSR--------------sAGRPTI-NLLQeqgAEKVLLHAFDGRPS-VAM  173
DSSP  HHHHLLLEEEEEE--------------lLHHHHH-HHHHhllLLLEEEELLLLLHH-HHH


DSSP  HHHHHLLEEEELhHHHHhlLLLLL--LHHHHHhllLEEEELLLLLLLL------LLLL-H
Query EFADAGVAIAHLiAPDLrmGWGLA--PIREYLdagITVGFGTTGSASN------DGGN-L  335
ident |   ||               |                   |   |              
Sbjct EGVRAGYFFSIP-PSII--RSGQKqkLVKQLP--lTSICLETDSPALGpekqvrNEPWnI  228
DSSP  HHHHLLLEEEEL-HHHH--LLHHHhhHHHHLL--hHHEEELLLLLLLLllllllLLHHhH


DSSP  HHHHHHHHHHLHhhllllhhhlLLHHHHHHHLLHHHHHHL-LLLLllllllllllleeee
Query LGDLRLAALAHRpadpnepekwLSARELLRMATRGSAECL-GRPDlgvleegraadiacw  394
ident        |               |  |     |                           
Sbjct SISAEYIAQVKG----------ISVEEVIEVTTQNALKLFpKLRH---------------  263
DSSP  HHHHHHHHHHHL----------LLHHHHHHHHHHHHHHHLlLHHH---------------


DSSP  elllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query rldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                            
Sbjct ---------------------------------------------------------ll  265
DSSP  ---------------------------------------------------------hl


No 31: Query=3ls9A Sbjct=2vc5A Z-score=16.6

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
ident                                                          |  
Sbjct -----------------------------------------mriplvgkdsieskdIGFT   19
DSSP  -----------------------------------------llllllllllllhhhLLLE


DSSP  EEEELHHHhhhlllhhhllllhhhhhhhhhhHHHHHHHLL-LLLHHHHHHHHHHHHHHHH
Query NSHQHLYEgamraipqlervtmaswlegvltRSAGWWRDG-KFGPDVIREVARAVLLESL  119
ident   | ||                           |           |     |        
Sbjct LIHEHLRV----------------------fSEAVRQQWPhLYNEDEEFRNAVNEVKRAM   57
DSSP  ELLLLLLL----------------------lLHHHHHHLHhHLLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEEEELLLlllllllHHHHHHHHHHHHLLEEEEEELLLLLlhhhlLLLLHH-hl
Query LGGITTVADQHLFFpgatadsYIDATIEAATDLGIRFHAARSSMTLgksegGFCDDL-fv  178
ident   |  |  |             |          ||   |                     
Sbjct QFGVKTIVDPTVMG----lgrDIRFMEKVVKATGINLVAGTGIYIY-----IDLPFYfln  108
DSSP  HLLLLEEEELLLLL----lllLHHHHHHHHHLLLLEEEELEELLLL-----LLLLHHhll


DSSP  lLHHHHHHHHHHHH------HHHLllllllleEEEELlLLLL-----llLHHHHHHHHHH
Query ePVDRVVQHCLGLI------DQYHepepfgmvRIALGpCGVP-----ydKPELFEAFAQM  227
ident    |         |                                         | |  
Sbjct rSIDEIADLFIHDIkegiqgTLNK--------AGFVX-IAADepgitkdVEKVIRAAAIA  159
DSSP  lLHHHHHHHHHHHHhlllllLLLL--------LLLEE-EELLlllllhhHHHHHHHHHHH


DSSP  HHHHLLEEEEEELLLLhhhhhhhhhllLHHHHHHHLLL----lLLLEEEEEL-LLLLHHH
Query AADYDVRLHTHFYEPLdagmsdhlygmTPWRFLEKHGW----aSDRVWLAHA-VVPPREE  282
ident      |   ||                                       |         
Sbjct NKETKVPIITHSNAHN-----------NTGLEQQRILTeegvdPGKILIGHLgDTDNIDY  208
DSSP  HHHHLLLEEEELLLLL-----------LHHHHHHHHHHhllllHHHEEELLHhHLLLHHH


DSSP  HHHHHHHLLEEEELHHHhHHLLLL----LLLHHHHHHLLL--EEEELLLLL---------
Query IPEFADAGVAIAHLIAPdLRMGWG----LAPIREYLDAGI--TVGFGTTGS---------  327
ident |   || |  |       |                   |                     
Sbjct IKKIADKGSFIGLDRYG-LDLFLPvdkrNETTLRLIKDGYsdKIMISHDYCctidwgtak  267
DSSP  HHHHHHLLLEEEELLLL-LLLLLLhhhhHHHHHHHHHLLLllLEEELLLLLlllllllll


DSSP  -------llLLLLLhhHHHHHHHHHLHhhllllhHHLLLHHHHHHHLLHHhHHHLLLlll
Query -------asNDGGNllGDLRLAALAHRpadpnepEKWLSARELLRMATRGsAECLGRpdl  380
ident                                                             
Sbjct peykpklapRWSIT--LIFEDTIPFLK-------RNGVNEEVIATIFKEN-PKKFFS---  314
DSSP  hhhhhhhllLLLLL--HHHHLHHHHHH-------LLLLLHHHHHHHHLHH-HHHHLL---


DSSP  lllllllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellll
Query gvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvlad  440
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhll
Query lerivanttalip  453
ident              
Sbjct -------------  314
DSSP  -------------


No 32: Query=3ls9A Sbjct=3gg7A Z-score=15.9

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                           ||
Sbjct ---------------------------------------------------------SLI    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELHHHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHHHH
Query NSHQHLYEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLESLL  120
ident   | ||                                              ||      
Sbjct DFHVHLDLYP---------------------------------------DPVAVARACEE   24
DSSP  EEEELHHHLL---------------------------------------LHHHHHHHHHH


DSSP  LLEeEEEEEELLllllllllHHHHHHHHHHHhLLEEEEEELL---LLLLhhhlllllhhh
Query GGItTVADQHLFfpgatadsYIDATIEAATDlGIRFHAARSS---MTLGkseggfcddlf  177
ident     ||                  |   |         |                     
Sbjct RQL-TVLSVTTT------paAWRGTLALAAG-RPHVWTALGFhpeVVSE-----------   65
DSSP  LLL-EEEELLLL------hhHHHHHHHHHLL-LLLEEELLLLlhhHLLL-----------


DSSP  llLHHHHhHHHHHHHHHhlllllllleEEEELLLLLL---------llLHHHHHHHHHHH
Query vePVDRVvQHCLGLIDQyhepepfgmvRIALGPCGVP---------ydKPELFEAFAQMA  228
ident                                |  |                 |       
Sbjct --RAADL-PWFDRYLPE----------TRFVGEVGLDgspslrgtwtqQFAVFQHILRRC  112
DSSP  --LHHHL-HHHHHHHHH----------LLEEEEEELLllhhhhhhhhhHHHHHHHHHHHH


DSSP  HHH-LLEEEEEELlllhhhhhhhhhlllHHHHHHhLLLL----llLEEEEELLlLLHHHH
Query ADY-DVRLHTHFYepldagmsdhlygmtPWRFLEkHGWA----sdRVWLAHAVvPPREEI  283
ident  |     |  |                                     |         | 
Sbjct EDHgGRILSIHSR--------------rAESEVL-NCLEanprsgTPILHWYS-GSVTEL  156
DSSP  HHLlLEEEEEELL--------------lLHHHHH-HHHHhlhhheEEEEELLL-LLHHHH


DSSP  HHHHHHLLEEEELhHHHHhllLLLL--LHHHHHhlllEEEELLLLLLL-----LLLLL-H
Query PEFADAGVAIAHLiAPDLrmgWGLA--PIREYLdagiTVGFGTTGSAS-----NDGGN-L  335
ident       |                     ||        |   | |               
Sbjct RRAISLGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETDGPFLeldgqAALPWdV  211
DSSP  HHHHHLLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLLLLLLeelleELLHHhH


DSSP  HHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHHHHHhlLLLLllllllllllleeeee
Query LGDLRLAALAHrpadpnepekWLSARELLRMATRGSAEclGRPDlgvleegraadiacwr  395
ident                         | |  |                              
Sbjct KSVVEGLSKIW----------QIPASEVERIVKENVSR--LLGT----------------  243
DSSP  HHHHHHHHHHH----------LLLHHHHHHHHHHHHHH--HHHL----------------


DSSP  lllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query ldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                           
Sbjct ----------------------------------------------------------  243
DSSP  ----------------------------------------------------------


No 33: Query=3ls9A Sbjct=3cjpA Z-score=15.5

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                            |
Sbjct ---------------------------------------------------------LII    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHHHHHHHH
Query NSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAVLLESLL  120
ident   | |                                                       
Sbjct DGHTHVI-----------------------------------------LPVEKHIKIMDE   22
DSSP  EEEEELL-----------------------------------------LLHHHHHHHHHH


DSSP  LLEEEEEEEELL---------------------------llLLLL-LLHHHHHHHHHHHH
Query GGITTVADQHLF---------------------------fpGATA-DSYIDATIEAATDL  152
ident  |                                               |          
Sbjct AGVDKTILFSTSihpetavnlrdvkkemkklndvvngktnsMIDVrRNSIKELTNVIQAY   82
DSSP  HLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhllllllLHHHhHHHHHHHHHHHHHL


DSSP  LLEEEEEELLLLLlhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleEEEELLLL
Query GIRFHAARSSMTLgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvRIALGPCG  212
ident   |                                    |                |   
Sbjct PSRYVGFGNVPVG-------------LSENDTNSYIEENIVNNK--------LVGIGELT  121
DSSP  LLLEEEEELLLLL-------------LLHHHHHHHHHHHLLLLL--------LLEEEEEL


DSSP  LL-lLLHHhHHHHHHHHHHHL-LEEEEEElLLLHHhhhhhhhllLHHHHHHHlLLLL---
Query VP-yDKPElFEAFAQMAADYD-VRLHTHFyEPLDAgmsdhlygmTPWRFLEKhGWAS---  267
ident                   |        |                                
Sbjct PAsgQIKS-LKPIFKYSMDSGsLPIWIHA-FNPLV--------lQDIKEIAE-LCKAfpk  170
DSSP  LLllLHHH-HHHHHHHHHHLLlLLEEELL-LLLLL--------hHHHHHHHH-HHHHlll


DSSP  lLEEEEEL-LLLLHHHHHHHHHHL-LEEEELhhHHHHllLLLL--LHHHHHhllLEEEEL
Query dRVWLAHA-VVPPREEIPEFADAG-VAIAHLiaPDLRmgWGLA--PIREYLdagITVGFG  323
ident   | | |                                       | |         ||
Sbjct vPVILGHMgGSNWMTAVELAKEIQnLYLDTS--AYFS--TFVLkiVINELP---LKCIFG  223
DSSP  lLEEEHHHhHHHHHHHHHHHHHLLlEEEELL--LLLL--HHHHhhHHHHLL---LLEELL


DSSP  LLLLllLLLLLhhHHHHHHHHHlhhhllllhhhlLLHHHHHHHLLHHHHHhlLLLLllll
Query TTGSasNDGGNllGDLRLAALAhrpadpnepekwLSARELLRMATRGSAEclGRPDlgvl  383
ident |                                                           
Sbjct TDMP--FGDLQ--LSIEAIKKM-----------sNDSYVANAVLGDNISR--LLNI----  262
DSSP  LLLL--LLLHH--HHHHHHHHH-----------lLLHHHHHHHHLHHHHH--HHLL----


DSSP  llllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhh
Query eegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladler  443
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhll
Query ivanttalip  453
ident           
Sbjct ----------  262
DSSP  ----------


No 34: Query=3ls9A Sbjct=4mupB Z-score=14.9

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                          |  
Sbjct -----------------------------------------lvrklsgtapnpafPRGAV   19
DSSP  -----------------------------------------llllllllllllllLLLLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhHHHHhhhhhlllllhhhhhHHHHHHHHHHHH
Query NSHQHLYegamraipqlervtmaswlegvLTRSagwwrdgkfgpdvirEVARAVLLESLL  120
ident     | |                                                     
Sbjct DTQMHMY-------------lpgypalpgGPGL----------ppgalPGPEDYRRLMQW   56
DSSP  ELLLLLL-------------lllllllllLLLL----------lllllLLHHHHHHHHHH


DSSP  LLEEEEEEEE-LLLLlllllLHHHHHHHHHHhhlLEEEEEELlllllhhhlllllhhhll
Query GGITTVADQH-LFFPgatadSYIDATIEAATdlgIRFHAARSsmtlgkseggfcddlfve  179
ident  ||  |                  |            ||                     
Sbjct LGIDRVIITQgNAHQ--rdnGNTLACVAEMG---EAAHAVVI------------------   93
DSSP  HLLLEEEEELlHHHL--lllHHHHHHHHHHH---HHEEEEEL------------------


DSSP  lhhhHHHHHHHHHHHHLLllllllEEEEELLLLLL---LLLHhHHHHHHHHHHHHLLEEE
Query pvdrVVQHCLGLIDQYHEpepfgmVRIALGPCGVP---YDKPeLFEAFAQMAADYDVRLH  236
ident                                   |           |    |   |    
Sbjct ---iDATTTEKDMEKLTA-----aGTVGARIMDLPggaVNLS-ELDAVDERAHAADWMVA  144
DSSP  ---lLLLLLHHHHHHHHH-----lLEEEEEEELLLlllLLHH-HHHHHHHHHHHLLLEEE


DSSP  EEElLLLHHhhhhhhhllLHHHHHHHLLLlllLEEEE-ELLL--------lLHHHHHHHH
Query THFyEPLDAgmsdhlygmTPWRFLEKHGWasdRVWLA-HAVV--------pPREEIPEFA  287
ident   |                    | |      |     |                     
Sbjct VQF-DGNGL--------lDHLPRLQKIRS---RWVFDhHGKFfkgirtdgpEMAALLKLI  192
DSSP  EEL-LHHHH--------hHHHHHHHLLLL---EEEELhHHHLllllllllhHHHHHHHHH


DSSP  HHL-LEEEELhhHHHHLL-------lLLLLHHHHHHLL-lEEEELLLLLLLLL-----ll
Query DAG-VAIAHLiaPDLRMG-------wGLAPIREYLDAG-iTVGFGTTGSASND-----gg  333
ident | |                         |  |            ||              
Sbjct DRGnLWFKFA--GVYESSrkswpyadVAAFSRVIAAHApeRIVWGTNWPHNSVretaayp  250
DSSP  HHLlEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLhhHEEELLLLLLLLLllhhhll


DSSP  lhHHHHHHHHHhlhhhllllhhhlLLHHHHHHHLLHHHHHHLLLLLLlllllllllleee
Query nlLGDLRLAALahrpadpnepekwLSARELLRMATRGSAECLGRPDLgvleegraadiac  393
ident        |                       |                            
Sbjct ddARLAELTLG-----------wlPDEAARHRALVENPEALFKLSPV-------------  286
DSSP  lhHHHHHHHHL-----------llLLHHHHHHHHLHHHHHHHLLLLL-------------


DSSP  eelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query wrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


No 35: Query=3ls9A Sbjct=2ffiA Z-score=14.7

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
ident                                                            |
Sbjct ------------------------------------------------------lhLTAI    6
DSSP  ------------------------------------------------------llLLLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhHHHHHHHLLlllhhhhhhHHHHHHHHHHH
Query NSHQHLYegamraipqlervtmaswlegvltRSAGWWRDGkfgpdvireVARAVLLESLL  120
ident  || |                                                 |     
Sbjct DSHAHVF----------------------srGLNLASQRR--yapnydaPLGDYLGQLRA   42
DSSP  ELLLLLL----------------------lhHHHHHLLLL--lllllllLHHHHHHHHHH


DSSP  LLEEEEEEEEL-LLLLllllLHHHHHHHHHHhhlLEEEEEELlllllhhhlllllhhhll
Query GGITTVADQHL-FFPGatadSYIDATIEAATdlgIRFHAARSsmtlgkseggfcddlfve  179
ident  |          |        |                                      
Sbjct HGFSHGVLVQPsFLGT--dnRYLLSALQTVP---GQLRGVVX------------------   79
DSSP  LLLLEELLLLLhHHLL--llHHHHHHHHHLL---LLLLLLLL------------------


DSSP  lhhhHHHHhHHHHHHHLLllllllEEEEELLLLLLL-LLHH---hhHHHHHHHHHHLLEE
Query pvdrVVQHcLGLIDQYHEpepfgmVRIALGPCGVPY-DKPE---lfEAFAQMAADYDVRL  235
ident                                                             
Sbjct ---lERDVeQATLAEXAR-----lGVRGVRLNLXGQdXPDLtgaqwRPLLERIGEQGWHV  131
DSSP  ---lLLLLlHHHHHHHHL-----lLLLEEELLLLLLlLLLLlllllHHHHHHHHHHLLEE


DSSP  EEEELLllhhhhhhhhhllLHHHHHHHLLllLLLEEEE-ELLL---------LLHHHHHH
Query HTHFYEpldagmsdhlygmTPWRFLEKHGwaSDRVWLA-HAVV---------PPREEIPE  285
ident   |                                                    |    
Sbjct ELHRQV------------aDIPVLVRALQpyGLDIVIDhFGRPdarrglgqpGFAELLTL  179
DSSP  EELLLL------------lLHHHHHHHHLllLLLEEELhHHLLlllllllllLHHHHLLL


DSSP  HHHHLLEEEELhhHHHHLL------LLLL--LHHHHHHLLL--EEEELLLLLLL----lL
Query FADAGVAIAHLiaPDLRMG------WGLA--PIREYLDAGI--TVGFGTTGSAS----nD  331
ident      |          |           |                  |            
Sbjct SGRGKVWVKVS--GIYRLQgspeenLAFArqALCALEAHYGaeRLXWGSDWPHTqheseV  237
DSSP  LLLLLEEEEEE--LHHHLLllhhhhHHHHhhHHHHHHHHLLhhHEEEELLLLLLlllllL


DSSP  LLL-HHHHHHHHHhhlhhhllllhhhlLLHHHHHHHLLHHHHHhLLLLLLllllllllll
Query GGN-LLGDLRLAAlahrpadpnepekwLSARELLRMATRGSAEcLGRPDLgvleegraad  390
ident                             ||              |    |          
Sbjct SFGsAVEQFEALG--------------CSAQLRQALLLDTARA-LFGFEL----------  272
DSSP  LHHhHHHHHHHHL--------------LLHHHHHHHHLHHHHH-HLLLLL----------


DSSP  eeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhh
Query iacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivantta  450
ident                                                             
Sbjct ------------------------------------------------------------  272
DSSP  ------------------------------------------------------------


DSSP  hll
Query lip  453
ident    
Sbjct --e  273
DSSP  --l


No 36: Query=3ls9A Sbjct=3irsA Z-score=14.6

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
ident                                                            |
Sbjct --------------------------------------------------------LKII    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEELHH------hhhHLLLHHHLL--LLHHhhhhhhhhhhhhhhhlllllhhhhhhHHH
Query NSHQHLY------egaMRAIPQLER--VTMAswlegvltrsagwwrdgkfgpdvireVAR  112
ident                         |                                   
Sbjct DFRLRPPamgflnariYTRPDIRNRftRQLG----------------fepapsaeekSLE   48
DSSP  ELLLLLLlhhhhhlhhHHLHHHHHHhhHHHL----------------llllhhhhhlLHH


DSSP  HHHHHHHHLLEEEEEEEELL--lllllllLHHHHHHHHHHhhlLEEEEEELLLLllhhhl
Query AVLLESLLGGITTVADQHLF--fpgatadSYIDATIEAATdlgIRFHAARSSMTlgkseg  170
ident     |    ||                      |   |       ||   |         
Sbjct LMFEEMAAAGIEQGVCVGRNssvlgsvsnADVAAVAKAYP---DKFHPVGSIEA------   99
DSSP  HHHHHHHHLLLLEEEEELLEellleellhHHHHHHHHHLL---LLEEEEEELLL------


DSSP  llllhhhlLLHHHHHHHHHHHHHHHLllllllleeEEELLlLLLLL-------LHHHhHH
Query gfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvrIALGPcGVPYD-------KPELfEA  223
ident                       |                                 |   
Sbjct --------ATRKEAMAQMQEILDLGI---------RIVNL-EPGVWatpmhvdDRRL-YP  140
DSSP  --------LLHHHHHHHHHHHHHLLL---------LLEEE-LHHHLlllllllLHHH-HH


DSSP  HHHHHHHHLLEEEEEELLL-lhHHHHhhhhllLHHHHHHhlLLLL----lLEEEEEL-LL
Query FAQMAADYDVRLHTHFYEP-ldAGMSdhlygmTPWRFLEkhGWAS----dRVWLAHA-VV  277
ident       |                         |                  |   |    
Sbjct LYAFCEDNGIPVIMMTGGNagpDITY------TNPEHID--RVLGdfpdlTVVSSHGnWP  192
DSSP  HHHHHHHLLLLEEEELLLLlllLHHH------HLHHHHH--HHHHhllllLEEEEHHhLL


DSSP  LLHHHHHHHHHHL-LEEEELhHHHHhlLLLLL-LHHHHHHLLL--EEEELLLLLllLLLL
Query PPREEIPEFADAG-VAIAHLiAPDLrmGWGLA-PIREYLDAGI--TVGFGTTGSasNDGG  333
ident    | |                                          |||         
Sbjct WVQEIIHVAFRRPnLYLSPD-MYLY--NLPGHaDFIQAANSFLadRMLFGTAYP--MCPL  247
DSSP  LHHHHHHHHHHLLlEEEELH-HHHL--LLLLHhHHHHHHLLHHhhLLLLLLLLL--LLLH


DSSP  L-HHHHHHHhhhhlhhhllllhhhLLLHHHHHHHLLHHHHHhLLLLllllllllllllee
Query N-LLGDLRLaalahrpadpnepekWLSARELLRMATRGSAEcLGRPdlgvleegraadia  392
ident                                           |                 
Sbjct KeYTEWFLT--------------lPIKPDAMEKILHGNAER-LLAQ--------------  278
DSSP  HhHHHHHHL--------------lLLLHHHHHHHHLHHHHH-HHHH--------------


DSSP  eeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhl
Query cwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttali  452
ident                                                             
Sbjct ----------------------------------------------------------ag  280
DSSP  ----------------------------------------------------------ll


DSSP  l
Query p  453
ident  
Sbjct r  281
DSSP  l


No 37: Query=3ls9A Sbjct=4hk5D Z-score=14.3

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                         |   
Sbjct -------------------------------------------------------TPVVV    5
DSSP  -------------------------------------------------------LLLLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhHHHH-----hHHHH------------------
Query NSHQHLYegamraipqlervtmaswlegVLTR-----sAGWW------------------   97
ident   | | |                                                     
Sbjct DIHTHMY-----------------ppsyIAMLekrqtiPLVRtfpqadeprlillssela   48
DSSP  EEEEEEL-----------------lhhhHHHHhlllllLEEEeelleeeeeeellhhhhh


DSSP  -----------hlllllhhhhhHHHHHHHHHHHHLLEEEEEEEE---LLLLL---LLLL-
Query -----------rdgkfgpdvirEVARAVLLESLLGGITTVADQH---LFFPG---ATAD-  139
ident                                    ||           |           
Sbjct aldaaladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLanpWFDFLapdEAPGi  108
DSSP  hhhhhhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEElllLLLLLlllLHHHh


DSSP  --LHHHHHHHHHHHHLLEEEEEELLLLllhhhlllllhhhLLLHHHHHHHHHHHHHHHll
Query --SYIDATIEAATDLGIRFHAARSSMTlgkseggfcddlfVEPVDRVVQHCLGLIDQYhe  197
ident                  |                        ||| |             
Sbjct adAVNAEFSDMCAQHVGRLFFFAALPL-------------SAPVDAVKASIERVKNLK--  153
DSSP  hhHHHHHHHHHHHLLLLLEEEEEELLL-------------LLLHHHHHHHHHHHHLLL--


DSSP  llllllEEEEELLlLLLLL-----LHHHhHHHHHHHHHHLLEEEEEE-------------
Query pepfgmVRIALGPcGVPYD-----KPELfEAFAQMAADYDVRLHTHF-------------  239
ident               |          | |        ||       |              
Sbjct ------YCRGIIL-GTSGLgkgldDPHL-LPVFEAVADAKLLVFLHPhyglpnevygprs  205
DSSP  ------LEEEEEE-LLLLLlllllLHHH-HHHHHHHHHLLLEEEELLlllllhhhhlllh


DSSP  -----------lLLLHhhhhhhhhllLHHHHHH-HLLL---lllLEEEE-ELLL--LLHH
Query -----------yEPLDagmsdhlygmTPWRFLE-KHGW---asdRVWLA-HAVV--PPRE  281
ident              |                                 ||           
Sbjct eeyghvlplalgFPME--------ttIAVARMYmAGVFdhvrnlQMLLAhSGGTlpFLAG  257
DSSP  hhlllhhhhhlhHHHH--------hhHHHHHHHhLLHHhhllllLEEEHhHHLLhhHHHH


DSSP  ------------------------HHHHHHhHLLEEEELHHhhhhllllllLHHHHHHLL
Query ------------------------EIPEFAdAGVAIAHLIApdlrmgwglaPIREYLDAG  317
ident                                        |                    
Sbjct riescivhdghlvktgkvpkdrrtIWTVLK-EQIYLDAVIY-------sevGLQAAIASS  309
DSSP  hhhhhhhllhhhhhllllllllllHHHHHH-HLEEEELLLL-------lhhHHHHHHHHH


DSSP  L--EEEELLLLLlLLLL---------lLHHHHHHHHHHhlhhhllllhhhLLLH--HHHH
Query I--TVGFGTTGSaSNDG---------gNLLGDLRLAALahrpadpnepekWLSA--RELL  364
ident       |||                                                   
Sbjct GadRLMFGTDHP-FFPPieedvqgpwdSSRLNAQAVIK------------AVGEgsSDAA  356
DSSP  LhhHEELLLLLL-LLLLlllllllllhHHHHHHHHHHH------------HHLLllHHHH


DSSP  HHLLHHHHHhLLLLLlllllllLLLLeeeeelllhhhlllllhhhhhhhlllllllleee
Query RMATRGSAEcLGRPDlgvleegRAADiacwrldgvdrvgvhdpaiglimtglsdraslvv  424
ident                                                             
Sbjct AVMGLNAVR-VLSLK-------AELE----------------------------------  374
DSSP  HHHLHHHHH-HLLLH-------HHHH----------------------------------


DSSP  eLLEEeeelleellllhhhhhhhhhhhll
Query vNGQVlvenerpvladlerivanttalip  453
ident                              
Sbjct -HHHH----------------------hh  380
DSSP  -HHHH----------------------hl


No 38: Query=3ls9A Sbjct=2dvtA Z-score=14.2

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                          |  
Sbjct -------------------------------------------------------MQGKV    5
DSSP  -------------------------------------------------------LLLEE


DSSP  EEEELHH-----hhhhlLLHHHLLLlhhhhhhhhhhhhhhhhhlllllhhhhhHHHH-HH
Query NSHQHLY-----egamrAIPQLERVtmaswlegvltrsagwwrdgkfgpdvirEVAR-AV  114
ident     |              |                                        
Sbjct ALEEHFAipetlqdsagFVPGDYWK----------------------elqhrlLDIQdTR   43
DSSP  EEEEEELlhhhhhhhllLLLLLHHH----------------------hhhhhhHLLLlHH


DSSP  HHHHHHLLEEEEEEEE--LLLL-----LLLLL---LHHHHHHHHHHHHLLEEEEEELLLL
Query LLESLLGGITTVADQH--LFFP-----GATAD---SYIDATIEAATDLGIRFHAARSSMT  164
ident |      || |                           |   |       || |      
Sbjct LKLMDAHGIETMILSLnaPAVQaipdrRKAIEiarRANDVLAEECAKRPDRFLAFAALPL  103
DSSP  HHHHHHLLEEEEEEEEllLHHHhlllhHHHHHhhhHHHHHHHHHHHHLLLLEEEEELLLL


DSSP  llhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleEEEELLLLL--------lLL
Query lgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvRIALGPCGV--------pYD  216
ident                  |                             |            
Sbjct --------------QDPDAATEELQRCVNDLG--------FVGALVNGFsqegdgqtpLY  141
DSSP  --------------LLHHHHHHHHHHHHHLLL--------LLEEEEELLlllllllllLL


DSSP  LHH-hHHHHHHHHHHHLLEEEEE----------------------elLLLHhhhhhhhhl
Query KPE-lFEAFAQMAADYDVRLHTH----------------------fyEPLDagmsdhlyg  253
ident         |       ||    |                                     
Sbjct YDLpqYRPFWGEVEKLDVPFYLHprnplpqdsriydghpwllgptwaFAQE--------t  193
DSSP  LLLhhHHHHHHHHHHHLLLEEEElllllhhhlhhhlllhhhlhhhlhHHHH--------h


DSSP  lLHHHHH--HHLL--llLLLEEEE-ELLL--LLHH--------------------HHHHH
Query mTPWRFL--EKHG--waSDRVWLA-HAVV--PPRE--------------------EIPEF  286
ident       |               |                                    |
Sbjct aVHALRLmaSGLFdehpRLNIILGhMGEGlpYMMWridhrnawvklpprypakrrFMDYF  253
DSSP  hHHHHHHhhLLHHhhllLLLEEELhHHLLhhHHHHhhhhllllllllllllllllHHHHH


DSSP  HhHLLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLLllLLLL-HHHHHHhhh
Query AdAGVAIAHLIApdlrmgwglaPIREYLDAGI--TVGFGTTGSAsnDGGN-LLGDLRlaa  343
ident       |                              | |                    
Sbjct N-ENFHITTSGN------frtqTLIDAILEIGadRILFSTDWPF--ENIDhASDWFN---  301
DSSP  H-HHEEEELLLL------llhhHHHHHHLLLLhhHEELLLLLLL--LLHHhHHHHHH---


DSSP  hhlhhhllllhhhLLLHHHHHHHLLHHHHHhLLLLLllllllllllleeeeelllhhhll
Query lahrpadpnepekWLSARELLRMATRGSAEcLGRPDlgvleegraadiacwrldgvdrvg  403
ident                                |   |                        
Sbjct -----------atSIAEADRVKIGRTNARR-LFKLD------------------------  325
DSSP  -----------hlLLLHHHHHHHHLHHHHH-HLLLL------------------------


DSSP  lllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query vhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                   
Sbjct --------------------------------------------------  325
DSSP  --------------------------------------------------


No 39: Query=3ls9A Sbjct=4ofcA Z-score=14.2

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgLI   60
ident                                                            |
Sbjct ---------------------------------------------------------mKI    3
DSSP  ---------------------------------------------------------lLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhHHHHHL------LLLL-----------
Query NSHQHLYegamraipqlervtmaswlegvltrsAGWWRD------GKFG-----------  103
ident   | |                                                       
Sbjct DIHSHIL-----------------------pkeWPDLKKrfgyggWVQLqhhskgeakll   40
DSSP  EEEEELL-----------------------lllLLLHHHhhllllLEEEeeeelleeeee


DSSP  --------hhhhhHHHHHHHHHHHHLLEEEEEEEE--LLLL-----LLLLL---LHHHHH
Query --------pdvirEVARAVLLESLLGGITTVADQH--LFFP-----GATAD---SYIDAT  145
ident                      |    | |  |       |        |           
Sbjct kdgkvfrvvrencWDPEVRIREMDQKGVTVQALSTvpVMFSywakpEDTLNlcqLLNNDL  100
DSSP  elleeeeeeehhhLLHHHHHHHHHHHLLLEEEEELlhHHHLllllhHHHHHhhhHHHHHH


DSSP  HHHHHHHLLEEEEEELLllllhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleE
Query IEAATDLGIRFHAARSSmtlgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvR  205
ident          ||                            |                    
Sbjct ASTVVSYPRRFVGLGTL--------------pmQAPELAVKEMERCVKELG--------F  138
DSSP  HHHHHHLLLLEEEEELL--------------llLLHHHHHHHHHHHHHLLL--------L


DSSP  EEELLlLLLL-----lLHHHhHHHHHHHHHHLLEEEEEE------------------lLL
Query IALGPcGVPY-----dKPELfEAFAQMAADYDVRLHTHF------------------yEP  242
ident       |           ||       |      |  |                     |
Sbjct PGVQI-GTHVnewdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMP  196
DSSP  LEEEE-ELEElleellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHH


DSSP  LHhhhhhhhhllLHHHHHH-HLLL---LLLLEEEEE-LLLL--LHHH-------------
Query LDagmsdhlygmTPWRFLE-KHGW---ASDRVWLAH-AVVP--PREE-------------  282
ident                                |  ||                        
Sbjct AE--------ttIAICSMImGGVFekfPKLKVCFAHgGGAFpfTVGRishgfsmrpdlca  248
DSSP  HH--------hhHHHHHHHlLLHHhhlLLLLEEELHhHLLHhhHHHHhhhhhhhlhhhhl


DSSP  -------hHHHHhhLLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLL-LLLL
Query -------iPEFAdaGVAIAHLIApdlrmgwglaPIREYLDAGI--TVGFGTTGSA-SNDG  332
ident                     |                  |      |  ||         
Sbjct qdnpmnpkKYLG--SFYTDALVH-------dplSLKLLTDVIGkdKVILGTDYPFpLGEL  299
DSSP  llllllhhHHLL--LLEEELLLL-------lhhHHHHHHHHHLllLEELLLLLLLlLLLL


DSSP  lLHHHHHHHHHhhlhhhllllhhhLLLHHHHHHHLLHHHHHHLLLLllllllllLLLLee
Query gNLLGDLRLAAlahrpadpnepekWLSARELLRMATRGSAECLGRPdlgvleegRAADia  392
ident                                           ||          |     
Sbjct -EPGKLIESME-------------EFDEETKNKLKAGNALAFLGLE--------RKQF--  335
DSSP  -LLLHHHHHLL-------------LLLHHHHHHHHLHHHHHHHLLL--------HHHL--


DSSP  eeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhl
Query cwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttali  452
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  l
Query p  453
ident  
Sbjct -  335
DSSP  -


No 40: Query=3ls9A Sbjct=3pnuA Z-score=14.1

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeELLL-EEEEELE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtiDGRG-MIALPGL   59
ident                                                         |   
Sbjct ---------------------------------------------enlYFQSnAMKLKNP   15
DSSP  ---------------------------------------------lllLLLLlLEEEELL


DSSP  EEEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHHHHHHHHHHH
Query INSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvIREVARAVLLESL  119
ident    | ||                                                   | 
Sbjct LDMHLHLR---------------------------------------DNQMLELIAPLSA   36
DSSP  EEEEELLL---------------------------------------LHHHHHHHHHHHH


DSSP  HlLEEEEEEEELLLLlllLLLHHHHHHHHHHHHL----LEEEEEELLLlllhhhlllllh
Query LgGITTVADQHLFFPgatADSYIDATIEAATDLG----IRFHAARSSMtlgkseggfcdd  175
ident               |         |                                   
Sbjct R-DFCAAVIMPNLIPplcNLEDLKAYKMRILKACkdenFTPLMTLFFK------------   83
DSSP  L-LLLEEEELLLLLLlllLHHHHHHHHHHHHHHHllllLEEEEEEELL------------


DSSP  hhlllhhhhHHHHHHHHHHhlllllllleEEEELlLLLL--------LLLHH---hHHHH
Query lfvepvdrvVQHCLGLIDQyhepepfgmvRIALGpCGVP--------YDKPE---lFEAF  224
ident                  |                                          
Sbjct ------nydEKFLYSAKDE----------IFGIX-LYPAgittnsngGVSSFdieyLKPT  126
DSSP  ------lllHHHHHHHLLL----------LLEEE-ELLLllllllllLLLLLlhhhHHHH


DSSP  HHHHHHHLLEEEEEEL-----lLLHHHhhhhhhllLHHHHHHHLLlLLLLEEEEELLLLL
Query AQMAADYDVRLHTHFY-----ePLDAGmsdhlygmTPWRFLEKHGwASDRVWLAHAVVPP  279
ident      |    |  |                          | ||          |     
Sbjct LEAMSDLNIPLLVHGEtndfvmDRESN------faKIYEKLAKHF-PRLKIVMEHITTKT  179
DSSP  HHHHHHLLLLEEELLLllllhhHLLHH------hhHHHHHHHHHL-LLLLEEELLLLLHH


DSSP  -hHHHHHhhHHLLEEEELHHHHHH------------------LLLL---LLLHHHHH-hl
Query -rEEIPEfaDAGVAIAHLIAPDLR------------------MGWG---LAPIREYL-da  316
ident   |                                                   |     
Sbjct lcELLKD--YENLYATITLHHLIItlddviggkmnphlfckpIAKRyedKEALCELAfsg  237
DSSP  hhHHHHH--LLLEEEEELLHHHLLlhhhhhlllllhhhllllLLLLhhhHHHHHHHHhll


DSSP  LLEEEELLLLLL-------LLLLL-LHHHHHHHHHHhlhhhllllhhhLLLHHHHHHHLL
Query GITVGFGTTGSA-------SNDGG-NLLGDLRLAALahrpadpnepekWLSARELLRMAT  368
ident    | ||                    |  |                   |   |     
Sbjct YEKVMFGSDSAPhpkgcaaGVFSApVILPVLAELFK-----------qNSSEENLQKFLS  286
DSSP  LLLEEELLLLLLlllllllLLLLHhHHHHHHHHHHH-----------hHLLHHHHHHHHL


DSSP  HHHHHHlLLLLLllllllLLLLEEEEELLlhhhlllllhhhhhhhLLLLlllleeeelle
Query RGSAEClGRPDLgvleegRAADIACWRLDgvdrvgvhdpaiglimTGLSdraslvvvngq  428
ident                       |                                     
Sbjct DNTCKI-YDLKF------KEDKILTLEEK----------------EWQV-----------  312
DSSP  HHHHHH-HLLLL------LLLLEEEEELL----------------LEEL-----------


DSSP  eeeelleellllhhhHHHHHH------------hhll
Query vlvenerpvladlerIVANTT------------alip  453
ident                                      
Sbjct -----------pnvyEDKYNQvvpymageilkfqlkh  338
DSSP  -----------llleELLLLEellllllleelleell


No 41: Query=3ls9A Sbjct=2a3lA Z-score=14.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------leeeeEEEEEEllllllleeeeeeeeeelleee
Query ---------------------------milirGLTRVItfddqereledadilidgpkiv   33
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  eeellllllllleeeellleeeEELEEEEEELHHHHHHL---------------------
Query avgkdlsdrsvsrtidgrgmiaLPGLINSHQHLYEGAMR---------------------   72
ident                              | |                            
Sbjct --------------------fyNVRKVDTHVHHSACMNQkhllrfiksklrkepdevvif  198
DSSP  --------------------llLLLEEEEEEELLLLLLHhhhhhhhhhhhhlllllllee


DSSP  -----------------------LLHH-----hllllhhHHHHHHHHhHHHH-hhlLLLL
Query -----------------------AIPQ-----lervtmaSWLEGVLTrSAGW-wrdGKFG  103
ident                                                   |       | 
Sbjct rdgtyltlrevfesldltgydlnVDLLdvhadkstfhrfDKFNLKYN-PCGQsrlrEIFL  257
DSSP  elleeelhhhhhhhhllllllllLLLLllllllllllllLLLHHHHL-LLLLlhhhHHHL


DSSP  -------HHHHHHHHHHHHHHHH-HLLEeEEEEEELLL-lLLLL-LLHHHHH-hHHHHhh
Query -------PDVIREVARAVLLESL-LGGItTVADQHLFF-pGATA-DSYIDAT-iEAATdl  152
ident             |    |                           |              
Sbjct kqdnliqGRFLGEITKQVFSDLEaSKYQ-MAEYRISIYgrKMSEwDQLASWIvnNDLY--  314
DSSP  lllllllLLLHHHHHHHHHHHHLlLLLE-EEEEEEELLllLLLHhHHHHHHHhlLLLL--


DSSP  LLEEEEEELLLLLLhhhlllLLHH-------hllLHHHHHHHHHH---------hhHHHL
Query GIRFHAARSSMTLGkseggfCDDL-------fvePVDRVVQHCLG---------liDQYH  196
ident             |                       |                       
Sbjct SENVVWLIQLPRLY------NIYKdmgivtsfqnILDNIFIPLFEatvdpdshpqlHVFL  368
DSSP  LLLEEEEEEEELLH------HHHLllllllllhhHHHHHLLHHHHhhhlhhhllllHHHH


DSSP  LllllllEEEEELLLLLL----------------------llLHHHHHHHHHHHHHHL--
Query EpepfgmVRIALGPCGVP----------------------ydKPELFEAFAQMAADYD--  232
ident                                                             
Sbjct K------QVVGFDLVDDEskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNkl  422
DSSP  L------LEEEEEEELLLllllllllllllllllllllllllHHHHHHHHHHHHHHHHhh


DSSP  --------LEEEEEELLLLHHhhhhhhhllLHHHHHhHLLLllllEEEEELLL-LLHH-H
Query --------VRLHTHFYEPLDAgmsdhlygmTPWRFLeKHGWasdrVWLAHAVV-PPRE-E  282
ident           |  |  |  |                            ||          
Sbjct reskgmttITLRPHSGEAGDI---------DHLAAT-FLTC----HSIAHGINlRKSPvL  468
DSSP  hlllllllLEELLLLLLLLLL---------HHHHHH-HHHL----LLLLLLHHhHHLHhH


DSSP  HHHHHHHLLEEEELHHHHHhLLLL---LLLHHHHHHLLLEEEELLLLLLLLL--llLHHH
Query IPEFADAGVAIAHLIAPDLrMGWG---LAPIREYLDAGITVGFGTTGSASND--ggNLLG  337
ident       |    |                 |       |  |   |            |  
Sbjct QYLYYLAQIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDPLQIHltkePLVE  527
DSSP  HHHHHHHLLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLHHHHLllllHHHH


DSSP  HHHHHHHHLhhhllllhhhLLLHHHHHHHlLHHHHHHLLL-LLLL--LLLLLLllleeee
Query DLRLAALAHrpadpnepekWLSARELLRMaTRGSAECLGR-PDLG--VLEEGRaadiacw  394
ident     ||              |||  |     | |    |    |                
Sbjct EYSIAASVW----------KLSACDLCEI-ARNSVYQSGFsHALKshWIGKDY-------  569
DSSP  HHHHHHHHH----------LLLHHHHHHH-HHHHHHHLLLlHHHHhhHLLLLL-------


DSSP  elllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query rldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                            
Sbjct ------------ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  ------------llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 42: Query=3ls9A Sbjct=4dlfA Z-score=13.9

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
ident                                                            |
Sbjct --------------------------------------------------------ALRI    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhHHHHHHHhhhlllllhhhhhhHHHHHHHHHHH
Query NSHQHLYegamraipqlervtmaswlegVLTRSAGwwrdgkfgpdvireVARAVLLESLL  120
ident  ||||                                               |       
Sbjct DSHQHFW--------------------rYRAADYP-wigagmgvlardyLPDALHPLMHA   43
DSSP  EEEELLL--------------------lLLHHHLL-llllllhhhllllLHHHHHHHHHH


DSSP  LLEEEEEEEELLLLlllllLHHHHHHHHHhhhLLEEEEEELlllllhhhlllllhhhlll
Query GGITTVADQHLFFPgatadSYIDATIEAAtdlGIRFHAARSsmtlgkseggfcddlfvep  180
ident                                                             
Sbjct QALGASIAVQARAG-rdetAFLLELACDE---ARIAAVVGW---------------edlr   84
DSSP  LLLLEEEEELLLLL-hhhhHHHHHHHLLL---LLEEEEEEL---------------llll


DSSP  HHHHHHHHHHhHHHHllllllllEEEEELLLLLLL-------lLHHHhHHHHHHHHHHLL
Query VDRVVQHCLGlIDQYhepepfgmVRIALGPCGVPY-------dKPELfEAFAQMAADYDV  233
ident                                                           | 
Sbjct APQLAERVAE-WRGT--------KLRGFRHQLQDEadvrafvdDADF-ARGVAWLQANDY  134
DSSP  LLLHHHHHHL-LLLL--------LEEEEEELHHHLllhhhhhhLHHH-HHHHHHHHHLLL


DSSP  EEEEEElLLLHHhhhhhhhllLHHHHHHhlLLLLLLEEEE-ELLL-------------lL
Query RLHTHFyEPLDAgmsdhlygmTPWRFLEkhGWASDRVWLA-HAVV-------------pP  279
ident                          |            |                     
Sbjct VYDVLV-FERQL--------pDVQAFCA--RHDAHWLVLDhAGKPalaefdrddtalarW  183
DSSP  EEEELL-LHHHH--------hHHHHHHH--HLLLLLEEEHhHHLLlhhhllllllhhhhH


DSSP  HHHHHHHHHHL-LEEEELhhHHHHLL------------lLLLLHHHHHHLLL--EEEELL
Query REEIPEFADAG-VAIAHLiaPDLRMG------------wGLAPIREYLDAGI--TVGFGT  324
ident |    | |    |                                  |||       || 
Sbjct RAALRELAALPhVVCKLS--GLVTEAdwrrglrasdlrhIEQCLDAALDAFGpqRLMFGS  241
DSSP  HHHHHHHHLLLlEEEEEL--LLLLLLlllllllhhhhhhHHHHHHHHHHHHLhhHEEELL


DSSP  LLLLLL--LLLLhhHHHHHHHHHLHhhllllhhHLLLHHHHHHHLLHHHHHHLLLLllll
Query TGSASN--DGGNllGDLRLAALAHRpadpnepeKWLSARELLRMATRGSAECLGRPdlgv  382
ident                   |                ||| |         | |   |    
Sbjct DWPVCLlaASYD--EVASLVERWAE--------SRLSAAERSALWGGTAARCYALP----  287
DSSP  LLLHHHhlLLHH--HHHHHHHHHHH--------HHLLHHHHHHHLLHHHHHHLLLL----


DSSP  lllllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhh
Query leegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladle  442
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhll
Query rivanttalip  453
ident            
Sbjct -----------  287
DSSP  -----------


No 43: Query=3ls9A Sbjct=4qrnA Z-score=13.9

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleEEEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmIALPGLI   60
ident                                                            |
Sbjct -------------------------------------------smtqdlktggEQGYLRI   17
DSSP  -------------------------------------------llllllllllLLLLLLE


DSSP  EEEELHH-----hhhhlllhhhlllLHHHHHH-HHHHHhhhhhhlllllhhhhhHHHH-H
Query NSHQHLY-----egamraipqlervTMASWLE-GVLTRsagwwrdgkfgpdvirEVAR-A  113
ident                               |                             
Sbjct ATEEAFAtreiidvylrmirdgtadKGMVSLWgFYAQS----pseratqilerlLDLGeR   73
DSSP  EEEEEELlhhhhhhhhhhhhhllllHHHHHHHhHHHHL----llhhhhhhhhhhHLLLhH


DSSP  HHHHHHHLLEEEEEEEE--LLLL------LLLLL--LHHHHHHHHHHHHLLEEEEEELLL
Query VLLESLLGGITTVADQH--LFFP------GATAD--SYIDATIEAATDLGIRFHAARSSM  163
ident         ||                    |        |    |      ||       
Sbjct RIADMDATGIDKAILALtsPGVQplhdldEARTLatRANDTLADACQKYPDRFIGMGTVA  133
DSSP  HHHHHHHLLLLEEEEEEllLLLLllllhhHHHHHhhHHHHHHHHHHHHLLLLEEELLLLL


DSSP  LllhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleEEEELLLLL----lllLHH
Query TlgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvRIALGPCGV----pydKPE  219
ident                                                             
Sbjct P--------------QDPEWSAREIHRGARELG--------FKGIQINSHtqgryldEEF  171
DSSP  L--------------LLHHHHHHHHHHHHHLLL--------LLLEEELLLlllllllLHH


DSSP  HhHHHHHHHHHHLLEEEEE---------------------elLLLHhhhhhhhhlllHHH
Query LfEAFAQMAADYDVRLHTH---------------------fyEPLDagmsdhlygmtPWR  258
ident             |  |  |                                        |
Sbjct F-DPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgFGVE-------tgmhLLR  223
DSSP  H-HHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhHHHH-------hhhhHHH


DSSP  HHHHLLL---lLLLEEEE-ELLL--LLHH------------------------HHHHHHh
Query FLEKHGW---aSDRVWLA-HAVV--PPRE------------------------EIPEFAd  288
ident            |                                                
Sbjct LITIGIFdkypSLQIMVGhMGEAlpYWLYrldymhqagvrsqryermkplkktIEGYLK-  282
DSSP  HHHHLHHhhllLLLEEELhHHHLhhHHHHhhhhhhhhhhhlllllllllllllHHHHHH-


DSSP  HLLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLlLLLLllhHHHHHHHHHhl
Query AGVAIAHLIApdlrmgwglaPIREYLDAGI--TVGFGTTGSaSNDGgnlLGDLRLAALah  346
ident   |                  |           |                   |      
Sbjct SNVLVTNSGV------awepAIKFCQQVMGedRVMYAMDYP-YQYV---ADEVRAMDA--  330
DSSP  HLEEEELLLL------llhhHHHHHHHHHLhhHEELLLLLL-LLLL---HHHHHHHHL--


DSSP  hhhllllhhhLLLHHHHHHHLLHHHHHHLLLllllllllllllleeeeelllhhhlllll
Query rpadpnepekWLSARELLRMATRGSAECLGRpdlgvleegraadiacwrldgvdrvgvhd  406
ident             ||                                              
Sbjct ---------mDMSAQTKKKFFQTNAEKWFKL-----------------------------  352
DSSP  ---------lLLLHHHHHHHHLHHHHHHLLL-----------------------------


DSSP  hhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query paiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                
Sbjct -----------------------------------------------  352
DSSP  -----------------------------------------------


No 44: Query=3ls9A Sbjct=2gwgA Z-score=13.6

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                            |
Sbjct ---------------------------------------------------------XII    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELhHHHHhlllhhhllllhhhhhhhhhHHHHHHHH----------------LLLLLH
Query NSHQHlYEGAmraipqlervtmaswlegvlTRSAGWWR----------------DGKFGP  104
ident   | | |  |                         |                    |   
Sbjct DIHGH-YTTA-------------------pKALEDWRNrqiagikdpsvxpkvsELKISD   43
DSSP  EEEEE-LLLL-------------------lHHHHHHHHhhhhhhhlhhhlllhhHLLLLH


DSSP  HHHHHHHH-HHHHHHHHLLEEEEEEEEL-llllLLLL------LHHHHHHHHHHhhlLEE
Query DVIREVAR-AVLLESLLGGITTVADQHL-ffpgATAD------SYIDATIEAATdlgIRF  156
ident |          |      |                                        |
Sbjct DELQASIIeNQLKKXQERGSDLTVFSPRagdfnVSSTwaaicnELCYRVSQLFP---DNF  100
DSSP  HHHHHHHHlLHHHHHHHHLLLEEEEELLlllhhHHHHhhhhhhHHHHHHHHHLL---LLE


DSSP  EEEELLLLLLHhhlllllhhhllLHHHHHHHHHHHHHHHLllllllleEEEELLlLLLL-
Query HAARSSMTLGKseggfcddlfvePVDRVVQHCLGLIDQYHepepfgmvRIALGPcGVPY-  215
ident   |                                   |           |         
Sbjct IGAAXLPQSPG-----------vDPKTCIPELEKCVKEYG--------FVAINL-NPDPs  140
DSSP  EEEEELLLLLL-----------lLHHHHHHHHHHHHHLLL--------LLEEEE-LLLLl


DSSP  ---------lLHHHhHHHHHHHHHHLLEEEEE----elLLLHhhhhhhhhlllHHHHH--
Query ---------dKPELfEAFAQMAADYDVRLHTH----fyEPLDagmsdhlygmtPWRFL--  260
ident                                |                            
Sbjct gghwtsppltDRIW-YPIYEKXVELEIPAXIHvstgahYLNA--------dttAFXQCva  191
DSSP  llllllllllLHHH-HHHHHHHHHHLLLEEELlllllhHHHH--------hhhHHHHHhh


DSSP  HHLL--llLLLEEEE-ELLL--LLHH-------------HHHHHHhHLLEEEELHHhhhh
Query EKHG--waSDRVWLA-HAVV--PPRE-------------EIPEFAdAGVAIAHLIApdlr  302
ident                                                             
Sbjct GDLFkdfpELKFVIPhGGGAvpYHWGrfrglaqexkkplLEDHVL-NNIFFDTCVY----  246
DSSP  LLHHhhllLLLEEELhHHLLlhHHHHhhhhhhhhlllllHHHHLL-LLEEEELLLL----


DSSP  llLLLL--LHHHHHhllLEEEELLLLLLLLL------lllhhHHHHHHHHhlhhhllllh
Query mgWGLA--PIREYLdagITVGFGTTGSASND------ggnllGDLRLAALahrpadpnep  354
ident                    | |                       |              
Sbjct -hQPGIdlLNTVIP--vDNVLFASEXIGAVRgidprtgfyydDTKRYIEA----------  293
DSSP  -lHHHHhhHHHHLL--hHHEELLLLLLLLLLleelllleellLLHHHHHH----------


DSSP  hHLLLHHHHHHHLLHHHHHHL--lLLLLlllllLLLLleeeeelllhhhlllllhhhhhh
Query eKWLSARELLRMATRGSAECL--gRPDLgvleeGRAAdiacwrldgvdrvgvhdpaigli  412
ident    |   |                   |                                
Sbjct sTILTPEEKQQIYEGNARRVYprlDAAL-----KAKG-----------------------  325
DSSP  lLLLLHHHHHHHHLHHHHHHLhhhHHHH-----HHHH-----------------------


DSSP  hlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query mtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                          
Sbjct -------------------------------------kleh  329
DSSP  -------------------------------------hhll


No 45: Query=3ls9A Sbjct=1v77A Z-score=13.5

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
ident                                                            |
Sbjct --------------------------------------------------------VKFI    4
DSSP  --------------------------------------------------------LLLE


DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhHHHHHHHH
Query NSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevarAVLLESLL  120
ident                                                             
Sbjct EMDIRDK---------------------------------------------EAYELAKE   19
DSSP  EEEELLH---------------------------------------------HHHHHHHH


DSSP  LlEEEEEEEellllllllllhhhhhhhhhhhhlleeeeeELLLLllhhhlllllhhhlll
Query GgITTVADQhlffpgatadsyidatieaatdlgirfhaaRSSMTlgkseggfcddlfvep  180
ident      |                                                      
Sbjct W-FDEVVVS------------------------------IKFNE----------------   32
DSSP  H-LLEEEEE------------------------------EEELL----------------


DSSP  hhhHHHHhhHHHHHHLLllllllEEEEELLLLlllLLHHHHHHHHHHHHhhLLEEEEEEL
Query vdrVVQHclGLIDQYHEpepfgmVRIALGPCGvpyDKPELFEAFAQMAAdyDVRLHTHFY  240
ident     |                     |         || |     |              
Sbjct ---EVDK--EKLREARK----eyGKVAILLSN---PKPSLVRDTVQKFK--SYLIYVESN   78
DSSP  ---LLLH--HHHHHHHH----hhLLEEEEEEL---LLHHHHHHHHHHLL--LLEEEEELL


DSSP  lllhhhhhhhhhllLHHHHHHhlLLLLllEEEEELL------LLLHHHHHHHHHHLLEEE
Query epldagmsdhlygmTPWRFLEkhGWASdrVWLAHAV------VPPREEIPEFADAGVAIA  294
ident                  |                                      ||  
Sbjct ------------dlRVIRYSI--EKGV--DAIISPWvnrkdpGIDHVLAKLMVKKNVALG  122
DSSP  ------------lhHHHHHHH--HLLL--LEEELLLllllllLLLHHHHHHHHHHLLEEE


DSSP  ELhHHHHHLL--------LLLL--LHHHHHHLLLEEEELLLLLLllLLLLHH-HHHHHHH
Query HLiAPDLRMG--------WGLA--PIREYLDAGITVGFGTTGSAsnDGGNLL-GDLRLAA  343
ident       |                                                  |  
Sbjct FS-LRPLLYSnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQE-kWDVRYPrDLISLGV  180
DSSP  EE-LHHHHHLlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLL-hHHLLLHhHHHHHHH


DSSP  HHLhhhllllhhhlLLHHHHHHHLLHHHHHHLLlllllllllllllleeeeelllhhhll
Query LAHrpadpnepekwLSARELLRMATRGSAECLGrpdlgvleegraadiacwrldgvdrvg  403
ident                                |                            
Sbjct VIG-----------MEIPQAKASISMYPEIILK---------------------------  202
DSSP  HLL-----------LLHHHHHHLLLHHHHHHHL---------------------------


DSSP  lllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query vhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                   
Sbjct --------------------------------------------------  202
DSSP  --------------------------------------------------


No 46: Query=3ls9A Sbjct=2qpxA Z-score=13.3

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                           | 
Sbjct ---------------------------------------------gxddlsefvdQVPLL   15
DSSP  ---------------------------------------------lllllhhhhhHLLEE


DSSP  EEEELhHHHH--hllLHHHLLL--LHHH--------------hhhhhhhhhhhhhhllll
Query NSHQHlYEGA--mraIPQLERV--TMAS--------------wlegvltrsagwwrdgkf  102
ident   | |                   | |                                 
Sbjct DHHCH-FLIDgkvpnRDDRLAQvsTEADkdypladtknrlayhgflalakefaldannpl   74
DSSP  EEEEL-LLLLlllllHHHHHHHhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllll


DSSP  lhhhhhhhhhhHHHHHHHLLEEEEEEEELLllllllllhhhHHHHHHHHHLLEEEEEELL
Query gpdvirevaraVLLESLLGGITTVADQHLFfpgatadsyidATIEAATDLGIRFHAARSS  162
ident                              |                |   ||   |    
Sbjct aaxndpgyatyNHRIFGHFHFKELLIDTGF----vpddpilDLDQTAELVGIPVKAIYRL  130
DSSP  llllhhhhhhhHHHHHHHLLEEEEEEELLL----lllllllLHHHHHHHHLLLEEEEEEH


DSSP  LLllhhhlllllhhhLLLH-----------HHHHHHHHHHHHHHlllllllleEEEELLL
Query MTlgkseggfcddlfVEPV-----------DRVVQHCLGLIDQYhepepfgmvRIALGPC  211
ident  |              |                                           
Sbjct ET------------hAEDFxlehdnfaawwQAFSNDVKQAKAHG---------FVGFXSI  169
DSSP  HH------------hHHHHhlllllhhhhhHHHHHHHHLLLLLL---------LLLEEEL


DSSP  LLLL--------------------------------lLHHHHHHHHHHHHHHLLEEEEEE
Query GVPY--------------------------------dKPELFEAFAQMAADYDVRLHTHF  239
ident                                              |      |  |  | 
Sbjct AAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHV  229
DSSP  HHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEE


DSSP  LLL---LHHHHhhhhhllLHHHHHHHLLL-lllLEEEEELLLLlhhhHHHHHHH-LLEEE
Query YEP---LDAGMsdhlygmTPWRFLEKHGW-asdRVWLAHAVVPpreeIPEFADA-GVAIA  294
ident        |             |   |        | | |                     
Sbjct GYGdadTDXYL----gnpLLXRDYLKAFTkkglKVVLLHCYPYhreaGYLASVFpNLYFD  285
DSSP  LLLlllLLHHH----llhHHHHHHHHHHHhhllLEEEEELLLLhhhhHHHHHHLlLEEEE


DSSP  EL-HHHHHHllllllLHHHHHHLLL--EEEELLLLLLllLLLL-HHHHHHHHHHHLHhhl
Query HL-IAPDLRmgwglaPIREYLDAGI--TVGFGTTGSAsnDGGN-LLGDLRLAALAHRpad  350
ident                   |           |    |               |  ||    
Sbjct ISlLDNLGP-sgasrVFNEAVELAPytRILFASDASTypEXYGlAARQFKQALVAHF---  341
DSSP  LLlHHHHLH-hhhhhHHHHHLLLLLhhHEELLLLLLLlhHHHHhHHHHHHHHHHHHH---


DSSP  llLHHH----llLHHHHHHHLLHHHHHHLLLLLLLLLllllllleeeeelllhhhlllll
Query pnEPEK----wlSARELLRMATRGSAECLGRPDLGVLeegraadiacwrldgvdrvgvhd  406
ident                         ||                                  
Sbjct --NQLPfvdlaqKKAWINAICWQTSAKLYHQERELRV-----------------------  376
DSSP  --HLLLlllhhhHHHHHHHHHLHHHHHHLLLHHHHLL-----------------------


DSSP  hhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query paiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                
Sbjct -----------------------------------------------  376
DSSP  -----------------------------------------------


No 47: Query=3ls9A Sbjct=1itqA Z-score=12.8

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeEEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiALPGLI   60
ident                                                            |
Sbjct -------------------------------------------dffrdeaerimRDSPVI   17
DSSP  -------------------------------------------lhhhhhhhhhhLLLLEE


DSSP  EEEELHHHHhhlllhhhllllhhhhhhhhhhhhhhhhhllLLLHHH-------hhhhhhh
Query NSHQHLYEGamraipqlervtmaswlegvltrsagwwrdgKFGPDV-------irevara  113
ident   |  |                                   |                  
Sbjct DGHNDLPWQ----------------------------lldMFNNRLqderanlttlagth   49
DSSP  EEEELHHHH----------------------------hhhHHLLLLllhhhlllllllll


DSSP  HHHH-HHHLLEEEEEEEELLL----lLLLLL---LHHHHHHHHHH---HHLL--------
Query VLLE-SLLGGITTVADQHLFF----pGATAD---SYIDATIEAAT---DLGI--------  154
ident         |                            |                      
Sbjct TNIPkLRAGFVGGQFWSVYTPcdtqnKDAVRrtlEQMDVVHRMCRmypETFLyvtssagi  109
DSSP  LLHHhHHHLLEEEEEEEELLLhhhllLLHHHhhhHHHHHHHHHHHhllLLEEelllhhhh


DSSP  ---------EEEEEELLLLllhhhlllllhhhlLLHHhhHHHHHHHHHHHllllllllee
Query ---------RFHAARSSMTlgkseggfcddlfvEPVDrvVQHCLGLIDQYhepepfgmvr  205
ident                                              |              
Sbjct rqafregkvASLIGVEGGH-------------sIDSS--LGVLRALYQLG---------m  145
DSSP  hhhhhllleEEEEEEELHH-------------hLLLL--HHHHHHHHHLL---------e


DSSP  EEELLLLlLLLLHHH--------------------HHHHHHHHHHHLLEEEEEEllllhh
Query IALGPCGvPYDKPEL--------------------FEAFAQMAADYDVRLHTHFyeplda  245
ident   |         |                                  |            
Sbjct RYLTLTH-SCNTPWAdnwlvdtgdsepqsqglspfGQRVVKELNRLGVLIDLAH------  198
DSSP  EEEELLL-LLLLLLLllhhhlllllllllllllhhHHHHHHHHHHHLLEEELLL------


DSSP  hhhhhhhlllHHHHHHhlLLLL---LLEEE-EELLL--------LLHHHHHHHHHHLLEE
Query gmsdhlygmtPWRFLEkhGWAS---DRVWL-AHAVV--------PPREEIPEFADAGVAI  293
ident                            |                 |              
Sbjct ---------vSVATMK--ATLQlsrAPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDSLV  247
DSSP  ---------lLHHHHH--HHHHhllLLLEElLLLLLllllllllLLHHHHHHHHHHLLEE


DSSP  EELhhHHHHLLLL---------llLHHHHHHLLL--EEEELLLLLLL------LLLL-LH
Query AHLiaPDLRMGWG---------laPIREYLDAGI--TVGFGTTGSAS------NDGG-NL  335
ident                                      ||||                   
Sbjct MVN--FYNNYISCtnkanlsqvadHLDHIKEVAGarAVGFGGDFDGVprvpegLEDVsKY  305
DSSP  EEL--LLHHHHLLlllllhhhhhhHHHHHHHHLLhhHEEELLLLLLLllllllLLLLlLH


DSSP  HHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHhLLLLlllllllllllleeeee
Query LGDLRLAALAhrpadpnepekWLSARELLRMATRGSAEcLGRPdlgvleegraadiacwr  395
ident                           |                                 
Sbjct PDLIAELLRR-----------NWTEAEVKGALADNLLR-VFEA-----------------  336
DSSP  HHHHHHHHHL-----------LLLHHHHHHHHLHHHHH-HHHH-----------------


DSSP  lllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query ldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                           
Sbjct -------------------------veqasnltqapeeepipldqlggscrthygyss  369
DSSP  -------------------------hhhllllllllllllllhhhlllllllllllll


No 48: Query=3ls9A Sbjct=4dziC Z-score=12.8

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleEEEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmIALPGLI   60
ident                                                            |
Sbjct -----------------------------------------------------ALNYRVI    7
DSSP  -----------------------------------------------------LLLLLEE


DSSP  EEEELHH--------------hhhhlllhhhllllhhhhhhhhhHHHHHHH---------
Query NSHQHLY--------------egamraipqlervtmaswlegvlTRSAGWW---------   97
ident     | |                                                     
Sbjct DVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnHFIPNPTfdpiivpgc   67
DSSP  EEEEELLlllllllllllhhhlllleeeeelllleeeeelleelLLLLLLLllleellll


DSSP  -------------------hlllllhhhhhHHHHHHHHHHHHLLEEEEEEEE--------
Query -------------------rdgkfgpdvirEVARAVLLESLLGGITTVADQH--------  130
ident                                   |         | |             
Sbjct ldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgvee  127
DSSP  lhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhh


DSSP  ---llllLLLLL--LHHHHHHHHHH--hhLLEEEEEELLLLllhhhlllllhhhlLLHHH
Query ---lffpGATAD--SYIDATIEAAT--dlGIRFHAARSSMTlgkseggfcddlfvEPVDR  183
ident           |          |         |  ||                       |
Sbjct alkhdieATMASvhAFNLWLDEDWGfdrpDHRIIAAPIVSL--------------ADPTR  173
DSSP  hllllhhHHHHHhhHHHHHHHHHLLllllLLLEEELLLLLL--------------LLHHH


DSSP  HHHHHHHHHHHHlllllllleEEEELLLLLLL---------lLHHHhHHHHHHHHHHLLE
Query VVQHCLGLIDQYhepepfgmvRIALGPCGVPY---------dKPELfEAFAQMAADYDVR  234
ident  |                            |                       |   | 
Sbjct AVEEVDFVLARG---------AKLVLVRPAPVpglvkprslgDRSH-DPVWARLAEAGVP  223
DSSP  HHHHHHHHHHLL---------LLLEELLLLLLllllllllllLHHH-HHHHHHHHHHLLL


DSSP  EEEE----------------------ellLLHHhhhhhhhllLHHHHHH-HLLL---lll
Query LHTH----------------------fyePLDAgmsdhlygmTPWRFLE-KHGW---asd  268
ident    |                            |                           
Sbjct VGFHlsdsgylhiaaawggakdpldqvllDDRA-------ihDTMASMIvHGVFtrhpkl  276
DSSP  EEEEllllllhhhhhhllllllhhhhhhhLLHH-------hhHHHHHHHhLLHHhhllll


DSSP  LEEEEE-LLLLLHHHH-------------------HHHHhHLLEEEELHhhhhhllllLL
Query RVWLAH-AVVPPREEI-------------------PEFAdAGVAIAHLIapdlrmgwgLA  308
ident                |                          | ||              
Sbjct KAVSIEnGSYFVHRLIkrlkkaantqpqyfpedpvEQLR-NNVWIAPYY---------ED  326
DSSP  LEEEELlLLLHHHHHHhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL---------LL


DSSP  LHHHHHHLLL--EEEELLLLLL-LLLLlLHHHHHhHHHHhlhhhllllhhhLLLHHHHHH
Query PIREYLDAGI--TVGFGTTGSA-SNDGgNLLGDLrLAALahrpadpnepekWLSARELLR  365
ident    |           ||                                    |      
Sbjct DLPELARVIGvdKILFGSDWPHgEGLA-SPVSFT-AELK------------GFSESDIRK  372
DSSP  LHHHHHHHHLhhHLLLLLLLLLlLLLL-LHHHHH-HHHL------------LLLHHHHHH


DSSP  HLLHHHHHhLLLLLllllllllllleeeeelllhhhlllllhhhhhhhlllllllleeee
Query MATRGSAEcLGRPDlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvv  425
ident          |                                                  
Sbjct IMRDNALD-LLGVQ----------------------------------------------  385
DSSP  HHLHHHHH-HHLLL----------------------------------------------


DSSP  lleeeeelleellllhhhhhhhhhhhll
Query ngqvlvenerpvladlerivanttalip  453
ident                             
Sbjct -------------------------vgs  388
DSSP  -------------------------lll


No 49: Query=3ls9A Sbjct=3qy6A Z-score=11.5

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgLI   60
ident                                                            |
Sbjct ----------------------------------------------------------MI    2
DSSP  ----------------------------------------------------------LE


DSSP  EEEELH-----HHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHHHHHHH
Query NSHQHL-----YEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvIREVARAVL  115
ident   | |                                                       
Sbjct DIHCHIlpamdDGAG------------------------------------DSADSIEMA   26
DSSP  ELLLLLlllllLLLL------------------------------------LHHHHHHHH


DSSP  HHHHHLLEEEEEEEEL---lllllllLLHHHHHHHHHHHH-----LLEEEEEEllllllh
Query LESLLGGITTVADQHL---ffpgataDSYIDATIEAATDL-----GIRFHAARssmtlgk  167
ident       || |                     |       |                    
Sbjct RAAVRQGIRTIIATPHhnngvyknepAAVREAADQLNKRLikediPLHVLPGQ-------   79
DSSP  HHHHHLLLLEEELLLEellllllllhHHHHHHHHHHHHHHhhlllLLEEELLL-------


DSSP  hhlllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLLLllllHHHHHHHHHH
Query seggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCGVpydkPELFEAFAQM  227
ident                                                    |     |  
Sbjct -----------------------------------------EIRIY----GEVEQDLAKR   94
DSSP  -----------------------------------------EEELL----LLHHHHHHLL


DSSP  ---hhhhlLEEEEEEllLLHHhhhhhhhlLLHHHHHHHLLllllLEEEEELLL-----lL
Query ---aadydVRLHTHFyePLDAgmsdhlygMTPWRFLEKHGwasdRVWLAHAVV-----pP  279
ident               |                                 ||          
Sbjct qllslndtKYILIEF-pFDHV-------pRYAEQLFYDLQlkgyIPVIAHPERnreireN  146
DSSP  llllhhhlLEEEEEL-lLLLL-------lLLHHHHHHHHHhlllEEEEELHHHlhhhhhL


DSSP  HHHHHHHHHHLLEEEELHHHH-HHLL---LLLL--LHHHHhhllLEEEELLLLLL-llLL
Query REEIPEFADAGVAIAHLIAPD-LRMG---WGLA--PIREYldagITVGFGTTGSA-snDG  332
ident           | |            |                                  
Sbjct PSLLYHLVEKGAASQITSGSLaGIFGkqlKAFSlrLVEAN----LIHFVASDAHNvktRN  202
DSSP  LHHHHHHHHLLLEEEEEHHHHlLLLLhhhHHHHhhHHHLL----LLLEEELLLLLlllLL


DSSP  LLHHHHHHHHHHHlhhhllllhhhlLLHHHHHHHLlHHHHHHLLLLllllllllllllee
Query GNLLGDLRLAALAhrpadpnepekwLSARELLRMAtRGSAECLGRPdlgvleegraadia  392
ident       |                                   |                 
Sbjct FHTQEALYVLEKE------------FGSELPYMLT-ENAELLLRNQ--------------  235
DSSP  LLHHHHHHHHHHH------------HLLHHHHHHH-HHHHHHHLLL--------------


DSSP  eeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhl
Query cwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttali  452
ident                                                             
Sbjct -------------------------------------------------tifrqppqpvk  246
DSSP  -------------------------------------------------lllllllllll


DSSP  l
Query p  453
ident  
Sbjct r  247
DSSP  l


No 50: Query=3ls9A Sbjct=1j5sA Z-score=11.4

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident                                                             
Sbjct --------------------------------hmflgedylltnraavrlfnevkDLPIV   28
DSSP  --------------------------------llllllllllllhhhhhhhhhhlLLLEE


DSSP  EEEELHH---------------hhhHLLLhhHLLL-------------------------
Query NSHQHLY---------------egaMRAIpqLERV-------------------------   80
ident   | ||                                                      
Sbjct DPHNHLDakdivenkpwndiwevegATDH-yVWELmrrcgvseeyitgsrsnkekwlala   87
DSSP  ELLLLLLhhhhhhllllllhhhhhlLLLH-hHHHHhhhllllhhhllllllhhhhhhhhh


DSSP  ----------------lhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhHHHHHHLLEE
Query ----------------tmaswlegvltrsagwwrdgkfgpdvirevaravLLESLLGGIT  124
ident                                                             
Sbjct kvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLLRDMKVE  147
DSSP  hhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHHHHLLEE


DSSP  EEEEEELllllllLLLHhHHHHHHHHHHL-LEEEEEELLL--LLLHhhllllLHHH----
Query TVADQHLffpgatADSYiDATIEAATDLG-IRFHAARSSM--TLGKseggfcDDLF----  177
ident                        |                                    
Sbjct ILCTTDD-----pVSTL-EHHRKAKEAVEgVTILPTWRPDraMNVD------KEGWreyv  195
DSSP  EEELLLL-----lLLLL-HHHHHHHHHLLlLEEELLLLLHhhHLLL------LLLHhhhh


DSSP  --------------llLHHHHHHHHHHHhHHHLllllllleEEEELlLLLL---------
Query --------------vePVDRVVQHCLGLiDQYHepepfgmvRIALGpCGVP---------  214
ident                                            |                
Sbjct ekmgerygedtstldgFLNALWKSHEHF-KEHG--------CVASD-HALLepsvyyvde  245
DSSP  hhhhhhhllllllhhhHHHHHHHHHHHH-HLLL--------LLEEE-EEELllllllllh


DSSP  ----------------------llLHHHHHHHHHHHHHHLLEEEEEELL-----------
Query ----------------------ydKPELFEAFAQMAADYDVRLHTHFYE-----------  241
ident                         |      |  |          |              
Sbjct nraravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfkt  305
DSSP  hhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhh


DSSP  --------LLHHHhhhhhhlLLHHHHHHHLL---llllLEEEEeLLLL-LHHH-HHHHHH
Query --------PLDAGmsdhlygMTPWRFLEKHG---wasdRVWLAhAVVP-PREE-IPEFAD  288
ident                           |              |     |            
Sbjct lgpdsggdISTNF-------LRIAEGLRYFLnefdgklKIVLY-VLDPtHLPTiSTIARA  357
DSSP  llllllllEELLL-------LLHHHHHHHHHhhlllllLEEEE-ELLHhHHHHhHHHHHH


DSSP  HL-LEEEELhhHHHHllLLLL--LHHHHHHLL---LEEEELLLLllllLLLL-HHHHHHH
Query AG-VAIAHLiaPDLRmgWGLA--PIREYLDAG---ITVGFGTTGsasnDGGN-LLGDLRL  341
ident    |                                  |  |                  
Sbjct FPnVYVGAPwwFNDS--PFGMemHLKYLASVDllyNLAGMVTDS----RKLLsFGSRTEM  411
DSSP  LLlEEELLLllLLLL--HHHHhhHHHHHHLLLlhhHLLLLLLLL----LLLLhHHHHHHH


DSSP  HHHHLHhhlllLHHH-------llLHHHHHHHLLHHHHHHLLlllllllllllllleeee
Query AALAHRpadpnEPEK-------wlSARELLRMATRGSAECLGrpdlgvleegraadiacw  394
ident                                    |                        
Sbjct FRRVLS--nvvGEMVekgqipikeARELVKHVSYDGPKALFF------------------  451
DSSP  HHHHHH--hhhHHHHhlllllhhhHHHHHHHHHLHHHHHHHL------------------


DSSP  elllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query rldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                            
Sbjct -----------------------------------------------------------  451
DSSP  -----------------------------------------------------------


No 51: Query=3ls9A Sbjct=3iacA Z-score=11.2

back to top
DSSP  -----------leeeeeeeEEELlllllleeeeeeeeeelleeeeeellllllllleeee
Query -----------milirgltRVITfddqereledadilidgpkivavgkdlsdrsvsrtid   49
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  llleeeEELEEEEEELHH------------hhhHLLL-hhHLLL----------------
Query grgmiaLPGLINSHQHLY------------egaMRAI-pqLERV----------------   80
ident              | ||                                           
Sbjct -----aPXPIYDFHCHLSpqeiaddrrfdnlgqIWLEgdhYKWRalrsagvdeslitgke   78
DSSP  -----lLLLEEELLLLLLhhhhhhllllllhhhHHHLlllHHHHhhhhllllhhhlllll


DSSP  ------------------------------lhhhhhhhhhhhhhhhhhlllllhhhhhhh
Query ------------------------------tmaswlegvltrsagwwrdgkfgpdvirev  110
ident                                                             
Sbjct tsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatp  138
DSSP  llhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllh


DSSP  hhHHHHHHHHLLEEEEEEEELllllllLLLHhHHHHHHHHH--HLLEEEEEELLL--LLL
Query arAVLLESLLGGITTVADQHLffpgatADSYiDATIEAATD--LGIRFHAARSSM--TLG  166
ident                |            ||        | |    |              
Sbjct afSARGIXQQXNVRXVGTTDD-----pIDSL-EYHRQIAADdsIDIEVAPSWRPDkvFKI  192
DSSP  hhLHHHHHHHLLEEEEELLLL-----lLLLL-HHHHHHHHLllLLLEEELLLLLHhhHLL


DSSP  HHHllllLHHHL---------------llhHHHHHHHHHHHHHHlllllllleEEEELlL
Query KSEggfcDDLFV---------------epvDRVVQHCLGLIDQYhepepfgmvRIALGpC  211
ident                                                        |    
Sbjct ELD---gFVDYLrkleaaadvsitrfddlrQALTRRLDHFAACG---------CRASD-H  239
DSSP  LLL---lHHHHHhhhhhhhllllllhhhhhHHHHHHHHHHHHLL---------LLEEE-E


DSSP  LLL--------------------------------llLHHHHHHHHHHHHHHLLEEEEEE
Query GVP--------------------------------ydKPELFEAFAQMAADYDVRLHTHF  239
ident |                                                |        | 
Sbjct GIEtlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHI  299
DSSP  EELlllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEE


DSSP  LL--------------------LLHHhhhhhhhllLHHHHHHHLLL------lllLEEEE
Query YE--------------------PLDAgmsdhlygmTPWRFLEKHGW------asdRVWLA  273
ident                         |               |                 | 
Sbjct GAirnnntrxfrllgpdtgfdsIGDN---------NISWALSRLLDsxdvtnelpKTILY  350
DSSP  LEellllhhhhhhhllllllleELLL---------LLHHHHHHHHHhhhllllllEEEEE


DSSP  eLLLL-LHHH-HHHHHHHL-------LEEEElhhHHHHlllLLLL-HHHHHHLLL---EE
Query hAVVP-PREE-IPEFADAG-------VAIAHliaPDLRmgwGLAP-IREYLDAGI---TV  320
ident     |   |                 |              |           |     |
Sbjct -CLNPrDNEVlATXIGNFQgpgiagkVQFGS-gwWFNDqkdGXLRqLEQLSQXGLlsqFV  408
DSSP  -ELLHhHHHHhHHHHHHLLlllllllEEELL-llHHHLlhhHHHHhHHHHHHHLLhhhLL


DSSP  EELLLLLlllLLLLHhHHHHHHHHHLhhhlllLHHH---------lllHHHHHHHLLHHH
Query GFGTTGSasnDGGNLlGDLRLAALAHrpadpnEPEK---------wlsARELLRMATRGS  371
ident |  |                                             |          
Sbjct GXLTDSR---SFLSY-TRHEYFRRIL--cnllGQWAqdgeipddeaxlSRXVQDICFNNA  462
DSSP  LLLLLLL---LLLLL-HHHHHHHHHH--hhhhHHHHhlllllllhhhhHHHHHHHHLHHH


DSSP  HHHLLlllllllllllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeee
Query AECLGrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlv  431
ident                                                             
Sbjct QRYFT-------------------------------------------------------  467
DSSP  HHHLL-------------------------------------------------------


DSSP  elleellllhhhhhhhhhhhll
Query enerpvladlerivanttalip  453
ident                       
Sbjct --------------------ik  469
DSSP  --------------------ll


No 52: Query=3ls9A Sbjct=3dcpA Z-score=10.2

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                             
Sbjct ---------------------------------------------------------XKR    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELHH----HHHHlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHH
Query NSHQHLY----EGAMraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLL  116
ident   | |                                                      |
Sbjct DGHTHTEfcphGTHD--------------------------------------DVEEXVL   25
DSSP  EEEELLLllllLLLL--------------------------------------LHHHHHH


DSSP  HHHHLLEEEEEEEEL---------------------LLLLlLLLL-HHHHHHHHHHHHL-
Query ESLLGGITTVADQHL---------------------FFPGaTADS-YIDATIEAATDLG-  153
ident                                               |             
Sbjct KAIELDFDEYSIVEHaplssefxkntagdkeavttaSXAX-SDLPyYFKKXNHIKKKYAs   84
DSSP  HHHHLLLLEEEEEEEllllhhhhhllllllhhhhllLLLH-HHHHhHHHHHHHHHHHLLl


DSSP  -LEEEEEEllllllhhhlllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLL
Query -IRFHAARssmtlgkseggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCG  212
ident     |                                                       
Sbjct dLLIHIGF------------------------------------------------EVDY   96
DSSP  lLEEEEEE------------------------------------------------EEEL


DSSP  LLllLHHHHHHHHHHHhhhlleeEEEEllllhhhHHHH----------------------
Query VPydKPELFEAFAQMAadydvrlHTHFyepldagMSDH----------------------  250
ident            |                                                
Sbjct LI-gYEDFTRDFLNEYgpqtddgVLSL------hFLEGqggfrsidfsaedynegivqfy  149
DSSP  LL-lLHHHHHHHHHHHhhhlleeEEEL------lEEEElleeeellllhhhhhhhlhhhh


DSSP  -------hhllLHHHHH-HHLLlllllEEEEELLL---------------------lLHH
Query -------lygmTPWRFL-EKHGwasdrVWLAHAVV---------------------pPRE  281
ident                   |            |                          | 
Sbjct ggfeqaqlaylEGVKQSiEADLglfkpRRXGHISLcqkfqqffgedtsdfseevxekFRV  209
DSSP  llhhhhhhhhhHHHHHHhHLLLlllllLEELLLLHhhllhhhhlllhhhllhhhhhhHHH


DSSP  HHHHHHHHLLEEEELHhHHHHL--LLLLL----LHHHHHHLLLEEEELLLLLLllLLLLH
Query EIPEFADAGVAIAHLIaPDLRM--GWGLA----PIREYLDAGITVGFGTTGSAsnDGGNL  335
ident                    |                      |    |            
Sbjct ILALVKKRDYELDFNT-AGLFKplCGETYppkkIVTLASELQIPFVYGSDSHG-vQDIGR  267
DSSP  HHHHHHHHLLEEEEEL-HHHHLllLLLLLllhhHHHHHHHLLLLEEEELLLLL-hHHLLL


DSSP  hhHHHHHHHHLHhhllllhhhlllhhhhhhhllhhhhhhlllllllllllllllleeeee
Query lgDLRLAALAHRpadpnepekwlsarellrmatrgsaeclgrpdlgvleegraadiacwr  395
ident                                                             
Sbjct --GYSTYCQKLE------------------------------------------------  277
DSSP  --LHHHHHHHLL------------------------------------------------


DSSP  lllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query ldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                           
Sbjct ----------------------------------------------------------  277
DSSP  ----------------------------------------------------------


No 53: Query=3ls9A Sbjct=3f2bA Z-score=9.5

back to top
DSSP  -------------------------------------------------leeeeeeeeee
Query -------------------------------------------------milirgltrvi   11
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  llllllleeeeeeeeeelleeeeeellllllLLLE--eeellleEEEELEEEEEELHHhh
Query tfddqereledadilidgpkivavgkdlsdrSVSR--tidgrgmIALPGLINSHQHLYeg   69
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIaanerqdtaPEGEKRVELHLHTP--  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEElllllllllLLLLLLLLLLLLLL--


DSSP  hhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHHHHLLEEEEEEE
Query amraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLESLLGGITTVADQ  129
ident                                                     |    |  
Sbjct --------------------------------msqmdavtSVTKLIEQAKKWGHPAIAVT  146
DSSP  --------------------------------llllllllLHHHHHHHHHHLLLLLEEEL


DSSP  ELLLllllllLHHHHHHHHHHHHLLEEEEEELLLLL---lhhhlllllhhhlllhhHHHH
Query HLFFpgatadSYIDATIEAATDLGIRFHAARSSMTL---gkseggfcddlfvepvdRVVQ  186
ident                   ||   |                                  | 
Sbjct DHAV-----vQSFPEAYSAAKKHGMKVIYGLEANIVddpfhvtllaqnetglknlfKLVS  201
DSSP  LLLL-----lLLHHHHHHHHHHHLLLEEEEEEEEEEllleeeeeeellhhhhhhhhHHHH


DSSP  hhhhhhhhhlllllllleeeeellllllLLLHHHHHHHHhhhhhhLLEEEEeellllhhh
Query hclglidqyhepepfgmvrialgpcgvpYDKPELFEAFAqmaadyDVRLHThfyepldag  246
ident                                              |  |           
Sbjct -----------------lshiqyfhrvpRIPRSVLVKHR------DGLLVG---------  229
DSSP  -----------------hhhllllllllLEEHHHHHHLL------LLEEEE---------


DSSP  hhhhhhlllhhhhhhhllllllleeEEEL---lLLLHhhHHHHHhHLLEEEELHhhHHHL
Query msdhlygmtpwrflekhgwasdrvwLAHA---vVPPReeIPEFAdAGVAIAHLIapDLRM  303
ident                                                             
Sbjct -------------------------SGCDkgelFDNV--EDIAR-FYDFLEVHP--PDVY  259
DSSP  -------------------------LLLLllllLLLL--LLLHH-HLLLEEELL--HHHH


DSSP  L---------LLLL---LHHHHHHLLLEEEELLLLLL-----------------------
Query G---------WGLA---PIREYLDAGITVGFGTTGSA-----------------------  328
ident                           | |                               
Sbjct KplyvkdeemIKNIirsIVALGEKLDIPVVATGNVHYlnpedkiyrkilihsqgganpln  319
DSSP  LllllllhhhHHHHhhhHHHHHHHLLLLEEELLLLLLllhhhhhhhhhhhhllhhhllll


DSSP  -----LLLLLLHHHHHHHHHHhlhhhllllhhhlLLHHHHHHHLLHHHHHHLLL------
Query -----SNDGGNLLGDLRLAALahrpadpnepekwLSARELLRMATRGSAECLGR------  377
ident                |                  |                         
Sbjct rhelpDVYFRTTNEMLDCFSF-------------LGPEKAKEIVVDNTQKIASLigdvkp  366
DSSP  lllllLLLLLLHHHHHHHHHH-------------HHHHHHHHHHLHHHHHHHHLllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct ikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylis  426
DSSP  llllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  377
ident                                                             
Sbjct hklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsg  486
DSSP  hhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllh


DSSP  -----------------------------llllllllllllleeeeelllhhhlllllhh
Query -----------------------------pdlgvleegraadiacwrldgvdrvgvhdpa  408
ident                                                             
Sbjct fdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfge  546
DSSP  hhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhll


DSSP  hhhhhlllllllleeeelleeeeelleellllhhhhhhhhhHHLL---------------
Query iglimtglsdraslvvvngqvlvenerpvladlerivanttALIP---------------  453
ident                                          |                  
Sbjct dnvyragtigtvadktaygfvkayasdhnlelrgaeidrlaAGCTgvkrttgqhpggiiv  606
DSSP  lleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhHHHLlleeeeeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  453
ident                                                             
Sbjct vpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsg  666
DSSP  llllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  453
ident                                                             
Sbjct idpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfs  726
DSSP  llhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  453
ident                                                             
Sbjct elvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimes  786
DSSP  hhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  453
ident                                                             
Sbjct vrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpll  846
DSSP  hlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  453
ident                                                             
Sbjct yyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcerg  906
DSSP  hhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  453
ident                                                             
Sbjct fsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrg  966
DSSP  leellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhh


DSSP  ----------------------------
Query ----------------------------  453
ident                             
Sbjct klsktlleylesrgcldslpdhnqlslf  994
DSSP  lllhhhhhhhhhllllllllllllllll


No 54: Query=3ls9A Sbjct=3au2A Z-score=9.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ---------------------------------------leeeeeeeeeellllllleee
Query ---------------------------------------milirgltrvitfddqerele   21
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  eeeeeeelleeeeeellllllllleeeellleeeEELEEEEEELH---HHHHhlllhhhl
Query dadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLINSHQHL---YEGAmraipqle   78
ident                                            |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysDGQN--------  352
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLlllLLLL--------


DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHHHHLLEEEEEEEEL-------
Query rvtmaswlegvltrsagwwrdgkfgpdvireVARAVLLESLLGGITTVADQHL-------  131
ident                                            |    |           
Sbjct -------------------------------TLEELWEAAKTMGYRYLAVTDHspavrva  381
DSSP  -------------------------------LHHHHHHHHHHHLLLEEEEEEElhhhhll


DSSP  --LLLLllllLHHHHHHHHHHHHL-LEEEEEEllllllhhhlllllhhhlllhhhhhhhh
Query --FFPGatadSYIDATIEAATDLG-IRFHAARssmtlgkseggfcddlfvepvdrvvqhc  188
ident     |                  |     |                              
Sbjct ggPSPE-ealKRVGEIRRFNETHGpPYLLAGA----------------------------  412
DSSP  llLLHH-hhhHHHHHHHHHHHHHLlLEEEEEE----------------------------


DSSP  hhhhhhhlllllllleeeeeLLLLLLlllhhhhhhHHHHHhhhlleEEEEelLLLHHHHH
Query lglidqyhepepfgmvrialGPCGVPydkpelfeaFAQMAadydvrLHTHfyEPLDAGMS  248
ident                          |                                  
Sbjct --------------------EVDIHP----dgtldYPDWVlreldlVLVS--VHSRFNLP  446
DSSP  --------------------EEELLL----lllllLLHHHhlllleEEEE--LLLLLLLL


DSSP  HhhhLLLHhHHHHHllLLLLLE-EEEELLL----------lLHHH-HHHHHHHLLEEEEL
Query DhlyGMTPwRFLEKhgWASDRV-WLAHAVV----------pPREE-IPEFADAGVAIAHL  296
ident            | |       |  |||                |         |||    
Sbjct K---ADQT-KRLLK-aLENPFVhVLAHPTArllgrrapieaDWEAvFQKAKEKGVAVEID  501
DSSP  H---HHHH-HHHHH-hHLLLLLlEELLLLLlllllllllllLHHHhHHHHHHHLLEEEEE


DSSP  HHHHHhllllllLHHHHHHLLLEEEELLLLLLllLLLLHHHHHHHHHHHlhhhllllhhh
Query IAPDLrmgwglaPIREYLDAGITVGFGTTGSAsnDGGNLLGDLRLAALAhrpadpnepek  356
ident    |          |     |      |      |           |             
Sbjct GYYDR-mdlpddLARMAYGMGLWISLSTDAHQ-tDHLRFMELAVGTAQR-----------  548
DSSP  LLLLL-llllhhHHHHHHHLLLLEEEELLLLL-hHHHHHHHHHHHHHHH-----------


DSSP  LLLHHHhhHHLLHhhhhhlLLLLllllllllllleeeeelllhhhlllllhhhhhhhlll
Query WLSAREllRMATRgsaeclGRPDlgvleegraadiacwrldgvdrvgvhdpaiglimtgl  416
ident      |     |                                                
Sbjct AWIGPE-rVLNTL--dyedLLSW-------------------------------------  568
DSSP  LLLLLL-lLHHHL--lhhhHHHH-------------------------------------


DSSP  llllleeeelleeeeelleellllhhhhhhhhhhhll
Query sdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                      
Sbjct ------------------------------lkarrgv  575
DSSP  ------------------------------hhlllll


No 55: Query=3ls9A Sbjct=1m65A Z-score=7.9

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelee
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgli   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeelhhhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhh
Query nshqhlyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevaravllesll  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llEEEEEEEEL-LLLLllllLHHHHHHHHHHHHLLEEEEEELLLLLlhhhlllllhHHLL
Query ggITTVADQHL-FFPGatadSYIDATIEAATDLGIRFHAARSSMTLgkseggfcddLFVE  179
ident          |          |     |  |   ||   |                     
Sbjct --YPVDLHMHTvASTH--aySTLSDYIAQAKQKGIKLFAITDHGPD---------mEDAP   47
DSSP  --LLEELLLLLlLLLL--llLLHHHHHHHHHHHLLLEEEEEEELLL---------lLLLL


DSSP  LHHHHHHhHHHHhhHHLLllllLLEEEEELLLLLL-----LLLHhhhHHHHHHHhhhlLE
Query PVDRVVQhCLGLidQYHEpepfGMVRIALGPCGVP-----YDKPelfEAFAQMAadydVR  234
ident                       |                  |                  
Sbjct HHWHFIN-MRIW--PRVV---dGVGILRGIEANIKnvdgeIDCS---GKMFDSL----DL   94
DSSP  LLHHHHH-HHHL--LLEE---lLEEEEEEEEEELLlllllLLLL---HHHHHHL----LE


DSSP  EEEEEllllHHHHhhhhhllLHHHHH-HHLLLllllEEEEELL----LLLHHHH-HHHHH
Query LHTHFyeplDAGMsdhlygmTPWRFL-EKHGWasdrVWLAHAV----VPPREEI-PEFAD  288
ident     |     |                             |                 | 
Sbjct IIAGFhepvFAPH-dkatntQAMIATiASGNV----HIISHPGnpkyEIDVKAVaEAAAK  149
DSSP  EEEELllllLLLL-lhhhhhHHHHHHhHLLLL----LEELLLLllllLLLHHHHhHHHHH


DSSP  HLLEEEELHHHhhhlllLLLL-HHHHHHLLLEEEELLLLlllllllLHHHHHHHHHhhlh
Query AGVAIAHLIAPdlrmgwGLAP-IREYLDAGITVGFGTTGsasndggNLLGDLRLAAlahr  347
ident   ||                       |||  |  |               |        
Sbjct HQVALEINNSS------NCREvAAAVRDAGGWVALGSDShtaftmgEFEECLKILD----  199
DSSP  HLLEEEEELLL------LHHHhHHHHHHHLLLEEEELLLllhhhllLLHHHHHHHH----


DSSP  hhllllhhhllLHHHHHHhllHHHH--hhLLLLlllllllllllleeeeelllhhhllll
Query padpnepekwlSARELLRmatRGSA--ecLGRPdlgvleegraadiacwrldgvdrvgvh  405
ident                      |                                      
Sbjct -----------AVDFPPE---RILNvsprRLLN---------------------------  218
DSSP  -----------HLLLLHH---HLHHhlhhHHHH---------------------------


DSSP  lhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll
Query dpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
ident                                                 
Sbjct --------------------------------flesrgmapiaefadl  234
DSSP  --------------------------------hhhhllllllhhhlll


No 56: Query=3ls9A Sbjct=1bksA Z-score=7.6

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelee
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgli   60
ident                                                             
Sbjct ------------------------------------------meryenlfaqlndrrega   18
DSSP  ------------------------------------------lhhhhhhhhhhhhlllle


DSSP  EEEELHHHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhHHHHHHHHHHHHH
Query NSHQHLYEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdviREVARAVLLESLL  120
ident                                                 |           
Sbjct FVPFVTLGDP------------------------------------gIEQSLKIIDTLID   42
DSSP  EEEEEELLLL------------------------------------lHHHHHHHHHHHHH


DSSP  LLEeEEEEEELLLLL-------------------llLLLHHHHHHHHHHHHLlEEEEEEL
Query GGItTVADQHLFFPG-------------------atADSYIDATIEAATDLGiRFHAARS  161
ident  |          |                                               
Sbjct AGA-DALELGVPFSDpladgptiqnanlrafaagvtPAQCFEMLALIREKHP-TIPIGLL  100
DSSP  LLL-LLEEEELLLLLlllllhhhhhhhhhhhhhlllHHHHHHHHHHHHHHLL-LLLEEEE


DSSP  LLLllhhhlllllhhhLLLHH-HHHHHHHHHHHHHlllllllleEEEELLLlllLLLHHH
Query SMTlgkseggfcddlfVEPVD-RVVQHCLGLIDQYhepepfgmvRIALGPCgvpYDKPEL  220
ident                                                           | 
Sbjct MYA-------------NLVFNnGIDAFYARCEQVG---------VDSVLVA---DVPVEE  135
DSSP  ELH-------------HHHHLlLHHHHHHHHHHHL---------LLEEEEL---LLLHHH


DSSP  HHHHHHHHHHHLLEEEEEELlLLHHhhhhhhhlLLHHHHHHHLlllllLEEEEELlllLH
Query FEAFAQMAADYDVRLHTHFYePLDAgmsdhlygMTPWRFLEKHgwasdRVWLAHAvvpPR  280
ident    | | |             |               |          |           
Sbjct SAPFRQAALRHNIAPIFICP-PNAD--------DDLLRQVASY----gRGYTYLLalpLH  182
DSSP  LHHHHHHHHHLLLEEEEEEL-LLLL--------HHHHHHHHHH----lLLLEEELlllHH


DSSP  HHHHHHHH-HLLEEEELhhHHHHlllllLLHHHHhhllleEEELLLL-LLLLL-------
Query EEIPEFAD-AGVAIAHLiaPDLRmgwglAPIREYldagitVGFGTTG-SASND-------  331
ident   |                         |  |         |                  
Sbjct HLIEKLKEyHAAPALQG-fGISSpeqvsAAVRAG-----aAGAISGSaIVKIIeknlasp  236
DSSP  HHHHHHHHhLLLLEEEL-lLLLLhhhhhHHHHHL-----lLEEEELLhHHHHHhhllllh


DSSP  -------llLHHHHHHHHHhhlhhhllllhhhlllhhhhhhhllhhhhhhllllllllll
Query -------ggNLLGDLRLAAlahrpadpnepekwlsarellrmatrgsaeclgrpdlgvle  384
ident                                                             
Sbjct kqmlaelrsFVSAMKAASR-----------------------------------------  255
DSSP  hhhhhhhhhHHHHHHHLLL-----------------------------------------


DSSP  lllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhh
Query egraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladleri  444
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhll
Query vanttalip  453
ident          
Sbjct ---------  255
DSSP  ---------


No 57: Query=3ls9A Sbjct=2anuA Z-score=6.2

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeEEELEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiALPGLI   60
ident                                                           | 
Sbjct ------------------------------------------------------TEWLLC    6
DSSP  ------------------------------------------------------LEEEEE


DSSP  EEEELHH--HHHHlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHH
Query NSHQHLY--EGAMraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLES  118
ident   | |     |                                            |    
Sbjct DFHVHTNxsDGHL--------------------------------------PLGEVVDLF   28
DSSP  EEEELLLllLLLL--------------------------------------LHHHHHHHH


DSSP  HHLLEEEEEEEE-------------------LLLLllLLLL-HHHHHHHHHHHHL----L
Query LLGGITTVADQH-------------------LFFPgaTADS-YIDATIEAATDLG----I  154
ident    |   |                                  |                 
Sbjct GKHGVDVVSITDhivdrrtleqrkrngeplgAITE--DKFQdYLKRLWREQKRAWeeygX   86
DSSP  HHLLLLEEEEEEeeelhhhhhhhhhllllllLLLL--LLHHhHHHHHHHHHHHHHhhhlL


DSSP  EEEEEEllllllhhhlllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLLLL
Query RFHAARssmtlgkseggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCGVP  214
ident                                                             
Sbjct ILIPGV------------------------------------------------EITNNT   98
DSSP  EEEEEE------------------------------------------------EEEELL


DSSP  L--------------LLHHhHHHHHHHHHhHLLEEEeeellllhhhhhhhhhlllhhhhh
Query Y--------------DKPElFEAFAQMAAdYDVRLHthfyepldagmsdhlygmtpwrfl  260
ident                      |            |                         
Sbjct DlyhivavdvkeyvdPSLP-VEEIVEKLK-EQNALV------------------------  132
DSSP  LleeeeeelllllllLLLL-HHHHHHHHH-HLLLEE------------------------


DSSP  hhllllllleEEEELL-----lllhHHHHHHHHHlLEEE-ELHHhhhhlllllllHHHHH
Query ekhgwasdrvWLAHAV-----vpprEEIPEFADAgVAIA-HLIApdlrmgwglapIREYL  314
ident             ||                | |   |                       
Sbjct ----------IAAHPDrkklswylwANXERFKDTfDAWEiANRD---------dlFNSVG  173
DSSP  ----------EELLLLllllllhhhHLLLLLLLLlLEEEeEELL---------eeLHHHH


DSSP  HLLLEEEELLLLLLlLLLLLHhhhhhhhhhhlhhhllllhhhlllhhhhhhHLLHhhhhh
Query DAGITVGFGTTGSAsNDGGNLlgdlrlaalahrpadpnepekwlsarellrMATRgsaec  374
ident                                                             
Sbjct VKKYRYVANSDFHE-LWHVYS-----------------------------wKTLV-----  198
DSSP  HLLLLEEEELLLLL-HHHHLL-----------------------------eEEEE-----


DSSP  llllllllllllLLLLeeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeell
Query lgrpdlgvleegRAADiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvene  434
ident                                                             
Sbjct -----------kSEKN------------------------------------------ie  205
DSSP  -----------eELLL------------------------------------------hh


DSSP  eellllhhhhhhhhhhhll
Query rpvladlerivanttalip  453
ident                    
Sbjct aikeairkntdvaiylxrk  224
DSSP  hhhhhhhhllleeeeelll


No 58: Query=3ls9A Sbjct=2yb1A Z-score=6.2

back to top
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE
Query milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
ident                                                            |
Sbjct ---------------------------------------------------------ANI    3
DSSP  ---------------------------------------------------------LLE


DSSP  EEEELH---HHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHHHHHHHHH
Query NSHQHL---YEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvIREVARAVLLE  117
ident   | |                                                       
Sbjct DLHFHSrtsDGAL------------------------------------TPTEVIDRAAA   27
DSSP  ELLLLLlllLLLL------------------------------------LHHHHHHHHHL


DSSP  HHhllEEEEEEEELllllllllLHHHHHHHHHHHHLLEEEEEEL----------------
Query SLlggITTVADQHLffpgatadSYIDATIEAATDLGIRFHAARS----------------  161
ident          |                    ||   || |                     
Sbjct RA---PALLALTDH-----dctGGLAEAAAAAARRGIPFLNGVEvsvswgrhtvhivglg   79
DSSP  LL---LLEEEELLL-----lllLLHHHHHHHHHHLLLLEEEEEEeeeeelleeeeeeeel


DSSP  -------------lLLLLhhhlllLLHHH--------------------------lllhh
Query -------------sMTLGkseggfCDDLF--------------------------vepvd  182
ident                  |                                          
Sbjct idpaepalaaglksIREG------RLERArqmgasleaagiagcfdgamrwcdnpemisr  133
DSSP  lllllhhhhhhhhhHHLL------HHHHHhhhhhhhhhlllllhhhhhhlllllhhhllh


DSSP  hhhhhhhhhhhhhlllllllleeeeellllllllLHHHHHHHHHHHHhHLLEEeeeelll
Query rvvqhclglidqyhepepfgmvrialgpcgvpydKPELFEAFAQMAAdYDVRLhthfyep  242
ident                                        |                    
Sbjct thfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWASLEDAVGWIV-GAGGM-------  185
DSSP  hhhhhhhhhllllllhhhhhhhllllllllllllLLLLHHHHHHHHH-HLLLE-------


DSSP  lhhhhhhhhhlllhhhhhhhlllllllEEEEELL--lLLHHH-HHHHHHHL----LEEEE
Query ldagmsdhlygmtpwrflekhgwasdrVWLAHAV--vPPREE-IPEFADAG----VAIAH  295
ident                               ||       |        |        |  
Sbjct ---------------------------AVIAHPGrydMGRTLiERLILDFQaaggQGIEV  218
DSSP  ---------------------------EEELLHHhllLLHHHhHHHHHHHHhlllLEEEE


DSSP  LHHHHhhllLLLL---LHHHHHHLLLEEEELLLLLLllLLLLHhhhhhhhhhhlhhhlll
Query LIAPDlrmgWGLA---PIREYLDAGITVGFGTTGSAsnDGGNLlgdlrlaalahrpadpn  352
ident                         |     |    |                        
Sbjct ASGSH----SLDDmhkFALHADRHGLYASSGSDFHApgEDVGH-----------------  257
DSSP  EELLL----LHHHhhhHHHHHHHHLLEEEEELLLLLllLLLLL-----------------


DSSP  lhhhlllHHHHhhhllhHHHHhlLLLLllllllllllleeeeelllhhhlllllhhhhhh
Query epekwlsARELlrmatrGSAEclGRPDlgvleegraadiacwrldgvdrvgvhdpaigli  412
ident                                                             
Sbjct ---tedlPPIC-----rPIWR--ELEA---------------------------------  274
DSSP  ---llllLLLL-----lLHHH--HLHH---------------------------------


DSSP  hlllllllleeeELLEeeeelleellllhhhhhhhhhhhll
Query mtglsdraslvvVNGQvlvenerpvladlerivanttalip  453
ident                                          
Sbjct --------rilrPADA-----------------------en  284
DSSP  --------hlllLLHH-----------------------hl


No 59: Query=3ls9A Sbjct=3e38A Z-score=6.0

back to top
DSSP  leeeeeeeeeELLLlllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE
Query milirgltrvITFDdqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
ident              |                                              
Sbjct -aqrrneiqvPDLD---------------------------------------gyTTLKC   20
DSSP  -lllllllllLLLL---------------------------------------llEEEEE


DSSP  EEEELH----HHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhHHHHHH
Query NSHQHL----YEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvirevARAVLL  116
ident   | |                                                       
Sbjct DFHXHSvfsdGLVW----------------------------------------PTVRVD   40
DSSP  ELLLLLllllLLLL----------------------------------------HHHHHH


DSSP  HHHHLLEEEEEEEE---LLLL--LLLLL--LHHHHHHHHHHHHLLEEEEEEllllllhhh
Query ESLLGGITTVADQH---LFFP--GATAD--SYIDATIEAATDLGIRFHAARssmtlgkse  169
ident |    |                     |     |   | |  |||               
Sbjct EAYRDGLDAISLTEhieYRPHkqDVVSDhnRSFDLCREQAEKLGILLIKGS---------   91
DSSP  HHHHLLLLEELLEEellLLLLllLLLLLllHHHHHHHHHHHHHLLEELLEE---------


DSSP  lllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLLLL---------------
Query ggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCGVP---------------  214
ident                                                             
Sbjct ---------------------------------------EITRAXapghfnaiflsdsnp  112
DSSP  ---------------------------------------EEELLLllleeeeelllllhh


DSSP  lLLHHhHHHHHHHHHhHLLEeeeeellllhhhhhhhhhlllhhhhhhhllllllLEEEEE
Query yDKPElFEAFAQMAAdYDVRlhthfyepldagmsdhlygmtpwrflekhgwasdRVWLAH  274
ident              |                                             |
Sbjct lEQKD-YKDAFREAK-KQGA----------------------------------FXFWNH  136
DSSP  hLLLL-HHHHHHHHH-HLLL----------------------------------EEEELL


DSSP  LL--------LLLHHhhhHHHHHL--LEEEELHHHHhhlllLLLL-HHHHHHLLLEEEEL
Query AV--------VPPREeipEFADAG--VAIAHLIAPDlrmgwGLAP-IREYLDAGITVGFG  323
ident                        |    |                 |   ||   |    
Sbjct PGwdsqqpdtTKWWPehtALYQEGcxHGIEVANGHL-----YXPEaIQWCLDKNLTXIGT  191
DSSP  LLllllllllLLLLHhhhHHHHLLllLEEEEEELLE-----ELLHhHHHHHHHLLEEEEE


DSSP  LLLLL---------lllLLLHhhhhhhhhhhlhhhllllhhhlllhhhhhhhLLHHhhhh
Query TTGSA---------sndGGNLlgdlrlaalahrpadpnepekwlsarellrmATRGsaec  374
ident                                                             
Sbjct SDIHQpiqtdydfekgeHRTX-------------------------------TFVF----  216
DSSP  LLLLLlhhhhllhhhllLLLE-------------------------------EEEE----


DSSP  llllllllllllLLLL--------------------------------------eeeeel
Query lgrpdlgvleegRAAD--------------------------------------iacwrl  396
ident                                                             
Sbjct -----------aKERSlqgirealdnrrtaayfhelligredllrpffekcvkieevsrn  265
DSSP  -----------eLLLLhhhhhhhhhllleeeeelleeellhhhhhhhhhhheeeeeeeee


DSSP  llhhhlLLLLHHhhHHHLL----------------------lllllleeeelleeeeell
Query dgvdrvGVHDPAigLIMTG----------------------lsdraslvvvngqvlvene  434
ident                                                             
Sbjct eqgvtlSITNVT--DLVLKlkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
DSSP  lleeeeEEEELL--LLLEEeeelllllleellleeeellleeeeeeeeellllllleeee


DSSP  eellllhhhhhhhhhhhll
Query rpvladlerivanttalip  453
ident                    
Sbjct evtnfivapdkglkytisl  342
DSSP  eeeeeeeelleeeeeeeel