Results: dupa

Query: 3k2gB

MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3k2g-B 69.7  0.0  358   358  100 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   2:  1bf6-A 40.6  1.5  290   291   31 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   3:  2ob3-A 39.4  2.0  292   329   30 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   4:  2vc5-A 37.0  2.8  293   314   29 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
   5:  2y1h-B 19.2  2.9  230   265   17 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   6:  1onx-A 19.0  2.7  242   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   7:  1k6w-A 18.5  3.9  261   423   11 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   8:  3mkv-A 18.4  3.4  243   414   14 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   9:  3ls9-A 18.2  3.4  247   453   11 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  10:  4cqb-A 17.8  3.9  250   402   12 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  11:  3mtw-A 17.6  3.6  244   404   12 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  12:  3gg7-A 17.4  3.0  223   243   16 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  13:  1gkp-A 17.3  2.8  233   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  14:  2oof-A 17.1  4.0  243   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  15:  2paj-A 17.0  3.1  230   421   16 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  16:  2vun-A 16.9  3.0  220   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  17:  3cjp-A 16.8  2.7  215   262   14 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  18:  3giq-A 16.7  3.1  235   475   16 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  19:  4b3z-D 16.7  3.1  237   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  20:  3nqb-A 16.6  3.6  230   587   15 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  21:  4dlf-A 16.4  3.3  239   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  22:  2qpx-A 16.4  3.2  238   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  23:  4c5y-A 16.2  3.8  239   436   13 PDB  MOLECULE: OCHRATOXINASE;                                             
  24:  3irs-A 16.1  3.4  230   281   15 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  25:  2ffi-A 15.8  3.3  235   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  26:  1j6p-A 15.7  3.5  234   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  27:  2imr-A 15.7  3.7  243   380   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  28:  4rdv-B 15.6  3.2  236   451   12 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  29:  4mup-B 15.4  3.2  224   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  30:  2dvt-A 15.3  3.2  229   325   14 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  31:  2uz9-A 15.3  3.7  235   444   10 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  32:  3e74-A 15.1  2.9  217   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  33:  3gri-A 15.1  3.2  229   422   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  34:  1a4m-A 15.0  3.9  245   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  35:  2ogj-A 14.9  3.5  227   379   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  36:  1itq-A 14.8  3.3  234   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  37:  4qrn-A 14.7  3.4  233   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  38:  3pnu-A 14.5  3.2  220   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  39:  1a5k-C 14.3  3.1  217   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  40:  4ofc-A 14.2  3.6  224   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  41:  3qy6-A 14.2  3.0  203   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  42:  3icj-A 14.2  4.1  227   468   12 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  43:  1j5s-A 13.7  3.9  249   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  44:  2gwg-A 13.7  3.4  222   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  45:  4hk5-D 13.4  3.6  243   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  46:  1yrr-B 13.2  3.9  211   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  47:  3iac-A 13.1  3.8  255   469   13 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  4dzi-C 12.9  3.9  224   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3ooq-A 12.8  3.5  202   384   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  1v77-A 11.4  3.5  176   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A 10.7  4.2  249   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3dcp-A  9.7  3.4  182   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3au2-A  9.1  4.0  182   575   15 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3f2b-A  8.4  3.8  179   994   13 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1m65-A  8.2  4.0  183   234   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  6.5  3.8  172   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.1  3.9  155   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.4  3.8  157   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  5.0  3.4  140   224    6 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3k2gB Sbjct=3k2gB Z-score=69.7

back to top
DSSP  LLLLLLLLLLLLLEEEELLEEEEHHHLLLEELLLLLLEELHHHLLLLLLHHHHHHHHLLL
Query SLSELSPCHVRSGRIXTVDGPIPSSALGHTLXHEHLQNDCRCWWNPPQEPERQYLAEAPI   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SLSELSPCHVRSGRIXTVDGPIPSSALGHTLXHEHLQNDCRCWWNPPQEPERQYLAEAPI   60
DSSP  LLLLLLLLLLLLLEEEELLEEEEHHHLLLEELLLLLLEELHHHLLLLLLHHHHHHHHLLL


DSSP  LHHHHHHHHLLHHHLLLLLEELLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHHH
Query SIEILSELRQDPFVNKHNIALDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRI  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SIEILSELRQDPFVNKHNIALDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRI  120
DSSP  LHHHHHHHHLLHHHLLLLLEELLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHHH


DSSP  HHHHLLEEEELLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEEELLL
Query SAETGVQVVXGAGYYLASSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGEIGVS  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SAETGVQVVXGAGYYLASSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGEIGVS  180
DSSP  HHHHLLEEEELLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEEELLL


DSSP  LLLLHHHHHHHHHHHHHHHHHLLLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLLHH
Query SDFTAEEEKSLRGAARAQVRTGLPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHXNP  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SDFTAEEEKSLRGAARAQVRTGLPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHXNP  240
DSSP  LLLLHHHHHHHHHHHHHHHHHLLLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLLHH


DSSP  HLLLHHHHHHHHHHLLEEEELLLLLLLEELLLLEELLLHHHHHHHHHHHHHLLLHHHEEE
Query SHXDPVYQATLAQRGAFLEFDXIGXDFFYADQGVQCPSDDEVARAILGLADHGYLDRILL  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SHXDPVYQATLAQRGAFLEFDXIGXDFFYADQGVQCPSDDEVARAILGLADHGYLDRILL  300
DSSP  HLLLHHHHHHHHHHLLEEEELLLLLLLEELLLLEELLLHHHHHHHHHHHHHLLLHHHEEE


DSSP  LLLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLL
Query SHDVFVKXXLTRYGGNGYAFVTKHFLPRLRRHGLDDAALETLXVTNPRRVFDASIEGH  358
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SHDVFVKXXLTRYGGNGYAFVTKHFLPRLRRHGLDDAALETLXVTNPRRVFDASIEGH  358
DSSP  LLLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLL


No 2: Query=3k2gB Sbjct=1bf6A Z-score=40.6

back to top
DSSP  llllllllllllleeeelleeEEHHHlLLEELLLLLLEELHHHLLllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpIPSSAlGHTLXHEHLQNDCRCWWNppqeperqylaeapi   60
ident                            | || ||||  |     |               
Sbjct ---------------------SFDPT-GYTLAHEHLHIDLSGFKN---------------   23
DSSP  ---------------------LLLLL-LEEEEEELLLEELHHHHL---------------


DSSP  lhhhhhhhhllhhhlLLLLEELLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHHH
Query sieilselrqdpfvnKHNIALDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRI  120
ident                     ||       |       | |     | |  ||        
Sbjct ---------------NVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDV   68
DSSP  ---------------LHHHEELLHHHHHHHHHHHHHLLEEEEEELLLHHHLLLHHHHHHH


DSSP  HHHHLLEEEELLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEEELLL
Query SAETGVQVVXGAGYYLASSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGEIGVS  180
ident   |||  ||   |||     ||  |  |    | | | |   | |||    | | ||| |
Sbjct MRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTS  128
DSSP  HHHHLLEEEEEELLLLHHHLLLHHHHLLHHHHHHHHHHHHHLLLLLLLLLEEEEEEEELL


DSSP  L-LLLHHHHHHHHHHHHHHHHHLLLEEELLLLLlLLHHHHHHHHHHLLLLHHHEEELLLH
Query S-DFTAEEEKSLRGAARAQVRTGLPLXVHLPGWfRLAHRVLDLVEEEGADLRHTVLCHXN  239
ident     |  |||    || |   || |   |           | |    | ||      |  
Sbjct EgKITPLEEKVFIAAALAHNQTGRPISTHTSFS-TMGLEQLALLQAHGVDLSRVTVGHCD  187
DSSP  LlLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH-LLHHHHHHHHHHLLLLHHHEEELLLL


DSSP  HHlLLHHHHHHHHHHLLEEEELLLLLLLeelllleeLLLHHHHHHHHHHHHHLLLHHHEE
Query PShXDPVYQATLAQRGAFLEFDXIGXDFfyadqgvqCPSDDEVARAILGLADHGYLDRIL  299
ident                ||   || ||              |         | | | | |  
Sbjct LK-DNLDNILKMIDLGAYVQFDTIGKNS--------YYPDEKRIAMLHALRDRGLLNRVM  238
DSSP  LL-LLHHHHHHHHHLLLEEEELLLLLLL--------LLLHHHHHHHHHHHHHLLLHHHEE


DSSP  ELLLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLllllll
Query LSHDVFVKXXLTRYGGNGYAFVTKHFLPRLRRHGLDDAALETLXVTNPRRVFDasiegh  358
ident || |      |   || ||      | | ||  |   |        ||   |       
Sbjct LSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ------  291
DSSP  ELLLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHLL------


No 3: Query=3k2gB Sbjct=2ob3A Z-score=39.4

back to top
DSSP  llllllllllllLEEEELLEEEEHHHLLLEELLLLLLEELhhhllllllhhhhhhhhlll
Query slselspchvrsGRIXTVDGPIPSSALGHTLXHEHLQNDCrcwwnppqeperqylaeapi   60
ident              || || |||  |  | || |||                         
Sbjct ------------DRINTVRGPITISEAGFTLTHEHICGSS--------------------   28
DSSP  ------------LLEEELLEEELHHHHLLEEEEELLEELL--------------------


DSSP  lhhhhhhhhllhhhLLLLleelLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHHH
Query sieilselrqdpfvNKHNialdDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRI  120
ident                           |        | | | |||     ||||   |   
Sbjct ------agflrawpEFFGsrkaLAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEV   82
DSSP  ------llhhhhlhHHHLlhhhHHHHHHHHHHHHHHLLLLEEEELLLHHHLLLHHHHHHH


DSSP  HHHHLLEEEELLLLLLhhHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEeELLL
Query SAETGVQVVXGAGYYLasSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGeIGVS  180
ident |    |  |   |       |      |          |   |   |  | | |      
Sbjct SRAADVHIVAATGLWF--DPPLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIX-VATT  139
DSSP  HHHHLLEEELEEELLL--LLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLEEE-EELL


DSSP  LLLLHHHHHHHHHHHHHHHHHLLLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLLHH
Query SDFTAEEEKSLRGAARAQVRTGLPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHXNP  240
ident    |   |  |  ||||   || |   |     |         | ||         |   
Sbjct GKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDD  199
DSSP  LLLLHHHHHHHHHHHHHHHHHLLLEEEELLHHHLHHHHHHHHHHHLLLLHHHEEELLHHH


DSSP  HlLLHHHHHHHHHHLLEEEELLLLLL---------LEELllleELLLHHHHHHHHHHHHH
Query ShXDPVYQATLAQRGAFLEFDXIGXD---------FFYAdqgvQCPSDDEVARAILGLAD  291
ident    |  |   || ||     | |                       |    |  |  | |
Sbjct T-DDLSYLTALAARGYLIGLDHIPYSaiglednasASAL---lGIRSWQTRALLIKALID  255
DSSP  L-LLHHHHHHHHHLLLEEEELLLLLLlllllllhhHHHH---hLLLLHHHHHHHHHHHHH


DSSP  LLLHHHEEELLLLL----------LHHHlhhHLLL--LLLHHHHLHHHHHHHLLLLHHHH
Query HGYLDRILLSHDVF----------VKXXltrYGGN--GYAFVTKHFLPRLRRHGLDDAAL  339
ident  ||   || | |                      |  | ||      | ||  |     |
Sbjct QGYMKQILVSNDWTfgfssyvtniMDVM---DRVNpdGMAFIPLRVIPFLREKGVPQETL  312
DSSP  LLLHHHEEELLLLLleellllllhHHHH---HHHLllHHHHHHHLHHHHHHHLLLLHHHH


DSSP  HHHHLHHHHHHHLLlllll
Query ETLXVTNPRRVFDAsiegh  358
ident     |||| |         
Sbjct AGITVTNPARFLSP--tlr  329
DSSP  HHHHLHHHHHHHLL--lll


No 4: Query=3k2gB Sbjct=2vc5A Z-score=37.0

back to top
DSSP  llllllllllllLEEEELL-EEEEHHHLLLEELLLLLLEELHHHLlllllhhhhhhhhll
Query slselspchvrsGRIXTVD-GPIPSSALGHTLXHEHLQNDCRCWWnppqeperqylaeap   59
ident              ||  |    | |   | || ||||                       
Sbjct ------------MRIPLVGkDSIESKDIGFTLIHEHLRVFSEAVR---------------   33
DSSP  ------------LLLLLLLlLLLLHHHLLLEELLLLLLLLLHHHH---------------


DSSP  llhhhhhhhhllhhHLLLlleeLLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHH
Query isieilselrqdpfVNKHnialDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRR  119
ident                            |  |||     |   |||||  | |||      
Sbjct -----------qqwPHLY-nedEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEK   81
DSSP  -----------hhlHHHL-lhhHHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHH


DSSP  HHHHHLLEEEELLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEeELL
Query ISAETGVQVVXGAGYYLASSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGeIGV  179
ident     ||   | | | |     |      | | |||       ||  ||    |    |  
Sbjct VVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVX-IAA  140
DSSP  HHHLLLLEEEELEELLLLLLLLHHHLLLLHHHHHHHHHHHHHLLLLLLLLLLLLEE-EEL


DSSP  LLL-LLHHHHHHHHHHHHHHHHHLLLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLL
Query SSD-FTAEEEKSLRGAARAQVRTGLPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHX  238
ident      |   ||  | || |   |  |   |                ||| |       | 
Sbjct DEPgITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHL  200
DSSP  LLLlLLHHHHHHHHHHHHHHHHHLLLEEEELLLLLLHHHHHHHHHHHLLLLHHHEEELLH


DSSP  HHHlLLHHHHHHHHHHLLEEEELLLLLLLeelllleeLLLHHHHHHHHHHHHHLLLHHHE
Query NPShXDPVYQATLAQRGAFLEFDXIGXDFfyadqgvqCPSDDEVARAILGLADHGYLDRI  298
ident         |    |  | |   |  | |             |      | |   || | |
Sbjct GDT-DNIDYIKKIADKGSFIGLDRYGLDL--------FLPVDKRNETTLRLIKDGYSDKI  251
DSSP  HHL-LLHHHHHHHHHLLLEEEELLLLLLL--------LLLHHHHHHHHHHHHHLLLLLLE


DSSP  EELLLLLLH---hhlhHHLL------LLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHH
Query LLSHDVFVK---xxltRYGG------NGYAFVTKHFLPRLRRHGLDDAALETLXVTNPRR  349
ident   |||                                | | | |       |    ||  
Sbjct MISHDYCCTidwgtakPEYKpklaprWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKK  311
DSSP  EELLLLLLLlllllllHHHHhhhlllLLLLHHHHLHHHHHHLLLLLHHHHHHHHLHHHHH


DSSP  HHLllllll
Query VFDasiegh  358
ident  |       
Sbjct FFS------  314
DSSP  HLL------


No 5: Query=3k2gB Sbjct=2y1hB Z-score=19.2

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapi   60
ident                            |    | ||                        
Sbjct -------------------------gvGLVDCHCHLSA----------------------   13
DSSP  -------------------------llLEEEEEELLLL----------------------


DSSP  lhhhhhhhhllhhhlllllEELLhHHHHHHHHHHHHLLLLEEEELLLLLLLL--LHHHHH
Query sieilselrqdpfvnkhniALDDlDLAIAEVKQFAAVGGRSIVDPTCRGIGR--DPVKLR  118
ident                       |                   |                 
Sbjct -------------------PDFD-RDLDDVLEKAKKANVVALVAVAEHSGEFekIMQLSE   53
DSSP  -------------------HHHL-LLHHHHHHHHHHLLEEEEEELLLLHHHHhhHHHHHH


DSSP  HHHhhhlLEEEELLLLLLHHH-----LLHHHhlllhhhHHHHHHHHHHllllllllLLLL
Query RISaetgVQVVXGAGYYLASS-----XPETAarlsaddIADEIVAEALegtdgtdaRIGL  173
ident |        |    |                           |             |   
Sbjct RYN----GFVLPCLGVHPVQGldqrsVTLKD----ldvALPIIENYKD--------RLLA   97
DSSP  HLL----LLEEEEELLLLEELllleeLLHHH----hhhHHHHHHHHLL--------LLLE


DSSP  EEEELLLLL--------lLHHHHHHHHHHHHHHHHHLLLEEELLLlllLLHHHHHHHHHH
Query IGEIGVSSD--------fTAEEEKSLRGAARAQVRTGLPLXVHLPgwfRLAHRVLDLVEE  225
ident ||| |               |    |        |  ||  ||             |  |
Sbjct IGEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSR---SAGRPTINLLQE  154
DSSP  EEEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEE---LLHHHHHHHHHH


DSSP  LLLLhhHEEELLLHHhllLHHHHHHHHHHLLEEEElLLLLlleelllleelLLHHHHHHH
Query EGADlrHTVLCHXNPshxDPVYQATLAQRGAFLEFdXIGXdffyadqgvqcPSDDEVARA  285
ident  ||      |         |         | |                            
Sbjct QGAE--KVLLHAFDG---RPSVAMEGVRAGYFFSI-PPSI-----------IRSGQKQKL  197
DSSP  LLLL--LEEEELLLL---LHHHHHHHHHLLLEEEE-LHHH-----------HLLHHHHHH


DSSP  HHHHhhllLHHHEEELLLLL-----lHHHLhhhlllLLLHHHhLHHHHHHHL-LLLHHHH
Query ILGLadhgYLDRILLSHDVF-----vKXXLtryggnGYAFVTkHFLPRLRRH-GLDDAAL  339
ident    |     |  | |  |                                   |      
Sbjct VKQL----PLTSICLETDSPalgpekQVRN------EPWNIS-ISAEYIAQVkGISVEEV  246
DSSP  HHHL----LHHHEEELLLLLllllllLLLL------LHHHHH-HHHHHHHHHhLLLHHHH


DSSP  -HHHHlHHHHHHHLllllll
Query -ETLXvTNPRRVFDasiegh  358
ident  |     |    |       
Sbjct iEVTT-QNALKLFPklrhll  265
DSSP  hHHHH-HHHHHHLLlhhhhl


No 6: Query=3k2gB Sbjct=1onxA Z-score=19.0

back to top
DSSP  -----------------------------------llllllllllllleeeelleeeehh
Query -----------------------------------slselspchvrsgrixtvdgpipss   25
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  hlLLEELLLLLLEELhHHLLllllhhhhhhhhllllhhhhhhhhllhhhlLLLLEELlhh
Query alGHTLXHEHLQNDCrCWWNppqeperqylaeapisieilselrqdpfvnKHNIALDdld   85
ident   |    | ||                                                 
Sbjct cpGFIDQHVHLIGGG-GEAG------------------------------PTTRTPE---   86
DSSP  eeLEEEEEELLLLLL-LLLL------------------------------HHHLLLL---


DSSP  hHHHHHHHHhhlLLLEEEELL---llLLLL--LHHHHHHHHHHhLLEEEELLLLLLHhhl
Query lAIAEVKQFaavGGRSIVDPT---crGIGR--DPVKLRRISAEtGVQVVXGAGYYLAssx  140
ident  |          |  | |                 | |    | |       | |     
Sbjct vALSRLTEA---GVTSVVGLLgtdsiSRHPesLLAKTRALNEE-GISAWMLTGAYHV---  139
DSSP  lLHHHHHHL---LEEEEEELLlllllLLLHhhHHHHHHHHHHH-LLEEEEEEELLLL---


DSSP  lhhhhlllhhhhhHHHHHHHHLLlllllLLLLLEEeELLLLL-LLHHHHHHHHHHHHHHH
Query petaarlsaddiaDEIVAEALEGtdgtdARIGLIGeIGVSSD-FTAEEEKSLRGAARAQV  199
ident                              |         |     |     |   |    
Sbjct -------psrtitGSVEKDVAII-----DRVIGVX-CAISDHrSAAPDVYHLANMAAESR  186
DSSP  -------llllllLLHHHHHHHL-----LLEEEEE-EEELLLlLLLLLHHHHHHHHHHHH


DSSP  HHL------LLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLLHHHLLLHHHHHHHHH
Query RTG------LPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHXNPSHXDPVYQATLAQ  253
ident   |           |            || |            | |            | 
Sbjct VGGllggkpGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFAR  246
DSSP  HHHhhhlllLEEEEEELLLLLLLHHHHHHHHLLLLLHHHEEEELHHHLHHHHHHHHHHHH


DSSP  HLLEEEELlLLLLleelllleeLLLHhhHHHHHHHHHHLLL-HHHEEELLLLLL------
Query RGAFLEFDxIGXDffyadqgvqCPSDdeVARAILGLADHGY-LDRILLSHDVFV------  306
ident  |          |          |     |  |      |  | |  || |         
Sbjct KGGTIDIT-SSID---------EPVA--PAEGIARAVQAGIpLARVTLSSDGNGsqpffd  294
DSSP  LLLLEEEE-LLLL---------LLLL--HHHHHHHHHHLLLlHHHEEEELLLLLeeeeel


DSSP  --------HHHLhhhllllLLHHHhLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL-----
Query --------KXXLtryggngYAFVTkHFLPRLR-RHGLDDAALETLXVTNPRRVFD-----  352
ident                               |                             
Sbjct degnlthiGVAG-------FETLL-ETVQVLVkDYDFSISDALRPLTSSVAGFLNltgkg  346
DSSP  lllleeeeEELL-------LHHHH-HHHHHHHhHHLLLHHHHHHHHLHHHHHHLLlllll


DSSP  --------------------------------------llllll
Query --------------------------------------asiegh  358
ident                                             
Sbjct eilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  llllllllleeeellllleeeeeelleeeeelleelllllllll


No 7: Query=3k2gB Sbjct=1k6wA Z-score=18.5

back to top
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL
Query -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL


DSSP  LLEelhhhllllllhhhhhhhhlLLLHhhHHHHhlLHHH-LLLL-------leeLLHHHH
Query LQNdcrcwwnppqeperqylaeaPISIeiLSELrqDPFV-NKHN-------ialDDLDLA   87
ident |                                    |                |    |
Sbjct LDT---------------tqtagQPNW--NQSG--TLFEgIERWaerkallthdDVKQRA  101
DSSP  LLL---------------lllllLLLL--LLLL--LHHHhHHHHhllhhhllhhHHHHHH


DSSP  HHHHHHHHHLLLLEEEELLLLL--lllLHHHHHHHHHHH--LLEEEELLLLLLHhhLLHH
Query IAEVKQFAAVGGRSIVDPTCRG--igrDPVKLRRISAET--GVQVVXGAGYYLAssXPET  143
ident     |   | |                          |          |           
Sbjct WQTLKWQIANGIQHVRTHVDVSdatltALKAMLEVKQEVapWIDLQIVAFPQEGilSYPN  161
DSSP  HHHHHHHHHLLEEEEEEEEELLllllhHHHHHHHHHHHHllLLEEEEEEELLLLllLLLL


DSSP  HhlllhhhhhHHHHHHHHlllllllLLLLLEEeELLL-lLLLHHHHHHHHHHHHHHHHHL
Query AarlsaddiaDEIVAEALegtdgtdARIGLIGeIGVS-sDFTAEEEKSLRGAARAQVRTG  202
ident                                |               ||           
Sbjct G--------eALLEEALR-------LGADVVG-AIPHfeFTREYGVESLHKTFALAQKYD  205
DSSP  H--------hHHHHHHHH-------LLLLEEE-ELHHhlLLHHHHHHHHHHHHHHHHHHL


DSSP  LLEEELLLLL----LLLHHHHHHHHHHlLLLHHHEEELLLHHHLL-----LHHHHHHHHH
Query LPLXVHLPGW----FRLAHRVLDLVEEeGADLRHTVLCHXNPSHX-----DPVYQATLAQ  253
ident     ||         |    |  |              |    |             |  
Sbjct RLIDVHCDEIddeqSRFVETVAALAHH-EGMGARVTASHTTAMHSyngayTSRLFRLLKM  264
DSSP  LEEEEEELLLllllLLHHHHHHHHHHH-HLLHHHEEEEELHHHHHllhhhHHHHHHHHHH


DSSP  HLLEEEElLLLL--LLEELLL---LEELLlhhhhhhHHHHHHHLLLhhHEEELLLLL-LH
Query RGAFLEFdXIGX--DFFYADQ---GVQCPsddevarAILGLADHGYldRILLSHDVF-VK  307
ident  |                                          |        ||     
Sbjct SGINFVA-NPLVniHLQGRFDtypKRRGI------tRVKEMLESGI--NVCFGHDDVfDP  315
DSSP  HLLEEEE-LHHHhhHHLLLLLlllLLLLL------lLHHHHHHLLL--LEEELLLLLlLL


DSSP  HHlhhhLLLLLlHHHH--LHHHH--HHHL-LLLHhHHHHHHLHHHHH-HHLLLL------
Query XXltryGGNGYaFVTK--HFLPR--LRRH-GLDDaALETLXVTNPRR-VFDASI------  355
ident                   |           |        |      |             
Sbjct WY----PLGTA-NMLQvlHMGLHvcQLMGyGQIN-DGLNLITHHSARtLNLQDYgiaagn  369
DSSP  LL----LLLLL-LHHHhhHHHHHhlLLLLhHHHH-HHHHHHLHHHHHhLLLLLLllllll


DSSP  ---------------------------------------------------lll
Query ---------------------------------------------------egh  358
ident                                                       
Sbjct sanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  llleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeellll


No 8: Query=3k2gB Sbjct=3mkvA Z-score=18.4

back to top
DSSP  ------------------------------llllllllllllleeeelleeeehhhlLLE
Query ------------------------------slselspchvrsgrixtvdgpipssalGHT   30
ident                                                          |  
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  ELLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllLLLE--------el
Query LXHEHLQNdcrcwwnppqeperqylaeapisieilselrqdpfvnkHNIA--------ld   82
ident   | |                                                       
Sbjct DLHVHVVA-------------------------------------iEFNLprvatlpnvl   83
DSSP  EEEELLLL-------------------------------------lLLLHhhhllllhhh


DSSP  LHHHHHHHHHHHHHLLLLEEEELLllllLLLHHHHHHHH--HHHLLEEEEL-LLLLLHH-
Query DLDLAIAEVKQFAAVGGRSIVDPTcrgiGRDPVKLRRIS--AETGVQVVXG-AGYYLAS-  138
ident     |          |     |      |               |               
Sbjct VTLRAVPIMRAMLRRGFTTVRDAG----GAGYPFKQAVEsgLVEGPRLFVSgRALSQTGg  139
DSSP  HHHHHHHHHHHHHHLLEEEEEELL----LLLHHHHHHHHllLLLLLEEEELlLEEELLLl


DSSP  -HLLH---------------------hhhlLLHHHHHHHHHHHHHlllllllLLLLLEEe
Query -SXPE---------------------taarLSADDIADEIVAEALegtdgtdARIGLIGe  176
ident    |                             |        |              |  
Sbjct hADPRarsdymppdspcgccvrvgalgrvaDGVDEVRRAVREELQ-------MGADQIX-  191
DSSP  lLLLLllllllllllllllllllllleeelLLHHHHHHHHHHHHH-------HLLLLEE-


DSSP  ELLL----------LLLLhHHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHHHHHHHhhl
Query IGVS----------SDFTaEEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHRVLDLVeee  226
ident |  |            |    |   |         |     |         |        
Sbjct IMASggvasptdpvGVFG-YSEDEIRAIVAEAQGRGTYVLAHA-YTPAAIARAVRCG---  246
DSSP  EELLllllllllllLLLL-LLHHHHHHHHHHHHLLLLLEEEEE-LLHHHHHHHHHLL---


DSSP  lllhhhEEELLLHHHllLHHHHHHHHHHLLEEEELLLLLLL------------eELLLLE
Query gadlrhTVLCHXNPShxDPVYQATLAQRGAFLEFDXIGXDF------------fYADQGV  274
ident           | |    |       |  ||         |                    
Sbjct -----vRTIEHGNLI--DDETARLVAEHGAYVVPTLVTYDAlasegekyglppeSIAKIA  299
DSSP  -----lLEEEELLLL--LHHHHHHHHHHLLEEELLHHHHHHhhhhlllllllhhHHLLHH


DSSP  ELLLhhHHHHHHHHHHHLLLhhHEEELLLLLlHHHLhhhllLLLLHHHhLHHHHHhhllL
Query QCPSddEVARAILGLADHGYldRILLSHDVFvKXXLtryggNGYAFVTkHFLPRLrrhgL  334
ident            |      |         |                      |       |
Sbjct DVHG--AGLHSIEIMKRAGV--KMGFGTDLL-GEAQ-----RLQSDEF-RILAEV----L  344
DSSP  HHHL--LHHHHHHHHHHHLL--LLLLLLLLL-HHHH-----HHLLHHH-HHHHLL----L


DSSP  LHHHHHHHHLHHHHHHHLLLL---------------------------------------
Query DDAALETLXVTNPRRVFDASI---------------------------------------  355
ident   |            |                                            
Sbjct SPAEVIASATIVSAEVLGMQDklgrivpgahadvlvvdgnplksvdcllgqgehiplvmk  404
DSSP  LHHHHHHHLLHHHHHHLLLLLlllllllllllleeeellllllllllllllllllleeee


DSSP  -------lll
Query -------egh  358
ident           
Sbjct dgrlfvnele  414
DSSP  lleeeeelll


No 9: Query=3k2gB Sbjct=3ls9A Z-score=18.2

back to top
DSSP  ------------------------------llllllllllllleeeelleeeehhhlLLE
Query ------------------------------slselspchvrsgrixtvdgpipssalGHT   30
ident                                                          |  
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  ELLLLLLEelhhhllllllhhhhhhhhllllhhhHHHHHLL----HHHL-LLLL------
Query LXHEHLQNdcrcwwnppqeperqylaeapisieiLSELRQD----PFVN-KHNI------   79
ident   | ||                               |                      
Sbjct NSHQHLYE---------------------gamraIPQLERVtmasWLEGvLTRSagwwrd   99
DSSP  EEEELHHH---------------------hhhllLHHHLLLlhhhHHHHhHHHHhhhhhl


DSSP  ----eeLLHHHHHHHHHHHHHLLLLEEEELLLLL----lllLHHHHHHHHHHHLLEEEEL
Query ----alDDLDLAIAEVKQFAAVGGRSIVDPTCRG----igrDPVKLRRISAETGVQVVXG  131
ident            | |        |     |                        |      
Sbjct gkfgpdVIREVARAVLLESLLGGITTVADQHLFFpgatadsYIDATIEAATDLGIRFHAA  159
DSSP  llllhhHHHHHHHHHHHHHHHLLEEEEEEEELLLlllllllHHHHHHHHHHHHLLEEEEE


DSSP  LLLLLHH----------HLLHhhhlllHHHHHHHHHHHHHllllllLLLL--------LL
Query AGYYLAS----------SXPEtaarlsADDIADEIVAEALegtdgtDARI--------GL  173
ident                             |                               
Sbjct RSSMTLGkseggfcddlFVEP------VDRVVQHCLGLID------QYHEpepfgmvrIA  207
DSSP  ELLLLLLhhhlllllhhHLLL------HHHHHHHHHHHHH------HHLLlllllleeEE


DSSP  EEEELLLllllhhHHHHHHHHHHHHHHHLLLEEELLLLLLL-----------LHHHHHHH
Query IGEIGVSsdftaeEEKSLRGAARAQVRTGLPLXVHLPGWFR-----------LAHRVLDL  222
ident  |  ||               |         |  |                         
Sbjct LGPCGVP----ydKPELFEAFAQMAADYDVRLHTHFYEPLDagmsdhlygmtPWRFLEKH  263
DSSP  ELLLLLL----llLHHHHHHHHHHHHHHLLEEEEEELLLLHhhhhhhhhlllHHHHHHHL


DSSP  HHhllllHHHEEELLLHHHllLHHHHHHHHHHLLEEEELLLLLLLEelllleELLLhhhh
Query VEeegadLRHTVLCHXNPShxDPVYQATLAQRGAFLEFDXIGXDFFyadqgvQCPSddev  282
ident             | |              |  |                           
Sbjct GW----aSDRVWLAHAVVP--PREEIPEFADAGVAIAHLIAPDLRM------GWGL----  307
DSSP  LL----lLLLEEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHL------LLLL----


DSSP  hhHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLhHHHLhHHHHHH-----------
Query arAILGLADHGYldRILLSHDVFVkxxltryggNGYAfVTKHfLPRLRR-----------  331
ident    |    | |                       |        |                
Sbjct -aPIREYLDAGI--TVGFGTTGSA-------snDGGN-LLGD-LRLAALahrpadpnepe  355
DSSP  -lLHHHHHHLLL--EEEELLLLLL-------llLLLL-HHHH-HHHHHHhlhhhllllhh


DSSP  LLLLHHHHHHHHLHHHHH-HHLLLL-----------------------------------
Query HGLDDAALETLXVTNPRR-VFDASI-----------------------------------  355
ident   |    |                                                    
Sbjct KWLSARELLRMATRGSAEcLGRPDLgvleegraadiacwrldgvdrvgvhdpaiglimtg  415
DSSP  HLLLHHHHHHHLLHHHHHhLLLLLLlllllllllleeeeelllhhhlllllhhhhhhhll


DSSP  -----------------------------------lll
Query -----------------------------------egh  358
ident                                       
Sbjct lsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllllleeeelleeeeelleellllhhhhhhhhhhhll


No 10: Query=3k2gB Sbjct=4cqbA Z-score=17.8

back to top
DSSP  --------------------------llllllllllllleeeelleeeehhhlLLEELLL
Query --------------------------slselspchvrsgrixtvdgpipssalGHTLXHE   34
ident                                                      |    | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  LLLEelhhhllllllhhhhhhhhllLLHHHHHhHHLLHH----------hllllleeLLH
Query HLQNdcrcwwnppqeperqylaeapISIEILSeLRQDPF----------vnkhnialDDL   84
ident |                                                           
Sbjct HMDK----------------sftstGERLPKF-WSRPYTrdaaiedglkyyknatheEIK  103
DSSP  LHHH----------------lllllLLLLLLL-LLLLLLhhhhhhhhhhhhhhllhhHHH


DSSP  HHHHHHHHHHHHLLLLEEEELLLLL---lllLHHHHHHHHHHH--LLEEEELLLLLL--H
Query DLAIAEVKQFAAVGGRSIVDPTCRG---igrDPVKLRRISAET--GVQVVXGAGYYL--A  137
ident    |         |                           |          |       
Sbjct RHVIEHAHMQVLHGTLYTRTHVDVDsvaktkAVEAVLEAKEELkdLIDIQVVAFAQSgfF  163
DSSP  HHHHHHHHHHHHLLEEEEEEEEELLlllllhHHHHHHHHHHHLllLLEEEEEEELLLllL


DSSP  HHLLhhhhlllhhhhhHHHHHHHHlllllllLLLLLEEeELLLLLLLHHHHHHHHHHHHH
Query SSXPetaarlsaddiaDEIVAEALegtdgtdARIGLIGeIGVSSDFTAEEEKSLRGAARA  197
ident                   |                | |            | ||      
Sbjct VDLE----------seSLIRKSLD-------MGCDLVG-GVDPATRENNVEGSLDLCFKL  205
DSSP  LLLL----------hhHHHHHHHH-------HLLLEEE-LLLLLLLLLLHHHHHHHHHHH


DSSP  HHHHLLLEEELLLLLL----LLHHHHHHHHHHLLlLHHHEEELLLHHHLL----LHHHHH
Query QVRTGLPLXVHLPGWF----RLAHRVLDLVEEEGaDLRHTVLCHXNPSHX----DPVYQA  249
ident           |             |      | |         |                
Sbjct AKEYDVDIDYHIHDIGtvgvYSINRLAQKTIENG-YKGRVTTSHAWCFADapseWLDEAI  264
DSSP  HHHLLLEEEEEELLLHhhhhHHHHHHHHHHHHLL-LLLLEEEEELLHHHHllhhHHHHHH


DSSP  HHHHH-LLEEEElLLLLlleelllleelllHHHHhhHHHHHHHLLLhhHEEELLLLL-LH
Query TLAQR-GAFLEFdXIGXdffyadqgvqcpsDDEVarAILGLADHGYldRILLSHDVF-VK  307
ident  |    |                                 |   |         |     
Sbjct PLYKDsGMKFVT-CFSS------------tPPTM--PVIKLLEAGI--NLGCASDNIrDF  307
DSSP  HHHHHhLLEEEE-ELLL------------lLLLL--LHHHHHHLLL--EEEEELLLLlLL


DSSP  HHlhhhlLLLLLHHHhLHHHHHH-HLLL----LHHHHHHHHLHHHHHH-HLLLL------
Query XXltrygGNGYAFVTkHFLPRLR-RHGL----DDAALETLXVTNPRRV-FDASI------  355
ident          |              |  |    |             ||            
Sbjct WV-----PFGNGDMV-QGALIETqRLELktnrDLGLIWKMITSEGARVlGIEKNygievg  361
DSSP  LL-----LLLLLLHH-HHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHhLLHHHllllll


DSSP  --------------------------------------lll
Query --------------------------------------egh  358
ident                                          
Sbjct kkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  lllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 11: Query=3k2gB Sbjct=3mtwA Z-score=17.6

back to top
DSSP  -------------------------------llllllllllllleeeelleeeehhhlLL
Query -------------------------------slselspchvrsgrixtvdgpipssalGH   29
ident                                                           | 
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EELLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhhllhhhLLLL---leeLLHHH
Query TLXHEHLQNdcrcwwnppqeperqylaeapisieilselrqdpfvNKHN---ialDDLDL   86
ident    | ||                                                     
Sbjct IDMHVHLDS-------------------------------laevgGYNSleysdrFWSVV   89
DSSP  EEEEELLLL-------------------------------lllllHHHHhhllhhHHHHH


DSSP  HHHHHHHHHHLLLLEEEELLLllLLLL-HHHHHHHHH--HHLLEEEEL-LLLLL--HHHL
Query AIAEVKQFAAVGGRSIVDPTCrgIGRD-PVKLRRISA--ETGVQVVXG-AGYYL--ASSX  140
ident   |  |     |              |       | |    |   |              
Sbjct QTANAKKTLEAGFTTVRNVGA--ADYDdVGLREAIDAgyVPGPRIVTAaISFGAtgGHCD  147
DSSP  HHHHHHHHHHLLEEEEEELLL--LLLHhHHHHHHHHLllLLLLEEEELlLLEELllLLLL


DSSP  L----------hhhhlLLHHHHHHHHHHHHHlllllllLLLLLEEeELLL----------
Query P----------etaarLSADDIADEIVAEALegtdgtdARIGLIGeIGVS----------  180
ident                  | |                       |  |             
Sbjct StffppsmdqknpfnsDSPDEARKAVRTLKK-------YGAQVIX-ICATggvfsrgnep  199
DSSP  LllllhhhllllllllLLHHHHHHHHHHHHH-------LLLLEEE-EELLllllllllll


DSSP  LLLLhhHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHHHHHHHhhllllhhhEEELLLHH
Query SDFTaeEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHRVLDLVeeegadlrhTVLCHXNP  240
ident                      |     |                            |   
Sbjct GQQQ-lTYEEMKAVVDEAHMAGIKVAAHA-HGASGIREAVRAG--------vDTIEHASL  249
DSSP  LLLL-lLHHHHHHHHHHHHHLLLEEEEEE-LLHHHHHHHHHLL--------lLEEEELLL


DSSP  HllLHHHHHHHHHHLLEEEELLLLLLL----------eeLLLLE--ELLLhhHHHHHHHH
Query ShxDPVYQATLAQRGAFLEFDXIGXDF----------fyADQGV--QCPSddEVARAILG  288
ident    |        | ||    |    |                                  
Sbjct V--DDEGIKLAVQKGAYFSMDIYNTDYtqaegkkngvleDNLRKdrDIGE--LQRENFRK  305
DSSP  L--LHHHHHHHHHHLLEEELLLLLHHHhhhhhhhhlllhHHHHHhhHHHH--HHHHHHHH


DSSP  HHHLLLhhHEEELLLLLLhhhlhhhllLLLLHHHhLHHHHHHHLLLLHHHHHHHHLHHHH
Query LADHGYldRILLSHDVFVkxxltryggNGYAFVTkHFLPRLRRHGLDDAALETLXVTNPR  348
ident     |         |                           | |               
Sbjct ALKAGV--KMVYGTDAGI---------YPHGDNA-KQFAVMVRYGATPLQAIQSATLTAA  353
DSSP  HHHHLL--EEELLLLLLL---------LLLLLHH-HHHHHHHHLLLLHHHHHHHLLHHHH


DSSP  HHHLLLL-----------------------------------------lll
Query RVFDASI-----------------------------------------egh  358
ident      |                                             
Sbjct EALGRSKdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  HHHLLLLlllllllllllleeeelllllllhhhhhllleeeelleeeelll


No 12: Query=3k2gB Sbjct=3gg7A Z-score=17.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapi   60
ident                                 | ||                        
Sbjct ---------------------------SLIDFHVHLDL----------------------   11
DSSP  ---------------------------LLEEEEELHHH----------------------


DSSP  lhhhhhhhhllhhhllllleELLHhhhHHHHHHHHHLLLlEEEELLLLlllLLHHHHHhH
Query sieilselrqdpfvnkhniaLDDLdlaIAEVKQFAAVGGrSIVDPTCRgigRDPVKLRrI  120
ident                       |     |                |          |   
Sbjct --------------------YPDP---VAVARACEERQL-TVLSVTTT-paAWRGTLA-L   45
DSSP  --------------------LLLH---HHHHHHHHHLLL-EEEELLLL-hhHHHHHHH-H


DSSP  HHHhLLEEEELLLLLLHhHLLHHHHlllhhhhhHHHHHHHHllllllllLLLLEEEELLL
Query SAEtGVQVVXGAGYYLAsSXPETAArlsaddiaDEIVAEALegtdgtdaRIGLIGEIGVS  180
ident  |     |    |        | ||                             || |  
Sbjct AAG-RPHVWTALGFHPE-VVSERAA------dlPWFDRYLP--------ETRFVGEVGLD   89
DSSP  HLL-LLLEEELLLLLHH-HLLLLHH------hlHHHHHHHH--------HLLEEEEEELL


DSSP  LL-----lLHHHHHHHHHHHHHHHHH-LLLEEELLLlllLLHHHHHHHHHHLLLLhhHEE
Query SD-----fTAEEEKSLRGAARAQVRT-GLPLXVHLPgwfRLAHRVLDLVEEEGADlrHTV  234
ident                     |      |  |  |     |    ||   |          
Sbjct GSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR---RAESEVLNCLEANPRS-gTPI  145
DSSP  LLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL---LLHHHHHHHHHHLHHH-eEEE


DSSP  ELLLHHhllLHHHHHHHHHHLLEEEeLLLLllleelllleellLHHHHHHHHHHHhhllL
Query LCHXNPshxDPVYQATLAQRGAFLEfDXIGxdffyadqgvqcpSDDEVARAILGLadhgY  294
ident |                   |                           |  |        
Sbjct LHWYSG---SVTELRRAISLGCWFS-VGPT-----------mvRTQKGAALIRSM----P  186
DSSP  EELLLL---LHHHHHHHHHLLLEEE-ELHH-----------hhLLHHHHHHHHHL----L


DSSP  HHHEEELLLLLL----HHHLhhhlllLLLHHHhLHHHHHHHLLLL--HHHHHHHhLHHHH
Query LDRILLSHDVFV----KXXLtryggnGYAFVTkHFLPRLRRHGLD--DAALETLxVTNPR  348
ident  || |   |                     |       |                  |  
Sbjct RDRVLTETDGPFleldGQAA------LPWDVK-SVVEGLSKIWQIpaSEVERIV-KENVS  238
DSSP  HHHEEELLLLLLleelLEEL------LHHHHH-HHHHHHHHHHLLlhHHHHHHH-HHHHH


DSSP  HHHLLlllll
Query RVFDAsiegh  358
ident |         
Sbjct RLLGT-----  243
DSSP  HHHHL-----


No 13: Query=3k2gB Sbjct=1gkpA Z-score=17.3

back to top
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL
Query -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
ident                                                     |    | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLEELHHhllllllhhhhhhhhllllhhhhhhhhllhhhllllLEELLHhhHHHHHHHHH
Query LQNDCRCwwnppqeperqylaeapisieilselrqdpfvnkhnIALDDLdlAIAEVKQFA   95
ident                                                |        |   
Sbjct IYLPFMA------------------------------------TFAKDT--HETGSKAAL   82
DSSP  LLLEELL------------------------------------EELLLL--HHHHHHHHH


DSSP  HLLLLEEEELLLLL--------lllLHHHHHHHHhhhLLEEEELLLLLlhhhllhhHHLL
Query AVGGRSIVDPTCRG--------igrDPVKLRRISaetGVQVVXGAGYYlassxpetAARL  147
ident   |        |                |    |                          
Sbjct MGGTTTYIEMCCPSrnddalegyqlWKSKAEGNS---YCDYTFHMAVS-------kFDEK  132
DSSP  HLLEEEEEEEELLLllllhhhhhhhHHHHHLLLL---LLEEEEEEELL-------lLLLL


DSSP  lhhhHHHHHHHHHHLlllllllLLLLEEeELLLLL-llhHHHHHHHHHHHHHHHHLLLEE
Query saddIADEIVAEALEgtdgtdaRIGLIGeIGVSSD-ftaEEEKSLRGAARAQVRTGLPLX  206
ident                        |     |  |                |     |    
Sbjct ----TEGQLREIVAD-------GISSFX-IFLSYKnffgVDDGEMYQTLRLAKELGVIVT  180
DSSP  ----HHHHHHHHHHL-------LLLEEE-EEELLLllllLLHHHHHHHHHHHHHHLLEEE


DSSP  ELLL-----------------------------lLLLL-HHHHHHHHHHLLLLhhhEEEL
Query VHLP-----------------------------gWFRL-AHRVLDLVEEEGADlrhTVLC  236
ident  |                                       |     |  ||        
Sbjct AHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEgTARFATFLETTGAT---GYVV  237
DSSP  EEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHhHHHHHHHHHHHLLE---EEEL


DSSP  LLhhHLLLhhHHHHHHHHL-----LEEEElLLLL----------------LLEElllleE
Query HXnpSHXDpvYQATLAQRG-----AFLEFdXIGX----------------DFFYadqgvQ  275
ident |   |                      |   |                            
Sbjct HL--SCKP--ALDAAMAAKargvpIYIES-VIPHflldktyaerggveamKYIM---spP  289
DSSP  LL--LLHH--HHHHHHHHHhllllEEEEE-EHHHhhllhhhhhllhhhhhLLLL---llL


DSSP  LLLhHHHHHHHHHHHhllLHHHEEELLLLLLHH-----------hlhhhllLLLLHHHHL
Query CPSdDEVARAILGLAdhgYLDRILLSHDVFVKX-----------xltryggNGYAFVTKH  324
ident                            |                                
Sbjct LRD-KRNQKVLWDAL--aQGFIDTVGTDHCPFDteqkllgkeaftaipngiPAIEDRVNL  346
DSSP  LLL-LHHHHHHHHHH--hLLLLLEEELLLLLLLhhhhhhhlllhhhlllllLLLLLHHHH


DSSP  HHHHHH-HLLLLHHHHHHHHLHHHHHHHL-------------------------------
Query FLPRLR-RHGLDDAALETLXVTNPRRVFD-------------------------------  352
ident        |  ||         |     |                                
Sbjct LYTYGVsRGRLDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvkt  406
DSSP  HHHHHLlLLLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhh


DSSP  ----------------------------------------------llllll
Query ----------------------------------------------asiegh  358
ident                                                     
Sbjct qhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  llllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 14: Query=3k2gB Sbjct=2oofA Z-score=17.1

back to top
DSSP  -----------------------------------llllllllllllleeeelleeeehh
Query -----------------------------------slselspchvrsgrixtvdgpipss   25
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  hlLLEELLLLLLEELHhhllllllhhhhhhhhllllhhhhhhhhllHHHLL---------
Query alGHTLXHEHLQNDCRcwwnppqeperqylaeapisieilselrqdPFVNK---------   76
ident   |    | ||                                                 
Sbjct tpGLIDCHTHLIFAGS------------------------------RAEEFelrqkgvpy   90
DSSP  eeLEEEEEELLLLLLL------------------------------LHHHHhhhhhlllh


DSSP  ------------------llleeLLHHHHHHHHHHHHHLLLLEEEELLLLL-----lllL
Query ------------------hnialDDLDLAIAEVKQFAAVGGRSIVDPTCRG-----igrD  113
ident                            ||   ||     |          |         
Sbjct aeiarkgggiistvratraasedQLFELALPRVKSLIREGVTTVEIKSGYGltledelkX  150
DSSP  hhhhhllllhhhhhhhhhhllhhHHHHHHHHHHHHHHHHLEEEEEEELLLLllhhhhhhH


DSSP  HHHHHHHHHHHLLEEEELL-LLLLhhhLLHHH---HLLLHHHHHH-HHHHHHHLLlllll
Query PVKLRRISAETGVQVVXGA-GYYLassXPETA---ARLSADDIAD-EIVAEALEGtdgtd  168
ident     ||        |             |             |    | | |  |     
Sbjct LRVARRLGEALPIRVKTTLlAAHA---VPPEYrddPDSWVETICQeIIPAAAEAG-----  202
DSSP  HHHHHHHHHHLLLEEEEEEeEELL---LLHHHlllHHHHHHHHHHlHHHHHHHLL-----


DSSP  lLLLLEEeELLLLLLlhhHHHHHHHHHHHHHHHLLLEEELLLLLLLL--HHHHHHhhhhl
Query aRIGLIGeIGVSSDFtaeEEKSLRGAARAQVRTGLPLXVHLPGWFRL--AHRVLDlveee  226
ident                             |    ||    |      |             
Sbjct -LADAVD-VFCEHIG--fSLAQTEQVYLAADQYGLAVKGHXDQLSNLggSTLAAN-----  253
DSSP  -LLLEEE-EEELLLL--lLHHHHHHHHHHHHHLLLEEEEEELLLLLLlhHHHHHH-----


DSSP  lllHHHEEELLLHHHllLHHHHHHHHHHLLEEEElLLLL-LLEEllllEELLlhhhhhhH
Query gadLRHTVLCHXNPShxDPVYQATLAQRGAFLEFdXIGX-DFFYadqgVQCPsddevarA  285
ident           |      ||     || ||            |                  
Sbjct ---FGALSVDHLEYL--DPEGIQALAHRGVVATL-LPTAfYFLK----ETKL------pP  297
DSSP  ---LLLLEEEELLLL--LHHHHHHHHHHLLEEEE-LHHHhHHLL----LLLL------lL


DSSP  HHHHHHLLLhhHEEELLLLLLHhhlhhhlLLLL-LHHHHLHHHHHHhllLLHHHHHHHHL
Query ILGLADHGYldRILLSHDVFVKxxltrygGNGY-AFVTKHFLPRLRrhgLDDAALETLXV  344
ident    |   |       | |                               |          
Sbjct VVALRKAGV--PXAVSSDINPG-----taPIVSlRXAXNXACTLFG---LTPVEAXAGVT  347
DSSP  HHHHHHLLL--LEEELLLLLLL-----llLLLLhHHHHHHHHHHHL---LLHHHHHHHLL


DSSP  HHHHH-HHLLLL-----------------------------------------lll
Query TNPRR-VFDASI-----------------------------------------egh  358
ident     |                                                   
Sbjct RHAARaLGEQEQlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
DSSP  HHHHHhLLLLLLllllllllllleeeellllllhhhhlllllleeeeeelleelll


No 15: Query=3k2gB Sbjct=2pajA Z-score=17.0

back to top
DSSP  ----------------------------------llllllllllllleeeelleeeehhh
Query ----------------------------------slselspchvrsgrixtvdgpipssa   26
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  lLLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllLLLE------
Query lGHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkHNIA------   80
ident       | ||                                                  
Sbjct pAWVNTHHHLF----------------------------------qsllkGEPFralfde   86
DSSP  eLEELLLLLHH----------------------------------hhhllLLLLhhhllh


DSSP  eLLHHHHHHHHHHHHHLLLLEEEELLLLL----lllLHHHHHHHHHHHLLEEEELLlLLL
Query lDDLDLAIAEVKQFAAVGGRSIVDPTCRG----igrDPVKLRRISAETGVQVVXGAgYYL  136
ident       |       |  |     |                |       |   |       
Sbjct rRFRLAARIGLIELARSGCATVADHNYVYypgmpfdSSAILFEEAEKLGLRFVLLRgGAT  146
DSSP  hHHHHHHHHHHHHHHLLLEEEEEELLLLLlllllllHHHHHHHHHHHLLLEEEEEElLLL


DSSP  HH-----------HLLHhhhlllhHHHHHHHHHHHHllllllLLLL--------LLEEEE
Query AS-----------SXPEtaarlsaDDIADEIVAEALegtdgtDARI--------GLIGEI  177
ident                         |     |   |                         
Sbjct QTrqleadlptalRPET------lDAYVADIERLAA------RYHDaspramrrVVMAPT  194
DSSP  LLllllllllhhhLLLL------hHHHHHHHHHHHH------HLLLlllllleeEEELLL


DSSP  LLLLlllhHHHHHHHHHHHHHHHHLLLEEELLLlllLLHHHHHHHHhhllllHHHEEELL
Query GVSSdftaEEEKSLRGAARAQVRTGLPLXVHLPgwfRLAHRVLDLVeeegadLRHTVLCH  237
ident  |            |  |    | ||    ||                           |
Sbjct TVLY---sISPREMRETAAVARRLGLRMHSHLS-gkSPVAFCGEHD----wlGSDVWYAH  246
DSSP  LLLL---lLLHHHHHHHHHHHHHLLLEEEEELL-llLHHHHHHHLL----llLLLEEEEL


DSSP  LHHHllLHHHHHHHHHHLLEEEeLLLL-LLLEelllleelllhhhhhhHHHHHHHLLLhh
Query XNPShxDPVYQATLAQRGAFLEfDXIG-XDFFyadqgvqcpsddevarAILGLADHGYld  296
ident       |    | ||| |                                   || |   
Sbjct LVKV--DADEIALLAQTGTGVA-HCPQsNGRL----------------PVREMADAGV--  285
DSSP  LLLL--LHHHHHHHHHHLLEEE-ELHHhHHLL----------------LLLLHHHHLL--


DSSP  HEEELLLLlLHHHlhhhlLLLL-LHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHH-HLLL
Query RILLSHDVfVKXXltrygGNGY-AFVTKHFLPRLRRHGLDDAALETLXVTNPRRV-FDAS  354
ident       |                           |      |           ||     
Sbjct PVSIGVDG-AASN-----EAADmISEVHMTWLAQRARLASIAEVIHWGTAGGARVmGLDE  339
DSSP  LEEELLLH-HHHL-----LLLLhHHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHhLLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  354
ident                                                             
Sbjct vgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegv  399
DSSP  llllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelllllll


DSSP  ------------------llll
Query ------------------iegh  358
ident                       
Sbjct dikelggearrvvrellrevvv  421
DSSP  lhhhhhhhhhhhhhhhhhhhhl


No 16: Query=3k2gB Sbjct=2vunA Z-score=16.9

back to top
DSSP  ---------------------------------llllllllllllleeeelleeeehhhl
Query ---------------------------------slselspchvrsgrixtvdgpipssal   27
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLHHhh
Query GHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDLDla   87
ident |    | |                                                    
Sbjct GLLDTHVHVS-------------------------------------ggdyaPRQKTM--   81
DSSP  LEEEEEELLL-------------------------------------llleeHHHLEE--


DSSP  hHHHHHHHHLLLLEEEELLLllLLLL----------------HHHHHHHHHhHLLEEE-E
Query iAEVKQFAAVGGRSIVDPTCrgIGRD----------------PVKLRRISAeTGVQVV-X  130
ident           |                                          || |   
Sbjct -DFISSALHGGVTTMISAGS--PHFPgrpkdaagtkalaitlSKSYYNARP-AGVKVHgG  137
DSSP  -LHHHHHHLLLEEEEEELLL--LLLLlllllhhhhhhhhhhhHHHHHHLLH-HHLEEElL


DSSP  LLLLllhhhllhhhhlLLHHhhHHHHHHHHHLlllllllLLLLEEEELllllllHHHH--
Query GAGYylassxpetaarLSADdiADEIVAEALEgtdgtdaRIGLIGEIGvssdftAEEE--  188
ident                                |            || |            
Sbjct AVIL-----------eKGLT--EEDFIEMKKE-------GVWIVGEVG----lgTIKNpe  173
DSSP  EELL-----------lLLLL--HHHHHHHHHL-------LLLEEEEEL----llLLLLhh


DSSP  HHHHHHHHHHHhHLLLEEELLLLL------LLLHHHHHHHHhhllllhhhEEELLLH---
Query KSLRGAARAQVrTGLPLXVHLPGW------FRLAHRVLDLVeeegadlrhTVLCHXN---  239
ident         |    |     |  |          |  |              |  | |   
Sbjct DAAPMVEWAHK-HGFKVQMHTGGTsipgssTVTADDVIKTK--------pDVVSHINggp  224
DSSP  HHHHHHHHHHH-LLLEEEEELLLLllllllLLLHHHHHHHL--------lLEEELLLlll


DSSP  -HHLLlhHHHHHHHH-HLLEEEElLLLLlleelllleellLHHHHHHHHHHHHHLLLHHH
Query -PSHXdpVYQATLAQ-RGAFLEFdXIGXdffyadqgvqcpSDDEVARAILGLADHGYLDR  297
ident                      |                              |  | | |
Sbjct tAISV--QEVDRIMDeTDFAMEI-VQCG------------NPKIADYVARRAAEKGQLGR  269
DSSP  lLLLH--HHHHHHHHhLLLEEEE-ELLL------------LHHHHHHHHHHHHHHLLHHH


DSSP  EEELLLLLLHHHLhhhlllLLLHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHHLLL--
Query ILLSHDVFVKXXLtryggnGYAFVTkHFLPRLRRH-GLDDAALETLXVTNPRRVFDAS--  354
ident      |      |                         |          |   |      
Sbjct VIFGNDAPSGTGL------IPLGIL-RNMCQIASMsDIDPEVAVCMATGNSTAVYGLNtg  322
DSSP  EEEELLLLLLLLL------LLLHHH-HHHHHHHHHlLLLHHHHHHHHLHHHHHHHLLLll


DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------i  355
ident                                                             
Sbjct viapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraa  382
DSSP  llllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllllll


DSSP  lll
Query egh  358
ident    
Sbjct kil  385
DSSP  eel


No 17: Query=3k2gB Sbjct=3cjpA Z-score=16.8

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ---------------------------LIIDGHTHVI-----------------------   10
DSSP  ---------------------------LLEEEEEELL-----------------------


DSSP  lhhhhhhhhllhhhllllleellhHHHHHHHHHHHHLLLLEEEELL--------------
Query sieilselrqdpfvnkhnialddlDLAIAEVKQFAAVGGRSIVDPT--------------  106
ident                                |     |                      
Sbjct ------------------------LPVEKHIKIMDEAGVDKTILFStsihpetavnlrdv   46
DSSP  ------------------------LLHHHHHHHHHHHLLLEEEEELllllhhhlllhhhh


DSSP  --------------------lLLLLL--LHHHHHHHHhhhlLEEEEL-LLLLlhhhllhh
Query --------------------cRGIGR--DPVKLRRISaetgVQVVXG-AGYYlassxpet  143
ident                      |                      |               
Sbjct kkemkklndvvngktnsmidvRRNSIkeLTNVIQAYP----SRYVGFgNVPV--------   94
DSSP  hhhhhhhhhhhlllllllhhhHHHHHhhHHHHHHHLL----LLEEEEeLLLL--------


DSSP  hhlLLHHHHHHHHHHHHHLllllllLLLLLEEEELLLLLllhHHHHhHHHHHHHHHHH-L
Query aarLSADDIADEIVAEALEgtdgtdARIGLIGEIGVSSDftaEEEKsLRGAARAQVRT-G  202
ident    ||  |    |                 |||    |         |            
Sbjct --gLSENDTNSYIEENIVN------NKLVGIGELTPASG---QIKS-LKPIFKYSMDSgS  142
DSSP  --lLLHHHHHHHHHHHLLL------LLLLEEEEELLLLL---LHHH-HHHHHHHHHHLlL


DSSP  LLEEELLlLLLL---LHHHHHHHHHHLLLLhhHEEELLL-HHHLllhHHHHHHHHHL--L
Query LPLXVHLpGWFR---LAHRVLDLVEEEGADlrHTVLCHX-NPSHxdpVYQATLAQRG--A  256
ident ||   |                |            | |              ||      
Sbjct LPIWIHA-FNPLvlqDIKEIAELCKAFPKV--PVILGHMgGSNW---MTAVELAKEIqnL  196
DSSP  LLEEELL-LLLLlhhHHHHHHHHHHHLLLL--LEEEHHHhHHHH---HHHHHHHHHLllE


DSSP  EEEELLLlllleelllleelLLHHHHHHHHHHhhhllLHHHEEELLLLLLhhhlhhhllL
Query FLEFDXIgxdffyadqgvqcPSDDEVARAILGladhgYLDRILLSHDVFVkxxltryggN  316
ident  |                   |       |                |             
Sbjct YLDTSAY-------------FSTFVLKIVINE-----LPLKCIFGTDMPF---------G  229
DSSP  EEELLLL-------------LLHHHHHHHHHH-----LLLLEELLLLLLL---------L


DSSP  LLLHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHHLllllll
Query GYAFVTkHFLPRLRrhgLDDAALETLXVTNPRRVFDasiegh  358
ident                   |          |  |         
Sbjct DLQLSI-EAIKKMS---NDSYVANAVLGDNISRLLN-----i  262
DSSP  LHHHHH-HHHHHHL---LLHHHHHHHHLHHHHHHHL-----l


No 18: Query=3k2gB Sbjct=3giqA Z-score=16.7

back to top
DSSP  -----------------------------llllllllllllleeeelleeeehhhlLLEE
Query -----------------------------slselspchvrsgrixtvdgpipssalGHTL   31
ident                                                         |   
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  LLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleellHHHHHhhH
Query XHEHLQNdcrcwwnppqeperqylaeapisieilselrqdpfvnkhnialddLDLAIaeV   91
ident  | |                                                        
Sbjct VHGHDDL-------------------------------------------mfVEKPD--L   75
DSSP  LLLLLLL-------------------------------------------hhHHLLL--L


DSSP  HHHHHLLLLEEEEL----LLLL----------------------lllLHHHH-HHHHhhh
Query KQFAAVGGRSIVDP----TCRG----------------------igrDPVKL-RRISaet  124
ident       |    |                                       |        
Sbjct RWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfadvpaYFAALdAQRP---  132
DSSP  HHHHLLLEEEEEELllllLLLLllllllllhhhhhhllllllllhhhHHHHHhHLLL---


DSSP  LLEEEELLLLLlhhhLLHH-------hHLLLhHHHHHHHHHHHHlllllllLLLLLEEeE
Query GVQVVXGAGYYlassXPET-------aARLSaDDIADEIVAEALegtdgtdARIGLIGeI  177
ident    |    |                  |        |   |          |        
Sbjct MINVAALVGHA-nlrLAAMrdpqaaptAAEQ-QAMQDMLQAALE-------AGAVGFS-T  182
DSSP  LLEEEEEEEHH-hhhHHHLllllllllHHHH-HHHHHHHHHHHH-------HLLLEEE-E


DSSP  LLLL--lLLHHhHHHHHHHHHHHHHHLLLEEELL-LLLL---LLHHHHHHHHHHLLLlhh
Query GVSS--dFTAEeEKSLRGAARAQVRTGLPLXVHL-PGWF---RLAHRVLDLVEEEGAdlr  231
ident |        |     | | ||           |              ||      |    
Sbjct GLAYqpgAVAQ-AAELEGLARVAAERRRLHTSHIrNEADgveAAVEEVLAIGRGTGC---  238
DSSP  ELLLllhHHLL-HHHHHHHHHHHHHLLLEEEEELlLLLLlhhHHHHHHHHHHHHHLL---


DSSP  HEEELLLHH-----hlLLHHHHHHHHHHL-----LEEEElLLLLLL--------------
Query HTVLCHXNP-----shXDPVYQATLAQRG-----AFLEFdXIGXDF--------------  267
ident  ||  |                |             |                       
Sbjct ATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDI-YPYPGSstiliperaetidd  297
DSSP  EEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEE-LLLLEEeeellhhhllllll


DSSP  -----------------------------------eellllEELLLHHHHHHHHHhhhhl
Query -----------------------------------fyadqgVQCPSDDEVARAILgladh  292
ident                                                ||| |        
Sbjct iritwstphpecsgeyladiaarwgcdkttaarrlapagaiYFAMDEDEVKRIFQ-----  352
DSSP  leeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeEELLLHHHHHHHHH-----


DSSP  llHHHEEELLLLLLHHhlhhHLLLL-LLHHHHLHHHHHH--HLLLLHHHHHHHHLHHHHH
Query gyLDRILLSHDVFVKXxltrYGGNG-YAFVTKHFLPRLR--RHGLDDAALETLXVTNPRR  349
ident           |                       | |                    | |
Sbjct --HPCCMVGSDGLPND----ARPHPrLWGSFTRVLGRYVreARLMTLEQAVARMTALPAR  406
DSSP  --LLLEEELLLLLLLL----LLLLLhHHHHHHHHHHHHHhhLLLLLHHHHHHHHLHHHHH


DSSP  HHLLL-------------------------------------------------------
Query VFDAS-------------------------------------------------------  354
ident ||                                                          
Sbjct VFGFAergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadg  466
DSSP  HHLLLlllllllllllleeeelllllllllllllllllllleeeeeelleeeelllllll


DSSP  -----llll
Query -----iegh  358
ident          
Sbjct rpgqvlrax  475
DSSP  lllllllll


No 19: Query=3k2gB Sbjct=4b3zD Z-score=16.7

back to top
DSSP  --------------------------llllllllllllleeeelleeeehhhlLLEELLL
Query --------------------------slselspchvrsgrixtvdgpipssalGHTLXHE   34
ident                                                      |      
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  LLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleELLHHHHHHHHHHH
Query HLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkhniaLDDLDLAIAEVKQF   94
ident  ||                                               |         
Sbjct YLQ-------------------------------------------KTAADDFFQGTRAA   77
DSSP  LLL-------------------------------------------LLLLLLHHHHHHHH


DSSP  HHLLLLEEEELLLLL--------lllLHHHHHHHHhhhLLEEEELLLLLlhhhllhhHHL
Query AAVGGRSIVDPTCRG--------igrDPVKLRRISaetGVQVVXGAGYYlassxpetAAR  146
ident    |   | |                        |                         
Sbjct LVGGTTMIIDHVVPEpgsslltsfekWHEAADTKS---CCDYSLHVDIT-------sWYD  127
DSSP  HHLLEEEEEEEELLLllllhhhhhhhHHHHHHLLL---LLEEEEEEELL-------lLLL


DSSP  LlhhhHHHHHHHHHHLLllllllLLLLEEeELLLLL-llhHHHHHHHHHHHHHHHHLLLE
Query LsaddIADEIVAEALEGtdgtdaRIGLIGeIGVSSD-ftaEEEKSLRGAARAQVRTGLPL  205
ident         |                                    |  |       |   
Sbjct G----VREELEVLVQDK------GVNSFQ-VYMAYKdvyqMSDSQLYEAFTFLKGLGAVI  176
DSSP  L----HHHHHHHHHHLL------LLLEEE-EELLLLllllLLHHHHHHHHHHHHHHLLEE


DSSP  EELLL------------------------------lLLLLHHHHHHHHHHlLLLHhhEEE
Query XVHLP------------------------------gWFRLAHRVLDLVEEeGADLrhTVL  235
ident  ||                                       |                 
Sbjct LVHAEngdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITIAGR-INCP--VYI  233
DSSP  EEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHHHHH-HLLL--EEE


DSSP  LLLHHhLLLHHHHHHHHH--HLLEEEElLLLL---LLEE-----------lllleELLL-
Query CHXNPsHXDPVYQATLAQ--RGAFLEFdXIGX---DFFY-----------adqgvQCPS-  278
ident              |         | |         |                        
Sbjct TKVMS-KSAADIIALARKkgPLVFGEP-IAASlgtDGTHywsknwakaaafvtspPLSPd  291
DSSP  EEELL-HHHHHHHHHHHHhlLLEEEEE-LHHHhhlLLHHhhlllhhhhhhlllllLLLLl


DSSP  hHHHHHHHHHHHHlllHHHEEELLLLLLHH-----------hlhhhlLLLLLHHHHLHHH
Query dDEVARAILGLADhgyLDRILLSHDVFVKX-----------xltrygGNGYAFVTKHFLP  327
ident           ||     |                              ||          
Sbjct pTTPDYLTSLLAC---GDLQVTGSGHCPYStaqkavgkdnftlipegVNGIEERMTVVWD  348
DSSP  lLHHHHHHHHHHH---LLLLLLLLLLLLLLhhhhhhhlllhhhllllLLLLLLHHHHHHH


DSSP  HHH-HLLLLHHHHHHHHLHHHHHHHL----------------------------------
Query RLR-RHGLDDAALETLXVTNPRRVFD----------------------------------  352
ident         |         ||    |                                   
Sbjct KAVaTGKMDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitakshks  408
DSSP  HHLlLLLLLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeellllllll


DSSP  -----------------------------------------------LLLL---------
Query -----------------------------------------------ASIE---------  356
ident                                                             
Sbjct aveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafPEHLyqrvkirnk  468
DSSP  lllllllllleeeeeeeeeeelleeeeelleelllllllllllllllLHHHhhhhhhhhh


DSSP  -------ll
Query -------gh  358
ident          
Sbjct vfglqgvsr  477
DSSP  hllllllll


No 20: Query=3k2gB Sbjct=3nqbA Z-score=16.6

back to top
DSSP  ---------------------------------------------------lllllllll
Query ---------------------------------------------------slselspch    9
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  lllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhh
Query vrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapisieilselr   69
ident                   |    | |                                  
Sbjct srrdaaqvidaggayvspGLIDTHXHIES-------------------------------   89
DSSP  lllleeeeeelllleeeeLEEEEEELHHH-------------------------------


DSSP  llhhhllllleELLHhhHHHHHHHHHHLLLLEEEELLllLLLL-------LHHHHHHhHH
Query qdpfvnkhniaLDDLdlAIAEVKQFAAVGGRSIVDPTcrGIGR-------DPVKLRRiSA  122
ident                    |      | |   ||                          
Sbjct -----------SXIT--PAAYAAAVVARGVTTIVWDP--HEFGnvhgvdgVRWAAKA-IE  133
DSSP  -----------HLLL--HHHHHHHHHLLLEEEEEELL--HHHHhhhlhhhHHHHHHH-HL


DSSP  HHLLEEEEL-LLLLlhHHLLHHHHlllhhhHHHHHHHHHHLllllllLLLLLEEEELLLL
Query ETGVQVVXG-AGYYlaSSXPETAArlsaddIADEIVAEALEgtdgtdARIGLIGEIGVSS  181
ident                  | |           |                 || | ||    
Sbjct NLPLRAILLaPSCV--PSAPGLER-ggadfDAAILADLLSW------PEIGGIAEIXNXR  184
DSSP  LLLLEEEEEeLLLL--LLLLLLLL-lllllLHHHHHHHHLL------LLEEEEEEELLHH


DSSP  -lLLHHhhHHHHHHHHHHHHHLLLEEELLlLLLL--LHHHHHHHHhhllllhhhEEELLL
Query -dFTAEeeKSLRGAARAQVRTGLPLXVHLpGWFR--LAHRVLDLVeeegadlrhTVLCHX  238
ident             |   |          |                                
Sbjct gvIERD--PRXSGIVQAGLAAEKLVCGHA-RGLKnaDLNAFXAAG--------vSSDHEL  233
DSSP  hhHLLL--HHHHHHHHHHHHHLLEEEELL-LLLLhhHHHHHHHLL--------lLEELLL


DSSP  hHHLLlhhHHHHHHHHLLEEEELlLLLLleelllleelLLHHHHHHHHHHhhHLLLHHHE
Query nPSHXdpvYQATLAQRGAFLEFDxIGXDffyadqgvqcPSDDEVARAILGlaDHGYLDRI  298
ident   |             |   |      |              |   |             
Sbjct -VSGE---DLXAKLRAGLTIELR-GSHD----------HLLPEFVAALNT--LGHLPQTV  276
DSSP  -LLHH---HHHHHHHLLLEEEEE-LLLH----------HHHHHHHHHHHH--HLLLLLLE


DSSP  EELLLLLLHHHLHhhlLLLL-LHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHHLLLL--
Query LLSHDVFVKXXLTrygGNGY-AFVTkHFLPRLRrhgLDDAALETLXVTNPRRVFDASI--  355
ident  |  |      |      |    |    | |     |           |       |   
Sbjct TLCTDDVFPDDLL---QGGGlDDVV-RRLVRYG---LKPEWALRAATLNAAQRLGRSDlg  329
DSSP  EEELLLLLHHHHH---HLLLhHHHH-HHHHHLL---LLHHHHHHHHLHHHHHHHLLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  355
ident                                                             
Sbjct liaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxa  389
DSSP  llllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  355
ident                                                             
Sbjct ndflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttk  449
DSSP  hhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  355
ident                                                             
Sbjct tgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtai  509
DSSP  eeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  355
ident                                                             
Sbjct lplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdx  569
DSSP  eelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelll


DSSP  ---------------lll
Query ---------------egh  358
ident                   
Sbjct giadvltgkvxespviev  587
DSSP  leeelllleeellleeel


No 21: Query=3k2gB Sbjct=4dlfA Z-score=16.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL----eeLHHHLLllllhhhhhhh
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQ----ndCRCWWNppqeperqyla   56
ident                                 | |                         
Sbjct --------------------------aLRIDSHQHFWryraadYPWIGA-----------   23
DSSP  --------------------------lLLEEEEELLLlllhhhLLLLLL-----------


DSSP  hllllhhhhhhhhllhhHLLLLLEELlhhHHHHHHHHHHHLLLLEEEELL-lLLLL---L
Query eapisieilselrqdpfVNKHNIALDdldLAIAEVKQFAAVGGRSIVDPT-cRGIG---R  112
ident                              |  |      |             |      
Sbjct -----------------GMGVLARDY---LPDALHPLMHAQALGASIAVQarAGRDetaF   63
DSSP  -----------------LLHHHLLLL---LHHHHHHHHHHLLLLEEEEELllLLHHhhhH


DSSP  LHHHHHHHHhhhlLEEEELLLLllhhhllhhhhllLHHHHHHHhHHHHHllllllLLLLL
Query DPVKLRRISaetgVQVVXGAGYylassxpetaarlSADDIADEiVAEALegtdgtDARIG  172
ident                                     |   |   |||             
Sbjct LLELACDEA----RIAAVVGWE-----------dlRAPQLAER-VAEWR------GTKLR  101
DSSP  HHHHHLLLL----LEEEEEELL-----------llLLLLHHHH-HHLLL------LLLEE


DSSP  LEEeELLLL--LLLHHHH--HHHHHHHHHHHhHLLLEEELLLLLLL-LHHHHHHHHHhll
Query LIGeIGVSS--DFTAEEE--KSLRGAARAQVrTGLPLXVHLPGWFR-LAHRVLDLVEeeg  227
ident            |  |        || |  |        |                     
Sbjct GFR-HQLQDeaDVRAFVDdaDFARGVAWLQA-NDYVYDVLVFERQLpDVQAFCARHD---  156
DSSP  EEE-ELHHHllLHHHHHHlhHHHHHHHHHHH-LLLEEEELLLHHHHhHHHHHHHHLL---


DSSP  llhHHEEELLLHHH------------lLLHHHHHHHHHHL-LEEEELLLLLLLEEL--ll
Query adlRHTVLCHXNPS------------hXDPVYQATLAQRG-AFLEFDXIGXDFFYA--dq  272
ident       || |                         ||                       
Sbjct --aHWLVLDHAGKPalaefdrddtalaRWRAALRELAALPhVVCKLSGLVTEADWRrglr  214
DSSP  --lLLEEEHHHHLLlhhhllllllhhhHHHHHHHHHHLLLlEEEEELLLLLLLLLLllll


DSSP  leellLHHHHHHHHHHHHhllLHHHEEELLLLLLhhhlhhhlLLLLLHHHHLHHHHHHHl
Query gvqcpSDDEVARAILGLAdhgYLDRILLSHDVFVkxxltrygGNGYAFVTKHFLPRLRRh  332
ident             | |         |     |  |           |  |           
Sbjct asdlrHIEQCLDAALDAF---GPQRLMFGSDWPV-----cllAASYDEVASLVERWAES-  265
DSSP  hhhhhHHHHHHHHHHHHH---LHHHEEELLLLLH-----hhhLLLHHHHHHHHHHHHHH-


DSSP  LLLHHHHHHHHLHHHHHHHLllllll
Query GLDDAALETLXVTNPRRVFDasiegh  358
ident  |  |    |      |         
Sbjct RLSAAERSALWGGTAARCYA----lp  287
DSSP  HLLHHHHHHHLLHHHHHHLL----ll


No 22: Query=3k2gB Sbjct=2qpxA Z-score=16.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlLL
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeaPI   60
ident                                 | |                         
Sbjct ---------------gxddlsefvdqvPLLDHHCHFL---------------idgkvpNR   30
DSSP  ---------------lllllhhhhhhlLEEEEEELLL---------------llllllLH


DSSP  LH------------hHHHHHHLL--------------hhhllllleellhHHHHHHHHHH
Query SI------------eILSELRQD--------------pfvnkhnialddlDLAIAEVKQF   94
ident                 |                                   |      |
Sbjct DDrlaqvsteadkdyPLADTKNRlayhgflalakefaldannplaaxndpGYATYNHRIF   90
DSSP  HHhhhhhllllllllLHHHHLLLhhhhhhhhhhhhhllllllllllllhhHHHHHHHHHH


DSSP  HHLLLLEEEELLLllllllhHHHHHHHHHHLLEEEELLLLLlhhhLLHH-------hHLL
Query AAVGGRSIVDPTCrgigrdpVKLRRISAETGVQVVXGAGYYlassXPET-------aARL  147
ident            |          |       |  |                          
Sbjct GHFHFKELLIDTGfvpddpiLDLDQTAELVGIPVKAIYRLE-thaEDFXlehdnfaaWWQ  149
DSSP  HHLLEEEEEEELLlllllllLLHHHHHHHHLLLEEEEEEHH-hhhHHHHlllllhhhHHH


DSSP  LhhhHHHHHHHHHHLlllllllLLLLEEeELLLLLL------------------------
Query SaddIADEIVAEALEgtdgtdaRIGLIGeIGVSSDF------------------------  183
ident                                                             
Sbjct A---FSNDVKQAKAH-------GFVGFX-SIAAYRVglhlepvnvieaaagfdtwkhsge  198
DSSP  H---HHHHHHLLLLL-------LLLLEE-ELHHHHLllllllllhhhhhhhhhhhhhhll


DSSP  -----LHHHHHHHHHHHHHHHHHLLLEEELLLL---------LLLL-HHHHHHHHHhLLL
Query -----TAEEEKSLRGAARAQVRTGLPLXVHLPG---------WFRL-AHRVLDLVEeEGA  228
ident             |   |        ||  |               |     |        
Sbjct krltsKPLIDYXLYHVAPFIIAQDXPLQFHVGYgdadtdxylGNPLlXRDYLKAFT-KKG  257
DSSP  lllllHHHHHHHHHHHHHHHHHHLLLEEEEELLllllllhhhLLHHhHHHHHHHHH-HHL


DSSP  LhhHEEELLLHHHLLlhhHHHHHHH--HLLEEEELL-LLLLleelllleellLHHHHHHH
Query DlrHTVLCHXNPSHXdpvYQATLAQ--RGAFLEFDX-IGXDffyadqgvqcpSDDEVARA  285
ident      || |  | |        ||                                |   
Sbjct L--KVVLLHCYPYHR---EAGYLASvfPNLYFDISLlDNLG---------psGASRVFNE  303
DSSP  L--LEEEEELLLLHH---HHHHHHHhlLLEEEELLLhHHHL---------hhHHHHHHHH


DSSP  HHHHHhllLHHHEEELLLLLLHhhlhhhllLLLLHHHHLHHHHHHHLL---------lLH
Query ILGLAdhgYLDRILLSHDVFVKxxltryggNGYAFVTKHFLPRLRRHG---------lDD  336
ident    ||      |||   |              |      |   |  |             
Sbjct AVELA---PYTRILFASDASTY-------pEXYGLAARQFKQALVAHFnqlpfvdlaqKK  353
DSSP  HLLLL---LHHHEELLLLLLLL-------hHHHHHHHHHHHHHHHHHHhllllllhhhHH


DSSP  HHHHHHHLHHHHHHHL-llllll
Query AALETLXVTNPRRVFD-asiegh  358
ident |                      
Sbjct AWINAICWQTSAKLYHqerelrv  376
DSSP  HHHHHHHLHHHHHHLLlhhhhll


No 23: Query=3k2gB Sbjct=4c5yA Z-score=16.2

back to top
DSSP  ----------------------------------llllllllllllleeeelleeeehhh
Query ----------------------------------slselspchvrsgrixtvdgpipssa   26
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  lLLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhLLLLLE------
Query lGHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvNKHNIA------   80
ident  |    | |                                          |        
Sbjct pGLWDCHMHFG----------------------------------gddDYYNDYtsglat   86
DSSP  eLEEEEEELLL----------------------------------lllLLLLLLhhhhhl


DSSP  --eLLHHHHHHHHHHHHHLLLLEEEELLlllllLLHHHHHHH--hHHHLLEEEEL-LLLL
Query --lDDLDLAIAEVKQFAAVGGRSIVDPTcrgigRDPVKLRRI--sAETGVQVVXG-AGYY  135
ident                    |  |  |               |      |  |    |   
Sbjct hpaSSGARLARGCWEALQNGYTSYRDLA----gYGCEVAKAIndgTIVGPNVYSSgAALS  142
DSSP  lhhHHHHHHHHHHHHHHHLLEEEEEELL----lLHHHHHHHHhllLLLLLEEEELlLEEE


DSSP  LHH--HLLH-------------------------hhhlLLHHHHHHHHHHHHHlllllll
Query LAS--SXPE-------------------------taarLSADDIADEIVAEALegtdgtd  168
ident                                                             
Sbjct QTAghGDIFalpagevlgsygvmnprpgywgagplciaDGVEEVRRAVRLQIR-------  195
DSSP  LLLllLLLLlllhhhhhhhhlllllllllllllleeelLLHHHHHHHHHHHHH-------


DSSP  LLLLLEEeELLL----------LLLLhHHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHH
Query ARIGLIGeIGVS----------SDFTaEEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHR  218
ident      |     |                    |        |       |          
Sbjct RGAKVIX-VMASggvmsrddnpNFAQ-FSPEELKVIVEEAARQNRIVSAHV-HGKAGIMA  252
DSSP  HLLLLEE-EELLllllllllllLLLL-LLHHHHHHHHHHHHHLLLLEEEEE-LLHHHHHH


DSSP  HHHHHhhllllhhhEEELLLHHHlllHHHHHHHHH-HLLEEEELLLL-LLLE-------e
Query VLDLVeeegadlrhTVLCHXNPShxdPVYQATLAQ-RGAFLEFDXIG-XDFF-------y  269
ident                 | |             |    |            |         
Sbjct AIKAG--------cKSLEHVSYA---DEEVWELMKeKGILYVATRSViEIFLasngeglv  301
DSSP  HHHHL--------lLEEEELLLL---LHHHHHHHHhHLLEEELLHHHhHHHHhhllllll


DSSP  LLLLE---ELLLhhHHHHHHHHHHHLLLhhHEEELLLLllhhhlhhhllllLLHHHhLHH
Query ADQGV---QCPSddEVARAILGLADHGYldRILLSHDVfvkxxltryggngYAFVTkHFL  326
ident                   |  |    |    | |  |                      |
Sbjct KESWAklqALAD--SHLKAYQGAIKAGV--TIALGTDT-----------apGGPTA-LEL  345
DSSP  LLHHHlllHHHH--HHHHHHHHHHHLLL--LEELLLLL-----------llLLLLH-HHH


DSSP  HHHHHL-LLLHHHHHHHHLHHHHHHH---LLLL---------------------------
Query PRLRRH-GLDDAALETLXVTNPRRVF---DASI---------------------------  355
ident        |            |                                       
Sbjct QFAVERgGMTPLEAIKAATANAPLSVgpqAPLTgqlregyeadvialeenpledikvfqe  405
DSSP  HHHHHLlLLLHHHHHHHHLLLHHHHHhhhLLLLlllllllllleeeelllllllhhhhhl


DSSP  ----------------------------lll
Query ----------------------------egh  358
ident                                
Sbjct pkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  hhheeeeeelleeeellllllllllllllll


No 24: Query=3k2gB Sbjct=3irsA Z-score=16.1

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLL----LEELH--HHLLllllhhhhh
Query slselspchvrsgrixtvdgpipssalGHTLXHEHL----QNDCR--CWWNppqeperqy   54
ident                                             |               
Sbjct --------------------------lKIIDFRLRPpamgFLNARiyTRPD---------   25
DSSP  --------------------------lLLEELLLLLllhhHHHLHhhHLHH---------


DSSP  hhhllllhhhhhhhhllHHHL------lllleellhHHHHHHHHHHHHLLLLEEEELLLL
Query laeapisieilselrqdPFVN------khnialddlDLAIAEVKQFAAVGGRSIVDPTCR  108
ident                                               || |    |     
Sbjct -----------------IRNRftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGRN   68
DSSP  -----------------HHHHhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELLE


DSSP  ----LLLL---LHHHHHHHHhhhLLEEEELLLLllhhhllhhhhlLLHHHHHHHHHHHHH
Query ----GIGR---DPVKLRRISaetGVQVVXGAGYylassxpetaarLSADDIADEIVAEAL  161
ident     |                        |                              
Sbjct ssvlGSVSnadVAAVAKAYP---DKFHPVGSIE-----------aATRKEAMAQMQEILD  114
DSSP  elllEELLhhhHHHHHHHLL---LLEEEEEELL-----------lLLHHHHHHHHHHHHH


DSSP  lllllllLLLLLEEeELLLlllLHHH--HHHHHHHHHHHHHHLLLEEELLLL--------
Query egtdgtdARIGLIGeIGVSsdfTAEE--EKSLRGAARAQVRTGLPLXVHLPG--------  211
ident          |            |        |          | |      |        
Sbjct -------LGIRIVN-LEPGvwaTPMHvdDRRLYPLYAFCEDNGIPVIMMTGGnagpdity  166
DSSP  -------LLLLLEE-ELHHhllLLLLllLHHHHHHHHHHHHLLLLEEEELLLlllllhhh


DSSP  LLLL-HHHHHHHhhhlLLLHhHEEELLL-HHHLLlhhHHHHHHH--HLLEEEELLLllll
Query WFRL-AHRVLDLveeeGADLrHTVLCHX-NPSHXdpvYQATLAQ--RGAFLEFDXIgxdf  267
ident        |||        ||   |  |   |           |       |  |      
Sbjct TNPEhIDRVLGD----FPDL-TVVSSHGnWPWVQ---EIIHVAFrrPNLYLSPDMY----  214
DSSP  HLHHhHHHHHHH----LLLL-LEEEEHHhLLLHH---HHHHHHHhlLLEEEELHHH----


DSSP  eelllleellLHHHHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhllLLLLHHHHLHHH
Query fyadqgvqcpSDDEVARAILGLADHGYLDRILLSHDVFVkxxltryggNGYAFVTKHFLP  327
ident                       |     || |                      |  || 
Sbjct ---------lYNLPGHADFIQAANSFLADRMLFGTAYPM---------CPLKEYTEWFLT  256
DSSP  ---------hLLLLLHHHHHHHHLLHHHHLLLLLLLLLL---------LLHHHHHHHHHL


DSSP  HhhhlLLLHHHHHHHHLHHHHHHHLLlllll
Query RlrrhGLDDAALETLXVTNPRRVFDAsiegh  358
ident           | |     |  |         
Sbjct L----PIKPDAMEKILHGNAERLLAQ--agr  281
DSSP  L----LLLHHHHHHHHLHHHHHHHHH--lll


No 25: Query=3k2gB Sbjct=2ffiA Z-score=15.8

back to top
DSSP  llllllllllllleeeelleeeehhHLLLEELLLLLL------eelHHHLlllllhhhhh
Query slselspchvrsgrixtvdgpipssALGHTLXHEHLQ------ndcRCWWnppqeperqy   54
ident                           |     | |           |             
Sbjct ------------------------lHLTAIDSHAHVFsrglnlasqRRYA----------   26
DSSP  ------------------------lLLLLEELLLLLLlhhhhhhllLLLL----------


DSSP  hhhllllhhhhhhhhllhhhllLLLEELlhhhHHHHHHHHHHLLLLEEEELL---lLLLL
Query laeapisieilselrqdpfvnkHNIALDdldlAIAEVKQFAAVGGRSIVDPT---cRGIG  111
ident                        |              |  | |    |           
Sbjct ----------------------PNYDAP----LGDYLGQLRAHGFSHGVLVQpsflGTDN   60
DSSP  ----------------------LLLLLL----HHHHHHHHHHLLLLEELLLLlhhhLLLL


DSSP  LL-HHHHHHHHhhhllEEEELLLLllhhhllhhhhlllhhhHHHHhHHHHHLLllllLLL
Query RD-PVKLRRISaetgvQVVXGAGYylassxpetaarlsaddIADEiVAEALEGtdgtDAR  170
ident |     |         |                           |  |   |        
Sbjct RYlLSALQTVP----gQLRGVVXL----------------eRDVE-QATLAEX---aRLG   96
DSSP  HHhHHHHHHLL----lLLLLLLLL----------------lLLLL-HHHHHHH---hLLL


DSSP  LLLEEeELLL-LLLLHhhHHHHHHHHHHHHHHLLLEEELLLLllLLHHHHHHHHHhLLLL
Query IGLIGeIGVS-SDFTAeeEKSLRGAARAQVRTGLPLXVHLPGwfRLAHRVLDLVEeEGAD  229
ident             |         |         |     |                     
Sbjct VRGVR-LNLXgQDXPDltGAQWRPLLERIGEQGWHVELHRQV--ADIPVLVRALQ-PYGL  152
DSSP  LLEEE-LLLLlLLLLLllLLLLHHHHHHHHHHLLEEEELLLL--LLHHHHHHHHL-LLLL


DSSP  hhHEEELL-LHHH---LLLH---HHHHHHHHHL-LEEEELLLLLLLeelllleelLLHHH
Query lrHTVLCH-XNPS---HXDP---VYQATLAQRG-AFLEFDXIGXDFfyadqgvqcPSDDE  281
ident     |  |   |               ||  ||        |                  
Sbjct --DIVIDHfGRPDarrGLGQpgfAELLTLSGRGkVWVKVSGIYRLQ-----gspeENLAF  205
DSSP  --LEEELHhHLLLlllLLLLllhHHHLLLLLLLlEEEEEELHHHLL-----llhhHHHHH


DSSP  HHHHHHHHHHLLLHHHEEELLLLL-LHHHlhhhLLLLLLHHHhLHHHHHHhllLLHHHHH
Query VARAILGLADHGYLDRILLSHDVF-VKXXltryGGNGYAFVTkHFLPRLRrhgLDDAALE  340
ident    |   |  |    |     |                          |           
Sbjct ARQALCALEAHYGAERLXWGSDWPhTQHE----SEVSFGSAV-EQFEALG---CSAQLRQ  257
DSSP  HHHHHHHHHHHLLHHHEEEELLLLlLLLL----LLLLHHHHH-HHHHHHL---LLHHHHH


DSSP  HHHLHHHHHHHLllllll
Query TLXVTNPRRVFDasiegh  358
ident  |     |  |       
Sbjct ALLLDTARALFG--fele  273
DSSP  HHHLHHHHHHLL--llll


No 26: Query=3k2gB Sbjct=1j6pA Z-score=15.7

back to top
DSSP  ------------------------llllllllllllleeeelleeeehhhlLLEELLLLL
Query ------------------------slselspchvrsgrixtvdgpipssalGHTLXHEHL   36
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH


DSSP  LEelhhhllllllhhhhhhhhllllhhhhhhHHLL---HHHLL-LLLE-----eLLHHHH
Query QNdcrcwwnppqeperqylaeapisieilseLRQD---PFVNK-HNIA-----lDDLDLA   87
ident                                           |   |             
Sbjct PX----------------------tllrgvaEDLSfeeWLFSKvLPIEdrltekXAYYGT   98
DSSP  HH----------------------hhhllllLLLLhhhHHHLLhHHHHllllhhHHHHHH


DSSP  HHHHHHHHHLLLLEEEELLlllllLLHHHHHHHHHHHLLEEEELLLLLlhhhllhhHHLL
Query IAEVKQFAAVGGRSIVDPTcrgigRDPVKLRRISAETGVQVVXGAGYYlassxpetAARL  147
ident |      |  |    ||                    |       |              
Sbjct ILAQXEXARHGIAGFVDXY-----FHEEWIAKAVRDFGXRALLTRGLV-------dSNGD  146
DSSP  HHHHHHHHLLLEEEEEEEE-----LLHHHHHHHHHHHLLEEEEEEEEL-------lLLLL


DSSP  lhhhhHHHHHHHHHllllllLLLL------LLEEEELLLllllhhHHHHHHHHHHHHHHH
Query saddiADEIVAEALegtdgtDARI------GLIGEIGVSsdftaeEEKSLRGAARAQVRT  201
ident        |                         |            |  |          
Sbjct -dggrLEENLKLYN------EWNGfegrifVGFGPHSPY----lcSEEYLKRVFDTAKSL  195
DSSP  -lllhHHHHHHHHH------HHLLhhhleeEEEEELLLL----llLHHHHHHHHHHHHHH


DSSP  LLLEEELLLLL---LLLHHHHHHHhhhllLLHH-HEEELLLHHHllLHHHHHHHHHHLLE
Query GLPLXVHLPGW---FRLAHRVLDLveeegADLR-HTVLCHXNPShxDPVYQATLAQRGAF  257
ident   |   ||             |             |   |         |   |     |
Sbjct NAPVTIHLYETskeEYDLEDILNI-----GLKEvKTIAAHCVHL--PERYFGVLKDIPFF  248
DSSP  LLLEEEEELLLlllLLLLHHHHLL-----LLLLlLEEEEELLLL--LHHHHHHHLLLLEE


DSSP  EEELLLLLLLEelllleELLLhhhhhhHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLL
Query LEFDXIGXDFFyadqgvQCPSddevarAILGLADHGYldRILLSHDVFVkxxltryggNG  317
ident                                   ||      |  |            | 
Sbjct VSHNPASNLKL------GNGI-----aPVQRXIEHGX--KVTLGTDGAA-------snNS  288
DSSP  EEELHHHHHHL------LLLL-----lLHHHHHHLLL--EEEELLLLLL-------llLL


DSSP  LLhHHHLHHHHHHHL------LLLHHHHHHHHLHHHHHHHL-------------------
Query YAfVTKHFLPRLRRH------GLDDAALETLXVTNPRRVFD-------------------  352
ident                       ||                                    
Sbjct LN-LFFEXRLASLLQkaqnprNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidl  347
DSSP  LL-HHHHHHHHHHHHhlllllLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeel


DSSP  ------------------------------------------------------llllll
Query ------------------------------------------------------asiegh  358
ident                                                             
Sbjct dlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  llhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 27: Query=3k2gB Sbjct=2imrA Z-score=15.7

back to top
DSSP  ----------------------------llllllllllllleeeelleeeehhhlLLEEL
Query ----------------------------slselspchvrsgrixtvdgpipssalGHTLX   32
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  LLLLLEELHHHLlllllhhhhhhhhllllhhhhhhHHLLHHhllLLLE-ELLHHHHHHHH
Query HEHLQNDCRCWWnppqeperqylaeapisieilseLRQDPFvnkHNIA-LDDLDLAIAEV   91
ident | ||                                             |     | |  
Sbjct HTHLDMSAYEFQ------------------alpyfQWIPEV--vIRGRhLRGVAAAQAGA  100
DSSP  EEELLLLHHHHH------------------hlhhhHLLHHH--hHHHLlLLHHHHHHHHH


DSSP  HHHHHLLLLEEEELLlllLLLL-HHHHHHHHhhhLLEEEELLlLLLHhhllhhHHLLlHH
Query KQFAAVGGRSIVDPTcrgIGRD-PVKLRRISaetGVQVVXGAgYYLAssxpetAARLsAD  150
ident       |     |             |                               ||
Sbjct DTLTRLGAGGVGDIV---WAPEvMDALLARE---DLSGTLYFeVLNP------FPDK-AD  147
DSSP  HHHHHLLLLLEEEEE---LLHHhHHHHHLLL---LLLEEEEEeELLL------LHHH-HH


DSSP  HHHHHHHHHHHLLlllLLLL----LLLEEEELLLllllhhHHHHHHHHHHHHHHHLLLEE
Query DIADEIVAEALEGtdgTDAR----IGLIGEIGVSsdftaeEEKSLRGAARAQVRTGLPLX  206
ident                                              |         |||| 
Sbjct EVFAAARTHLERW---RRLErpglRLGLSPHTPF----tvSHRLMRLLSDYAAGEGLPLQ  200
DSSP  HHHHHHHHHHHHH---HLLLllleEEEEEELLLL----llLHHHHHHHHHHHHHHLLLLE


DSSP  ELLLLLL--------------------------------------LLHHHHH-HHHHhll
Query VHLPGWF--------------------------------------RLAHRVL-DLVEeeg  227
ident  |                                                     |    
Sbjct IHVAEHPtelemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLGVL---  257
DSSP  EEELLLHhhhhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHLLH---


DSSP  llHHHEEELLLHHHllLHHHHHHHHHHLLEEEeLLLL-LLLEelllleELLLhhhhhhHH
Query adLRHTVLCHXNPShxDPVYQATLAQRGAFLEfDXIG-XDFFyadqgvQCPSddevarAI  286
ident        | |       |   |  |  |                     |          
Sbjct --AARPTLVHMVNV--TPDDIARVARAGCAVV-TCPRsNHHL------ECGT-----fDW  301
DSSP  --HHLLEEEELLLL--LHHHHHHHHHHLLLEE-ELHHhHHHL------LLLL-----lLH


DSSP  HHHHHLLLhhHEEELLLLLLhhhlhhhllLLLL--HHHHlHHHHHHHlLLLHHHHHHHHL
Query LGLADHGYldRILLSHDVFVkxxltryggNGYA--FVTKhFLPRLRRhGLDDAALETLXV  344
ident    |  |      |  |                       |   |   |||   |    |
Sbjct PAFAAAGV--EVALGTDSVA-------sgETLNvrEEVT-FARQLYP-GLDPRVLVRAAV  350
DSSP  HHHHHLLL--LEEELLLLHH-------hhLLLLlhHHHH-HHHHHLL-LLLHHHHHHHHH


DSSP  HHHHHHHL----------------llllll
Query TNPRRVFD----------------asiegh  358
ident     ||                        
Sbjct KGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  HHHHHHHLlllllllllllhhhlhhhllll


No 28: Query=3k2gB Sbjct=4rdvB Z-score=15.6

back to top
DSSP  ----------------------llllllllllllleeeelleeeehhhlLLEELLLLLLe
Query ----------------------slselspchvrsgrixtvdgpipssalGHTLXHEHLQn   38
ident                                                  |    | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAF-   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHH-


DSSP  elhhhllllllhhhhhhhhllllhhHHHH-----hhlLHHHLlLLLE-----eLLHHHHH
Query dcrcwwnppqeperqylaeapisieILSE-----lrqDPFVNkHNIA-----lDDLDLAI   88
ident                                                           | 
Sbjct ------------------qramaglAEVAgnpndsfwTWRELmYRMVarlspeQIEVIAC  101
DSSP  ------------------hhhhlllLLLLllllllhhHHHHHhHHHHllllhhHHHHHHH


DSSP  HHHHHHHHLLLLEEEELLLLL----------lllLHHHHHHHHHHHLLEEEELLLLLLHH
Query AEVKQFAAVGGRSIVDPTCRG----------igrDPVKLRRISAETGVQVVXGAGYYLAS  138
ident          |                              |     |         |   
Sbjct QLYIEMLKAGYTAVAEFHYVHhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHA  161
DSSP  HHHHHHHHHLEEEEEEEELLLllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEE


DSSP  H---llhhhhlllhhhHHHHHHHHHHLLLllLLLL----lLLEEEELLLllllhhHHHHH
Query S---xpetaarlsaddIADEIVAEALEGTdgTDAR----iGLIGEIGVSsdftaeEEKSL  191
ident                                                             
Sbjct GfggqpasegqrrfinGSEAYLELLQRLR--APLEaaghsLGLCFHSLR----avTPQQI  215
DSSP  EllleellhhhlllllLHHHHHHHHHHHH--HHHHhhlleELEEELLLL----llLHHHH


DSSP  HHHHHhhHHHL-LLEEELLLLLL------------LLHHHHHHHHHhlllLHHHEEELLL
Query RGAARaqVRTG-LPLXVHLPGWF------------RLAHRVLDLVEeegaDLRHTVLCHX  238
ident             ||   |                 |        |           | | 
Sbjct ATVLA--AGHDdLPVHIHIAEQQkevddcqawsgrRPLQWLYENVA----VDQRWCLVHA  269
DSSP  HHHHL--LLLLlLLEEEEELLLHhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEEL


DSSP  HHHllLHHHHHHHHHHLLEEEeLLLL-LLLEelllleELLLhhhhhhHHHHHHHLLLhhH
Query NPShxDPVYQATLAQRGAFLEfDXIG-XDFFyadqgvQCPSddevarAILGLADHGYldR  297
ident      ||   |  |  ||                                     |   |
Sbjct THA--DPAEVAAMARSGAVAG-LCLStEANL------GDGI-----fPATDFLAQGG--R  313
DSSP  LLL--LHHHHHHHHHHLLEEE-ELHHhHHHL------LLLL-----lLHHHHHHLLL--E


DSSP  EEELLLLllhhhlhhhllLLLLhhHHLHHHHHH---------HLLL-------LHHHHHH
Query ILLSHDVfvkxxltryggNGYAfvTKHFLPRLR---------RHGL-------DDAALET  341
ident      |                      |  |          |  |           |  
Sbjct LGIGSDS----------hVSLS--VVEELRWLEygqrlrdrkRNRLyrddqpmIGRTLYD  361
DSSP  EEELLLL----------lLLLL--HHHHHHHHHhhhhhhhllLLLLlllllllHHHHHHH


DSSP  HHLHHHHHH-HLLL----------------------------------------------
Query LXVTNPRRV-FDAS----------------------------------------------  354
ident                                                             
Sbjct AALAGGAQAlGQPIgslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvm  421
DSSP  HHHHHHHHHhLLLLlllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeee


DSSP  --------------------------llll
Query --------------------------iegh  358
ident                               
Sbjct vagrwvvrdgrhageersarafvqvlgell  451
DSSP  elleeeelllllllhhhhhhhhhhhhhhhl


No 29: Query=3k2gB Sbjct=4mupB Z-score=15.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL----eELHHHLlllllhhhhhhh
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQ----nDCRCWWnppqeperqyla   56
ident                            |      |                         
Sbjct -----------lvrklsgtapnpafprGAVDTQMHMYlpgypALPGGP------------   37
DSSP  -----------llllllllllllllllLLEELLLLLLlllllLLLLLL------------


DSSP  hllllhhhhhhhhllhhhllllLEELLHHHHHHHHHHHHH-LLLLEEEELL--llLLLLL
Query eapisieilselrqdpfvnkhnIALDDLDLAIAEVKQFAA-VGGRSIVDPT--crGIGRD  113
ident                                           |                 
Sbjct ----------------------GLPPGALPGPEDYRRLMQwLGIDRVIITQgnahQRDNG   75
DSSP  ----------------------LLLLLLLLLHHHHHHHHHhHLLLEEEEELlhhhLLLLH


DSSP  --HHHHHHHHhhhllEEEELLLlllhhhllhhhhlllhhhHHHHhHHHHHLLLlllLLLL
Query --PVKLRRISaetgvQVVXGAGyylassxpetaarlsaddIADEiVAEALEGTdgtDARI  171
ident                                          |          |    |  
Sbjct ntLACVAEMG----eAAHAVVI-----------------iDATTtEKDMEKLT---AAGT  111
DSSP  hhHHHHHHHH----hHEEEEEL-----------------lLLLLlHHHHHHHH---HLLE


DSSP  LLEEeELLLllllhhHHHHHHHHHHHHHHHLLLEEELLLLLLL-LHHHHHHHHHhllllh
Query GLIGeIGVSsdftaeEEKSLRGAARAQVRTGLPLXVHLPGWFR-LAHRVLDLVEeegadl  230
ident      |             |               |   |         |          
Sbjct VGAR-IMDL-pggavNLSELDAVDERAHAADWMVAVQFDGNGLlDHLPRLQKIR------  163
DSSP  EEEE-EELL-lllllLHHHHHHHHHHHHHLLLEEEEELLHHHHhHHHHHHHLLL------


DSSP  hHEEELLLHHH-------llLHHHHHHHHHHL-LEEEELLLLLLleelllleellLHHHH
Query rHTVLCHXNPS-------hxDPVYQATLAQRG-AFLEFDXIGXDffyadqgvqcpSDDEV  282
ident    |  |                    |  ||     |                     |
Sbjct sRWVFDHHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAGVYES------srkswPYADV  217
DSSP  lEEEELHHHHLllllllllhHHHHHHHHHHHLlEEEEELLHHHL------lllllLLHHH


DSSP  HHHHHHHHHlLLHHHEEELLLL-LLHHhlhHHLLLlllHHHHLHHHHHHhllLLHHHHHH
Query ARAILGLADhGYLDRILLSHDV-FVKXxltRYGGNgyaFVTKHFLPRLRrhgLDDAALET  341
ident |      |      ||                               |     | ||   
Sbjct AAFSRVIAA-HAPERIVWGTNWpHNSV-reTAAYP---DDARLAELTLG-wlPDEAARHR  271
DSSP  HHHHHHHHH-HLHHHEEELLLLlLLLL-llHHHLL---LHHHHHHHHHL-llLLHHHHHH


DSSP  HHLHHHHHHHLllllll
Query LXVTNPRRVFDasiegh  358
ident   | ||   |       
Sbjct ALVENPEALFK--lspv  286
DSSP  HHLHHHHHHHL--llll


No 30: Query=3k2gB Sbjct=2dvtA Z-score=15.3

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEEL---HHHLLllllhhhhhhhh
Query slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDC---RCWWNppqeperqylae   57
ident                            |     ||                         
Sbjct -------------------------mqGKVALEEH-FAIPetlQDSAG------------   22
DSSP  -------------------------llLEEEEEEE-ELLHhhhHHHLL------------


DSSP  llllhhhhhhhhllHHHL--LLLLE--ELLHhhHHHHHHHHHHLLLLEEEELL-------
Query apisieilselrqdPFVN--KHNIA--LDDLdlAIAEVKQFAAVGGRSIVDPT-------  106
ident                            | |        |   | |               
Sbjct --------------FVPGdyWKELQhrLLDI--QDTRLKLMDAHGIETMILSLnapavqa   66
DSSP  --------------LLLLlhHHHHHhhHHLL--LLHHHHHHHHLLEEEEEEEElllhhhh


DSSP  -----------lllllLLHHHHHHHHhhhlLEEEELLLLllhhhllhhhhlLLHHHHHHH
Query -----------crgigRDPVKLRRISaetgVQVVXGAGYylassxpetaarLSADDIADE  155
ident                                     |                 |    |
Sbjct ipdrrkaieiarrandVLAEECAKRP----DRFLAFAAL----------plQDPDAATEE  112
DSSP  lllhhhhhhhhhhhhhHHHHHHHHLL----LLEEEEELL----------llLLHHHHHHH


DSSP  HHHHHHLllllllLLLLLEEeELLL----llllHHHH--hhhHHHHHHHHHHLLLEEELL
Query IVAEALEgtdgtdARIGLIGeIGVS----sdftAEEE--kslRGAARAQVRTGLPLXVHL  209
ident                                           |           |   | 
Sbjct LQRCVND------LGFVGAL-VNGFsqegdgqtPLYYdlpqyRPFWGEVEKLDVPFYLHP  165
DSSP  HHHHHHL------LLLLEEE-EELLllllllllLLLLllhhhHHHHHHHHHHLLLEEEEL


DSSP  -----------------------LLLL--LLHHHHH-HHHH-HLLLLhhHEEELL-LHHH
Query -----------------------PGWF--RLAHRVL-DLVE-EEGADlrHTVLCH-XNPS  241
ident                                | |        |         | |     
Sbjct rnplpqdsriydghpwllgptwaFAQEtaVHALRLMaSGLFdEHPRL--NIILGHmGEGL  223
DSSP  llllhhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLLHHhHLLLL--LEEELHhHLLH


DSSP  LLLHH-------------------hhHHHHHHLLEEEELLLLllleelllleelllhhhH
Query HXDPV-------------------yqATLAQRGAFLEFDXIGxdffyadqgvqcpsddeV  282
ident                                                             
Sbjct PYMMWridhrnawvklpprypakrrfMDYFNENFHITTSGNF-----------------R  266
DSSP  HHHHHhhhhllllllllllllllllhHHHHHHHEEEELLLLL-----------------L


DSSP  HHHHHHHHHLLLHHHEEELLLLLLhhhlhhhllLLLLHHHhLHHHHHHhllLLHHHHHHH
Query ARAILGLADHGYLDRILLSHDVFVkxxltryggNGYAFVTkHFLPRLRrhgLDDAALETL  342
ident              |||| | |                                 |     
Sbjct TQTLIDAILEIGADRILFSTDWPF---------ENIDHAS-DWFNATS---IAEADRVKI  313
DSSP  HHHHHHHHLLLLHHHEELLLLLLL---------LLHHHHH-HHHHHLL---LLHHHHHHH


DSSP  HLHHHHHHHLLLllll
Query XVTNPRRVFDASiegh  358
ident   || || |       
Sbjct GRTNARRLFKLD----  325
DSSP  HLHHHHHHLLLL----


No 31: Query=3k2gB Sbjct=2uz9A Z-score=15.3

back to top
DSSP  ------------------------------------------llllllllllllleeeel
Query ------------------------------------------slselspchvrsgrixtv   18
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  leeeehhhlLLEELLLLLLE-------------------ELHHhllllllhhhhhhhhll
Query dgpipssalGHTLXHEHLQN-------------------DCRCwwnppqeperqylaeap   59
ident          |    | |                                           
Sbjct lshheffmpGLVDTHIHASQysfagssidlpllewltkyTFPA-----------------  103
DSSP  llllleeeeLEEEEEEEHHHhhhllllllllhhhhhhhlHHHH-----------------


DSSP  llhhhhhhhhllhhhllllleeLLHHHHHHHHHHHHhllLLEEEELLLLlllLLHHHHHH
Query isieilselrqdpfvnkhnialDDLDLAIAEVKQFAavgGRSIVDPTCRgigRDPVKLRR  119
ident                                                             
Sbjct -----------ehrfqnidfaeEVYTRVVRRTLKNG---TTTACYFATIhtdSSLLLADI  149
DSSP  -----------hhhhhlhhhhhHHHHHHHHHHHHLL---EEEEEEELLLlhhHHHHHHHH


DSSP  HHHHhLLEEEELLLLLLHH-----HLLHhhhlllHHHHHHHHHHHHHlLLLLLLL--lLL
Query ISAEtGVQVVXGAGYYLAS-----SXPEtaarlsADDIADEIVAEALeGTDGTDA--rIG  172
ident      |     |                            |                   
Sbjct TDKF-GQRAFVGKVCMDLNdtfpeYKET------TEESIKETERFVS-EMLQKNYsrvKP  201
DSSP  HHHH-LLEEEEELEELLLLlllllLLLL------HHHHHHHHHHHHH-HHHHHLLlleEE


DSSP  LEEEELLLllllhhHHHHHHHHHHHHHHHLLLEEELLLLLL--------------LLHHH
Query LIGEIGVSsdftaeEEKSLRGAARAQVRTGLPLXVHLPGWF--------------RLAHR  218
ident                |              |    |                        
Sbjct IVTPRFSL----scSETLMGELGNIAKTRDLHIQSHISENRdeveavknlypsykNYTSV  257
DSSP  EEEELLHH----hlLHHHHHHHHHHHHHHLLEEEEEELLLHhhhhhhhhhlllllLHHHH


DSSP  HHHHHhhllllHHHEEELLLHHHllLHHHHHHHHHHLLEEEELLLLLLLEelllleELLL
Query VLDLVeeegadLRHTVLCHXNPShxDPVYQATLAQRGAFLEFDXIGXDFFyadqgvQCPS  278
ident               ||  |                |||                      
Sbjct YDKNN----llTNKTVMAHGCYL--SAEELNVFHERGASIAHCPNSNLSL------SSGF  305
DSSP  HHHLL----llLLLEEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHL------LLLL


DSSP  hhhhhhHHHHHHHLLLhhHEEELLLLLlhhhlhhhllLLLL--HHHHlHHHHHHH-----
Query ddevarAILGLADHGYldRILLSHDVFvkxxltryggNGYA--FVTKhFLPRLRR-----  331
ident         |    |     | |  ||             |                    
Sbjct -----lNVLEVLKHEV--KIGLGTDVA--------ggYSYSmlDAIR-RAVMVSNillin  349
DSSP  -----lLHHHHHHLLL--EEEELLLLL--------llLLLLhhHHHH-HHHHHHHhhhhl


DSSP  ----LLLLHHHHHHHHLHHHHH-HHLLLL-------------------------------
Query ----HGLDDAALETLXVTNPRR-VFDASI-------------------------------  355
ident       |       |                                             
Sbjct kvneKSLTLKEVFRLATLGGSQaLGLDGEignfevgkefdailinpkasdspidlfygdf  409
DSSP  llllLLLLHHHHHHHHLHHHHHhLLLLLLllllllllllleeeelllllllllllllhhh


DSSP  --------------------------------lll
Query --------------------------------egh  358
ident                                    
Sbjct fgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  hlllllhhhhhhhhhllhhheeeeeelleeeelll


No 32: Query=3k2gB Sbjct=3e74A Z-score=15.1

back to top
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL
Query -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
ident                                                     |    | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LleelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleellhhHHHHHHHHHH
Query LqndcrcwwnppqeperqylaeapisieilselrqdpfvnkhnialddldLAIAEVKQFA   95
ident                                                            |
Sbjct I-------------------------------------------------GYETGTRAAA   71
DSSP  L-------------------------------------------------LHHHHHHHHH


DSSP  HLLLLEEEELLLllLLLL-------HHHHHH-HHHHHLLEEEE-LLLLllhhhllhhhhl
Query AVGGRSIVDPTCrgIGRD-------PVKLRR-ISAETGVQVVX-GAGYylassxpetaar  146
ident   |                                         |               
Sbjct KGGITTXIEXPL--NQLPatvdrasIELKFDaAKGKLTIDAAQlGGLV------------  117
DSSP  HLLEEEEEELLL--LLLLllllhhhHHHHHHhHLLLLLLEEEElEELL------------


DSSP  llhhHHHHHHHHHHHlllllllLLLLLEeEELLlllllhHHHHHHHHHHHHHHHHLLLEE
Query lsadDIADEIVAEALegtdgtdARIGLIgEIGVssdftaEEEKSLRGAARAQVRTGLPLX  206
ident        |                        |               |      | |  
Sbjct ---sYNIDRLHELDE-------VGVVGF-XCFV----rdVNDWQFFKGAQKLGELGQPVL  162
DSSP  ---lLLLLLHHHHHH-------HLLLLE-EEEL----llLLHHHHHHHHHHHHHHLLLEE


DSSP  ELLL------------------------------lLLLLHHHHHHHHHHLLLLhhhEEEL
Query VHLP------------------------------gWFRLAHRVLDLVEEEGADlrhTVLC  236
ident ||                                       ||| |    |        |
Sbjct VHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAKVAGCR---LHVC  219
DSSP  EELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHHHHLLL---EEEL


DSSP  LLhHHLLlhhHHHHHHHHL-----LEEEElLLLL-------------LLEElllleELLL
Query HXnPSHXdpvYQATLAQRG-----AFLEFdXIGX-------------DFFYadqgvQCPS  278
ident |   |                      |                                
Sbjct HV-SSPE---GVEEVTRARqegqdITCES-CPHYfvldtdqfeeigtLAKC---spPIRD  271
DSSP  LL-LLHH---HHHHHHHHHhllllEEEEE-LLHHhhllhhhhhhhlhHHLL---llLLLL


DSSP  ---HHHHHHHHHHHHhlllhhHEEELLLLLLHH--------hlhhhllLLLLHHHHLHHH
Query ---DDEVARAILGLAdhgyldRILLSHDVFVKX--------xltryggNGYAFVTKHFLP  327
ident                         |  |                     |          
Sbjct lenQKGXWEKLFNGE------IDCLVSDHSPCPpexkagnixkawggiAGLQSCXDVXFD  325
DSSP  hhhHHHHHHHHHLLL------LLEELLLLLLLLlllllllllllllllLLHHHHHHHHHH


DSSP  HHH-HLLLLHHHHHHHHLHHHHHHHL----------------------------------
Query RLR-RHGLDDAALETLXVTNPRRVFD----------------------------------  352
ident       |        || ||    |                                   
Sbjct EAVqKRGXSLPXFGKLXATNAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyr  385
DSSP  HHLlLLLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeeelllleellhhhllll


DSSP  --------------------------------------llllll
Query --------------------------------------asiegh  358
ident                                             
Sbjct hkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  llllllllleelleeeeeeelleeeeelllllllllllleelll


No 33: Query=3k2gB Sbjct=3griA Z-score=15.1

back to top
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL
Query -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
ident                                                     |    | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLEElhhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLhhHHHHHHHHHH
Query LQNDcrcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDldLAIAEVKQFA   95
ident |                                                       |  |
Sbjct LREP----------------------------------------GGEYkeTIETGTKAAA   80
DSSP  LLLL----------------------------------------LLLLllLHHHHHHHHH


DSSP  HLLLLEEEELLLlLLLL--------LHHHHHHHHhhhLLEEEELLL---LLLHhhllhhh
Query AVGGRSIVDPTCrGIGR--------DPVKLRRISaetGVQVVXGAG---YYLAssxpeta  144
ident   |                                   | |   |      |        
Sbjct RGGFTTVCPXPNtRPVPdsvehfeaLQKLIDDNA---QVRVLPYASittRQLG-------  130
DSSP  HLLEEEEEELLLlLLLLllhhhhhhHHHHHHHHL---LLEELLLEEllhHHLL-------


DSSP  hlllhHHHHhHHHHHHHlllllllLLLLLEEeELLLllllhHHHHHHHHHHHHHHHHLLL
Query arlsaDDIAdEIVAEALegtdgtdARIGLIGeIGVSsdftaEEEKSLRGAARAQVRTGLP  204
ident              |                                              
Sbjct -----KELV-DFPALVK-------EGAFAFT-DDGV---gvQTASXXYEGXIEAAKVNKA  173
DSSP  -----LLLL-LHHHHHL-------LLLLLEE-ELLL---llLLHHHHHHHHHHHHHHLLL


DSSP  EEELLL--------------------------lLLLL-HHHHHHHHHHLLLLhhhEEELL
Query LXVHLP--------------------------gWFRL-AHRVLDLVEEEGADlrhTVLCH  237
ident    |                                    |   | |  |        ||
Sbjct IVAHCEdnsliyggaxhegkrskelgipgipniCESVqIARDVLLAEAAGCH---YHVCH  230
DSSP  EEELLLlhhhllllleellhhhhhhllleellhHHHHhHHHHHHHHHHHLLL---EEELL


DSSP  LhHHLLlhhHHHHHHHHL-----LEEEElLLLL-------------LLEElllleELLLh
Query XnPSHXdpvYQATLAQRG-----AFLEFdXIGX-------------DFFYadqgvQCPSd  279
ident                           |                               | 
Sbjct V-STKE---SVRVIRDAKragihVTAEV-TPHHlllteddipgnnaIYKX---npPLRS-  281
DSSP  L-LLHH---HHHHHHHHHhllllEEEEE-LHHHhhllhhhlllllhHHLL---llLLLL-


DSSP  hhhHHHHHHHHHLLLhhHEEELLLLLLHH--------hlhhhlLLLLLHHHHLHHHHHH-
Query devARAILGLADHGYldRILLSHDVFVKX--------xltrygGNGYAFVTKHFLPRLR-  330
ident      | |     |         |                     |              
Sbjct tedREALLEGLLDGT--IDCIATDHAPHArdekaqpxekapfgIVGSETAFPLLYTHFVk  339
DSSP  hhhHHHHHHHHHLLL--LLEELLLLLLLLhhhhllllllllllLLLLLLHHHHHHHHHLl


DSSP  HLLLLHHHHHHHHLHHHHHHHLLL------------------------------------
Query RHGLDDAALETLXVTNPRRVFDAS------------------------------------  354
ident         |       |   |                                       
Sbjct NGDWTLQQLVDYLTIKPCETFNLEygtlkengyadltiidldseqeikgedflskadntp  399
DSSP  LLLLLHHHHHHHHLHHHHHHLLLLllllllllllleeeeelllleellhhhlllllllll


DSSP  -------------------llll
Query -------------------iegh  358
ident                        
Sbjct figykvygnpiltxvegevkfeg  422
DSSP  lllleelleeeeeeelleeeeel


No 34: Query=3k2gB Sbjct=1a4mA Z-score=15.0

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhHHLL-
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylAEAP-   59
ident                                 | ||                   |    
Sbjct ---------------------tpafnkPKVELHVHLDG-aikpetilyfgkkrgiALPAd   38
DSSP  ---------------------llllllLEEEEEEEHHH-lllhhhhhhhhhhhllLLLLl


DSSP  lLHHHH--hhHHLL------hhhlLLLL---------eellHHHHHHHHHHHHhllLLEE
Query iSIEIL--seLRQD------pfvnKHNI---------alddLDLAIAEVKQFAavgGRSI  102
ident    |                                                        
Sbjct tVEELRniigMDKPlslpgflakfDYYMpviagcreaikriAYEFVEMKAKEG---VVYV   95
DSSP  lHHHHHhhhlLLLLllhhhhhllhHHHHhhhlllhhhhhhhHHHHHHHHHHLL---EEEE


DSSP  EELLLLLLL------------------------lLHHHHHHHHHHHLLEEEELLLLLLHH
Query VDPTCRGIG------------------------rDPVKLRRISAETGVQVVXGAGYYLAS  138
ident                                       |       |  |          
Sbjct EVRYSPHLLanskvdpmpwnqtegdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMRHQ  155
DSSP  EEEELLHHHllllllllhhhlllllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEELLL


DSSP  hllhhhhlllhhHHHHHHHHHHHLLLllllLLLLLEEeELLL--LLLLhhHHHHHHHHHH
Query sxpetaarlsadDIADEIVAEALEGTdgtdARIGLIGeIGVS--SDFTaeEEKSLRGAAR  196
ident                 |                                        |  
Sbjct -----------pSWSLEVLELCKKYN---qKTVVAMD-LAGDetIEGS-sLFPGHVEAYE  199
DSSP  -----------hHHHHHHHHHHHHLL---lLLEEEEE-EELLllLLLH-hHLHHHHHHHH


DSSP  HHHHHLLLEEELLLLLLL--LHHHHHHHHHhllllhhhEEELLLHHHLLLHHHHHHHHHH
Query AQVRTGLPLXVHLPGWFR--LAHRVLDLVEeegadlrhTVLCHXNPSHXDPVYQATLAQR  254
ident   |  |    ||              |               |      |      |   
Sbjct GAVKNGIHRTVHAGEVGSpeVVREAVDILK-------tERVGHGYHTIEDEALYNRLLKE  252
DSSP  HHHHHLLEEEEEELLLLLhhHHHHHHHLLL-------lLEEEELHHHHHLHHHHHHHHHL


DSSP  LLEEEeLLLL-LLLEelllleELLL--hHHHHHHHHHHHhlllhHHEEELLLLlLHHHlh
Query GAFLEfDXIG-XDFFyadqgvQCPS--dDEVARAILGLAdhgylDRILLSHDVfVKXXlt  311
ident     |                                           |  |        
Sbjct NMHFE-VCPWsSYLT------GAWDpktTHAVVRFKNDK-----ANYSLNTDD-PLIF--  297
DSSP  LLEEE-ELHHhHHHL------LLLLlllLLHHHHHHHLL-----LLEEELLLL-LLLL--


DSSP  hhlLLLLLHHHHLHHHHHHhllLLHHHHHHHHlHHHHHH-HLLL-----------llll
Query rygGNGYAFVTKHFLPRLRrhgLDDAALETLXvTNPRRV-FDAS-----------iegh  358
ident                               |   |     |                  
Sbjct ---KSTLDTDYQMTKKDMG---FTEEEFKRLN-INAAKSsFLPEeekkellerlyreyq  349
DSSP  ---LLLHHHHHHHHHHLLL---LLHHHHHHHH-HHHHHLlLLLHhhhhhhhhhhhhhll


No 35: Query=3k2gB Sbjct=2ogjA Z-score=14.9

back to top
DSSP  -----------------------------llllllllllllleeeelleeeehhhlLLEE
Query -----------------------------slselspchvrsgrixtvdgpipssalGHTL   31
ident                                                         |   
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  LLLLLL--EELHhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleellhhhhhh
Query XHEHLQ--NDCRcwwnppqeperqylaeapisieilselrqdpfvnkhnialddldlaia   89
ident  | |                                                        
Sbjct LHVHIWhgGTDI----------------------------------------------si   74
DSSP  EEELLLllLLLL----------------------------------------------ll


DSSP  HHHH-HHHLLLLEEEE-LLLL--llllLHHH-HHHHhhhhLLEEEELLLLL--------l
Query EVKQ-FAAVGGRSIVD-PTCR--gigrDPVK-LRRIsaetGVQVVXGAGYY--------l  136
ident       |  |    ||                                            
Sbjct RPSEcGAERGVTTLVDaGSAGeanfhgFREYiIEPS----RERIKAFLNLGsiglvacnr  130
DSSP  LHHHlLHHHLEEEEEEeLLLLlllhhhHHHHlLLLL----LLEEEEEEELLlllllllll


DSSP  hHHLLhhHHLLlhhHHHHHHHHHHHLLLllllLLLLLEEeELLLLL-LLHHHHHHHHHHH
Query aSSXPetAARLsadDIADEIVAEALEGTdgtdARIGLIGeIGVSSD-FTAEEEKSLRGAA  195
ident                  | |     |        |        |                
Sbjct vPELR--DIKD---IDLDRILECYAENS----EHIVGLX-VRASHViTGSWGVTPVKLGK  180
DSSP  lLLLL--LHHH---LLHHHHHHHHHLLL----LLEEEEE-EEELHHhHLLLLLHHHHHHH


DSSP  HHHHHHLLLEEELLLllllLHHHHHHHHhhllllHHHEEELLLHH-----HLLLHH-HHH
Query RAQVRTGLPLXVHLPgwfrLAHRVLDLVeeegadLRHTVLCHXNP-----SHXDPV-YQA  249
ident         | |||      |   ||             |  |        | |       
Sbjct KIAKILKVPXXVHVGeppaLYDEVLEIL------GPGDVVTHCFNgksgsSIXEDEdLFN  234
DSSP  HHHHHHLLLEEEEELllllLHHHHHHHL------LLLLEEELLLLlllllLLLLLHhHHH


DSSP  HHHHH-LLEEEELLLLLlleelllleelllhhhHHHHHHHHHHLLLHhHEEELLLLLlHH
Query TLAQR-GAFLEFDXIGXdffyadqgvqcpsddeVARAILGLADHGYLdRILLSHDVFvKX  308
ident       |  |     |                            | |     | |     
Sbjct LAERCeGIRLDIGHGGA--------------sfSFKVAEAAIARGLL-PFSISTDLH-GH  278
DSSP  HHHHLlLLEEELLLLLL--------------llLHHHHHHHHHLLLL-LLLLLLLLL-LL


DSSP  HLhhhLLLLlLHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLL-------------
Query XLtryGGNGyAFVTkHFLPRLRRHGLDDAALETLXVTNPRRVFDASI-------------  355
ident                     |                ||  |                  
Sbjct SX---NFPV-WDLA-TTXSKLLSVDXPFENVVEAVTRNPASVIRLDXenrldvgqradft  333
DSSP  LL---LLLL-LLHH-HHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLLlllllllllleee


DSSP  -------------------------------------------lll
Query -------------------------------------------egh  358
ident                                               
Sbjct vfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 36: Query=3k2gB Sbjct=1itqA Z-score=14.8

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapi   60
ident                                 |  |                        
Sbjct -------------dffrdeaerimrdsPVIDGHNDLPW----------------------   25
DSSP  -------------lhhhhhhhhhhlllLEEEEEELHHH----------------------


DSSP  lhhhhhhhhllhhhlllllEELL---------hHHHH------hHHHHHHHLLLLEEEEL
Query sieilselrqdpfvnkhniALDD---------lDLAI------aEVKQFAAVGGRSIVDP  105
ident                     | |                           |         
Sbjct -------------------QLLDmfnnrlqderANLTtlagthtNIPKLRAGFVGGQFWS   66
DSSP  -------------------HHHHhhllllllhhHLLLlllllllLHHHHHHLLEEEEEEE


DSSP  LLLLL-----------llLHHHHHHHH---HHHL-----------------LEEEE-LLL
Query TCRGI-----------grDPVKLRRIS---AETG-----------------VQVVX-GAG  133
ident                         |      ||                  |       |
Sbjct VYTPCdtqnkdavrrtleQMDVVHRMCrmyPETFlyvtssagirqafregkVASLIgVEG  126
DSSP  ELLLHhhllllhhhhhhhHHHHHHHHHhhlLLLEeelllhhhhhhhhhlllEEEEEeEEL


DSSP  LLlhhhllhhhhlllhhHHHHHHHHHHHlllllllLLLLLeEEEL---------LLLL--
Query YYlassxpetaarlsadDIADEIVAEALegtdgtdARIGLiGEIG---------VSSD--  182
ident                         |                                   
Sbjct GH------------sidSSLGVLRALYQ-------LGMRY-LTLThscntpwadNWLVdt  166
DSSP  HH------------hllLLHHHHHHHHH-------LLEEE-EELLlllllllllLHHHll


DSSP  ----LLHHHHH-hHHHHHHHHHHHLLLEEELLllllllHHHHHHHHHHLlLLHHhEEEL-
Query ----FTAEEEK-sLRGAARAQVRTGLPLXVHLpgwfrlAHRVLDLVEEEgADLRhTVLC-  236
ident                       | |                                   
Sbjct gdsePQSQGLSpfGQRVVKELNRLGVLIDLAH-----vSVATMKATLQL-SRAP-VIFSh  219
DSSP  llllLLLLLLLhhHHHHHHHHHHHLLEEELLL-----lLHHHHHHHHHH-LLLL-LEELl


DSSP  LLHHHLLL-----hHHHHHHHHHL-LEEEELLllLLLEellllEELLLHHHHHHHHHHHH
Query HXNPSHXD-----pVYQATLAQRG-AFLEFDXigXDFFyadqgVQCPSDDEVARAILGLA  290
ident     |              |                               ||       
Sbjct SSAYSVCAsrrnvpDDVLRLVKQTdSLVMVNF--YNNY--iscTNKANLSQVADHLDHIK  275
DSSP  LLLLLLLLllllllHHHHHHHHHHlLEEEELL--LHHH--hllLLLLLHHHHHHHHHHHH


DSSP  HLLLHHHEEELLLL-LLHHHlhhhllLLLLHhHHLHHHHHHHLLLLHHHHHHHHLHHHHH
Query DHGYLDRILLSHDV-FVKXXltryggNGYAFvTKHFLPRLRRHGLDDAALETLXVTNPRR  349
ident             |   |                      | |     |        |  |
Sbjct EVAGARAVGFGGDFdGVPRV--peglEDVSK-YPDLIAELLRRNWTEAEVKGALADNLLR  332
DSSP  HHLLHHHEEELLLLlLLLLL--llllLLLLL-HHHHHHHHHHLLLLHHHHHHHHLHHHHH


DSSP  HHLL----------------------------lllll
Query VFDA----------------------------siegh  358
ident || |                                 
Sbjct VFEAveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHHHhhhllllllllllllllhhhlllllllllllll


No 37: Query=3k2gB Sbjct=4qrnA Z-score=14.7

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEEL--------------------
Query slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDC--------------------   40
ident                                  |                          
Sbjct -------------smtqdlktggeqgyLRIATEEA-FATReiidvylrmirdgtadkgmv   46
DSSP  -------------llllllllllllllLLEEEEEE-ELLHhhhhhhhhhhhhllllhhhh


DSSP  hHHLLllllhhhhhHHHLLLlhhhhhhhhllhhhLLLLL-EELL-HHHHHHHHHHHHhll
Query rCWWNppqeperqyLAEAPIsieilselrqdpfvNKHNI-ALDD-LDLAIAEVKQFAavg   98
ident   |                                      | |     ||         
Sbjct sLWGF-------yaQSPSER--------------ATQILeRLLDlGERRIADMDATG---   82
DSSP  hHHHH-------hhHLLLHH--------------HHHHHhHHHLlLHHHHHHHHHLL---


DSSP  LLEEEELL----------------lLLLL--LLHHHHHHHHhhhlLEEEELLLLllhhhl
Query GRSIVDPT----------------cRGIG--RDPVKLRRISaetgVQVVXGAGYylassx  140
ident                                                             
Sbjct IDKAILALtspgvqplhdldeartlATRAndTLADACQKYP----DRFIGMGTV------  132
DSSP  LLEEEEEEllllllllllhhhhhhhHHHHhhHHHHHHHHLL----LLEEELLLL------


DSSP  lhhhhlLLHHHHHHHHHHHHHLllllllLLLLLEEeELLLllLLHHHH--hhhHHHHHHH
Query petaarLSADDIADEIVAEALEgtdgtdARIGLIGeIGVSsdFTAEEE--kslRGAARAQ  198
ident             | ||   | |           |  |                    || 
Sbjct ----apQDPEWSAREIHRGARE------LGFKGIQ-INSH--TQGRYLdeeffDPIFRAL  179
DSSP  ----llLLHHHHHHHHHHHHHL------LLLLLEE-ELLL--LLLLLLllhhhHHHHHHH


DSSP  HHHLLLEEELL----------------------LLLL--LLHHHHH-HHHH-HLLLLhhH
Query VRTGLPLXVHL----------------------PGWF--RLAHRVL-DLVE-EEGADlrH  232
ident |    ||  |                        |        |                
Sbjct VEVDQPLYIHPatspdsmidpmleagldgaifgFGVEtgMHLLRLItIGIFdKYPSL--Q  237
DSSP  HHHLLLEEELLllllllllhhhhhhlllllllhHHHHhhHHHHHHHhHLHHhHLLLL--L


DSSP  EEELLLHHHL-LLHH-----------------------hhHHHHHHLLEEEELLLLllle
Query TVLCHXNPSH-XDPV-----------------------yqATLAQRGAFLEFDXIGxdff  268
ident     |                                                       
Sbjct IMVGHMGEALpYWLYrldymhqagvrsqryermkplkktiEGYLKSNVLVTNSGVA----  293
DSSP  EEELHHHHLHhHHHHhhhhhhhhhhhlllllllllllllhHHHHHHLEEEELLLLL----


DSSP  elllleelllhhhHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhlllLLLHHHHLHHHH
Query yadqgvqcpsddeVARAILGLADHGYLDRILLSHDVFVkxxltryggnGYAFVTKHFLPR  328
ident                 ||         ||     |               |         
Sbjct -------------WEPAIKFCQQVMGEDRVMYAMDYPY---------qYVADEVRAMDAM  331
DSSP  -------------LHHHHHHHHHHHLHHHEELLLLLLL---------lLLHHHHHHHHLL


DSSP  hhhlLLLHHHHHHHHLHHHHHHHLllllll
Query lrrhGLDDAALETLXVTNPRRVFDasiegh  358
ident                 ||    |       
Sbjct ----DMSAQTKKKFFQTNAEKWFK-----l  352
DSSP  ----LLLHHHHHHHHLHHHHHHLL-----l


No 38: Query=3k2gB Sbjct=3pnuA Z-score=14.5

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeapi   60
ident                                 | ||                        
Sbjct --------------enlyfqsnamklkNPLDMHLHLR-----------------------   23
DSSP  --------------llllllllleeeeLLEEEEELLL-----------------------


DSSP  lhhhhhhhhllhhhllllleelLHHHHHHHHHHHHHlLLLEEEELLLlLLLL-----LHH
Query sieilselrqdpfvnkhnialdDLDLAIAEVKQFAAvGGRSIVDPTCrGIGR-----DPV  115
ident                       |           |       |                 
Sbjct ----------------------DNQMLELIAPLSAR-DFCAAVIMPNlIPPLcnledLKA   60
DSSP  ----------------------LHHHHHHHHHHHHL-LLLEEEELLLlLLLLllhhhHHH


DSSP  HHHHHHHHH---LLEEEELLLLllhhhllhhhhlllhhHHHH-HHHHHHHllllllllLL
Query KLRRISAET---GVQVVXGAGYylassxpetaarlsadDIAD-EIVAEALegtdgtdaRI  171
ident    ||                                                      |
Sbjct YKMRILKACkdeNFTPLMTLFF---------------kNYDEkFLYSAKD--------EI   97
DSSP  HHHHHHHHHlllLLEEEEEEEL---------------lLLLHhHHHHHLL--------LL


DSSP  LLEEeELLL--------llLLHHhHHHHHHHHHHHHHHLLLEEELLL-------lLLLLH
Query GLIGeIGVS--------sdFTAEeEKSLRGAARAQVRTGLPLXVHLP-------gWFRLA  216
ident   |                        |     |      || ||              |
Sbjct FGIX-LYPAgittnsnggvSSFD-IEYLKPTLEAMSDLNIPLLVHGEtndfvmdrESNFA  155
DSSP  LEEE-ELLLllllllllllLLLL-HHHHHHHHHHHHHLLLLEEELLLllllhhhlLHHHH


DSSP  HHHHHHHHHLLLLhhHEEELLLHHhlllHHHHHHHHHHL-LEEEElLLLL--LLEE----
Query HRVLDLVEEEGADlrHTVLCHXNPshxdPVYQATLAQRG-AFLEFdXIGX--DFFY----  269
ident      |           |  |             |                         
Sbjct KIYEKLAKHFPRL--KIVMEHITT----KTLCELLKDYEnLYATI-TLHHliITLDdvig  208
DSSP  HHHHHHHHHLLLL--LEEELLLLL----HHHHHHHHHLLlEEEEE-LLHHhlLLHHhhhl


DSSP  ------lllleELLLhhhhhHHHHHHhhlllHHHEEELLLLLLHHhlhhhlLLLLLHHHH
Query ------adqgvQCPSddevaRAILGLadhgyLDRILLSHDVFVKXxltrygGNGYAFVTK  323
ident                      |   |             |                    
Sbjct gkmnphlfckpIAKR-yedkEALCEL-afsgYEKVMFGSDSAPHPkgcaagVFSAPVILP  266
DSSP  llllhhhllllLLLL-hhhhHHHHHH-hhllLLLEEELLLLLLLLllllllLLLHHHHHH


DSSP  LHHHHHHHLlLLHHHHHHHHLHHHHHHHL-------------------------------
Query HFLPRLRRHgLDDAALETLXVTNPRRVFD-------------------------------  352
ident                |      |     |                               
Sbjct VLAELFKQN-SSEENLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvp  325
DSSP  HHHHHHHHH-LLHHHHHHHHLHHHHHHHLllllllleeeeellleelllleelllleell


DSSP  -------llllll
Query -------asiegh  358
ident              
Sbjct ymageilkfqlkh  338
DSSP  llllleelleell


No 39: Query=3k2gB Sbjct=1a5kC Z-score=14.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----------------------------------------llllllllllllleeeelle
Query ----------------------------------------slselspchvrsgrixtvdg   20
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  eeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllle
Query pipssalGHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkhnia   80
ident        |    | |                                             
Sbjct egkivtaGGIDTHIHWI-------------------------------------------  137
DSSP  llleeeeLEEEEEEELL-------------------------------------------


DSSP  ellhhhHHHHHHHHHHLLLLEEEE------------LLLLlllLLHHHHHHhHHHHLLEE
Query lddldlAIAEVKQFAAVGGRSIVD------------PTCRgigRDPVKLRRiSAETGVQV  128
ident                  |    |                         |        |  
Sbjct ------CPQQAEEALVSGVTTMVGggtgpaagthatTCTPgpwYISRMLQA-ADSLPVNI  190
DSSP  ------LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLLhhhHHHHHHHH-HLLLLLEE


DSSP  EELLLLLlhhhllhhhhlllHHHHhHHHHHHHHlllllllLLLLLEEeELLLllllhhHH
Query VXGAGYYlassxpetaarlsADDIaDEIVAEALegtdgtdARIGLIGeIGVSsdftaeEE  188
ident                          |              |       |           
Sbjct GLLGKGN-------------VSQP-DALREQVA-------AGVIGLE-IHED---wgaTP  225
DSSP  EEEEELL-------------LLLH-HHHHHHHH-------HLLLEEE-EEHH---hllLH


DSSP  HHHHHHHHHHHHHLLLEEELLLLLL--lLHHHHHHHHhhlLLLHhhEEELLLHH--hlll
Query KSLRGAARAQVRTGLPLXVHLPGWF--rLAHRVLDLVeeeGADLrhTVLCHXNP--shxd  244
ident      |             |             |      |         |         
Sbjct AAIDCALTVADEMDIQVALHSDTLNesgFVEDTLAAI---GGRT--IHTFHTEGagggha  280
DSSP  HHHHHHHHHHHHHLLEEEEELLLLLlllLHHHHHHHH---LLLL--EEELLLLLllllll


DSSP  hHHHHhHHHH-LLEEEElLLLL---------LLEE---------------LLLL-EELL-
Query pVYQAtLAQR-GAFLEFdXIGX---------DFFY---------------ADQG-VQCP-  277
ident                                                             
Sbjct pDIIT-ACAHpNILPSS-TNPTlpytlntidEHLDmlmvchhldpdiaedVAFAeSRIRr  338
DSSP  lLHHH-HHHLlLEEEEE-EHHHllllllhhhHHHHhhhhhhllllllhhhHHLLlLLLLh


DSSP  -LHHHHHHHHHHHHhlllhhhEEELLLLLLhhhlhhhlllLLLHHHHLHHHHHHHLL---
Query -SDDEVARAILGLAdhgyldrILLSHDVFVkxxltryggnGYAFVTKHFLPRLRRHG---  333
ident              |        | | |                 |         |     
Sbjct eTIAAEDVLHDLGA------fSLTSSDSQA--------mgRVGEVILRTWQVAHRMKvqr  384
DSSP  hHHHHHHHHHHLLL------lLEEELLLLL--------llLLLLHHHHHHHHHHHHHhhh


DSSP  ------------lLHHHHHHHHLHHHHHHHL-----------------------------
Query ------------lDDAALETLXVTNPRRVFD-----------------------------  352
ident                         ||                                  
Sbjct galaeetgdndnfRVKRYIAKYTINPALTHGiahevgsievgkladlvvwspaffgvkpa  444
DSSP  lllllllllllhhHHHHHHHLLLHHHHHHLLllllllllllllllleeeelhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct tvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerl  504
DSSP  eeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhl


DSSP  ---------------llLLLL---------------------------------------
Query ---------------asIEGH---------------------------------------  358
ident                                                             
Sbjct nlrsaiavvkgcrtvqkADMVhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryf  564
DSSP  lllleeeellllllllhHHLLllllllleeelllllleeelleellllllllllllllll


DSSP  --
Query --  358
ident   
Sbjct lf  566
DSSP  ll


No 40: Query=3k2gB Sbjct=4ofcA Z-score=14.2

back to top
DSSP  llllllllllllleeeelleeeehhhllLEELLLLLLEE---------------------
Query slselspchvrsgrixtvdgpipssalgHTLXHEHLQND---------------------   39
ident                                 | |                         
Sbjct ---------------------------mKIDIHSHILPKewpdlkkrfgyggwvqlqhhs   33
DSSP  ---------------------------lLEEEEEELLLLllllhhhhhllllleeeeeee


DSSP  --lHHHLLLLllhhhhhhhhllllhhhhhhhhllhhHLLLLLE-ELLHHHHHHHHHHHHh
Query --cRCWWNPPqeperqylaeapisieilselrqdpfVNKHNIA-LDDLDLAIAEVKQFAa   96
ident                                     |         |    | |  |   
Sbjct kgeAKLLKDG-------------------------kVFRVVREnCWDPEVRIREMDQKG-   67
DSSP  lleEEEEELL-------------------------eEEEEEEHhHLLHHHHHHHHHHHL-


DSSP  llLLEEEELL------------------lllllLLHHHHHHHHhhhlLEEEELLLLllhh
Query vgGRSIVDPT------------------crgigRDPVKLRRISaetgVQVVXGAGYylas  138
ident          |                                        |         
Sbjct --VTVQALSTvpvmfsywakpedtlnlcqllnnDLASTVVSYP----RRFVGLGTL----  117
DSSP  --LLEEEEELlhhhhlllllhhhhhhhhhhhhhHHHHHHHHLL----LLEEEEELL----


DSSP  hllhhhhlLLHHHHHHHHHHHHHLllllllLLLLLEEeELLLllLLHH---HHHHhHHHH
Query sxpetaarLSADDIADEIVAEALEgtdgtdARIGLIGeIGVSsdFTAE---EEKSlRGAA  195
ident                 |      |              ||                    
Sbjct ------pmQAPELAVKEMERCVKE------LGFPGVQ-IGTH--VNEWdlnAQEL-FPVY  161
DSSP  ------llLLHHHHHHHHHHHHHL------LLLLEEE-EELE--ELLEellLHHH-HHHH


DSSP  HHHHHHLLLEEELL-------------------LLLL--LLHHHHH-HHHHHLLLLHhHE
Query RAQVRTGLPLXVHL-------------------PGWF--RLAHRVL-DLVEEEGADLrHT  233
ident  |  |    | ||                                    | |    |   
Sbjct AAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttIAICSMImGGVFEKFPKL-KV  220
DSSP  HHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhHHHHHHHlLLHHHHLLLL-LE


DSSP  EELL-LHHHLLLHH-------------------hhhHHHHhLLEEEELLLlllleellll
Query VLCH-XNPSHXDPV-------------------yqaTLAQrGAFLEFDXIgxdffyadqg  273
ident    |                                                        
Sbjct CFAHgGGAFPFTVGrishgfsmrpdlcaqdnpmnpkKYLG-SFYTDALVH----------  269
DSSP  EELHhHLLHHHHHHhhhhhhhhlhhhhlllllllhhHHLL-LLEEELLLL----------


DSSP  eelllHHHHHHHHHHHhhllLHHHEEELLLLLLhhhlhhhlllllLHHHhLHHHHHHhlL
Query vqcpsDDEVARAILGLadhgYLDRILLSHDVFVkxxltryggngyAFVTkHFLPRLRrhG  333
ident      |                |   |  |                              
Sbjct -----DPLSLKLLTDV---iGKDKVILGTDYPF--------plgeLEPG-KLIESME--E  310
DSSP  -----LHHHHHHHHHH---hLLLLEELLLLLLL--------llllLLLL-HHHHHLL--L


DSSP  LLHHHHHHHHLHHHHHHHLllllll
Query LDDAALETLXVTNPRRVFDasiegh  358
ident  |      |   |            
Sbjct FDEETKNKLKAGNALAFLGlerkqf  335
DSSP  LLHHHHHHHHLHHHHHHHLllhhhl


No 41: Query=3k2gB Sbjct=3qy6A Z-score=14.2

back to top
DSSP  llllllllllllleeeelleeeehhhllLEELLLLL-LEELhhhllllllhhhhhhhhll
Query slselspchvrsgrixtvdgpipssalgHTLXHEHL-QNDCrcwwnppqeperqylaeap   59
ident                                 | |                         
Sbjct ----------------------------MIDIHCHIlPAMD-------------------   13
DSSP  ----------------------------LEELLLLLlLLLL-------------------


DSSP  llhhhhhhhhllhhhllllleELLHHHHHHHHHHHHHLLLLEEEELLL-----LLLL--L
Query isieilselrqdpfvnkhniaLDDLDLAIAEVKQFAAVGGRSIVDPTC-----RGIG--R  112
ident                        |    |         | | |                 
Sbjct -------------------dgAGDSADSIEMARAAVRQGIRTIIATPHhnngvYKNEpaA   54
DSSP  -------------------llLLLHHHHHHHHHHHHHLLLLEEELLLEellllLLLLhhH


DSSP  LHHHHHHHHHHH-----LLEEEELlllllhhhllhhhhlllhhhhhhhhhhhhhllllll
Query DPVKLRRISAET-----GVQVVXGagyylassxpetaarlsaddiadeivaealegtdgt  167
ident                     |  |                                    
Sbjct VREAADQLNKRLikediPLHVLPG------------------------------------   78
DSSP  HHHHHHHHHHHHhhlllLLEEELL------------------------------------


DSSP  lllllleEEELLlllllhhhhhhHHHHHHHHHHH-------lLLEEELLLLLLLLhHHHH
Query darigliGEIGVssdftaeeeksLRGAARAQVRT-------gLPLXVHLPGWFRLaHRVL  220
ident         ||                                       |          
Sbjct -------QEIRI-----------YGEVEQDLAKRqllslndtKYILIEFPFDHVP-RYAE  119
DSSP  -------LEEEL-----------LLLHHHHHHLLllllhhhlLEEEEELLLLLLL-LLHH


DSSP  HHHHH--LLLLhhHEEELLLHH---HLLLHHHHHHHHHHLLEEEElLLLLlleellllee
Query DLVEE--EGADlrHTVLCHXNP---SHXDPVYQATLAQRGAFLEFdXIGXdffyadqgvq  275
ident  |             |  |          |     |   ||       |           
Sbjct QLFYDlqLKGY--IPVIAHPERnreIRENPSLLYHLVEKGAASQI-TSGS----lagifg  172
DSSP  HHHHHhhHLLL--EEEEELHHHlhhHHHLLHHHHHHHHLLLEEEE-EHHH----hlllll


DSSP  lLLHHHHHHHHHHHhhlllhhHEEELLLLllhhHLHHhlLLLLlHHHHlHHHHHHHLlLL
Query cPSDDEVARAILGLadhgyldRILLSHDVfvkxXLTRygGNGYaFVTKhFLPRLRRHgLD  335
ident         |                  |                      |  |      
Sbjct kQLKAFSLRLVEAN------lIHFVASDA----HNVK--TRNF-HTQE-ALYVLEKE-FG  217
DSSP  hHHHHHHHHHHHLL------lLLEEELLL----LLLL--LLLL-LHHH-HHHHHHHH-HL


DSSP  HHHHHHHHlHHHHHHH-LLLLLLL-------
Query DAALETLXvTNPRRVF-DASIEGH-------  358
ident       |   |         |          
Sbjct SELPYMLT-ENAELLLrNQTIFRQppqpvkr  247
DSSP  LHHHHHHH-HHHHHHHlLLLLLLLlllllll


No 42: Query=3k2gB Sbjct=3icjA Z-score=14.2

back to top
DSSP  ---------------------------------llllllllllllleeeelleeeehhhl
Query ---------------------------------slselspchvrsgrixtvdgpipssal   27
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEELLLLLLE-----------elhhhllllllhhhhhhhhlLLLHH-------------
Query GHTLXHEHLQN-----------dcrcwwnppqeperqylaeaPISIE-------------   63
ident      | ||                                                   
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriiFGFGWdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleEEEEElhhhhlllllhhh


DSSP  ----------HHHHH-----------------------------------hllhhhllll
Query ----------ILSEL-----------------------------------rqdpfvnkhn   78
ident                                                             
Sbjct ldvidrpvflYRRCFhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeEELLLleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  leeLLHHHHHHHHHHHHHLLLLEEEELLLLllllLHHHHHHHH--HHHLLEEEELLLLll
Query ialDDLDLAIAEVKQFAAVGGRSIVDPTCRgigrDPVKLRRIS--AETGVQVVXGAGYyl  136
ident    |               |  |               |            |        
Sbjct tvkDYKHYIESAQEHLLSLGVHSVGFMSVG--ekALKALFELEreGRLKMNVFAYLSP--  236
DSSP  lhhHHHHHHHHHHHHHHHLLEEEEEEEEEL--hhHHHHHHHHHhlLLLLLEEEEEELH--


DSSP  hhhllhhhhlllhhhhhhHHHHHHHLL----lllllllLLLEEeELLL------------
Query assxpetaarlsaddiadEIVAEALEG----tdgtdarIGLIGeIGVS------------  180
ident                   |      |            |       |             
Sbjct ------------------ELLDKLEELnlgkfegrrlrIWGVX-LFVDgslgartallse  277
DSSP  ------------------HHHHHHHHHlllleellleeEEEEE-EELLllllllllllll


DSSP  ---------LLLLhhHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHHHHHHHHHlLLLHh
Query ---------SDFTaeEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHRVLDLVEEeGADLr  231
ident                               ||   ||           ||  ||      
Sbjct pytdnpttsGELV-mNKDEIVEVIERAKPLGLDVAVHA-IGDKAVDVALDAFEE-AEFS-  333
DSSP  lllllllllLLLL-lLHHHHHHHHHHHLLLLLEEEEEE-LLHHHHHHHHHHHHH-HLLL-


DSSP  hEEELLLHHHllLHHHHHHHHHHLLEEEElLLLL--LLEElLLLEelllhhhhhhHHHHH
Query hTVLCHXNPShxDPVYQATLAQRGAFLEFdXIGX--DFFYaDQGVqcpsddevarAILGL  289
ident      |                                      |              |
Sbjct -GRIEHASLV--RDDQLERIKELKVRISA-QPHFivSDWWiVNRV-geerakwayRLKTL  388
DSSP  -LEEEELLLL--LHHHHHHHHHHLLEEEE-LLLHhhHLLLhHHHH-hhhhhhhllLHHHH


DSSP  HhllLHHHEEELLLLLlhhhlhhhllLLLLhhHHLHHHHHHHL-------LLLHHHHHHH
Query AdhgYLDRILLSHDVFvkxxltryggNGYAfvTKHFLPRLRRH-------GLDDAALETL  342
ident            | |                                             |
Sbjct S---SITKLGFSTDSP---------iEPAD--PWVSIDAAVNRyvvdpgeRVSREEALHL  434
DSSP  H---HHLLEEELLLLL---------lLLLL--HHHHHHHHHHLllllhhhLLLHHHHHHH


DSSP  HLHHHHHH-HLLL-----------------llll
Query XVTNPRRV-FDAS-----------------iegh  358
ident        |                          
Sbjct YTHGSAQVtLAEDlgklergfraeyiildrdplk  468
DSSP  LLHHHHHHlLLLLllllllllllleeeellllll


No 43: Query=3k2gB Sbjct=1j5sA Z-score=13.7

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL--------------------eel
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQ--------------------ndc   40
ident                                 | ||                        
Sbjct --hmflgedylltnraavrlfnevkdlPIVDPHNHLDakdivenkpwndiwevegatdhy   58
DSSP  --llllllllllllhhhhhhhhhhlllLEEELLLLLLhhhhhhllllllhhhhhllllhh


DSSP  hhhllLLLLhhHHHHHH--LLLL--HHHHHH-----------------------------
Query rcwwnPPQEpeRQYLAE--APIS--IEILSE-----------------------------   67
ident                             |                               
Sbjct vwelmRRCG-vSEEYITgsRSNKekWLALAKvfprfvgnptyewihldlwrrfnikkvis  117
DSSP  hhhhhHHLL-lLHHHLLllLLHHhhHHHHHHhhhhhlllhhhhhhhhhhhhhllllllll


DSSP  hhllhhhllllleellhhHHHHHHHHHHhllLLEEEELLLLlllLLHHHHHHHH-HHHLL
Query lrqdpfvnkhnialddldLAIAEVKQFAavgGRSIVDPTCRgigRDPVKLRRIS-AETGV  126
ident                                                   |    |  ||
Sbjct eetaeeiweetkkklpemTPQKLLRDMK---VEILCTTDDP--vSTLEHHRKAKeAVEGV  172
DSSP  hhhhhhhhhhhhhhllllLHHHHHHHLL---EEEEELLLLL--lLLLHHHHHHHhHLLLL


DSSP  EEEELLLLL--LHHH--lLHHHHL--------------lLHHHHHHHHHHHHHlllllll
Query QVVXGAGYY--LASS--xPETAAR--------------lSADDIADEIVAEALegtdgtd  168
ident                                                             
Sbjct TILPTWRPDraMNVDkegWREYVEkmgerygedtstldgFLNALWKSHEHFKE-------  225
DSSP  EEELLLLLHhhHLLLlllHHHHHHhhhhhhllllllhhhHHHHHHHHHHHHHL-------


DSSP  LLLLLEeEELLLL---------------------------llLHHHHHHHHHHHHHHHHH
Query ARIGLIgEIGVSS---------------------------dfTAEEEKSLRGAARAQVRT  201
ident                                                            |
Sbjct HGCVAS-DHALLEpsvyyvdenraravhekafsgekltqdeiNDYKAFMMVQFGKMNQET  284
DSSP  LLLLEE-EEEELLlllllllhhhhhhhhhhhlllllllhhhhHHHHHHHHHHHHHHHHHH


DSSP  LLLEEELLLL-----------------------lLLLHHHHHHHHHH-LLLLhhHEEELL
Query GLPLXVHLPG-----------------------wFRLAHRVLDLVEE-EGADlrHTVLCH  237
ident       |                            | |        |  |      ||  
Sbjct NWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAEGLRYFLNEfDGKL--KIVLYV  342
DSSP  LLEEEEEELEellllhhhhhhlllllllleelllLLHHHHHHHHHHHlLLLL--LEEEEE


DSSP  lhHHLLLHHHHHHHHHHL--LEEEEllllllleelllleeLLLH-HHHHHHHHHHHHLLL
Query xnPSHXDPVYQATLAQRG--AFLEFdxigxdffyadqgvqCPSD-DEVARAILGLADHGY  294
ident             | |                                       ||    
Sbjct --LDPTHLPTISTIARAFpnVYVGA------------pwwFNDSpFGMEMHLKYLASVDL  388
DSSP  --LLHHHHHHHHHHHHHLllEEELL------------lllLLLLhHHHHHHHHHHHLLLL


DSSP  HHHE-EELLLLLLhhhlhhhllLLLLHHHHLHHHHHHHLL------------lLHHHHHH
Query LDRI-LLSHDVFVkxxltryggNGYAFVTKHFLPRLRRHG------------lDDAALET  341
ident |        |                  |  |   |                        
Sbjct LYNLaGMVTDSRK--------lLSFGSRTEMFRRVLSNVVgemvekgqipikeARELVKH  440
DSSP  HHHLlLLLLLLLL--------lLHHHHHHHHHHHHHHHHHhhhhhlllllhhhHHHHHHH


DSSP  HHLHHHHHHHLllllll
Query LXVTNPRRVFDasiegh  358
ident      |   |       
Sbjct VSYDGPKALFF------  451
DSSP  HHLHHHHHHHL------


No 44: Query=3k2gB Sbjct=2gwgA Z-score=13.7

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEElhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNDcrcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ---------------------------XIIDIHGHYTTA-------pkaledwrnrqiag   26
DSSP  ---------------------------LLEEEEEELLLL-------lhhhhhhhhhhhhh


DSSP  lhhhhhhhhllhhhllllleeLLHHHH-HHHHHHHHhllLLEEEELL----------llL
Query sieilselrqdpfvnkhnialDDLDLA-IAEVKQFAavgGRSIVDPT----------crG  109
ident                                            |                
Sbjct ikdpsvxpkvselkisddelqASIIENqLKKXQERG---SDLTVFSPragdfnvsstwaA   83
DSSP  hhlhhhlllhhhllllhhhhhHHHHLLhHHHHHHHL---LLEEEEELllllhhhhhhhhH


DSSP  LLL--LHHHHHHHHhhhlLEEEELLLLllhhhllhhHHLLLHHHHHHHHHHHHHLlllll
Query IGR--DPVKLRRISaetgVQVVXGAGYylassxpetAARLSADDIADEIVAEALEgtdgt  167
ident |                       |                      |      |     
Sbjct ICNelCYRVSQLFP----DNFIGAAXL-------pqSPGVDPKTCIPELEKCVKE-----  127
DSSP  HHHhhHHHHHHHLL----LLEEEEEEL-------llLLLLLHHHHHHHHHHHHHL-----


DSSP  lLLLLLEEeELLL----lLLLH--hHHHHhHHHHHHHHHHLLLEEEL-----lLLLL--L
Query dARIGLIGeIGVS----sDFTA--eEEKSlRGAARAQVRTGLPLXVH-----lPGWF--R  214
ident       |                              |    | | |             
Sbjct -YGFVAIN-LNPDpsgghWTSPpltDRIW-YPIYEKXVELEIPAXIHvstgahYLNAdtT  184
DSSP  -LLLLEEE-ELLLlllllLLLLlllLHHH-HHHHHHHHHHLLLEEELlllllhHHHHhhH


DSSP  LHHHH-hHHHHHLLLLHhHEEELL-LHHHLLLHH-------------hhhHHHHhLLEEE
Query LAHRV-lDLVEEEGADLrHTVLCH-XNPSHXDPV-------------yqaTLAQrGAFLE  259
ident                 |   |  |                                 |  
Sbjct AFXQCvaGDLFKDFPEL-KFVIPHgGGAVPYHWGrfrglaqexkkplledHVLN-NIFFD  242
DSSP  HHHHHhhLLHHHHLLLL-LEEELHhHLLLHHHHHhhhhhhhhlllllhhhHLLL-LEEEE


DSSP  eLLLLllleelllleellLHHHHHHHHHHHhhllLHHHEEELLLLLLhHHLH----hhLL
Query fDXIGxdffyadqgvqcpSDDEVARAILGLadhgYLDRILLSHDVFVkXXLT----ryGG  315
ident                                     |  |                    
Sbjct -TCVY-------------HQPGIDLLNTVI----PVDNVLFASEXIG-AVRGidprtgFY  283
DSSP  -LLLL-------------LHHHHHHHHHHL----LHHHEELLLLLLL-LLLLeellllEE


DSSP  LLllHHHHlHHHHHhhLLLLHHHHHHHHLHHHHHHHL--------llllll
Query NGyaFVTKhFLPRLrrHGLDDAALETLXVTNPRRVFD--------asiegh  358
ident                   |           | |||                
Sbjct YD--DTKR-YIEAS--TILTPEEKQQIYEGNARRVYPrldaalkakgkleh  329
DSSP  LL--LLHH-HHHHL--LLLLHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll


No 45: Query=3k2gB Sbjct=4hk5D Z-score=13.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEE----------lhHHLL-----
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQND----------crCWWN-----   45
ident                                 | |                         
Sbjct -------------------------tpVVVDIHTHMYPPsyiamlekrqtiPLVRtfpqa   35
DSSP  -------------------------llLLEEEEEEELLHhhhhhhhlllllLEEEeelle


DSSP  -------------LLLL---HHHHHHHhllllhhhhhhhhllhhhLLLLLE-ELLHHHHH
Query -------------PPQE---PERQYLAeapisieilselrqdpfvNKHNIA-LDDLDLAI   88
ident                          |                             |    
Sbjct deprlillsselaALDAalaDPAAKLP------------------GRPLSThFASLAQKM   77
DSSP  eeeeeellhhhhhHHHHhhhLLLLLLL------------------LEELLHhHLLHHHHH


DSSP  HHHHHHHhllLLEEEELL---LLLL--------------lLLHHHHHHHHhhhlLEEEEL
Query AEVKQFAavgGRSIVDPT---CRGI--------------gRDPVKLRRISaetgVQVVXG  131
ident            |  |                                             
Sbjct HFMDTNG---IRVSVISLanpWFDFlapdeapgiadavnaEFSDMCAQHV----GRLFFF  130
DSSP  HHHHHLL---LLEEEEEElllLLLLlllllhhhhhhhhhhHHHHHHHLLL----LLEEEE


DSSP  LLLllhhhllhhhhlLLHHHHHHHHHHHHHLLlllllllLLLEEeELLLllLLHHHH--h
Query AGYylassxpetaarLSADDIADEIVAEALEGtdgtdarIGLIGeIGVSsdFTAEEE--k  189
ident |                 |     |                 |   | |           
Sbjct AAL---------plsAPVDAVKASIERVKNLK------yCRGII-LGTS--GLGKGLddp  172
DSSP  EEL---------lllLLHHHHHHHHHHHHLLL------lEEEEE-ELLL--LLLLLLllh


DSSP  hHHHHHHHHHHHLLLEEELL-------------------------LLLL--LLHHHHH--
Query sLRGAARAQVRTGLPLXVHL-------------------------PGWF--RLAHRVL--  220
ident  |     |     |    |                                    |    
Sbjct hLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgFPMEttIAVARMYma  232
DSSP  hHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhhHHHHHHHhl


DSSP  HHHHHLLLLhhHEEELL-LHHHLLLHH-----------------------hhHHHHHHLL
Query DLVEEEGADlrHTVLCH-XNPSHXDPV-----------------------yqATLAQRGA  256
ident               | |                                    |      
Sbjct GVFDHVRNL--QMLLAHsGGTLPFLAGriescivhdghlvktgkvpkdrrtiWTVLKEQI  290
DSSP  LHHHHLLLL--LEEEHHhHLLHHHHHHhhhhhhhllhhhhhllllllllllhHHHHHHLE


DSSP  EEEELlllllleelllleelllhhhHHHHHHHHHHLlLHHHEEELLLLLlhHHLH---HH
Query FLEFDxigxdffyadqgvqcpsddeVARAILGLADHgYLDRILLSHDVFvkXXLT---RY  313
ident  |                                     ||     |             
Sbjct YLDAV------------------iySEVGLQAAIASsGADRLMFGTDHP--FFPPieeDV  330
DSSP  EEELL------------------llLHHHHHHHHHHhLHHHEELLLLLL--LLLLlllLL


DSSP  LLLLlLHHHhLHHHHHHhLLLL--HHHHHHHHLHHHHHHHL------llllll
Query GGNGyAFVTkHFLPRLRrHGLD--DAALETLXVTNPRRVFD------asiegh  358
ident  |                                |  ||              
Sbjct QGPW-DSSR-LNAQAVI-KAVGegSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  LLLL-HHHH-HHHHHHH-HHHLllLHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 46: Query=3k2gB Sbjct=1yrrB Z-score=13.2

back to top
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL
Query -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
ident                                                     |       
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  L-----LEELhhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLHHHHHHH
Query L-----QNDCrcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDLDLAIAE   90
ident        ||                                                   
Sbjct GcggvqFNDT--------------------------------------aEAVSVETLEIM   82
DSSP  EelleeLLLL--------------------------------------lLLLLHHHHHHH


DSSP  HHHHHHLLLLEEEELLLLL----lllLHHHHHHHHHHHL-LEEEELL-LLLLHhhllhhh
Query VKQFAAVGGRSIVDPTCRG----igrDPVKLRRISAETG-VQVVXGA-GYYLAssxpeta  144
ident  |     |                       |   |            |  |        
Sbjct QKANEKSGCTNYLPTLITTsdelmkqGVRVMREYLAKHPnQALGLHLeGPWLN-------  135
DSSP  HHHHHLLLEEEEEEEELLLlhhhhhhHHHHHHHHHHHLLlLLLLEEEeLLLLL-------


DSSP  hlllhHHHHHHHHHHHhllllllllLLLLeEEELLLllllhHHHHhhHHHHHHHHhHLLL
Query arlsaDDIADEIVAEAlegtdgtdaRIGLiGEIGVSsdftaEEEKslRGAARAQVrTGLP  204
ident          |     |          |                              |  
Sbjct -----AALVDFLCENA--------dVITK-VTLAPE-----MVPA--EVISKLAN-AGIV  173
DSSP  -----LHHHHHHHHLH--------hHEEE-EEELHH-----HLLH--HHHHHHHH-HLLE


DSSP  EEELLL-lllLLHHHHHHHHhhllllhhhEEELLLHH--------hlllhHHHHHHHhhL
Query LXVHLP-gwfRLAHRVLDLVeeegadlrhTVLCHXNP--------shxdpVYQATLAqrG  255
ident             |                |   |                      |   
Sbjct VSAGHSnatlKEAKAGFRAG--------iTFATHLYNampyitgrepglaGAILDEA--D  223
DSSP  EEELLLlllhHHHHHHHHHL--------eEEELLLLLllllllllllhhhHHHHHLL--L


DSSP  LEEEElLLLLlleelllleellLHHHhHHHHHHHHHlLLHHHEEELLLLLlhhhlhhhLL
Query AFLEFdXIGXdffyadqgvqcpSDDEvARAILGLADhGYLDRILLSHDVFvkxxltryGG  315
ident                               |         |   |  |           |
Sbjct IYCGI-IADG------------LHVD-YANIRNAKR-LKGDKLCLVTDAT--------SG  260
DSSP  LEEEE-ELLL------------LLLL-HHHHHHHHH-HHHHHEEEELLLL--------LL


DSSP  LLllHHHHLHHHHHHHL-LLLHHHHHHHHLHHHHHH-HLLL-------------------
Query NGyaFVTKHFLPRLRRH-GLDDAALETLXVTNPRRV-FDAS-------------------  354
ident              |  | |             | |                         
Sbjct SS--LTMIEGVRNLVEHcGIALDEVLRMATLYPARAiGVEKrlgtlaagkvanltaftpd  318
DSSP  LL--LLHHHHHHHHHHHhLLLHHHHHHHHLHHHHHHlLLLLlllllllllllleeeelll


DSSP  ------------llll
Query ------------iegh  358
ident                 
Sbjct fkitktivngnevvtq  334
DSSP  lleeeeeelleeeeel


No 47: Query=3k2gB Sbjct=3iacA Z-score=13.1

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL--------------------eel
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQ--------------------ndc   40
ident                                 | ||                        
Sbjct -atfxtedfllkndiartlyhkyaapxPIYDFHCHLSpqeiaddrrfdnlgqiwlegdhy   59
DSSP  -llllllllllllhhhhhhhhhlllllLEEELLLLLLhhhhhhllllllhhhhhhllllh


DSSP  hhhllllllhHHHHHHH--LLLL--HHHHHHHH---------------------------
Query rcwwnppqepERQYLAE--APIS--IEILSELR---------------------------   69
ident                                                             
Sbjct kwralrsagvDESLITGkeTSDYekYXAWANTVpktlgnplyhwthlelrrpfgitgtlf  119
DSSP  hhhhhhhlllLHHHLLLllLLHHhhHHHHHHHHhhllllhhhhhhhhhhhllllllllll


DSSP  -----llhhhllllleellhhHHHHHHHhhhHLLLLEEEELLLLlllLLHHHHHHHHHH-
Query -----qdpfvnkhnialddldLAIAEVKqfaAVGGRSIVDPTCRgigRDPVKLRRISAE-  123
ident                       |            |                 | | |  
Sbjct gpdtaesiwtqcneklatpafSARGIXQ---QXNVRXVGTTDDP--iDSLEYHRQIAADd  174
DSSP  lhhhhhhhhhhhhhhhllhhhLHHHHHH---HLLEEEEELLLLL--lLLLHHHHHHHHLl


DSSP  -HLLEEEELLLLL---LHHH--lLHHH-------------HLLLHHHHHHHHHHHHHlll
Query -TGVQVVXGAGYY---LASS--xPETA-------------ARLSADDIADEIVAEALegt  164
ident      |                                                 |    
Sbjct sIDIEVAPSWRPDkvfKIELdgfVDYLrkleaaadvsitrFDDLRQALTRRLDHFAA---  231
DSSP  lLLLEEELLLLLHhhhLLLLllhHHHHhhhhhhhllllllHHHHHHHHHHHHHHHHH---


DSSP  llllLLLLLEeEELLLLLL----------------------------LHHHHHHHHHHHH
Query dgtdARIGLIgEIGVSSDF----------------------------TAEEEKSLRGAAR  196
ident              |                                        |    |
Sbjct ----CGCRAS-DHGIETLRfapvpddaqldailgkrlagetlseleiAQFTTAVLVWLGR  286
DSSP  ----LLLLEE-EEEELLLLllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHH


DSSP  HHHHHLLLEEELLLL----------------------LLLLHHHHHHHHHHL----LLLH
Query AQVRTGLPLXVHLPG----------------------WFRLAHRVLDLVEEE----GADL  230
ident      |     |                                   |            
Sbjct QYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsigDNNISWALSRLLDSXdvtnELPK  346
DSSP  HHHHHLLEEEEEELEellllhhhhhhhllllllleelLLLLHHHHHHHHHHHhlllLLLE


DSSP  hhEEELLlhHHLLLHHHHHHHHHH--------LLEEEELLllllleelllleeLLLH-HH
Query rhTVLCHxnPSHXDPVYQATLAQR--------GAFLEFDXigxdffyadqgvqCPSD-DE  281
ident   | |        |    ||                                      | 
Sbjct --TILYC--LNPRDNEVLATXIGNfqgpgiagKVQFGSGW------------wFNDQkDG  390
DSSP  --EEEEE--LLHHHHHHHHHHHHHllllllllLEEELLLL------------hHHLLhHH


DSSP  HHHHHHHHHHLLLH-HHEEELLLLLLhhhlhhhlllLLLHHHHLHHHHHHHLL-------
Query VARAILGLADHGYL-DRILLSHDVFVkxxltryggnGYAFVTKHFLPRLRRHG-------  333
ident   |    |   | |        |                     |   |           
Sbjct XLRQLEQLSQXGLLsQFVGXLTDSRS---------fLSYTRHEYFRRILCNLLgqwaqdg  441
DSSP  HHHHHHHHHHHLLHhHLLLLLLLLLL---------lLLLHHHHHHHHHHHHHHhhhhhll


DSSP  -------lLHHHHHHHHLHHHHHHHLLLllll
Query -------lDDAALETLXVTNPRRVFDASiegh  358
ident                    |  | |       
Sbjct eipddeaxLSRXVQDICFNNAQRYFTIK----  469
DSSP  lllllhhhHHHHHHHHHLHHHHHHLLLL----


No 48: Query=3k2gB Sbjct=4dziC Z-score=12.9

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEEL--------------------
Query slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDC--------------------   40
ident                                   |                         
Sbjct -----------------------alnyRVIDVDNH-YYEPldsftrhldkkfkrrgvqml   36
DSSP  -----------------------llllLEEEEEEE-LLLLlllllllllhhhlllleeee


DSSP  ---------------hHHLL------llllhhhhhhhhllllhHHHHHHHLlhhhLLLL-
Query ---------------rCWWN------ppqeperqylaeapisiEILSELRQdpfvNKHN-   78
ident                    |                            |           
Sbjct sdgkrtwavigdrvnhFIPNptfdpiivpgcldllfrgeipdgVDPASLMK----VERLa   92
DSSP  elllleeeeelleellLLLLllllleelllllhhhhhllllllLLHHHLLL----EELHh


DSSP  --leELLHHHHHHHHHHHHhllLLEEEELL---------------------llllllLHH
Query --iaLDDLDLAIAEVKQFAavgGRSIVDPT---------------------crgigrDPV  115
ident         |  ||                                               
Sbjct dhpeYQNRDARIAVMDEQD---IETAFMLPtfgcgveealkhdieatmasvhafnlwLDE  149
DSSP  hlhhHLLHHHHHHHHHHHL---EEEEEEELlhhhhhhhhllllhhhhhhhhhhhhhhHHH


DSSP  HHHhhhhhhLLEEEELLLLllhhhllhhhhlLLHHHHHHHHHHHHHlllllllLLLLLEE
Query KLRrisaetGVQVVXGAGYylassxpetaarLSADDIADEIVAEALegtdgtdARIGLIG  175
ident                                        |                 |  
Sbjct DWG--fdrpDHRIIAAPIV----------slADPTRAVEEVDFVLA-------RGAKLVL  190
DSSP  HLL--llllLLLEEELLLL----------llLLHHHHHHHHHHHHH-------LLLLLEE


DSSP  eELLLllLLHH-------hhhhHHHHHHHHHHHLLLEEELL-------------------
Query eIGVSsdFTAE-------eeksLRGAARAQVRTGLPLXVHL-------------------  209
ident                                  | |   ||                   
Sbjct -VRPA--PVPGlvkprslgdrsHDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpl  247
DSSP  -LLLL--LLLLlllllllllhhHHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhh


DSSP  -----LLLL--LLHHHHH-HHHHHLLLLHhHEEEL-LLHHHllLHHH-------------
Query -----PGWF--RLAHRVL-DLVEEEGADLrHTVLC-HXNPShxDPVY-------------  247
ident                      |      |   |                           
Sbjct dqvllDDRAihDTMASMIvHGVFTRHPKL-KAVSIeNGSYF--VHRLikrlkkaantqpq  304
DSSP  hhhhhLLHHhhHHHHHHHhLLHHHHLLLL-LEEEElLLLLH--HHHHhhhhhhhhhhlhh


DSSP  -----hhHHHHHLLEEEEllllllleelllleelllHHHHhhhHHHHHHLLLHHHEEELL
Query -----qaTLAQRGAFLEFdxigxdffyadqgvqcpsDDEVaraILGLADHGYLDRILLSH  302
ident                                               ||     | ||   
Sbjct yfpedpvEQLRNNVWIAP-----------------yYEDD---LPELARVIGVDKILFGS  344
DSSP  hllllhhHHHHHHEEELL-----------------lLLLL---HHHHHHHHLHHHLLLLL


DSSP  LLLLhhhlhhhlLLLLLHHHhLHHHHHHhlLLLHHHHHHHHLHHHHHHHLLLllll
Query DVFVkxxltrygGNGYAFVTkHFLPRLRrhGLDDAALETLXVTNPRRVFDASiegh  358
ident |           | | |     |   |   |            |            
Sbjct DWPH--------GEGLASPV-SFTAELK--GFSESDIRKIMRDNALDLLGVQ-vgs  388
DSSP  LLLL--------LLLLLLHH-HHHHHHL--LLLHHHHHHHHLHHHHHHHLLL-lll


No 49: Query=3k2gB Sbjct=3ooqA Z-score=12.8

back to top
DSSP  -------------------------llllllllllllleeeelleeeehhHLLLEELLLL
Query -------------------------slselspchvrsgrixtvdgpipssALGHTLXHEH   35
ident                                                     |    | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  LLEElhhhllllllhhhhhhhhllllhhhhhhhhllhhhlLLLLEE--------------
Query LQNDcrcwwnppqeperqylaeapisieilselrqdpfvnKHNIAL--------------   81
ident                                                             
Sbjct IGLF--------------------------------eegvGYYYSDgneatdpvtphvka   88
DSSP  LLLL--------------------------------llllLHHHLLlllllllllllllh


DSSP  --llHHHHhHHHHHHHHLLLLEEEELLLllllllhhhhhhhhhhhlleeeellLLLLhhh
Query --ddLDLAiAEVKQFAAVGGRSIVDPTCrgigrdpvklrrisaetgvqvvxgaGYYLass  139
ident                 | |  |                                      
Sbjct ldgfNPQD-PAIERALAGGVTSVXIVPG------------------------sANPV---  120
DSSP  hhhlLLLL-HHHHHHHLLLEEEEEELLL------------------------lLLLE---


DSSP  llhhhhlllhhhhhhhhhhhhhllllllllLLLLEEEELLLL-----------------L
Query xpetaarlsaddiadeivaealegtdgtdaRIGLIGEIGVSS-----------------D  182
ident                                                             
Sbjct -----------ggqgsvikfrsiiveecivKDPAGLKXAFGEnpkrvygerkqtpstrxG  169
DSSP  -----------eeeeeeeelllllhhhheeEEEEEEEEELLHhhhhhhhhlllllllhhH


DSSP  LLHHHHHH--------------------------hhhhHHHHHHHLLLEEELLlLLLLLH
Query FTAEEEKS--------------------------lrgaARAQVRTGLPLXVHLpGWFRLA  216
ident                                            |   |   |        
Sbjct TAGVIRDYftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHA-HRADDI  228
DSSP  HHHHHHHHhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEE-LLHHHH


DSSP  HHHHHHHHHLLLLhhhEEELLLHhHLLLhhHHHHHHHHLLEEEELLLLLLLEEllllEEL
Query HRVLDLVEEEGADlrhTVLCHXNpSHXDpvYQATLAQRGAFLEFDXIGXDFFYadqgVQC  276
ident        || |      |  |             ||                        
Sbjct LTAIRIAEEFGFN---LVIEHGT-EAYK--ISKVLAEKKIPVVVGPLLTFRTK----LEL  278
DSSP  HHHHHHHHHHLLL---EEEEELL-LHHH--HHHHHHHHLLLEEELLLLLLLLL----HHH


DSSP  LlhhHHHHHHHHHHHLLLhhHEEELLLLLlhhhlhhhllLLLLHHHhLHHHHHHHLLLLH
Query PsddEVARAILGLADHGYldRILLSHDVFvkxxltryggNGYAFVTkHFLPRLRRHGLDD  336
ident          |  |   |    | |  |                | |        | |   
Sbjct K--dLTXETIAKLLKDGV--LIALXCDHP---------vIPLEFAT-VQAATAXRYGAKE  324
DSSP  L--lLLLLHHHHHHHLLL--LEEELLLLL---------lLLHHHHH-HHHHHHHHHLLLH


DSSP  HHHHHHHLHHHHHH-HLLLL-------------------------------------lll
Query AALETLXVTNPRRV-FDASI-------------------------------------egh  358
ident   |      ||                                                 
Sbjct EDLLKILTVNPAKIlGLEDRigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  HHHHHLLLHHHHHHlLLLLLllllllllllleeeelllllllllleeeeeelleeeeell


No 50: Query=3k2gB Sbjct=1v77A Z-score=11.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeapi   60
ident                                                             
Sbjct --------------------------vKFIEMDIRDK-----------------------   11
DSSP  --------------------------lLLEEEEELLH-----------------------


DSSP  lhhhhhhhhllhhhllllleellhhhhhhHHHHHhhllLLEEEELLLllllllhhhhhhh
Query sieilselrqdpfvnkhnialddldlaiaEVKQFaavgGRSIVDPTCrgigrdpvklrri  120
ident                                |          |                 
Sbjct -------------------------eayeLAKEW----FDEVVVSIK-------------   29
DSSP  -------------------------hhhhHHHHH----LLEEEEEEE-------------


DSSP  hhhhlleeeellllLLHHhllhhhhlllhhhhhhhHHHHHhllllllLLLL----LLEEE
Query saetgvqvvxgagyYLASsxpetaarlsaddiadeIVAEAlegtdgtDARI----GLIGE  176
ident                                                             
Sbjct --------------FNEE----------------vDKEKL-------REARkeygKVAIL   52
DSSP  --------------ELLL----------------lLHHHH-------HHHHhhhlLEEEE


DSSP  ELLLllllhhHHHHHHHHHHHHHhhLLLEEELLllLLLL-HHHHHHHHhhllllhhhEEE
Query IGVSsdftaeEEKSLRGAARAQVrtGLPLXVHLpgWFRL-AHRVLDLVeeegadlrhTVL  235
ident                |              |                             
Sbjct LSNP------KPSLVRDTVQKFK--SYLIYVES--NDLRvIRYSIEKG--------vDAI   94
DSSP  EELL------LHHHHHHHHHHLL--LLEEEEEL--LLHHhHHHHHHLL--------lLEE


DSSP  LLLH-----HHLLlHHHHHHHHHHLLEEEElLLLL-LLEElllleellLHHHHHHHHHHH
Query CHXN-----PSHXdPVYQATLAQRGAFLEFdXIGX-DFFYadqgvqcpSDDEVARAILGL  289
ident          |     |           | |                         |    
Sbjct ISPWvnrkdPGID-HVLAKLMVKKNVALGF-SLRPlLYSN--pyeranLLRFMMKAWKLV  150
DSSP  ELLLlllllLLLL-HHHHHHHHHHLLEEEE-ELHHhHHLL--hhhhhhHHHHHHHHHHHH


DSSP  HHLLLhhHEEELLLLLLHhhlhhhlLLLLL--HHHHlHHHHHHhllLLHHHHHHHHLHHH
Query ADHGYldRILLSHDVFVKxxltrygGNGYA--FVTKhFLPRLRrhgLDDAALETLXVTNP  347
ident        |  |      |                                         |
Sbjct EKYKV--RRFLTSSAQEK-------WDVRYprDLIS-LGVVIG---MEIPQAKASISMYP  197
DSSP  HHHLL--LEEEELLLLLH-------HHLLLhhHHHH-HHHHLL---LLHHHHHHLLLHHH


DSSP  HHHHLllllll
Query RRVFDasiegh  358
ident            
Sbjct EIILK------  202
DSSP  HHHHL------


No 51: Query=3k2gB Sbjct=2a3lA Z-score=10.7

back to top
DSSP  --------------------------------------------llllllllllLLLE--
Query --------------------------------------------slselspchvRSGR--   14
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqeTVAPwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllLLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   14
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------eeelleeeehhhlLLEELLLLLL--------
Query -----------------------------ixtvdgpipssalGHTLXHEHLQ--------   37
ident                                                | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  --------------eelhhhllllllhhhhhhhhllllhHHHHHH---------------
Query --------------ndcrcwwnppqeperqylaeapisiEILSEL---------------   68
ident                                             |               
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydLNVDLLdvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhllllllLLLLLLlllllllllllllll


DSSP  ---hllhhhLLLL--LEEL--------LHHHHHHHHHHHHHLLLLEEEELLLLL------
Query ---rqdpfvNKHN--IALD--------DLDLAIAEVKQFAAVGGRSIVDPTCRG------  109
ident                                         |                   
Sbjct nlkynpcgqSRLReiFLKQdnliqgrfLGEITKQVFSDLEASKYQMAEYRISIYgrkmse  300
DSSP  hhhhlllllLHHHhhHLLLllllllllHHHHHHHHHHHHLLLLLEEEEEEEELLlllllh


DSSP  lllLHHHHH--HHHHhhlLEEEELLLLLLHhhLLHH-----hHLLLhhhhhHHHHHHHHL
Query igrDPVKLR--RISAetgVQVVXGAGYYLAssXPET-----aARLSaddiaDEIVAEALE  162
ident                     ||                             | |     |
Sbjct wdqLASWIVnnDLYS---ENVVWLIQLPRL--YNIYkdmgivTSFQ--nilDNIFIPLFE  353
DSSP  hhhHHHHHHllLLLL---LLEEEEEEEELL--HHHHllllllLLLH--hhhHHHLLHHHH


DSSP  L-------llLLLLL--LLLEeEELLLLL-------------------lLHHHHHHHHHH
Query G-------tdGTDAR--IGLIgEIGVSSD-------------------fTAEEEKSLRGA  194
ident                                                             
Sbjct AtvdpdshpqLHVFLkqVVGF-DLVDDESkperrptkhmptpaqwtnafNPAFSYYVYYC  412
DSSP  HhhlhhhlllLHHHHllEEEE-EEELLLLllllllllllllllllllllLLLHHHHHHHH


DSSP  HHHHHHHL----------LLEEELLLLLLL--LHHHHHHHHhhllllhhhEEELLLHHHL
Query ARAQVRTG----------LPLXVHLPGWFR--LAHRVLDLVeeegadlrhTVLCHXNPSH  242
ident                     |  |                              |     
Sbjct YANLYVLNklreskgmttITLRPHSGEAGDidHLAATFLTC---------HSIAHGINLR  463
DSSP  HHHHHHHHhhhlllllllLEELLLLLLLLLlhHHHHHHHHL---------LLLLLLHHHH


DSSP  LLHHHHHHHHHHLLEEEElLLLLlleelllleELLLHHHHhhHHHHHHHLLLhhHEEELL
Query XDPVYQATLAQRGAFLEFdXIGXdffyadqgvQCPSDDEVarAILGLADHGYldRILLSH  302
ident   || |         |                                  |      || 
Sbjct KSPVLQYLYYLAQIGLAM-SPLS------nnsLFLDYHRN--PFPVFFLRGL--NVSLST  512
DSSP  HLHHHHHHHHHHLLLEEE-LHHH------hllLLLLLLLL--LHHHHHHLLL--LEEELL


DSSP  LLlLHHHlhhhlllllLHHHhLHHHHHHH-LLLLHHHHHHHHlHHHHHHH----------
Query DVfVKXXltryggngyAFVTkHFLPRLRR-HGLDDAALETLXvTNPRRVF----------  351
ident |                               |    |      |               
Sbjct DD-PLQI-----hltkEPLV-EEYSIAASvWKLSACDLCEIA-RNSVYQSgfshalkshw  564
DSSP  LL-HHHH-----llllLHHH-HHHHHHHHhHLLLHHHHHHHH-HHHHHHLlllhhhhhhh


DSSP  --llLLLLL-------------------------------------------
Query --daSIEGH-------------------------------------------  358
ident                                                     
Sbjct igkdYYKRGpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  llllLLLLLhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=3k2gB Sbjct=3dcpA Z-score=9.7

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEELhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNDCrcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ---------------------------XKRDGHTHTEFCP--------------------   13
DSSP  ---------------------------LLEEEEELLLLLL--------------------


DSSP  lhhhhhhhhllhhhllllLEELLhhHHHHHHHHHHHLLLLEEEELLLLL-----------
Query sieilselrqdpfvnkhnIALDDldLAIAEVKQFAAVGGRSIVDPTCRG-----------  109
ident                       |       |                             
Sbjct ------------------HGTHD--DVEEXVLKAIELDFDEYSIVEHAPlssefxkntag   53
DSSP  ------------------LLLLL--LHHHHHHHHHHLLLLEEEEEEELLllhhhhhllll


DSSP  --------------lllLHHHHHHHHHHH--LLEEEELlllllhhhllhhhhlllhhhhh
Query --------------igrDPVKLRRISAET--GVQVVXGagyylassxpetaarlsaddia  153
ident                     |   |            |                      
Sbjct dkeavttasxaxsdlpyYFKKXNHIKKKYasDLLIHIG----------------------   91
DSSP  llhhhhlllllhhhhhhHHHHHHHHHHHLllLLEEEEE----------------------


DSSP  hhhhhhhhlllllllllllleEEELLlllLLHHhHHHHHHHHHHHhhHLLL-eEELLL--
Query deivaealegtdgtdarigliGEIGVssdFTAEeEKSLRGAARAQvrTGLP-lXVHLP--  210
ident                       |           |   |                 |   
Sbjct ---------------------FEVDY---LIGY-EDFTRDFLNEY-gPQTDdgVLSLHfl  125
DSSP  ---------------------EEEEL---LLLL-HHHHHHHHHHH-hHHLLeeEEELLee


DSSP  --------------------------------lLLLLHHHH-HHHHhhLLLLhhhEEELL
Query --------------------------------gWFRLAHRV-LDLVeeEGADlrhTVLCH  237
ident                                                            |
Sbjct egqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSiEADL--GLFK--pRRXGH  181
DSSP  eelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHhHLLL--LLLL--lLEELL


DSSP  LHHH-------------------llLHHHHHHHHHHLLEEEElLLLL-LLEElllleeLL
Query XNPS-------------------hxDPVYQATLAQRGAFLEFdXIGX-DFFYadqgvqCP  277
ident                            |  |    |   | |                | 
Sbjct ISLCqkfqqffgedtsdfseevxekFRVILALVKKRDYELDF-NTAGlFKPL------CG  234
DSSP  LLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEE-ELHHhHLLL------LL


DSSP  LHhhHHHHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLHHHhLHHHHHHHllllhh
Query SDdeVARAILGLADHGYldRILLSHDVFVkxxltryggNGYAFVTkHFLPRLRRhgldda  337
ident                          |                                  
Sbjct ETypPKKIVTLASELQI--PFVYGSDSHG--------vQDIGRGY-STYCQKLE------  277
DSSP  LLllLHHHHHHHHHLLL--LEEEELLLLL--------hHHLLLLH-HHHHHHLL------


DSSP  hhhhhhlhhhhhhhlllllll
Query aletlxvtnprrvfdasiegh  358
ident                      
Sbjct ---------------------  277
DSSP  ---------------------


No 53: Query=3k2gB Sbjct=3au2A Z-score=9.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------llllllllllllleeeelleeeehhhllLEELLLLLLEELhhhllllllhh
Query ---------slselspchvrsgrixtvdgpipssalgHTLXHEHLQNDCrcwwnppqepe   51
ident                                            |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTYSD-----------  349
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLLLL-----------


DSSP  hhhhhhllllhhhhhhhhllhhhllllleellhhHHHHHHHHHHHLLLLEEEELLLLL--
Query rqylaeapisieilselrqdpfvnkhnialddldLAIAEVKQFAAVGGRSIVDPTCRG--  109
ident                                               | |           
Sbjct -------------------------------gqnTLEELWEAAKTMGYRYLAVTDHSPav  378
DSSP  -------------------------------lllLHHHHHHHHHHHLLLEEEEEEELHhh


DSSP  ----------lllLHHHHHHHHHHHL-LEEEELlllllhhhllhhhhlllhhhhhhhhhh
Query ----------igrDPVKLRRISAETG-VQVVXGagyylassxpetaarlsaddiadeiva  158
ident                   ||     |      |                           
Sbjct rvaggpspeealkRVGEIRRFNETHGpPYLLAG---------------------------  411
DSSP  hllllllhhhhhhHHHHHHHHHHHHLlLEEEEE---------------------------


DSSP  hhhlllllllllllleEEELLLLLLlhhhhhHHHHhHHHHHhhllLEEELLL--------
Query ealegtdgtdarigliGEIGVSSDFtaeeekSLRGaARAQVrtglPLXVHLP--------  210
ident                  |     |                        |           
Sbjct ----------------AEVDIHPDG-----tLDYP-DWVLR-eldLVLVSVHsrfnlpka  448
DSSP  ----------------EEEELLLLL-----lLLLL-HHHHL-lllEEEEELLllllllhh


DSSP  lLLLLHHHHHHHHhhllllhhHEEELLLHH---------hlLLHHHHHHHHHHLLEEEEL
Query gWFRLAHRVLDLVeeegadlrHTVLCHXNP---------shXDPVYQATLAQRGAFLEFD  261
ident          |             || |                          |   | |
Sbjct dQTKRLLKALENP-------fVHVLAHPTArllgrrapieaDWEAVFQKAKEKGVAVEID  501
DSSP  hHHHHHHHHHLLL-------lLLEELLLLLlllllllllllLHHHHHHHHHHHLLEEEEE


DSSP  lLLLLleelllleelllhhhHHHHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLHH
Query xIGXDffyadqgvqcpsddeVARAILGLADHGYldRILLSHDVFVkxxltryggNGYAFV  321
ident     |                          |    | || |                | 
Sbjct -GYYD-----------rmdlPDDLARMAYGMGL--WISLSTDAHQ--------tDHLRFM  539
DSSP  -LLLL-----------llllLHHHHHHHHHLLL--LEEEELLLLL--------hHHHHHH


DSSP  HhLHHHHHHHLLLlhhHHHHH-HLHH---HHHHHLLLllll
Query TkHFLPRLRRHGLddaALETL-XVTN---PRRVFDASiegh  358
ident          |        |                |     
Sbjct E-LAVGTAQRAWI---GPERVlNTLDyedLLSWLKAR-rgv  575
DSSP  H-HHHHHHHHLLL---LLLLLhHHLLhhhHHHHHHLL-lll


No 54: Query=3k2gB Sbjct=3f2bA Z-score=8.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ---------------------llllllllllllleeeelleeeehhhlLLEELLLLLLEE
Query ---------------------slselspchvrsgrixtvdgpipssalGHTLXHEHLQND   39
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL


DSSP  LHhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLHhhHHHHHHHHHHLLL
Query CRcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDLdlAIAEVKQFAAVGG   99
ident                                                      |    | 
Sbjct QM--------------------------------------DAVTS--VTKLIEQAKKWGH  140
DSSP  LL--------------------------------------LLLLL--HHHHHHHHHHLLL


DSSP  LEEEELLLLlLLLLHHHHHHHHHHHLLEEEELlllllhhhllhhhhlllhhhhhhhhhhh
Query RSIVDPTCRgIGRDPVKLRRISAETGVQVVXGagyylassxpetaarlsaddiadeivae  159
ident   |                      |  |  |                            
Sbjct PAIAVTDHA-VVQSFPEAYSAAKKHGMKVIYG----------------------------  171
DSSP  LLEEELLLL-LLLLHHHHHHHHHHHLLLEEEE----------------------------


DSSP  hhlllllllllllleEEELLL------------------------lllLHHH----hhHH
Query alegtdgtdarigliGEIGVS------------------------sdfTAEE----ekSL  191
ident                 |                                           
Sbjct ---------------LEANIVddpfhvtllaqnetglknlfklvslshIQYFhrvpriPR  216
DSSP  ---------------EEEEEEllleeeeeeellhhhhhhhhhhhhhhhLLLLllllleEH


DSSP  HHHHHHHhhHLLLEeellllllllhhhhhhhhhhllllhhheEELLL--hhHLLLhhhhH
Query RGAARAQvrTGLPLxvhlpgwfrlahrvldlveeegadlrhtVLCHX--npSHXDpvyqA  249
ident           ||                                                
Sbjct SVLVKHR--DGLLV----------------------------GSGCDkgelFDNV----E  242
DSSP  HHHHHLL--LLEEE----------------------------ELLLLllllLLLL----L


DSSP  HHHHHLLEEEEL-llLLLLeelllleelllhHHHHHHHHHHHHLLL--hHHEEELLLLLl
Query TLAQRGAFLEFD-xiGXDFfyadqgvqcpsdDEVARAILGLADHGY--lDRILLSHDVFv  306
ident   |    |||                           |      |            |  
Sbjct DIARFYDFLEVHppdVYKP------lyvkdeEMIKNIIRSIVALGEkldIPVVATGNVH-  295
DSSP  LLHHHLLLEEELlhhHHLL------lllllhHHHHHHHHHHHHHHHhllLLEEELLLLL-


DSSP  hhHLHHHLL-----------------------lLLLHhHHLHHHHHHhlLLLHHHHHHHH
Query kxXLTRYGG-----------------------nGYAFvTKHFLPRLRrhGLDDAALETLX  343
ident    |                                  |   |       |         
Sbjct --YLNPEDKiyrkilihsqgganplnrhelpdvYFRT-TNEMLDCFS--FLGPEKAKEIV  350
DSSP  --LLLHHHHhhhhhhhhllhhhlllllllllllLLLL-HHHHHHHHH--HHHHHHHHHHH


DSSP  LHHHHHHHLL--------------------------------------------------
Query VTNPRRVFDA--------------------------------------------------  353
ident | |                                                         
Sbjct VDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerleke  410
DSSP  LHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct lksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcp  470
DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct nckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsg  530
DSSP  lllleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct eyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagc  590
DSSP  llhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct tgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldil  650
DSSP  llleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct ghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgt  710
DSSP  eehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct rfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyl  770
DSSP  hhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct iyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayv  830
DSSP  hhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct lmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakek  890
DSSP  hhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  353
ident                                                             
Sbjct slltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivra  950
DSSP  hhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhh


DSSP  ---------------------------------------lllll
Query ---------------------------------------siegh  358
ident                                             
Sbjct reegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 55: Query=3k2gB Sbjct=1m65A Z-score=8.2

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEELHhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDCRcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ---------------------------YPVDLHMH-TVAST-------------------   13
DSSP  ---------------------------LLEELLLL-LLLLL-------------------


DSSP  lhhhhhhhhllhhhllllLEELlhHHHHHHHHHHHhllLLEEEELLLllllllhhhhhhh
Query sieilselrqdpfvnkhnIALDdlDLAIAEVKQFAavgGRSIVDPTCrgigrdpvklrri  120
ident                    |       ||  ||                           
Sbjct ------------------HAYStlSDYIAQAKQKG---IKLFAITDH-------------   39
DSSP  ------------------LLLLlhHHHHHHHHHHL---LLEEEEEEE-------------


DSSP  hhhhlleeeellLLLLhHHLLhhhhlllhhhhhHHHHHHHHllllllllllLLEEEELLL
Query saetgvqvvxgaGYYLaSSXPetaarlsaddiaDEIVAEALegtdgtdariGLIGEIGVS  180
ident             |       |                                  |    
Sbjct ------------GPDM-EDAP----------hhWHFINMRIwprvvdgvgiLRGIEANIK   76
DSSP  ------------LLLL-LLLL----------llHHHHHHHHllleelleeeEEEEEEELL


DSSP  LLLlhhhHHHHHHhhHHHHHhlLLEEELLL----------lLLLLHHHH-HHHHhhllll
Query SDFtaeeEKSLRGaaRAQVRtgLPLXVHLP----------gWFRLAHRV-LDLVeeegad  229
ident        |    |                                               
Sbjct NVD---gEIDCSG--KMFDS-lDLIIAGFHepvfaphdkatNTQAMIATiASGN------  124
DSSP  LLL---lLLLLLH--HHHHH-lLEEEEELLllllllllhhhHHHHHHHHhHLLL------


DSSP  hhhEEELLLHH--hlLLHHHHHHHH-HHLLEEEElLLLLlleelllleelllhhHHHHHH
Query lrhTVLCHXNP--shXDPVYQATLA-QRGAFLEFdXIGXdffyadqgvqcpsddEVARAI  286
ident        |        |    |  |      ||                           
Sbjct --vHIISHPGNpkyeIDVKAVAEAAaKHQVALEI-NNSS---------------NCREVA  166
DSSP  --lLEELLLLLllllLLHHHHHHHHhHHLLEEEE-ELLL---------------LHHHHH


DSSP  HHHHHLLLhhHEEELLLLLLhhhlhhhlllLLLHHhHLHHHHHHHLLLlhhHHHH-HHLH
Query LGLADHGYldRILLSHDVFVkxxltryggnGYAFVtKHFLPRLRRHGLddaALET-LXVT  345
ident     | |      |  |                      |  |          |  | | 
Sbjct AAVRDAGG--WVALGSDSHT--------afTMGEF-EECLKILDAVDF---PPERiLNVS  212
DSSP  HHHHHHLL--LEEEELLLLL--------hhHLLLL-HHHHHHHHHLLL---LHHHlHHHL


DSSP  --HHHHHHLL-------lllll
Query --NPRRVFDA-------siegh  358
ident                       
Sbjct prRLLNFLESrgmapiaefadl  234
DSSP  hhHHHHHHHHllllllhhhlll


No 56: Query=3k2gB Sbjct=1bksA Z-score=6.5

back to top
DSSP  llllllllllllleeeelleeeehhhllleellLLLLeelhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalghtlxhEHLQndcrcwwnppqeperqylaeapi   60
ident                                                             
Sbjct ------------meryenlfaqlndrregafvpFVTL-----------------------   25
DSSP  ------------lhhhhhhhhhhhhlllleeeeEEEL-----------------------


DSSP  lhhhhhhhhllhhhllllleELLHHHHHHHHHHHHHLLLLEEEELLlLLLL---------
Query sieilselrqdpfvnkhniaLDDLDLAIAEVKQFAAVGGRSIVDPTcRGIG---------  111
ident                                      |                      
Sbjct -------------------gDPGIEQSLKIIDTLIDAGADALELGVpFSDPladgptiqn   66
DSSP  -------------------lLLLHHHHHHHHHHHHHLLLLLEEEELlLLLLllllhhhhh


DSSP  -------------lLHHHHHHHHHH-hlleEEELLLLllhhhllhhhhlllhhhhhhHHH
Query -------------rDPVKLRRISAE-tgvqVVXGAGYylassxpetaarlsaddiadEIV  157
ident                   |  |                                    | 
Sbjct anlrafaagvtpaqCFEMLALIREKhptipIGLLMYA--------------nlvfnnGID  112
DSSP  hhhhhhhhlllhhhHHHHHHHHHHHlllllEEEEELH--------------hhhhllLHH


DSSP  HHHHLlllllLLLLLLEE-EELLlllllhhHHHHhHHHHHHHHHHLLLEEELLlLLLL--
Query AEALEgtdgtDARIGLIG-EIGVssdftaeEEKSlRGAARAQVRTGLPLXVHLpGWFR--  214
ident |                              | |      |  |                
Sbjct AFYAR---ceQVGVDSVLvADVP-------VEES-APFRQAALRHNIAPIFIC-PPNAdd  160
DSSP  HHHHH---hhHHLLLEEEeLLLL-------HHHL-HHHHHHHHHLLLEEEEEE-LLLLlh


DSSP  -LHHHHHHHhhhllllhhHEEELLLhhhlLLHHHHHHHHH-HLLEEEEL-LLLLlleell
Query -LAHRVLDLveeegadlrHTVLCHXnpshXDPVYQATLAQ-RGAFLEFD-XIGXdffyad  271
ident  |   |                               |     |       |        
Sbjct dLLRQVASY--------gRGYTYLL--alPLHHLIEKLKEyHAAPALQGfGISS------  204
DSSP  hHHHHHHHH--------lLLLEEEL--llLHHHHHHHHHHhLLLLEEELlLLLL------


DSSP  lleelllHHHHHHHHHHHhhlllhhhEEELLLLllhhHLHHHL--------llllLHHHH
Query qgvqcpsDDEVARAILGLadhgyldrILLSHDVfvkxXLTRYG--------gngyAFVTK  323
ident           |  |                                              
Sbjct -------PEQVSAAVRAG-------aAGAISGS--aiVKIIEKnlaspkqmlaelRSFVS  248
DSSP  -------HHHHHHHHHHL-------lLEEEELL--hhHHHHHHllllhhhhhhhhHHHHH


DSSP  LHHHHHHhllllhhhhhhhhlhhhhhhhlllllll
Query HFLPRLRrhglddaaletlxvtnprrvfdasiegh  358
ident       |                            
Sbjct AMKAASR----------------------------  255
DSSP  HHHHLLL----------------------------


No 57: Query=3k2gB Sbjct=2yb1A Z-score=6.1

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEELhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDCrcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ---------------------------ANIDLHFHsRTSD--------------------   13
DSSP  ---------------------------LLEELLLLlLLLL--------------------


DSSP  lhhhhhhhhllhhhllllleELLHHHHHHHHHHHHhllLLEEEELLLLlLLLLHHHHHHH
Query sieilselrqdpfvnkhniaLDDLDLAIAEVKQFAavgGRSIVDPTCRgIGRDPVKLRRI  120
ident                            |      |                         
Sbjct -------------------gALTPTEVIDRAAARA---PALLALTDHD-CTGGLAEAAAA   50
DSSP  -------------------lLLLHHHHHHHHHLLL---LLEEEELLLL-LLLLHHHHHHH


DSSP  HHHHLLEEEE-LLLL-----------------------llhhhLLHHHHL----------
Query SAETGVQVVX-GAGY-----------------------ylassXPETAAR----------  146
ident  |  |                                        |              
Sbjct AARRGIPFLNgVEVSvswgrhtvhivglgidpaepalaaglksIREGRLErarqmgasle  110
DSSP  HHHLLLLEEEeEEEEeeelleeeeeeeellllllhhhhhhhhhHHLLHHHhhhhhhhhhh


DSSP  -------------------llhhhhhhhhhhhhhlllllllllllleeeellllllLHHH
Query -------------------lsaddiadeivaealegtdgtdarigligeigvssdfTAEE  187
ident                                                             
Sbjct aagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvsHQWA  170
DSSP  hlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllLLLL


DSSP  hhHHHHHHHHHHHHLLLEEEL-LLLLLL---LHHHHHHHHHHLLLlhhhEEEL---llHH
Query ekSLRGAARAQVRTGLPLXVH-LPGWFR---LAHRVLDLVEEEGAdlrhTVLC---hxNP  240
ident   ||  |    |  |                |  |        |                
Sbjct --SLEDAVGWIVGAGGMAVIAhPGRYDMgrtLIERLILDFQAAGG----QGIEvasgsHS  224
DSSP  --LHHHHHHHHHHLLLEEEELlHHHLLLlhhHHHHHHHHHHHLLL----LEEEeeellLL


DSSP  HLllHHHHHHHHHHLLEEeellllllleelllleelllhhhhhhhhhhhhhlllhhheEE
Query SHxdPVYQATLAQRGAFLefdxigxdffyadqgvqcpsddevarailgladhgyldriLL  300
ident               |                                             
Sbjct LDdmHKFALHADRHGLYA----------------------------------------SS  244
DSSP  HHhhHHHHHHHHHHLLEE----------------------------------------EE


DSSP  LLLLLLHhhlhhhlLLLLlhhhhlhhhhhhhllllhhhhhhhhlhHHHHHHLL-----ll
Query SHDVFVKxxltrygGNGYafvtkhflprlrrhglddaaletlxvtNPRRVFDA-----si  355
ident   |           |                                 |   |       
Sbjct GSDFHAP-------GEDV----------------ghtedlppicrPIWRELEArilrpad  281
DSSP  ELLLLLL-------LLLL----------------lllllllllllLHHHHLHHhlllllh


DSSP  lll
Query egh  358
ident    
Sbjct aen  284
DSSP  hhl


No 58: Query=3k2gB Sbjct=3e38A Z-score=5.4

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEELhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDCrcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ----------aqrrneiqvpdldgyttLKCDFHXHsVFSD--------------------   30
DSSP  ----------llllllllllllllleeEEEELLLLlLLLL--------------------


DSSP  lhhhhhhhhllhhhlllllEELLhHHHHHHHHHHHhllLLEEEELLLLLLL---------
Query sieilselrqdpfvnkhniALDDlDLAIAEVKQFAavgGRSIVDPTCRGIG---------  111
ident                     |        |           |                  
Sbjct -------------------GLVWpTVRVDEAYRDG---LDAISLTEHIEYRphkqdvvsd   68
DSSP  -------------------LLLLhHHHHHHHHHLL---LLEELLEEELLLLlllllllll


DSSP  --lLHHHHHHHHHHHLLEEEELLLLLlhhhllhhhhlllhhhhhhhhhhhhhllllllll
Query --rDPVKLRRISAETGVQVVXGAGYYlassxpetaarlsaddiadeivaealegtdgtda  169
ident         |      |     |                                      
Sbjct hnrSFDLCREQAEKLGILLIKGSEIT----------------------------------   94
DSSP  llhHHHHHHHHHHHHLLEELLEEEEE----------------------------------


DSSP  lllleeeellLLLL---------------lHHHHHHHHHHHHHHhhhlLLEEELLLLL--
Query rigligeigvSSDF---------------tAEEEKSLRGAARAQvrtgLPLXVHLPGW--  212
ident                                      | |               |||  
Sbjct ---------rAXAPghfnaiflsdsnpleqKDYKDAFREAKKQG----AFXFWNHPGWds  141
DSSP  ---------lLLLLleeeeelllllhhhllLLHHHHHHHHHHLL----LEEEELLLLLll


DSSP  -----LLLHhHHHHHHHHLLLlhhhEEELLL---HHHLllhhhHHHHHHHLLEEEELlll
Query -----FRLAhRVLDLVEEEGAdlrhTVLCHX---NPSHxdpvyQATLAQRGAFLEFDxig  264
ident                   ||                                        
Sbjct qqpdtTKWW-PEHTALYQEGC---xHGIEVAnghLYXP---eaIQWCLDKNLTXIGT---  191
DSSP  lllllLLLL-HHHHHHHHLLL---lLEEEEEellEELL---hhHHHHHHHLLEEEEE---


DSSP  llleelllleelllhhhhhhhhhhhhhlllhhheeelLLLLLHhhlhhHLLLlllhhhHL
Query xdffyadqgvqcpsddevarailgladhgyldrillsHDVFVKxxltrYGGNgyafvtKH  324
ident                                       |                   | 
Sbjct -------------------------------------SDIHQP----iQTDY---dfeKG  207
DSSP  -------------------------------------LLLLLL----hHHHL---lhhHL


DSSP  HHhhhhhllllhhhhhhhHLHH--------hHHHHL------------llLLLL------
Query FLprlrrhglddaaletlXVTN--------pRRVFD------------asIEGH------  358
ident                    |                                        
Sbjct EH------------rtxtFVFAkerslqgirEALDNrrtaayfhelligrEDLLrpffek  255
DSSP  LL------------lleeEEEEllllhhhhhHHHHLlleeeeelleeellHHHHhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct cvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqg  315
DSSP  heeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeelll


DSSP  ---------------------------
Query ---------------------------  358
ident                            
Sbjct ikggdvnfevtnfivapdkglkytisl  342
DSSP  lllleeeeeeeeeeeelleeeeeeeel


No 59: Query=3k2gB Sbjct=2anuA Z-score=5.0

back to top
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEELhhhllllllhhhhhhhhlll
Query slselspchvrsgrixtvdgpipssalGHTLXHEHLQNDCrcwwnppqeperqylaeapi   60
ident                                 | |                         
Sbjct ------------------------tewLLCDFHVHTNXSD--------------------   16
DSSP  ------------------------leeEEEEEEELLLLLL--------------------


DSSP  lhhhhhhhhllhhhllllleELLHHHHHHHHHHHHhllLLEEEELLLLL-----------
Query sieilselrqdpfvnkhniaLDDLDLAIAEVKQFAavgGRSIVDPTCRG-----------  109
ident                        |                                    
Sbjct -------------------gHLPLGEVVDLFGKHG---VDVVSITDHIVdrrtleqrkrn   54
DSSP  -------------------lLLLHHHHHHHHHHLL---LLEEEEEEEEElhhhhhhhhhl


DSSP  -----------lllLHHHHHHHHHHHL----LEEE-ELLLlLLHHhllhhhhlllhhhhh
Query -----------igrDPVKLRRISAETG----VQVV-XGAGyYLASsxpetaarlsaddia  153
ident                   | |                                       
Sbjct geplgaitedkfqdYLKRLWREQKRAWeeygXILIpGVEI-TNNT---------------   98
DSSP  lllllllllllhhhHHHHHHHHHHHHHhhhlLEEEeEEEE-EELL---------------


DSSP  hhhhhhhhlllllllllllleeeelllllllhhhhHHHHHHHHHHHHHLLLEEELLL---
Query deivaealegtdgtdarigligeigvssdftaeeeKSLRGAARAQVRTGLPLXVHLP---  210
ident                                                         |   
Sbjct ------------------dlyhivavdvkeyvdpsLPVEEIVEKLKEQNALVIAAHPdrk  140
DSSP  ------------------lleeeeeelllllllllLLHHHHHHHHHHLLLEEEELLLlll


DSSP  lLLLL-HHHHhHHHHhllllhhhEEELLL---HHHLllhhhHHHHHhhllEEEELlllll
Query gWFRL-AHRVlDLVEeegadlrhTVLCHX---NPSHxdpvyQATLAqrgaFLEFDxigxd  266
ident                                                             
Sbjct kLSWYlWANXeRFKD------tfDAWEIAnrdDLFN---svGVKKY----RYVAN-----  182
DSSP  lLLLHhHHLLlLLLL------llLEEEEEellEELH---hhHHLLL----LEEEE-----


DSSP  leelllleelllhhhhhhhhhhhhhlllhhheeelLLLLLHhhlhhhllLLLLHHhhlhh
Query ffyadqgvqcpsddevarailgladhgyldrillsHDVFVKxxltryggNGYAFVtkhfl  326
ident                                     |                       
Sbjct -----------------------------------SDFHEL--------WHVYSW-----  194
DSSP  -----------------------------------LLLLLH--------HHHLLE-----


DSSP  hhhhhllllhhhhhhhHLHH---hHHHHLL---------lllll
Query prlrrhglddaaletlXVTN---pRRVFDA---------siegh  358
ident                  |           |              
Sbjct --------------ktLVKSekniEAIKEAirkntdvaiylxrk  224
DSSP  --------------eeEEEElllhHHHHHHhhhllleeeeelll