Results: dupa

Query: 3irsA

MOLECULE: UNCHARACTERIZED PROTEIN BB4693;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3irs-A 56.0  0.0  281   281  100 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   2:  3cjp-A 23.8  2.3  224   262   19 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   3:  2dvt-A 21.9  2.8  246   325   17 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   4:  4dlf-A 21.3  2.8  234   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   5:  4qrn-A 20.5  3.1  245   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   6:  4hk5-D 20.2  3.1  241   380   17 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   7:  4ofc-A 19.8  3.0  236   335   19 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   8:  2qpx-A 19.2  3.1  239   376   14 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
   9:  2ffi-A 19.2  2.8  223   273   16 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  10:  1gkp-A 18.8  2.8  235   458   11 PDB  MOLECULE: HYDANTOINASE;                                              
  11:  2gwg-A 18.3  2.9  223   329   21 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  12:  4b3z-D 18.3  2.9  232   477   10 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  13:  4mup-B 18.2  3.0  225   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  14:  3pnu-A 18.2  3.0  225   338   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  15:  2vun-A 18.1  2.9  225   385   15 PDB  MOLECULE: ENAMIDASE;                                                 
  16:  2y1h-B 17.8  3.1  216   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  17:  4dzi-C 17.5  3.6  245   388   19 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  18:  1bf6-A 16.8  3.3  229   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  19:  2ob3-A 16.6  3.4  226   329   10 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  20:  3gri-A 16.5  3.1  230   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  3gg7-A 16.4  3.4  212   243   15 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  22:  3k2g-B 16.1  3.4  230   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  23:  2vc5-A 16.0  3.3  221   314    8 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  24:  3mtw-A 15.8  3.3  218   404   14 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  25:  3e74-A 15.8  2.8  214   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  26:  3giq-A 15.6  2.9  221   475   11 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  27:  1onx-A 15.6  3.1  226   390   12 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  28:  1itq-A 15.6  3.2  227   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  29:  4cqb-A 15.0  4.2  227   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  30:  3mkv-A 15.0  3.5  216   414   13 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  31:  1k6w-A 14.8  4.2  228   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  32:  1j6p-A 14.8  3.6  221   407   10 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  33:  2oof-A 14.7  3.8  224   403    8 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  34:  2imr-A 14.7  3.8  230   380   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  35:  4c5y-A 14.6  3.4  215   436   11 PDB  MOLECULE: OCHRATOXINASE;                                             
  36:  3ls9-A 14.6  3.9  226   453   10 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  37:  3nqb-A 14.6  3.2  209   587   12 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  38:  2paj-A 14.6  3.4  213   421    8 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  39:  1yrr-B 14.4  3.2  207   334   14 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  40:  1j5s-A 14.3  3.3  233   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  41:  3icj-A 14.2  3.5  210   468   10 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  42:  3iac-A 14.1  3.5  240   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  43:  1a5k-C 13.8  3.2  216   566   12 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  44:  2ogj-A 13.7  3.2  215   379   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  45:  1a4m-A 13.7  3.7  222   349    9 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  46:  3qy6-A 13.3  3.1  185   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  2uz9-A 12.9  4.0  224   444    9 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  48:  4rdv-B 12.9  3.4  215   451    9 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  49:  3ooq-A 12.2  3.5  190   384   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  1v77-A 10.5  3.6  169   202   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  1m65-A 10.3  3.4  196   234    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  52:  3au2-A  9.9  3.3  180   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  2a3l-A  9.5  3.9  211   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  54:  3dcp-A  8.5  3.3  173   277    6 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  7.2  3.9  163   994   12 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  5.8  3.9  141   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.1  4.0  147   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  2anu-A  4.7  3.9  130   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  4.0  3.9  142   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3irsA Sbjct=3irsA Z-score=56.0

back to top
DSSP  LLLEELLLLLLLHHHHHLHHHHLHHHHHHHHHHHLLLLLHHHHHLLHHHHHHHHHHLLLL
Query LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIE   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIE   60
DSSP  LLLEELLLLLLLHHHHHLHHHHLHHHHHHHHHHHLLLLLHHHHHLLHHHHHHHHHHLLLL


DSSP  EEEEELLEELLLEELLHHHHHHHHHHLLLLEEEEEELLLLLHHHHHHHHHHHHHLLLLLE
Query QGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIV  120
DSSP  EEEEELLEELLLEELLHHHHHHHHHHLLLLEEEEEELLLLLHHHHHHHHHHHHHLLLLLE


DSSP  EELHHHLLLLLLLLLHHHHHHHHHHHHLLLLEEEELLLLLLLLHHHHLHHHHHHHHHHLL
Query NLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFP  180
DSSP  EELHHHLLLLLLLLLHHHHHHHHHHHHLLLLEEEELLLLLLLLHHHHLHHHHHHHHHHLL


DSSP  LLLEEEEHHHLLLHHHHHHHHHHLLLEEEELHHHHLLLLLHHHHHHHHLLHHHHLLLLLL
Query DLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGT  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGT  240
DSSP  LLLEEEEHHHLLLHHHHHHHHHHLLLEEEELHHHHLLLLLHHHHHHHHLLHHHHLLLLLL


DSSP  LLLLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHHHLLL
Query AYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR  281
ident |||||||||||||||||||||||||||||||||||||||||
Sbjct AYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR  281
DSSP  LLLLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHHHLLL


No 2: Query=3irsA Sbjct=3cjpA Z-score=23.8

back to top
DSSP  lLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhlLHHHHHHHHHHLLLL
Query lKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeekSLELMFEEMAAAGIE   60
ident   |||                                          |     |  ||  
Sbjct -LIIDGHTHVIL---------------------------------PVEKHIKIMDEAGVD   26
DSSP  -LLEEEEEELLL---------------------------------LHHHHHHHHHHHLLL


DSSP  EEEEELL------------------eELLL-----------eeLLHHHHHHHHHHLLLLE
Query QGVCVGR------------------nSSVL-----------gsVSNADVAAVAKAYPDKF   91
ident                                             |      |  |||   
Sbjct KTILFSTsihpetavnlrdvkkemkkLNDVvngktnsmidvrrNSIKELTNVIQAYPSRY   86
DSSP  EEEEELLlllhhhlllhhhhhhhhhhHHHHhlllllllhhhhhHHHHHHHHHHHHLLLLE


DSSP  EEEEELL-LLLHHHHHHHHH-HHHHLLLLLEE-ELHHhllllLLLLLhhHHHHHHHHHH-
Query HPVGSIE-AATRKEAMAQMQ-EILDLGIRIVN-LEPGvwatpMHVDDrrLYPLYAFCED-  147
ident    |                  |          | |             | |      | 
Sbjct VGFGNVPvGLSENDTNSYIEeNIVNNKLVGIGeLTPA----sGQIKS--LKPIFKYSMDs  140
DSSP  EEEELLLlLLLHHHHHHHHHhHLLLLLLLEEEeELLL----lLLHHH--HHHHHHHHHHl


DSSP  LLLLEEEELLLLLlllHHHHlHHHHHHHHHHLLLLLEEEEHHHLLLHHHHHHHHHHLLLE
Query NGIPVIMMTGGNAgpdITYTnPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNL  207
ident    |                    |      ||   |   |            |    ||
Sbjct GSLPIWIHAFNPL---VLQD-IKEIAELCKAFPKVPVILGHMGGSNWMTAVELAKEIQNL  196
DSSP  LLLLEEELLLLLL---LHHH-HHHHHHHHHHLLLLLEEEHHHHHHHHHHHHHHHHHLLLE


DSSP  EEELHhHHLLlllHHHHHHHHLLhHHHLLLLLLLLLLLLHHHHHHHHHLLLLLHHHHHHH
Query YLSPDmYLYNlpgHADFIQAANSfLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKI  267
ident ||                   |  |     |||  |   |    |               
Sbjct YLDTS-AYFS---TFVLKIVINE-LPLKCIFGTDMPFGDLQLSIEAIKKMSNDSYVANAV  251
DSSP  EEELL-LLLL---HHHHHHHHHH-LLLLEELLLLLLLLLHHHHHHHHHHHLLLHHHHHHH


DSSP  HLHHHHHHHHhlll
Query LHGNAERLLAqagr  281
ident |  |  |||     
Sbjct LGDNISRLLN---i  262
DSSP  HLHHHHHHHL---l


No 3: Query=3irsA Sbjct=2dvtA Z-score=21.9

back to top
DSSP  -LLLEELLLLLllhHHHHLHhhHLHHHHHHhhhhhlllllhhHHHL---lHHHHHHHHHH
Query -LKIIDFRLRPpamGFLNARiyTRPDIRNRftrqlgfepapsAEEK---sLELMFEEMAA   56
ident                                                          | |
Sbjct mQGKVALEEHF---AIPETL--QDSAGFVP------gdywkeLQHRlldiQDTRLKLMDA   49
DSSP  lLLEEEEEEEE---LLHHHH--HHHLLLLL------llhhhhHHHHhhllLLHHHHHHHH


DSSP  LLLLEEEEELL---EELL--------leeLLHHHHHHHHHHLLLLEEEEEELLLLLHHHH
Query AGIEQGVCVGR---NSSV--------lgsVSNADVAAVAKAYPDKFHPVGSIEAATRKEA  105
ident  |||                           |   |      || |             |
Sbjct HGIETMILSLNapaVQAIpdrrkaieiarRANDVLAEECAKRPDRFLAFAALPLQDPDAA  109
DSSP  LLEEEEEEEELllhHHHLllhhhhhhhhhHHHHHHHHHHHHLLLLEEEEELLLLLLHHHH


DSSP  HHHHHHHH-HLLLLLEEELHhHLLL-----LLLLLLHHHHHHHHHHHHLLLLEEEElllL
Query MAQMQEIL-DLGIRIVNLEPgVWAT-----PMHVDDRRLYPLYAFCEDNGIPVIMMtggN  159
ident     |    |||                  |   |     |     |    |        
Sbjct TEELQRCVnDLGFVGALVNG-FSQEgdgqtPLYYDLPQYRPFWGEVEKLDVPFYLH---P  165
DSSP  HHHHHHHHhLLLLLEEEEEL-LLLLlllllLLLLLLHHHHHHHHHHHHHLLLEEEE---L


DSSP  LLLL---------------------HHHHL-HHHHH--HHHHHLLLLLEEEEHHHLLLHH
Query AGPD---------------------ITYTN-PEHID--RVLGDFPDLTVVSSHGNWPWVQ  195
ident   |                                         | |     |       
Sbjct RNPLpqdsriydghpwllgptwafaQETAVhALRLMasGLFDEHPRLNIILGHMGEGLPY  225
DSSP  LLLLhhhlhhhlllhhhlhhhlhhhHHHHHhHHHHHhlLHHHHLLLLLEEELHHHLLHHH


DSSP  H----------------------hHHHHHhlLLEEEELHHHHLLLlLHHHHHHHhllHHH
Query E----------------------iIHVAFrrPNLYLSPDMYLYNLpGHADFIQAansFLA  233
ident                                 |                | |       |
Sbjct MmwridhrnawvklpprypakrrfMDYFN--ENFHITTSGNFRTQ-TLIDAILE---IGA  279
DSSP  HhhhhhhllllllllllllllllhHHHHH--HHEEEELLLLLLHH-HHHHHHLL---LLH


DSSP  HLLLLLLLLLLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHHHlll
Query DRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQagr  281
ident || || |  |         ||    |      ||   || ||      
Sbjct DRILFSTDWPFENIDHASDWFNATSIAEADRVKIGRTNARRLFKL--d  325
DSSP  HHEELLLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHLLL--l


No 4: Query=3irsA Sbjct=4dlfA Z-score=21.3

back to top
DSSP  LLLEELLLLLLLhhhhHLHHhHLHHHHHhhhhhhlllllhhHHHLLH-HHHHHHHHHLLL
Query LKIIDFRLRPPAmgflNARIyTRPDIRNrftrqlgfepapsAEEKSL-ELMFEEMAAAGI   59
ident    ||                                         |       | |   
Sbjct ALRIDSHQHFWRyraaDYPW-IGAGMGV-------------LARDYLpDALHPLMHAQAL   46
DSSP  LLLEEEEELLLLllhhHLLL-LLLLLHH-------------HLLLLLhHHHHHHHHHLLL


DSSP  LEEEEELLEEllleeLLHHHHHHHHHHlLLLE-EEEEELLllLHHHHHHHHHHhHHLL-L
Query EQGVCVGRNSsvlgsVSNADVAAVAKAyPDKF-HPVGSIEaaTRKEAMAQMQEiLDLG-I  117
ident      |            |     |          ||               |       
Sbjct GASIAVQARA---grDETAFLLELACD-EARIaAVVGWED-lRAPQLAERVAE-WRGTkL  100
DSSP  LEEEEELLLL---lhHHHHHHHHHHLL-LLLEeEEEELLL-lLLLLHHHHHHL-LLLLlE


DSSP  LLEEELHHHLllLLLL--LLHH-HHHHHHHHHHLLLLEEEELLLlllllhhhHLHHHHHH
Query RIVNLEPGVWatPMHV--DDRR-LYPLYAFCEDNGIPVIMMTGGnagpdityTNPEHIDR  174
ident |                  |        |    |                          
Sbjct RGFRHQLQDE--ADVRafVDDAdFARGVAWLQANDYVYDVLVFE--------RQLPDVQA  150
DSSP  EEEEELHHHL--LLHHhhHHLHhHHHHHHHHHHLLLEEEELLLH--------HHHHHHHH


DSSP  HHHHLLLLLEEEEHHHLL--------------LHHHHHHHHHhLLLEEEELHHH------
Query VLGDFPDLTVVSSHGNWP--------------WVQEIIHVAFrRPNLYLSPDMY------  214
ident           |  |   |              |       |   |               
Sbjct FCARHDAHWLVLDHAGKPalaefdrddtalarWRAALRELAA-LPHVVCKLSGLvteadw  209
DSSP  HHHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHHHHHHHL-LLLEEEEELLLllllll


DSSP  ---------hlLLLLHHHHHHHHllhHHHLLLLLLLLLLL----LHHHHHHHHHLL---L
Query ---------lyNLPGHADFIQAAnsfLADRMLFGTAYPMC----PLKEYTEWFLTL---P  258
ident                      |       |  ||   | |       |            
Sbjct rrglrasdlrhIEQCLDAALDAF---GPQRLMFGSDWPVCllaaSYDEVASLVERWaesR  266
DSSP  lllllhhhhhhHHHHHHHHHHHH---LHHHEEELLLLLHHhhllLHHHHHHHHHHHhhhH


DSSP  LLHHHHHHHHLHHHHHHHHhlll
Query IKPDAMEKILHGNAERLLAqagr  281
ident            | | |  |    
Sbjct LSAAERSALWGGTAARCYA--lp  287
DSSP  LLHHHHHHHLLHHHHHHLL--ll


No 5: Query=3irsA Sbjct=4qrnA Z-score=20.5

back to top
DSSP  -------------LLLEELLLLLllhHHHHLH----------------hhhLHHHHHHhh
Query -------------LKIIDFRLRPpamGFLNAR----------------iytRPDIRNRft   31
ident                 |                                           
Sbjct smtqdlktggeqgYLRIATEEAF---ATREIIdvylrmirdgtadkgmvslWGFYAQS--   55
DSSP  lllllllllllllLLLEEEEEEE---LLHHHHhhhhhhhhhllllhhhhhhHHHHHHL--


DSSP  hhhlllllhHHHHL---lHHHHHHHHHHLLLLEEEEEL---LEELL--------leeLLH
Query rqlgfepapSAEEK---sLELMFEEMAAAGIEQGVCVG---RNSSV--------lgsVSN   77
ident             |      |     | | ||                            |
Sbjct ---pseratQILERlldlGERRIADMDATGIDKAILALtspGVQPLhdldeartlatRAN  112
DSSP  ---llhhhhHHHHHhhllLHHHHHHHHHLLLLEEEEEElllLLLLLllhhhhhhhhhHHH


DSSP  HHHHHHHHHLLLLEEEEEELLLLLHHHHHHHHHHHH-HLLLLLEEELhHHLLlLLLLLLH
Query ADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEIL-DLGIRIVNLEpGVWAtPMHVDDR  136
ident    |     ||| |   |                    ||                 |  
Sbjct DTLADACQKYPDRFIGMGTVAPQDPEWSAREIHRGArELGFKGIQIN-SHTQ-GRYLDEE  170
DSSP  HHHHHHHHHLLLLEEELLLLLLLLHHHHHHHHHHHHhLLLLLLEEEL-LLLL-LLLLLLH


DSSP  HHHHHHHHHHHLLLLEEEElllLLLLL--------------------HHHHL-HHHHH--
Query RLYPLYAFCEDNGIPVIMMtggNAGPD--------------------ITYTN-PEHID--  173
ident    |          |        |                                    
Sbjct FFDPIFRALVEVDQPLYIH---PATSPdsmidpmleagldgaifgfgVETGMhLLRLIti  227
DSSP  HHHHHHHHHHHHLLLEEEL---LLLLLllllhhhhhhlllllllhhhHHHHHhHHHHHhh


DSSP  HHHHHLLLLLEEEEHHHLLLHHH--------------------------hHHHHHhlLLE
Query RVLGDFPDLTVVSSHGNWPWVQE--------------------------iIHVAFrrPNL  207
ident       | |     |                                           | 
Sbjct GIFDKYPSLQIMVGHMGEALPYWlyrldymhqagvrsqryermkplkktiEGYLK--SNV  285
DSSP  LHHHHLLLLLEEELHHHHLHHHHhhhhhhhhhhhhhlllllllllllllhHHHHH--HLE


DSSP  EEELHHHHLllllHHHHHHHHLLHHHHLLLLLLLLLLLLHHHHHHHHHLLLLLHHHHHHH
Query YLSPDMYLYnlpgHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKI  267
ident                           ||      ||                      | 
Sbjct LVTNSGVAW----EPAIKFCQQVMGEDRVMYAMDYPYQYVADEVRAMDAMDMSAQTKKKF  341
DSSP  EEELLLLLL----HHHHHHHHHHHLHHHEELLLLLLLLLLHHHHHHHHLLLLLHHHHHHH


DSSP  HLHHHHHHHHHlll
Query LHGNAERLLAQagr  281
ident    |||        
Sbjct FQTNAEKWFKL---  352
DSSP  HLHHHHHHLLL---


No 6: Query=3irsA Sbjct=4hk5D Z-score=20.2

back to top
DSSP  -LLLEELLLLLLlhhHHHLhhHHLH-----------------------------------
Query -LKIIDFRLRPPamgFLNAriYTRP-----------------------------------   24
ident      |                                                      
Sbjct tPVVVDIHTHMY---PPSY--IAMLekrqtiplvrtfpqadeprlillsselaaldaala   55
DSSP  lLLLEEEEEEEL---LHHH--HHHHhlllllleeeeelleeeeeeellhhhhhhhhhhhh


DSSP  ------HHHHhhhhhhlllLLHHHhhLLHHHHHHHHHHLLLLEEEEEL---LEELL----
Query ------DIRNrftrqlgfePAPSAeeKSLELMFEEMAAAGIEQGVCVG---RNSSV----   71
ident         |                  ||      |   ||   |               
Sbjct dpaaklPGRP---------LSTHF--ASLAQKMHFMDTNGIRVSVISLanpWFDFLapde  104
DSSP  llllllLLEE---------LLHHH--LLHHHHHHHHHHLLLLEEEEEElllLLLLLllll


DSSP  ---leelLHHHHHHHHHHLLLLEEEEEELLL-LLHHHHHHHHHHHHHLL-LLLEEELHHh
Query ---lgsvSNADVAAVAKAYPDKFHPVGSIEA-ATRKEAMAQMQEILDLG-IRIVNLEPGv  126
ident         ||                      |      |       |   |   |    
Sbjct apgiadaVNAEFSDMCAQHVGRLFFFAALPLsAPVDAVKASIERVKNLKyCRGIILGTS-  163
DSSP  hhhhhhhHHHHHHHHHHLLLLLEEEEEELLLlLLHHHHHHHHHHHHLLLlEEEEEELLL-


DSSP  llLLLLLLLHHHHHHHHHHHHLLLLEEEElllLLLLL-----------------------
Query waTPMHVDDRRLYPLYAFCEDNGIPVIMMtggNAGPD-----------------------  163
ident        ||  | |      |    |                                  
Sbjct -gLGKGLDDPHLLPVFEAVADAKLLVFLH---PHYGLpnevygprseeyghvlplalgfp  219
DSSP  -lLLLLLLLHHHHHHHHHHHHLLLEEEEL---LLLLLlhhhhlllhhhlllhhhhhlhhh


DSSP  HHHHL-HHHHH--HHHHHLLLLLEEEEHHHLLLHHHH----------------------h
Query ITYTN-PEHID--RVLGDFPDLTVVSSHGNWPWVQEI----------------------i  198
ident    |          |      |     |                                
Sbjct METTIaVARMYmaGVFDHVRNLQMLLAHSGGTLPFLAgriescivhdghlvktgkvpkdr  279
DSSP  HHHHHhHHHHHhlLHHHHLLLLLEEEHHHHLLHHHHHhhhhhhhhllhhhhhllllllll


DSSP  hhHHHL--LLEEEELHhhHLLLllhHHHHHHHLlHHHHLLLLLLLLLLLL--------hH
Query hvAFRR--PNLYLSPDmyLYNLpghADFIQAANsFLADRMLFGTAYPMCP--------lK  248
ident            ||      |          |     |||  |||  |  |          
Sbjct rtIWTVlkEQIYLDAV--IYSE---VGLQAAIAsSGADRLMFGTDHPFFPpieedvqgpW  334
DSSP  llHHHHhhHLEEEELL--LLLH---HHHHHHHHhHLHHHEELLLLLLLLLlllllllllL


DSSP  HHHHHHHL--LLLL---HHHHHHHHLHHHHHHHH--------hlll
Query EYTEWFLT--LPIK---PDAMEKILHGNAERLLA--------qagr  281
ident                            || | |             
Sbjct DSSRLNAQavIKAVgegSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  HHHHHHHHhhHHHHlllLHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 7: Query=3irsA Sbjct=4ofcA Z-score=19.8

back to top
DSSP  lLLEELLLLLllhHHHH-------------------lhhHHLH-----HHHHhhhhhhll
Query lKIIDFRLRPpamGFLN-------------------ariYTRP-----DIRNrftrqlgf   36
ident    ||                                             |         
Sbjct -MKIDIHSHI---LPKEwpdlkkrfgyggwvqlqhhskgEAKLlkdgkVFRV--------   48
DSSP  -LLEEEEEEL---LLLLlllhhhhhllllleeeeeeellEEEEeelleEEEE--------


DSSP  lllhhhHHLL---HHHHHHHHHHLLLLEEEEELL--EELL---------leeLLHHHHHH
Query epapsaEEKS---LELMFEEMAAAGIEQGVCVGR--NSSV---------lgsVSNADVAA   82
ident               |    ||   |             |               | | | 
Sbjct ------VRENcwdPEVRIREMDQKGVTVQALSTVpvMFSYwakpedtlnlcqLLNNDLAS  102
DSSP  ------EEHHhllHHHHHHHHHHHLLLEEEEELLhhHHLLlllhhhhhhhhhHHHHHHHH


DSSP  HHHHLLLLEEEEEELLLLLHHHHHHHHHHHH-HLLLLLEEELHHHllLLLLLLLHHHHHH
Query VAKAYPDKFHPVGSIEAATRKEAMAQMQEIL-DLGIRIVNLEPGVwaTPMHVDDRRLYPL  141
ident     ||  |   |         |   |      ||   |     |           | | 
Sbjct TVVSYPRRFVGLGTLPMQAPELAVKEMERCVkELGFPGVQIGTHV--NEWDLNAQELFPV  160
DSSP  HHHHLLLLEEEEELLLLLLHHHHHHHHHHHHhLLLLLEEEEELEE--LLEELLLHHHHHH


DSSP  HHHHHHLLLLEEEELlllLLLL----------------hHHHL--HHHHH--HHHHHLLL
Query YAFCEDNGIPVIMMTggnAGPD----------------iTYTN--PEHID--RVLGDFPD  181
ident ||  |                                    |           |   || 
Sbjct YAAAERLKCSLFVHP---WDMQmdgrmakywlpwlvgmpAETTiaICSMImgGVFEKFPK  217
DSSP  HHHHHHHLLEEEEEL---LLLLllhhhhlllhhhhlhhhHHHHhhHHHHHllLHHHHLLL


DSSP  LLEEEEHHHLLLHHH------------------hhhhhHHLL-LEEEELHhhHLLLLLHH
Query LTVVSSHGNWPWVQE------------------iihvaFRRP-NLYLSPDmyLYNLPGHA  222
ident | |   ||                                     |              
Sbjct LKVCFAHGGGAFPFTvgrishgfsmrpdlcaqdnpmnpKKYLgSFYTDAL--VHDPLSLK  275
DSSP  LLEEELHHHLLHHHHhhhhhhhhhhlhhhhlllllllhHHHLlLLEEELL--LLLHHHHH


DSSP  HHHHHhllhHHHLLLLLLLLLL--LLHHhHHHHHHLL-LLLHHHHHHHHLHHHHHHHHH-
Query DFIQAansfLADRMLFGTAYPM--CPLKeYTEWFLTL-PIKPDAMEKILHGNAERLLAQ-  278
ident            |    || ||     |                   |   |||   |   
Sbjct LLTDV---iGKDKVILGTDYPFplGELE-PGKLIESMeEFDEETKNKLKAGNALAFLGLe  331
DSSP  HHHHH---hLLLLEELLLLLLLllLLLL-LLHHHHHLlLLLHHHHHHHHLHHHHHHHLLl


DSSP  -lll
Query -agr  281
ident     
Sbjct rkqf  335
DSSP  hhhl


No 8: Query=3irsA Sbjct=2qpxA Z-score=19.2

back to top
DSSP  -----------LLLEELLLLLLLHhhhhlhhhHLHHHHHHH-----------hHHHL--L
Query -----------LKIIDFRLRPPAMgflnariyTRPDIRNRF-----------tRQLG--F   36
ident                |                 |                   |     |
Sbjct gxddlsefvdqVPLLDHHCHFLID-gkvpnrdDRLAQVSTEadkdypladtknRLAYhgF   59
DSSP  lllllhhhhhhLLEEEEEELLLLL-lllllhhHHHHHHLLLllllllhhhhllLHHHhhH


DSSP  LLLH-------------hhhhlLHHHHHHHHHHLLLLEEEEELLEellleellhhhhhHH
Query EPAP-------------saeekSLELMFEEMAAAGIEQGVCVGRNssvlgsvsnadvaAV   83
ident                                                             
Sbjct LALAkefaldannplaaxndpgYATYNHRIFGHFHFKELLIDTGF-------vpddpiLD  112
DSSP  HHHHhhhllllllllllllhhhHHHHHHHHHHHLLEEEEEEELLL-------llllllLL


DSSP  HHHLL----LLEEEEEEL--LLLL-----------HHHHHHHHHHHHHLLLLLEEELHHH
Query AKAYP----DKFHPVGSI--EAAT-----------RKEAMAQMQEILDLGIRIVNLEPGV  126
ident                      |                           |          
Sbjct LDQTAelvgIPVKAIYRLetHAEDfxlehdnfaawWQAFSNDVKQAKAHGFVGFXSIAAY  172
DSSP  HHHHHhhhlLLEEEEEEHhhHHHHhhlllllhhhhHHHHHHHHHLLLLLLLLLEEELHHH


DSSP  lllLLLLL------------------------------LHHHHHHHHHHHHLLLLEEEEL
Query watPMHVD------------------------------DRRLYPLYAFCEDNGIPVIMMT  156
ident                                       |  ||    |      |     
Sbjct ---RVGLHlepvnvieaaagfdtwkhsgekrltskpliDYXLYHVAPFIIAQDXPLQFHV  229
DSSP  ---HLLLLlllllhhhhhhhhhhhhhhlllllllhhhhHHHHHHHHHHHHHHLLLEEEEE


DSSP  LLL-llLLHHHHLHHHHHHHHHHLL--LLLEEEEHhHLLLHHHHHHHHHHLLLEEEELHH
Query GGN-agPDITYTNPEHIDRVLGDFP--DLTVVSSHgNWPWVQEIIHVAFRRPNLYLSPDM  213
ident |      |    ||      |  |    | ||  |   |   |    |   ||||     
Sbjct GYGdadTDXYLGNPLLXRDYLKAFTkkGLKVVLLH-CYPYHREAGYLASVFPNLYFDISL  288
DSSP  LLLlllLLHHHLLHHHHHHHHHHHHhhLLLEEEEE-LLLLHHHHHHHHHHLLLEEEELLL


DSSP  H---HLLL--LLHHHHHHHhllHHHHLLLLLLLLL--llLHHHHHHHHHL--LLLL----
Query Y---LYNL--PGHADFIQAansFLADRMLFGTAYP--mcPLKEYTEWFLT--LPIK----  260
ident                           | ||                 |            
Sbjct LdnlGPSGasRVFNEAVEL---APYTRILFASDAStypeXYGLAARQFKQalVAHFnqlp  345
DSSP  HhhhLHHHhhHHHHHHLLL---LLHHHEELLLLLLllhhHHHHHHHHHHHhhHHHHhlll


DSSP  -------HHHHHHHHLHHHHHHHH---hlll
Query -------PDAMEKILHGNAERLLA---qagr  281
ident              |       |         
Sbjct fvdlaqkKAWINAICWQTSAKLYHqerelrv  376
DSSP  lllhhhhHHHHHHHHLHHHHHHLLlhhhhll


No 9: Query=3irsA Sbjct=2ffiA Z-score=19.2

back to top
DSSP  --lLLEELLLLLLL---hhhhhlhhHHLHhhhhhhhhhhlllllhhhhHLLHHHHHHHHH
Query --lKIIDFRLRPPA---mgflnariYTRPdirnrftrqlgfepapsaeEKSLELMFEEMA   55
ident      ||                                            |        
Sbjct lhlTAIDSHAHVFSrglnlasqrryAPNY-------------------DAPLGDYLGQLR   41
DSSP  lllLLEELLLLLLLhhhhhhlllllLLLL-------------------LLLHHHHHHHHH


DSSP  HLLLLEEEEELLeellLEEL-LHHHHHHHHHHLLLLEEEEEELLlllhhHHHHhhHHHHH
Query AAGIEQGVCVGRnssvLGSV-SNADVAAVAKAYPDKFHPVGSIEaatrkEAMAqmQEILD  114
ident | |   || |            |          |     |   |                
Sbjct AHGFSHGVLVQP----SFLGtDNRYLLSALQTVPGQLRGVVXLE-----RDVE-qATLAE   91
DSSP  HLLLLEELLLLL----HHHLlLLHHHHHHHHHLLLLLLLLLLLL-----LLLL-hHHHHH


DSSP  LL---LLLEEELHHHLllLLLLLLH-HHHHHHHHHHHLLLLEEEELLllllllhhHHLHH
Query LG---IRIVNLEPGVWatPMHVDDR-RLYPLYAFCEDNGIPVIMMTGgnagpditYTNPE  170
ident       | | |                  ||       |  |                | 
Sbjct XArlgVRGVRLNLXGQ--DXPDLTGaQWRPLLERIGEQGWHVELHRQ-------vADIPV  142
DSSP  HHlllLLEEELLLLLL--LLLLLLLlLLHHHHHHHHHHLLEEEELLL-------lLLHHH


DSSP  HHHHHhHHLLlLLEEEEHHHLL---------LHHHHHHhhHHLL-LEEEELHHH------
Query HIDRVlGDFPdLTVVSSHGNWP---------WVQEIIHvaFRRP-NLYLSPDMY------  214
ident            |  |  |   |            |                         
Sbjct LVRAL-QPYG-LDIVIDHFGRPdarrglgqpGFAELLT--LSGRgKVWVKVSGIyrlqgs  198
DSSP  HHHHH-LLLL-LLEEELHHHLLlllllllllLHHHHLL--LLLLlLEEEEEELHhhllll


DSSP  --hLLLLLHHHHHHHHLLHHHHLLLLLLLLLL------LLHHHHHHHHHLLLLLHHHHHH
Query --lYNLPGHADFIQAANSFLADRMLFGTAYPM------CPLKEYTEWFLTLPIKPDAMEK  266
ident                     | |   |   |              | |  |         
Sbjct peeNLAFARQALCALEAHYGAERLXWGSDWPHtqheseVSFGSAVEQFEALGCSAQLRQA  258
DSSP  hhhHHHHHHHHHHHHHHHLLHHHEEEELLLLLllllllLLHHHHHHHHHHHLLLHHHHHH


DSSP  HHLHHHHHHHHhlll
Query ILHGNAERLLAqagr  281
ident  |   |  |      
Sbjct LLLDTARALFGfele  273
DSSP  HHLHHHHHHLLllll


No 10: Query=3irsA Sbjct=1gkpA Z-score=18.8

back to top
DSSP  ---------------------------------------------------LLLEELLLL
Query ---------------------------------------------------LKIIDFRLR    9
ident                                                       ||    
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  LllhhHHHL--HHHHlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELL
Query PpamgFLNA--RIYTrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGR   67
ident       |                                 |         |         
Sbjct I----YLPFmaTFAK----------------------DTHETGSKAALMGGTTTYIEMCC   94
DSSP  L----LLEEllEELL----------------------LLHHHHHHHHHHLLEEEEEEEEL


DSSP  EEL-lleelLHHHHHHHHHHL-lLLEEEEEELLLLLhHHHHHHHHHHHHLLLLLEEELHH
Query NSS-vlgsvSNADVAAVAKAY-pDKFHPVGSIEAATrKEAMAQMQEILDLGIRIVNLEPG  125
ident  |               |                        |  ||   ||        
Sbjct PSRnddaleGYQLWKSKAEGNsyCDYTFHMAVSKFD-EKTEGQLREIVADGISSFXIFLS  153
DSSP  LLLlllhhhHHHHHHHHHLLLllLEEEEEEELLLLL-LLHHHHHHHHHHLLLLEEEEEEL


DSSP  HLL-LLLLllLHHHHHHHHHHHHLLLLEEEELlllLLLLH--------------------
Query VWA-TPMHvdDRRLYPLYAFCEDNGIPVIMMTggnAGPDI--------------------  164
ident           |   |         |  |                                
Sbjct YKNfFGVD--DGEMYQTLRLAKELGVIVTAHC--eNAELVgrlqqkllsegktgpewhep  209
DSSP  LLLlLLLL--HHHHHHHHHHHHHHLLEEEEEE--lLHHHHhhhhhhhhhlllllhhhlll


DSSP  ----hHHLH--HHHHHHHHHLLlLLEEEEHHhlllHHHHHHHHHHLL----LEEEELH-H
Query ----tYTNP--EHIDRVLGDFPdLTVVSSHGnwpwVQEIIHVAFRRP----NLYLSPD-M  213
ident                  |      |    |            |          |      
Sbjct srpeaVEAEgtARFATFLETTG-ATGYVVHL---sCKPALDAAMAAKargvPIYIESViP  265
DSSP  lllhhHHHHhhHHHHHHHHHHL-LEEEELLL---lLHHHHHHHHHHHhlllLEEEEEEhH


DSSP  HHLLL-----------------------LLHHHHHHHHLLHHhhLLLLLLLLL-------
Query YLYNL-----------------------PGHADFIQAANSFLadRMLFGTAYP-------  243
ident                                     |           ||          
Sbjct HFLLDktyaerggveamkyimspplrdkRNQKVLWDALAQGF--IDTVGTDHCpfdteqk  323
DSSP  HHHLLhhhhhllhhhhhlllllllllllHHHHHHHHHHHLLL--LLEEELLLLlllhhhh


DSSP  -------------LLLHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHH--------
Query -------------MCPLKEYTEWFLTLP-----IKPDAMEKILHGNAERLLA--------  277
ident                          |                    |  |          
Sbjct llgkeaftaipngIPAIEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGlfprkgti  383
DSSP  hhhlllhhhllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct avgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvg  443
DSSP  llllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleell


DSSP  ---------HLLL--
Query ---------QAGR--  281
ident                
Sbjct ekgwgkllrREPMyf  458
DSSP  lllllllllLLLLll


No 11: Query=3irsA Sbjct=2gwgA Z-score=18.3

back to top
DSSP  lLLEELLLLLLLH----hhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHH-HHHHH
Query lKIIDFRLRPPAM----gflnariytrpdirnrftrqlgfepapsaeeKSLELM-FEEMA   55
ident   |||                                            |          
Sbjct -XIIDIHGHYTTApkaledwrnrqiagikdpsvxpkvselkisddelqASIIENqLKKXQ   59
DSSP  -LLEEEEEELLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHLLhHHHHH


DSSP  HLLLLEEEEELL-----eellleeLLHHHHHHHHHHLLLLEEEEEELLL---LLHHHHHH
Query AAGIEQGVCVGR-----nssvlgsVSNADVAAVAKAYPDKFHPVGSIEA---ATRKEAMA  107
ident   |    |   |              |     |    || |              |    
Sbjct ERGSDLTVFSPRagdfnvsstwaaICNELCYRVSQLFPDNFIGAAXLPQspgVDPKTCIP  119
DSSP  HHLLLEEEEELLlllhhhhhhhhhHHHHHHHHHHHHLLLLEEEEEELLLlllLLHHHHHH


DSSP  HHHHHH-HLLLLLEEELhHHLL----LLLLLLLHHHHHHHHHHHHLLLLEEEE-----lL
Query QMQEIL-DLGIRIVNLEpGVWA----TPMHVDDRRLYPLYAFCEDNGIPVIMM-----tG  157
ident          |    ||          |     ||  || |       ||           
Sbjct ELEKCVkEYGFVAINLN-PDPSgghwTSPPLTDRIWYPIYEKXVELEIPAXIHvstgahY  178
DSSP  HHHHHHhLLLLLEEEEL-LLLLllllLLLLLLLHHHHHHHHHHHHHLLLEEELlllllhH


DSSP  LLLlllhhhHLHHHHH--HHHHHLLLLLEEEEHHHLLLHHH------------hhHHHHH
Query GNAgpdityTNPEHID--RVLGDFPDLTVVSSHGNWPWVQE------------iiHVAFR  203
ident  ||      |            ||| |  |  ||                          
Sbjct LNA----dtTAFXQCVagDLFKDFPELKFVIPHGGGAVPYHwgrfrglaqexkkpLLEDH  234
DSSP  HHH----hhHHHHHHHhlLHHHHLLLLLEEELHHHLLLHHHhhhhhhhhhhllllLHHHH


DSSP  L-LLEEEELHhhHLLLLLHHHHHHHHllhHHHLLLLLLLL-LLLL---------hhHHHH
Query R-PNLYLSPDmyLYNLPGHADFIQAAnsfLADRMLFGTAY-PMCP---------lkEYTE  252
ident    |         |  ||             |  ||                        
Sbjct VlNNIFFDTC--VYHQPGIDLLNTVI---PVDNVLFASEXiGAVRgidprtgfyydDTKR  289
DSSP  LlLLEEEELL--LLLHHHHHHHHHHL---LHHHEELLLLLlLLLLleelllleellLLHH


DSSP  HHHLL-LLLHHHHHHHHLHHHHHHHHHL----------ll
Query WFLTL-PIKPDAMEKILHGNAERLLAQA----------gr  281
ident          |     |  ||| |                 
Sbjct YIEAStILTPEEKQQIYEGNARRVYPRLdaalkakgkleh  329
DSSP  HHHHLlLLLHHHHHHHHLHHHHHHLHHHhhhhhhhhhhll


No 12: Query=3irsA Sbjct=4b3zD Z-score=18.3

back to top
DSSP  ----------------------------------------------------LLLEELLL
Query ----------------------------------------------------LKIIDFRL    8
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  LLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhHHLLHHHHHHHHHHLLLLEEEEELLE
Query RPPAmgflnariytrpdirnrftrqlgfepapsaEEKSLELMFEEMAAAGIEQGVCVGRN   68
ident                                                  |          
Sbjct YLQK-----------------------------tAADDFFQGTRAALVGGTTMIIDHVVP   91
DSSP  LLLL-----------------------------lLLLLHHHHHHHHHHLLEEEEEEEELL


DSSP  EL-lleelLHHHHHHHHHHLL-LLEEEEEELLLLLhHHHHHHHHHHH-HLLLLLEEELHH
Query SS-vlgsvSNADVAAVAKAYP-DKFHPVGSIEAATrKEAMAQMQEIL-DLGIRIVNLEPG  125
ident         |       |             |                 | |         
Sbjct EPgsslltSFEKWHEAADTKScCDYSLHVDITSWY-DGVREELEVLVqDKGVNSFQVYMA  150
DSSP  LLlllhhhHHHHHHHHHHLLLlLEEEEEEELLLLL-LLHHHHHHHHHhLLLLLEEEEELL


DSSP  HLLLLLLllLHHHHHHHHHHHHLLLLEEEELllllLLLH---------------------
Query VWATPMHvdDRRLYPLYAFCEDNGIPVIMMTggnaGPDI---------------------  164
ident          |  ||    |    |           |  |                     
Sbjct YKDVYQM-sDSQLYEAFTFLKGLGAVILVHA--enGDLIaqeqkrilemgitgpeghals  207
DSSP  LLLLLLL-lHHHHHHHHHHHHHHLLEEEEEL--llHHHHhhhhhhhhhllllllhhhhhh


DSSP  --hhHLHHHHHHHHHHLL--LLLEEEEHHHlllHHHHHHHHHHLL----LEEEELH-HHH
Query --tyTNPEHIDRVLGDFP--DLTVVSSHGNwpwVQEIIHVAFRRP----NLYLSPD-MYL  215
ident        |   |           |                              |    |
Sbjct rpeeLEAEAVFRAITIAGriNCPVYITKVM---SKSAADIIALARkkgpLVFGEPIaASL  264
DSSP  llhhHHHHHHHHHHHHHHhhLLLEEEEEEL---LHHHHHHHHHHHhhllLEEEEELhHHH


DSSP  LLL-------------------------LLHHHHHHHHLLHHhhLLLLLLLLL-------
Query YNL-------------------------PGHADFIQAANSFLadRMLFGTAYP-------  243
ident                                                 |           
Sbjct GTDgthywsknwakaaafvtspplspdpTTPDYLTSLLACGD--LQVTGSGHCpystaqk  322
DSSP  HLLlhhhhlllhhhhhhlllllllllllLHHHHHHHHHHHLL--LLLLLLLLLlllhhhh


DSSP  -------------LLLHHHHHHHHHLL-----LLLHHHHHHHHLHHHHHHHH--------
Query -------------MCPLKEYTEWFLTL-----PIKPDAMEKILHGNAERLLA--------  277
ident                   |                          ||             
Sbjct avgkdnftlipegVNGIEERMTVVWDKavatgKMDENQFVAVTSTNAAKIFNlyprkgri  382
DSSP  hhhlllhhhllllLLLLLLHHHHHHHHhllllLLLHHHHHHHHLHHHHHHHLllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct avgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninv  442
DSSP  llllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleell


DSSP  ---------HLLL----------------------
Query ---------QAGR----------------------  281
ident                                    
Sbjct nkgmgrfipRKAFpehlyqrvkirnkvfglqgvsr  477
DSSP  lllllllllLLLLlhhhhhhhhhhhhhllllllll


No 13: Query=3irsA Sbjct=4mupB Z-score=18.2

back to top
DSSP  ---------------LLLEELLLLLLLHhHHHL----HHHHlhhhhhhhhhhhlllllhh
Query ---------------LKIIDFRLRPPAMgFLNA----RIYTrpdirnrftrqlgfepaps   41
ident                    |                                        
Sbjct lvrklsgtapnpafpRGAVDTQMHMYLPgYPALpggpGLPP-------------------   41
DSSP  lllllllllllllllLLLEELLLLLLLLlLLLLllllLLLL-------------------


DSSP  hHHLLH-HHHHHHHHHLLLLEEEEELLeellLEEL-LHHHHHHHHHHLLLLEEEEEELll
Query aEEKSL-ELMFEEMAAAGIEQGVCVGRnssvLGSV-SNADVAAVAKAYPDKFHPVGSIea   99
ident        |     |   ||                  |    |         | |  |  
Sbjct -GALPGpEDYRRLMQWLGIDRVIITQG----NAHQrDNGNTLACVAEMGEAAHAVVII--   94
DSSP  -LLLLLhHHHHHHHHHHLLLEEEEELL----HHHLlLLHHHHHHHHHHHHHEEEEELL--


DSSP  llhHHHH-HHHHHHHHLLLLLEEELHHHLllllLLLLhhHHHHHHHHHHLLLLEEEELLl
Query atrKEAM-AQMQEILDLGIRIVNLEPGVWatpmHVDDrrLYPLYAFCEDNGIPVIMMTGg  158
ident           |      |                     |             |      
Sbjct --dATTTeKDMEKLTAAGTVGARIMDLPG-gavNLSE--LDAVDERAHAADWMVAVQFD-  148
DSSP  --lLLLLhHHHHHHHHLLEEEEEEELLLL-lllLHHH--HHHHHHHHHHLLLEEEEELL-


DSSP  lllllhhhHLHHHHHHHHHHLlLLLEEEEHHHLL--LHHH---hHHHHHHLL---LEEEE
Query nagpdityTNPEHIDRVLGDFpDLTVVSSHGNWP--WVQE---iIHVAFRRP---NLYLS  210
ident                  |        |  |                         ||   
Sbjct -------gNGLLDHLPRLQKI-RSRWVFDHHGKFfkGIRTdgpeMAALLKLIdrgNLWFK  200
DSSP  -------hHHHHHHHHHHHLL-LLEEEELHHHHLllLLLLllhhHHHHHHHHhhlLEEEE


DSSP  LHHHH-------lLLLLHHHHHHHHlLHHHHLLLLLLLLLL------llhhHHHHHHHL-
Query PDMYL-------yNLPGHADFIQAAnSFLADRMLFGTAYPM------cplkEYTEWFLT-  256
ident                   |     |      |   ||  |                    
Sbjct FAGVYessrkswpYADVAAFSRVIA-AHAPERIVWGTNWPHnsvretaaypDDARLAELt  259
DSSP  ELLHHhlllllllLHHHHHHHHHHH-HHLHHHEEELLLLLLlllllhhhllLHHHHHHHh


DSSP  -LLLL-HHHHHHHHLHHHHHHHHHlll
Query -LPIK-PDAMEKILHGNAERLLAQagr  281
ident         |    |  | | |      
Sbjct lGWLPdEAARHRALVENPEALFKLspv  286
DSSP  hLLLLlHHHHHHHHLHHHHHHHLLlll


No 14: Query=3irsA Sbjct=3pnuA Z-score=18.2

back to top
DSSP  ------------LLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHH
Query ------------LKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeeKSLE   48
ident                 |  |                                      ||
Sbjct enlyfqsnamklKNPLDMHLHLRD-------------------------------nQMLE   29
DSSP  llllllllleeeELLEEEEELLLL-------------------------------hHHHH


DSSP  HHHHHHHHlLLLEEEEELLeelllEELLHH-HHHHHHHHLL-------LLEEEEEELLLl
Query LMFEEMAAaGIEQGVCVGRnssvlGSVSNA-DVAAVAKAYP-------DKFHPVGSIEAa  100
ident |     |       |             |  |  |                         
Sbjct LIAPLSAR-DFCAAVIMPN---liPPLCNLeDLKAYKMRILkackdenFTPLMTLFFKN-   84
DSSP  HHHHHHHL-LLLEEEELLL---llLLLLLHhHHHHHHHHHHhhhllllLEEEEEEELLL-


DSSP  lhhHHHHHHHHHHHlLLLLEEELHHH------LLLLLLllLHHHHHHHHHHHHLLLLEEE
Query trkEAMAQMQEILDlGIRIVNLEPGV------WATPMHvdDRRLYPLYAFCEDNGIPVIM  154
ident              |  |    | |                   | |      |  ||   
Sbjct ---YDEKFLYSAKD-EIFGIXLYPAGittnsnGGVSSF-dIEYLKPTLEAMSDLNIPLLV  139
DSSP  ---LLHHHHHHHLL-LLLEEEELLLLllllllLLLLLL-lHHHHHHHHHHHHHLLLLEEE


DSSP  ELlllLLLL--HHHH--LHHHHHHHHHHLLLLLEEEEhHHLLlhHHHHHHHHHLLLEEEE
Query MTggnAGPD--ITYT--NPEHIDRVLGDFPDLTVVSShGNWPwvQEIIHVAFRRPNLYLS  210
ident         |                   || |  |                    |||  
Sbjct HG---ETNDfvMDREsnFAKIYEKLAKHFPRLKIVME-HITT--KTLCELLKDYENLYAT  193
DSSP  LL---LLLLlhHHLLhhHHHHHHHHHHHLLLLLEEEL-LLLL--HHHHHHHHHLLLEEEE


DSSP  LH-HHHLLL----------------------LLHHHHHHHHLLhhHHLLLLLLLLL----
Query PD-MYLYNL----------------------PGHADFIQAANSflADRMLFGTAYP----  243
ident      |                                  | |       ||        
Sbjct ITlHHLIITlddviggkmnphlfckpiakryEDKEALCELAFS-gYEKVMFGSDSAphpk  252
DSSP  ELlHHHLLLhhhhhlllllhhhllllllllhHHHHHHHHHHHL-lLLLEEELLLLLllll


DSSP  -----LLLHHHHHHHHHLL---LLLHHHHHHHHLHHHHHHHHH-----------------
Query -----MCPLKEYTEWFLTL---PIKPDAMEKILHGNAERLLAQ-----------------  278
ident                   |           | |  |                        
Sbjct gcaagVFSAPVILPVLAELfkqNSSEENLQKFLSDNTCKIYDLkfkedkiltleekewqv  312
DSSP  lllllLLLHHHHHHHHHHHhhhHLLHHHHHHHHLHHHHHHHLLlllllleeeeellleel


DSSP  -----------------------lll
Query -----------------------agr  281
ident                           
Sbjct pnvyedkynqvvpymageilkfqlkh  338
DSSP  llleelllleellllllleelleell


No 15: Query=3irsA Sbjct=2vunA Z-score=18.1

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------L    1
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE


DSSP  LLEELLLLLLLHhhhhlhhhhlhhhhhhhhhhhlllllhhHHHLLhhHHHHHHHHLLLLE
Query KIIDFRLRPPAMgflnariytrpdirnrftrqlgfepapsAEEKSleLMFEEMAAAGIEQ   61
ident    |                                                    |   
Sbjct GLLDTHVHVSGG------------------------dyapRQKTM--DFISSALHGGVTT   94
DSSP  LEEEEEELLLLL------------------------leehHHLEE--LHHHHHHLLLEEE


DSSP  EEEELLE-elLLEE------lLHHHHHHHHHHLL---LLEEE-EEELLLLlhhHHHHHHH
Query GVCVGRN-ssVLGS------vSNADVAAVAKAYP---DKFHP-VGSIEAAtrkEAMAQMQ  110
ident     |                                 | |      |            
Sbjct MISAGSPhfpGRPKdaagtkaLAITLSKSYYNARpagVKVHGgAVILEKG---LTEEDFI  151
DSSP  EEELLLLlllLLLLlhhhhhhHHHHHHHHHHHLLhhhLEEELlEELLLLL---LLHHHHH


DSSP  HHHHLLLLLEE-ELHHHLllllLLLLhHHHHHHHHHHHLLLLEEEELLLlLLLL-HHHHL
Query EILDLGIRIVN-LEPGVWatpmHVDDrRLYPLYAFCEDNGIPVIMMTGGnAGPD-ITYTN  168
ident |    |  ||     |              |        |  | | |||           
Sbjct EMKKEGVWIVGeVGLGTI----KNPE-DAAPMVEWAHKHGFKVQMHTGG-TSIPgSSTVT  205
DSSP  HHHHLLLLEEEeELLLLL----LLHH-HHHHHHHHHHHLLLEEEEELLL-LLLLlLLLLL


DSSP  HHHHHHHHhhllllLEEEEHH----hLLLHHHHHHHHHHLLlEEEELH-HHHLllLLHHH
Query PEHIDRVLgdfpdlTVVSSHG----nWPWVQEIIHVAFRRPnLYLSPD-MYLYnlPGHAD  223
ident                 | ||         |||                            
Sbjct ADDVIKTK------PDVVSHInggptAISVQEVDRIMDETD-FAMEIVqCGNP--KIADY  256
DSSP  HHHHHHHL------LLEEELLlllllLLLHHHHHHHHHHLL-LEEEEElLLLH--HHHHH


DSSP  HHHHHLL-HHHHLLLLLLLLLL---LLHHhHHHHHHLL-----LLLHHHHHHHHLHHHHH
Query FIQAANS-FLADRMLFGTAYPM---CPLKeYTEWFLTL-----PIKPDAMEKILHGNAER  274
ident     |       |  ||   |                       | |        ||   
Sbjct VARRAAEkGQLGRVIFGNDAPSgtgLIPL-GILRNMCQiasmsDIDPEVAVCMATGNSTA  315
DSSP  HHHHHHHhLLHHHEEEELLLLLlllLLLL-HHHHHHHHhhhhlLLLHHHHHHHHLHHHHH


DSSP  HHHH--------------------------------------------------------
Query LLAQ--------------------------------------------------------  278
ident                                                             
Sbjct VYGLntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrnt  375
DSSP  HHLLlllllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllll


DSSP  -------lll
Query -------agr  281
ident           
Sbjct ppakraakil  385
DSSP  llllllleel


No 16: Query=3irsA Sbjct=2y1hB Z-score=17.8

back to top
DSSP  -LLLEELLLLLllhHHHHlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLL
Query -LKIIDFRLRPpamGFLNariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGI   59
ident      |                                         |    |    |  
Sbjct gVGLVDCHCHL---SAPD-------------------------fdRDLDDVLEKAKKANV   32
DSSP  lLLEEEEEELL---LLHH-------------------------hlLLHHHHHHHHHHLLE


DSSP  LEEEEELLEellleelLHHHHHHHHHHLLLLEEEEEEL--------llLLHHHHHHHHHH
Query EQGVCVGRNssvlgsvSNADVAAVAKAYPDKFHPVGSI--------eaATRKEAMAQMQE  111
ident    | |                     |     |               | |        
Sbjct VALVAVAEH-----sgEFEKIMQLSERYNGFVLPCLGVhpvqgldqrsVTLKDLDVALPI   87
DSSP  EEEEELLLL-----hhHHHHHHHHHHHLLLLEEEEELLlleelllleeLLHHHHHHHHHH


DSSP  HHHL--LLLLE-EELHH-------hlLLLLlllLHHHHHHHHHHHHLLLLEEEELLllll
Query ILDL--GIRIV-NLEPG-------vwATPMhvdDRRLYPLYAFCEDNGIPVIMMTGgnag  161
ident |                                   |            ||         
Sbjct IENYkdRLLAIgEVGLDfsprfagtgEQKE-eqRQVLIRQIQLAKRLNLPVNVHSR----  142
DSSP  HHHHllLLLEEeEEEEEllllllllhHHHH-hhHHHHHHHHHHHHHHLLLEEEEEE----


DSSP  llhhHHLHHHHHHHHHHLLlLLEEEEHHhLLLHHHHHHHHHhlLLEEEELHHHHLLLLL-
Query pditYTNPEHIDRVLGDFPdLTVVSSHGnWPWVQEIIHVAFrrPNLYLSPDMYLYNLPG-  220
ident           |           |                         |           
Sbjct ----SAGRPTINLLQEQGA-EKVLLHAF-DGRPSVAMEGVR--AGYFFSIPPSIIRSGQk  194
DSSP  ----LLHHHHHHHHHHLLL-LLEEEELL-LLLHHHHHHHHH--LLLEEEELHHHHLLHHh


DSSP  HHHHHHHhllhHHHLLLLLLLLLL--------LLHHhHHHHHHL--LLLL----HHHHHH
Query HADFIQAansfLADRMLFGTAYPM--------CPLKeYTEWFLT--LPIK----PDAMEK  266
ident      |             |  |                          |        | 
Sbjct QKLVKQL----PLTSICLETDSPAlgpekqvrNEPW-NISISAEyiAQVKgisvEEVIEV  249
DSSP  HHHHHHL----LHHHEEELLLLLLllllllllLLHH-HHHHHHHhhHHHHlllhHHHHHH


DSSP  HhLHHHHHHHHH--lll
Query IlHGNAERLLAQ--agr  281
ident     ||  |        
Sbjct T-TQNALKLFPKlrhll  265
DSSP  H-HHHHHHHLLLhhhhl


No 17: Query=3irsA Sbjct=4dziC Z-score=17.5

back to top
DSSP  ---LLLEELLLLLllhhHHHL-------------------------------------hh
Query ---LKIIDFRLRPpamgFLNA-------------------------------------ri   20
ident       ||                                                    
Sbjct alnYRVIDVDNHY----YEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipn   56
DSSP  lllLLEEEEEEEL----LLLLllllllllhhhlllleeeeelllleeeeelleellllll


DSSP  hHLHHHHHhhHHHHLL--------------lllhhhHHLLH----HHHHHHHHHLLLLEE
Query yTRPDIRNrfTRQLGF--------------epapsaEEKSL----ELMFEEMAAAGIEQG   62
ident  |   |                                             |    ||  
Sbjct pTFDPIIV-pGCLDLLfrgeipdgvdpaslmkverlADHPEyqnrDARIAVMDEQDIETA  115
DSSP  lLLLLEEL-lLLLHHHhhllllllllhhhllleelhHHLHHhllhHHHHHHHHHHLEEEE


DSSP  EEEL--LEELLL------------eelLHHHHHHHHH--HLLLLEEEEEELLLLLHHHHH
Query VCVG--RNSSVL------------gsvSNADVAAVAK--AYPDKFHPVGSIEAATRKEAM  106
ident                             |                        |    | 
Sbjct FMLPtfGCGVEEalkhdieatmasvhaFNLWLDEDWGfdRPDHRIIAAPIVSLADPTRAV  175
DSSP  EEELlhHHHHHHhllllhhhhhhhhhhHHHHHHHHLLllLLLLLEEELLLLLLLLHHHHH


DSSP  HHHHHHHHLLLLLEEELHHHLLL---LLLLLLHHHHHHHHHHHHLLLLEEEEllLLLLLL
Query AQMQEILDLGIRIVNLEPGVWAT---PMHVDDRRLYPLYAFCEDNGIPVIMMtgGNAGPD  163
ident       |  |   |   |        |    ||   |  |     | ||           
Sbjct EEVDFVLARGAKLVLVRPAPVPGlvkPRSLGDRSHDPVWARLAEAGVPVGFH--LSDSGY  233
DSSP  HHHHHHHHLLLLLEELLLLLLLLlllLLLLLLHHHHHHHHHHHHHLLLEEEE--LLLLLL


DSSP  --------------------hHHHL--HHHHH--HHHHHLLLLLEEEEHHHLLLHHHHH-
Query --------------------iTYTN--PEHID--RVLGDFPDLTVVSSHGNWPWVQEII-  198
ident                                    |    | |  ||       |   | 
Sbjct lhiaaawggakdpldqvllddRAIHdtMASMIvhGVFTRHPKLKAVSIENGSYFVHRLIk  293
DSSP  hhhhhhllllllhhhhhhhllHHHHhhHHHHHhlLHHHHLLLLLEEEELLLLLHHHHHHh


DSSP  --------------hhHHHL--LLEEEELhhhHLLLllhhHHHHHHLLHHHHLLLLLLLL
Query --------------hvAFRR--PNLYLSPdmyLYNLpghaDFIQAANSFLADRMLFGTAY  242
ident                        |    |    |      |    |     |  |||   
Sbjct rlkkaantqpqyfpedPVEQlrNNVWIAP---YYED----DLPELARVIGVDKILFGSDW  346
DSSP  hhhhhhhhlhhhllllHHHHhhHHEEELL---LLLL----LHHHHHHHHLHHHLLLLLLL


DSSP  L---LLLHhhhHHHHHLL--LLLHHHHHHHHLHHHHHHHHH-lll
Query P---MCPLkeyTEWFLTL--PIKPDAMEKILHGNAERLLAQ-agr  281
ident |             |             ||   ||  ||      
Sbjct PhgeGLAS---PVSFTAElkGFSESDIRKIMRDNALDLLGVqvgs  388
DSSP  LlllLLLL---HHHHHHHhlLLLHHHHHHHHLHHHHHHHLLllll


No 18: Query=3irsA Sbjct=1bf6A Z-score=16.8

back to top
DSSP  ----LLLEELLLLLLlhhHHHLhhhHLHHHHhhhhhhhlllllhhhhhLLHHHHHHHHHH
Query ----LKIIDFRLRPPamgFLNAriyTRPDIRnrftrqlgfepapsaeeKSLELMFEEMAA   56
ident                                                         ||  
Sbjct sfdpTGYTLAHEHLH---IDLS--gFKNNVD--------------crlDQYAFICQEMND   41
DSSP  llllLLEEEEEELLL---EELH--hHHLLHH--------------heeLLHHHHHHHHHH


DSSP  LL---LLEEEEELLEellleELLHhhHHHHHHHLL----LLEEEEEEL----------ll
Query AG---IEQGVCVGRNssvlgSVSNadVAAVAKAYP----DKFHPVGSI----------ea   99
ident                            |                                
Sbjct LMtrgVRNVIEMTNR-----YMGR--NAQFMLDVMretgINVVACTGYyqdaffpehvat   94
DSSP  HHhllEEEEEELLLH-----HHLL--LHHHHHHHHhhhlLEEEEEELLllhhhlllhhhh


DSSP  LLHHHHHHHHHHHHH-------LLLLLEE-ELHH-hllLLLLllLHHHHHHHHHHHHLLL
Query ATRKEAMAQMQEILD-------LGIRIVN-LEPG-vwaTPMHvdDRRLYPLYAFCEDNGI  150
ident     |    |            |   |           ||                  | 
Sbjct RSVQELAQEMVDEIEqgidgteLKAGIIAeIGTSegkiTPLE--EKVFIAAALAHNQTGR  152
DSSP  LLHHHHHHHHHHHHHlllllllLLEEEEEeEELLllllLHHH--HHHHHHHHHHHHHHLL


DSSP  LEEEELLLlllllhhhHLHHHHHHHHHH-LLLL-LEEEEHHhLLLHHHHHHHHHHLLlEE
Query PVIMMTGGnagpdityTNPEHIDRVLGD-FPDL-TVVSSHGnWPWVQEIIHVAFRRPnLY  208
ident |    |          |        |     ||  |   |         |         |
Sbjct PISTHTSF-------sTMGLEQLALLQAhGVDLsRVTVGHCdLKDNLDNILKMIDLG-AY  204
DSSP  LEEEELHH-------hLLHHHHHHHHHHlLLLHhHEEELLLlLLLLHHHHHHHHHLL-LE


DSSP  EELHHHHL-----LLLLHHHHHHHHLLHHHHLLLLLLLLLL---------lLHHHHHHHH
Query LSPDMYLY-----NLPGHADFIQAANSFLADRMLFGTAYPM---------cPLKEYTEWF  254
ident    |              |         |  |                           |
Sbjct VQFDTIGKnsyypDEKRIAMLHALRDRGLLNRVMLSMDITRrshlkanggyGYDYLLTTF  264
DSSP  EEELLLLLlllllHHHHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhlllLLLHHHHLH


DSSP  HLLL----LLHHHHHHHHLHHHHHHHHhlll
Query LTLP----IKPDAMEKILHGNAERLLAqagr  281
ident                  |  |          
Sbjct IPQLrqsgFSQADVDVMLRENPSQFFQ----  291
DSSP  HHHHhhllLLHHHHHHHHLHHHHHHLL----


No 19: Query=3irsA Sbjct=2ob3A Z-score=16.6

back to top
DSSP  --------------lLLEELLLLLLlhhHHHL----hhhHLHHhhhhhhhhhlllllhhh
Query --------------lKIIDFRLRPPamgFLNA----riyTRPDirnrftrqlgfepapsa   42
ident                                |                            
Sbjct drintvrgpitiseaGFTLTHEHIC---GSSAgflrawpEFFG-------------srka   44
DSSP  lleeelleeelhhhhLLEEEEELLE---ELLLlhhhhlhHHHL-------------lhhh


DSSP  HHLLHHHHHHHHHHLLLLEEEEELLEellleELLHhhHHHHHHHLL----LLEEEEEEL-
Query EEKSLELMFEEMAAAGIEQGVCVGRNssvlgSVSNadVAAVAKAYP----DKFHPVGSI-   97
ident              |||    | |                                     
Sbjct LAEKAVRGLRRARAAGVRTIVDVSTF-----DIGR--DVSLLAEVSraadVHIVAATGLw   97
DSSP  HHHHHHHHHHHHHHLLLLEEEELLLH-----HHLL--LHHHHHHHHhhhlLEEELEEELl


DSSP  -------llLLHHHHHHHHHHHHH-------LLLLLEEELHHhllllllllLHHH-HHHH
Query -------eaATRKEAMAQMQEILD-------LGIRIVNLEPGvwatpmhvdDRRL-YPLY  142
ident              |                     |                        
Sbjct fdpplsmrlRSVEELTQFFLREIQygiedtgIRAGIIXVATT---gkatpfQELVlKAAA  154
DSSP  llllhhhhlLLHHHHHHHHHHHHHlllllllLLLLEEEEELL---llllhhHHHHhHHHH


DSSP  HHHHHLLLLEEEELLLlllllHHHHlHHHHHHHHHHLLLL--LEEEEHHHLL-LHHHHHH
Query AFCEDNGIPVIMMTGGnagpdITYTnPEHIDRVLGDFPDL--TVVSSHGNWP-WVQEIIH  199
ident       | ||   |             |               |   |            
Sbjct RASLATGVPVTTHTAA-----SQRD-GEQQAAIFESEGLSpsRVCIGHSDDTdDLSYLTA  208
DSSP  HHHHHHLLLEEEELLH-----HHLH-HHHHHHHHHHLLLLhhHEEELLHHHLlLHHHHHH


DSSP  HHHHLllEEEELHHH--------------------hLLLLlHHHHHHHHLLHHHHLLLLL
Query VAFRRpnLYLSPDMY--------------------lYNLPgHADFIQAANSFLADRMLFG  239
ident  | |        |                                            |  
Sbjct LAARG--YLIGLDHIpysaiglednasasallgirsWQTR-ALLIKALIDQGYMKQILVS  265
DSSP  HHHLL--LEEEELLLllllllllllhhhhhhhllllHHHH-HHHHHHHHHLLLHHHEEEL


DSSP  LLLL------------------llLHHHHHHHHHLLL----LLHHHHHHHHLHHHHHHHh
Query TAYP------------------mcPLKEYTEWFLTLP----IKPDAMEKILHGNAERLLa  277
ident                                                  |   |  | | 
Sbjct NDWTfgfssyvtnimdvmdrvnpdGMAFIPLRVIPFLrekgVPQETLAGITVTNPARFL-  324
DSSP  LLLLleellllllhhhhhhhhlllHHHHHHHLHHHHHhhllLLHHHHHHHHLHHHHHHH-


DSSP  HLLL-
Query QAGR-  281
ident      
Sbjct SPTLr  329
DSSP  LLLLl


No 20: Query=3irsA Sbjct=3griA Z-score=16.5

back to top
DSSP  ---------------------------------------------------LLLEELLLL
Query ---------------------------------------------------LKIIDFRLR    9
ident                                                        |    
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL


DSSP  LLLHHHHhlhhhhlhhhhhhhhhhhlllllhhhhHLLH-HHHHHHHHHLLLLEEEEELLe
Query PPAMGFLnariytrpdirnrftrqlgfepapsaeEKSL-ELMFEEMAAAGIEQGVCVGRn   68
ident     |                              |   |      |  |          
Sbjct LREPGGE---------------------------YKETiETGTKAAARGGFTTVCPXPN-   92
DSSP  LLLLLLL---------------------------LLLLhHHHHHHHHHLLEEEEEELLL-


DSSP  ellLEEL-----LHHHHHHHHHHLL-LLEEEEEEL---LLLLhhHHHHhHHHHHHLLLLL
Query ssvLGSV-----SNADVAAVAKAYP-DKFHPVGSI---EAATrkEAMAqMQEILDLGIRI  119
ident       |                       |  ||         |           |   
Sbjct ---TRPVpdsveHFEALQKLIDDNAqVRVLPYASIttrQLGK--ELVD-FPALVKEGAFA  146
DSSP  ---LLLLlllhhHHHHHHHHHHHHLlLEELLLEELlhhHLLL--LLLL-HHHHHLLLLLL


DSSP  EEELHHhllLLLLllLHHHHHHHHHHHHLLLLEEEELlllLLLLHH--------------
Query VNLEPGvwaTPMHvdDRRLYPLYAFCEDNGIPVIMMTggnAGPDIT--------------  165
ident                    |                                        
Sbjct FTDDGV---GVQT--ASXXYEGXIEAAKVNKAIVAHC---EDNSLIyggaxhegkrskel  198
DSSP  EEELLL---LLLL--HHHHHHHHHHHHHHLLLEEELL---LLHHHLlllleellhhhhhh


DSSP  -------hHLHHHHHHHHHHLL--LLLEEEEHHHlllHHHHHHHHHHLL----LEEEELH
Query -------yTNPEHIDRVLGDFP--DLTVVSSHGNwpwVQEIIHVAFRRP----NLYLSPD  212
ident              | |               |       |   |                
Sbjct gipgipniCESVQIARDVLLAEaaGCHYHVCHVS---TKESVRVIRDAKragiHVTAEVT  255
DSSP  llleellhHHHHHHHHHHHHHHhhLLLEEELLLL---LHHHHHHHHHHHhlllLEEEEEL


DSSP  -HHHLLL--------------------LLHHHHHHHHLLHHhhLLLLLLLLL--------
Query -MYLYNL--------------------PGHADFIQAANSFLadRMLFGTAYP--------  243
ident    |                                            |           
Sbjct pHHLLLTeddipgnnaiykxnpplrstEDREALLEGLLDGT--IDCIATDHAphardeka  313
DSSP  hHHHHLLhhhlllllhhhllllllllhHHHHHHHHHHHLLL--LLEELLLLLlllhhhhl


DSSP  ---------LLLHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHHH-----------
Query ---------MCPLKEYTEWFLTLP-----IKPDAMEKILHGNAERLLAQ-----------  278
ident                      |                |                     
Sbjct qpxekapfgIVGSETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLeygtlkengya  373
DSSP  lllllllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllllll


DSSP  ----------------------------------------------lll
Query ----------------------------------------------agr  281
ident                                                  
Sbjct dltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel


No 21: Query=3irsA Sbjct=3gg7A Z-score=16.4

back to top
DSSP  lLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLl
Query lKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIe   60
ident    |||                                                      
Sbjct -SLIDFHVHLDL-------------------------------yPDPVAVARACEERQL-   27
DSSP  -LLEEEEELHHH-------------------------------lLLHHHHHHHHHHLLL-


DSSP  EEEEELLEellleelLHHHHHHHHHHLlLLEEEEEEL---LLLL-HHHHhHHHHHHHHlL
Query QGVCVGRNssvlgsvSNADVAAVAKAYpDKFHPVGSI---EAAT-RKEAmAQMQEILDlG  116
ident     |                | |                                |   
Sbjct TVLSVTTT-----paAWRGTLALAAGR-PHVWTALGFhpeVVSErAADL-PWFDRYLP-E   79
DSSP  EEEELLLL-----hhHHHHHHHHHLLL-LLEEELLLLlhhHLLLlHHHL-HHHHHHHH-H


DSSP  LLLEE-ELHH----hlLLLLlllLHHHHHHHHHHHH-LLLLEEEELLllllllhhhHLHH
Query IRIVN-LEPG----vwATPMhvdDRRLYPLYAFCED-NGIPVIMMTGgnagpdityTNPE  170
ident  | |             |               |||  |                     
Sbjct TRFVGeVGLDgspslrGTWT-qqFAVFQHILRRCEDhGGRILSIHSR---------RAES  129
DSSP  LLEEEeEELLllhhhhHHHH-hhHHHHHHHHHHHHHlLLEEEEEELL---------LLHH


DSSP  HHHHHHHHLLL-LLEEEEHhHLLLhHHHHHHHHHLLlEEEELHHHHLLLLLHHHHHHHHl
Query HIDRVLGDFPD-LTVVSSHgNWPWvQEIIHVAFRRPnLYLSPDMYLYNLPGHADFIQAAn  229
ident      |   |   |                 |        |           |  |    
Sbjct EVLNCLEANPRsGTPILHW-YSGS-VTELRRAISLG-CWFSVGPTMVRTQKGAALIRSM-  185
DSSP  HHHHHHHHLHHhEEEEEEL-LLLL-HHHHHHHHHLL-LEEEELHHHHLLHHHHHHHHHL-


DSSP  lhHHHLLLLLLLLLL-------LLHHhHHHHHHL--LLLL----HHHHHHHhLHHHHHHH
Query sfLADRMLFGTAYPM-------CPLKeYTEWFLT--LPIK----PDAMEKIlHGNAERLL  276
ident     || |  |  |                        |               |  |||
Sbjct --PRDRVLTETDGPFleldgqaALPW-DVKSVVEglSKIWqipaSEVERIV-KENVSRLL  241
DSSP  --LHHHEEELLLLLLleelleeLLHH-HHHHHHHhhHHHHlllhHHHHHHH-HHHHHHHH


DSSP  HHlll
Query AQagr  281
ident      
Sbjct GT---  243
DSSP  HL---


No 22: Query=3irsA Sbjct=3k2gB Z-score=16.1

back to top
DSSP  --------------------------lLLEELLLLLllhhHHHLHhhHLHH---------
Query --------------------------lKIIDFRLRPpamgFLNARiyTRPD---------   25
ident                                             |               
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHL----QNDCR--CWWNppqeperqy   54
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLL----LEELH--HHLLllllhhhhh


DSSP  -----------------HHHHhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELLE
Query -----------------IRNRftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGRN   68
ident                                               || |    |     
Sbjct laeapisieilselrqdPFVN------khnialddlDLAIAEVKQFAAVGGRSIVDPTCR  108
DSSP  hhhllllhhhhhhhhllHHHL------lllleellhHHHHHHHHHHHHLLLLEEEELLLL


DSSP  elllEELLhhhHHHHHHHLL---LLEEEEEELL-----------lLLHHHHHHHHHHHHH
Query ssvlGSVSnadVAAVAKAYP---DKFHPVGSIE-----------aATRKEAMAQMQEILD  114
ident     |                        |                              
Sbjct ----GIGR---DPVKLRRISaetGVQVVXGAGYylassxpetaarLSADDIADEIVAEAL  161
DSSP  ----LLLL---LHHHHHHHHhhhLLEEEELLLLllhhhllhhhhlLLHHHHHHHHHHHHH


DSSP  -------LLLLLEE-ELHHhllLLLLllLHHHHHHHHHHHHLLLLEEEELLLlllllhhh
Query -------LGIRIVN-LEPGvwaTPMHvdDRRLYPLYAFCEDNGIPVIMMTGGnagpdity  166
ident          |            |        |          | |      |        
Sbjct egtdgtdARIGLIGeIGVSsdfTAEE--EKSLRGAARAQVRTGLPLXVHLPG--------  211
DSSP  lllllllLLLLLEEeELLLlllLHHH--HHHHHHHHHHHHHHLLLEEELLLL--------


DSSP  HLHHhHHHHHHH----LLLL-LEEEEHHhLLLHH---HHHHHHHhlLLEEEELHHH----
Query TNPEhIDRVLGD----FPDL-TVVSSHGnWPWVQ---EIIHVAFrrPNLYLSPDMY----  214
ident        |||        ||   |  |   |           |       |  |      
Sbjct WFRL-AHRVLDLveeeGADLrHTVLCHX-NPSHXdpvYQATLAQ--RGAFLEFDXIgxdf  267
DSSP  LLLL-HHHHHHHhhhlLLLHhHEEELLL-HHHLLlhhHHHHHHH--HLLEEEELLLllll


DSSP  ---------hLLLLLHHHHHHHHLLHHHHLLLLLLLLLL---------LLHHHHHHHHHL
Query ---------lYNLPGHADFIQAANSFLADRMLFGTAYPM---------CPLKEYTEWFLT  256
ident                       |     || |                      |  || 
Sbjct fyadqgvqcpSDDEVARAILGLADHGYLDRILLSHDVFVkxxltryggNGYAFVTKHFLP  327
DSSP  eelllleellLHHHHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhllLLLLHHHHLHHH


DSSP  L----LLLHHHHHHHHLHHHHHHHHH--lll
Query L----PIKPDAMEKILHGNAERLLAQ--agr  281
ident           | |     |  |         
Sbjct RlrrhGLDDAALETLXVTNPRRVFDAsiegh  358
DSSP  HhhhlLLLHHHHHHHHLHHHHHHHLLlllll


No 23: Query=3irsA Sbjct=2vc5A Z-score=16.0

back to top
DSSP  ---------------lLLEELLLLLLlhhHHHLhhhhlhhhhhhhhhhhlllllhhhHHL
Query ---------------lKIIDFRLRPPamgFLNAriytrpdirnrftrqlgfepapsaEEK   45
ident                                                          |  
Sbjct mriplvgkdsieskdiGFTLIHEHLR---VFSE----------avrqqwphlynedeEFR   47
DSSP  llllllllllllhhhlLLEELLLLLL---LLLH----------hhhhhlhhhllhhhHHH


DSSP  LHHHHHHHHHHLLLLEEEEELLEellleELLHhhHHHHHHHLL----LLEEEEEEL----
Query SLELMFEEMAAAGIEQGVCVGRNssvlgSVSNadVAAVAKAYP----DKFHPVGSI----   97
ident             |    |                                     |    
Sbjct NAVNEVKRAMQFGVKTIVDPTVM-----GLGR--DIRFMEKVVkatgINLVAGTGIyiyi  100
DSSP  HHHHHHHHHHHLLLLEEEELLLL-----LLLL--LHHHHHHHHhlllLEEEELEELllll


DSSP  ------llLLHHHHHHHHHHHHH-------LLLLLEEELHHhlllLLLL--lLHHHHHHH
Query ------eaATRKEAMAQMQEILD-------LGIRIVNLEPGvwatPMHV--dDRRLYPLY  142
ident             |                      |                        
Sbjct dlpfyflnRSIDEIADLFIHDIKegiqgtlNKAGFVXIAAD----EPGItkdVEKVIRAA  156
DSSP  lllhhhllLLHHHHHHHHHHHHHlllllllLLLLLEEEELL----LLLLlhhHHHHHHHH


DSSP  HH-HHHLLLLEEEELlllllllhhHHLHHHHHHHHHHLL-----LLLEEEEHH-HLLLHH
Query AF-CEDNGIPVIMMTggnagpditYTNPEHIDRVLGDFP-----DLTVVSSHG-NWPWVQ  195
ident |        | |                                       |        
Sbjct AIaNKETKVPIITHS---------NAHNNTGLEQQRILTeegvdPGKILIGHLgDTDNID  207
DSSP  HHhHHHHLLLEEEEL---------LLLLLHHHHHHHHHHhllllHHHEEELLHhHLLLHH


DSSP  HHHHHHHhlLLEEEELHHH-----hLLLLLHHHHHHHHLLHHHHLLLLLLLLL-------
Query EIIHVAFrrPNLYLSPDMY-----lYNLPGHADFIQAANSFLADRMLFGTAYP-------  243
ident  |   |          | |                        |       |        
Sbjct YIKKIAD--KGSFIGLDRYgldlflPVDKRNETTLRLIKDGYSDKIMISHDYCctidwgt  265
DSSP  HHHHHHH--LLLEEEELLLllllllLHHHHHHHHHHHHHLLLLLLEEELLLLLlllllll


DSSP  -----------lLLHHhHHHH-HHLLL----LLHHHHHHHHLHHHHHHHHhlll
Query -----------mCPLKeYTEW-FLTLP----IKPDAMEKILHGNAERLLAqagr  281
ident                                        |   |          
Sbjct akpeykpklaprWSIT-LIFEdTIPFLkrngVNEEVIATIFKENPKKFFS----  314
DSSP  llhhhhhhhlllLLLL-HHHHlHHHHHhlllLLHHHHHHHHLHHHHHHLL----


No 24: Query=3irsA Sbjct=3mtwA Z-score=15.8

back to top
DSSP  ---------------------------------------------------------LLL
Query ---------------------------------------------------------LKI    3
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE


DSSP  EELLLLLLlhhhhhlhHHHLHHHhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEE
Query IDFRLRPPamgflnarIYTRPDIrnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGV   63
ident ||                                                   ||     
Sbjct IDMHVHLD-------sLAEVGGY-------nsleysdrfwsVVQTANAKKTLEAGFTTVR  106
DSSP  EEEEELLL-------lLLLLLHH-------hhhhllhhhhhHHHHHHHHHHHHLLEEEEE


DSSP  EELLeellleeLLHHhHHHHHHHLL------lLEEEE-EELL------------------
Query CVGRnssvlgsVSNAdVAAVAKAYP------dKFHPV-GSIE------------------   98
ident  ||                   |                |                    
Sbjct NVGA-------ADYD-DVGLREAIDagyvpgpRIVTAaISFGatgghcdstffppsmdqk  158
DSSP  ELLL-------LLLH-HHHHHHHHHlllllllEEEELlLLEEllllllllllllhhhlll


DSSP  ----LLLHHHHHHHHHHHHHLLLLLEEELHHH-------lllllLLLLHHHHHHHHHHHH
Query ----AATRKEAMAQMQEILDLGIRIVNLEPGV-------watpmHVDDRRLYPLYAFCED  147
ident          ||          |                                      
Sbjct npfnSDSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHM  218
DSSP  llllLLLHHHHHHHHHHHHHLLLLEEEEELLLllllllllllllLLLHHHHHHHHHHHHH


DSSP  LLLLEEEELLllllllhhhhLHHHHHHHHHhlllLLEEEEHhHLLLHHHHHHHHHHLLlE
Query NGIPVIMMTGgnagpditytNPEHIDRVLGdfpdLTVVSSHgNWPWVQEIIHVAFRRPnL  207
ident  || |                   |               |       | |  |      
Sbjct AGIKVAAHAH----------GASGIREAVR---aGVDTIEH-ASLVDDEGIKLAVQKG-A  263
DSSP  LLLEEEEEEL----------LHHHHHHHHH---lLLLEEEE-LLLLLHHHHHHHHHHL-L


DSSP  EEELHhHHLL------------------------LLLHHHHHHHHLLHHhhLLLLLLLLL
Query YLSPDmYLYN------------------------LPGHADFIQAANSFLadRMLFGTAYP  243
ident | | |                                   |  |        |  ||   
Sbjct YFSMD-IYNTdytqaegkkngvlednlrkdrdigELQRENFRKALKAGV--KMVYGTDAG  320
DSSP  EEELL-LLLHhhhhhhhhhhlllhhhhhhhhhhhHHHHHHHHHHHHHLL--EEELLLLLL


DSSP  LLLHHHHHhHHHLL----LLLHHHHHHHHLHHHHHHHHH---------------------
Query MCPLKEYTeWFLTL----PIKPDAMEKILHGNAERLLAQ---------------------  278
ident   |                  |          |   |                       
Sbjct IYPHGDNA-KQFAVmvryGATPLQAIQSATLTAAEALGRskdvgqvavgrygdmiavagd  379
DSSP  LLLLLLHH-HHHHHhhhlLLLHHHHHHHLLHHHHHHHLLlllllllllllllleeeelll


DSSP  ----------------------lll
Query ----------------------agr  281
ident                          
Sbjct pladvttlekpvfvmkggavvkapx  404
DSSP  llllhhhhhllleeeelleeeelll


No 25: Query=3irsA Sbjct=3e74A Z-score=15.8

back to top
DSSP  ---------------------------------------------------LLLEELLLL
Query ---------------------------------------------------LKIIDFRLR    9
ident                                                        |    
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL


DSSP  LLlhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllHHHHHHHHHHLLLLEEEEELLEe
Query PPamgflnariytrpdirnrftrqlgfepapsaeeksLELMFEEMAAAGIEQGVCVGRNs   69
ident                                       |      |  ||        | 
Sbjct IG-----------------------------------YETGTRAAAKGGITTXIEXPLN-   84
DSSP  LL-----------------------------------HHHHHHHHHHLLEEEEEELLLL-


DSSP  lllEELLH--HHHHHHHHHL----lLLEEEEEELLLllhhHHHHHHHHHHHLLLLLEEEL
Query svlGSVSN--ADVAAVAKAY----pDKFHPVGSIEAatrkEAMAQMQEILDLGIRIVNLE  123
ident           |       |            |               |    |       
Sbjct --qLPATVdrASIELKFDAAkgkltIDAAQLGGLVS----YNIDRLHELDEVGVVGFXCF  138
DSSP  --lLLLLLlhHHHHHHHHHHlllllLEEEELEELLL----LLLLLHHHHHHHLLLLEEEE


DSSP  HHHllllllllLHHH-HHHHHHHHHLLLLEEEELllllLLLH------------------
Query PGVwatpmhvdDRRL-YPLYAFCEDNGIPVIMMTggnaGPDI------------------  164
ident                           | ||                              
Sbjct VRD-------vNDWQfFKGAQKLGELGQPVLVHC--enALICdelgeeakregrvtahdy  189
DSSP  LLL-------lLHHHhHHHHHHHHHHLLLEEEEL--llHHHHhhhhhhhhhhllllhhhh


DSSP  -----hhHLHHHHHHHHHHLL--LLLEEEEHHHlllHHHHHHHHHHLL----LEEEELH-
Query -----tyTNPEHIDRVLGDFP--DLTVVSSHGNwpwVQEIIHVAFRRP----NLYLSPD-  212
ident        |  | | |||             |       |      |              
Sbjct vasrpvfTEVEAIRRVLYLAKvaGCRLHVCHVS---SPEGVEEVTRARqegqDITCESCp  246
DSSP  hhlllhhHHHHHHHHHHHHHHhhLLLEEELLLL---LHHHHHHHHHHHhlllLEEEEELl


DSSP  HHHLLL--------------------LLHHHHHHHHLLHHhhLLLLLLLLL---------
Query MYLYNL--------------------PGHADFIQAANSFLadRMLFGTAYP---------  243
ident  |                                                          
Sbjct HYFVLDtdqfeeigtlakcsppirdlENQKGXWEKLFNGE--IDCLVSDHSpcppexkag  304
DSSP  HHHHLLhhhhhhhlhhhllllllllhHHHHHHHHHHHLLL--LLEELLLLLlllllllll


DSSP  --------LLLHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHH-------------
Query --------MCPLKEYTEWFLTLP-----IKPDAMEKILHGNAERLLA-------------  277
ident            |                       |    ||                  
Sbjct nixkawggIAGLQSCXDVXFDEAvqkrgXSLPXFGKLXATNAADIFGlqqkgriapgkda  364
DSSP  llllllllLLLHHHHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLlllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct dfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll


DSSP  -hlll
Query -qagr  281
ident      
Sbjct filkh  429
DSSP  eelll


No 26: Query=3irsA Sbjct=3giqA Z-score=15.6

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------LKIID    5
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE


DSSP  LLLL--LLLHhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHhhHHHHHHLLLLEEE
Query FRLR--PPAMgflnariytrpdirnrftrqlgfepapsaeeKSLElmFEEMAAAGIEQGV   63
ident                                                       ||   |
Sbjct VHGHddLMFV-------------------------------EKPD--LRWKTSQGITTVV   87
DSSP  LLLLllLHHH-------------------------------HLLL--LHHHHLLLEEEEE


DSSP  EE-----------lleeLLLEE--------lLHHHHHHHHH--HLLLLEEEEEE--LLLL
Query CV-----------grnsSVLGS--------vSNADVAAVAK--AYPDKFHPVGS--IEAA  100
ident                                      |                      
Sbjct VGncgvsaapaplpgntAAALAllgetplfaDVPAYFAALDaqRPMINVAALVGhaNLRL  147
DSSP  ELlllllllllllllllLHHHHhhlllllllLHHHHHHHHHhlLLLLEEEEEEEhhHHHH


DSSP  -------------LHHHHHHHHHHHHHLLLLLEEELHHHLlLLLLllLHHHHHHHHHHHH
Query -------------TRKEAMAQMQEILDLGIRIVNLEPGVWaTPMHvdDRRLYPLYAFCED  147
ident                       |  |  |                     |  |      
Sbjct aamrdpqaaptaaEQQAMQDMLQAALEAGAVGFSTGLAYQ-PGAVaqAAELEGLARVAAE  206
DSSP  hhlllllllllhhHHHHHHHHHHHHHHHLLLEEEEELLLL-LHHHllHHHHHHHHHHHHH


DSSP  LLLLEEEELlllllllHHHHlHHHHHHHHHHLL--LLLEEEEHHHLL------LHHHHHH
Query NGIPVIMMTggnagpdITYTnPEHIDRVLGDFP--DLTVVSSHGNWP------WVQEIIH  199
ident                            ||          | ||                 
Sbjct RRRLHTSHI----rneADGV-EAAVEEVLAIGRgtGCATVVSHHKCMmpqnwgRSRATLA  261
DSSP  LLLEEEEEL----lllLLLH-HHHHHHHHHHHHhhLLEEEELLLLLLlhhhllLHHHHHH


DSSP  HHHHLL----LEEEELHhhHLLL-------------------------------------
Query VAFRRP----NLYLSPDmyLYNL-------------------------------------  218
ident    |         |      |                                       
Sbjct NIDRAReqgvEVALDIY--PYPGsstiliperaetiddiritwstphpecsgeyladiaa  319
DSSP  HHHHHHhlllLEEEEEL--LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhh


DSSP  -------------------------LLHHHHHHHHllhhhhLLLLLLLLL------LLLH
Query -------------------------PGHADFIQAAnsfladRMLFGTAYP------MCPL  247
ident                                 |            |             |
Sbjct rwgcdkttaarrlapagaiyfamdeDEVKRIFQHP------CCMVGSDGLpndarpHPRL  373
DSSP  hhlllhhhhhhhhlleeeeeelllhHHHHHHHHLL------LEEELLLLLllllllLLHH


DSSP  HHHHHHHHLL------LLLHHHHHHHHLHHHHHHHHH-----------------------
Query KEYTEWFLTL------PIKPDAMEKILHGNAERLLAQ-----------------------  278
ident        |                        |                           
Sbjct WGSFTRVLGRyvrearLMTLEQAVARMTALPARVFGFaergvlqpgawadvvvfdpdtva  433
DSSP  HHHHHHHHHHhhhhllLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllll


DSSP  ---------------------------------------lll
Query ---------------------------------------agr  281
ident                                           
Sbjct dratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  lllllllllllllleeeeeelleeeellllllllllllllll


No 27: Query=3irsA Sbjct=1onxA Z-score=15.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  -LLLEELLLLLLLhhhhhlhHHHL-HHHHhhhhhhhlllllhhhhhllhhhHHHHHHHLL
Query -LKIIDFRLRPPAmgflnarIYTR-PDIRnrftrqlgfepapsaeekslelMFEEMAAAG   58
ident     ||                   |  |                             ||
Sbjct cPGFIDQHVHLIG------gGGEAgPTTR------------------tpevALSRLTEAG   96
DSSP  eELEEEEEELLLL------lLLLLlHHHL------------------llllLHHHHHHLL


DSSP  LLEEEEELLeelLLEE-LLHHHHHHHHHHLL---LLEEEEEE-LLLLlhhhhhHHHHHH-
Query IEQGVCVGRnssVLGS-VSNADVAAVAKAYP---DKFHPVGS-IEAAtrkeamAQMQEI-  112
ident     |                   |   |                               
Sbjct VTSVVGLLG---TDSIsRHPESLLAKTRALNeegISAWMLTGaYHVP-srtitGSVEKDv  152
DSSP  EEEEEELLL---LLLLlLLHHHHHHHHHHHHhhlLEEEEEEElLLLL-lllllLLHHHHh


DSSP  HHLL-LLLEEEL--HHHLlLLLLllLHHHHHHHHHHHHLL------LLEEEELLLlllll
Query LDLG-IRIVNLE--PGVWaTPMHvdDRRLYPLYAFCEDNG------IPVIMMTGGnagpd  163
ident         |                   |    |     |             |      
Sbjct AIIDrVIGVXCAisDHRS-AAPD--VYHLANMAAESRVGGllggkpGVTVFHMGD-----  204
DSSP  HHLLlEEEEEEEelLLLL-LLLL--HHHHHHHHHHHHHHHhhhlllLEEEEEELL-----


DSSP  HHHHlHHHHHHHHH--HLLLLLEEEEHHHLL--LHHHHHHHHHHLllEEEELHHHhLLLL
Query ITYTnPEHIDRVLG--DFPDLTVVSSHGNWP--WVQEIIHVAFRRpnLYLSPDMYlYNLP  219
ident         |   |   | |       | |            |                 |
Sbjct SKKA-LQPIYDLLEncDVPISKLLPTHVNRNvpLFEQALEFARKG--GTIDITSS-IDEP  260
DSSP  LLLL-LHHHHHHHHllLLLHHHEEEELHHHLhhHHHHHHHHHHLL--LLEEEELL-LLLL


DSSP  LH-hHHHHHHLL--HHHHLLLLLLLLL----------------LLLHhHHHHHHHLLL--
Query GH-aDFIQAANS--FLADRMLFGTAYP----------------MCPLkEYTEWFLTLP--  258
ident       |  |        |                             |           
Sbjct VApaEGIARAVQagIPLARVTLSSDGNgsqpffddegnlthigVAGF-ETLLETVQVLvk  319
DSSP  LLhhHHHHHHHHllLLHHHEEEELLLLleeeeellllleeeeeELLL-HHHHHHHHHHhh


DSSP  ---LLHHHHHHHHLHHHHHHHHH-------------------------------------
Query ---IKPDAMEKILHGNAERLLAQ-------------------------------------  278
ident             |       |                                       
Sbjct dydFSISDALRPLTSSVAGFLNLtgkgeilpgndadllvmtpelrieqvyargklmvkdg  379
DSSP  hhlLLHHHHHHHHLHHHHHHLLLllllllllllllleeeellllleeeeeelleeeeell


DSSP  --------lll
Query --------agr  281
ident            
Sbjct kacvkgtfetd  390
DSSP  eelllllllll


No 28: Query=3irsA Sbjct=1itqA Z-score=15.6

back to top
DSSP  -------------LLLEELLLLL--LLHHhhhlhhhhlhhhhhhhhhhhlllllhhhhHL
Query -------------LKIIDFRLRP--PAMGflnariytrpdirnrftrqlgfepapsaeEK   45
ident                 ||                                          
Sbjct dffrdeaerimrdSPVIDGHNDLpwQLLD--------------------mfnnrlqdeRA   40
DSSP  lhhhhhhhhhhllLLEEEEEELHhhHHHH--------------------hhllllllhHH


DSSP  LHHH------HHHHHHHLLLLEEEEELLEELLLE----elLHHHHHHHHHHLL-------
Query SLEL------MFEEMAAAGIEQGVCVGRNSSVLG----svSNADVAAVAKAYP-------   88
ident  |              |                              |            
Sbjct NLTTlagthtNIPKLRAGFVGGQFWSVYTPCDTQnkdavrRTLEQMDVVHRMCrmypetf  100
DSSP  LLLLllllllLHHHHHHLLEEEEEEEELLLHHHLlllhhhHHHHHHHHHHHHHhhlllle


DSSP  -----------------LLEEEEEE---LLLLlhhhHHHHHHHHHHLLLLLEEELHHHLl
Query -----------------DKFHPVGS---IEAAtrkeAMAQMQEILDLGIRIVNLEPGVWa  128
ident                                               || |   |      
Sbjct lyvtssagirqafregkVASLIGVEgghSIDS----SLGVLRALYQLGMRYLTLTHSCN-  155
DSSP  eelllhhhhhhhhhlllEEEEEEEElhhHLLL----LHHHHHHHHHLLEEEEELLLLLL-


DSSP  lLLLL----------------LLHHHHHHHHHHHHLLLLEEEELlllllllhhhhLHHHH
Query tPMHV----------------DDRRLYPLYAFCEDNGIPVIMMTggnagpditytNPEHI  172
ident                                     |                       
Sbjct -TPWAdnwlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH----------vSVATM  204
DSSP  -LLLLllhhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL----------lLHHHH


DSSP  HHHHHHLlLLLEEEEHH---------HLLLhHHHHHHHHHLLlEEEELHHH--HLLL---
Query DRVLGDFpDLTVVSSHG---------NWPWvQEIIHVAFRRPnLYLSPDMY--LYNL---  218
ident    |       |  ||                                  |         
Sbjct KATLQLS-RAPVIFSHSsaysvcasrRNVP-DDVLRLVKQTD-SLVMVNFYnnYISCtnk  261
DSSP  HHHHHHL-LLLLEELLLlllllllllLLLL-HHHHHHHHHHL-LEEEELLLhhHHLLlll


DSSP  ----llHHHHHHHHLLHHHHLLLLLLLLLLL--------LHHHhHHHHHLLL----LLHH
Query ----pgHADFIQAANSFLADRMLFGTAYPMC--------PLKEyTEWFLTLP----IKPD  262
ident                   |    ||                                   
Sbjct anlsqvADHLDHIKEVAGARAVGFGGDFDGVprvpegleDVSK-YPDLIAELlrrnWTEA  320
DSSP  llhhhhHHHHHHHHHHLLHHHEEELLLLLLLllllllllLLLL-HHHHHHHHhhllLLHH


DSSP  HHHHHHLHHHHHHHHHLLL------------------------------
Query AMEKILHGNAERLLAQAGR------------------------------  281
ident      |  |  |                                     
Sbjct EVKGALADNLLRVFEAVEQasnltqapeeepipldqlggscrthygyss  369
DSSP  HHHHHHLHHHHHHHHHHHHllllllllllllllhhhlllllllllllll


No 29: Query=3irsA Sbjct=4cqbA Z-score=15.0

back to top
DSSP  ----------------------------------------------------LLLEELLL
Query ----------------------------------------------------LKIIDFRL    8
ident                                                         |   
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE


DSSP  LLLLhhhhhlHHHH----LHHHhHHHH--------hhhlllllhhhhhlLHHHHHHHHHH
Query RPPAmgflnaRIYT----RPDIrNRFT--------rqlgfepapsaeekSLELMFEEMAA   56
ident              |            |                                 
Sbjct HMDK-----sFTSTgerlPKFWsRPYTrdaaiedglkyyknatheeikrHVIEHAHMQVL  115
DSSP  LHHH-----lLLLLllllLLLLlLLLLhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHH


DSSP  LLLLEEEEELLEellleelLHHHHHHHHHHLL--LLEEEEEEL--LLLLHHHHHHHHHHH
Query AGIEQGVCVGRNssvlgsvSNADVAAVAKAYP--DKFHPVGSI--EAATRKEAMAQMQEI  112
ident  |                     |               |           |        
Sbjct HGTLYTRTHVDVdsvaktkAVEAVLEAKEELKdlIDIQVVAFAqsGFFVDLESESLIRKS  175
DSSP  LLEEEEEEEEELllllllhHHHHHHHHHHHLLllLEEEEEEELllLLLLLLLHHHHHHHH


DSSP  HHLLLLLEEEL-HHHLlLLLLllLHHHHHHHHHHHHLLLLEEEELLLlllllHHHHLH--
Query LDLGIRIVNLE-PGVWaTPMHvdDRRLYPLYAFCEDNGIPVIMMTGGnagpdITYTNP--  169
ident || |   |    |             |                          |      
Sbjct LDMGCDLVGGVdPATR-ENNV--EGSLDLCFKLAKEYDVDIDYHIHD----iGTVGVYsi  228
DSSP  HHHLLLEEELLlLLLL-LLLH--HHHHHHHHHHHHHLLLEEEEEELL----lHHHHHHhh


DSSP  HHHHHHHHHLLL-lLEEEEHhHLLLH-------hhhHHHHHHLLlEEEEL-HHHHllLLL
Query EHIDRVLGDFPD-lTVVSSHgNWPWV-------qeiIHVAFRRPnLYLSP-DMYLynLPG  220
ident                |  ||  |             |                     | 
Sbjct NRLAQKTIENGYkgRVTTSH-AWCFAdapsewldeaIPLYKDSG-MKFVTcFSST--PPT  284
DSSP  HHHHHHHHHLLLllLEEEEE-LLHHHhllhhhhhhhHHHHHHHL-LEEEEeLLLL--LLL


DSSP  HhHHHHHHLLHHhhLLLLLLLLL------LLLHHhhHHHHHLL---------llLHHHHH
Query HaDFIQAANSFLadRMLFGTAYP------MCPLKeyTEWFLTL---------piKPDAME  265
ident     |                                                       
Sbjct M-PVIKLLEAGI--NLGCASDNIrdfwvpFGNGD--MVQGALIetqrlelktnrDLGLIW  339
DSSP  L-LHHHHHHLLL--EEEEELLLLllllllLLLLL--HHHHHHHhhhhhllllhhHHHHHH


DSSP  HHHLHHHHH-HHHH----------------------------------------------
Query KILHGNAER-LLAQ----------------------------------------------  278
ident |       | |                                                 
Sbjct KMITSEGARvLGIEknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdev  399
DSSP  HHHLHHHHHhHLLHhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelle


DSSP  lll
Query agr  281
ident    
Sbjct iva  402
DSSP  ell


No 30: Query=3irsA Sbjct=3mkvA Z-score=15.0

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------LKII    4
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE


DSSP  ELLLLLLlhhhhHLHHHHLHhhhhhhhhhhlllllhhhHHLLHHHHHHHHHHLLLLEEEE
Query DFRLRPPamgflNARIYTRPdirnrftrqlgfepapsaEEKSLELMFEEMAAAGIEQGVC   64
ident |           |                                    |   |      
Sbjct DLHVHVV-aiefNLPRVATL--------------pnvlVTLRAVPIMRAMLRRGFTTVRD  105
DSSP  EEEELLL-llllLHHHHLLL--------------lhhhHHHHHHHHHHHHHHLLEEEEEE


DSSP  ELLeellleellhhhHHHHHHHLL------lLEEEE-EELL-------------------
Query VGRnssvlgsvsnadVAAVAKAYP------dKFHPV-GSIE-------------------   98
ident  |                   |                                      
Sbjct AGG-----------aGYPFKQAVEsglvegpRLFVSgRALSqtgghadprarsdymppds  154
DSSP  LLL-----------lLHHHHHHHHlllllllEEEELlLEEElllllllllllllllllll


DSSP  --------------LLLHHHHHHHHHHHHHLLLLLEEELHHH------llllLLLLLHHH
Query --------------AATRKEAMAQMQEILDLGIRIVNLEPGV------watpMHVDDRRL  138
ident               |    |      | |  |                            
Sbjct pcgccvrvgalgrvADGVDEVRRAVREELQMGADQIXIMASGgvasptdpvgVFGYSEDE  214
DSSP  llllllllllleeeLLLHHHHHHHHHHHHHHLLLLEEEELLLllllllllllLLLLLHHH


DSSP  -HHHHHHHHHLLLLEEEELLllllllhhhhLHHHHHHHHHHLlllLEEEEHhHLLLhhhH
Query -YPLYAFCEDNGIPVIMMTGgnagpditytNPEHIDRVLGDFpdlTVVSSHgNWPWvqeI  197
ident      |     |  |                |  | |             |         
Sbjct iRAIVAEAQGRGTYVLAHAY----------TPAAIARAVRCG---VRTIEH-GNLI---D  257
DSSP  hHHHHHHHHLLLLLEEEEEL----------LHHHHHHHHHLL---LLEEEE-LLLL---L


DSSP  HHHHHHL--LLEEEELH-HHHL---------------------lLLLHHHHHHHHLLHHh
Query IHVAFRR--PNLYLSPD-MYLY---------------------nLPGHADFIQAANSFLa  233
ident    |        |  |                                   |        
Sbjct DETARLVaeHGAYVVPTlVTYDalasegekyglppesiakiadvHGAGLHSIEIMKRAG-  316
DSSP  HHHHHHHhhHLLEEELLhHHHHhhhhhlllllllhhhhllhhhhHLLHHHHHHHHHHHL-


DSSP  hLLLLLLLLLLlLHHHHHhHHHLL---LLLHHHHHHHHLHHHHHHHHH------------
Query dRMLFGTAYPMcPLKEYTeWFLTL---PIKPDAMEKILHGNAERLLAQ------------  278
ident   | |||                       |              |              
Sbjct vKMGFGTDLLGeAQRLQS-DEFRIlaeVLSPAEVIASATIVSAEVLGMqdklgrivpgah  375
DSSP  lLLLLLLLLLHhHHHHLL-HHHHHhhlLLLHHHHHHHLLHHHHHHLLLllllllllllll


DSSP  ------------------------------------lll
Query ------------------------------------agr  281
ident                                        
Sbjct advlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  lleeeellllllllllllllllllleeeelleeeeelll


No 31: Query=3irsA Sbjct=1k6wA Z-score=14.8

back to top
DSSP  ---------------------------------------------------LLLEELLLL
Query ---------------------------------------------------LKIIDFRLR    9
ident                                                             
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LLlhhhhhlhhHHLH----------HHHHHhhhhhlllllhhhhhLLHHHHHHHHHHLLL
Query PPamgflnariYTRP----------DIRNRftrqlgfepapsaeeKSLELMFEEMAAAGI   59
ident                              |                          | ||
Sbjct LD------ttqTAGQpnwnqsgtlfEGIER-waerkallthddvkQRAWQTLKWQIANGI  113
DSSP  LL------lllLLLLllllllllhhHHHHH-hhllhhhllhhhhhHHHHHHHHHHHHLLE


DSSP  LEEEEELLEellleeLLHHHHHHHHHHLL--LLEEEEEEL---LLLLhHHHHHHHHHHHH
Query EQGVCVGRNssvlgsVSNADVAAVAKAYP--DKFHPVGSI---EAATrKEAMAQMQEILD  114
ident                        |            |               |   | | 
Sbjct QHVRTHVDV-sdatlTALKAMLEVKQEVApwIDLQIVAFPqegILSY-PNGEALLEEALR  171
DSSP  EEEEEEEEL-lllllHHHHHHHHHHHHHLllLEEEEEEELlllLLLL-LLHHHHHHHHHH


DSSP  LLLLLEEELHHHLLLLLLLLLhhHHHHHHHHHHLLLLEEEELLLLlllLHHHHLHHHHHH
Query LGIRIVNLEPGVWATPMHVDDrrLYPLYAFCEDNGIPVIMMTGGNagpDITYTNPEHIDR  174
ident ||   |   |    |        |    |                   |      |    
Sbjct LGADVVGAIPHFEFTREYGVE-sLHKTFALAQKYDRLIDVHCDEI--dDEQSRFVETVAA  228
DSSP  LLLLEEEELHHHLLLHHHHHH-hHHHHHHHHHHHLLEEEEEELLL--lLLLLLHHHHHHH


DSSP  HHHHLLL-lLEEEEHhHLLLH-------hhHHHHHHHLLlEEEELH--HHHL--------
Query VLGDFPD-lTVVSSHgNWPWV-------qeIIHVAFRRPnLYLSPD--MYLY--------  216
ident           |  ||                                             
Sbjct LAHHEGMgaRVTASH-TTAMHsyngaytsrLFRLLKMSG-INFVANplVNIHlqgrfdty  286
DSSP  HHHHHLLhhHEEEEE-LHHHHhllhhhhhhHHHHHHHHL-LEEEELhhHHHHhlllllll


DSSP  --LLLLhhHHHHHHLLHHhhLLLLLLLLL------lLLHHhhHHHHHLL----------l
Query --NLPGhaDFIQAANSFLadRMLFGTAYP------mCPLKeyTEWFLTL----------p  258
ident                |       ||                     |             
Sbjct pkRRGI-tRVKEMLESGI--NVCFGHDDVfdpwyplGTAN--MLQVLHMglhvcqlmgyg  341
DSSP  llLLLL-lLHHHHHHLLL--LEEELLLLLlllllllLLLL--HHHHHHHhhhhlllllhh


DSSP  LLHHhHHHHHLHHHHH-HHHH---------------------------------------
Query IKPDaMEKILHGNAER-LLAQ---------------------------------------  278
ident    |           | |  |                                       
Sbjct QIND-GLNLITHHSARtLNLQdygiaagnsanliilpaengfdalrrqvpvrysvrggkv  400
DSSP  HHHH-HHHHHLHHHHHhLLLLllllllllllleeeellllhhhhhhhllllleeeellee


DSSP  --------------------lll
Query --------------------agr  281
ident                        
Sbjct iastqpaqttvyleqpeaidykr  423
DSSP  eeellllleeeellleeeellll


No 32: Query=3irsA Sbjct=1j6pA Z-score=14.8

back to top
DSSP  --------------------------------------------------LLLEELLLLL
Query --------------------------------------------------LKIIDFRLRP   10
ident                                                             
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH


DSSP  LlhhhhhlhhHHLHHHhHHHH--------hhhlllllhhhhhllhHHHHHHHHHLLLLEE
Query PamgflnariYTRPDIrNRFT--------rqlgfepapsaeekslELMFEEMAAAGIEQG   62
ident |                                             |   | |  ||   
Sbjct P------xtlLRGVAE-DLSFeewlfskvlpiedrltekxayygtILAQXEXARHGIAGF  113
DSSP  H------hhhHLLLLL-LLLHhhhhhllhhhhhllllhhhhhhhhHHHHHHHHLLLEEEE


DSSP  EEELleellleeLLHHHHHHHHHHLLLLEEEEEELLLL--LHHHHHHHHHHHHHLLL---
Query VCVGrnssvlgsVSNADVAAVAKAYPDKFHPVGSIEAA--TRKEAMAQMQEILDLGI---  117
ident |                 |                                         
Sbjct VDXY--------FHEEWIAKAVRDFGXRALLTRGLVDSngDDGGRLEENLKLYNEWNgfe  165
DSSP  EEEE--------LLHHHHHHHHHHHLLEEEEEEEELLLllLLLLHHHHHHHHHHHHLlhh


DSSP  ----LLEEE-LHHHLlllllllLHHHHHHHHHHHHLLLLEEEELLLLlllLHHHhLHHHH
Query ----RIVNL-EPGVWatpmhvdDRRLYPLYAFCEDNGIPVIMMTGGNagpDITYtNPEHI  172
ident            |             |            ||             |   | |
Sbjct grifVGFGPhSPYLC------sEEYLKRVFDTAKSLNAPVTIHLYET--sKEEY-DLEDI  216
DSSP  hleeEEEEElLLLLL------lHHHHHHHHHHHHHHLLLEEEEELLL--lLLLL-LLHHH


DSSP  HHHHhhLLLLLEEEEHhHLLLHHHHHHHHHHlLLEEEELH--HHHL--lLLLHhhHHHHH
Query DRVLgdFPDLTVVSSHgNWPWVQEIIHVAFRrPNLYLSPD--MYLY--nLPGHadFIQAA  228
ident                |           |         |      |               
Sbjct LNIG--LKEVKTIAAH-CVHLPERYFGVLKD-IPFFVSHNpaSNLKlgnGIAP--VQRXI  270
DSSP  HLLL--LLLLLEEEEE-LLLLLHHHHHHHLL-LLEEEEELhhHHHHlllLLLL--HHHHH


DSSP  LLHHhhLLLLLLLLL--LLLHhhHHHH-HHLL----------LLLHHHHHHHHLHHHHHH
Query NSFLadRMLFGTAYP--MCPLkeYTEW-FLTL----------PIKPDAMEKILHGNAERL  275
ident           ||        |                             |         
Sbjct EHGX--KVTLGTDGAasNNSL--NLFFeXRLAsllqkaqnprNLDVNTCLKXVTYDGAQA  326
DSSP  HLLL--EEEELLLLLllLLLL--LHHHhHHHHhhhhhlllllLLLHHHHHHHHLHHHHHH


DSSP  HH----------------------------------------------------------
Query LA----------------------------------------------------------  277
ident                                                             
Sbjct XGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgey  386
DSSP  HLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellll


DSSP  -----------------hlll
Query -----------------qagr  281
ident                      
Sbjct ptidseevkrelariekelys  407
DSSP  llllhhhhhhhhhhhhhhhhl


No 33: Query=3irsA Sbjct=2oofA Z-score=14.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  -LLLEELLLLLLLhhhhhlhhHHLHH-------------------hhhhhhhhhlllllh
Query -LKIIDFRLRPPAmgflnariYTRPD-------------------irnrftrqlgfepap   40
ident     ||                                                      
Sbjct tPGLIDCHTHLIF--------AGSRAeefelrqkgvpyaeiarkgggiistvratraase  112
DSSP  eELEEEEEELLLL--------LLLLHhhhhhhhhlllhhhhhhllllhhhhhhhhhhllh


DSSP  hhhhLLHHHHHHHHHHLLLLEEEEELLEellleelLHHHHHHHHHHLL----LLEEEEEE
Query saeeKSLELMFEEMAAAGIEQGVCVGRNssvlgsvSNADVAAVAKAYP----DKFHPVGS   96
ident                  |                        ||                
Sbjct dqlfELALPRVKSLIREGVTTVEIKSGY--gltleDELKXLRVARRLGealpIRVKTTLL  170
DSSP  hhhhHHHHHHHHHHHHHLEEEEEEELLL--lllhhHHHHHHHHHHHHHhhllLEEEEEEE


DSSP  LL-----------lLLHHHHH-HHHHHHHHLL-LLLEEELHHHLllLLLLLLhhHHHHHH
Query IE-----------aATRKEAM-AQMQEILDLG-IRIVNLEPGVWatPMHVDDrrLYPLYA  143
ident                                |    |                     | 
Sbjct AAhavppeyrddpdSWVETICqEIIPAAAEAGlADAVDVFCEHI--GFSLAQ--TEQVYL  226
DSSP  EEllllhhhlllhhHHHHHHHhLHHHHHHHLLlLLEEEEEELLL--LLLHHH--HHHHHH


DSSP  HHHHLLLLEEEELLLLllllhhHHLHhHHHHHHHhllLLLEEEEHhHLLLHHHHHHHHHH
Query FCEDNGIPVIMMTGGNagpditYTNPeHIDRVLGdfpDLTVVSSHgNWPWVQEIIHVAFR  203
ident      |  |                                   |       | |     
Sbjct AADQYGLAVKGHXDQL------SNLG-GSTLAAN---FGALSVDH-LEYLDPEGIQALAH  275
DSSP  HHHHLLLEEEEEELLL------LLLL-HHHHHHH---LLLLEEEE-LLLLLHHHHHHHHH


DSSP  LLlEEEELH-HHHL---LLLLHhHHHHHHLLHHhhLLLLLLLLL----LLLH-HHHHHHH
Query RPnLYLSPD-MYLY---NLPGHaDFIQAANSFLadRMLFGTAYP----MCPL-KEYTEWF  254
ident |            |                                              
Sbjct RG-VVATLLpTAFYflkETKLP-PVVALRKAGV--PXAVSSDINpgtaPIVSlRXAXNXA  331
DSSP  HL-LEEEELhHHHHhllLLLLL-LHHHHHHLLL--LEEELLLLLllllLLLLhHHHHHHH


DSSP  HL-LLLLHHHHHHHHLHHHHH--HHHH---------------------------------
Query LT-LPIKPDAMEKILHGNAER--LLAQ---------------------------------  278
ident  |     |          | |                                       
Sbjct CTlFGLTPVEAXAGVTRHAARalGEQEqlgqlrvgxladflvwncghpaelsyligvdql  391
DSSP  HHhHLLLHHHHHHHLLHHHHHhlLLLLlllllllllllleeeellllllhhhhlllllle


DSSP  ---------lll
Query ---------agr  281
ident             
Sbjct vsrvvngeetlh  403
DSSP  eeeeelleelll


No 34: Query=3irsA Sbjct=2imrA Z-score=14.7

back to top
DSSP  ------------------------------------------------------LLLEEL
Query ------------------------------------------------------LKIIDF    6
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE


DSSP  LLLLllhhHHHLHH-----hhlhHHHHHhhhhhlllllhhHHHL----LHHHHHHHHHHL
Query RLRPpamgFLNARI-----ytrpDIRNRftrqlgfepapsAEEK----SLELMFEEMAAA   57
ident                                                             
Sbjct HTHL---dMSAYEFqalpyfqwiPEVVI-----------rGRHLrgvaAAQAGADTLTRL  106
DSSP  EEEL---lLLHHHHhhlhhhhllHHHHH-----------hHLLLlhhhHHHHHHHHHHHL


DSSP  LLLEEEEELleellleeLLHHHHHHHHHHLLLLEEEEEELLL----LLHHHHHHHHHHHH
Query GIEQGVCVGrnssvlgsVSNADVAAVAKAYPDKFHPVGSIEA----ATRKEAMAQMQEIL  113
ident |                       |                            |      
Sbjct GAGGVGDIV--------WAPEVMDALLAREDLSGTLYFEVLNpfpdKADEVFAAARTHLE  158
DSSP  LLLLEEEEE--------LLHHHHHHHHLLLLLLEEEEEEELLllhhHHHHHHHHHHHHHH


DSSP  HLL-------LLLEEE-LHHHLlllllllLHHHHHHHHHHHHLLLLEEEELLLL-lLLLH
Query DLG-------IRIVNL-EPGVWatpmhvdDRRLYPLYAFCEDNGIPVIMMTGGN-aGPDI  164
ident                   |           |    |       | |              
Sbjct RWRrlerpglRLGLSPhTPFTV------sHRLMRLLSDYAAGEGLPLQIHVAEHptELEM  212
DSSP  HHHlllllleEEEEEElLLLLL------lHHHHHHHHHHHHHHLLLLEEEELLLhhHHHH


DSSP  H-------------------------------hHLHHHHH--HHHHhlllLLEEEEHHhL
Query T-------------------------------yTNPEHID--RVLGdfpdLTVVSSHGnW  191
ident                                  |     |   ||           |   
Sbjct FrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelGVLA----ARPTLVHM-V  267
DSSP  HhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhLLHH----HLLEEEEL-L


DSSP  LLHHHHHHHHHHLLlEEEELH--HHHL-LLLLHhHHHHHHLLHHhhLLLLLLLLL-LLLH
Query PWVQEIIHVAFRRPnLYLSPD--MYLY-NLPGHaDFIQAANSFLadRMLFGTAYP-MCPL  247
ident       |    |                      |    |          ||        
Sbjct NVTPDDIARVARAG-CAVVTCprSNHHlECGTF-DWPAFAAAGV--EVALGTDSVaSGET  323
DSSP  LLLHHHHHHHHHHL-LLEEELhhHHHHlLLLLL-LHHHHHHLLL--LEEELLLLHhHHLL


DSSP  ---hHHHHHHHLLL--LLHHHHHHHHLHHHHHHHH------------------hlll
Query ---kEYTEWFLTLP--IKPDAMEKILHGNAERLLA------------------qagr  281
ident     |       |     |            |                         
Sbjct lnvrEEVTFARQLYpgLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  lllhHHHHHHHHHLllLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 35: Query=3irsA Sbjct=4c5yA Z-score=14.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLLEELLLLLllhhHHHLhhhHLHHHHhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL
Query LKIIDFRLRPpamgFLNAriyTRPDIRnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
ident     |                                         |     |    |  
Sbjct PGLWDCHMHF----GGDD---DYYNDY-----tsglathpassgARLARGCWEALQNGYT  108
DSSP  ELEEEEEELL----LLLL---LLLLLL-----hhhhhllhhhhhHHHHHHHHHHHHLLEE


DSSP  EEEEELleellleellhhHHHHHHHHLL------lLEEEE-EELL---------------
Query QGVCVGrnssvlgsvsnaDVAAVAKAYP------dKFHPV-GSIE---------------   98
ident                       ||||                                  
Sbjct SYRDLA-----------gYGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifalpage  157
DSSP  EEEELL-----------lLHHHHHHHHHlllllllEEEELlLEEEllllllllllllhhh


DSSP  ----------------------LLLHHHHHHHHHHHHHLLLLLEEELHHH-------lll
Query ----------------------AATRKEAMAQMQEILDLGIRIVNLEPGV-------wat  129
ident                       |    |           |                    
Sbjct vlgsygvmnprpgywgagplciADGVEEVRRAVRLQIRRGAKVIXVMASGgvmsrddnpn  217
DSSP  hhhhhlllllllllllllleeeLLLHHHHHHHHHHHHHHLLLLEEEELLLllllllllll


DSSP  llLLLLHHHHHHHHHHHHLLLLEEEELLllllllhhhhLHHHHHHHHHhlllLLEEEEHh
Query pmHVDDRRLYPLYAFCEDNGIPVIMMTGgnagpditytNPEHIDRVLGdfpdLTVVSSHg  189
ident         |             |                   |               | 
Sbjct faQFSPEELKVIVEEAARQNRIVSAHVH----------GKAGIMAAIK---aGCKSLEH-  263
DSSP  llLLLHHHHHHHHHHHHHLLLLEEEEEL----------LHHHHHHHHH---hLLLEEEE-


DSSP  HLLLHHHHHHHHHHLLlEEEELH-HHHL---------------------LLLLHHHHHHH
Query NWPWVQEIIHVAFRRPnLYLSPD-MYLY---------------------NLPGHADFIQA  227
ident       |                                                    |
Sbjct VSYADEEVWELMKEKG-ILYVATrSVIEiflasngeglvkeswaklqalADSHLKAYQGA  322
DSSP  LLLLLHHHHHHHHHHL-LEEELLhHHHHhhhhhllllllllhhhlllhhHHHHHHHHHHH


DSSP  HLLHHhhLLLLLLLLLlllHHHHHhHHHLL-----LLLHHHHHHHHLHHHHHHHHHL---
Query ANSFLadRMLFGTAYPmcpLKEYTeWFLTL-----PIKPDAMEKILHGNAERLLAQA---  279
ident            ||              |          |    |    ||          
Sbjct IKAGV--TIALGTDTA--pGGPTA-LELQFavergGMTPLEAIKAATANAPLSVGPQapl  377
DSSP  HHLLL--LEELLLLLL--lLLLLH-HHHHHhhhllLLLHHHHHHHHLLLHHHHHHHHlll


DSSP  ---------------------------------------------------------ll
Query ---------------------------------------------------------gr  281
ident                                                            
Sbjct tgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  llllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 36: Query=3irsA Sbjct=3ls9A Z-score=14.6

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------LKII    4
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE


DSSP  ELLLLLLlhhhhhlhhHHLHHHHHHhhHHHL----------------llllhhhhhlLHH
Query DFRLRPPamgflnariYTRPDIRNRftRQLG----------------fepapsaeekSLE   48
ident                         |                                   
Sbjct NSHQHLY------egaMRAIPQLER--VTMAswlegvltrsagwwrdgkfgpdvireVAR  112
DSSP  EEEELHH------hhhHLLLHHHLL--LLHHhhhhhhhhhhhhhhhlllllhhhhhhHHH


DSSP  HHHHHHHHLLLLEEEEELLEellleellhHHHHHHHHHLL---LLEEEEEELLL------
Query LMFEEMAAAGIEQGVCVGRNssvlgsvsnADVAAVAKAYP---DKFHPVGSIEA------   99
ident     |    ||                      |   |       ||   |         
Sbjct AVLLESLLGGITTVADQHLF--fpgatadSYIDATIEAATdlgIRFHAARSSMTlgkseg  170
DSSP  HHHHHHHHLLEEEEEEEELL--lllllllLHHHHHHHHHHhhlLEEEEEELLLLllhhhl


DSSP  --------LLHHHHHHHHHHHHHLLL---------LLEEE-LHHHLlllllllLHHH-HH
Query --------ATRKEAMAQMQEILDLGI---------RIVNL-EPGVWatpmhvdDRRL-YP  140
ident                       |                                 |   
Sbjct gfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvrIALGPcGVPYD-------KPELfEA  223
DSSP  llllhhhlLLHHHHHHHHHHHHHHHLllllllleeEEELLlLLLLL-------LHHHhHH


DSSP  HHHHHHHLLLLEEEELLLLlllLHHH------HLHHHHH--HHHHhllllLEEEEHHhLL
Query LYAFCEDNGIPVIMMTGGNagpDITY------TNPEHID--RVLGdfpdlTVVSSHGnWP  192
ident       |                         |                  |   |    
Sbjct FAQMAADYDVRLHTHFYEP-ldAGMSdhlygmTPWRFLEkhGWAS----dRVWLAHA-VV  277
DSSP  HHHHHHHHLLEEEEEELLL-lhHHHHhhhhllLHHHHHHhlLLLL----lLEEEEEL-LL


DSSP  LHHHHHHHHHHLLlEEEELH-HHHL--LLLLHhHHHHHHLLHHhhLLLLLLLLL--LLLH
Query WVQEIIHVAFRRPnLYLSPD-MYLY--NLPGHaDFIQAANSFLadRMLFGTAYP--MCPL  247
ident    | |                                          |||         
Sbjct PPREEIPEFADAG-VAIAHLiAPDLrmGWGLA-PIREYLDAGI--TVGFGTTGSasNDGG  333
DSSP  LLHHHHHHHHHHL-LEEEELhHHHHhlLLLLL-LHHHHHHLLL--EEEELLLLLllLLLL


DSSP  HhHHHHHHL--------------lLLLHHHHHHHHLHHHHH-HHHH--------------
Query KeYTEWFLT--------------lPIKPDAMEKILHGNAER-LLAQ--------------  278
ident                                           |                 
Sbjct N-LLGDLRLaalahrpadpnepekWLSARELLRMATRGSAEcLGRPdlgvleegraadia  392
DSSP  L-HHHHHHHhhhhlhhhllllhhhLLLHHHHHHHLLHHHHHhLLLLllllllllllllee


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------ag  280
ident                                                             
Sbjct cwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttali  452
DSSP  eeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhl


DSSP  l
Query r  281
ident  
Sbjct p  453
DSSP  l


No 37: Query=3irsA Sbjct=3nqbA Z-score=14.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  -----------------LLLEELLLLLLlhhhhhlhhhhlhhhhhhhhhhhlllllhhhh
Query -----------------LKIIDFRLRPPamgflnariytrpdirnrftrqlgfepapsae   43
ident                     ||                                      
Sbjct srrdaaqvidaggayvsPGLIDTHXHIE------------------------------ss   90
DSSP  lllleeeeeelllleeeELEEEEEELHH------------------------------hh


DSSP  hllHHHHHHHHHHLLLLEEEEELLeelllEELL------HHHHHHHHHHLLLLEEEEEEL
Query eksLELMFEEMAAAGIEQGVCVGRnssvlGSVS------NADVAAVAKAYPDKFHPVGSI   97
ident             | |    |                       |      |         
Sbjct xitPAAYAAAVVARGVTTIVWDPH-----EFGNvhgvdgVRWAAKAIENLPLRAILLAPS  145
DSSP  lllHHHHHHHHHLLLEEEEEELLH-----HHHHhhlhhhHHHHHHHHLLLLLEEEEEELL


DSSP  LLL--------lhhHHHHHHHHHHHLL-LLLEE-ELHHhllllLLLLLHH--HHHHHHHH
Query EAA--------trkEAMAQMQEILDLG-IRIVN-LEPGvwatpMHVDDRR--LYPLYAFC  145
ident                  |     |    |                |  |           
Sbjct CVPsapglerggadFDAAILADLLSWPeIGGIAeIXNX-----RGVIERDprXSGIVQAG  200
DSSP  LLLlllllllllllLLHHHHHHHHLLLlEEEEEeELLH-----HHHHLLLhhHHHHHHHH


DSSP  HHLLLLEEEELLllllllhhhHLHH-HHHHHHHHLllllEEEEHhhLLLHHHHHHHHHHL
Query EDNGIPVIMMTGgnagpdityTNPE-HIDRVLGDFpdltVVSSHgnWPWVQEIIHVAFRR  204
ident       |                                                     
Sbjct LAAEKLVCGHAR---------GLKNaDLNAFXAAG---vSSDHE--LVSGEDLXAKLRAG  246
DSSP  HHHLLEEEELLL---------LLLHhHHHHHHHLL---lLEELL--LLLHHHHHHHHHLL


DSSP  llEEEELHHHHLLllLHHHHHHHHL--LHHHHLLLLLLLLLL--lLHHH--hHHHHHLL-
Query pnLYLSPDMYLYNlpGHADFIQAAN--SFLADRMLFGTAYPM--cPLKE--yTEWFLTL-  257
ident   |                |  | |    |       |        |           | 
Sbjct --LTIELRGSHDH--LLPEFVAALNtlGHLPQTVTLCTDDVFpddLLQGgglDDVVRRLv  302
DSSP  --LEEEEELLLHH--HHHHHHHHHHhhLLLLLLEEEELLLLLhhhHHHLllhHHHHHHHh


DSSP  --LLLHHHHHHHHLHHHHHHHHH-------------------------------------
Query --PIKPDAMEKILHGNAERLLAQ-------------------------------------  278
ident     ||         ||   |                                       
Sbjct ryGLKPEWALRAATLNAAQRLGRsdlgliaagrradivvfedlngfsarhvlasgravae  362
DSSP  hlLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllllleeeeeelleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  278
ident                                                             
Sbjct ggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvk  422
DSSP  lleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  278
ident                                                             
Sbjct dgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnag  482
DSSP  lleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  278
ident                                                             
Sbjct dxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvve  542
DSSP  hhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------lll
Query ------------------------------------------agr  281
ident                                              
Sbjct wqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllllhhhhhlllllllllleelllleeelllleeellleeel


No 38: Query=3irsA Sbjct=2pajA Z-score=14.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  LLLEELLLLLLlhhhhhlhhhhlhhhHHHHhhhhlllllhhhhhLLHHHHHHHHHHLLLL
Query LKIIDFRLRPPamgflnariytrpdiRNRFtrqlgfepapsaeeKSLELMFEEMAAAGIE   60
ident                                                     | |  |  
Sbjct PAWVNTHHHLF-----------qsllKGEP---fralfderrfrLAARIGLIELARSGCA  106
DSSP  ELEELLLLLHH-----------hhhlLLLL---lhhhllhhhhhHHHHHHHHHHHLLLEE


DSSP  EEEEELLEELlleellhHHHHHHHHHLL---LLEEEEEELLL---------------LLH
Query QGVCVGRNSSvlgsvsnADVAAVAKAYP---DKFHPVGSIEA---------------ATR  102
ident                     |            |                        | 
Sbjct TVADHNYVYY--pgmpfDSSAILFEEAEklgLRFVLLRGGATqtrqleadlptalrpETL  164
DSSP  EEEELLLLLL--lllllLHHHHHHHHHHhllLEEEEEELLLLllllllllllhhhllLLH


DSSP  HHHHHHHHHHHHLLL---------LLEEE-LHHHllllllllLHHHHHHHHHHHHLLLLE
Query KEAMAQMQEILDLGI---------RIVNL-EPGVwatpmhvdDRRLYPLYAFCEDNGIPV  152
ident     |                                      |      |     |   
Sbjct DAYVADIERLAARYHdaspramrrVVMAPtTVLY-----sisPREMRETAAVARRLGLRM  219
DSSP  HHHHHHHHHHHHHLLllllllleeEEELLlLLLL-----lllHHHHHHHHHHHHHLLLEE


DSSP  EEELLllllllhHHHLHHHHHHHHhhllllLEEEEHHhLLLHHHHHHHHHHLLlEEEELH
Query IMMTGgnagpdiTYTNPEHIDRVLgdfpdlTVVSSHGnWPWVQEIIHVAFRRPnLYLSPD  212
ident                                |   |         |              
Sbjct HSHLS-------GKSPVAFCGEHD--wlgsDVWYAHL-VKVDADEIALLAQTG-TGVAHC  268
DSSP  EEELL-------LLLHHHHHHHLL--llllLEEEELL-LLLLHHHHHHHHHHL-LEEEEL


DSSP  H-HHLLLllhhHHHHHHLLHHhhLLLLLLLLL--LLLH--HHHHHHHHLLL----LLHHH
Query M-YLYNLpghaDFIQAANSFLadRMLFGTAYP--MCPL--KEYTEWFLTLP----IKPDA  263
ident       |         |          |                                
Sbjct PqSNGRL----PVREMADAGV--PVSIGVDGAasNEAAdmISEVHMTWLAQrarlASIAE  322
DSSP  HhHHHLL----LLLLHHHHLL--LEEELLLHHhhLLLLlhHHHHHHHHHHHhhllLLHHH


DSSP  HHHHHLHHHHH-HHHH--------------------------------------------
Query MEKILHGNAER-LLAQ--------------------------------------------  278
ident           |                                                 
Sbjct VIHWGTAGGARvMGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvma  382
DSSP  HHHHHLHHHHHhHLLLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeee


DSSP  ------------------------------------lll
Query ------------------------------------agr  281
ident                                        
Sbjct lfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 39: Query=3irsA Sbjct=1yrrB Z-score=14.4

back to top
DSSP  ---------------------------------------------------LLLEELLLL
Query ---------------------------------------------------LKIIDFRLR    9
ident                                                       ||  | 
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL


DSSP  L--llhhHHHLhhhhlhhhhhhhhhhhlllllhhhhhlLHHHHHHHHHHLLLLEEEEELL
Query P--pamgFLNAriytrpdirnrftrqlgfepapsaeekSLELMFEEMAAAGIEQGVCVGR   67
ident           |                            || |       |         
Sbjct GcggvqfNDTA---------------------eavsveTLEIMQKANEKSGCTNYLPTLI   99
DSSP  EelleelLLLL---------------------llllhhHHHHHHHHHHLLLEEEEEEEEL


DSSP  EEL-lleelLHHHHHHHHHHLLLLEE-EEEELLlllhHHHHHHHHHHHhLLLLLEEELhh
Query NSS-vlgsvSNADVAAVAKAYPDKFH-PVGSIEaatrKEAMAQMQEILdLGIRIVNLEpg  125
ident   |                  |                       |     |  | |   
Sbjct TTSdelmkqGVRVMREYLAKHPNQALgLHLEGP-wlnAALVDFLCENA-DVITKVTLA--  155
DSSP  LLLhhhhhhHHHHHHHHHHHLLLLLLlEEEELL-lllLHHHHHHHHLH-HHEEEEEEL--


DSSP  hllllllLLLHhHHHHHHHHHHLLLLEEEELlllllllhhHHLHHHHHHHHHHlllLLEE
Query vwatpmhVDDRrLYPLYAFCEDNGIPVIMMTggnagpditYTNPEHIDRVLGDfpdLTVV  185
ident                        || |                                 
Sbjct -------PEMV-PAEVISKLANAGIVVSAGH--------sNATLKEAKAGFRA---GITF  196
DSSP  -------HHHL-LHHHHHHHHHHLLEEEELL--------lLLLHHHHHHHHHH---LEEE


DSSP  EEHHHL-LLHH-----hhHHHHHHLLLEEEELHhhHLLL-lLHHHHHHHHlLHHHHLLLL
Query SSHGNW-PWVQ-----eiIHVAFRRPNLYLSPDmyLYNL-pGHADFIQAAnSFLADRMLF  238
ident   |                         |         |    |    |      |    
Sbjct ATHLYNaMPYItgrepglAGAILDEADIYCGII--ADGLhvDYANIRNAK-RLKGDKLCL  253
DSSP  ELLLLLlLLLLlllllhhHHHHHHLLLLEEEEE--LLLLllLHHHHHHHH-HHHHHHEEE


DSSP  LLLLL--LLLHhhHHHHHHLL----LLLHHHHHHHHLHHHHHHHHH--------------
Query GTAYP--MCPLkeYTEWFLTL----PIKPDAMEKILHGNAERLLAQ--------------  278
ident  |             |    |     |  |           |                  
Sbjct VTDATsgSSLT--MIEGVRNLvehcGIALDEVLRMATLYPARAIGVekrlgtlaagkvan  311
DSSP  ELLLLllLLLL--HHHHHHHHhhhhLLLHHHHHHHHLHHHHHHLLLllllllllllllll


DSSP  --------------------lll
Query --------------------agr  281
ident                        
Sbjct ltaftpdfkitktivngnevvtq  334
DSSP  eeeellllleeeeeelleeeeel


No 40: Query=3irsA Sbjct=1j5sA Z-score=14.3

back to top
DSSP  ------------------------LLLEELLLLLLLH-----hhhhlhhhhlHHHHHHH-
Query ------------------------LKIIDFRLRPPAM-----gflnariytrPDIRNRF-   30
ident                         | | |      |                        
Sbjct hmflgedylltnraavrlfnevkdLPIVDPHNHLDAKdivenkpwndiweveGATDHYVw   60
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLLHHhhhhllllllhhhhhLLLLHHHh


DSSP  ----------------------------------hHHHLLLL------------------
Query ----------------------------------tRQLGFEP------------------   38
ident                                                             
Sbjct elmrrcgvseeyitgsrsnkekwlalakvfprfvgNPTYEWIhldlwrrfnikkviseet  120
DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhllLHHHHHHhhhhhhhllllllllhhh


DSSP  -----lhhhhhllhHHHHHHHHHLLLLEEEEELLeellleelLHHHhhHHHHHLL-----
Query -----apsaeekslELMFEEMAAAGIEQGVCVGRnssvlgsvSNADvaAVAKAYP-----   88
ident                           |                                 
Sbjct aeeiweetkkklpeMTPQKLLRDMKVEILCTTDD-------pVSTL--EHHRKAKeaveg  171
DSSP  hhhhhhhhhhhlllLLHHHHHHHLLEEEEELLLL-------lLLLL--HHHHHHHhhlll


DSSP  LLEEEEEEL--LLLL-----------------------hHHHHHHHHHHHHLL---LLLE
Query DKFHPVGSI--EAAT-----------------------rKEAMAQMQEILDLG---IRIV  120
ident     |                                      |                
Sbjct VTILPTWRPdrAMNVdkegwreyvekmgerygedtstldGFLNALWKSHEHFKehgCVAS  231
DSSP  LEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHHHlllLLEE


DSSP  EELHHhlllllLLLL-------------------------------HHHHHHHHHHHHLL
Query NLEPGvwatpmHVDD-------------------------------RRLYPLYAFCEDNG  149
ident                                                             
Sbjct DHALL------EPSVyyvdenraravhekafsgekltqdeindykaFMMVQFGKMNQETN  285
DSSP  EEEEL------LLLLllllhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHL


DSSP  LLEEEELlllLLLL--------------------HHHHLHHHHHHHHHHLL-LLLEEEeh
Query IPVIMMTggnAGPD--------------------ITYTNPEHIDRVLGDFP-DLTVVSsh  188
ident                                         |     |  |   |  |   
Sbjct WVTQLHI---GALRdyrdslfktlgpdsggdistNFLRIAEGLRYFLNEFDgKLKIVL--  340
DSSP  LEEEEEE---LEELlllhhhhhhlllllllleelLLLLHHHHHHHHHHHLLlLLLEEE--


DSSP  HHLL--LHHHHHHHHHHLLLEE-EELHH-HHLLLlLHHHHHHHHLL--HHHHLLLLLLLL
Query GNWP--WVQEIIHVAFRRPNLY-LSPDM-YLYNLpGHADFIQAANS--FLADRMLFGTAY  242
ident           |   |   || |   |         |         |   |       |  
Sbjct YVLDptHLPTISTIARAFPNVYvGAPWWfNDSPF-GMEMHLKYLASvdLLYNLAGMVTDS  399
DSSP  EELLhhHHHHHHHHHHHLLLEEeLLLLLlLLLHH-HHHHHHHHHHLllLHHHLLLLLLLL


DSSP  LL-lLHHHHHHHHHL--LLLL--------------HHHHHHHHLHHHHHHHHhlll
Query PM-cPLKEYTEWFLT--LPIK--------------PDAMEKILHGNAERLLAqagr  281
ident          || |                                    |      
Sbjct RKllSFGSRTEMFRRvlSNVVgemvekgqipikeaRELVKHVSYDGPKALFF----  451
DSSP  LLllHHHHHHHHHHHhhHHHHhhhhhlllllhhhhHHHHHHHHLHHHHHHHL----


No 41: Query=3irsA Sbjct=3icjA Z-score=14.2

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------L    1
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE


DSSP  LLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhHHHHL----------------
Query KIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapSAEEK----------------   45
ident    |  |                                   |                 
Sbjct AFFDSHLHLDE--------------------------lgMSLEMvdlrgvksmeelverv   94
DSSP  LEEEEEELHHH--------------------------hhHHHHLeellllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   45
ident                                                             
Sbjct kkgrgriifgfgwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpsk  154
DSSP  hlllllleeeeeelhhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllll


DSSP  ---------------------------------LHHHHHHHHHHLLLLEEEEELLeelll
Query ---------------------------------SLELMFEEMAAAGIEQGVCVGRnssvl   72
ident                                    |   |     |              
Sbjct dfdestgivreraleesrkiinekiltvkdykhYIESAQEHLLSLGVHSVGFMSV-----  209
DSSP  leelllleeehhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEEEEE-----


DSSP  eellHHHHHHHHHHLL------LLEEEEEELLlllhhhhhhHHHHHHH----------ll
Query gsvsNADVAAVAKAYP------DKFHPVGSIEaatrkeamaQMQEILD----------lg  116
ident                              | |                            
Sbjct ----GEKALKALFELEregrlkMNVFAYLSPE---------LLDKLEElnlgkfegrrlr  256
DSSP  ----LHHHHHHHHHHHhlllllLEEEEEELHH---------HHHHHHHhlllleelllee


DSSP  LLLEEELHHH-------------------lllLLLLLLhHHHHHHHHHHHLLLLEEEELL
Query IRIVNLEPGV-------------------watPMHVDDrRLYPLYAFCEDNGIPVIMMTG  157
ident |  | |                               |             |  |     
Sbjct IWGVXLFVDGslgartallsepytdnpttsgeLVMNKD-EIVEVIERAKPLGLDVAVHAI  315
DSSP  EEEEEEELLLllllllllllllllllllllllLLLLHH-HHHHHHHHHLLLLLEEEEEEL


DSSP  llllllhhHHLH-HHHHHHHHHLLlLLEEEEHHhLLLHHHHHHHHHHLLlEEEELH-HHH
Query gnagpditYTNP-EHIDRVLGDFPdLTVVSSHGnWPWVQEIIHVAFRRPnLYLSPD-MYL  215
ident                                |                     |      
Sbjct --------GDKAvDVALDAFEEAE-FSGRIEHA-SLVRDDQLERIKELK-VRISAQpHFI  364
DSSP  --------LHHHhHHHHHHHHHHL-LLLEEEEL-LLLLHHHHHHHHHHL-LEEEELlLHH


DSSP  LLL------------LLHHhHHHHHLLHHhhLLLLLLLLLLLLHHhhHHHHHLL------
Query YNL------------PGHAdFIQAANSFLadRMLFGTAYPMCPLKeyTEWFLTL------  257
ident                           |       | |  |  |                 
Sbjct VSDwwivnrvgeeraKWAY-RLKTLSSIT--KLGFSTDSPIEPAD--PWVSIDAavnryv  419
DSSP  HHLllhhhhhhhhhhHHLL-LHHHHHHHL--LEEELLLLLLLLLL--HHHHHHHhhhlll


DSSP  -----LLLHHHHHHHHLHHHHH--HHHH------------------lll
Query -----PIKPDAMEKILHGNAER--LLAQ------------------agr  281
ident                         |                        
Sbjct vdpgeRVSREEALHLYTHGSAQvtLAEDlgklergfraeyiildrdplk  468
DSSP  llhhhLLLHHHHHHHLLHHHHHhlLLLLllllllllllleeeellllll


No 42: Query=3irsA Sbjct=3iacA Z-score=14.1

back to top
DSSP  -------------------------LLLEELLLLLLLH----hhhhlhhhhlHHHHHhHH
Query -------------------------LKIIDFRLRPPAM----gflnariytrPDIRNrFT   31
ident                            | ||                             
Sbjct atfxtedfllkndiartlyhkyaapXPIYDFHCHLSPQeiaddrrfdnlgqiWLEGD-HY   59
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLLLHHhhhhllllllhhhhHHLLL-LH


DSSP  HH---------------------------------------hLLLL--------------
Query RQ---------------------------------------lGFEP--------------   38
ident                                                             
Sbjct KWralrsagvdeslitgketsdyekyxawantvpktlgnplyHWTHlelrrpfgitgtlf  119
DSSP  HHhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhHHHHhhhhllllllllll


DSSP  -----------lhhhhhllhHHHHHHHHHLLLLEEEEELLEellleelLHHHHHHHHHH-
Query -----------apsaeekslELMFEEMAAAGIEQGVCVGRNssvlgsvSNADVAAVAKA-   86
ident                                                           | 
Sbjct gpdtaesiwtqcneklatpaFSARGIXQQXNVRXVGTTDDP------iDSLEYHRQIAAd  173
DSSP  lhhhhhhhhhhhhhhhllhhHLHHHHHHHLLEEEEELLLLL------lLLLHHHHHHHHl


DSSP  --LLLLEEEEEELLLL----------------------------LHHHHHHHHHHHHHLL
Query --YPDKFHPVGSIEAA----------------------------TRKEAMAQMQEILDLG  116
ident         |                                    |             |
Sbjct dsIDIEVAPSWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLDHFAACG  233
DSSP  llLLLEEELLLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHHLL


DSSP  LLLEEELHHhllllLLLL-------------------------------LHHHHHHHHHH
Query IRIVNLEPGvwatpMHVD-------------------------------DRRLYPLYAFC  145
ident  |                                                  |  |    
Sbjct CRASDHGIE-----TLRFapvpddaqldailgkrlagetlseleiaqftTAVLVWLGRQY  288
DSSP  LLEEEEEEL-----LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHH


DSSP  HHLLLLEEEELlllLLLL-------------------HHHHLHHHHHHHHHHLL----LL
Query EDNGIPVIMMTggnAGPD-------------------ITYTNPEHIDRVLGDFP----DL  182
ident    |                                           | |          
Sbjct AARGWVXQLHI---GAIRnnntrxfrllgpdtgfdsiGDNNISWALSRLLDSXDvtneLP  345
DSSP  HHHLLEEEEEE---LEELlllhhhhhhhllllllleeLLLLLHHHHHHHHHHHHllllLL


DSSP  LEEEehHHLL--LHHHHHHHHHHLL------LEEEEL-HHHHLLLLLHHHHHHHHLL--H
Query TVVSshGNWP--WVQEIIHVAFRRP------NLYLSP-DMYLYNLPGHADFIQAANS--F  231
ident                                               |             
Sbjct KTIL--YCLNprDNEVLATXIGNFQgpgiagKVQFGSgWWFNDQKDGXLRQLEQLSQxgL  403
DSSP  EEEE--EELLhhHHHHHHHHHHHLLllllllLEEELLlLHHHLLHHHHHHHHHHHHHhlL


DSSP  HHHLLLLLLLLLLlLHHHHHHHHHLLLL------------------LHHHHHHHHLHHHH
Query LADRMLFGTAYPMcPLKEYTEWFLTLPI------------------KPDAMEKILHGNAE  273
ident |       |           | |                              |   || 
Sbjct LSQFVGXLTDSRSfLSYTRHEYFRRILCnllgqwaqdgeipddeaxLSRXVQDICFNNAQ  463
DSSP  HHHLLLLLLLLLLlLLLHHHHHHHHHHHhhhhhhhhlllllllhhhHHHHHHHHHLHHHH


DSSP  HHHHHLll
Query RLLAQAgr  281
ident |       
Sbjct RYFTIK--  469
DSSP  HHLLLL--


No 43: Query=3irsA Sbjct=1a5kC Z-score=13.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ------LLLEELLLLLLlhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllHHHHHHHH
Query ------LKIIDFRLRPPamgflnariytrpdirnrftrqlgfepapsaeeksLELMFEEM   54
ident          ||                                              || 
Sbjct egkivtAGGIDTHIHWI-----------------------------------CPQQAEEA  145
DSSP  llleeeELEEEEEEELL-----------------------------------LLLHHHHH


DSSP  HHLLLLEEEEELleellLEEL-------LHHHHHHHHHHLL---LLEEEEEELLLllhhh
Query AAAGIEQGVCVGrnssvLGSV-------SNADVAAVAKAYP---DKFHPVGSIEAatrke  104
ident    |    |  |                          |           |         
Sbjct LVSGVTTMVGGG--tgpAAGThattctpGPWYISRMLQAADslpVNIGLLGKGNV----s  199
DSSP  HHHLEEEEEEEL--lllLHHHhhlllllHHHHHHHHHHHHLlllLEEEEEEELLL----l


DSSP  HHHHHHHHHHLLLLLEEELHHHllllLLLLLhhHHHHHHHHHHLLLLEEEELlllLLLLH
Query AMAQMQEILDLGIRIVNLEPGVwatpMHVDDrrLYPLYAFCEDNGIPVIMMTggnAGPDI  164
ident       |    |                                 | |            
Sbjct QPDALREQVAAGVIGLEIHEDW----GATPA-aIDCALTVADEMDIQVALHS---DTLNE  251
DSSP  LHHHHHHHHHHLLLEEEEEHHH----LLLHH-hHHHHHHHHHHHLLEEEEEL---LLLLL


DSSP  HhhLHHHHHHHHHHlllLLEEEEHHHLL---lhHHHHHHHHhLLLEEEELHHHHLLL---
Query TytNPEHIDRVLGDfpdLTVVSSHGNWP---wvQEIIHVAFrRPNLYLSPDMYLYNL---  218
ident      |      |     |    |           ||      ||   |           
Sbjct S-gFVEDTLAAIGG---RTIHTFHTEGAggghaPDIITACA-HPNILPSSTNPTLPYtln  306
DSSP  L-lLHHHHHHHHLL---LLEEELLLLLLlllllLLHHHHHH-LLLEEEEEEHHHLLLlll


DSSP  --------------------------------LLHHHHHHHHLLHHhhLLLLLLLLLL-L
Query --------------------------------PGHADFIQAANSFLadRMLFGTAYPM-C  245
ident                                    |              |         
Sbjct tidehldmlmvchhldpdiaedvafaesrirrETIAAEDVLHDLGA--FSLTSSDSQAmG  364
DSSP  hhhhhhhhhhhhhllllllhhhhhlllllllhHHHHHHHHHHHLLL--LLEEELLLLLlL


DSSP  LHHHHHHHHHLLL-------------------lLHHHHHHHHLHHHHHHHH---------
Query PLKEYTEWFLTLP-------------------iKPDAMEKILHGNAERLLA---------  277
ident    |                                        |               
Sbjct RVGEVILRTWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGiahevgsie  424
DSSP  LLLLHHHHHHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct vgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarh  484
DSSP  lllllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhh


DSSP  ------------------------------HLLL--------------------------
Query ------------------------------QAGR--------------------------  281
ident                                                             
Sbjct hcrltflsqaaaangvaerlnlrsaiavvkGCRTvqkadmvhnslqpnitvdaqtyevrv  544
DSSP  hhleeeelhhhhhhlhhhhllllleeeellLLLLllhhhllllllllleeelllllleee


DSSP  ----------------------
Query ----------------------  281
ident                       
Sbjct dgelitsepadvlpmaqryflf  566
DSSP  lleellllllllllllllllll


No 44: Query=3irsA Sbjct=2ogjA Z-score=13.7

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------LKIID    5
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE


DSSP  LLLLLLLHhHHHLhhhhlhhhhhhhhhhhlllllhhhhhllhhhHHHHHHHLLLLEEEEE
Query FRLRPPAMgFLNAriytrpdirnrftrqlgfepapsaeekslelMFEEMAAAGIEQGVCV   65
ident                                               |  |  |    |  
Sbjct LHVHIWHG-GTDI----------------------------sirPSECGAERGVTTLVDA   91
DSSP  EEELLLLL-LLLL----------------------------lllHHHLLHHHLEEEEEEE


DSSP  LLeellleelLHHHHHH-HHHHLLLLEEEEEELL------------LLLHHHH-HHHHHH
Query GRnssvlgsvSNADVAA-VAKAYPDKFHPVGSIE------------AATRKEA-MAQMQE  111
ident |                                                 |        |
Sbjct GS----ageaNFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIKDIdLDRILE  147
DSSP  LL----llllLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHHHLlHHHHHH


DSSP  HHHLL---LLLEEELHH--HLLLLLLlllHHHHHHHHHHHHLLLLEEEELlllLLLLhhH
Query ILDLG---IRIVNLEPG--VWATPMHvddRRLYPLYAFCEDNGIPVIMMTggnAGPDitY  166
ident         |                                   |          |    
Sbjct CYAENsehIVGLXVRAShvITGSWGV---TPVKLGKKIAKILKVPXXVHV---GEPP--A  199
DSSP  HHHLLlllEEEEEEEELhhHHLLLLL---HHHHHHHHHHHHHLLLEEEEE---LLLL--L


DSSP  HLHhHHHHHHhhllLLLEEEEHH----hlLLHH---HHHHHHHHLLLEEEELHH---HHL
Query TNPeHIDRVLgdfpDLTVVSSHG----nwPWVQ---EIIHVAFRRPNLYLSPDM---YLY  216
ident          |        |  |                   | |     |          
Sbjct LYD-EVLEIL----GPGDVVTHCfngksgSSIXedeDLFNLAERCEGIRLDIGHggaSFS  254
DSSP  LHH-HHHHHL----LLLLEEELLllllllLLLLllhHHHHHHHHLLLLEEELLLlllLLL


DSSP  LlLLHHHHHHhhLLHHhhLLLLLLLLL------LLLHhhHHHHHHLL---LLLHHHHHHH
Query NlPGHADFIQaaNSFLadRMLFGTAYP------MCPLkeYTEWFLTL---PIKPDAMEKI  267
ident         |      |       |                      |             
Sbjct F-KVAEAAIA--RGLL--PFSISTDLHghsxnfPVWD--LATTXSKLlsvDXPFENVVEA  307
DSSP  H-HHHHHHHH--LLLL--LLLLLLLLLllllllLLLL--HHHHHHHHhhlLLLHHHHHHL


DSSP  HLHHHHHHHH--------------------------------------------------
Query LHGNAERLLA--------------------------------------------------  277
ident    |                                                        
Sbjct VTRNPASVIRldxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryaviga  367
DSSP  LLHHHHHHLLllllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeell


DSSP  --------hlll
Query --------qagr  281
ident             
Sbjct eaiaasryipra  379
DSSP  eeeellllllll


No 45: Query=3irsA Sbjct=1a4mA Z-score=13.7

back to top
DSSP  -----LLLEELLLLLL---------------lhhhhhlhhhhlHHHHHhhHHHHL-----
Query -----LKIIDFRLRPP---------------amgflnariytrPDIRNrfTRQLG-----   35
ident                                              |              
Sbjct tpafnKPKVELHVHLDgaikpetilyfgkkrgialpadtveelRNIIG--MDKPLslpgf   58
DSSP  lllllLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhHHHHL--LLLLLlhhhh


DSSP  ----------llllhhhhhllhhHHHHHHHHLLLLEEEEELLE-----------------
Query ----------fepapsaeeksleLMFEEMAAAGIEQGVCVGRN-----------------   68
ident                           |  |  |                           
Sbjct lakfdyympviagcreaikriayEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqte  118
DSSP  hllhhhhhhhhlllhhhhhhhhhHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlll


DSSP  ellleelLHHHHHHHHHHLL----LLEEEEEELLllLHHHHHHHHHHHHHLL---LLLEE
Query ssvlgsvSNADVAAVAKAYP----DKFHPVGSIEaaTRKEAMAQMQEILDLG---IRIVN  121
ident            |             |                                  
Sbjct gdvtpddVVDLVNQGLQEGEqafgIKVRSILCCMrhQPSWSLEVLELCKKYNqktVVAMD  178
DSSP  llllhhhHHHHHHHHHHHHHhhhlLEEEEEEEEEllLHHHHHHHHHHHHHLLlllEEEEE


DSSP  ELHHHlllLLLLLLHH-HHHHHHHHHHLLLLEEEELLLLllllhhhHLHHHHHHHHHHLl
Query LEPGVwatPMHVDDRR-LYPLYAFCEDNGIPVIMMTGGNagpdityTNPEHIDRVLGDFp  180
ident |                    |     |||      |           ||          
Sbjct LAGDE--tIEGSSLFPgHVEAYEGAVKNGIHRTVHAGEV-------GSPEVVREAVDIL-  228
DSSP  EELLL--lLLLHHHLHhHHHHHHHHHHHLLEEEEEELLL-------LLHHHHHHHHHLL-


DSSP  lLLEEEEHhHLLLHHH--HHHHHHHLLlEEEELH-HHHL---LLLL--hHHHHHHHLLHH
Query dLTVVSSHgNWPWVQE--IIHVAFRRPnLYLSPD-MYLY---NLPG--hADFIQAANSFL  232
ident   |    |                              |                 |   
Sbjct -KTERVGH-GYHTIEDeaLYNRLLKEN-MHFEVCpWSSYltgAWDPkttHAVVRFKNDKA  285
DSSP  -LLLEEEE-LHHHHHLhhHHHHHHHLL-LEEEELhHHHHhllLLLLlllLHHHHHHHLLL


DSSP  hhLLLLLLLL-LLLLhhHHHHHHHLL-----LLLHHHHHHHhLHHHHH-HHHH-------
Query adRMLFGTAY-PMCPlkEYTEWFLTL-----PIKPDAMEKIlHGNAER-LLAQ-------  278
ident        |                                    ||              
Sbjct --NYSLNTDDpLIFK--STLDTDYQMtkkdmGFTEEEFKRL-NINAAKsSFLPeeekkel  340
DSSP  --LEEELLLLlLLLL--LLHHHHHHHhhhllLLLHHHHHHH-HHHHHHlLLLLhhhhhhh


DSSP  ------lll
Query ------agr  281
ident          
Sbjct lerlyreyq  349
DSSP  hhhhhhhll


No 46: Query=3irsA Sbjct=3qy6A Z-score=13.3

back to top
DSSP  llLEELLLLLLLHHHHhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL
Query lkIIDFRLRPPAMGFLnariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
ident    ||                                            |       || 
Sbjct --MIDIHCHILPAMDD-----------------------gagdsADSIEMARAAVRQGIR   35
DSSP  --LEELLLLLLLLLLL-----------------------llllhHHHHHHHHHHHHLLLL


DSSP  EEEEELLEELLLEELLHHHHHHHHHHLL---------lLEEEEEelllllhhhhhhhhhh
Query QGVCVGRNSSVLGSVSNADVAAVAKAYP---------dKFHPVGsieaatrkeamaqmqe  111
ident                  | |   |                 |                  
Sbjct TIIATPHHNNGVYKNEPAAVREAADQLNkrlikediplHVLPGQ----------------   79
DSSP  EEELLLEELLLLLLLLHHHHHHHHHHHHhhhhhlllllEEELLL----------------


DSSP  hhhllllleEELHHhlllllllllhHHHHHHHH----hhhlLLLEEEELlllllllhHHH
Query ildlgirivNLEPGvwatpmhvddrRLYPLYAF----cednGIPVIMMTggnagpdiTYT  167
ident                                |                            
Sbjct ---------EIRIY----------gEVEQDLAKrqllslndTKYILIEF------pfDHV  114
DSSP  ---------EEELL----------lLHHHHHHLlllllhhhLLEEEEEL------llLLL


DSSP  LhHHHHHHHHHLL--LLLEEEEHhHLLL------HHHHHHHHHHLllEEEELH-hHHLL-
Query NpEHIDRVLGDFP--DLTVVSSHgNWPW------VQEIIHVAFRRpnLYLSPD-mYLYN-  217
ident           |        |  |                |                |   
Sbjct P-RYAEQLFYDLQlkGYIPVIAH-PERNreirenPSLLYHLVEKG--AASQITsgSLAGi  170
DSSP  L-LLHHHHHHHHHhlLLEEEEEL-HHHLhhhhhlLHHHHHHHHLL--LEEEEEhhHHLLl


DSSP  -----LLLHHHHHHHHllhhhhlLLLLLLLL---LLLHhhHHHHHHLL---LLLHHHHHH
Query -----LPGHADFIQAAnsfladrMLFGTAYP---MCPLkeYTEWFLTL---PIKPDAMEK  266
ident               |                          |   |              
Sbjct fgkqlKAFSLRLVEAN-----liHFVASDAHnvkTRNF--HTQEALYVlekEFGSELPYM  223
DSSP  llhhhHHHHHHHHHLL-----llLEEELLLLlllLLLL--LHHHHHHHhhhHHLLHHHHH


DSSP  HHlHHHHHHHHHL----------ll
Query ILhGNAERLLAQA----------gr  281
ident     ||| ||               
Sbjct LT-ENAELLLRNQtifrqppqpvkr  247
DSSP  HH-HHHHHHHLLLllllllllllll


No 47: Query=3irsA Sbjct=2uz9A Z-score=12.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  --------LLLEELLLLLLlhhhhhlhHHHLhhhHHHHHHH------------hlllllh
Query --------LKIIDFRLRPPamgflnarIYTRpdiRNRFTRQ------------lgfepap   40
ident             |               |                               
Sbjct lshheffmPGLVDTHIHAS--------QYSF--aGSSIDLPllewltkytfpaehrfqni  110
DSSP  llllleeeELEEEEEEEHH--------HHHH--lLLLLLLLhhhhhhhlhhhhhhhhhlh


DSSP  hhhhLLHHHHHHHHHHLLLLEEEEELLEellleelLHHHHHHHHHHLL---LLEEEEEEL
Query saeeKSLELMFEEMAAAGIEQGVCVGRNssvlgsvSNADVAAVAKAYP---DKFHPVGSI   97
ident                  |                         |                
Sbjct dfaeEVYTRVVRRTLKNGTTTACYFATI-------HTDSSLLLADITDkfgQRAFVGKVC  163
DSSP  hhhhHHHHHHHHHHHHLLEEEEEEELLL-------LHHHHHHHHHHHHhhlLEEEEELEE


DSSP  LL---------LLHHHHHHHHHHHHHLL--------LLLEEE-LHHHLlllllllLHHH-
Query EA---------ATRKEAMAQMQEILDLG--------IRIVNL-EPGVWatpmhvdDRRL-  138
ident             |  |                      ||                  | 
Sbjct MDlndtfpeykETTEESIKETERFVSEMlqknysrvKPIVTPrFSLSC-------SETLm  216
DSSP  LLlllllllllLLHHHHHHHHHHHHHHHhhhlllleEEEEEElLHHHL-------LHHHh


DSSP  HHHHHHHHHLLLLEEEELLLLllllHHHHL---------hHHHHHHHHHL-lllLEEEEH
Query YPLYAFCEDNGIPVIMMTGGNagpdITYTN---------pEHIDRVLGDF-pdlTVVSSH  188
ident   |                 |                                   |  |
Sbjct GELGNIAKTRDLHIQSHISEN----RDEVEavknlypsykNYTSVYDKNNlltnKTVMAH  272
DSSP  HHHHHHHHHHLLEEEEEELLL----HHHHHhhhhhlllllLHHHHHHHLLllllLEEEEE


DSSP  HhLLLHHHHHHHHHHLLlEEEELH-HHHL---lLLLH-HHHHHHhllhhhhLLLLLLLLL
Query GnWPWVQEIIHVAFRRPnLYLSPD-MYLY---nLPGH-ADFIQAansfladRMLFGTAYP  243
ident |      |   |   |                                       ||   
Sbjct G-CYLSAEELNVFHERG-ASIAHCpNSNLslssGFLNvLEVLKH-----evKIGLGTDVA  325
DSSP  L-LLLLHHHHHHHHHHL-LEEEELhHHHHhlllLLLLhHHHHHL-----llEEEELLLLL


DSSP  L-LLHH-HHHHHHHLL-------------LLLHHHHHHHHLHHHHH--HHHH--------
Query M-CPLK-EYTEWFLTL-------------PIKPDAMEKILHGNAER--LLAQ--------  278
ident                                                  |          
Sbjct GgYSYSmLDAIRRAVMvsnillinkvnekSLTLKEVFRLATLGGSQalGLDGeignfevg  385
DSSP  LlLLLLhHHHHHHHHHhhhhhhhllllllLLLHHHHHHHHLHHHHHhlLLLLllllllll


DSSP  --------------------------------------------------------lll
Query --------------------------------------------------------agr  281
ident                                                            
Sbjct kefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  lllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 48: Query=3irsA Sbjct=4rdvB Z-score=12.9

back to top
DSSP  ------------------------------------------------LLLEELLLLLL-
Query ------------------------------------------------LKIIDFRLRPP-   11
ident                                                             
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh


DSSP  --------------lhhhhhLHHHHLHhhhhhhhhhhlllllhhhhhlLHHHHHHHHHHL
Query --------------amgflnARIYTRPdirnrftrqlgfepapsaeekSLELMFEEMAAA   57
ident                          |                             ||  |
Sbjct ramaglaevagnpndsfwtwRELMYRM----------varlspeqievIACQLYIEMLKA  110
DSSP  hhhlllllllllllllhhhhHHHHHHH----------hllllhhhhhhHHHHHHHHHHHH


DSSP  LLLEEEEELL----eellleellHHHHHHHHHHLL---LLEEEEEELLLL----------
Query GIEQGVCVGR----nssvlgsvsNADVAAVAKAYP---DKFHPVGSIEAA----------  100
ident |                               |                           
Sbjct GYTAVAEFHYvhhdldgrsyadpAELSLRISRAASaagIGLTLLPVLYSHagfggqpase  170
DSSP  LEEEEEEEELlllllllllllllLHHHHHHHHHHHhhlLEEEEEELLLLEeellleellh


DSSP  ----lhhHHHHHHHHHHHLL--------lLLEEE-LHHHLlllllllLHHHHHHHHHhHH
Query ----trkEAMAQMQEILDLG--------iRIVNL-EPGVWatpmhvdDRRLYPLYAFcED  147
ident           |       |                                    |    
Sbjct gqrrfinGSEAYLELLQRLRapleaaghsLGLCFhSLRAV------tPQQIATVLAA-GH  223
DSSP  hhlllllLHHHHHHHHHHHHhhhhhhlleELEEElLLLLL------lHHHHHHHHLL-LL


DSSP  LLLLEEEELLLL--LLLLHH----hHLHHHHHHHHHhllllLEEEEHhHLLLHHHHHHHH
Query NGIPVIMMTGGN--AGPDIT----yTNPEHIDRVLGdfpdlTVVSSHgNWPWVQEIIHVA  201
ident    ||            |                            |             
Sbjct DDLPVHIHIAEQqkEVDDCQawsgrRPLQWLYENVA--vdqRWCLVH-ATHADPAEVAAM  280
DSSP  LLLLEEEEELLLhhHHHHHHhhhllLHHHHHHHHLL--lllLEEEEE-LLLLLHHHHHHH


DSSP  HHLLlEEEELH--HHHL-LLLLHhHHHHHHLLHHhhLLLLLLLLLlLLHHhhHHHH-HLL
Query FRRPnLYLSPD--MYLY-NLPGHaDFIQAANSFLadRMLFGTAYPmCPLKeyTEWF-LTL  257
ident  |                                  |   |       |          |
Sbjct ARSG-AVAGLClsTEANlGDGIF-PATDFLAQGG--RLGIGSDSH-VSLS--VVEElRWL  333
DSSP  HHHL-LEEEELhhHHHHlLLLLL-LHHHHHHLLL--EEEELLLLL-LLLL--HHHHhHHH


DSSP  L-------------------lLHHHHHHHHLHHHHH-HHHH-------------------
Query P-------------------iKPDAMEKILHGNAER-LLAQ-------------------  278
ident                                      |                      
Sbjct EygqrlrdrkrnrlyrddqpmIGRTLYDAALAGGAQaLGQPigslavgrradllvldgnd  393
DSSP  HhhhhhhhlllllllllllllHHHHHHHHHHHHHHHhHLLLllllllllllleeeellll


DSSP  -------------------------------------------------------lll
Query -------------------------------------------------------agr  281
ident                                                           
Sbjct pylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  hhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 49: Query=3irsA Sbjct=3ooqA Z-score=12.2

back to top
DSSP  ---------------------------------------------------LLLEELLLL
Query ---------------------------------------------------LKIIDFRLR    9
ident                                                        |    
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  LLLhhhhhlhhhhlhhhhhhhhhhhlllllhHHHH------------------------l
Query PPAmgflnariytrpdirnrftrqlgfepapSAEE------------------------k   45
ident                                                             
Sbjct IGL---------------------------fEEGVgyyysdgneatdpvtphvkaldgfn   93
DSSP  LLL---------------------------lLLLLlhhhlllllllllllllllhhhhll


DSSP  LHHHHHHHHHHLLLLEEEEELLEE--llleellhhhhhhhHHHLLLleeeeeelllllhh
Query SLELMFEEMAAAGIEQGVCVGRNS--svlgsvsnadvaavAKAYPDkfhpvgsieaatrk  103
ident       |   | |      |                                        
Sbjct PQDPAIERALAGGVTSVXIVPGSAnpvggqgsvikfrsiiVEECIV--------------  139
DSSP  LLLHHHHHHHLLLEEEEEELLLLLlleeeeeeeeelllllHHHHEE--------------


DSSP  hhhhhhhhhhhlLLLLEEELH--HHLL---------LLLLllLHHHHHH-----------
Query eamaqmqeildlGIRIVNLEP--GVWA---------TPMHvdDRRLYPL-----------  141
ident                                                             
Sbjct -----------kDPAGLKXAFgeNPKRvygerkqtpSTRXgtAGVIRDYftkvknyxkkk  188
DSSP  -----------eEEEEEEEELlhHHHHhhhhlllllLLHHhhHHHHHHHhhhhhhhhhhh


DSSP  -------------------HHHHHHLLLLEEEELLllllllhhhHLHHHHHHHHHHLLlL
Query -------------------YAFCEDNGIPVIMMTGgnagpdityTNPEHIDRVLGDFPdL  182
ident                            ||                      |    |   
Sbjct elaqkegkeftetdlkxevGEXVLRKKIPARXHAH-------raDDILTAIRIAEEFG-F  240
DSSP  hhhhhlllllllllhhhhhHHHHHLLLLLEEEEEL-------lhHHHHHHHHHHHHHL-L


DSSP  LEEEEHHHLlLHHHhHHHHHHLLlEEEELHHhHLLL--------LLHHHHHHHHLLHHhh
Query TVVSSHGNWpWVQEiIHVAFRRPnLYLSPDMyLYNL--------PGHADFIQAANSFLad  234
ident   |  ||          |              |                           
Sbjct NLVIEHGTE-AYKI-SKVLAEKK-IPVVVGP-LLTFrtklelkdLTXETIAKLLKDGV--  294
DSSP  LEEEEELLL-HHHH-HHHHHHHL-LLEEELL-LLLLlllhhhllLLLLHHHHHHHLLL--


DSSP  LLLLLLLLLLLLHHHHHHHHHLLL---LLHHHHHHHHLHHHHHHHH--------------
Query RMLFGTAYPMCPLKEYTEWFLTLP---IKPDAMEKILHGNAERLLA--------------  277
ident         |  ||   |    |      |     |||  |    |               
Sbjct LIALXCDHPVIPLEFATVQAATAXrygAKEEDLLKILTVNPAKILGledrigsiepgkda  354
DSSP  LEEELLLLLLLLHHHHHHHHHHHHhhlLLHHHHHHLLLHHHHHHLLllllllllllllll


DSSP  --------------------------hlll
Query --------------------------qagr  281
ident                               
Sbjct dlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  leeeelllllllllleeeeeelleeeeell


No 50: Query=3irsA Sbjct=1v77A Z-score=10.5

back to top
DSSP  LLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllhhhhhhHHHHLlLL
Query LKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeekslelmfeEMAAAgIE   60
ident  | |    |                                                   
Sbjct VKFIEMDIRDKE-------------------------------------ayeLAKEW-FD   22
DSSP  LLLEEEEELLHH-------------------------------------hhhHHHHH-LL


DSSP  EEEEELleellleellhhhhhhhhhhlllleeeeeELLLllhhhhhhHHHHHHHLLL---
Query QGVCVGrnssvlgsvsnadvaavakaypdkfhpvgSIEAatrkeamaQMQEILDLGI---  117
ident   |                                               | |       
Sbjct EVVVSI-----------------------------KFNE-------eVDKEKLREARkey   46
DSSP  EEEEEE-----------------------------EELL-------lLLHHHHHHHHhhh


DSSP  --lLEEELHhhlllllLLLLhhHHHHHHHHhhLLLLEEEELlllllllhhhhLHHHHHHH
Query --rIVNLEPgvwatpmHVDDrrLYPLYAFCedNGIPVIMMTggnagpditytNPEHIDRV  175
ident       |                                                 |   
Sbjct gkvAILLSN-------PKPS-lVRDTVQKF--KSYLIYVES----------nDLRVIRYS   86
DSSP  lleEEEEEL-------LLHH-hHHHHHHHL--LLLEEEEEL----------lLHHHHHHH


DSSP  HHHlllLLEEEEhHHLLLH-HHHHH--HHHHLL--LEEEELHHHHL-------LLLLHHH
Query LGDfpdLTVVSShGNWPWV-QEIIH--VAFRRP--NLYLSPDMYLY-------NLPGHAD  223
ident                |       |    |      |  |                     
Sbjct IEK---GVDAII-SPWVNRkDPGIDhvLAKLMVkkNVALGFSLRPLlysnpyeRANLLRF  142
DSSP  HHL---LLLEEE-LLLLLLlLLLLLhhHHHHHHhhLLEEEEELHHHhhllhhhHHHHHHH


DSSP  HHHHHlLHHH---HLLLLLLLLLL--LLHHhhHHHHHLL----LLLHHHHHHHHLHHHHH
Query FIQAAnSFLA---DRMLFGTAYPM--CPLKeyTEWFLTL----PIKPDAMEKILHGNAER  274
ident    |          |                       |                   | 
Sbjct MMKAW-KLVEkykVRRFLTSSAQEkwDVRY--PRDLISLgvviGMEIPQAKASISMYPEI  199
DSSP  HHHHH-HHHHhhlLLEEEELLLLLhhHLLL--HHHHHHHhhhlLLLHHHHHHLLLHHHHH


DSSP  HHHhlll
Query LLAqagr  281
ident  |     
Sbjct ILK----  202
DSSP  HHL----


No 51: Query=3irsA Sbjct=1m65A Z-score=10.3

back to top
DSSP  llLEELLLLlllhhHHHLHHHhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL
Query lkIIDFRLRppamgFLNARIYtrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
ident     |                                         |          || 
Sbjct -yPVDLHMH-----TVASTHA----------------------ySTLSDYIAQAKQKGIK   32
DSSP  -lLEELLLL-----LLLLLLL----------------------lLLHHHHHHHHHHHLLL


DSSP  EEEEELLE-ELLLeELLHHHHHHHHHHLLL----LEEEEEELL-LLLHhhHHHHHHHHHh
Query QGVCVGRN-SSVLgSVSNADVAAVAKAYPD----KFHPVGSIE-AATRkeAMAQMQEILd  114
ident                                                             
Sbjct LFAITDHGpDMED-APHHWHFINMRIWPRVvdgvGILRGIEANiKNVD-gEIDCSGKMF-   89
DSSP  EEEEEEELlLLLL-LLLLHHHHHHHHLLLEelleEEEEEEEEElLLLL-lLLLLLHHHH-


DSSP  LLLLLEEELHhHLLLLLL----lLLHHHHHHHHHHhhllLLEEEELLllllllHHHHlhH
Query LGIRIVNLEPgVWATPMH----vDDRRLYPLYAFCedngIPVIMMTGgnagpdITYTnpE  170
ident                                 |         |            |    
Sbjct DSLDLIIAGF-HEPVFAPhdkatNTQAMIATIASG----NVHIISHP----gnPKYE--I  138
DSSP  HHLLEEEEEL-LLLLLLLllhhhHHHHHHHHHHLL----LLLEELLL----llLLLL--L


DSSP  HHHHHHHHLLLLLEEEEHHhlLLHHHHHHHHHHLLlEEEELH----------HHHLllll
Query HIDRVLGDFPDLTVVSSHGnwPWVQEIIHVAFRRPnLYLSPD----------MYLYnlpg  220
ident     |        |           |                                  
Sbjct DVKAVAEAAAKHQVALEINnsSNCREVAAAVRDAG-GWVALGsdshtaftmgEFEE---c  194
DSSP  LHHHHHHHHHHHLLEEEEEllLLHHHHHHHHHHHL-LLEEEElllllhhhllLLHH---h


DSSP  HHHHHHHhlLHHHHLLLLllllllllhhhhhhhhhlllllhhhhhhHHLHHHHHHHHHLL
Query HADFIQAanSFLADRMLFgtaypmcplkeytewfltlpikpdamekILHGNAERLLAQAG  280
ident           |   | |                                      |   |
Sbjct LKILDAV--DFPPERILN----------------------------VSPRRLLNFLESRG  224
DSSP  HHHHHHL--LLLHHHLHH----------------------------HLHHHHHHHHHHLL


DSSP  L---------
Query R---------  281
ident           
Sbjct Mapiaefadl  234
DSSP  Llllhhhlll


No 52: Query=3irsA Sbjct=3au2A Z-score=9.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -----------------------------------LLLEELLLLLllHHHHhlhhhhlhh
Query -----------------------------------LKIIDFRLRPpaMGFLnariytrpd   25
ident                                        |                    
Sbjct yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHS--TYSD---------  349
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELL--LLLL---------


DSSP  hhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELLEEL--LLEEL---LHHHH
Query irnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGRNSS--VLGSV---SNADV   80
ident                      ||   |     |              | |          
Sbjct -----------------gqNTLEELWEAAKTMGYRYLAVTDHSPAvrVAGGPspeEALKR  392
DSSP  -----------------llLLHHHHHHHHHHHLLLEEEEEEELHHhhLLLLLlhhHHHHH


DSSP  HHHHHHLL-----lLEEEEeelllllhhhhhhhhhhhhhlllllEEELHHhllllLLLLl
Query AAVAKAYP-----dKFHPVgsieaatrkeamaqmqeildlgiriVNLEPGvwatpMHVDd  135
ident                                                             
Sbjct VGEIRRFNethgppYLLAG-------------------------AEVDIH-----PDGT-  421
DSSP  HHHHHHHHhhhlllEEEEE-------------------------EEEELL-----LLLL-


DSSP  hhhhhhhhhhhhllllEEEELlllLLLLHH--hhLHHHHHHHHHhlLLLLEEEEHHHLL-
Query rrlyplyafcedngipVIMMTggnAGPDIT--ytNPEHIDRVLGdfPDLTVVSSHGNWP-  192
ident                 |                         |        |  |     
Sbjct ---ldypdwvlreldlVLVSV---HSRFNLpkadQTKRLLKALE--NPFVHVLAHPTARl  473
DSSP  ---llllhhhhlllleEEEEL---LLLLLLlhhhHHHHHHHHHL--LLLLLEELLLLLLl


DSSP  ------lhhHHHHHHHHL--LLEEEELH----HHHLlllLHHHHHHHHLLHHhhLLLLLL
Query ------wvqEIIHVAFRR--PNLYLSPD----MYLYnlpGHADFIQAANSFLadRMLFGT  240
ident              |             |                  |    |       |
Sbjct lgrrapieaDWEAVFQKAkeKGVAVEIDgyydRMDL---PDDLARMAYGMGL--WISLST  528
DSSP  lllllllllLHHHHHHHHhhHLLEEEEEllllLLLL---LHHHHHHHHHLLL--LEEEEL


DSSP  LLL-lLLHHhHHHHHHLL----LLLHHHhhHHHLH---hHHHHHHH-lll
Query AYP-mCPLKeYTEWFLTL----PIKPDAmeKILHG---nAERLLAQ-agr  281
ident        |    |          | |                 |      
Sbjct DAHqtDHLR-FMELAVGTaqraWIGPER--VLNTLdyedLLSWLKArrgv  575
DSSP  LLLlhHHHH-HHHHHHHHhhhlLLLLLL--LHHHLlhhhHHHHHHLllll


No 53: Query=3irsA Sbjct=2a3lA Z-score=9.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------------------LLLEELLLLLLlhhhhhlh
Query -----------------------------------------LKIIDFRLRPPamgflnar   19
ident                                              |              
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHS--------  172
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELL--------


DSSP  hhhlhhhhhhhhhhhlllllhhHHHL----------------------------------
Query iytrpdirnrftrqlgfepapsAEEK----------------------------------   45
ident                                                             
Sbjct -------------------acmNQKHllrfiksklrkepdevvifrdgtyltlrevfesl  213
DSSP  -------------------lllLHHHhhhhhhhhhhllllllleeelleeelhhhhhhhh


DSSP  ---------------------------------------------------------LHH
Query ---------------------------------------------------------SLE   48
ident                                                             
Sbjct dltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeITK  273
DSSP  lllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHHH


DSSP  HHHHHHHHLLLLEEEEELLEE--llleelLHHHhhhhhhHLLLLEEEEEELLLL------
Query LMFEEMAAAGIEQGVCVGRNS--svlgsvSNADvaavakAYPDKFHPVGSIEAA------  100
ident   |    |                       |        |                   
Sbjct QVFSDLEASKYQMAEYRISIYgrkmsewdQLASwivnndLYSENVVWLIQLPRLyniykd  333
DSSP  HHHHHHLLLLLEEEEEEEELLlllllhhhHHHHhhhlllLLLLLEEEEEEEELLhhhhll


DSSP  ------LHHHHHHHHHH-------------hhHLLL--LLEEELHH--------------
Query ------TRKEAMAQMQE-------------ilDLGI--RIVNLEPG--------------  125
ident                                           |                 
Sbjct mgivtsFQNILDNIFIPlfeatvdpdshpqlhVFLKqvVGFDLVDDeskperrptkhmpt  393
DSSP  llllllLHHHHHHHLLHhhhhhhlhhhllllhHHHLleEEEEEELLllllllllllllll


DSSP  ----hllLLLLLLLhhHHHHHHHHHHLL----------LLEEEELLLLllllhhhHLHHH
Query ----vwaTPMHVDDrrLYPLYAFCEDNG----------IPVIMMTGGNagpdityTNPEH  171
ident                  |  ||                |      |             |
Sbjct paqwtnaFNPAFSY-yVYYCYANLYVLNklreskgmttITLRPHSGEA-------GDIDH  445
DSSP  lllllllLLLLHHH-hHHHHHHHHHHHHhhhlllllllLEELLLLLLL-------LLLHH


DSSP  HHHHHHHllllLEEEEHhHLLLHHH--HHHHHHHLLlEEEELH-HHHL----LLLLHhHH
Query IDRVLGDfpdlTVVSSHgNWPWVQE--IIHVAFRRPnLYLSPD-MYLY----NLPGHaDF  224
ident                 |                      |                   |
Sbjct LAATFLT----CHSIAH-GINLRKSpvLQYLYYLAQ-IGLAMSpLSNNslflDYHRN-PF  498
DSSP  HHHHHHH----LLLLLL-LHHHHHLhhHHHHHHHHL-LLEEELhHHHLllllLLLLL-LH


DSSP  HHHHLLHHhhLLLLLLLL-LLLL--hHHHHHHHHLL----LLLHHHHHHHHlHHHHH-HH
Query IQAANSFLadRMLFGTAY-PMCP--lKEYTEWFLTL----PIKPDAMEKILhGNAER-LL  276
ident        |       |              |                  |   |      
Sbjct PVFFLRGL--NVSLSTDDpLQIHltkEPLVEEYSIAasvwKLSACDLCEIA-RNSVYqSG  555
DSSP  HHHHHLLL--LEEELLLLhHHHLlllLHHHHHHHHHhhhhLLLHHHHHHHH-HHHHHhLL


DSSP  HH--------------------------------------------------------ll
Query AQ--------------------------------------------------------ag  280
ident                                                             
Sbjct FShalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevv  615
DSSP  LLhhhhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllllllllll


DSSP  l
Query r  281
ident  
Sbjct p  616
DSSP  l


No 54: Query=3irsA Sbjct=3dcpA Z-score=8.5

back to top
DSSP  lLLEELLLLLLlhhhHHLHHHhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL
Query lKIIDFRLRPPamgfLNARIYtrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
ident     |                                          |            
Sbjct -XKRDGHTHTE----FCPHGT----------------------hDDVEEXVLKAIELDFD   33
DSSP  -LLEEEEELLL----LLLLLL----------------------lLLHHHHHHHHHHLLLL


DSSP  EEEEELLEE---------------LLLEEL---LHHHHHHHHHHLLL------LEEEEE-
Query QGVCVGRNS---------------SVLGSV---SNADVAAVAKAYPD------KFHPVG-   95
ident     |                       |                          |    
Sbjct EYSIVEHAPlssefxkntagdkeaVTTASXaxsDLPYYFKKXNHIKKkyasdlLIHIGFe   93
DSSP  EEEEEEELLllhhhhhllllllhhHHLLLLlhhHHHHHHHHHHHHHHhlllllEEEEEEe


DSSP  -ellllLHHHHHHHHHHHHhLLLLLEeelhhhlllllllllhhhhhhhhhhhhlllleEE
Query -sieaaTRKEAMAQMQEILdLGIRIVnlepgvwatpmhvddrrlyplyafcedngipvIM  154
ident                 |                                           
Sbjct vdyligYEDFTRDFLNEYG-PQTDDG--------------------------------VL  120
DSSP  eellllLHHHHHHHHHHHH-HHLLEE--------------------------------EE


DSSP  ELlllLLLL----------------------------hhhhLHHHHHHHHHHL--llllE
Query MTggnAGPD----------------------------itytNPEHIDRVLGDF--pdltV  184
ident                                            |                
Sbjct SL---HFLEgqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEADlglfkpR  177
DSSP  EL---LEEEelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLLllllllL


DSSP  EEEHHHLL-----------------lhHHHHHHHHHL--LLEEEELHHHHL-------ll
Query VSSHGNWP-----------------wvQEIIHVAFRR--PNLYLSPDMYLY-------nl  218
ident    |                                       |                
Sbjct RXGHISLCqkfqqffgedtsdfseevxEKFRVILALVkkRDYELDFNTAGLfkplcgety  237
DSSP  EELLLLHHhllhhhhlllhhhllhhhhHHHHHHHHHHhhHLLEEEEELHHHhllllllll


DSSP  lLHHHHHHHHLLHHhhLLLLLLLLL-llLHHHHHHHHHLLLLlhhhhhhhhlhhhhhhhh
Query pGHADFIQAANSFLadRMLFGTAYP-mcPLKEYTEWFLTLPIkpdamekilhgnaerlla  277
ident         |           |                                       
Sbjct pPKKIVTLASELQI--PFVYGSDSHgvqDIGRGYSTYCQKLE------------------  277
DSSP  lLHHHHHHHHHLLL--LEEEELLLLlhhHLLLLHHHHHHHLL------------------


DSSP  hlll
Query qagr  281
ident     
Sbjct ----  277
DSSP  ----


No 55: Query=3irsA Sbjct=3f2bA Z-score=7.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -----------------------------------------------LLLEELLLLLLlh
Query -----------------------------------------------LKIIDFRLRPPam   13
ident                                                 |     |  |  
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTP--  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLL--


DSSP  HHHHLhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELLEellle
Query GFLNAriytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGRNssvlg   73
ident                                 |     |     |               
Sbjct MSQMD------------------------avTSVTKLIEQAKKWGHPAIAVTDHA-----  149
DSSP  LLLLL------------------------llLLHHHHHHHHHHLLLLLEEELLLL-----


DSSP  ellHHHHHHHHH----hlllLEEEEEelllllhhhhhhhhhhhhhllllleEELHH----
Query svsNADVAAVAK----aypdKFHPVGsieaatrkeamaqmqeildlgirivNLEPG----  125
ident           |         |                                       
Sbjct ---VVQSFPEAYsaakkhgmKVIYGL-------------------------EANIVddpf  181
DSSP  ---LLLLHHHHHhhhhhhllLEEEEE-------------------------EEEEEllle


DSSP  ------------------------hlLLLLllllhhHHHHHHHHHhLLLLEeeellllll
Query ------------------------vwATPMhvddrrLYPLYAFCEdNGIPVimmtggnag  161
ident                                                |  |         
Sbjct hvtllaqnetglknlfklvslshiqyFHRV---priPRSVLVKHR-DGLLV---------  228
DSSP  eeeeeellhhhhhhhhhhhhhhhlllLLLL---lleEHHHHHHLL-LLEEE---------


DSSP  llhhhhlhhhhhhhhhhllllleEEEH---hHLLLhhhHHHHHhhLLLEEEELHhHHLLL
Query pditytnpehidrvlgdfpdltvVSSH---gNWPWvqeIIHVAfrRPNLYLSPDmYLYNL  218
ident                         |                 |  |    |         
Sbjct -----------------------GSGCdkgeLFDN---VEDIA--RFYDFLEVH-PPDVY  259
DSSP  -----------------------ELLLllllLLLL---LLLLH--HHLLLEEEL-LHHHH


DSSP  ---------LLHHHHHHHHlLHHH---HLLLLLLLLL-----------------------
Query ---------PGHADFIQAAnSFLA---DRMLFGTAYP-----------------------  243
ident                                                             
Sbjct kplyvkdeeMIKNIIRSIV-ALGEkldIPVVATGNVHylnpedkiyrkilihsqgganpl  318
DSSP  lllllllhhHHHHHHHHHH-HHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhlll


DSSP  -------LLLHhhHHHHHHL--LLLLHHHHHHHHLHHHHHHHHHL---------------
Query -------MCPLkeYTEWFLT--LPIKPDAMEKILHGNAERLLAQA---------------  279
ident               |   |       |     |   |                       
Sbjct nrhelpdVYFR--TTNEMLDcfSFLGPEKAKEIVVDNTQKIASLIgdvkpikdelytpri  376
DSSP  lllllllLLLL--LHHHHHHhhHHHHHHHHHHHHLHHHHHHHHLLlllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct egadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksldd  436
DSSP  llhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct gylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncpr  496
DSSP  lllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct cgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtig  556
DSSP  llllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct tvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydf  616
DSSP  ellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct tpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptdd  676
DSSP  lleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct pdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglsh  736
DSSP  hhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct gtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpe  796
DSSP  llllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct feaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvra  856
DSSP  hhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct edfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyr  916
DSSP  llllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  279
ident                                                             
Sbjct sqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleyl  976
DSSP  lllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhh


DSSP  ----------------ll
Query ----------------gr  281
ident                   
Sbjct esrgcldslpdhnqlslf  994
DSSP  hhllllllllllllllll


No 56: Query=3irsA Sbjct=1bksA Z-score=5.8

back to top
DSSP  llleelllllllhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllhhhhhhhhhhllll
Query lkiidfrlrppamgflnariytrpdirnrftrqlgfepapsaeekslelmfeemaaagie   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeelleellleellhhhhhhhhhhLLLLEEEEEELL--LLLHHHHHHHHHHHHHLLLL
Query qgvcvgrnssvlgsvsnadvaavakaYPDKFHPVGSIE--AATRKEAMAQMQEILDLGIR  118
ident                                  |                     | |  
Sbjct --------------meryenlfaqlnDRREGAFVPFVTlgDPGIEQSLKIIDTLIDAGAD   46
DSSP  --------------lhhhhhhhhhhhHLLLLEEEEEEEllLLLHHHHHHHHHHHHHLLLL


DSSP  LEEELHHH-------------LLLL--llllLHHHHHHHHHHHH--LLLLEEEELLllll
Query IVNLEPGV-------------WATP--mhvdDRRLYPLYAFCED--NGIPVIMMTGgnag  161
ident    |                                   |        ||          
Sbjct ALELGVPFsdpladgptiqnaNLRAfaagvtPAQCFEMLALIREkhPTIPIGLLMY----  102
DSSP  LEEEELLLlllllllhhhhhhHHHHhhhlllHHHHHHHHHHHHHhlLLLLEEEEEL----


DSSP  llhHHHL---hhhHHHHHHHLllLLEEEEhHHLL---LHHHHHHHHHHLLlEEEELHHhH
Query pdiTYTN---pehIDRVLGDFpdLTVVSShGNWP---WVQEIIHVAFRRPnLYLSPDMyL  215
ident                                              | |            
Sbjct --aNLVFnngidaFYARCEQV--GVDSVL-VADVpveESAPFRQAALRHN-IAPIFIC-P  155
DSSP  --hHHHHlllhhhHHHHHHHH--LLLEEE-ELLLlhhHLHHHHHHHHHLL-LEEEEEE-L


DSSP  LLLllhhhhHHHHllhhHHLL-LLLLLlllllhHHHHHHHHLLlllhhhHHHHH------
Query YNLpghadfIQAAnsflADRM-LFGTAypmcplKEYTEWFLTLpikpdaMEKIL------  268
ident  |                                        |                 
Sbjct PNA--dddlLRQV---aSYGRgYTYLL-----aLPLHHLIEKL----keYHAAPalqgfg  201
DSSP  LLL--lhhhHHHH---hHHLLlLEEEL-----lLLHHHHHHHH----hhHLLLLeeelll


DSSP  -----------------------------------------lhhhhhhhhhlll
Query -----------------------------------------hgnaerllaqagr  281
ident                                                       
Sbjct isspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
DSSP  lllhhhhhhhhhhllleeeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll


No 57: Query=3irsA Sbjct=2yb1A Z-score=5.1

back to top
DSSP  lLLEELLLLlllhhHHHLHHHhlhhhhhhhhhhhlllllhhhhhllhhhhhhhHHHLLLL
Query lKIIDFRLRppamgFLNARIYtrpdirnrftrqlgfepapsaeekslelmfeeMAAAGIE   60
ident    ||                                                 ||    
Sbjct -ANIDLHFH-----SRTSDGA-----------------------ltptevidrAAARAPA   31
DSSP  -LLEELLLL-----LLLLLLL-----------------------llhhhhhhhHHLLLLL


DSSP  EEEEELLEellleeLLHHHHHHHHHHLLLLEEEE------------eelllllhhhHHHH
Query QGVCVGRNssvlgsVSNADVAAVAKAYPDKFHPV------------gsieaatrkeAMAQ  108
ident                  |  || |      |                           | 
Sbjct LLALTDHD----ctGGLAEAAAAAARRGIPFLNGvevsvswgrhtvhivglgidpaEPAL   87
DSSP  EEEELLLL----llLLHHHHHHHHHHLLLLEEEEeeeeeeelleeeeeeeelllllLHHH


DSSP  HHhhhhllllleeelhhHLLL---------------------------------------
Query MQeildlgirivnlepgVWAT---------------------------------------  129
ident                                                             
Sbjct AA-----------glksIREGrlerarqmgasleaagiagcfdgamrwcdnpemisrthf  136
DSSP  HH-----------hhhhHHLLhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhh


DSSP  ------------------------------LLLLLlhhhhhhHHHHhhLLLLeeeellll
Query ------------------------------PMHVDdrrlyplYAFCedNGIPvimmtggn  159
ident                                                             
Sbjct arhlvdsgavkdmrtvfrkyltpgkpgyvsHQWAS--ledavGWIV--GAGG--------  184
DSSP  hhhhhhllllllhhhhhhhlllllllllllLLLLL--hhhhhHHHH--HLLL--------


DSSP  llllhhhhlhhhhhhhhhhllllLEEEEHHHLLL--hHHHHHHHHHLL---LEEEE-lHH
Query agpditytnpehidrvlgdfpdlTVVSSHGNWPW--vQEIIHVAFRRP---NLYLS-pDM  213
ident                          |  |          |                    
Sbjct -----------------------MAVIAHPGRYDmgrTLIERLILDFQaagGQGIEvaSG  221
DSSP  -----------------------EEEELLHHHLLllhHHHHHHHHHHHhllLLEEEeeEL


DSSP  HHLLLlLHHHHHHHHLLHhHHLLLLLLLLL---LLLHhhhhhhhhllllLHHHhhhhhlH
Query YLYNLpGHADFIQAANSFlADRMLFGTAYP---MCPLkeytewfltlpiKPDAmekilhG  270
ident           |   |          |                        |         
Sbjct SHSLD-DMHKFALHADRH-GLYASSGSDFHapgEDVG-------htedlPPIC-----rP  267
DSSP  LLLHH-HHHHHHHHHHHH-LLEEEEELLLLlllLLLL-------lllllLLLL-----lL


DSSP  HHHHhHHHL-------ll
Query NAERlLAQA-------gr  281
ident      |            
Sbjct IWRE-LEARilrpadaen  284
DSSP  HHHH-LHHHlllllhhhl


No 58: Query=3irsA Sbjct=2anuA Z-score=4.7

back to top
DSSP  --LLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLL
Query --LKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAG   58
ident       ||                                        |          |
Sbjct teWLLCDFHVHTNX----------------------------sdghLPLGEVVDLFGKHG   32
DSSP  leEEEEEEEELLLL----------------------------llllLLHHHHHHHHHHLL


DSSP  LLEEEEELLEELL------------LEEL---LHHHHHHHHHHLLL--------LEEEEe
Query IEQGVCVGRNSSV------------LGSV---SNADVAAVAKAYPD--------KFHPVg   95
ident                          ||        |                     |  
Sbjct VDVVSITDHIVDRrtleqrkrngepLGAItedKFQDYLKRLWREQKraweeygxILIPG-   91
DSSP  LLEEEEEEEEELHhhhhhhhhllllLLLLlllLHHHHHHHHHHHHHhhhhhhllEEEEE-


DSSP  elllllhhhhhhhhhhhhhllllleeELHHhlllllllllhhhhhhhhhhhhLLLLEeee
Query sieaatrkeamaqmqeildlgirivnLEPGvwatpmhvddrrlyplyafcedNGIPVimm  155
ident                             |                               
Sbjct ------veitnntdlyhivavdvkeyVDPS-----------lpveeiveklkEQNAL---  131
DSSP  ------eeeeelllleeeeeelllllLLLL-----------llhhhhhhhhhHLLLE---


DSSP  llllllllhhhhlhhhhhhhhhhlllllEEEEH-----hhLLLHHHHHHHHhhLLLEEEE
Query tggnagpditytnpehidrvlgdfpdltVVSSH-----gnWPWVQEIIHVAfrRPNLYLS  210
ident                             |   |       |                   
Sbjct ----------------------------VIAAHpdrkklsWYLWANXERFK--DTFDAWE  161
DSSP  ----------------------------EEELLlllllllLHHHHLLLLLL--LLLLEEE


DSSP  -lHHHHLllllhhhHHHHHLLHHhhLLLLLLLLLL-lLHHHhhhhhhlllllhhhhhhhH
Query -pDMYLYnlpghadFIQAANSFLadRMLFGTAYPM-cPLKEytewfltlpikpdamekiL  268
ident               |          |                                  
Sbjct iaNRDDL-------FNSVGVKKY--RYVANSDFHElwHVYS----------------wkT  196
DSSP  eeELLEE-------LHHHHHLLL--LEEEELLLLLhhHHLL----------------eeE


DSSP  LHH----hhHHHH-----------hlll
Query HGN----aeRLLA-----------qagr  281
ident                             
Sbjct LVKseknieAIKEairkntdvaiylxrk  224
DSSP  EEEelllhhHHHHhhhhllleeeeelll


No 59: Query=3irsA Sbjct=3e38A Z-score=4.0

back to top
DSSP  ----------------LLLEELLLLLllHHHHhlhhhhlhhhhhhhhhhhlllllhhhhh
Query ----------------LKIIDFRLRPpaMGFLnariytrpdirnrftrqlgfepapsaee   44
ident                     ||                                      
Sbjct aqrrneiqvpdldgytTLKCDFHXHS--VFSD--------------------------gl   32
DSSP  llllllllllllllleEEEEELLLLL--LLLL--------------------------ll


DSSP  LLHHHHHHHHHHLLLLEEEEELL-EELLLE---elLHHHHHHHHHHLL----LLEEEEee
Query KSLELMFEEMAAAGIEQGVCVGR-NSSVLG---svSNADVAAVAKAYP----DKFHPVgs   96
ident         |    |                                              
Sbjct VWPTVRVDEAYRDGLDAISLTEHiEYRPHKqdvvsDHNRSFDLCREQAeklgILLIKG--   90
DSSP  LLHHHHHHHHHHLLLLEELLEEElLLLLLLlllllLLLHHHHHHHHHHhhhlLEELLE--


DSSP  lllllhhhhhhhhhhhhhllLLLEeelhhhlllllllllhHHHHHHHHHHhLLLLeeeel
Query ieaatrkeamaqmqeildlgIRIVnlepgvwatpmhvddrRLYPLYAFCEdNGIPvimmt  156
ident                                                             
Sbjct ----seitraxapghfnaifLSDS----------npleqkDYKDAFREAK-KQGA-----  130
DSSP  ----eeeelllllleeeeelLLLL----------hhhlllLHHHHHHHHH-HLLL-----


DSSP  lllllllhhhhlhhhhhhhhhhllllLEEEEHHHLL-----LHHH---hhhhhhhllLEE
Query ggnagpditytnpehidrvlgdfpdlTVVSSHGNWP-----WVQE---iihvafrrpNLY  208
ident                                |  |                         
Sbjct --------------------------FXFWNHPGWDsqqpdTTKWwpehtalyqegcXHG  164
DSSP  --------------------------EEEELLLLLLlllllLLLLlhhhhhhhhlllLLE


DSSP  EE-LHHHHLllllHHHHHHHHLLHHHhLLLLLLLLLLLL--------hHHHHhhhhllll
Query LS-PDMYLYnlpgHADFIQAANSFLAdRMLFGTAYPMCP--------lKEYTewfltlpi  259
ident        ||        ||                                |        
Sbjct IEvANGHLY----XPEAIQWCLDKNL-TXIGTSDIHQPIqtdydfekgEHRT--------  211
DSSP  EEeEELLEE----LLHHHHHHHHHLL-EEEEELLLLLLHhhhllhhhlLLLL--------


DSSP  lhhhhhhHHLH------hhHHHH-------------------------------------
Query kpdamekILHG------naERLL-------------------------------------  276
ident                     |                                       
Sbjct ------xTFVFakerslqgIREAldnrrtaayfhelligredllrpffekcvkieevsrn  265
DSSP  ------eEEEEellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct eqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfev  325
DSSP  lleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeee


DSSP  ------------hhlll
Query ------------aqagr  281
ident                  
Sbjct tnfivapdkglkytisl  342
DSSP  eeeeeelleeeeeeeel