Results: dupa

Query: 3icjA

MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3icj-A 66.0  0.0  468   468  100 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
   2:  3mtw-A 30.1  3.1  315   404   20 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   3:  3ls9-A 29.6  2.7  326   453   16 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   4:  2paj-A 28.8  2.8  310   421   16 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   5:  3mkv-A 28.7  3.0  309   414   19 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   6:  4c5y-A 28.4  3.2  323   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
   7:  2uz9-A 28.4  3.1  320   444   16 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   8:  1j6p-A 28.1  2.8  315   407   16 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   9:  2oof-A 28.1  2.9  325   403   18 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  10:  4cqb-A 27.6  2.6  311   402   17 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  11:  1k6w-A 26.7  3.5  319   423   16 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  12:  4rdv-B 24.9  3.3  317   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  13:  3ooq-A 24.5  3.0  277   384   20 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  14:  2vun-A 23.7  3.0  284   385   16 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  3giq-A 23.6  3.5  294   475   17 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  16:  1onx-A 23.0  3.2  289   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  17:  1yrr-B 22.8  3.3  283   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  1gkp-A 22.7  3.2  296   458   17 PDB  MOLECULE: HYDANTOINASE;                                              
  19:  3e74-A 22.6  3.3  282   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  20:  3gri-A 22.1  3.3  288   422   19 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  4b3z-D 21.9  3.6  300   477   15 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  22:  3nqb-A 21.7  3.3  280   587   16 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  23:  2imr-A 21.0  5.6  279   380   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  24:  2ogj-A 20.3  3.8  274   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  1a4m-A 17.7  3.4  264   349   15 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  26:  1a5k-C 17.2  3.4  279   566   16 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  27:  2y1h-B 16.6  2.9  215   265   17 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  28:  2ffi-A 15.3  3.6  219   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  29:  3cjp-A 15.2  2.9  201   262   16 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  30:  3gg7-A 15.1  3.1  204   243   15 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  31:  4dlf-A 14.7  4.2  221   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  32:  3pnu-A 14.6  3.9  239   338   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  33:  2ob3-A 14.5  3.7  222   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  34:  1bf6-A 14.3  3.7  219   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  35:  3irs-A 14.2  3.5  210   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  36:  3k2g-B 14.2  4.1  227   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  37:  2vc5-A 13.7  4.0  222   314   14 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  38:  4mup-B 13.6  3.4  220   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  39:  4hk5-D 13.4  3.7  230   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  40:  2a3l-A 13.3  3.7  275   616    8 PDB  MOLECULE: AMP DEAMINASE;                                             
  41:  1v77-A 13.1  3.4  178   202    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  42:  2dvt-A 12.7  3.3  205   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  43:  4ofc-A 12.6  4.1  217   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  44:  3qy6-A 12.5  3.6  188   247   10 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  45:  4qrn-A 12.2  3.5  211   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  46:  1itq-A 12.2  3.9  223   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  47:  2gwg-A 12.0  4.2  225   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  48:  4dzi-C 11.1  4.4  209   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  2qpx-A 11.0  4.4  220   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  50:  1j5s-A  9.7  3.8  216   451   14 PDB  MOLECULE: URONATE ISOMERASE;                                         
  51:  3iac-A  9.6  3.6  206   469   13 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3f2b-A  9.1  8.3  181   994    8 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  53:  3dcp-A  9.0  3.3  165   277   11 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  3au2-A  8.6  8.3  178   575   15 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  1m65-A  7.5  3.8  163   234   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  2yb1-A  5.1  4.0  149   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  57:  2anu-A  4.4  3.8  135   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  4.2  3.9  144   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  1bks-A  4.1  4.2  145   255    4 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3icjA Sbjct=3icjA Z-score=66.0

back to top
DSSP  LEEEEELLEEEEEELLEEEELEEEEELLEEEEEELHHHHHHHHHHHLLEEEELLLLEEEE
Query CMKALINGTIYTSFSPVKKVSGLVISNERVLYAGDSSTALRIAELAGGEIIDLKGKFVMP   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CMKALINGTIYTSFSPVKKVSGLVISNERVLYAGDSSTALRIAELAGGEIIDLKGKFVMP   60
DSSP  LEEEEELLEEEEEELLEEEELEEEEELLEEEEEELHHHHHHHHHHHLLEEEELLLLEEEE


DSSP  LEEEEEELHHHHHHHHHLEELLLLLLHHHHHHHHHLLLLLLEEEEEELHHHHLLLLLHHH
Query AFFDSHLHLDELGMSLEMVDLRGVKSMEELVERVKKGRGRIIFGFGWDQDELGRWPTRED  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AFFDSHLHLDELGMSLEMVDLRGVKSMEELVERVKKGRGRIIFGFGWDQDELGRWPTRED  120
DSSP  LEEEEEELHHHHHHHHHLEELLLLLLHHHHHHHHHLLLLLLEEEEEELHHHHLLLLLHHH


DSSP  HLLLLLLEEEEELLLLEEEELHHHHHHHLLLLLLLEELLLLEEEHHHHHHHHHHHHHLLL
Query LDVIDRPVFLYRRCFHVAVMNSKMIDLLNLKPSKDFDESTGIVRERALEESRKIINEKIL  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LDVIDRPVFLYRRCFHVAVMNSKMIDLLNLKPSKDFDESTGIVRERALEESRKIINEKIL  180
DSSP  HLLLLLLEEEEELLLLEEEELHHHHHHHLLLLLLLEELLLLEEEHHHHHHHHHHHHHLLL


DSSP  LHHHHHHHHHHHHHHHHHLLEEEEEEEEELHHHHHHHHHHHHLLLLLLEEEEEELHHHHH
Query TVKDYKHYIESAQEHLLSLGVHSVGFMSVGEKALKALFELEREGRLKMNVFAYLSPELLD  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TVKDYKHYIESAQEHLLSLGVHSVGFMSVGEKALKALFELEREGRLKMNVFAYLSPELLD  240
DSSP  LHHHHHHHHHHHHHHHHHLLEEEEEEEEELHHHHHHHHHHHHLLLLLLEEEEEELHHHHH


DSSP  HHHHHLLLLEELLLEEEEEEEEELLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHH
Query KLEELNLGKFEGRRLRIWGVXLFVDGSLGARTALLSEPYTDNPTTSGELVMNKDEIVEVI  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KLEELNLGKFEGRRLRIWGVXLFVDGSLGARTALLSEPYTDNPTTSGELVMNKDEIVEVI  300
DSSP  HHHHHLLLLEELLLEEEEEEEEELLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHH


DSSP  HHHLLLLLEEEEEELLHHHHHHHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEEEL
Query ERAKPLGLDVAVHAIGDKAVDVALDAFEEAEFSGRIEHASLVRDDQLERIKELKVRISAQ  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ERAKPLGLDVAVHAIGDKAVDVALDAFEEAEFSGRIEHASLVRDDQLERIKELKVRISAQ  360
DSSP  HHHLLLLLEEEEEELLHHHHHHHHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEEEL


DSSP  LLHHHHLLLHHHHHHHHHHHHLLLHHHHHHHLLEEELLLLLLLLLLHHHHHHHHHHLLLL
Query PHFIVSDWWIVNRVGEERAKWAYRLKTLSSITKLGFSTDSPIEPADPWVSIDAAVNRYVV  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PHFIVSDWWIVNRVGEERAKWAYRLKTLSSITKLGFSTDSPIEPADPWVSIDAAVNRYVV  420
DSSP  LLHHHHLLLHHHHHHHHHHHHLLLHHHHHHHLLEEELLLLLLLLLLHHHHHHHHHHLLLL


DSSP  LHHHLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELLLLLL
Query DPGERVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDRDPLK  468
ident ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DPGERVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDRDPLK  468
DSSP  LHHHLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELLLLLL


No 2: Query=3icjA Sbjct=3mtwA Z-score=30.1

back to top
DSSP  -LEEEEELLEEEeEELLEEEE--LEEEEELLEEEEEELHHhhHHHHhhHLLEEEELLLLE
Query -CMKALINGTIYtSFSPVKKV--SGLVISNERVLYAGDSStaLRIAelAGGEIIDLKGKF   57
ident    ||             | |          |    |           ||    || |  
Sbjct aEIKAVSAARLL-DVASGKYVdnPLVIVTDGRITSIGKKG--DAVP--AGATAVDLPGVT   55
DSSP  lLEEEEEEEEEE-ELLLLEEEelEEEEEELLEEEEEEELL--LLLL--LLLEEEEEEEEE


DSSP  EEELEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllll
Query VMPAFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
ident   |   | | |||                                               
Sbjct LLPGLIDMHVHLDS--LAEV----------------------------------------   73
DSSP  EEELEEEEEELLLL--LLLL----------------------------------------


DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHhh
Query redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIIne  177
ident                                                             
Sbjct -----------------------------------------------------gGYNS--   78
DSSP  -----------------------------------------------------lHHHH--


DSSP  LLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELHHH-HHHHHHHHHLLLLLLEEEEEEL-
Query KILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGEKA-LKALFELEREGRLKMNVFAYLS-  235
ident                    |  |   |                                 
Sbjct LEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAADYDdVGLREAIDAGYVPGPRIVTAAIs  138
DSSP  HHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLLLLHhHHHHHHHHLLLLLLLEEEELLLl


DSSP  -----------------------------------hHHHHHhhhhlllleellleeEEEE
Query -----------------------------------pELLDKleelnlgkfegrrlrIWGV  260
ident                                      |                      
Sbjct fgatgghcdstffppsmdqknpfnsdspdearkavrTLKKY--------------gAQVI  184
DSSP  eellllllllllllhhhllllllllllhhhhhhhhhHHHHL--------------lLLEE


DSSP  EEELLLLLLL--LLLLlllllllllllllLLLLLHHHHHHHHHHHLLLLLEEEEEELLHH
Query XLFVDGSLGA--RTALlsepytdnpttsgELVMNKDEIVEVIERAKPLGLDVAVHAIGDK  318
ident |    |                              |   |   |   |  || || |  
Sbjct XICATGGVFSrgNEPG-------------QQQLTYEEMKAVVDEAHMAGIKVAAHAHGAS  231
DSSP  EEELLLLLLLllLLLL-------------LLLLLHHHHHHHHHHHHHLLLEEEEEELLHH


DSSP  HHHHHHHHHhhhllLLEEEELLLLLHHHHHHHHHHLLEEEELLLHHHH------------
Query AVDVALDAFeeaefSGRIEHASLVRDDQLERIKELKVRISAQPHFIVS------------  366
ident     |  |         ||||||| |             |                    
Sbjct GIREAVRAG-----VDTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYtqaegkkngvle  286
DSSP  HHHHHHHLL-----LLEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHhhhhhhhhlllh


DSSP  -----LLLHhhhhhhhhhHHLL-LHHHHHH-HLLEEELLLLLLLL-LLHHHHHHHHHHll
Query -----DWWIvnrvgeeraKWAY-RLKTLSS-ITKLGFSTDSPIEP-ADPWVSIDAAVNry  418
ident      |  |                        |    ||  | |  |        |   
Sbjct dnlrkDRDI--------gELQReNFRKALKaGVKMVYGTDAGIYPhGDNAKQFAVMVR--  336
DSSP  hhhhhHHHH--------hHHHHhHHHHHHHhLLEEELLLLLLLLLlLLHHHHHHHHHH--


DSSP  lllhhHLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELLLLLL---------
Query vvdpgERVSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDRDPLK---------  468
ident             |    |   |       | |    |     |    |||          
Sbjct -----YGATPLQAIQSATLTAAEALGRSkDVGQVAVGRYGDMIAVAGDPLAdvttlekpv  391
DSSP  -----LLLLHHHHHHHLLHHHHHHHLLLlLLLLLLLLLLLLEEEELLLLLLlhhhhhlll


DSSP  -------------
Query -------------  468
ident              
Sbjct fvmkggavvkapx  404
DSSP  eeeelleeeelll


No 3: Query=3icjA Sbjct=3ls9A Z-score=29.6

back to top
DSSP  lEEEEELL-EEEEEELLEEEE--LEEEEELLEEEEEELhhHHHHhhhHHLLEEEELLLLE
Query cMKALING-TIYTSFSPVKKV--SGLVISNERVLYAGDssTALRiaeLAGGEIIDLKGKF   57
ident  |          |              |        |                ||  |  
Sbjct -MILIRGLtRVITFDDQERELedADILIDGPKIVAVGK--DLSD---RSVSRTIDGRGMI   54
DSSP  -LEEEEEEeEEELLLLLLLEEeeEEEEEELLEEEEEEL--LLLL---LLLLEEEELLLEE


DSSP  EEELEEEEEELHHHhHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll
Query VMPAFFDSHLHLDElGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
ident   |    || || | |                                            
Sbjct ALPGLINSHQHLYE-GAMR-----------------------------------------   72
DSSP  EEELEEEEEELHHH-HHHL-----------------------------------------


DSSP  hhhhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHH-
Query redldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIIN-  176
ident                                                             
Sbjct -------------aiPQLE---------------------rvtmaswlegvLTRSAGWWr   98
DSSP  -------------llHHHL---------------------lllhhhhhhhhHHHHHHHHh


DSSP  hLLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH------HHHHHHHHHHhlLLLLLEE
Query eKILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE------KALKALFELEreGRLKMNV  230
ident                     |  |   |                 |  |      |    
Sbjct dGKFGPDVIREVARAVLLESLLGGITTVADQHLFFpgatadSYIDATIEAA--TDLGIRF  156
DSSP  lLLLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLLllllllLHHHHHHHHH--HHHLLEE


DSSP  EEEELH--------------------HHHHHHhhHLLL--LEEL---LLEEeEEEE-EEL
Query FAYLSP--------------------ELLDKLeeLNLG--KFEG---RRLRiWGVX-LFV  264
ident  |  |                             | |     |       |        |
Sbjct HAARSSmtlgkseggfcddlfvepvdRVVQHC--LGLIdqYHEPepfGMVR-IALGpCGV  213
DSSP  EEEELLllllhhhlllllhhhlllhhHHHHHH--HHHHhhHLLLlllLLEE-EEELlLLL


DSSP  LllllllllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEELL--------
Query DgslgartallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAIG--------  316
ident                                       |         |           
Sbjct P------------------------YDKPELFEAFAQMAADYDVRLHTHFYEpldagmsd  249
DSSP  L------------------------LLLHHHHHHHHHHHHHHLLEEEEEELLllhhhhhh


DSSP  ----hHHHHHHHHHhhhHLLL--LEEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLLlh
Query ----dKAVDVALDAfeeAEFS--GRIEHASLVRDDQLERIKELKVRISAQPHFIVSDWwi  370
ident                     |      ||               | |             
Sbjct hlygmTPWRFLEKH---GWASdrVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMG--  304
DSSP  hhhllLHHHHHHHL---LLLLllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL--


DSSP  hhhhhhhhhhhLLLHHHHHH-HLLEEELLLLL--LLLLLHHHHHHHHHHLLLLLH----H
Query vnrvgeerakwAYRLKTLSS-ITKLGFSTDSP--IEPADPWVSIDAAVNRYVVDP----G  423
ident                          || |                 |             
Sbjct ---------wgLAPIREYLDaGITVGFGTTGSasNDGGNLLGDLRLAALAHRPADpnepE  355
DSSP  ---------llLLLHHHHHHlLLEEEELLLLLllLLLLLHHHHHHHHHHHLHHHLlllhH


DSSP  HLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELL----------LLLL-----
Query ERVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDR----------DPLK-----  468
ident    |  | |   | |||      ||| || |  |                          
Sbjct KWLSARELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLdgvdrvgvhdPAIGlimtg  415
DSSP  HLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELllhhhlllllHHHHhhhll


DSSP  --------------------------------------
Query --------------------------------------  468
ident                                       
Sbjct lsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllllleeeelleeeeelleellllhhhhhhhhhhhll


No 4: Query=3icjA Sbjct=2pajA Z-score=28.8

back to top
DSSP  LEEEEELL-EEEEEEL-----LEEE-ELEEEEELLEEEEEElhhHHHHhhhHHLLEEEEL
Query CMKALING-TIYTSFS-----PVKK-VSGLVISNERVLYAGdssTALRiaeLAGGEIIDL   53
ident       |   | |        |         |        |            |  | | 
Sbjct PSTLIRNAaAIMTGGRgtaddPSRVpGPDIRIVGDTIDAIG---ALAP---RPGETIVDA   54
DSSP  LEEEEELLlEELLLLLlllllLLLLlLLLEEEELLEEEEEL---LLLL---LLLLEEEEL


DSSP  LLLEEEELEEEEEELHHHhHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhl
Query KGKFVMPAFFDSHLHLDElGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelg  113
ident       ||    | ||                                            
Sbjct TDCVIYPAWVNTHHHLFQ-SLLK-------------------------------------   76
DSSP  LLLEEEELEELLLLLHHH-HHLL-------------------------------------


DSSP  llllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhh
Query rwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrk  173
ident                                                             
Sbjct ----------------------------------------------------------ge   78
DSSP  ----------------------------------------------------------ll


DSSP  hHHHLlLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH------HHHHHHHHHHhlLLLL
Query iINEKiLTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE------KALKALFELEreGRLK  227
ident                       |   |   |                  |||      | 
Sbjct pFRAL-FDERRFRLAARIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEA--EKLG  135
DSSP  lLHHH-LLHHHHHHHHHHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHH--HHLL


DSSP  LEEEEEELH---------------------HHHHHHhhHLLL--LEEL---LLEEeEEEE
Query MNVFAYLSP---------------------ELLDKLeeLNLG--KFEG---RRLRiWGVX  261
ident                                         |             |     
Sbjct LRFVLLRGGatqtrqleadlptalrpetldAYVADI--ERLAarYHDAsprAMRR-VVMA  192
DSSP  LEEEEEELLllllllllllllhhhllllhhHHHHHH--HHHHhhLLLLlllLLEE-EEEL


DSSP  E-ELLLlllllllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEELlhHHH
Query L-FVDGslgartallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAIgdKAV  320
ident    |                              |  |    |  |||    |      |
Sbjct PtTVLY-----------------------SISPREMRETAAVARRLGLRMHSHLSgkSPV  229
DSSP  LlLLLL-----------------------LLLHHHHHHHHHHHHHLLLEEEEELLllLHH


DSSP  HHHHHHhhhHLLL--LEEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLllhhhhhhhhh
Query DVALDAfeeAEFS--GRIEHASLVRDDQLERIKELKVRISAQPHFIVSDwwivnrvgeer  378
ident                    |   |  |               |                 
Sbjct AFCGEH---DWLGsdVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRL-----------  275
DSSP  HHHHHL---LLLLllEEEELLLLLLHHHHHHHHHHLLEEEELHHHHHLL-----------


DSSP  hhhllLHHHHHH-HLLEEELLLLL--LLLLLHHHHHHHHHHLLlLLHHhlLLHHHHHHHL
Query akwayRLKTLSS-ITKLGFSTDSP--IEPADPWVSIDAAVNRYvVDPGerVSREEALHLY  435
ident                      |     | ||                    |  |  |  
Sbjct -----PVREMADaGVPVSIGVDGAasNEAADMISEVHMTWLAQ-RARL--ASIAEVIHWG  327
DSSP  -----LLLLHHHhLLLEEELLLHHhhLLLLLHHHHHHHHHHHH-HHLL--LLHHHHHHHH


DSSP  LHHHHHHLLLLLLLLLLLLLLLLEEEELL----------LLLL-----------------
Query THGSAQVTLAEDLGKLERGFRAEYIILDR----------DPLK-----------------  468
ident | | | |      ||   |  |                                      
Sbjct TAGGARVMGLDEVGKVAVGYAADIAVYRLddpryfglhdPAIGpvasggrpsvmalfsag  387
DSSP  LHHHHHHHLLLLLLLLLLLLLLLEEEEELllhhhlllllHHHHhhhllllleeeeeeell


DSSP  ----------------------------------
Query ----------------------------------  468
ident                                   
Sbjct krvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 5: Query=3icjA Sbjct=3mkvA Z-score=28.7

back to top
DSSP  -LEEEEELLEEEeEELLEEEE--LEEEEELLEEEEEELHHHhhhHHHHhlLEEEELLLLE
Query -CMKALINGTIYtSFSPVKKV--SGLVISNERVLYAGDSSTalrIAELagGEIIDLKGKF   57
ident        ||                  |         |               || ||| 
Sbjct lTTFLFRNGALL-DPDHPDLLqgFEILIEDGFIREVSDKPI---KSSN--AHVIDVKGKT   54
DSSP  lLEEEEEEEEEL-LLLLLLLEeeEEEEEELLEEEEEELLLL---LLLL--LEEEELLLLE


DSSP  EEELEEEEEELHHHHhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll
Query VMPAFFDSHLHLDELgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
ident  ||   | | |                                                 
Sbjct IMPGLIDLHVHVVAI---------------------------------------------   69
DSSP  EEELEEEEEELLLLL---------------------------------------------


DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHHh
Query redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIINe  177
ident                                                             
Sbjct ---------------------------------------------------efnLPRVA-   77
DSSP  ---------------------------------------------------lllHHHHL-


DSSP  lLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELhhHHHHHHHHHHLLLLLLEEEEEEL--
Query kILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGekALKALFELEREGRLKMNVFAYLS--  235
ident   |                |  |   |                |         |      
Sbjct -TLPNVLVTLRAVPIMRAMLRRGFTTVRDAGGA--GYPFKQAVESGLVEGPRLFVSGRal  134
DSSP  -LLLHHHHHHHHHHHHHHHHHLLEEEEEELLLL--LHHHHHHHHLLLLLLLEEEELLLee


DSSP  ---------------------------------------------hHHHHHhhhhlllle
Query ---------------------------------------------pELLDKleelnlgkf  250
ident                                               | |           
Sbjct sqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravrEELQM---------  185
DSSP  elllllllllllllllllllllllllllllleeelllhhhhhhhhhHHHHH---------


DSSP  ellleeEEEEEEELLLLLLL--LLLLlllllllllllllLLLLLHHHHHHHHHHHLLLLL
Query egrrlrIWGVXLFVDGSLGA--RTALlsepytdnpttsgELVMNKDEIVEVIERAKPLGL  308
ident           |    |                             |||      |   | 
Sbjct -----gADQIXIMASGGVASptDPVG-------------VFGYSEDEIRAIVAEAQGRGT  227
DSSP  -----lLLLEEEELLLLLLLllLLLL-------------LLLLLHHHHHHHHHHHHLLLL


DSSP  EEEEEELLHHHHHHHHHHHhhhllLLEEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLL
Query DVAVHAIGDKAVDVALDAFeeaefSGRIEHASLVRDDQLERIKELKVRISAQPHFIVSDW  368
ident  |  ||    |   |            |||  |  |       |                
Sbjct YVLAHAYTPAAIARAVRCG-----VRTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALA  282
DSSP  LEEEEELLHHHHHHHHHLL-----LLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHH


DSSP  --------------LHHHhhhhhhHHHLL-LHHHHHH-HLLEEELLLLL---LLLLLhhH
Query --------------WIVNrvgeerAKWAY-RLKTLSS-ITKLGFSTDSP---IEPADpwV  409
ident                |                        | || ||             
Sbjct segekyglppesiaKIAD-----vHGAGLhSIEIMKRaGVKMGFGTDLLgeaQRLQS--D  335
DSSP  hhlllllllhhhhlLHHH-----hHLLHHhHHHHHHHhLLLLLLLLLLLhhhHHHLL--H


DSSP  HHHHHHHlllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELLLLLL
Query SIDAAVNryvvdpgeRVSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDRDPLK  468
ident                  |  |     |  || |      ||    |  |     |  |||
Sbjct EFRILAE--------VLSPAEVIASATIVSAEVLGMQdKLGRIVPGAHADVLVVDGNPLK  387
DSSP  HHHHHHL--------LLLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELLLLLL


DSSP  ---------------------------
Query ---------------------------  468
ident                            
Sbjct svdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllleeeelleeeeelll


No 6: Query=3icjA Sbjct=4c5yA Z-score=28.4

back to top
DSSP  ---LEEEEELLEEEEEElLEEEE-LEEEEELLEEEEEELHHHHHHHHHHHLLEEEELllL
Query ---CMKALINGTIYTSFsPVKKV-SGLVISNERVLYAGDSSTALRIAELAGGEIIDLkgK   56
ident           |               ||||       |                      
Sbjct deaKVTIIYAGLLIPGD-GEPLRnAALVISDKIIAFVGSEADIPKKYLRSTQSTHRV--P   57
DSSP  lllLEEEEEEEEELLLL-LLLEEeEEEEEELLEEEEEEEHHHLLHHHHHHLLLEEEE--E


DSSP  EEEELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleEEEEelhhhhllll
Query FVMPAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriiFGFGwdqdelgrwp  116
ident   ||   | | |                                                
Sbjct VLMPGLWDCHMHFGG-----------------------------ddDYYN----------   78
DSSP  EEEELEEEEEELLLL-----------------------------llLLLL----------


DSSP  lhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHH
Query tredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIIN  176
ident                                                             
Sbjct -------------------------------------------------------DYTSG   83
DSSP  -------------------------------------------------------LLHHH


DSSP  HlLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEElhhhHHHHHHHHHLLLLLLEEEEEEL-
Query EkILTVKDYKHYIESAQEHLLSLGVHSVGFMSVgekaLKALFELEREGRLKMNVFAYLS-  235
ident                     |  |  |                         ||      
Sbjct L-ATHPASSGARLARGCWEALQNGYTSYRDLAG--ygCEVAKAINDGTIVGPNVYSSGAa  140
DSSP  H-HLLHHHHHHHHHHHHHHHHHLLEEEEEELLL--lhHHHHHHHHLLLLLLLEEEELLLe


DSSP  -----------------------------------------------hHHHHhhhhhlLL
Query -----------------------------------------------pELLDkleelnLG  248
ident                                                             
Sbjct lsqtaghgdifalpagevlgsygvmnprpgywgagplciadgveevrrAVRL-----qIR  195
DSSP  eellllllllllllhhhhhhhhlllllllllllllleeelllhhhhhhHHHH-----hHH


DSSP  LEellleeEEEEEEELLLLLLL--LLLLlllllllllllllLLLLLHHHHHHHHHHHLLL
Query KFegrrlrIWGVXLFVDGSLGA--RTALlsepytdnpttsgELVMNKDEIVEVIERAKPL  306
ident             |    |                              |     | |   
Sbjct RG------AKVIXVMASGGVMSrdDNPN-------------FAQFSPEELKVIVEEAARQ  236
DSSP  HL------LLLEEEELLLLLLLllLLLL-------------LLLLLHHHHHHHHHHHHHL


DSSP  LLEEEEEELLHHHHHHHHHHHhhhllLLEEEELLLLLHHHHHHHHHHLLEEEELLLHHHH
Query GLDVAVHAIGDKAVDVALDAFeeaefSGRIEHASLVRDDQLERIKELKVRISAQPHFIVS  366
ident    |  |  |      |  |          || |       |  ||      |    |  
Sbjct NRIVSAHVHGKAGIMAAIKAG-----CKSLEHVSYADEEVWELMKEKGILYVATRSVIEI  291
DSSP  LLLEEEEELLHHHHHHHHHHL-----LLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHH


DSSP  LL--------lhhHHHHHHHHHHLL-LHHHHHH-HLLEEELLLLLLLLLLHhHHHHHHHH
Query DW--------wivNRVGEERAKWAY-RLKTLSS-ITKLGFSTDSPIEPADPwVSIDAAVN  416
ident                     |                    ||              || 
Sbjct FLasngeglvkesWAKLQALADSHLkAYQGAIKaGVTIALGTDTAPGGPTA-LELQFAVE  350
DSSP  HHhhllllllllhHHLLLHHHHHHHhHHHHHHHlLLLEELLLLLLLLLLLH-HHHHHHHH


DSSP  LllllhhHLLLHHHHHHHLLHHHHHHLL--LLLLLLLLLLLLLLEEEELLLLLL------
Query RyvvdpgERVSREEALHLYTHGSAQVTL--AEDLGKLERGFRAEYIILDRDPLK------  468
ident |            ||    |          |   | |  |  |  | |   ||       
Sbjct R------GGMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEENPLEdikvfq  404
DSSP  L------LLLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELLLLLLlhhhhh


DSSP  --------------------------------
Query --------------------------------  468
ident                                 
Sbjct epkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lhhheeeeeelleeeellllllllllllllll


No 7: Query=3icjA Sbjct=2uz9A Z-score=28.4

back to top
DSSP  -LEEEEElLEEEEEELL--EEEE--LEEEEE-LLEEEEEELHHHhhHHHHHHLL---EEE
Query -CMKALInGTIYTSFSP--VKKV--SGLVIS-NERVLYAGDSSTalRIAELAGG---EII   51
ident         ||   |             |  |           |     |        || 
Sbjct pLAHIFR-GTFVHSTWTcpMEVLrdHLLGVSdSGKIVFLEEASQqeKLAKEWCFkpcEIR   59
DSSP  lLLEEEE-EEEEELLLLllLEEEeeEEEEELlLLLEEEEEEHHHhhHHHHHHLLlhhHEE


DSSP  ELLL-LEEEELEEEEEELHHHHhHHHHLeellllllhhhhhhhhhlllllleeeeeelhh
Query DLKG-KFVMPAFFDSHLHLDELgMSLEMvdlrgvksmeelvervkkgrgriifgfgwdqd  110
ident  |    | ||   | | |                                          
Sbjct ELSHhEFFMPGLVDTHIHASQY-SFAGS--------------------------------   86
DSSP  ELLLlLEEEELEEEEEEEHHHH-HHLLL--------------------------------


DSSP  hhlllllhhhhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhhh
Query elgrwptredldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralee  170
ident                                                             
Sbjct --------------sidlplleWLTK-------------------------------ytf  101
DSSP  --------------lllllhhhHHHH-------------------------------lhh


DSSP  hhhHHHHlllLHHHHHHHHHHHHHHHHHLLEEEEEEEEE-LHHHHHHHHHHHhllLLLLE
Query srkIINEkilTVKDYKHYIESAQEHLLSLGVHSVGFMSV-GEKALKALFELEregRLKMN  229
ident                           |  |                 |            
Sbjct paeHRFQ---NIDFAEEVYTRVVRRTLKNGTTTACYFATiHTDSSLLLADIT--dKFGQR  156
DSSP  hhhHHHH---LHHHHHHHHHHHHHHHHHLLEEEEEEELLlLHHHHHHHHHHH--hHHLLE


DSSP  EEEEELH------------------HHHHHHhhhlLLLE--ELLLEEeEEEE-EELLlll
Query VFAYLSP------------------ELLDKLeelnLGKF--EGRRLRiWGVX-LFVDgsl  268
ident  |                                          |     |   |     
Sbjct AFVGKVCmdlndtfpeyketteesiKETERF---vSEMLqkNYSRVK-PIVTpRFSL---  209
DSSP  EEEELEElllllllllllllhhhhhHHHHHH---hHHHHhhLLLLEE-EEEEeLLHH---


DSSP  lllllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEEL-------------
Query gartallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAI-------------  315
ident                              |    ||   |    |               
Sbjct ---------------------SCSETLMGELGNIAKTRDLHIQSHISenrdeveavknly  248
DSSP  ---------------------HLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhl


DSSP  --lhHHHHHHHHHHhhhlLLLE-EEELLLLLHHHHHHHHHHLLEEEELLLHHHHLLLHhh
Query --gdKAVDVALDAFeeaeFSGR-IEHASLVRDDQLERIKELKVRISAQPHFIVSDWWIvn  372
ident         |                |        |    |    |   |    |      
Sbjct psykNYTSVYDKNN--llTNKTvMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSG--  304
DSSP  llllLHHHHHHHLL--llLLLEeEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLL--


DSSP  hhhhhhhhhLLLHHHHHH-HLLEEELLLLLLL-LLLHHHHHHHHHHLLLLLHH-----hL
Query rvgeerakwAYRLKTLSS-ITKLGFSTDSPIE-PADPWVSIDAAVNRYVVDPG-----eR  425
ident                      | |  ||            |  ||               
Sbjct ---------FLNVLEVLKhEVKIGLGTDVAGGySYSMLDAIRRAVMVSNILLInkvnekS  355
DSSP  ---------LLLHHHHHHlLLEEEELLLLLLLlLLLHHHHHHHHHHHHHHHHHllllllL


DSSP  LLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELL--------------------
Query VSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDR--------------------  464
ident     |   | | |  |        |  | |     |                        
Sbjct LTLKEVFRLATLGGSQALGLDgEIGNFEVGKEFDAILINPkasdspidlfygdffgdise  415
DSSP  LLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELLlllllllllllhhhhlllll


DSSP  -LLLL------------------------
Query -DPLK------------------------  468
ident     |                        
Sbjct aVIQKflylgddrnieevyvggkqvvpfs  444
DSSP  hHHHHhhhhllhhheeeeeelleeeelll


No 8: Query=3icjA Sbjct=1j6pA Z-score=28.1

back to top
DSSP  LEEEEELLEEEEEElLEEEE-LEEEEELLEEEEEELHHHHHhhhhhhlleEEELLLLEEE
Query CMKALINGTIYTSFsPVKKV-SGLVISNERVLYAGDSSTALriaelaggeIIDLKGKFVM   59
ident       |  |   |           | |                        || || | 
Sbjct HHXIIGNCLILKDF-SSEPFwGAVEIENGTIKRVLQGEVKV---------DLDLSGKLVX   50
DSSP  LEEEEEEEEELLLL-LLLLEeEEEEEELLEEEEEEELLLLL---------LEELLLEEEE


DSSP  ELEEEEEELHHHhHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLDElGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident || |  | |                                                   
Sbjct PALFNTHTHAPX-TLLR-------------------------------------------   66
DSSP  ELEEEEEELHHH-HHHL-------------------------------------------


DSSP  hhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHHHlL
Query dldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIINEkI  179
ident                                                        |    
Sbjct ----------gvaEDLS---------------------------feewlFSKVLPIED-R   88
DSSP  ----------lllLLLL---------------------------hhhhhHLLHHHHHL-L


DSSP  LLHHHHHHHHHHHHHHHHHLLEEEEEEeEELHhhHHHHHHHHhlLLLLLEEEEEELH---
Query LTVKDYKHYIESAQEHLLSLGVHSVGFmSVGEkaLKALFELEreGRLKMNVFAYLSP---  236
ident || |        ||      |                                       
Sbjct LTEKXAYYGTILAQXEXARHGIAGFVD-XYFH--EEWIAKAV--RDFGXRALLTRGLvds  143
DSSP  LLHHHHHHHHHHHHHHHHLLLEEEEEE-EELL--HHHHHHHH--HHHLLEEEEEEEElll


DSSP  -----HHHHHHHhhlLLLEEL-LLEEeEEEE-EELLllllllllllllllllllllllll
Query -----ELLDKLEelnLGKFEG-RRLRiWGVX-LFVDgslgartallsepytdnpttsgel  289
ident        |               |    |                               
Sbjct ngddgGRLEENLklyNEWNGFeGRIF-VGFGpHSPY------------------------  178
DSSP  lllllLHHHHHHhhhHHHLLHhHLEE-EEEEeLLLL------------------------


DSSP  LLLHHHHHHHHHHHLLLLLEEEEEEL-LHHHhhhhHHHHHHHLLL---LEEEELLLLLHH
Query VMNKDEIVEVIERAKPLGLDVAVHAI-GDKAvdvaLDAFEEAEFS---GRIEHASLVRDD  345
ident          |   || |   |  |     |     |                |       
Sbjct LCSEEYLKRVFDTAKSLNAPVTIHLYeTSKE-eydLEDILNIGLKevkTIAAHCVHLPER  237
DSSP  LLLHHHHHHHHHHHHHHLLLEEEEELlLLLL-lllLHHHHLLLLLlllEEEEELLLLLHH


DSSP  HHHHHHHHLLEEEELLLHHHHLLlhhhhhhhhhhhhLLLHHHHHH-HLLEEELLLLL--L
Query QLERIKELKVRISAQPHFIVSDWwivnrvgeerakwAYRLKTLSS-ITKLGFSTDSP--I  402
ident      |      |  |                                |    ||     
Sbjct YFGVLKDIPFFVSHNPASNLKLG-----------ngIAPVQRXIEhGXKVTLGTDGAasN  286
DSSP  HHHHHLLLLEEEEELHHHHHHLL-----------llLLLHHHHHHlLLEEEELLLLLllL


DSSP  LLLLHHHHHHHHHHLLlLLHHhLLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEE
Query EPADPWVSIDAAVNRYvVDPGeRVSREEALHLYTHGSAQVTLAeDLGKLERGFRAEYIIL  462
ident            |                 |   |   ||       || | |  |     
Sbjct NSLNLFFEXRLASLLQkAQNPrNLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVI  345
DSSP  LLLLHHHHHHHHHHHHhLLLLlLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEE


DSSP  LL----------LLLL--------------------------------------------
Query DR----------DPLK--------------------------------------------  468
ident |                                                           
Sbjct DLdlpexfpvqnIKNHlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekel  405
DSSP  ELllhhhllhhhHHHHhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhh


DSSP  --
Query --  468
ident   
Sbjct ys  407
DSSP  hl


No 9: Query=3icjA Sbjct=2oofA Z-score=28.1

back to top
DSSP  --LEEEEELLEEEEEEL---LEEEE--LEEEEELLEEEEEELHHHhhhhhHHHLleEEEL
Query --CMKALINGTIYTSFS---PVKKV--SGLVISNERVLYAGDSSTalriaELAGgeIIDL   53
ident   |     | |  |  |            |     |                |     | 
Sbjct lnCERVWLNVTPATLRSdlaDYGLLepHALGVHEGRIHALVPXQD---lkYPAH--WQDX   55
DSSP  llLLEEEEEEEELLLLLlllLLLLLllEEEEEELLEEEEEEEHHH---llLLLL--LEEL


DSSP  LLLEEEELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleEEEEelhhhhl
Query KGKFVMPAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriiFGFGwdqdelg  113
ident ||| | |   | | ||                                            
Sbjct KGKLVTPGLIDCHTHLIF-----------------------------agSRAE-------   79
DSSP  LLLEEEELEEEEEELLLL-----------------------------llLLHH-------


DSSP  llllhhhhlllllleeEEELLlleeeelhhhhhhhllllllleellllEEEHHHHH-HHH
Query rwptredldvidrpvfLYRRCfhvavmnskmidllnlkpskdfdestgIVRERALE-ESR  172
ident                                                           | 
Sbjct ----------------EFELR--------------------qkgvpyaEIARKGGGiIST  103
DSSP  ----------------HHHHH--------------------hhlllhhHHHHLLLLhHHH


DSSP  HHHHHlLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEE-------LHHHHHHHHHHHhlLL
Query KIINEkILTVKDYKHYIESAQEHLLSLGVHSVGFMSV-------GEKALKALFELEreGR  225
ident                        |   ||  |   |          | |     |     
Sbjct VRATR-AASEDQLFELALPRVKSLIREGVTTVEIKSGygltledELKXLRVARRLG--EA  160
DSSP  HHHHH-HLLHHHHHHHHHHHHHHHHHHLEEEEEEELLllllhhhHHHHHHHHHHHH--HH


DSSP  LLLEEEEEELH---------------------hHHHHHHhhLLLLeellleeEEEEEEEL
Query LKMNVFAYLSP---------------------eLLDKLEelNLGKfegrrlrIWGVXLFV  264
ident |   |   |                                  |           |  | 
Sbjct LPIRVKTTLLAahavppeyrddpdswveticqeIIPAAA--EAGL-------ADAVDVFC  211
DSSP  LLLEEEEEEEEellllhhhlllhhhhhhhhhhlHHHHHH--HLLL-------LLEEEEEE


DSSP  LllllllllllllllllllllllLLLLLHHHHHHHHHHHLLLLLEEEEEE-LLHHHhHHH
Query DgslgartallsepytdnpttsgELVMNKDEIVEVIERAKPLGLDVAVHA-IGDKAvDVA  323
ident                                   |   |   || |  |           
Sbjct E----------------------HIGFSLAQTEQVYLAADQYGLAVKGHXdQLSNL-GGS  248
DSSP  L----------------------LLLLLHHHHHHHHHHHHHLLLEEEEEElLLLLL-LHH


DSSP  HHHHhhhLLLL-EEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLLLHhhhhhhhhhhHL
Query LDAFeeaEFSG-RIEHASLVRDDQLERIKELKVRISAQPHFIVSDWWIvnrvgeerakWA  382
ident   |     |      |                |     |                     
Sbjct TLAA---NFGAlSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKET----------KL  295
DSSP  HHHH---HLLLlEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLL----------LL


DSSP  LLHHHHHH-HLLEEELLLLL---LLLLLHHHHHHHHHHLLlllhhhLLLHHHHHHHLLHH
Query YRLKTLSS-ITKLGFSTDSP---IEPADPWVSIDAAVNRYvvdpgeRVSREEALHLYTHG  438
ident      |         | |                 |               ||    |  
Sbjct PPVVALRKaGVPXAVSSDINpgtAPIVSLRXAXNXACTLF------GLTPVEAXAGVTRH  349
DSSP  LLHHHHHHlLLLEEELLLLLlllLLLLLHHHHHHHHHHHH------LLLHHHHHHHLLHH


DSSP  HHHHLLLL-LLLLLLLLLLLLEEEELL-LLLL----------------------
Query SAQVTLAE-DLGKLERGFRAEYIILDR-DPLK----------------------  468
ident  |        || |  |  |         |                        
Sbjct AARALGEQeQLGQLRVGXLADFLVWNCgHPAElsyligvdqlvsrvvngeetlh  403
DSSP  HHHHLLLLlLLLLLLLLLLLLEEEELLlLLLHhhhlllllleeeeeelleelll


No 10: Query=3icjA Sbjct=4cqbA Z-score=27.6

back to top
DSSP  ---LEEEEELLEEEeeellEEEE-LEEEEELLEEEEEELhhHHHHHHhhhlLEEEELLLL
Query ---CMKALINGTIYtsfspVKKV-SGLVISNERVLYAGDssTALRIAelagGEIIDLKGK   56
ident          |          |       |   |                     || || 
Sbjct skdFDLIIRNAYLS-----EKDSvYDIGIVGDRIIKIEA--KIEGTV----KDEIDAKGN   49
DSSP  lllEEEEEEEEEEL-----LLLEeEEEEEELLEEEEEEL--LLLLLE----EEEEELLLL


DSSP  EEEELEEEEEELHHHHHHHhhLEELLllllhhhhhhhhhlllllleEEEEelhhhhllll
Query FVMPAFFDSHLHLDELGMSleMVDLRgvksmeelvervkkgrgriiFGFGwdqdelgrwp  116
ident  | | | | | | |    |                             |           
Sbjct LVSPGFVDAHTHMDKSFTS--TGERL--------------------PKFW----------   77
DSSP  LEEELEEEEEELHHHLLLL--LLLLL--------------------LLLL----------


DSSP  lhhhhlllllleeeeELLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHH
Query tredldvidrpvflyRRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIIN  176
ident                 |                                    |      
Sbjct ---------------SRPYT----------------------------rdaaIEDGLKYY   94
DSSP  ---------------LLLLL----------------------------hhhhHHHHHHHH


DSSP  hLLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEEL-----HHHHHHHHHHHhlLLLL--LE
Query eKILTVKDYKHYIESAQEHLLSLGVHSVGFMSVG-----EKALKALFELEreGRLK--MN  229
ident  |  |    |             |                ||  |  |      ||    
Sbjct -KNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVdsvakTKAVEAVLEAK--EELKdlID  151
DSSP  -HHLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELlllllLHHHHHHHHHH--HHLLllLE


DSSP  EEEEELH------------HHHHhhhhhlllleellleeEEEEEEELLllllllllllll
Query VFAYLSP------------ELLDkleelnlgkfegrrlrIWGVXLFVDgslgartallse  277
ident                                           |                 
Sbjct IQVVAFAqsgffvdlesesLIRK-----------sldmgCDLVGGVDP------------  188
DSSP  EEEEEELlllllllllhhhHHHH-----------hhhhlLLEEELLLL------------


DSSP  llllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEEL-----LHHHHHHHHHHHHHH
Query pytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAI-----GDKAVDVALDAFEEA  330
ident                            ||    |   |       |            | 
Sbjct ----------ATREnnVEGSLDLCFKLAKEYDVDIDYHIHdigtvGVYSINRLAQKTIEN  238
DSSP  ----------LLLLllHHHHHHHHHHHHHHLLLEEEEEELllhhhHHHHHHHHHHHHHHL


DSSP  LL--LLEEEELLLL-------LHHHHHHHHHHLLEEEELLLHHhhlllhhhhhhhhhhhh
Query EF--SGRIEHASLV-------RDDQLERIKELKVRISAQPHFIvsdwwivnrvgeerakw  381
ident          ||           |      |                              
Sbjct GYkgRVTTSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSST---------------pp  283
DSSP  LLllLEEEEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLL---------------ll


DSSP  LLLHHHHHH-HLLEEELLLLL------LLLLLHHHHHHHHHHLLlllhhhllLHHHHHHH
Query AYRLKTLSS-ITKLGFSTDSP------IEPADPWVSIDAAVNRYvvdpgervSREEALHL  434
ident       |      ||   |            |          |                 
Sbjct TMPVIKLLEaGINLGCASDNIrdfwvpFGNGDMVQGALIETQRL--elktnrDLGLIWKM  341
DSSP  LLLHHHHHHlLLEEEEELLLLllllllLLLLLHHHHHHHHHHHH--llllhhHHHHHHHH


DSSP  LLHHHHHHLL-LLLLlLLLLLLLLLEEEELL-LLLL------------------------
Query YTHGSAQVTL-AEDLgKLERGFRAEYIILDR-DPLK------------------------  468
ident  |   | |          | |  |    |    |                          
Sbjct ITSEGARVLGiEKNY-GIEVGKKADLVVLNSlSPQWaiidqakrlcvikngriivkdevi  400
DSSP  HLHHHHHHHLlHHHL-LLLLLLLLLEEEELLlLHHHhhhhllleeeeeelleeeeellee


DSSP  --
Query --  468
ident   
Sbjct va  402
DSSP  ll


No 11: Query=3icjA Sbjct=1k6wA Z-score=26.7

back to top
DSSP  LEEEEELLEEeeeellEEEE--LEEEEELLEEEEEELHHhhhhhhhhhLLEEEELLLLEE
Query CMKALINGTIytsfspVKKV--SGLVISNERVLYAGDSStalriaelaGGEIIDLKGKFV   58
ident      ||                               |              |     |
Sbjct ALQTIINARL------PGEEglWQIHLQDGKISAIDAQS----gvmpiTENSLDAEQGLV   50
DSSP  LLLEEEEELL------LLLLleEEEEEELLEEEEEEEEL----lllllLLLEEELLLLEE


DSSP  EELEEEEEELHHHHHHHhhleellllllhhhhhhhhhlllllleEEEEelhhhhlllllh
Query MPAFFDSHLHLDELGMSlemvdlrgvksmeelvervkkgrgriiFGFGwdqdelgrwptr  118
ident  | |   | |||                                                
Sbjct IPPFVEPHIHLDTTQTA-------------------------gqPNWN------------   73
DSSP  ELLEEEEEELLLLLLLL-------------------------llLLLL------------


DSSP  hhhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHhHL
Query edldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIInEK  178
ident                                                    |        
Sbjct --------------QSGT----------------------------lfegIERWAER-KA   90
DSSP  --------------LLLL----------------------------hhhhHHHHHLL-HH


DSSP  LLLHHHHHHHHHHHHHHHHHLLEEEEEEEEEL----HHHHHHHHHHHhlLLLL--LEEEE
Query ILTVKDYKHYIESAQEHLLSLGVHSVGFMSVG----EKALKALFELEreGRLK--MNVFA  232
ident  ||  | |             |   |            ||||  |               
Sbjct LLTHDDVKQRAWQTLKWQIANGIQHVRTHVDVsdatLTALKAMLEVK--QEVApwIDLQI  148
DSSP  HLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELllllLHHHHHHHHHH--HHHLllLEEEE


DSSP  EELH------------HHHHHHHhhlllleellleeEEEEEEELLLllllllllllllll
Query YLSP------------ELLDKLEelnlgkfegrrlrIWGVXLFVDGslgartallsepyt  280
ident    |             |   |                 |                    
Sbjct VAFPqegilsypngeaLLEEALR-----------lgADVVGAIPHF--------------  183
DSSP  EEELlllllllllhhhHHHHHHH-----------llLLEEEELHHH--------------


DSSP  lllllllLLLLLHHHHHHHHHHHLLLLLEEEEEEL-----lHHHHHHHHHHHHHHLLL--
Query dnpttsgELVMNKDEIVEVIERAKPLGLDVAVHAI-----gDKAVDVALDAFEEAEFS--  333
ident                       |        ||           |               
Sbjct -----efTREYGVESLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALAHHEGMGar  238
DSSP  -----llLHHHHHHHHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHHHHHLLHhh


DSSP  LEEEELLLL-------LHHHHHHHHHHLLEEEELLLHHHHLLlHHHHhHHHHHhhLLLHH
Query GRIEHASLV-------RDDQLERIKELKVRISAQPHFIVSDWwIVNRvGEERAkwAYRLK  386
ident     |                   |       | |                      | |
Sbjct VTASHTTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHLQ-GRFD-TYPKRrgITRVK  296
DSSP  EEEEELHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHHL-LLLL-LLLLLllLLLHH


DSSP  HHHH-HLLEEELLLLL------LLLLLHHHHHHHHHHLllllhhHLLL----HHHHHHHL
Query TLSS-ITKLGFSTDSP------IEPADPWVSIDAAVNRyvvdpgERVS----REEALHLY  435
ident           |  |           |                              | | 
Sbjct EMLEsGINVCFGHDDVfdpwypLGTANMLQVLHMGLHV------CQLMgygqINDGLNLI  350
DSSP  HHHHlLLLEEELLLLLllllllLLLLLHHHHHHHHHHH------LLLLlhhhHHHHHHHH


DSSP  LHHHHHHLLLLLLlLLLLLLLLLEEEELL-LLLL--------------------------
Query THGSAQVTLAEDLgKLERGFRAEYIILDR-DPLK--------------------------  468
ident || ||      |      |  |  |||                                 
Sbjct THHSARTLNLQDY-GIAAGNSANLIILPAeNGFDalrrqvpvrysvrggkviastqpaqt  409
DSSP  LHHHHHHLLLLLL-LLLLLLLLLEEEELLlLHHHhhhhllllleeeelleeeeellllle


DSSP  --------------
Query --------------  468
ident               
Sbjct tvyleqpeaidykr  423
DSSP  eeellleeeellll


No 12: Query=3icjA Sbjct=4rdvB Z-score=24.9

back to top
DSSP  leEEEELLEEEEEellEEEE--LEEEEE-LLEEEEEELHhHHHHhhhhhllEEEELLlLE
Query cmKALINGTIYTSfspVKKV--SGLVIS-NERVLYAGDSsTALRiaelaggEIIDLKgKF   57
ident    |                      ||                           |    
Sbjct --SAIFAERALLP---EGWArnVRFEISaDGVLAEIRPD-ANAD-------GAERLG-GA   46
DSSP  --LEEEEEEEEEL---LEEEeeEEEEELlLLLEEEEELL-LLLL-------LLEELL-LL


DSSP  EEELEEEEEELHHHHHHHhhleellllllhhhhhhhhhlllllleEEEEELhhhhlllll
Query VMPAFFDSHLHLDELGMSlemvdlrgvksmeelvervkkgrgriiFGFGWDqdelgrwpt  117
ident | |     | |     |                                           
Sbjct VLPGMPNLHSHAFQRAMA--------------------------gLAEVAG---------   71
DSSP  EEELEEEEEELHHHHHHL--------------------------lLLLLLL---------


DSSP  hhhhlllllleeeeELLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHHH
Query redldvidrpvflyRRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIINE  177
ident                                                     |       
Sbjct --------------NPNDS----------------------------fwtwRELMYRMVA   89
DSSP  --------------LLLLL----------------------------hhhhHHHHHHHHL


DSSP  lLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH------------HHHHHHHHHhhlLL
Query kILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE------------KALKALFELereGR  225
ident   |                |  |   |                                 
Sbjct -RLSPEQIEVIACQLYIEMLKAGYTAVAEFHYVHhdldgrsyadpaELSLRISRA--aSA  146
DSSP  -LLLHHHHHHHHHHHHHHHHHHLEEEEEEEELLLllllllllllllHHHHHHHHH--hHH


DSSP  LLLEEEEEELH-----------------------HHHHHHhhhLLLL--EELLLEEeEEE
Query LKMNVFAYLSP-----------------------ELLDKLeelNLGK--FEGRRLRiWGV  260
ident                                     |  |          |       | 
Sbjct AGIGLTLLPVLyshagfggqpasegqrrfingseAYLELL---QRLRapLEAAGHS-LGL  202
DSSP  HLLEEEEEELLlleeellleellhhhllllllhhHHHHHH---HHHHhhHHHHLLE-ELE


DSSP  E-EELLllllllllllllllllllllllllLLLHHHHHHHHHhhLLLL-LEEEEEEL---
Query X-LFVDgslgartallsepytdnpttsgelVMNKDEIVEVIEraKPLG-LDVAVHAI---  315
ident                                     |  |         | |  |     
Sbjct CfHSLR------------------------AVTPQQIATVLA--AGHDdLPVHIHIAeqq  236
DSSP  EeLLLL------------------------LLLHHHHHHHHL--LLLLlLLEEEEELllh


DSSP  ----------lhHHHHHHHHhhhHHLLL--LEEEELLLLLHHHHHHHHHHLLEEEELLL-
Query ----------gdKAVDVALDafeEAEFS--GRIEHASLVRDDQLERIKELKVRISAQPH-  362
ident                                   ||                        
Sbjct kevddcqawsgrRPLQWLYE---NVAVDqrWCLVHATHADPAEVAAMARSGAVAGLCLSt  293
DSSP  hhhhhhhhhhllLHHHHHHH---HLLLLllEEEEELLLLLHHHHHHHHHHLLEEEELHHh


DSSP  HHHHLllhhhhhhhhhhhhLLLHHHHHH-HLLEEELLLLLLlLLLHHHHHHHHHHL-LLL
Query FIVSDwwivnrvgeerakwAYRLKTLSS-ITKLGFSTDSPIePADPWVSIDAAVNR-YVV  420
ident                                 ||   ||                     
Sbjct EANLG------------dgIFPATDFLAqGGRLGIGSDSHV-SLSVVEELRWLEYGqRLR  340
DSSP  HHHLL------------llLLLHHHHHHlLLEEEELLLLLL-LLLHHHHHHHHHHHhHHH


DSSP  L--HHHLL------LHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEELL--------
Query D--PGERV------SREEALHLYTHGSAQVTLAeDLGKLERGFRAEYIILDR--------  464
ident |                        | ||       | |  | ||    ||         
Sbjct DrkRNRLYrddqpmIGRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDGndpylasa  399
DSSP  HllLLLLLllllllHHHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELLllhhhhll


DSSP  ----LLLL--------------------------------------------
Query ----DPLK--------------------------------------------  468
ident                                                     
Sbjct egdaLLNRwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhHHHHhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 13: Query=3icjA Sbjct=3ooqA Z-score=24.5

back to top
DSSP  lEEEEELLEEEEEEllEEEE-LEEEEELLEEEEEELhhHHHHhhhhHLLEEEELLLLEEE
Query cMKALINGTIYTSFspVKKV-SGLVISNERVLYAGDssTALRiaelAGGEIIDLKGKFVM   59
ident       | |                 ||  |   |              || || |||  
Sbjct -KILFKNATVFPIT--SRPFkGDVLVSNGKVEKVGE--NIED----PDAEIVDLTGKFLF   51
DSSP  -LEEEEEEEELLLL--LLLEeEEEEEELLEEEEEEL--LLLL----LLLEEEELLLLEEE


DSSP  ELEEEEEELHHHHHhhHHLEEllllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLDELGmsLEMVDlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident | | | | |                                                   
Sbjct PGFVDAHSHIGLFE--EGVGY---------------------------------------   70
DSSP  ELEEEEEELLLLLL--LLLLH---------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHhhll
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIIneki  179
ident                                                             
Sbjct ----------------------------------------------yysdgnEATDpvtp   84
DSSP  ----------------------------------------------hhllllLLLLllll


DSSP  llhhhhhhHHHH-HHHHHHHLLEEEEEEEEelhhhhhhhhhhhhlllLLLEeeeeelhhh
Query ltvkdykhYIES-AQEHLLSLGVHSVGFMSvgekalkalfeleregrLKMNvfaylspel  238
ident              | |  |  || ||                      |           
Sbjct hvkaldgfNPQDpAIERALAGGVTSVXIVP-----gsanpvggqgsvIKFR---------  130
DSSP  lllhhhhlLLLLhHHHHHHLLLEEEEEELL-----llllleeeeeeeEELL---------


DSSP  hhhhhhhlllleeLLLE--EEEEEEEELLLLlllllllllllllllllllLLLLlLHHHH
Query ldkleelnlgkfeGRRL--RIWGVXLFVDGSlgartallsepytdnpttsGELVmNKDEI  296
ident                       |                                    |
Sbjct ---------siivEECIvkDPAGLKXAFGEN-------pkrvygerkqtpSTRXgTAGVI  174
DSSP  ---------lllhHHHEeeEEEEEEEELLHH-------hhhhhhhlllllLLHHhHHHHH


DSSP  HH------------------------------hHHHHLLLLLEEEEEELLHHHHHHHHHH
Query VE------------------------------vIERAKPLGLDVAVHAIGDKAVDVALDA  326
ident                                   |           ||        |   
Sbjct RDyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAHRADDILTAIRI  234
DSSP  HHhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEELLHHHHHHHHHH


DSSP  HHHHLLLLEEEELLLLLHhHHHHHHHHLLEEEELlLHHHhLLLHHhhhhhhhHHHLL-LH
Query FEEAEFSGRIEHASLVRDdQLERIKELKVRISAQpHFIVsDWWIVnrvgeerAKWAY-RL  385
ident  ||  |   |||             | |                                
Sbjct AEEFGFNLVIEHGTEAYK-ISKVLAEKKIPVVVG-PLLT-FRTKL-----elKDLTXeTI  286
DSSP  HHHHLLLEEEEELLLHHH-HHHHHHHHLLLEEEL-LLLL-LLLLH-----hhLLLLLlHH


DSSP  HHHHH-HLLEEELLLLLLLLL-LHHHHHHHHHHLllllhhhLLLHHHHHHHLLHHHHHHL
Query KTLSS-ITKLGFSTDSPIEPA-DPWVSIDAAVNRyvvdpgeRVSREEALHLYTHGSAQVT  443
ident   |           | |  |     |    |              |  |   |   |   
Sbjct AKLLKdGVLIALXCDHPVIPLeFATVQAATAXRY-------GAKEEDLLKILTVNPAKIL  339
DSSP  HHHHHlLLLEEELLLLLLLLHhHHHHHHHHHHHH-------LLLHHHHHHLLLHHHHHHL


DSSP  LLL-LLLLLLLLLLLLEEEELLLLLL-------------------
Query LAE-DLGKLERGFRAEYIILDRDPLK-------------------  468
ident   |   |  | |  |        |                     
Sbjct GLEdRIGSIEPGKDADLVVWSGHPFDxksvvervyidgvevfrre  384
DSSP  LLLlLLLLLLLLLLLLEEEELLLLLLlllleeeeeelleeeeell


No 14: Query=3icjA Sbjct=2vunA Z-score=23.7

back to top
DSSP  LEEEEELL-EEEEEEL-LEEE-ELEEEEELLEEEEEELhHHHHHhhHHHLLEEEELLLLE
Query CMKALING-TIYTSFS-PVKK-VSGLVISNERVLYAGDsSTALRiaELAGGEIIDLKGKF   57
ident       |   |               |         |               |||  |  
Sbjct SKTIIKNIgKIVSGDIkSPVLqADTIVVEDGLIAAIGG-EELMK--DAGDATIIDAAGST   57
DSSP  LEEEEELLlEEELLLLlLLEElLLEEEEELLEEEEEEL-HHHHL--LLLLLEEEELLLLE


DSSP  EEELEEEEEELHH--hhHHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlll
Query VMPAFFDSHLHLD--elGMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrw  115
ident | |   | | |                                                 
Sbjct VTPGLLDTHVHVSggdyAPRQK--------------------------------------   79
DSSP  EEELEEEEEELLLllleEHHHL--------------------------------------


DSSP  llhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhh
Query ptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkii  175
ident                                                             
Sbjct ------------------------------------------------------------   79
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhHHHHHHHHLLEEEEEEEEE-------------LHHHHHHHHHHHh
Query nekiltvkdykhyieSAQEHLLSLGVHSVGFMSV-------------GEKALKALFELEr  222
ident                      |  ||                        |         
Sbjct -------------tmDFISSALHGGVTTMISAGSphfpgrpkdaagtKALAITLSKSYY-  125
DSSP  -------------eeLHHHHHHLLLEEEEEELLLlllllllllhhhhHHHHHHHHHHHH-


DSSP  lLLLL--LEEE-EEELHH---hHHHHHhhlLLLEellleeEEEEEEELllllllllllll
Query eGRLK--MNVF-AYLSPE---lLDKLEelnLGKFegrrlrIWGVXLFVdgslgartalls  276
ident          |       |              |        | |                
Sbjct -NARPagVKVHgGAVILEkgltEEDFI---EMKK----egVWIVGEVG------------  165
DSSP  -HLLHhhLEEElLEELLLllllHHHHH---HHHH----llLLEEEEEL------------


DSSP  lllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEELL------hHHHH-HHHHHHhh
Query epytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAIG------dKAVD-VALDAFee  329
ident                |        | |   |  |  |  |                    
Sbjct ----------lgtIKNPEDAAPMVEWAHKHGFKVQMHTGGtsipgssTVTAdDVIKTK--  213
DSSP  ----------lllLLLHHHHHHHHHHHHHLLLEEEEELLLlllllllLLLHhHHHHHL--


DSSP  hllLLEEEELL----LLLHHH-HHHHHHHLLEEEELLLHHhhlllhhhhhhhhhhHHLL-
Query aefSGRIEHAS----LVRDDQ-LERIKELKVRISAQPHFIvsdwwivnrvgeeraKWAY-  383
ident         |                  |                                
Sbjct ---PDVVSHINggptAISVQEvDRIMDETDFAMEIVQCGN---------------PKIAd  255
DSSP  ---LLEEELLLllllLLLHHHhHHHHHHLLLEEEEELLLL---------------HHHHh


DSSP  -LHHHH---hHHLLEEELLLLLL---LLLL-HHHHHHHHHHLllllhhHLLLHHHHHHHL
Query -RLKTL---sSITKLGFSTDSPI---EPAD-PWVSIDAAVNRyvvdpgERVSREEALHLY  435
ident                 |  | |                               | |    
Sbjct yVARRAaekgQLGRVIFGNDAPSgtgLIPLgILRNMCQIASM------SDIDPEVAVCMA  309
DSSP  hHHHHHhhhlLHHHEEEELLLLLlllLLLLhHHHHHHHHHHH------LLLLHHHHHHHH


DSSP  LHHHHHHLLLlLLLLLLLLLLLLEEEELL-------LLLL--------------------
Query THGSAQVTLAeDLGKLERGFRAEYIILDR-------DPLK--------------------  468
ident |  |  |      |    |  |  || |        |                       
Sbjct TGNSTAVYGL-NTGVIAPGKEADLIIMDTplgsvaeDAMGaiaagdipgisvvlidgeav  368
DSSP  LHHHHHHHLL-LLLLLLLLLLLLEEEEELlllllllLHHHhhhhlllleeeeeeelleee


DSSP  -----------------
Query -----------------  468
ident                  
Sbjct vtksrntppakraakil  385
DSSP  ellllllllllllleel


No 15: Query=3icjA Sbjct=3giqA Z-score=23.6

back to top
DSSP  --LEEEEELLEEEEEELLEEEELEEEEELLEEEEEELhhhHHHHhhhHLLEEEELLLLEE
Query --CMKALINGTIYTSFSPVKKVSGLVISNERVLYAGDsstALRIaelAGGEIIDLKGKFV   58
ident          | |            |     |    |                 |  || |
Sbjct ekLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGE---LGAH---PARHAWDASGKIV   54
DSSP  llEEEEEELLEELLLLLLLLEELEEEEELLEEEEEEL---LLLL---LEEEEEELLLLEE


DSSP  EELEEEEEELHHHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllh
Query MPAFFDSHLHLDELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptr  118
ident  | | | | | |                                                
Sbjct APGFIDVHGHDDLMF---------------------------------------------   69
DSSP  EELEEELLLLLLLHH---------------------------------------------


DSSP  hhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhl
Query edldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinek  178
ident                                                             
Sbjct ------------------------------------------------------------   69
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhHHHHHhHHHHHHLLEEEEEEE----EELH--------------------HHH
Query iltvkdykHYIESaQEHLLSLGVHSVGFM----SVGE--------------------KAL  214
ident                    | |   |       |                          
Sbjct --------VEKPD-LRWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfADV  120
DSSP  --------HHLLL-LHHHHLLLEEEEEELllllLLLLllllllllhhhhhhllllllLLH


DSSP  HHHHHHHHLLLLLLEEEEEELHHHH------------------HHHHhhlLLLEellleE
Query KALFELEREGRLKMNVFAYLSPELL------------------DKLEelnLGKFegrrlR  256
ident  | |      |   || |      |                                   
Sbjct PAYFAALDAQRPMINVAALVGHANLrlaamrdpqaaptaaeqqAMQDmlqAALE----aG  176
DSSP  HHHHHHHHHLLLLLEEEEEEEHHHHhhhhlllllllllhhhhhHHHHhhhHHHH----hL


DSSP  EEEEEEELLLllllllllllllllllllllllLLLLHHHHHHHHHHHLLLLLEEEEEE--
Query IWGVXLFVDGslgartallsepytdnpttsgeLVMNKDEIVEVIERAKPLGLDVAVHA--  314
ident   |                              |    |       |         |   
Sbjct AVGFSTGLAY-------------------qpgAVAQAAELEGLARVAAERRRLHTSHIrn  217
DSSP  LLEEEEELLL-------------------llhHHLLHHHHHHHHHHHHHLLLEEEEELll


DSSP  ---lLHHHHHHHHHHHHHHLLLLEEEELLL-------lLHHHHHHHHHHL-----LEEEE
Query ---iGDKAVDVALDAFEEAEFSGRIEHASL-------vRDDQLERIKELK-----VRISA  359
ident        ||   |             |               |  |         |    
Sbjct eadgVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDI  277
DSSP  llllHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEE


DSSP  LlLHHH------------------------------------------------------
Query QpHFIV------------------------------------------------------  365
ident                                                             
Sbjct Y-PYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapag  336
DSSP  L-LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhllee


DSSP  -HLLLHhhhhhhhhHHHLL-LHHHHhhhlLEEELLLLL-------LLLLL-HHHHHHHHH
Query -SDWWIvnrvgeerAKWAY-RLKTLssitKLGFSTDSP-------IEPAD-PWVSIDAAV  415
ident                                    |                       |
Sbjct aIYFAM-------dEDEVKrIFQHP----CCMVGSDGLpndarphPRLWGsFTRVLGRYV  385
DSSP  eEEELL-------lHHHHHhHHHLL----LEEELLLLLlllllllLHHHHhHHHHHHHHH


DSSP  HLllllhhhLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEllLLLL-------
Query NRyvvdpgeRVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILdrDPLK-------  468
ident              | |    |   | |      | |  |  |       ||         
Sbjct RE-----arLMTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVF--DPDTvadratw  438
DSSP  HH-----llLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEE--LLLLlllllll


DSSP  -------------------------------------
Query -------------------------------------  468
ident                                      
Sbjct deptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  llllllllleeeeeelleeeellllllllllllllll


No 16: Query=3icjA Sbjct=1onxA Z-score=23.0

back to top
DSSP  -------LEEEEELLEEEEEellEEEE-LEEEEELLEEEEEELhhHHHHhhHHHL-LEEE
Query -------CMKALINGTIYTSfspVKKV-SGLVISNERVLYAGDssTALRiaELAG-GEII   51
ident            |     |                |                         
Sbjct midytaaGFTLLQGAHLYAP---EDRGiCDVLVANGKIIAVAS--NIPS--DIVPnCTVV   53
DSSP  llllhhhLLEEEEEEEEELL---LEEEeEEEEEELLEEEEEEL--LLLL--LLLLlLEEE


DSSP  ELLLLEEEELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhh
Query DLKGKFVMPAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqde  111
ident || |    | | | | ||                                          
Sbjct DLSGQILCPGFIDQHVHLIG----------------------------------------   73
DSSP  ELLLLEEEELEEEEEELLLL----------------------------------------


DSSP  hlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhHHHH
Query lgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraLEES  171
ident                                                             
Sbjct ----------------------------------------------------gggeAGPT   81
DSSP  ----------------------------------------------------llllLLHH


DSSP  HHhhhhllllhhhhhHHHHhhHHHHHHLLEEEEEEEE-------eLHHHHHHHHHHHhll
Query RKiinekiltvkdykHYIEsaQEHLLSLGVHSVGFMS-------vGEKALKALFELEreg  224
ident                         |   || ||             |  |     |    
Sbjct TR------------tPEVA--LSRLTEAGVTSVVGLLgtdsisrhPESLLAKTRALN---  124
DSSP  HL------------lLLLL--HHHHHHLLEEEEEELLllllllllHHHHHHHHHHHH---


DSSP  LLLLEEEEEEL-----HHHHHHHhhhllLLEEllleEEEEEEEELLLlllllllllllll
Query RLKMNVFAYLS-----PELLDKLeelnlGKFEgrrlRIWGVXLFVDGslgartallsepy  279
ident                                     |  |||                  
Sbjct EEGISAWMLTGayhvpSRTITGSvekdvAIID----RVIGVXCAISD-------------  167
DSSP  HHLLEEEEEEElllllLLLLLLLhhhhhHHLL----LEEEEEEEELL-------------


DSSP  lllllllLLLL-LLHHHHHHHHHHHLLLL------LEEEEEELL-hHHHHHHHHHHH-HH
Query tdnpttsGELV-MNKDEIVEVIERAKPLG------LDVAVHAIG-dKAVDVALDAFE-EA  330
ident                             |           |     ||     |  |   
Sbjct -------HRSAaPDVYHLANMAAESRVGGllggkpGVTVFHMGDskKALQPIYDLLEnCD  220
DSSP  -------LLLLlLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHHHlLL


DSSP  LLL--LEEEEL-LLLL--HHHHHHHHHhLLEEEELLLHHhhlllhhhhhhhhhhHHLL--
Query EFS--GRIEHA-SLVR--DDQLERIKElKVRISAQPHFIvsdwwivnrvgeeraKWAY--  383
ident          |    |      ||        |                            
Sbjct VPIskLLPTHVnRNVPlfEQALEFARK-GGTIDITSSID---------------EPVApa  264
DSSP  LLHhhEEEELHhHLHHhhHHHHHHHHL-LLLEEEELLLL---------------LLLLhh


DSSP  -LHHHHHHH----lLEEELLLLLL----------------LLLL-HHHHHHHHHHLllll
Query -RLKTLSSI----tKLGFSTDSPI----------------EPAD-PWVSIDAAVNRyvvd  421
ident                   | |                                |      
Sbjct eGIARAVQAgiplaRVTLSSDGNGsqpffddegnlthigvAGFEtLLETVQVLVKD----  320
DSSP  hHHHHHHHLlllhhHEEEELLLLLeeeeellllleeeeeeLLLHhHHHHHHHHHHH----


DSSP  hhhlLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELLLL---------------
Query pgerVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDRDP---------------  466
ident      |   ||   |   |        |    |  |                        
Sbjct --ydFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELrieqvyargklmvkd  378
DSSP  --hlLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEELLLLleeeeeelleeeeel


DSSP  ----------ll
Query ----------lk  468
ident             
Sbjct gkacvkgtfetd  390
DSSP  leelllllllll


No 17: Query=3icjA Sbjct=1yrrB Z-score=22.8

back to top
DSSP  leEEEELLEEEEEEllEEEE-LEEEEELLEEEEEELHHhhhHHHHhhLLEEEELLLLEEE
Query cmKALINGTIYTSFspVKKV-SGLVISNERVLYAGDSStalRIAElaGGEIIDLKGKFVM   59
ident    ||  | | |            ||                       |   | |    
Sbjct --YALTQGRIFTGH--EFLDdHAVVIADGLIKSVCPVA---ELPP--EIEQRSLNGAILS   51
DSSP  --LEEELLEEELLL--LEELlEEEEEELLEEEEEEEHH---HLLL--LLLEEELLLLEEE


DSSP  ELEEEEEELHhhHHHHhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLdeLGMSlemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident | | |  |     |                                              
Sbjct PGFIDVQLNG--CGGV--------------------------------------------   65
DSSP  ELEEEEEELE--ELLE--------------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlL
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekI  179
ident                                                             
Sbjct -------------------------------------------------------qfndT   70
DSSP  -------------------------------------------------------elllL


DSSP  LLHhHHHHHHHHHHHHHHHLLEEEEEEEEE------LHHHHHHHHHHHhlLLLL-LEEEE
Query LTVkDYKHYIESAQEHLLSLGVHSVGFMSV------GEKALKALFELEreGRLK-MNVFA  232
ident           |  |      |                        |              
Sbjct AEA-VSVETLEIMQKANEKSGCTNYLPTLIttsdelMKQGVRVMREYL--AKHPnQALGL  127
DSSP  LLL-LLHHHHHHHHHHHHLLLEEEEEEEELlllhhhHHHHHHHHHHHH--HHLLlLLLLE


DSSP  EELHH-----HHHHHhhhlLLLEellleEEEEEEEELlllllllllllllllllllllll
Query YLSPE-----LLDKLeelnLGKFegrrlRIWGVXLFVdgslgartallsepytdnpttsg  287
ident  |        | | |              |  | |                         
Sbjct HLEGPwlnaaLVDFL---cENAD-----VITKVTLAP-----------------------  156
DSSP  EEELLllllhHHHHH---hHLHH-----HEEEEEELH-----------------------


DSSP  llllLHHHhHHHHHHHLLLLLEEEEEEllhHHHH-HHHHHHHhhLLLLEEEELL--LLLH
Query elvmNKDEiVEVIERAKPLGLDVAVHAigdKAVD-VALDAFEeaEFSGRIEHAS--LVRD  344
ident           |||      |  |        |    |   |          |        
Sbjct ----EMVP-AEVISKLANAGIVVSAGH--sNATLkEAKAGFR--AGITFATHLYnaMPYI  207
DSSP  ----HHLL-HHHHHHHHHHLLEEEELL--lLLLHhHHHHHHH--HLEEEELLLLllLLLL


DSSP  H-----hHHHHHHH-LLEEEELLLhHHHLllhhhhhhhhhhhhllLHHHHHHHL--LEEE
Query D-----qLERIKEL-KVRISAQPHfIVSDwwivnrvgeerakwayRLKTLSSIT--KLGF  396
ident           |                                             ||  
Sbjct TgrepglAGAILDEaDIYCGIIAD-GLHV-------------dyaNIRNAKRLKgdKLCL  253
DSSP  LllllhhHHHHHHLlLLEEEEELL-LLLL-------------lhhHHHHHHHHHhhHEEE


DSSP  LLLLL-LLLLLHHHHHHHHHHLllllhhHLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLL
Query STDSP-IEPADPWVSIDAAVNRyvvdpgERVSREEALHLYTHGSAQVTLAE-DLGKLERG  454
ident  ||                |              | |   |   |     |  || |  |
Sbjct VTDATsGSSLTMIEGVRNLVEH------CGIALDEVLRMATLYPARAIGVEkRLGTLAAG  307
DSSP  ELLLLlLLLLLHHHHHHHHHHH------HLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLL


DSSP  LLLLEEEELLLL-------------ll
Query FRAEYIILDRDP-------------lk  468
ident   |       |                
Sbjct KVANLTAFTPDFkitktivngnevvtq  334
DSSP  LLLLEEEELLLLleeeeeelleeeeel


No 18: Query=3icjA Sbjct=1gkpA Z-score=22.7

back to top
DSSP  lEEEEELLEEEeEELLeEEELEEEEELLEEEEEeLHHHhhhHHHHhLLEEEELLLLEEEE
Query cMKALINGTIYtSFSPvKKVSGLVISNERVLYAgDSSTalrIAELaGGEIIDLKGKFVMP   60
ident       || |                 |              |   | | ||  || | |
Sbjct -PLLIKNGEII-TADS-RYKADIYAEGETITRI-GQNL---EAPP-GTEVIDATGKYVFP   52
DSSP  -LEEEELLEEE-ELLE-EEELEEEELLLLLLEE-ELLL---LLLL-LLEEEELLLLEEEE


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident  | | | |                                                    
Sbjct GFIDPHVHIYL-------------------------------------------------   63
DSSP  LEEEEEELLLL-------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHHhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIINekil  180
ident                                                             
Sbjct --------------------------------------------------pFMATF----   69
DSSP  --------------------------------------------------eELLEE----


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEEEL------HHHHHHHHHHHHlLLLLLEEEEEE
Query tvkdykhYIESAQEHLLSLGVHSVGFMSVG------EKALKALFELEReGRLKMNVFAYL  234
ident          |      |  |      |                      |          
Sbjct ----akdTHETGSKAALMGGTTTYIEMCCPsrnddaLEGYQLWKSKAE-GNSYCDYTFHM  124
DSSP  ----lllLHHHHHHHHHHLLEEEEEEEELLlllllhHHHHHHHHHHHL-LLLLLEEEEEE


DSSP  LHH-----HHHHHHhhLLLLEEllleeEEEEEEELLLlllllllllllllllllllllll
Query SPE-----LLDKLEelNLGKFEgrrlrIWGVXLFVDGslgartallsepytdnpttsgel  289
ident             |              |   | |                          
Sbjct AVSkfdekTEGQLR--EIVADG-----ISSFXIFLSY-------------------knff  158
DSSP  ELLlllllHHHHHH--HHHHLL-----LLEEEEEELL-------------------llll


DSSP  LLLHHHHHHHHHHHLLLLLEEEEEEL-------------------------------LHH
Query VMNKDEIVEVIERAKPLGLDVAVHAI-------------------------------GDK  318
ident      |       || ||  |  |                                    
Sbjct GVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAE  218
DSSP  LLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHH


DSSP  HHHHHHHHHHHHLLLLEEEELLL--LLHHHHHHHH-HHLLEEEELLLHHHHL--------
Query AVDVALDAFEEAEFSGRIEHASL--VRDDQLERIK-ELKVRISAQPHFIVSD--------  367
ident          |     |   | |     |             |         |        
Sbjct GTARFATFLETTGATGYVVHLSCkpALDAAMAAKArGVPIYIESVIPHFLLDktyaergg  278
DSSP  HHHHHHHHHHHHLLEEEELLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLhhhhhllh


DSSP  ------------LLHHhhhhhhhHHHLL--LHHHHHhhllEEELLLLL------------
Query ------------WWIVnrvgeerAKWAY--RLKTLSsitkLGFSTDSP------------  401
ident                                |            ||              
Sbjct veamkyimspplRDKR-------NQKVLwdALAQGF---iDTVGTDHCpfdteqkllgke  328
DSSP  hhhhllllllllLLLH-------HHHHHhhHHHLLL---lLEEELLLLlllhhhhhhhll


DSSP  --------LLLL--LHHHHHHHHHHlllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLL
Query --------IEPA--DPWVSIDAAVNryvvdpgeRVSREEALHLYTHGSAQVTLAE-DLGK  450
ident         |              |         |              |         | 
Sbjct aftaipngIPAIedRVNLLYTYGVS------rgRLDIHRFVDAASTKAAKLFGLFpRKGT  382
DSSP  lhhhllllLLLLllHHHHHHHHHLL------llLLLHHHHHHHHLHHHHHHLLLLlLLLL


DSSP  LLLLLLLLEEEELLL---------------------------------------------
Query LERGFRAEYIILDRD---------------------------------------------  465
ident    |  |     |                                               
Sbjct IAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfv  442
DSSP  LLLLLLLLEEEEELLlleellhhhllllllllllllleelleeeeeeelleeeeelleel


DSSP  -------------lll
Query -------------plk  468
ident                 
Sbjct gekgwgkllrrepmyf  458
DSSP  llllllllllllllll


No 19: Query=3icjA Sbjct=3e74A Z-score=22.6

back to top
DSSP  -LEEEEELLEEEEEelLEEEELEEEEELLEEEEEELhhHHHHHhhhhlLEEEELLLLEEE
Query -CMKALINGTIYTSfsPVKKVSGLVISNERVLYAGDssTALRIaelagGEIIDLKGKFVM   59
ident        |||          |             |              |  |  |  | 
Sbjct sFDLIIKNGTVILE--NEARVVDIAVKGGKIAAIGQ--DLGDA-----KEVXDASGLVVS   51
DSSP  lEEEEEELLEEELL--LLEEELEEEEELLEEEEEEL--LLLLE-----EEEEELLLLEEE


DSSP  ELEEEEEELHhhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLdelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident |   | | |                                                   
Sbjct PGXVDAHTHI--------------------------------------------------   61
DSSP  ELEEEEEELL--------------------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
ident                                                             
Sbjct ------------------------------------------------------------   61
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhHHHHHHHHHHHLLEEEEEEEE------ELHH-HHHHHHHHHHlLLLLLEEEE
Query ltvkdykhYIESAQEHLLSLGVHSVGFMS------VGEK-ALKALFELEReGRLKMNVFA  232
ident           |         |                        |     | |      
Sbjct --------GYETGTRAAAKGGITTXIEXPlnqlpaTVDRaSIELKFDAAK-GKLTIDAAQ  112
DSSP  --------LHHHHHHHHHHLLEEEEEELLllllllLLLHhHHHHHHHHHL-LLLLLEEEE


DSSP  EELHH-----HHHHhhhhllLLEEllleeEEEEEEELlllllllllllllllllllllll
Query YLSPE-----LLDKleelnlGKFEgrrlrIWGVXLFVdgslgartallsepytdnpttsg  287
ident            |                   | | ||                       
Sbjct LGGLVsynidRLHE-----lDEVG-----VVGFXCFV-----------------------  139
DSSP  LEELLlllllLHHH-----hHHHL-----LLLEEEEL-----------------------


DSSP  llLLLHHHHHHHHHHHLLLLLEEEEEEL-------------------------------L
Query elVMNKDEIVEVIERAKPLGLDVAVHAI-------------------------------G  316
ident     |             ||  | ||                                  
Sbjct -rDVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvftE  198
DSSP  -lLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhH


DSSP  HHHHHHHHHHHHHHLLLLEEEELLL--LLHHHHHHHH-HHLLEEEELLLHHHHLLL----
Query DKAVDVALDAFEEAEFSGRIEHASL--VRDDQLERIK-ELKVRISAQPHFIVSDWW----  369
ident   |    |     |       | |                       ||  | |      
Sbjct VEAIRRVLYLAKVAGCRLHVCHVSSpeGVEEVTRARQeGQDITCESCPHYFVLDTDqfee  258
DSSP  HHHHHHHHHHHHHHLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEELLHHHHLLHHhhhh


DSSP  -----------HHHHhhhhhhHHLL-LHHHHHhhllEEELLLLL----------------
Query -----------IVNRvgeeraKWAY-RLKTLSsitkLGFSTDSP----------------  401
ident                      |     |             |                  
Sbjct igtlakcsppiRDLE----nqKGXWeKLFNGE---iDCLVSDHSpcppexkagnixkawg  311
DSSP  hlhhhllllllLLHH----hhHHHHhHHHLLL---lLEELLLLLllllllllllllllll


DSSP  -LLLL--LHHHHHHHHHHlllllhhhLLLHH-HHHHHLLHHHHHHLLLLLLLLLLLLLLL
Query -IEPA--DPWVSIDAAVNryvvdpgeRVSRE-EALHLYTHGSAQVTLAEDLGKLERGFRA  457
ident  |        |  | ||         |         |     |        |    |  |
Sbjct gIAGLqsCXDVXFDEAVQ-------kRGXSLpXFGKLXATNAADIFGLQQKGRIAPGKDA  364
DSSP  lLLLHhhHHHHHHHHHLL-------lLLLLHhHHHHHHLHHHHHHLLLLLLLLLLLLLLL


DSSP  LEEEELL-----------------------------------------------------
Query EYIILDR-----------------------------------------------------  464
ident                                                             
Sbjct DFVFIQPnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
DSSP  LEEEEELllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll


DSSP  -llll
Query -dplk  468
ident      
Sbjct filkh  429
DSSP  eelll


No 20: Query=3icjA Sbjct=3griA Z-score=22.1

back to top
DSSP  lEEEEELLEEEeeelLEEE-ELEEEEELLEEEEEELhhhHHHHhhHHLLEEEELLLLEEE
Query cMKALINGTIYtsfsPVKK-VSGLVISNERVLYAGDsstALRIaeLAGGEIIDLKGKFVM   59
ident   |   ||                 |             |       |  ||| || || 
Sbjct -XKLIKNGKVL---qNGELqQADILIDGKVIKQIAP---AIEP--SNGVDIIDAKGHFVS   51
DSSP  -LEEEELLEEE---eLLEEeELEEEEELLEEEEEEL---LLLL--LLLLEEEELLLLEEE


DSSP  ELEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident | | | | || |                                                
Sbjct PGFVDVHVHLREpgGEYK------------------------------------------   69
DSSP  ELEEEEEELLLLllLLLL------------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
ident                                                             
Sbjct ------------------------------------------------------------   69
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhHHHHHHHHHHHLLEEEEEEEE-----ELHH-HHHHHHHHHHlLLLLLEEEEE
Query ltvkdykhYIESAQEHLLSLGVHSVGFMS-----VGEK-ALKALFELEReGRLKMNVFAY  233
ident          ||         |   |                 ||  |         |  |
Sbjct -------eTIETGTKAAARGGFTTVCPXPntrpvPDSVeHFEALQKLID-DNAQVRVLPY  121
DSSP  -------lLHHHHHHHHHHLLEEEEEELLlllllLLLHhHHHHHHHHHH-HHLLLEELLL


DSSP  ELHHH-------HHHHhhhlLLLEellleEEEEEEEElllllllllllllllllllllll
Query LSPEL-------LDKLeelnLGKFegrrlRIWGVXLFvdgslgartallsepytdnptts  286
ident  |           |                                              
Sbjct ASITTrqlgkelVDFP----ALVK----eGAFAFTDD-----------------------  150
DSSP  EELLHhhlllllLLHH----HHHL----lLLLLEEEL-----------------------


DSSP  lllLLLHHHHHHHHHHHLLLLLEEEEEEL----------------------------LHH
Query gelVMNKDEIVEVIERAKPLGLDVAVHAI----------------------------GDK  318
ident    |       |    |         |                                 
Sbjct gvgVQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnicESV  210
DSSP  lllLLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhhHHH


DSSP  HHHHHHHHHHHHLLLLEEEELLL--LLHHHHHHHH-HHLLEEEELLLHHHH---------
Query AVDVALDAFEEAEFSGRIEHASL--VRDDQLERIK-ELKVRISAQPHFIVS---------  366
ident          | |       | |                 |     ||             
Sbjct QIARDVLLAEAAGCHYHVCHVSTkeSVRVIRDAKRaGIHVTAEVTPHHLLLteddipgnn  270
DSSP  HHHHHHHHHHHHLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEELHHHHHLlhhhlllll


DSSP  --------LLLHHhhhhhhhHHHLL-LHHHHhhhLLEEELLLLL----------------
Query --------DWWIVnrvgeerAKWAY-RLKTLssiTKLGFSTDSP----------------  401
ident                            |      |     ||                  
Sbjct aiykxnppLRSTE------dREALLeGLLDG---TIDCIATDHAphardekaqpxekapf  321
DSSP  hhhlllllLLLHH------hHHHHHhHHHLL---LLLEELLLLLlllhhhhlllllllll


DSSP  LLLL--LHHHHHH-HHHHlllllhhhLLLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLL
Query IEPA--DPWVSID-AAVNryvvdpgeRVSREEALHLYTHGSAQVTLAEdLGKLERGFRAE  458
ident                 |                    |         |  | |     | 
Sbjct GIVGseTAFPLLYtHFVK------ngDWTLQQLVDYLTIKPCETFNLE-YGTLKENGYAD  374
DSSP  LLLLllLHHHHHHhHHLL------llLLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLL


DSSP  EEEELLL--------------------------------------lll
Query YIILDRD--------------------------------------plk  468
ident   | | |                                         
Sbjct LTIIDLDseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  EEEEELLlleellhhhllllllllllllleelleeeeeeelleeeeel


No 21: Query=3icjA Sbjct=4b3zD Z-score=21.9

back to top
DSSP  LEEEEELLEEeEEELlEEEELEEEEELLEEEEEeLHHHhhHHHHhhLLEEEELLLLEEEE
Query CMKALINGTIyTSFSpVKKVSGLVISNERVLYAgDSSTalRIAElaGGEIIDLKGKFVMP   60
ident        | |                                    |   |   |  | |
Sbjct DRLLIKGGRI-INDD-QSLYADVYLEDGLIKQI-GENL--IVPG--GVKTIEANGRMVIP   53
DSSP  LEEEEEEEEE-ELLL-LEEEEEEEEELLEEEEE-ELLL--LLLL--LLEEEELLLLEEEE


DSSP  LEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    |    |                                                   
Sbjct GGIDVNTYLQK--TAAD-------------------------------------------   68
DSSP  LEEEEEELLLL--LLLL-------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct ------------------------------------------------------------   68
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEeEELH-------HHHHHHHHHHHlLLLLLEEEEE
Query tvkdykhYIESAQEHLLSLGVHSVGFmSVGE-------KALKALFELEReGRLKMNVFAY  233
ident                 |  |        |                |              
Sbjct -------DFFQGTRAALVGGTTMIID-HVVPepgssllTSFEKWHEAAD-TKSCCDYSLH  119
DSSP  -------LHHHHHHHHHHLLEEEEEE-EELLlllllhhHHHHHHHHHHH-LLLLLEEEEE


DSSP  ELHH-----HHHHHHhhlLLLEellleEEEEEEEELLLllllllllllllllllllllll
Query LSPE-----LLDKLEelnLGKFegrrlRIWGVXLFVDGslgartallsepytdnpttsge  288
ident              ||                                             
Sbjct VDITswydgVREELE---VLVQ---dkGVNSFQVYMAY-------------------kdv  154
DSSP  EELLlllllHHHHHH---HHHH---llLLLEEEEELLL-------------------lll


DSSP  lLLLHHHHHHHHHHHLLLLLEEEEEEL-------------------------------LH
Query lVMNKDEIVEVIERAKPLGLDVAVHAI-------------------------------GD  317
ident   |      |     | ||    |||                                  
Sbjct yQMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeelEA  214
DSSP  lLLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhHH


DSSP  HHHHHHHHHHHHHLLLLEEEELLLLL--HHHHHHHH-HHLLEEEELLLHHHHLllHHHH-
Query KAVDVALDAFEEAEFSGRIEHASLVR--DDQLERIK-ELKVRISAQPHFIVSDwwIVNR-  373
ident  ||  |            |         |      |    |           |       
Sbjct EAVFRAITIAGRINCPVYITKVMSKSaaDIIALARKkGPLVFGEPIAASLGTD--GTHYw  272
DSSP  HHHHHHHHHHHHHLLLEEEEEELLHHhhHHHHHHHHhLLLEEEEELHHHHHLL--LHHHh


DSSP  --------------hhhhHHHH-lLLHHHHHHHLLEEELLLLL-----------------
Query --------------vgeeRAKW-aYRLKTLSSITKLGFSTDSP-----------------  401
ident                         |    |                              
Sbjct sknwakaaafvtspplspDPTTpdYLTSLLACGDLQVTGSGHCpystaqkavgkdnftli  332
DSSP  lllhhhhhhlllllllllLLLHhhHHHHHHHHLLLLLLLLLLLlllhhhhhhhlllhhhl


DSSP  ---LLLL--LHHHHHHHHHHLllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLL
Query ---IEPA--DPWVSIDAAVNRyvvdpgeRVSREEALHLYTHGSAQVTLAE-DLGKLERGF  455
ident             |  | ||                        |         |    | 
Sbjct pegVNGIeeRMTVVWDKAVAT------gKMDENQFVAVTSTNAAKIFNLYpRKGRIAVGS  386
DSSP  lllLLLLllHHHHHHHHHLLL------lLLLHHHHHHHHLHHHHHHHLLLlLLLLLLLLL


DSSP  LLLEEEEllLLLL-----------------------------------------------
Query RAEYIILdrDPLK-----------------------------------------------  468
ident  |   |   || |                                               
Sbjct DADVVIW--DPDKlktitakshksaveynifegmechgsplvvisqgkivfedgninvnk  444
DSSP  LLLEEEE--EEEEeeelllllllllllllllllleeeeeeeeeeelleeeeelleellll


DSSP  ---------------------------------
Query ---------------------------------  468
ident                                  
Sbjct gmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  llllllllllllhhhhhhhhhhhhhllllllll


No 22: Query=3icjA Sbjct=3nqbA Z-score=21.7

back to top
DSSP  -----------------------lEEEEELLEEEeEELLEE-EELEEEEELLEEEEEELH
Query -----------------------cMKALINGTIYtSFSPVK-KVSGLVISNERVLYAGDS   36
ident                               ||                |           
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLV-DVVTGElRPADIGIVGALIASVHEP   59
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEE-LLLLLLeEELEEEEELLEEEEEELL


DSSP  HHhHHHHhhhlLEEEELLLLEEEELEEEEEELHHHHHHhhhleellllllhhhhhhhhhl
Query STaLRIAelagGEIIDLKGKFVMPAFFDSHLHLDELGMslemvdlrgvksmeelvervkk   96
ident     | |       ||  |  | |   | | |                            
Sbjct AS-RRDA----AQVIDAGGAYVSPGLIDTHXHIESSXI----------------------   92
DSSP  LL-LLLE----EEEEELLLLEEEELEEEEEELHHHHLL----------------------


DSSP  llllleeeeeelhhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllle
Query grgriifgfgwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdf  156
ident                                                             
Sbjct ------------------------------------------------------------   92
DSSP  ------------------------------------------------------------


DSSP  elllleeehhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEEEeELHH----
Query destgivreraleesrkiinekiltvkdykhYIESAQEHLLSLGVHSVGFMsVGEK----  212
ident                                            ||         |     
Sbjct -------------------------------TPAAYAAAVVARGVTTIVWD-PHEFgnvh  120
DSSP  -------------------------------LHHHHHHHHHLLLEEEEEEL-LHHHhhhh


DSSP  ---HHHHHHHHHhlLLLLLEEEEEELH--------------HHHHHHHhhLLLLEEllle
Query ---ALKALFELEreGRLKMNVFAYLSP--------------ELLDKLEelNLGKFEgrrl  255
ident                 |                             |    |        
Sbjct gvdGVRWAAKAI--ENLPLRAILLAPScvpsapglerggadFDAAILA--DLLSWP----  172
DSSP  lhhHHHHHHHHH--LLLLLEEEEEELLllllllllllllllLLHHHHH--HHHLLL----


DSSP  EEEEEE-EELLllllllllllllllllllllllllLLLHHH---HHHHHHHHLLLLLEEE
Query RIWGVX-LFVDgslgartallsepytdnpttsgelVMNKDE---IVEVIERAKPLGLDVA  311
ident  | |                                                      | 
Sbjct EIGGIAeIXNX------------------------RGVIERdprXSGIVQAGLAAEKLVC  208
DSSP  LEEEEEeELLH------------------------HHHHLLlhhHHHHHHHHHHHLLEEE


DSSP  EEELLHH--HHHHHHHHHhhhlllLEEEeLLLLLHhHHHHHHHHLLEEEELLLHHHHlll
Query VHAIGDK--AVDVALDAFeeaefsGRIEhASLVRDdQLERIKELKVRISAQPHFIVSdww  369
ident  || | |         |                    |         |            
Sbjct GHARGLKnaDLNAFXAAG-----vSSDH-ELVSGE-DLXAKLRAGLTIELRGSHDHL---  258
DSSP  ELLLLLLhhHHHHHHHLL-----lLEEL-LLLLHH-HHHHHHHLLLEEEEELLLHHH---


DSSP  hhhhhhhhhhhhllLHHHH----hHHLLEEELLLLLL-----lLLLHHHHHHHHHHLlll
Query ivnrvgeerakwayRLKTL----sSITKLGFSTDSPI-----ePADPWVSIDAAVNRyvv  420
ident                   |             ||                    |     
Sbjct -----------lpeFVAALntlghLPQTVTLCTDDVFpddllqGGGLDDVVRRLVRY---  304
DSSP  -----------hhhHHHHHhhhllLLLLEEEELLLLLhhhhhhLLLHHHHHHHHHHL---


DSSP  lhhhLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELlLLLL------------
Query dpgeRVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDrDPLK------------  468
ident         | ||   |   ||     |||    | ||       |               
Sbjct ----GLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFE-DLNGfsarhvlasgra  359
DSSP  ----LLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEL-LLLLlleeeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct vaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetea  419
DSSP  eeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct dvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfgg  479
DSSP  eeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct nagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgk  539
DSSP  lhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------
Query ------------------------------------------------  468
ident                                                 
Sbjct vvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 23: Query=3icjA Sbjct=2imrA Z-score=21.0

back to top
DSSP  -LEEEEElleEEEEElleEEELEEEEELLEEEEEELHHHHHHHHHhhLLEEEELllLEEE
Query -CMKALIngtIYTSFspvKKVSGLVISNERVLYAGDSSTALRIAElaGGEIIDLkgKFVM   59
ident      |     ||         | |   | |  ||      |                  
Sbjct hTPRLLTcdvLYTGA---QSPGGVVVVGETVAAAGHPDELRRQYP--HAAEERA-gAVIA   54
DSSP  lLEEEEEeleEELLE---ELLEEEEEELLEEEEEELHHHHHHHLL--LLEEEEL-lLEEL


DSSP  ELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident |     | |||                                                 
Sbjct PPPVNAHTHLDM------------------------------------------------   66
DSSP  LLLLEEEEELLL------------------------------------------------


DSSP  hhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll
Query dldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
ident                                                             
Sbjct --sayefqalpyfQWIP--------------------------------------evvir   86
DSSP  --lhhhhhhlhhhHLLH--------------------------------------hhhhh


DSSP  llhhhHHHHHHHHHHHHHHLLEEEEEEEEELHHHHHHHHHHhhlllLLLEEEEEELH---
Query ltvkdYKHYIESAQEHLLSLGVHSVGFMSVGEKALKALFELeregrLKMNVFAYLSP---  236
ident                 |  ||   ||          ||               |      
Sbjct grhlrGVAAAQAGADTLTRLGAGGVGDIVWAPEVMDALLAR-----EDLSGTLYFEVlnp  141
DSSP  hllllHHHHHHHHHHHHHHLLLLLEEEEELLHHHHHHHHLL-----LLLLEEEEEEElll


DSSP  ---------hhHHHHhhhLLLL-EELLLEEeEEEE-EELLllllllllllllllllllll
Query ---------elLDKLeelNLGK-FEGRRLRiWGVX-LFVDgslgartallsepytdnptt  285
ident                         |   ||  |                           
Sbjct fpdkadevfaaARTH--lERWRrLERPGLR-LGLSpHTPF--------------------  178
DSSP  lhhhhhhhhhhHHHH--hHHHHlLLLLLEE-EEEEeLLLL--------------------


DSSP  llllLLLHHHHHHHHHHHLLLLLEEEEEEL------------------------------
Query sgelVMNKDEIVEVIERAKPLGLDVAVHAI------------------------------  315
ident                  |   ||    |                                
Sbjct ----TVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyphtla  234
DSSP  ----LLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhh


DSSP  ---------lhHHHHHHH--HHHHhhlLLLEEEELLLLLHHHHHHHHHHLLEEEELLLHH
Query ---------gdKAVDVAL--DAFEeaeFSGRIEHASLVRDDQLERIKELKVRISAQPHFI  364
ident              |                   |   |  |   |           |   
Sbjct evigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVTPDDIARVARAGCAVVTCPRSN  291
DSSP  hhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLLHHHHHHHHHHLLLEEELHHHH


DSSP  HHLLlhhhhhhhhhhhhLLLHHHHHH-HLLEEELLLLL-LLLL-LHHHHHHHHHHLLlll
Query VSDWwivnrvgeerakwAYRLKTLSS-ITKLGFSTDSP-IEPA-DPWVSIDAAVNRYvvd  421
ident                                   |||               |   |   
Sbjct HHLE-----------cgTFDWPAFAAaGVEVALGTDSVaSGETlNVREEVTFARQLY---  337
DSSP  HHLL-----------llLLLHHHHHHlLLLEEELLLLHhHHLLlLLHHHHHHHHHHL---


DSSP  hhhlLLHHHHHHHLLHHHHHHLLlllLLLLLLLL-lllEEEELLllll
Query pgerVSREEALHLYTHGSAQVTLaedLGKLERGF-raeYIILDRdplk  468
ident                 |   |        | ||               
Sbjct --pgLDPRVLVRAAVKGGQRVVG---TPFLRRGEtwqeGFRWELsrdl  380
DSSP  --llLLHHHHHHHHHHHHHHHHL---LLLLLLLLlllhHHLHHHllll


No 24: Query=3icjA Sbjct=2ogjA Z-score=20.3

back to top
DSSP  -LEEEEElLEEEEEELL-EEEE-LEEEEE-LLEEEEEELhhhHHHHhhhHLLEEEELlLL
Query -CMKALInGTIYTSFSP-VKKV-SGLVIS-NERVLYAGDsstALRIaelAGGEIIDLkGK   56
ident      |        |            |         |    ||                
Sbjct qAPILLT-NVKPVGFGKgASQSsTDILIGgDGKIAAVGS---ALQA---PADTQRID-AA   52
DSSP  lLLEEEE-EEEELLLLLlLLLLlEEEEELlLLLEEEEEL---LLLL---LLLEEELL-LL


DSSP  EEEELEEEEEELH-----HHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhh
Query FVMPAFFDSHLHL-----DELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqde  111
ident |  |   | | |      |                                         
Sbjct FISPGWVDLHVHIwhggtDISI--------------------------------------   74
DSSP  EEEELEEEEEELLlllllLLLL--------------------------------------


DSSP  hlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhh
Query lgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreralees  171
ident                                                             
Sbjct ------------------------------------------------------------   74
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllhhhhhhhhhhHHHH-HHHLLEEEEEEEE-ELHHHHHHHHHHHhlLLLLLE
Query rkiinekiltvkdykhyiesAQEH-LLSLGVHSVGFMS-VGEKALKALFELEreGRLKMN  229
ident                              ||         ||       |          
Sbjct --------------------RPSEcGAERGVTTLVDAGsAGEANFHGFREYI-iEPSRER  113
DSSP  --------------------LHHHlLHHHLEEEEEEELlLLLLLHHHHHHHL-lLLLLLE


DSSP  EEEEELHHH-------------------HHHHHHhlLLLEEllleEEEEEEEELLlllll
Query VFAYLSPEL-------------------LDKLEElnLGKFEgrrlRIWGVXLFVDgslga  270
ident   | |                       ||   |      |     | | |         
Sbjct IKAFLNLGSiglvacnrvpelrdikdidLDRILEcyAENSE----HIVGLXVRAS-----  164
DSSP  EEEEEELLLllllllllllllllhhhllHHHHHHhhHLLLL----LEEEEEEEEL-----


DSSP  lllllllllllllllllLLLL---LHHHHHHHHHHHLLLLLEEEEEELL-hhHHHHHHHH
Query rtallsepytdnpttsgELVM---NKDEIVEVIERAKPLGLDVAVHAIG-dkAVDVALDA  326
ident                                    || |     ||        |  |  
Sbjct -----------------HVITgswGVTPVKLGKKIAKILKVPXXVHVGEppaLYDEVLEI  207
DSSP  -----------------HHHHlllLLHHHHHHHHHHHHHLLLEEEEELLlllLHHHHHHH


DSSP  HhhhLLLLEEEELL------LLLH--HHHHHHHHH-LLEEEEL---llHHHHlllhhhhh
Query FeeaEFSGRIEHAS------LVRD--DQLERIKEL-KVRISAQ---phFIVSdwwivnrv  374
ident            |              |           |         |           
Sbjct L---GPGDVVTHCFngksgsSIXEdeDLFNLAERCeGIRLDIGhggasFSFK--------  256
DSSP  L---LLLLEEELLLllllllLLLLlhHHHHHHHHLlLLEEELLlllllLLHH--------


DSSP  hhhhhhhLLLH----HHHHhhllEEELLLLL------LLLLlHHHHHHHHHHLllllhhh
Query geerakwAYRL----KTLSsitkLGFSTDSP------IEPAdPWVSIDAAVNRyvvdpge  424
ident                  |        |||                               
Sbjct -------VAEAaiarGLLP----FSISTDLHghsxnfPVWD-LATTXSKLLSV-------  297
DSSP  -------HHHHhhhlLLLL----LLLLLLLLllllllLLLL-HHHHHHHHHHL-------


DSSP  LLLHHHHHHHLLHHHHHhLLLLLL-lLLLLLLLLLEEEEllLLLL---------------
Query RVSREEALHLYTHGSAQvTLAEDL-gKLERGFRAEYIILdrDPLK---------------  468
ident     |      |   |      |    |  | ||       |                  
Sbjct DXPFENVVEAVTRNPAS-VIRLDXenRLDVGQRADFTVF--DLVDadleatdsngdvsrl  354
DSSP  LLLHHHHHHLLLHHHHH-HLLLLLllLLLLLLLLEEEEE--EEEEeeeeeellllleeee


DSSP  -------------------------
Query -------------------------  468
ident                          
Sbjct krlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeeelleeeellllllll


No 25: Query=3icjA Sbjct=1a4mA Z-score=17.7

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct ------------------------------------------------------tpafNK    6
DSSP  ------------------------------------------------------llllLL


DSSP  LEEEEEELHHHHhhHHHLeellllllhhhhhhhhhlllLLLEeeeeelhhhhlllllhhh
Query AFFDSHLHLDELgmSLEMvdlrgvksmeelvervkkgrGRIIfgfgwdqdelgrwptred  120
ident      | |||                                                  
Sbjct PKVELHVHLDGA--IKPE-----------------tilYFGK------------------   29
DSSP  LEEEEEEEHHHL--LLHH-----------------hhhHHHH------------------


DSSP  hllllLLEEEE-----ELLLleeeelhhhhhhhllllllleelllleeehhhhHHHHHHH
Query ldvidRPVFLY-----RRCFhvavmnskmidllnlkpskdfdestgivreralEESRKII  175
ident                  |                                          
Sbjct ---krGIALPAdtveeLRNI------------------igmdkplslpgflakFDYYMPV   68
DSSP  ---hhLLLLLLllhhhHHHH------------------hlllllllhhhhhllHHHHHHH


DSSP  HHllLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH----------------------HH
Query NEkiLTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE----------------------KA  213
ident           |       |     ||  |                               
Sbjct IA--GCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllanskvdpmpwnqtegdvtpdDV  126
DSSP  HL--LLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhllllllllhhhlllllllhhHH


DSSP  HHHHHHHHhlLLLL----LEEEEEELH---------HHHHHHHhhlLLLEEllleEEEEE
Query LKALFELEreGRLK----MNVFAYLSP---------ELLDKLEelnLGKFEgrrlRIWGV  260
ident                     |   |           | |                     
Sbjct VDLVNQGL--QEGEqafgIKVRSILCCmrhqpswslEVLELCK---KYNQK----TVVAM  177
DSSP  HHHHHHHH--HHHHhhhlLEEEEEEEEelllhhhhhHHHHHHH---HLLLL----LEEEE


DSSP  EEELLLLlllllllllllllllllllLLLLLLHHHHHHHHHHHLLLLLEEEEEEL---LH
Query XLFVDGSlgartallsepytdnpttsGELVMNKDEIVEVIERAKPLGLDVAVHAI---GD  317
ident  |  |                      |        ||  | |   |    |||      
Sbjct DLAGDET-------------------IEGSSLFPGHVEAYEGAVKNGIHRTVHAGevgSP  218
DSSP  EEELLLL-------------------LLLHHHLHHHHHHHHHHHHHLLEEEEEELlllLH


DSSP  HHHHHHHHHHhhhlLLLEEEELLLL--LHHHHHHHHHHLLEEEELLLHHHHLL-lHHHHh
Query KAVDVALDAFeeaeFSGRIEHASLV--RDDQLERIKELKVRISAQPHFIVSDW-wIVNRv  374
ident   |  | |         |  |            |           |              
Sbjct EVVREAVDIL----KTERVGHGYHTieDEALYNRLLKENMHFEVCPWSSYLTGawDPKT-  273
DSSP  HHHHHHHHLL----LLLEEEELHHHhhLHHHHHHHHHLLLEEEELHHHHHHLLllLLLL-


DSSP  hhhhhhhlLLHHHHH-HHLLEEELLLLL--LLLLlHHHHHHHHHHLLlllhhhLLLHHHH
Query geerakwaYRLKTLS-SITKLGFSTDSP--IEPAdPWVSIDAAVNRYvvdpgeRVSREEA  431
ident                         || |                             || 
Sbjct -------tHAVVRFKnDKANYSLNTDDPliFKST-LDTDYQMTKKDM------GFTEEEF  319
DSSP  -------lLHHHHHHhLLLLEEELLLLLllLLLL-HHHHHHHHHHLL------LLLHHHH


DSSP  HHHlLHHHHHHLL-----LLLL--LLLLlllllleeeellllll
Query LHLyTHGSAQVTL-----AEDL--GKLErgfraeyiildrdplk  468
ident   |     |            |                      
Sbjct KRL-NINAAKSSFlpeeeKKELleRLYR-------------eyq  349
DSSP  HHH-HHHHHHLLLllhhhHHHHhhHHHH-------------hll


No 26: Query=3icjA Sbjct=1a5kC Z-score=17.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----lEEEEELLEeEEEElLEEEELEEEEELLEEEEEELH--------HHHHhhHHHHlL
Query ----cMKALINGTiYTSFsPVKKVSGLVISNERVLYAGDS--------STALriAELAgG   48
ident         | |                     |    |           |       |  
Sbjct aadcvDLVLTNAL-IVDH-WGIVKADIGVKDGRIFAIGKAgnpdiqpnVTIP--IGAA-T  115
DSSP  hhhllLEEEEEEE-EEEL-LEEEEEEEEEELLEEEEEELEelllllllLLEE--LLLL-L


DSSP  EEEELLLLEEEELEEEEEELhHHHHhhhhleellllllhhhhhhhhhlllllleeeeeel
Query EIIDLKGKFVMPAFFDSHLHlDELGmslemvdlrgvksmeelvervkkgrgriifgfgwd  108
ident | |   || |     | | |                                        
Sbjct EVIAAEGKIVTAGGIDTHIH-WICP-----------------------------------  139
DSSP  EEEELLLLEEEELEEEEEEE-LLLL-----------------------------------


DSSP  hhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhh
Query qdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreral  168
ident                                                             
Sbjct ------------------------------------------------------------  139
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllhhhhhhhhhHHHHHHHHLLEEEEEE------------EEELH-HHHH
Query eesrkiinekiltvkdykhyieSAQEHLLSLGVHSVGF------------MSVGE-KALK  215
ident                          |  |  ||                           
Sbjct ----------------------QQAEEALVSGVTTMVGggtgpaagthatTCTPGpWYIS  177
DSSP  ----------------------LHHHHHHHHLEEEEEEelllllhhhhhlLLLLHhHHHH


DSSP  HHHHHHhlLLLLLEEEEEELH-----hHHHHHhhhlllleellleeEEEEEEELLlllll
Query ALFELEreGRLKMNVFAYLSP-----eLLDKLeelnlgkfegrrlrIWGVXLFVDgslga  270
ident           |  |              |                   |     |     
Sbjct RMLQAA--DSLPVNIGLLGKGnvsqpdALREQ----------vaagVIGLEIHED-----  220
DSSP  HHHHHH--LLLLLEEEEEEELllllhhHHHHH----------hhhlLLEEEEEHH-----


DSSP  lllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEE---llhhhHHHHHHHH
Query rtallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHA---igdkaVDVALDAF  327
ident                          |      |      || |         |   | | 
Sbjct ------------------wGATPAAIDCALTVADEMDIQVALHSdtlnesgfVEDTLAAI  262
DSSP  ------------------hLLLHHHHHHHHHHHHHHLLEEEEELllllllllHHHHHHHH


DSSP  HhhLLLLEEEELLL----lLHHHHHHHHHHLLEEEELLLHHHHLLLHHHH----------
Query EeaEFSGRIEHASL----vRDDQLERIKELKVRISAQPHFIVSDWWIVNR----------  373
ident           |          |            |                         
Sbjct G--GRTIHTFHTEGaggghAPDIITACAHPNILPSSTNPTLPYTLNTIDEhldmlmvchh  320
DSSP  L--LLLEEELLLLLlllllLLLHHHHHHLLLEEEEEEHHHLLLLLLHHHHhhhhhhhhhl


DSSP  ------------hhhhHHHHL-lLHHHH-HHHLlEEELLLLL-LLLL-LHHHHHHHHHHL
Query ------------vgeeRAKWA-yRLKTL-SSITkLGFSTDSP-IEPA-DPWVSIDAAVNR  417
ident                 |                    | ||                  |
Sbjct ldpdiaedvafaesriRRETIaaEDVLHdLGAF-SLTSSDSQaMGRVgEVILRTWQVAHR  379
DSSP  lllllhhhhhllllllLHHHHhhHHHHHhLLLL-LEEELLLLlLLLLlLHHHHHHHHHHH


DSSP  ---------llllhhhllLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELLLLL
Query ---------yvvdpgervSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDRDPL  467
ident                           ||   |         |  | |  |          
Sbjct mkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAhEVGSIEVGKLADLVVWSPAFF  439
DSSP  hhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLlLLLLLLLLLLLLEEEELHHHL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct gvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaang  499
DSSP  llllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct vaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpm  559
DSSP  hhhhllllleeeellllllllhhhllllllllleeelllllleeelleelllllllllll


DSSP  ------l
Query ------k  468
ident        
Sbjct aqryflf  566
DSSP  lllllll


No 27: Query=3icjA Sbjct=2y1hB Z-score=16.6

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct ----------------------------------------------------------GV    2
DSSP  ----------------------------------------------------------LL


DSSP  LEEEEEELHHH-HHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query AFFDSHLHLDE-LGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident    | | ||                                                   
Sbjct GLVDCHCHLSApDFDRD-------------------------------------------   19
DSSP  LEEEEEELLLLhHHLLL-------------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
ident                                                             
Sbjct ------------------------------------------------------------   19
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhHHHHHHHHHHLLEEEEEEEE----eLHHHHHHHHHHHhlllllLEEEEEEL
Query ltvkdykhyIESAQEHLLSLGVHSVGFMS----vGEKALKALFELEregrlkMNVFAYLS  235
ident               |      |             ||                 |   | 
Sbjct ---------LDDVLEKAKKANVVALVAVAehsgeFEKIMQLSERYN------GFVLPCLG   64
DSSP  ---------HHHHHHHHHHLLEEEEEELLllhhhHHHHHHHHHHLL------LLEEEEEL


DSSP  H-----------------HHHHHHHhhlLLLEEllleeEEEE-EEELLLlllllllllll
Query P-----------------ELLDKLEelnLGKFEgrrlrIWGV-XLFVDGslgartallse  277
ident                     |   |     |                |            
Sbjct VhpvqgldqrsvtlkdldVALPIIE---NYKDR-----LLAIgEVGLDF-----------  105
DSSP  LlleelllleellhhhhhHHHHHHH---HHLLL-----LLEEeEEEEEL-----------


DSSP  llllllllLLLL------llLHHHHHHHHHHHLLLLLEEEEEELLhhHHHHHHHHHHHHL
Query pytdnpttSGEL------vmNKDEIVEVIERAKPLGLDVAVHAIGdkAVDVALDAFEEAE  331
ident                             |  || | | | ||     |         |  
Sbjct -------sPRFAgtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSRS--AGRPTINLLQEQG  156
DSSP  -------lLLLLllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEEL--LHHHHHHHHHHLL


DSSP  LL-LEEEELLLLLHhHHHHHHHHLLEEEELlLHHHHLllhhhhhhhhhhHHLL-LHHHHH
Query FS-GRIEHASLVRDdQLERIKELKVRISAQpHFIVSDwwivnrvgeeraKWAY-RLKTLS  389
ident                            |     |                      | | 
Sbjct AEkVLLHAFDGRPS-VAMEGVRAGYFFSIP-PSIIRS------------GQKQkLVKQLP  202
DSSP  LLlEEEELLLLLHH-HHHHHHHLLLEEEEL-HHHHLL------------HHHHhHHHHLL


DSSP  HhlLEEELLLLLL--------LLLL-HHHHHHHHHHlllllhhhLLLH--HHHHHHLLHH
Query SitKLGFSTDSPI--------EPAD-PWVSIDAAVNryvvdpgeRVSR--EEALHLYTHG  438
ident         ||||                 |                    ||     |  
Sbjct L-tSICLETDSPAlgpekqvrNEPWnISISAEYIAQ--------VKGIsvEEVIEVTTQN  253
DSSP  H-hHEEELLLLLLllllllllLLHHhHHHHHHHHHH--------HHLLlhHHHHHHHHHH


DSSP  HHHHL-LLLLllllllllllleeeellllll
Query SAQVT-LAEDlgklergfraeyiildrdplk  468
ident                                
Sbjct ALKLFpKLRH-------------------ll  265
DSSP  HHHHLlLHHH-------------------hl


No 28: Query=3icjA Sbjct=2ffiA Z-score=15.3

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
ident                                                             
Sbjct ---------------------------------------------------------lhL    3
DSSP  ---------------------------------------------------------llL


DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllLEEEeeelhhhhlllllhhh
Query AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgrIIFGfgwdqdelgrwptred  120
ident    ||| |                                                    
Sbjct TAIDSHAHVF-------------------------srglnLASQ----------------   22
DSSP  LLEELLLLLL-------------------------lhhhhHHLL----------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhHHHHHHhhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleESRKIInekil  180
ident                                                             
Sbjct -------------------------------------------------RRYAPN-----   28
DSSP  -------------------------------------------------LLLLLL-----


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEE------eLHHHHHHHHHHHhllllllEEEEEE
Query tvkdykhYIESAQEHLLSLGVHSVGFMS------vGEKALKALFELEregrlkmNVFAYL  234
ident                |   |                   | ||                 
Sbjct ----ydaPLGDYLGQLRAHGFSHGVLVQpsflgtdNRYLLSALQTVP------gQLRGVV   78
DSSP  ----lllLHHHHHHHHHHLLLLEELLLLlhhhlllLHHHHHHHHHLL------lLLLLLL


DSSP  LHHhhHHHHHhLLLLEEllleEEEEEEEELLLlllllllllllllllllllllLLLLLHH
Query SPEllDKLEElNLGKFEgrrlRIWGVXLFVDGslgartallsepytdnpttsgELVMNKD  294
ident   |                     || |   |                            
Sbjct XLErdVEQATlAEXARL----GVRGVRLNLXG---------------------QDXPDLT  113
DSSP  LLLllLLHHHhHHHHLL----LLLEEELLLLL---------------------LLLLLLL


DSSP  H--hHHHHHHHLLLLLEEEEEElLHHHHHHHHHHHHHHLLLLEEE-ELLL---------L
Query E--iVEVIERAKPLGLDVAVHAiGDKAVDVALDAFEEAEFSGRIE-HASL---------V  342
ident         ||    |  |  |        |   |         |                
Sbjct GaqwRPLLERIGEQGWHVELHR-QVADIPVLVRALQPYGLDIVIDhFGRPdarrglgqpG  172
DSSP  LlllHHHHHHHHHHLLEEEELL-LLLLHHHHHHHHLLLLLLEEELhHHLLlllllllllL


DSSP  LHHH-HHHHhHHLLEEEELlLHHHHLLLHHhhhhhhhhhhllLHHHHHHHL---LEEELL
Query RDDQ-LERIkELKVRISAQpHFIVSDWWIVnrvgeerakwayRLKTLSSIT---KLGFST  398
ident             ||                             |  |        |    
Sbjct FAELlTLSG-RGKVWVKVS-GIYRLQGSPE----enlafarqALCALEAHYgaeRLXWGS  226
DSSP  HHHHlLLLL-LLLEEEEEE-LHHHLLLLHH----hhhhhhhhHHHHHHHHLlhhHEEEEL


DSSP  LLLL------LLLL-HHHHHHHHHhlllllhhhlLLHHHHHHHLLHHHHHhLLLLLLlll
Query DSPI------EPAD-PWVSIDAAVnryvvdpgerVSREEALHLYTHGSAQvTLAEDLgkl  451
ident | |                  |             |      |             |   
Sbjct DWPHtqheseVSFGsAVEQFEALG----------CSAQLRQALLLDTARA-LFGFEL---  272
DSSP  LLLLllllllLLHHhHHHHHHHHL----------LLHHHHHHHHLHHHHH-HLLLLL---


DSSP  llllllleeeellllll
Query ergfraeyiildrdplk  468
ident                  
Sbjct ----------------e  273
DSSP  ----------------l


No 29: Query=3icjA Sbjct=3cjpA Z-score=15.2

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    | | |                                                    
Sbjct LIIDGHTHVIL-------------------------------------------------   11
DSSP  LLEEEEEELLL-------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct ------------------------------------------------------------   11
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEEE-------------------------------
Query tvkdykhYIESAQEHLLSLGVHSVGFMSV-------------------------------  209
ident          |         ||      |                                
Sbjct -------PVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngktnsm   64
DSSP  -------LHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllllll


DSSP  ------LHHHHHHHHHHhhlllLLLEEEEEELHH----------HHHHHhhhlLLLEell
Query ------GEKALKALFELeregrLKMNVFAYLSPE----------LLDKLeelnLGKFegr  253
ident         | |                                                 
Sbjct idvrrnSIKELTNVIQA-----YPSRYVGFGNVPvglsendtnsYIEEN---iVNNK---  113
DSSP  hhhhhhHHHHHHHHHHH-----LLLLEEEEELLLllllhhhhhhHHHHH---lLLLL---


DSSP  leeEEEEE-EELLlllllllllllllllllllllllLLLLHhHHHHHHHHHLLLL-LEEE
Query rlrIWGVX-LFVDgslgartallsepytdnpttsgeLVMNKdEIVEVIERAKPLG-LDVA  311
ident      |   |                              |             | |   
Sbjct ---LVGIGeLTPA-----------------------SGQIK-SLKPIFKYSMDSGsLPIW  146
DSSP  ---LLEEEeELLL-----------------------LLLHH-HHHHHHHHHHHLLlLLEE


DSSP  EEEL---LHHHHHHHHHHHHHHL-LLLEEEE-LLLLLHHHHHHHHHHL-LEEEELllHHH
Query VHAI---GDKAVDVALDAFEEAE-FSGRIEH-ASLVRDDQLERIKELK-VRISAQphFIV  365
ident  ||                           |          |  ||              
Sbjct IHAFnplVLQDIKEIAELCKAFPkVPVILGHmGGSNWMTAVELAKEIQnLYLDTS--AYF  204
DSSP  ELLLlllLHHHHHHHHHHHHHLLlLLEEEHHhHHHHHHHHHHHHHHLLlEEEELL--LLL


DSSP  HlllhhhhhhhhhhhhllLHHHHHHHL--LEEELLLLLLLLLLhhHHHHHHHHlllllhh
Query SdwwivnrvgeerakwayRLKTLSSIT--KLGFSTDSPIEPADpwVSIDAAVNryvvdpg  423
ident |                  ||        |  | || |        || |          
Sbjct S---------------tfVLKIVINELplKCIFGTDMPFGDLQ--LSIEAIKK-------  240
DSSP  L---------------hhHHHHHHHHLllLEELLLLLLLLLHH--HHHHHHHH-------


DSSP  hLLLHH-HHHHHLLHHHHHhlLLLLllllllllllleeeellllll
Query eRVSRE-EALHLYTHGSAQvtLAEDlgklergfraeyiildrdplk  468
ident         |            |                        
Sbjct -MSNDSyVANAVLGDNISR--LLNI---------------------  262
DSSP  -HLLLHhHHHHHHLHHHHH--HHLL---------------------


No 30: Query=3icjA Sbjct=3gg7A Z-score=15.1

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELHHHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    | | |||                                                  
Sbjct SLIDFHVHLDLYP-----------------------------------------------   13
DSSP  LLEEEEELHHHLL-----------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct ------------------------------------------------------------   13
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhHHHHHHHHHHHLLEeEEEEEEE----LHHHHHHHHhhhhlllLLLEEEEEELH
Query tvkdykhYIESAQEHLLSLGVhSVGFMSV----GEKALKALFeleregrLKMNVFAYLSP  236
ident                        |             |               |   |  
Sbjct -------DPVAVARACEERQL-TVLSVTTtpaaWRGTLALAA-------GRPHVWTALGF   58
DSSP  -------LHHHHHHHHHHLLL-EEEELLLlhhhHHHHHHHHL-------LLLLEEELLLL


DSSP  -------------HHHHhhhhhlLLLEellleeEEEEE-EELLLllllllllllllllll
Query -------------ELLDkleelnLGKFegrrlrIWGVX-LFVDGslgartallsepytdn  282
ident                                     |     ||                
Sbjct hpevvseraadlpWFDR------YLPE------TRFVGeVGLDG----------------   90
DSSP  lhhhllllhhhlhHHHH------HHHH------LLEEEeEELLL----------------


DSSP  lllLLLL---llLHHHHHHHHHHHLLLL-LEEEEEELLhhHHHHHHHHHHHHLL--LLEE
Query pttSGEL---vmNKDEIVEVIERAKPLG-LDVAVHAIGdkAVDVALDAFEEAEF--SGRI  336
ident                       |    |      |     |    |   |          
Sbjct --sPSLRgtwtqQFAVFQHILRRCEDHGgRILSIHSRR--AESEVLNCLEANPRsgTPIL  146
DSSP  --lHHHHhhhhhHHHHHHHHHHHHHHLLlEEEEEELLL--LHHHHHHHHHHLHHheEEEE


DSSP  EELLlLLHHHHHHHHHHLLEEEELLLHHHhlllhhhhhhhhhhHHLL-LHHHHHHhlLEE
Query EHASlVRDDQLERIKELKVRISAQPHFIVsdwwivnrvgeeraKWAY-RLKTLSSitKLG  395
ident    |      | |   |    |  |                                   
Sbjct HWYS-GSVTELRRAISLGCWFSVGPTMVR-------------tQKGAaLIRSMPR-dRVL  191
DSSP  ELLL-LLHHHHHHHHHLLLEEEELHHHHL-------------lHHHHhHHHHLLH-hHEE


DSSP  ELLLLL-------LLLL-LHHHHHHHHHHlllllhhHLLL-HHHHHHHLLHHHHHhlLLL
Query FSTDSP-------IEPA-DPWVSIDAAVNryvvdpgERVS-REEALHLYTHGSAQvtLAE  446
ident   || |            |                        |             |  
Sbjct TETDGPfleldgqAALPwDVKSVVEGLSK-------IWQIpASEVERIVKENVSR--LLG  242
DSSP  ELLLLLlleelleELLHhHHHHHHHHHHH-------HHLLlHHHHHHHHHHHHHH--HHH


DSSP  Lllllllllllleeeellllll
Query Dlgklergfraeyiildrdplk  468
ident                       
Sbjct T---------------------  243
DSSP  L---------------------


No 31: Query=3icjA Sbjct=4dlfA Z-score=14.7

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
ident                                                             
Sbjct -----------------------------------------------------------A    1
DSSP  -----------------------------------------------------------L


DSSP  LEEEEEELHHhhhhhhHLEEllllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDelgmslEMVDlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    ||| |                                                    
Sbjct LRIDSHQHFW------RYRA----------------------------------------   15
DSSP  LLEEEEELLL------LLLH----------------------------------------


DSSP  hlllllleeeeELLLLeeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflyRRCFHvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct -----adypwiGAGMG--------------------------------------------   26
DSSP  -----hhllllLLLLH--------------------------------------------


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEE------ELHHHHHHHHHhhhlllLLLEEEEEE
Query tvkdykhYIESAQEHLLSLGVHSVGFMS------VGEKALKALFEleregrLKMNVFAYL  234
ident                                        |                    
Sbjct -vlardyLPDALHPLMHAQALGASIAVQaragrdETAFLLELACD------EARIAAVVG   79
DSSP  -hhllllLHHHHHHHHHHLLLLEEEEELllllhhHHHHHHHHHLL------LLLEEEEEE


DSSP  LHH-----hHHHHHhhlLLLEEllleEEEEEEEELLLllllllllllllllllllllLLL
Query SPE-----lLDKLEelnLGKFEgrrlRIWGVXLFVDGslgartallsepytdnpttsGEL  289
ident                              |                              
Sbjct WEDlrapqlAERVA---EWRGT----KLRGFRHQLQD--------------------EAD  112
DSSP  LLLlllllhHHHHH---LLLLL----LEEEEEELHHH--------------------LLL


DSSP  L-lLHHH--HHHHHHHHLLLLLEEEEEELLHHhHHHHHHHHHHHLL-LLEEE-ELLL---
Query V-mNKDE--IVEVIERAKPLGLDVAVHAIGDKaVDVALDAFEEAEF-SGRIE-HASL---  341
ident |    |                   |                                  
Sbjct VraFVDDadFARGVAWLQANDYVYDVLVFERQ-LPDVQAFCARHDAhWLVLDhAGKPala  171
DSSP  HhhHHHLhhHHHHHHHHHHLLLEEEELLLHHH-HHHHHHHHHHLLLlLEEEHhHHLLlhh


DSSP  ----------lLHHH-HHHHHHHLLEEEELllHHHHLL----LHHHhhhhhhhhhllLHH
Query ----------vRDDQ-LERIKELKVRISAQphFIVSDW----WIVNrvgeerakwayRLK  386
ident                  |      |                                 | 
Sbjct efdrddtalarWRAAlRELAALPHVVCKLS-gLVTEADwrrgLRAS----dlrhieqCLD  226
DSSP  hllllllhhhhHHHHhHHHHLLLLEEEEEL-lLLLLLLllllLLHH----hhhhhhhHHH


DSSP  HHHHHL---LEEELLLLLL----LLLL--HHHHHHHHHHlllllhhhLLLHHHHHHHLLH
Query TLSSIT---KLGFSTDSPI----EPAD--PWVSIDAAVNryvvdpgeRVSREEALHLYTH  437
ident           | |  | |        |         |          | |  |   |   
Sbjct AALDAFgpqRLMFGSDWPVcllaASYDevASLVERWAES--------RLSAAERSALWGG  278
DSSP  HHHHHHlhhHEEELLLLLHhhhlLLHHhhHHHHHHHHHH--------HLLHHHHHHHLLH


DSSP  HHHHHLLLLlllllllllllleeeellllll
Query GSAQVTLAEdlgklergfraeyiildrdplk  468
ident   |                            
Sbjct TAARCYALP----------------------  287
DSSP  HHHHHLLLL----------------------


No 32: Query=3icjA Sbjct=3pnuA Z-score=14.6

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelLLLE-EE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlKGKF-VM   59
ident                                                             
Sbjct ------------------------------------------------enlyfQSNAmKL   12
DSSP  ------------------------------------------------lllllLLLLeEE


DSSP  ELEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query PAFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident     | ||||                                                  
Sbjct KNPLDMHLHLR-------------------------------------------------   23
DSSP  ELLEEEEELLL-------------------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
ident                                                             
Sbjct ------------------------------------------------------------   23
DSSP  ------------------------------------------------------------


DSSP  llhhhHHHHHHHHHHHHHHlLEEEEEEEE-----ELHH-HHHHHHHHHhlLLLL----LE
Query ltvkdYKHYIESAQEHLLSlGVHSVGFMS-----VGEK-ALKALFELEreGRLK----MN  229
ident           |                |            |||                 
Sbjct -----DNQMLELIAPLSAR-DFCAAVIMPnlippLCNLeDLKAYKMRI--LKACkdenFT   75
DSSP  -----LHHHHHHHHHHHHL-LLLEEEELLlllllLLLHhHHHHHHHHH--HHHHllllLE


DSSP  EEEEELHH--hHHHHHhhlLLLEEllleeEEEEEEELLLLllllllllllllllllllll
Query VFAYLSPE--lLDKLEelnLGKFEgrrlrIWGVXLFVDGSlgartallsepytdnpttsg  287
ident     |         |      | |     | | ||   |                     
Sbjct PLMTLFFKnydEKFLY---SAKDE-----IFGIXLYPAGI--------------ttnsng  113
DSSP  EEEEEELLlllHHHHH---HHLLL-----LLEEEELLLLL--------------llllll


DSSP  llLLLHH-HHHHHHHHHLLLLLEEEEEEL--------LHHHHHHHHHHHHHHL-LLLEEE
Query elVMNKD-EIVEVIERAKPLGLDVAVHAI--------GDKAVDVALDAFEEAE-FSGRIE  337
ident               |    |     ||                                |
Sbjct gvSSFDIeYLKPTLEAMSDLNIPLLVHGEtndfvmdrESNFAKIYEKLAKHFPrLKIVME  173
DSSP  llLLLLHhHHHHHHHHHHHLLLLEEELLLllllhhhlLHHHHHHHHHHHHHLLlLLEEEL


DSSP  ELLLLLhhHHHHHHHHL-LEEEELLLHHHhLLLHHH-----------hhhhhHHHHL-lL
Query HASLVRddQLERIKELK-VRISAQPHFIVsDWWIVN-----------rvgeeRAKWA-yR  384
ident |         |  |           |                          |       
Sbjct HITTKT--LCELLKDYEnLYATITLHHLI-ITLDDViggkmnphlfckpiakRYEDKeaL  230
DSSP  LLLLHH--HHHHHHHLLlEEEEELLHHHL-LLHHHHhlllllhhhlllllllLHHHHhhH


DSSP  HHH-hHHHLLEEELLLLL---------LLLL-LHHHHHHHHHHlllllhhhLLLHHHHHH
Query LKT-lSSITKLGFSTDSP---------IEPA-DPWVSIDAAVNryvvdpgeRVSREEALH  433
ident      |   |  |  ||             |                      | |    
Sbjct CELafSGYEKVMFGSDSAphpkgcaagVFSApVILPVLAELFK-------qNSSEENLQK  283
DSSP  HHHhhLLLLLEEELLLLLlllllllllLLLHhHHHHHHHHHHH-------hHLLHHHHHH


DSSP  HLLHHHHHHlLLLLLllllllLLLLEEEELLL---------------------------l
Query LYTHGSAQVtLAEDLgklergFRAEYIILDRD---------------------------p  466
ident                             |                               
Sbjct FLSDNTCKI-YDLKF------KEDKILTLEEKewqvpnvyedkynqvvpymageilkfql  336
DSSP  HHLHHHHHH-HLLLL------LLLLEEEEELLleelllleelllleellllllleellee


DSSP  ll
Query lk  468
ident   
Sbjct kh  338
DSSP  ll


No 33: Query=3icjA Sbjct=2ob3A Z-score=14.5

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ---------------------------------------------drintvrgpitisea   15
DSSP  ---------------------------------------------lleeelleeelhhhh


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident  |   | |                                                    
Sbjct GFTLTHEHICG-------------------------------------------------   26
DSSP  LLEEEEELLEE-------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHHHLLL
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIINEKIL  180
ident                                                             
Sbjct --------------------------------------------------sSAGFLRAWP   36
DSSP  --------------------------------------------------lLLLHHHHLH


DSSP  ----LHHHHHHHHHHHHHHHHHLLEEEEEEEEEL--hhHHHHHHHHHhlLLLLLEEEEEE
Query ----TVKDYKHYIESAQEHLLSLGVHSVGFMSVG--ekALKALFELEreGRLKMNVFAYL  234
ident       |                ||      |          | |            |  
Sbjct effgSRKALAEKAVRGLRRARAAGVRTIVDVSTFdigrDVSLLAEVS--RAADVHIVAAT   94
DSSP  hhhlLHHHHHHHHHHHHHHHHHLLLLEEEELLLHhhllLHHHHHHHH--HHHLLEEELEE


DSSP  LH------------------HHHHHHHHhlllleellleeEEEEEEELLlllllllllll
Query SP------------------ELLDKLEElnlgkfegrrlrIWGVXLFVDgslgartalls  276
ident                       |                     |               
Sbjct GLwfdpplsmrlrsveeltqFFLREIQY----giedtgirAGIIXVATT-----------  139
DSSP  ELlllllhhhhlllhhhhhhHHHHHHHL----llllllllLLEEEEELL-----------


DSSP  lllllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEELLH-HHHHHHHHHHHH-HLL
Query epytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAIGD-KAVDVALDAFEE-AEF  332
ident                                 |  |  |              ||     
Sbjct -----------GKATpfQELVLKAAARASLATGVPVTTHTAASqRDGEQQAAIFESeGLS  188
DSSP  -----------LLLLhhHHHHHHHHHHHHHHHLLLEEEELLHHhLHHHHHHHHHHHlLLL


DSSP  L--LEEEEL-LLLLHHHHHHHHHHLLEEEE-LLLH-----------hhhLLLHhhhhhhh
Query S--GRIEHA-SLVRDDQLERIKELKVRISA-QPHF-----------ivsDWWIvnrvgee  377
ident      | |         |         |                                
Sbjct PsrVCIGHSdDTDDLSYLTALAARGYLIGLdHIPYsaiglednasasalLGIR------s  242
DSSP  HhhEEELLHhHLLLHHHHHHHHHLLLEEEElLLLLllllllllhhhhhhHLLL------l


DSSP  hhhhlLLHHHHH---HHLLEEELLLLL------------------llLLLH--HHHHHHH
Query rakwaYRLKTLS---SITKLGFSTDSP------------------iePADP--WVSIDAA  414
ident         | |           | |                               |   
Sbjct wqtraLLIKALIdqgYMKQILVSNDWTfgfssyvtnimdvmdrvnpdGMAFipLRVIPFL  302
DSSP  hhhhhHHHHHHHhllLHHHEEELLLLLleellllllhhhhhhhhlllHHHHhhHLHHHHH


DSSP  HHLllllhhhLLLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll
Query VNRyvvdpgeRVSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
ident            |  |          |                            
Sbjct REK-------GVPQETLAGITVTNPARFLS--------------------ptlr  329
DSSP  HHL-------LLLHHHHHHHHLHHHHHHHL--------------------llll


No 34: Query=3icjA Sbjct=1bf6A Z-score=14.3

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
ident                                                             
Sbjct -------------------------------------------------------sfdpT    5
DSSP  -------------------------------------------------------llllL


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident      | ||                                                   
Sbjct GYTLAHEHLHI-------------------------------------------------   16
DSSP  LEEEEEELLLE-------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhHHHHhHHHHhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraLEESrKIINekil  180
ident                                                             
Sbjct --------------------------------------------dlsGFKN-NVDC----   27
DSSP  --------------------------------------------elhHHHL-LHHH----


DSSP  lhhhHHHHHHHHHHHHHHLLEEEEEEEEEL--HHHHHHHHHHHhlLLLLLEEEEEELH--
Query tvkdYKHYIESAQEHLLSLGVHSVGFMSVG--EKALKALFELEreGRLKMNVFAYLSP--  236
ident         |      |   ||  |  |                       || |      
Sbjct -rldQYAFICQEMNDLMTRGVRNVIEMTNRymGRNAQFMLDVM--RETGINVVACTGYyq   84
DSSP  -eelLHHHHHHHHHHHHHLLEEEEEELLLHhhLLLHHHHHHHH--HHHLLEEEEEELLll


DSSP  ------------------HHHHHHHHhlllleellleeEEEEE-EELLLlllllllllll
Query ------------------ELLDKLEElnlgkfegrrlrIWGVX-LFVDGslgartallse  277
ident                   |  |  |                                   
Sbjct daffpehvatrsvqelaqEMVDEIEQ----gidgtelkAGIIAeIGTSE-----------  129
DSSP  hhhlllhhhhllhhhhhhHHHHHHHL----llllllllEEEEEeEELLL-----------


DSSP  llllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEELLHHHHHHHHHHHHH-HLLL-
Query pytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAIGDKAVDVALDAFEE-AEFS-  333
ident                                |     |          |           
Sbjct ----------GKITplEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAhGVDLs  179
DSSP  ----------LLLLhhHHHHHHHHHHHHHHHLLLEEEELHHHLLHHHHHHHHHHlLLLHh


DSSP  -LEEEELL--LLLHhHHHHHHHHLLEEEE-LLLHhhhLLLHhhhhhhhhhhhllLHHHHH
Query -GRIEHAS--LVRDdQLERIKELKVRISA-QPHFivsDWWIvnrvgeerakwayRLKTLS  389
ident      |       |        |                                |  | 
Sbjct rVTVGHCDlkDNLD-NILKMIDLGAYVQFdTIGK---NSYY------pdekriaMLHALR  229
DSSP  hEEELLLLllLLHH-HHHHHHHLLLEEEElLLLL---LLLL------lhhhhhhHHHHHH


DSSP  ---HHLLEEELLLLL----------llLLLHH-HHHHHHHHLllllhhhLLLHHHHHHHL
Query ---SITKLGFSTDSP----------iePADPW-VSIDAAVNRyvvdpgeRVSREEALHLY  435
ident           | |                      |               |        
Sbjct drgLLNRVMLSMDITrrshlkanggygYDYLLtTFIPQLRQS-------GFSQADVDVML  282
DSSP  hllLHHHEEELLLLLlhhhlhhhllllLLHHHhLHHHHHHHL-------LLLHHHHHHHH


DSSP  LHHHHHHLLlllllllllllllleeeellllll
Query THGSAQVTLaedlgklergfraeyiildrdplk  468
ident      |                           
Sbjct RENPSQFFQ------------------------  291
DSSP  LHHHHHHLL------------------------


No 35: Query=3icjA Sbjct=3irsA Z-score=14.2

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
ident                                                             
Sbjct -----------------------------------------------------------L    1
DSSP  -----------------------------------------------------------L


DSSP  LEEEEEELHHH--------------------------hhHHHHLeellllllhhhhhhhh
Query AFFDSHLHLDE--------------------------lgMSLEMvdlrgvksmeelverv   94
ident    |  |                                   |                 
Sbjct KIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapSAEEK----------------   45
DSSP  LLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhHHHHL----------------


DSSP  hlllllleeeeeelhhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllll
Query kkgrgriifgfgwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpsk  154
ident                                                             
Sbjct ------------------------------------------------------------   45
DSSP  ------------------------------------------------------------


DSSP  leelllleeehhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEEEEE-----
Query dfdestgivreraleesrkiinekiltvkdykhYIESAQEHLLSLGVHSVGFMSV-----  209
ident                                    |   |     |              
Sbjct ---------------------------------SLELMFEEMAAAGIEQGVCVGRnssvl   72
DSSP  ---------------------------------LHHHHHHHHHHLLLLEEEEELLeelll


DSSP  ----LHHHHHHHHHHHhlllllLEEEEEELHH---------HHHHHHHhlllleelllee
Query ----GEKALKALFELEregrlkMNVFAYLSPE---------LLDKLEElnlgkfegrrlr  256
ident                              | |                            
Sbjct gsvsNADVAAVAKAYP------DKFHPVGSIEaatrkeamaQMQEILD----------lg  116
DSSP  eellHHHHHHHHHHLL------LLEEEEEELLlllhhhhhhHHHHHHH----------ll


DSSP  EEEEEEELLLllllllllllllllllllllllLLLLHH-HHHHHHHHHLLLLLEEEEEEL
Query IWGVXLFVDGslgartallsepytdnpttsgeLVMNKD-EIVEVIERAKPLGLDVAVHAI  315
ident |  | |                               |             |  |     
Sbjct IRIVNLEPGV-------------------watPMHVDDrRLYPLYAFCEDNGIPVIMMTG  157
DSSP  LLLEEELHHH-------------------lllLLLLLLhHHHHHHHHHHHLLLLEEEELL


DSSP  --------LHHHhHHHHHHHHHHL-LLLEEEEL-LLLLHHHHHHHHHHL-LEEEELlLHH
Query --------GDKAvDVALDAFEEAE-FSGRIEHA-SLVRDDQLERIKELK-VRISAQpHFI  364
ident                                |                     |      
Sbjct gnagpditYTNP-EHIDRVLGDFPdLTVVSSHGnWPWVQEIIHVAFRRPnLYLSPD-MYL  215
DSSP  llllllhhHHLH-HHHHHHHHHLLlLLEEEEHHhLLLHHHHHHHHHHLLlEEEELH-HHH


DSSP  HHLllhhhhhhhhhhHHLL-LHHHHHHHL--LEEELLLLLLLLLL--HHHHHHHhhhlll
Query VSDwwivnrvgeeraKWAY-RLKTLSSIT--KLGFSTDSPIEPAD--PWVSIDAavnryv  419
ident                           |       | |  |  |                 
Sbjct YNL------------PGHAdFIQAANSFLadRMLFGTAYPMCPLKeyTEWFLTL------  257
DSSP  LLL------------LLHHhHHHHHLLHHhhLLLLLLLLLLLLHHhhHHHHHLL------


DSSP  llhhhLLLHHHHHHHLLHHHHHhlLLLLllllllllllleeeellllll
Query vdpgeRVSREEALHLYTHGSAQvtLAEDlgklergfraeyiildrdplk  468
ident                         |                        
Sbjct -----PIKPDAMEKILHGNAER--LLAQ------------------agr  281
DSSP  -----LLLHHHHHHHHLHHHHH--HHHH------------------lll


No 36: Query=3icjA Sbjct=3k2gB Z-score=14.2

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ---------------------------------slselspchvrsgrixtvdgpipssal   27
DSSP  ---------------------------------llllllllllllleeeelleeeehhhl


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleEEEEElhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriiFGFGWdqdelgrwptred  120
ident      | ||                                                   
Sbjct GHTLXHEHLQN-----------dcrcwwnppqeperqylaeaPISIE-------------   63
DSSP  LLEELLLLLLE-----------elhhhllllllhhhhhhhhlLLLHH-------------


DSSP  hlllllleeeEELLLleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflYRRCFhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct ----------ILSEL-----------------------------------rqdpfvnkhn   78
DSSP  ----------HHHHH-----------------------------------hllhhhllll


DSSP  lhhHHHHHHHHHHHHHHHLLEEEEEEEEEL--hhHHHHHHHHHhlLLLLLEEEEEELH--
Query tvkDYKHYIESAQEHLLSLGVHSVGFMSVG--ekALKALFELEreGRLKMNVFAYLSP--  236
ident    |               |  |               |            |        
Sbjct ialDDLDLAIAEVKQFAAVGGRSIVDPTCRgigrDPVKLRRIS--AETGVQVVXGAGYyl  136
DSSP  leeLLHHHHHHHHHHHHHLLLLEEEELLLLllllLHHHHHHHH--HHHLLEEEELLLLll


DSSP  ------------------HHHHHHHHHlllleellleeEEEEE-EELLllllllllllll
Query ------------------ELLDKLEELnlgkfegrrlrIWGVX-LFVDgslgartallse  277
ident                   |      |            |       |             
Sbjct assxpetaarlsaddiadEIVAEALEG----tdgtdarIGLIGeIGVS------------  180
DSSP  hhhllhhhhlllhhhhhhHHHHHHHLL----lllllllLLLEEeELLL------------


DSSP  lllllllllLLLL-lLHHHHHHHHHHHLLLLLEEEEEE-LLHHHHHHHHHHHHH-HLLL-
Query pytdnpttsGELV-mNKDEIVEVIERAKPLGLDVAVHA-IGDKAVDVALDAFEE-AEFS-  333
ident                               ||   ||           ||  ||      
Sbjct ---------SDFTaeEEKSLRGAARAQVRTGLPLXVHLpGWFRLAHRVLDLVEEeGADLr  231
DSSP  ---------LLLLhhHHHHHHHHHHHHHHHLLLEEELLlLLLLLHHHHHHHHHHlLLLHh


DSSP  -LEEEELLLL--LHHHHHHHHHHLLEEEE-LLLHhhHLLLhHHHH-hhhhhhhllLHHHH
Query -GRIEHASLV--RDDQLERIKELKVRISA-QPHFivSDWWiVNRV-geerakwayRLKTL  388
ident      |                                      |              |
Sbjct hTVLCHXNPShxDPVYQATLAQRGAFLEFdXIGX--DFFYaDQGVqcpsddevarAILGL  289
DSSP  hEEELLLHHHllLHHHHHHHHHHLLEEEElLLLL--LLEElLLLEelllhhhhhhHHHHH


DSSP  H---HHLLEEELLLLL---------lLLLL--HHHHHHHHHHLllllhhhLLLHHHHHHH
Query S---SITKLGFSTDSP---------iEPAD--PWVSIDAAVNRyvvdpgeRVSREEALHL  434
ident            | |                                             |
Sbjct AdhgYLDRILLSHDVFvkxxltryggNGYAfvTKHFLPRLRRH-------GLDDAALETL  342
DSSP  HhllLHHHEEELLLLLlhhhlhhhllLLLLhhHHLHHHHHHHL-------LLLHHHHHHH


DSSP  LLHHHHHHlLLLLllllllllllleeeellllll
Query YTHGSAQVtLAEDlgklergfraeyiildrdplk  468
ident        |                          
Sbjct XVTNPRRV-FDAS-----------------iegh  358
DSSP  HLHHHHHH-HLLL-----------------llll


No 37: Query=3icjA Sbjct=2vc5A Z-score=13.7

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct --------------------------------------------mriplvgkdsieskdi   16
DSSP  --------------------------------------------llllllllllllhhhl


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident  |   | ||                                                   
Sbjct GFTLIHEHLRV-------------------------------------------------   27
DSSP  LLEELLLLLLL-------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHH--hhL
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKII--neK  178
ident                                                             
Sbjct -------------------------------------------------fsEAVRqqwpH   38
DSSP  -------------------------------------------------llHHHHhhlhH


DSSP  LLLHHHHHHHHHHHHHHHHHLLEEEEEEEEEL--hhHHHHHHHHHhlLLLLLEEEEEELH
Query ILTVKDYKHYIESAQEHLLSLGVHSVGFMSVG--ekALKALFELEreGRLKMNVFAYLSP  236
ident                      ||       |                     |  |    
Sbjct LYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMglgrDIRFMEKVV--KATGINLVAGTGI   96
DSSP  HLLHHHHHHHHHHHHHHHHHLLLLEEEELLLLllllLHHHHHHHH--HLLLLEEEELEEL


DSSP  --------------------HHHHHHHHhlllleellleeEEEEEEELLLllllllllll
Query --------------------ELLDKLEElnlgkfegrrlrIWGVXLFVDGslgartalls  276
ident                            |               ||   |           
Sbjct yiyidlpfyflnrsideiadLFIHDIKE----giqgtlnkAGFVXIAADE----------  142
DSSP  lllllllhhhllllhhhhhhHHHHHHHL----llllllllLLLEEEELLL----------


DSSP  lllllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEELLH-HHHHHHHHHHHHHLLL
Query epytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAIGD-KAVDVALDAFEEAEFS  333
ident                      |       |        |                |    
Sbjct -----------PGITkdVEKVIRAAAIANKETKVPIITHSNAHnNTGLEQQRILTEEGVD  191
DSSP  -----------LLLLhhHHHHHHHHHHHHHHHLLLEEEELLLLlLHHHHHHHHHHHLLLL


DSSP  ---LEEEEL-LLLLHHHHHHHHHHLLEEEE-LLLH----HHHLllhhhhhhhhhhhhllL
Query ---GRIEHA-SLVRDDQLERIKELKVRISA-QPHF----IVSDwwivnrvgeerakwayR  384
ident      | |       |    |      |            |                   
Sbjct pgkILIGHLgDTDNIDYIKKIADKGSFIGLdRYGLdlflPVDK-------------rneT  238
DSSP  hhhEEELLHhHLLLHHHHHHHHHLLLEEEElLLLLllllLHHH-------------hhhH


DSSP  HHHHH---HHLLEEELLLLL-------------------LLLLLHH-HHHHHHHHLllll
Query LKTLS---SITKLGFSTDSP-------------------IEPADPW-VSIDAAVNRyvvd  421
ident    |       |   | |                               |          
Sbjct TLRLIkdgYSDKIMISHDYCctidwgtakpeykpklaprWSITLIFeDTIPFLKRN----  294
DSSP  HHHHHhllLLLLEEELLLLLlllllllllhhhhhhhlllLLLLHHHhLHHHHHHLL----


DSSP  hhhLLLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll
Query pgeRVSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
ident     |  |                                       
Sbjct ---GVNEEVIATIFKENPKKFFS------------------------  314
DSSP  ---LLLHHHHHHHHLHHHHHHLL------------------------


No 38: Query=3icjA Sbjct=4mupB Z-score=13.6

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct --------------------------------------------lvrklsgtapnpafPR   16
DSSP  --------------------------------------------llllllllllllllLL


DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    |   |                                                    
Sbjct GAVDTQMHMY--------------------------------------------------   26
DSSP  LLEELLLLLL--------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhHHHL--
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiINEK--  178
ident                                                             
Sbjct --------------------------------------------------lpgyPALPgg   36
DSSP  --------------------------------------------------llllLLLLll


DSSP  lllhhhhhHHHHHHHHHHHHLLEEEEEEEEE------LHHHHHHHHHhhhlllLLLEEEE
Query iltvkdykHYIESAQEHLLSLGVHSVGFMSV------GEKALKALFEleregrLKMNVFA  232
ident            |        ||   |               |    |            |
Sbjct pglppgalPGPEDYRRLMQWLGIDRVIITQGnahqrdNGNTLACVAE------MGEAAHA   90
DSSP  llllllllLLHHHHHHHHHHHLLLEEEEELLhhhlllLHHHHHHHHH------HHHHEEE


DSSP  EELHHhhHHHHhHLLL-LEELlleEEEEEEEELLLlllllllllllllllllllllllLL
Query YLSPEllDKLEeLNLG-KFEGrrlRIWGVXLFVDGslgartallsepytdnpttsgelVM  291
ident           |                |                              | 
Sbjct VVIID-aTTTE-KDMEkLTAA---GTVGARIMDLP--------------------ggaVN  125
DSSP  EELLL-lLLLH-HHHHhHHHL---LEEEEEEELLL--------------------lllLL


DSSP  LHhHHHHHHHHHLLLLLEEEEEELLHHHHHHhHHHHHHHLLLLEEE-ELLL--------l
Query NKdEIVEVIERAKPLGLDVAVHAIGDKAVDVaLDAFEEAEFSGRIE-HASL--------v  342
ident    |   | |||      |||   |    |  |              |            
Sbjct LS-ELDAVDERAHAADWMVAVQFDGNGLLDH-LPRLQKIRSRWVFDhHGKFfkgirtdgp  183
DSSP  HH-HHHHHHHHHHHLLLEEEEELLHHHHHHH-HHHHHLLLLEEEELhHHHLllllllllh


DSSP  LHHH-HHHHHHHLLEEEELlLHHHhLLLHhhhhhhhhhHHLL-LHHHHHHHL--LEEELL
Query RDDQ-LERIKELKVRISAQpHFIVsDWWIvnrvgeeraKWAY-RLKTLSSIT--KLGFST  398
ident      |  |                                                  |
Sbjct EMAAlLKLIDRGNLWFKFA-GVYEsSRKS------wpyADVAaFSRVIAAHApeRIVWGT  236
DSSP  HHHHhHHHHHHLLEEEEEL-LHHHlLLLL------lllHHHHhHHHHHHHHLhhHEEELL


DSSP  LLLL---------LLLLhHHHHHHHHhlllllhhHLLLHHHHHHHLLHHHHHHLLLLLLl
Query DSPI---------EPADpWVSIDAAVnryvvdpgERVSREEALHLYTHGSAQVTLAEDLg  449
ident   |                                                         
Sbjct NWPHnsvretaayPDDA-RLAELTLG--------WLPDEAARHRALVENPEALFKLSPV-  286
DSSP  LLLLlllllhhhlLLHH-HHHHHHHL--------LLLLHHHHHHHHLHHHHHHHLLLLL-


DSSP  llllllllleeeellllll
Query klergfraeyiildrdplk  468
ident                    
Sbjct -------------------  286
DSSP  -------------------


No 39: Query=3icjA Sbjct=4hk5D Z-score=13.4

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                            |
Sbjct ----------------------------------------------------------TP    2
DSSP  ----------------------------------------------------------LL


DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhllllllEEEEeelhhhhlllllhhh
Query AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriIFGFgwdqdelgrwptred  120
ident    | | |                                                    
Sbjct VVVDIHTHMY--------ppsyiamlekrqtiplvrtfpqaDEPR---------------   39
DSSP  LLEEEEEEEL--------lhhhhhhhhlllllleeeeelleEEEE---------------


DSSP  hlllllleeeeelLLLEEeelhhhhhhhlllllllEELLLLEEEHhhhhhhhhhhhhlll
Query ldvidrpvflyrrCFHVAvmnskmidllnlkpskdFDESTGIVREraleesrkiinekil  180
ident                  |                                          
Sbjct --------lillsSELAA-------------ldaaLADPAAKLPG--------------r   64
DSSP  --------eellhHHHHH-------------hhhhHHLLLLLLLL--------------e


DSSP  lhhhhhHHHHHHHHHHHHLLEEEEEEEE---------------eLHHHHHHHHHHHhllL
Query tvkdykHYIESAQEHLLSLGVHSVGFMS---------------vGEKALKALFELEregR  225
ident                    |                                        
Sbjct plsthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVNAEFSDMC--aQ  122
DSSP  ellhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHHHHHHHHH--hL


DSSP  LLLEEEEEELHH------hHHHHhhhLLLLEELlleEEEEEEEELLllllllllllllll
Query LKMNVFAYLSPE------lLDKLeelNLGKFEGrrlRIWGVXLFVDgslgartallsepy  279
ident      |                       |         |  |                 
Sbjct HVGRLFFFAALPlsapvdaVKAS--iERVKNLK---YCRGIILGTS--------------  163
DSSP  LLLLEEEEEELLllllhhhHHHH--hHHHHLLL---LEEEEEELLL--------------


DSSP  lllllllllLLLLHHH-HHHHHHHHLLLLLEEEEEE------------------------
Query tdnpttsgeLVMNKDE-IVEVIERAKPLGLDVAVHA------------------------  314
ident               |     | |      | |  |                         
Sbjct -------glGKGLDDPhLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplal  216
DSSP  -------llLLLLLLHhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhl


DSSP  ----LLHHHHHHHH--HHHHHHL-LLLEEEE-LLLL---LHHH-----------------
Query ----IGDKAVDVAL--DAFEEAE-FSGRIEH-ASLV---RDDQ-----------------  346
ident         ||        |           |                             
Sbjct gfpmETTIAVARMYmaGVFDHVRnLQMLLAHsGGTLpflAGRIescivhdghlvktgkvp  276
DSSP  hhhhHHHHHHHHHHhlLHHHHLLlLLEEEHHhHLLHhhhHHHHhhhhhllhhhhhlllll


DSSP  ------HHHHHhHLLEEEELLLhhhhlllhhhhhhhhhhhhllLHHHHHHHL---LEEEL
Query ------LERIKeLKVRISAQPHfivsdwwivnrvgeerakwayRLKTLSSIT---KLGFS  397
ident           |       |                         |           | | 
Sbjct kdrrtiWTVLK-EQIYLDAVIY------------------sevGLQAAIASSgadRLMFG  317
DSSP  lllllhHHHHH-HLEEEELLLL------------------lhhHHHHHHHHHlhhHEELL


DSSP  LLLLLLL----------lLHHHHHHHHHHlllllhhhLLLH--HHHHHHLLHHHHHhLLL
Query TDSPIEP----------aDPWVSIDAAVNryvvdpgeRVSR--EEALHLYTHGSAQvTLA  445
ident || |  |                  |            |      |            | 
Sbjct TDHPFFPpieedvqgpwdSSRLNAQAVIK--------AVGEgsSDAAAVMGLNAVR-VLS  368
DSSP  LLLLLLLllllllllllhHHHHHHHHHHH--------HHLLllHHHHHHHLHHHHH-HLL


DSSP  LLllllllLLLLleeeellllll
Query EDlgklerGFRAeyiildrdplk  468
ident                        
Sbjct LK---aelEHHH--------hhh  380
DSSP  LH---hhhHHHH--------hhl


No 40: Query=3icjA Sbjct=2a3lA Z-score=13.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------------------leeeeeLLEEEEeelleeeeleeeeelleeeeee
Query --------------------------cmkaliNGTIYTsfspvkkvsglvisnervlyag   34
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  lhhhhhhhhhhhlleeeelllleeEELEEEEEELHHHHHHH-HHLEellllllhhhhhhh
Query dsstalriaelaggeiidlkgkfvMPAFFDSHLHLDELGMS-LEMVdlrgvksmeelver   93
ident                              | | |                          
Sbjct ----------------------fyNVRKVDTHVHHSACMNQkHLLR--------------  182
DSSP  ----------------------llLLLEEEEEEELLLLLLHhHHHH--------------


DSSP  hhlLLLLleeeeeelhhhhlllllhhhhllLLLL-------eeeeeLLLLEEEElhhhhh
Query vkkGRGRiifgfgwdqdelgrwptredldvIDRP-------vflyrRCFHVAVMnskmid  146
ident                                                   |         
Sbjct -fiKSKL-----rkepdevvifrdgtyltlREVFesldltgydlnvDLLDVHAD------  230
DSSP  -hhHHHH-----hllllllleeelleeelhHHHHhhhlllllllllLLLLLLLL------


DSSP  hhllllllleellLLEEEHH------hhHHHH------hhhHHLLLLHHHHHHHHHHHHH
Query llnlkpskdfdesTGIVRER------alEESR------kiiNEKILTVKDYKHYIESAQE  194
ident                                                             
Sbjct -------------KSTFHRFdkfnlkynPCGQsrlreiflkQDNLIQGRFLGEITKQVFS  277
DSSP  -------------LLLLLLLlllhhhhlLLLLlhhhhhhllLLLLLLLLLHHHHHHHHHH


DSSP  HHHHLLEEEEEEEEEL--------hHHHHHHHHHHhllLLLLEEEEEELH----------
Query HLLSLGVHSVGFMSVG--------eKALKALFELEregRLKMNVFAYLSP----------  236
ident  |                                        ||                
Sbjct DLEASKYQMAEYRISIygrkmsewdQLASWIVNND---LYSENVVWLIQLprlyniykdm  334
DSSP  HHLLLLLEEEEEEEELllllllhhhHHHHHHHLLL---LLLLLEEEEEEEellhhhhlll


DSSP  -----------HHHHHHHHHL-----llleellleEEEEEEEElLLLLllllllllllll
Query -----------ELLDKLEELN-----lgkfegrrlRIWGVXLFvDGSLgartallsepyt  280
ident                 | |                   |  |  |               
Sbjct givtsfqnildNIFIPLFEATvdpdshpqlhvflkQVVGFDLV-DDES------------  381
DSSP  llllllhhhhhHHLLHHHHHHhlhhhllllhhhhlLEEEEEEE-LLLL------------


DSSP  lllllLLLL----------------lLLHHHHHHHHHHHLLLL----------LEEEEEE
Query dnpttSGEL----------------vMNKDEIVEVIERAKPLG----------LDVAVHA  314
ident                                          |                | 
Sbjct ----kPERRptkhmptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmttITLRPHS  437
DSSP  ----lLLLLlllllllllllllllllLHHHHHHHHHHHHHHHHhhhlllllllLEELLLL


DSSP  L---LHHHHHHHHHHHhhhlllLEEEELLLL--LHHHHHHHHHHLLEEEELLLHHHHLLL
Query I---GDKAVDVALDAFeeaefsGRIEHASLV--RDDQLERIKELKVRISAQPHFIVSDWW  369
ident                         | |                        |    |   
Sbjct GeagDIDHLAATFLTC------HSIAHGINLrkSPVLQYLYYLAQIGLAMSPLSNNSLFL  491
DSSP  LlllLLHHHHHHHHHL------LLLLLLHHHhhLHHHHHHHHHHLLLEEELHHHHLLLLL


DSSP  HhhhhhhhhhhhLLLHHHHHH-HLLEEELLLL-LLLL---LLHHHHHHHHHHLllllhhh
Query IvnrvgeerakwAYRLKTLSS-ITKLGFSTDS-PIEP---ADPWVSIDAAVNRyvvdpge  424
ident                             |||                  |          
Sbjct D---------yhRNPFPVFFLrGLNVSLSTDDpLQIHltkEPLVEEYSIAASV-------  535
DSSP  L---------llLLLHHHHHHlLLLEEELLLLhHHHLlllLHHHHHHHHHHHH-------


DSSP  LLLHH-HHHHHlLHHHHHHLLLLL---llLLLLLL-------------------------
Query RVSRE-EALHLyTHGSAQVTLAED---lgKLERGF-------------------------  455
ident                |                                            
Sbjct WKLSAcDLCEI-ARNSVYQSGFSHalkshWIGKDYykrgpdgndihktnvphirvefrdt  594
DSSP  HLLLHhHHHHH-HHHHHHHLLLLHhhhhhHLLLLLllllhhhllhhhhlllhhhhhhhhh


DSSP  ---------llleeeellllll
Query ---------raeyiildrdplk  468
ident                       
Sbjct iwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhlllllllllllll


No 41: Query=3icjA Sbjct=1v77A Z-score=13.1

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
ident                                                             
Sbjct -----------------------------------------------------------V    1
DSSP  -----------------------------------------------------------L


DSSP  LEEEEEELHHHHhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDELgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident  |        |                                                 
Sbjct KFIEMDIRDKEA------------------------------------------------   13
DSSP  LLEEEEELLHHH------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct ------------------------------------------------------------   13
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhHHHHHLlEEEEEEEEElhhhhhhhhhhhhlllllleeeeeelHHHHh
Query tvkdykhyiesaqEHLLSLgVHSVGFMSVgekalkalfeleregrlkmnvfaylsPELLd  240
ident              |         |                                    
Sbjct ------------yELAKEW-FDEVVVSIK----------------------fneeVDKE-   37
DSSP  ------------hHHHHHH-LLEEEEEEE----------------------elllLLHH-


DSSP  hhhhhlllLEELllEEEEEEEEELllllllllllllllllllllllllllLLHHHHHHHH
Query kleelnlgKFEGrrLRIWGVXLFVdgslgartallsepytdnpttsgelvMNKDEIVEVI  300
ident                      |                                      
Sbjct ----klreARKE--YGKVAILLSN--------------------------PKPSLVRDTV   65
DSSP  ----hhhhHHHH--HLLEEEEEEL--------------------------LLHHHHHHHH


DSSP  HHHLllLLEEEEEELLHHHHHHHHHHHhhhllLLEEEELL------LLLHHHHHHHHHHL
Query ERAKplGLDVAVHAIGDKAVDVALDAFeeaefSGRIEHAS------LVRDDQLERIKELK  354
ident    |       |                       |                        
Sbjct QKFK--SYLIYVESNDLRVIRYSIEKG-----VDAIISPWvnrkdpGIDHVLAKLMVKKN  118
DSSP  HHLL--LLEEEEELLLHHHHHHHHHLL-----LLEEELLLllllllLLLHHHHHHHHHHL


DSSP  LEEEELlLHHHHLLLHHHhhhhhhhHHLL--LHHHHHH-HLLEEELLLLLL--LLLLHHH
Query VRISAQpHFIVSDWWIVNrvgeeraKWAY--RLKTLSS-ITKLGFSTDSPI--EPADPWV  409
ident |                                |                       |  
Sbjct VALGFS-LRPLLYSNPYE---ranlLRFMmkAWKLVEKyKVRRFLTSSAQEkwDVRYPRD  174
DSSP  LEEEEE-LHHHHHLLHHH---hhhhHHHHhhHHHHHHHhLLLEEEELLLLLhhHLLLHHH


DSSP  HHHHHHHlllllhhHLLLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll
Query SIDAAVNryvvdpgERVSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
ident  |   |               |                                     
Sbjct LISLGVV-------IGMEIPQAKASISMYPEIILK------------------------  202
DSSP  HHHHHHH-------LLLLHHHHHHLLLHHHHHHHL------------------------


No 42: Query=3icjA Sbjct=2dvtA Z-score=12.7

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                           | 
Sbjct ----------------------------------------------------------MQ    2
DSSP  ----------------------------------------------------------LL


DSSP  LEEEEEELHH---------------hhhHHHHleellllllhhhhhhhhhlllllleeee
Query AFFDSHLHLD---------------elgMSLEmvdlrgvksmeelvervkkgrgriifgf  105
ident        |                                                    
Sbjct GKVALEEHFAipetlqdsagfvpgdywkELQH----------------------------   34
DSSP  LEEEEEEEELlhhhhhhhlllllllhhhHHHH----------------------------


DSSP  eelhhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeeh
Query gwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivre  165
ident                                                             
Sbjct ------------------------------------------------------------   34
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhllllhhhhhHHHHH-HHHHHHHLLEEEEEEEE----------------
Query raleesrkiinekiltvkdykHYIES-AQEHLLSLGVHSVGFMS----------------  208
ident                        |           |                        
Sbjct -------------------rlLDIQDtRLKLMDAHGIETMILSLnapavqaipdrrkaie   75
DSSP  -------------------hhHLLLLhHHHHHHHLLEEEEEEEElllhhhhlllhhhhhh


DSSP  eLHHHHHHHHHHHHllLLLLEEEEEELHH-----hHHHHhhhlLLLEellleEEEEEEEE
Query vGEKALKALFELERegRLKMNVFAYLSPE-----lLDKLeelnLGKFegrrlRIWGVXLF  263
ident     |   | |            |                               |    
Sbjct iARRANDVLAEECA--KRPDRFLAFAALPlqdpdaATEE--lqRCVN---dlGFVGALVN  128
DSSP  hHHHHHHHHHHHHH--HLLLLEEEEELLLlllhhhHHHH--hhHHHH---llLLLEEEEE


DSSP  LlllllllllllllllllllllllllLLLHHH--hhHHHHHHLLLLLEEEEEE-------
Query VdgslgartallsepytdnpttsgelVMNKDE--ivEVIERAKPLGLDVAVHA-------  314
ident                               |             |      |        
Sbjct G----------------fsqegdgqtPLYYDLpqyrPFWGEVEKLDVPFYLHPrnplpqd  172
DSSP  L----------------lllllllllLLLLLLhhhhHHHHHHHHHLLLEEEELllllhhh


DSSP  ----------------LLHHHHHHHHHHH-HHHL-----LLLEEEE-LLLLLHHH-----
Query ----------------IGDKAVDVALDAF-EEAE-----FSGRIEH-ASLVRDDQ-----  346
ident                         ||                   |              
Sbjct sriydghpwllgptwaFAQETAVHALRLMaSGLFdehprLNIILGHmGEGLPYMMwridh  232
DSSP  lhhhlllhhhlhhhlhHHHHHHHHHHHHHhLLHHhhlllLLEEELHhHLLHHHHHhhhhh


DSSP  -----------------HHHHHhHLLEEEEL-LLHHhhlllhhhhhhhhhhhhllLHHHH
Query -----------------LERIKeLKVRISAQ-PHFIvsdwwivnrvgeerakwayRLKTL  388
ident                            |                            |   
Sbjct rnawvklpprypakrrfMDYFN-ENFHITTSgNFRT------------------qTLIDA  273
DSSP  llllllllllllllllhHHHHH-HHEEEELLlLLLH------------------hHHHHH


DSSP  HHHL---LEEELLLLLLLLLL--HHHHHHHhhhlllllhhhLLLHHHHHHHLLHHHHHhL
Query SSIT---KLGFSTDSPIEPAD--PWVSIDAavnryvvdpgeRVSREEALHLYTHGSAQvT  443
ident           |||| | |  |                                       
Sbjct ILEIgadRILFSTDWPFENIDhaSDWFNAT-----------SIAEADRVKIGRTNARR-L  321
DSSP  HLLLlhhHEELLLLLLLLLHHhhHHHHHHL-----------LLLHHHHHHHHLHHHHH-H


DSSP  LLLLllllllllllleeeellllll
Query LAEDlgklergfraeyiildrdplk  468
ident    |                     
Sbjct FKLD---------------------  325
DSSP  LLLL---------------------


No 43: Query=3icjA Sbjct=4ofcA Z-score=12.6

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    | | |                                                    
Sbjct MKIDIHSHIL--------------------------------------------------   10
DSSP  LLEEEEEELL--------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeeHHHHhhHHHHH-----
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivrERALeeSRKII-----  175
ident                                                             
Sbjct ----------------------------------pkewpdlkkrFGYG--GWVQLqhhsk   34
DSSP  ----------------------------------llllllhhhhHLLL--LLEEEeeeel


DSSP  --------hhllllhhhhhHHHHHHHHHHHHLLEEEEEEEE----------------eLH
Query --------nekiltvkdykHYIESAQEHLLSLGVHSVGFMS----------------vGE  211
ident                       |         ||                          
Sbjct geakllkdgkvfrvvrencWDPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlCQ   94
DSSP  leeeeeelleeeeeeehhhLLHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhHH


DSSP  HHHHHHHHHHhllLLLLEEEEEELHH-----hHHHHhhhlLLLEellleEEEEEEEELLl
Query KALKALFELEregRLKMNVFAYLSPE-----lLDKLeelnLGKFegrrlRIWGVXLFVDg  266
ident      |                            |                 ||      
Sbjct LLNNDLASTV--vSYPRRFVGLGTLPmqapelAVKE--meRCVK---elGFPGVQIGTH-  146
DSSP  HHHHHHHHHH--hHLLLLEEEEELLLlllhhhHHHH--hhHHHH---llLLLEEEEELE-


DSSP  lllllllllllllllllllllLLLLLHHH-HHHHHHHHLLLLLEEEEEE-----------
Query slgartallsepytdnpttsgELVMNKDE-IVEVIERAKPLGLDVAVHA-----------  314
ident                                  |   |  |     ||            
Sbjct --------------------vNEWDLNAQeLFPVYAAAERLKCSLFVHPwdmqmdgrmak  186
DSSP  --------------------eLLEELLLHhHHHHHHHHHHHLLEEEEELllllllhhhhl


DSSP  -----------LLHHHHHHHH--HHHHHHL-LLLEEE-ELLL-LLHH-------------
Query -----------IGDKAVDVAL--DAFEEAE-FSGRIE-HASL-VRDD-------------  345
ident                |         ||                                 
Sbjct ywlpwlvgmpaETTIAICSMImgGVFEKFPkLKVCFAhGGGAfPFTVgrishgfsmrpdl  246
DSSP  llhhhhlhhhhHHHHHHHHHHllLHHHHLLlLLEEELhHHLLhHHHHhhhhhhhhhlhhh


DSSP  --------HHHHHHhhLLEEEELLLHHhhlllhhhhhhhhhhhhllLHHHHHHHL---LE
Query --------QLERIKelKVRISAQPHFIvsdwwivnrvgeerakwayRLKTLSSIT---KL  394
ident                      |  |                      || |       | 
Sbjct caqdnpmnPKKYLG--SFYTDALVHDP------------------lSLKLLTDVIgkdKV  286
DSSP  hlllllllHHHHLL--LLEEELLLLLH------------------hHHHHHHHHHlllLE


DSSP  EELLLLLL--LLLLHHHHHHHHHhlllllhhhLLLHHHHHHHLLHHHHHHLLLLllllll
Query GFSTDSPI--EPADPWVSIDAAVnryvvdpgeRVSREEALHLYTHGSAQVTLAEdlgkle  452
ident    || |       |   |                 |    |           |      
Sbjct ILGTDYPFplGELEPGKLIESME---------EFDEETKNKLKAGNALAFLGLE------  331
DSSP  ELLLLLLLllLLLLLLHHHHHLL---------LLLHHHHHHHHLHHHHHHHLLL------


DSSP  llLLLLeeeellllll
Query rgFRAEyiildrdplk  468
ident                 
Sbjct --RKQF----------  335
DSSP  --HHHL----------


No 44: Query=3icjA Sbjct=3qy6A Z-score=12.5

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELHH----HHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhllll
Query aFFDSHLHLD----ELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwp  116
ident    | | |                                                    
Sbjct -MIDIHCHILpamdDGAG------------------------------------------   17
DSSP  -LEELLLLLLllllLLLL------------------------------------------


DSSP  lhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhh
Query tredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiin  176
ident                                                             
Sbjct ------------------------------------------------------------   17
DSSP  ------------------------------------------------------------


DSSP  hllllhhhHHHHHHHHHHHHHHLLEEEEEEEE------------eLHHHHHHHHHHHHLL
Query ekiltvkdYKHYIESAQEHLLSLGVHSVGFMS------------vGEKALKALFELEREG  224
ident                        |                        |   |       
Sbjct --------DSADSIEMARAAVRQGIRTIIATPhhnngvyknepaaVREAADQLNKRLIKE   69
DSSP  --------LHHHHHHHHHHHHHLLLLEEELLLeellllllllhhhHHHHHHHHHHHHHHL


DSSP  LLLLEEEEEelhhhhhhhhhhlllleellleeeeeEEEELllllllllllllllllllll
Query RLKMNVFAYlspelldkleelnlgkfegrrlriwgVXLFVdgslgartallsepytdnpt  284
ident      |                                                      
Sbjct DIPLHVLPG--------------------------QEIRI--------------------   83
DSSP  LLLLEEELL--------------------------LEEEL--------------------


DSSP  llllllllHHHHHHHHHHHllLLLE------EEEEELLHHHHHHHHHHHHHHL---LLLE
Query tsgelvmnKDEIVEVIERAkpLGLD------VAVHAIGDKAVDVALDAFEEAE---FSGR  335
ident           |            |              |     |   |           
Sbjct --------YGEVEQDLAKR--QLLSlndtkyILIEFPFDHVPRYAEQLFYDLQlkgYIPV  133
DSSP  --------LLLHHHHHHLL--LLLLhhhlleEEEELLLLLLLLLHHHHHHHHHhllLEEE


DSSP  EEELL-----llLHHH-HHHHHHHlLEEEELLLHH-HHLLLHhhhhhhhhhhhllLHHHH
Query IEHAS-----lvRDDQ-LERIKELkVRISAQPHFI-VSDWWIvnrvgeerakwayRLKTL  388
ident | |                                                         
Sbjct IAHPErnreireNPSLlYHLVEKG-AASQITSGSLaGIFGKQ------lkafslrLVEAN  186
DSSP  EELHHhlhhhhhLLHHhHHHHHLL-LEEEEEHHHHlLLLLHH------hhhhhhhHHHLL


DSSP  HhhllEEELLLLL---LLLLLHHHHHHHHHHlllllhhhLLLHHHHHHHlLHHHHHhlLL
Query SsitkLGFSTDSP---IEPADPWVSIDAAVNryvvdpgeRVSREEALHLyTHGSAQvtLA  445
ident           |                                |    | |       | 
Sbjct L---iHFVASDAHnvkTRNFHTQEALYVLEK--------EFGSELPYML-TENAEL--LL  232
DSSP  L---lLEEELLLLlllLLLLLHHHHHHHHHH--------HHLLHHHHHH-HHHHHH--HH


DSSP  LLllllllllllleeeellllll
Query EDlgklergfraeyiildrdplk  468
ident                        
Sbjct RN--------qtifrqppqpvkr  247
DSSP  LL--------lllllllllllll


No 45: Query=3icjA Sbjct=4qrnA Z-score=12.2

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleEEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfVMP   60
ident                                                             
Sbjct ----------------------------------------------smtqdlktggeQGY   14
DSSP  ----------------------------------------------lllllllllllLLL


DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident                                                             
Sbjct LRIATEEAFA--------------------------------------------------   24
DSSP  LLEEEEEEEL--------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhHHHHLLL
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkIINEKIL  180
ident                                                             
Sbjct ----------------------------------------------------tREIIDVY   32
DSSP  ----------------------------------------------------lHHHHHHH


DSSP  -----------------------------lhhhhhHHHH-HHHHHHHHLLEEEEEEEE--
Query -----------------------------tvkdykHYIE-SAQEHLLSLGVHSVGFMS--  208
ident                                                  |          
Sbjct lrmirdgtadkgmvslwgfyaqspseratqilerlLDLGeRRIADMDATGIDKAILALts   92
DSSP  hhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhHLLLhHHHHHHHHLLLLEEEEEEll


DSSP  --------------eLHHHHHHHHHHHhllLLLLEEEEEELHH-----hHHHHhhhlLLL
Query --------------vGEKALKALFELEregRLKMNVFAYLSPE-----lLDKLeelnLGK  249
ident                   |   |                                   | 
Sbjct pgvqplhdldeartlATRANDTLADAC--qKYPDRFIGMGTVApqdpewSARE--ihRGA  148
DSSP  llllllllhhhhhhhHHHHHHHHHHHH--hHLLLLEEELLLLLlllhhhHHHH--hhHHH


DSSP  EEllleEEEEEEEELLllllllllllllllllllllllLLLLLHHH-hHHHHHHHLLLLL
Query FEgrrlRIWGVXLFVDgslgartallsepytdnpttsgELVMNKDE-iVEVIERAKPLGL  308
ident  |       |                                   |              
Sbjct RE---lGFKGIQINSH---------------------tQGRYLDEEffDPIFRALVEVDQ  184
DSSP  HL---lLLLLEEELLL---------------------lLLLLLLLHhhHHHHHHHHHHLL


DSSP  EEEEE-------------------------eLLHHHHHHHH--HHHHHHL-LLLEEEE-L
Query DVAVH-------------------------aIGDKAVDVAL--DAFEEAE-FSGRIEH-A  339
ident     |                                        |           |  
Sbjct PLYIHpatspdsmidpmleagldgaifgfgvETGMHLLRLItiGIFDKYPsLQIMVGHmG  244
DSSP  LEEELlllllllllhhhhhhlllllllhhhhHHHHHHHHHHhhLHHHHLLlLLEEELHhH


DSSP  LLLLHHH--------------------------HHHHHhHLLEEEELLLHHhhlllhhhh
Query SLVRDDQ--------------------------LERIKeLKVRISAQPHFIvsdwwivnr  373
ident                                      |   |                  
Sbjct EALPYWLyrldymhqagvrsqryermkplkktiEGYLK-SNVLVTNSGVAW---------  294
DSSP  HLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-HLEEEELLLLLL---------


DSSP  hhhhhhhhllLHHHHHHHL---LEEELLLLLLLLLL--HHHHHHHhhhlllllhhhLLLH
Query vgeerakwayRLKTLSSIT---KLGFSTDSPIEPAD--PWVSIDAavnryvvdpgeRVSR  428
ident             |               | |                           | 
Sbjct --------epAIKFCQQVMgedRVMYAMDYPYQYVAdeVRAMDAM-----------DMSA  335
DSSP  --------hhHHHHHHHHHlhhHEELLLLLLLLLLHhhHHHHHLL-----------LLLH


DSSP  HHHHHHLLHHHHHHLLLllllllllllllleeeellllll
Query EEALHLYTHGSAQVTLAedlgklergfraeyiildrdplk  468
ident                                         
Sbjct QTKKKFFQTNAEKWFKL-----------------------  352
DSSP  HHHHHHHLHHHHHHLLL-----------------------


No 46: Query=3icjA Sbjct=1itqA Z-score=12.2

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleEEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfVMP   60
ident                                                             
Sbjct ----------------------------------------------dffrdeaerimRDS   14
DSSP  ----------------------------------------------lhhhhhhhhhhLLL


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    | |  |                                                   
Sbjct PVIDGHNDLPW-------------------------------------------------   25
DSSP  LEEEEEELHHH-------------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhllL
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekiL  180
ident                                                             
Sbjct ------------------------------------------------------qlldmF   31
DSSP  ------------------------------------------------------hhhhhH


DSSP  LHHH--------hhhhhhhHHHHHHHLLEEEEEEEEE-------------LHHHHHHHHH
Query TVKD--------ykhyiesAQEHLLSLGVHSVGFMSV-------------GEKALKALFE  219
ident                        |    |                               
Sbjct NNRLqderanlttlagthtNIPKLRAGFVGGQFWSVYtpcdtqnkdavrrTLEQMDVVHR   91
DSSP  LLLLllhhhllllllllllLHHHHHHLLEEEEEEEELllhhhllllhhhhHHHHHHHHHH


DSSP  HHHL-LLLLL-----------------EEEEEEL-HHHH----HHHHhhlLLLEellleE
Query LERE-GRLKM-----------------NVFAYLS-PELL----DKLEelnLGKFegrrlR  256
ident   |                                          |              
Sbjct MCRMyPETFLyvtssagirqafregkvASLIGVEgGHSIdsslGVLR---ALYQ----lG  144
DSSP  HHHHlLLLEEelllhhhhhhhhhllleEEEEEEElHHHLlllhHHHH---HHHH----lL


DSSP  EEEEEEE--------LLLLllllllLLLLllllllllLLLLL-lLHHH-HHHHHHHHLLL
Query IWGVXLF--------VDGSlgartaLLSEpytdnpttSGELV-mNKDE-IVEVIERAKPL  306
ident      |                                 |            |      |
Sbjct MRYLTLThscntpwaDNWL------VDTG--------DSEPQsqGLSPfGQRVVKELNRL  190
DSSP  EEEEELLllllllllLLHH------HLLL--------LLLLLllLLLHhHHHHHHHHHHH


DSSP  LLEEEEEEllhhHHHHHHHHHHHHLLLLEEE-ELLL--------LLHHHHHHHHHHLLEE
Query GLDVAVHAigdkAVDVALDAFEEAEFSGRIE-HASL--------VRDDQLERIKELKVRI  357
ident |            |                              | || |   |      
Sbjct GVLIDLAH---vSVATMKATLQLSRAPVIFShSSAYsvcasrrnVPDDVLRLVKQTDSLV  247
DSSP  LLEEELLL---lLHHHHHHHHHHLLLLLEELlLLLLllllllllLLHHHHHHHHHHLLEE


DSSP  EELlLHHH-HLLLHhhhhhhhhhhhllLHHHHHHHL---LEEELLLLLL--------LLL
Query SAQpHFIV-SDWWIvnrvgeerakwayRLKTLSSIT---KLGFSTDSPI--------EPA  405
ident                             |            ||  |           |  
Sbjct MVN-FYNNyISCTN----kanlsqvadHLDHIKEVAgarAVGFGGDFDGvprvpeglEDV  302
DSSP  EEL-LLHHhHLLLL----lllhhhhhhHHHHHHHHLlhhHEEELLLLLLllllllllLLL


DSSP  L-HHHHHHHHHHLllllhhhlLLHHHHHHHLLHHHHHHLL----------llllllllll
Query D-PWVSIDAAVNRyvvdpgerVSREEALHLYTHGSAQVTL----------aedlgklerg  454
ident       |     |            |           |                      
Sbjct SkYPDLIAELLRR-------nWTEAEVKGALADNLLRVFEaveqasnltqapeeepipld  355
DSSP  LlHHHHHHHHHHL-------lLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhh


DSSP  lllleeeellllll
Query fraeyiildrdplk  468
ident               
Sbjct qlggscrthygyss  369
DSSP  hlllllllllllll


No 47: Query=3icjA Sbjct=2gwgA Z-score=12.0

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELhhHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHldELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    | | |                                                    
Sbjct XIIDIHGH--YTTA----------------------------------------------   12
DSSP  LLEEEEEE--LLLL----------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHH-----
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKII-----  175
ident                                                             
Sbjct -----------------------------------------------pkalEDWRnrqia   25
DSSP  -----------------------------------------------lhhhHHHHhhhhh


DSSP  -----------hhLLLLHHHHHHHHH-HHHHHHHHLLEEEEEEEE--------------e
Query -----------neKILTVKDYKHYIE-SAQEHLLSLGVHSVGFMS--------------v  209
ident                         |           |     |                 
Sbjct gikdpsvxpkvseLKISDDELQASIIeNQLKKXQERGSDLTVFSPragdfnvsstwaaic   85
DSSP  hhhlhhhlllhhhLLLLHHHHHHHHHlLHHHHHHHHLLLEEEEELllllhhhhhhhhhhh


DSSP  LHHHHHHHHHHHhlllllLEEEEEELHH--------hHHHHhhhlLLLEEllleEEEEEE
Query GEKALKALFELEregrlkMNVFAYLSPE--------lLDKLeelnLGKFEgrrlRIWGVX  261
ident  |                 |                             |          
Sbjct NELCYRVSQLFP------DNFIGAAXLPqspgvdpktCIPE--leKCVKE---yGFVAIN  134
DSSP  HHHHHHHHHHLL------LLEEEEEELLllllllhhhHHHH--hhHHHHL---lLLLEEE


DSSP  EELLlllllllllllllllllllLLLL-LLLLHH-HHHHHHHHHLLLLLEEEEE------
Query LFVDgslgartallsepytdnptTSGE-LVMNKD-EIVEVIERAKPLGLDVAVH------  313
ident |  |                             |       |    |      |      
Sbjct LNPD-----------------psGGHWtSPPLTDrIWYPIYEKXVELEIPAXIHvstgah  177
DSSP  ELLL-----------------llLLLLlLLLLLLhHHHHHHHHHHHHLLLEEELlllllh


DSSP  --eLLHHHHHHH--hHHHHHHL-LLLEEEE-LLLL---LHHH------------HHHHHh
Query --aIGDKAVDVA--lDAFEEAE-FSGRIEH-ASLV---RDDQ------------LERIKe  352
ident        |       | |         | |    |                         
Sbjct ylnADTTAFXQCvagDLFKDFPeLKFVIPHgGGAVpyhWGRFrglaqexkkpllEDHVL-  236
DSSP  hhhHHHHHHHHHhhlLHHHHLLlLLEEELHhHLLLhhhHHHHhhhhhhlllllhHHHLL-


DSSP  HLLEEEELLlHHHHlllhhhhhhhhhhhhlLLHHHHHHhLLEEELLLLLL----------
Query LKVRISAQPhFIVSdwwivnrvgeerakwaYRLKTLSSiTKLGFSTDSPI----------  402
ident                                            |                
Sbjct NNIFFDTCV-YHQP-------------gidLLNTVIPV-DNVLFASEXIGavrgidprtg  281
DSSP  LLEEEELLL-LLHH-------------hhhHHHHHLLH-HHEELLLLLLLlllleellll


DSSP  --LLLLHhHHHHHHHhlllllhhhLLLHHHHHHHLLHHHHHHLL--LLLLlllllLLLLl
Query --EPADPwVSIDAAVnryvvdpgeRVSREEALHLYTHGSAQVTL--AEDLgklerGFRAe  458
ident           | |               ||    |      |       |          
Sbjct fyYDDTK-RYIEAST---------ILTPEEKQQIYEGNARRVYPrlDAAL-----KAKG-  325
DSSP  eeLLLLH-HHHHHLL---------LLLHHHHHHHHLHHHHHHLHhhHHHH-----HHHH-


DSSP  eeeellllll
Query yiildrdplk  468
ident           
Sbjct ------kleh  329
DSSP  ------hhll


No 48: Query=3icjA Sbjct=4dziC Z-score=11.1

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct --------------------------------------------------------alNY    4
DSSP  --------------------------------------------------------llLL


DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhHHLLLLL-----------leEEEEelh
Query AFFDSHLHLDElgmslemvdlrgvksmeelverVKKGRGR-----------iiFGFGwdq  109
ident    |   |  |                        |                        
Sbjct RVIDVDNHYYEpldsftrhldkkfkrrgvqmlsDGKRTWAvigdrvnhfipnpTFDP---   61
DSSP  LEEEEEEELLLllllllllllhhhlllleeeeeLLLLEEEeelleelllllllLLLL---


DSSP  hhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhh
Query delgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivrerale  169
ident                                                             
Sbjct -----------------------------------------iivpgcldllfrgeipdgv   80
DSSP  -----------------------------------------eelllllhhhhhlllllll


DSSP  hhhhhhhhllllhhhhhHHHHHHHHHHHHLLEEEEEEEE---------------------
Query esrkiinekiltvkdykHYIESAQEHLLSLGVHSVGFMS---------------------  208
ident                                                             
Sbjct dpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdieatmasv  140
DSSP  lhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhhh


DSSP  --eLHHHHHHHHhhhhlllLLLEEEEEELHH---------HHHHHhhhllLLEEllleeE
Query --vGEKALKALFeleregrLKMNVFAYLSPE---------LLDKLeelnlGKFEgrrlrI  257
ident                          |                |                 
Sbjct hafNLWLDEDWG----fdrPDHRIIAAPIVSladptraveEVDFV-----LARG-----A  186
DSSP  hhhHHHHHHHLL----lllLLLLEEELLLLLlllhhhhhhHHHHH-----HHLL-----L


DSSP  EEEEEELLllllllllllllllllllllllllLLLHHH-HHHHHHHHLLLLLEEEEE---
Query WGVXLFVDgslgartallsepytdnpttsgelVMNKDE-IVEVIERAKPLGLDVAVH---  313
ident   |                                 |     |  |    |  |  |   
Sbjct KLVLVRPA----------------pvpglvkpRSLGDRsHDPVWARLAEAGVPVGFHlsd  230
DSSP  LLEELLLL----------------llllllllLLLLLHhHHHHHHHHHHHLLLEEEElll


DSSP  ------------------------eLLHHHHHHHH--HHHHHHL-LLLEEEELL-LLLHH
Query ------------------------aIGDKAVDVAL--DAFEEAE-FSGRIEHAS-LVRDD  345
ident                                        |                    
Sbjct sgylhiaaawggakdpldqvllddrAIHDTMASMIvhGVFTRHPkLKAVSIENGsYFVHR  290
DSSP  lllhhhhhhllllllhhhhhhhllhHHHHHHHHHHhlLHHHHLLlLLEEEELLLlLHHHH


DSSP  HH-------------------HHHHhHLLEEEELLlhhhhlllhhhhhhhhhhhhlLLHH
Query QL-------------------ERIKeLKVRISAQPhfivsdwwivnrvgeerakwaYRLK  386
ident                      |      | |                           | 
Sbjct LIkrlkkaantqpqyfpedpvEQLR-NNVWIAPYY--------------------eDDLP  329
DSSP  HHhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL--------------------lLLHH


DSSP  HHHHHL---LEEELLLLLL--LLLLHHHHHHHHHhlllllhhhLLLHHHHHHHLLHHHHH
Query TLSSIT---KLGFSTDSPI--EPADPWVSIDAAVnryvvdpgeRVSREEALHLYTHGSAQ  441
ident  |       |  |  | |     | |                   |              
Sbjct ELARVIgvdKILFGSDWPHgeGLASPVSFTAELK---------GFSESDIRKIMRDNALD  380
DSSP  HHHHHHlhhHLLLLLLLLLllLLLLHHHHHHHHL---------LLLHHHHHHHHLHHHHH


DSSP  hLLLLlllllllllllleeeellllll
Query vTLAEdlgklergfraeyiildrdplk  468
ident   |                        
Sbjct -LLGV------------------qvgs  388
DSSP  -HHLL------------------llll


No 49: Query=3icjA Sbjct=2qpxA Z-score=11.0

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct ------------------------------------------------gxddlsefvdQV   12
DSSP  ------------------------------------------------lllllhhhhhHL


DSSP  LEEEEEELhhHHHHhhHLEEllllllhhhhhhhhhlllllleEEEEelhhhhlllllhhh
Query AFFDSHLHldELGMslEMVDlrgvksmeelvervkkgrgriiFGFGwdqdelgrwptred  120
ident    | | |   |      |                                         
Sbjct PLLDHHCH--FLID--GKVP----------------------NRDD--------------   32
DSSP  LEEEEEEL--LLLL--LLLL----------------------LHHH--------------


DSSP  hlllllleeeeelLLLEeeelhhhhhhhllllllleelllleeEHHH-------------
Query ldvidrpvflyrrCFHVavmnskmidllnlkpskdfdestgivRERA-------------  167
ident                                               |             
Sbjct -----rlaqvsteADKD--------------------------YPLAdtknrlayhgfla   61
DSSP  -----hhhhhlllLLLL--------------------------LLHHhhlllhhhhhhhh


DSSP  hhhhhhhhhhllllhhhhhhhhHHHHHHHHHLLEEEEEEEEEL--hhhhhHHHHhhhllL
Query leesrkiinekiltvkdykhyiESAQEHLLSLGVHSVGFMSVG--ekalkALFEleregR  225
ident                                                    |        
Sbjct lakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFvpddpilDLDQ--taeL  119
DSSP  hhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLlllllllLHHH--hhhH


DSSP  LLLEEEEEELH------------------hhHHHHhhhLLLLEellleEEEEEEEELLLl
Query LKMNVFAYLSP------------------elLDKLeelNLGKFegrrlRIWGVXLFVDGs  267
ident     | |                                  |         | |      
Sbjct VGIPVKAIYRLethaedfxlehdnfaawwqaFSND--vKQAKA----hGFVGFXSIAAY-  172
DSSP  HLLLEEEEEEHhhhhhhhhlllllhhhhhhhHHHH--hHLLLL----lLLLLEEELHHH-


DSSP  llllllllllllllllllllLLLLLH------------------------------HHHH
Query lgartallsepytdnpttsgELVMNK------------------------------DEIV  297
ident                                                             
Sbjct --------------------RVGLHLepvnvieaaagfdtwkhsgekrltskplidYXLY  212
DSSP  --------------------HLLLLLllllhhhhhhhhhhhhhhlllllllhhhhhHHHH


DSSP  HHHHHHLLLLLEEEEEEL-------LHHH-HHHHHHHHHHHL---LLLEEEELLLLlhhh
Query EVIERAKPLGLDVAVHAI-------GDKA-VDVALDAFEEAE---FSGRIEHASLVrddq  346
ident  |             |                   |               |        
Sbjct HVAPFIIAQDXPLQFHVGygdadtdXYLGnPLLXRDYLKAFTkkgLKVVLLHCYPYhrea  272
DSSP  HHHHHHHHHLLLEEEEELlllllllHHHLlHHHHHHHHHHHHhhlLLEEEEELLLLhhhh


DSSP  HHHHHHHL-LEEEEL--LLHHHHLllhhhhhhhhhhhhllLHHHHHHHL---LEEELLLL
Query LERIKELK-VRISAQ--PHFIVSDwwivnrvgeerakwayRLKTLSSIT---KLGFSTDS  400
ident                       |                                |  | 
Sbjct GYLASVFPnLYFDISllDNLGPSG-------------asrVFNEAVELApytRILFASDA  319
DSSP  HHHHHHLLlEEEELLlhHHHLHHH-------------hhhHHHHHLLLLlhhHEELLLLL


DSSP  L--llLLLH--HHHHHHHHHL--llllhhhllLHHHHHHHLLHHHHHHLLLLLLLLLlll
Query P--iePADP--WVSIDAAVNR--yvvdpgervSREEALHLYTHGSAQVTLAEDLGKLerg  454
ident                 | |                         ||     |        
Sbjct StypeXYGLaaRQFKQALVAHfnqlpfvdlaqKKAWINAICWQTSAKLYHQERELRV---  376
DSSP  LllhhHHHHhhHHHHHHHHHHhhllllllhhhHHHHHHHHHLHHHHHHLLLHHHHLL---


DSSP  lllleeeellllll
Query fraeyiildrdplk  468
ident               
Sbjct --------------  376
DSSP  --------------


No 50: Query=3icjA Sbjct=1j5sA Z-score=9.7

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct -----------------------------------hmflgedylltnraavrlfnevkDL   25
DSSP  -----------------------------------llllllllllllhhhhhhhhhhlLL


DSSP  LEEEEEELHH---hhhhhHHLEEllllllhhhhhhhhhlllllleeeEEEL--HHHHlll
Query AFFDSHLHLD---elgmsLEMVDlrgvksmeelvervkkgrgriifgFGWD--QDELgrw  115
ident    | | |||                                                  
Sbjct PIVDPHNHLDakdivenkPWNDI-------------wevegatdhyvWELMrrCGVS---   69
DSSP  LEEELLLLLLhhhhhhllLLLLH-------------hhhhllllhhhHHHHhhLLLL---


DSSP  llhhhhlllllleeeeellllEEEEL---------hhhhhhhllllllleelllleeehh
Query ptredldvidrpvflyrrcfhVAVMN---------skmidllnlkpskdfdestgivrer  166
ident                                                             
Sbjct ------------------eeyITGSRsnkekwlalakvfprfvgnptyewihldlwrrfn  111
DSSP  ------------------hhhLLLLLlhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhll


DSSP  hhhhhhhhhhhllllhhhhhhhhhHHHHHHHHLLEEEEEEeEELH-HHHHHHHHHHhlLL
Query aleesrkiinekiltvkdykhyieSAQEHLLSLGVHSVGFmSVGE-KALKALFELEreGR  225
ident                           |  |    |             |           
Sbjct ikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCT-TDDPvSTLEHHRKAK--EA  168
DSSP  llllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEEL-LLLLlLLLHHHHHHH--HH


DSSP  LL-LEEEEEELHH---------------------------------hHHHHhhhLLLLEE
Query LK-MNVFAYLSPE---------------------------------lLDKLeelNLGKFE  251
ident            |                                   | |       |  
Sbjct VEgVTILPTWRPDramnvdkegwreyvekmgerygedtstldgflnaLWKS--hEHFKEH  226
DSSP  LLlLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhhhhHHHH--hHHHHLL


DSSP  llleEEEEEEEELLllllllllllllllllllllllllLLLH------------------
Query grrlRIWGVXLFVDgslgartallsepytdnpttsgelVMNK------------------  293
ident                                                             
Sbjct ----GCVASDHALL------------------------EPSVyyvdenraravhekafsg  258
DSSP  ----LLLEEEEEEL------------------------LLLLllllhhhhhhhhhhhlll


DSSP  -------------HHHHHHHHHHLLLLLEEEEEELL------------------------
Query -------------DEIVEVIERAKPLGLDVAVHAIG------------------------  316
ident                 |               |                           
Sbjct ekltqdeindykaFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnf  318
DSSP  llllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleelll


DSSP  hHHHHHHHHHHHHHL--LLLEEEeLLLLL--hhHHHHHHHHL-LEEEEL--llHHHHLll
Query dKAVDVALDAFEEAE--FSGRIEhASLVR--ddQLERIKELK-VRISAQ--phFIVSDww  369
ident             |                              |   |            
Sbjct lRIAEGLRYFLNEFDgkLKIVLY-VLDPThlptISTIARAFPnVYVGAPwwfnDSPFG--  375
DSSP  lLHHHHHHHHHHHLLllLLEEEE-ELLHHhhhhHHHHHHHLLlEEELLLllllLLHHH--


DSSP  hhhhhhhhhhhhllLHHHHHHH----LLEEELLLLL-llLLLH--HHHHHHHHHL-----
Query ivnrvgeerakwayRLKTLSSI----TKLGFSTDSP-iePADP--WVSIDAAVNR-----  417
ident                || | |        |  |||                  |      
Sbjct -----------memHLKYLASVdllyNLAGMVTDSRkllSFGSrtEMFRRVLSNVvgemv  424
DSSP  -----------hhhHHHHHHLLllhhHLLLLLLLLLlllHHHHhhHHHHHHHHHHhhhhh


DSSP  llllhhhllLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll
Query yvvdpgervSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
ident           ||   |    |                              
Sbjct ekgqipikeARELVKHVSYDGPKALFF------------------------  451
DSSP  hlllllhhhHHHHHHHHHLHHHHHHHL------------------------


No 51: Query=3icjA Sbjct=3iacA Z-score=9.6

back to top
DSSP  ----------leeeeelleEEEEelleeeeleeeeelleeeeeelhhhhhhhhhhhllee
Query ----------cmkalingtIYTSfspvkkvsglvisnervlyagdsstalriaelaggei   50
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eelllleeEELEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhh
Query idlkgkfvMPAFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqd  110
ident              | | ||                                         
Sbjct -------aPXPIYDFHCHLS----------------------------------------   36
DSSP  -------lLLLEEELLLLLL----------------------------------------


DSSP  hhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhh
Query elgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreralee  170
ident                                                             
Sbjct ------------------------------------------------------------   36
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllhhhhhHHHH----------------------------------------
Query srkiinekiltvkdykHYIE----------------------------------------  190
ident                   |                                         
Sbjct ---------------pQEIAddrrfdnlgqiwlegdhykwralrsagvdeslitgketsd   81
DSSP  ---------------hHHHHhllllllhhhhhhllllhhhhhhhhllllhhhlllllllh


DSSP  -----------------------------------------------------------h
Query -----------------------------------------------------------s  191
ident                                                             
Sbjct yekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafs  141
DSSP  hhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhl


DSSP  HHHHHHHLLEEEEEEeEELH-HHHHHHHHHHHLLLLLLEEEEEELH--------------
Query AQEHLLSLGVHSVGFmSVGE-KALKALFELEREGRLKMNVFAYLSP--------------  236
ident |        |  ||         |               |     |              
Sbjct ARGIXQQXNVRXVGT-TDDPiDSLEYHRQIAADDSIDIEVAPSWRPdkvfkieldgfvdy  200
DSSP  HHHHHHHLLEEEEEL-LLLLlLLLHHHHHHHHLLLLLLEEELLLLLhhhhllllllhhhh


DSSP  -------------------hhHHHHhhhlLLLEEllleEEEEEEEELLllllllllllll
Query -------------------elLDKLeelnLGKFEgrrlRIWGVXLFVDgslgartallse  277
ident                      |                                      
Sbjct lrkleaaadvsitrfddlrqaLTRR---lDHFAA---cGCRASDHGIE------------  242
DSSP  hhhhhhhhllllllhhhhhhhHHHH---hHHHHH---lLLLEEEEEEL------------


DSSP  lllllllllllLLLL-------------------------------HHHHHHHHHHHLLL
Query pytdnpttsgeLVMN-------------------------------KDEIVEVIERAKPL  306
ident                                                   |         
Sbjct -----------TLRFapvpddaqldailgkrlagetlseleiaqftTAVLVWLGRQYAAR  291
DSSP  -----------LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHHHHH


DSSP  LLEEEEEELL-----------------------hHHHHHHHHHHHHHL-----LLLEEeE
Query GLDVAVHAIG-----------------------dKAVDVALDAFEEAE-----FSGRIeH  338
ident |     |                                                     
Sbjct GWVXQLHIGAirnnntrxfrllgpdtgfdsigdnNISWALSRLLDSXDvtnelPKTIL-Y  350
DSSP  LLEEEEEELEellllhhhhhhhllllllleelllLLHHHHHHHHHHHHlllllLEEEE-E


DSSP  LLL--LLHHHHHHHHHHL-------LEEEE--lllHHHHLllhhhhhhhhhhhhllLHHH
Query ASL--VRDDQLERIKELK-------VRISA--qphFIVSDwwivnrvgeerakwayRLKT  387
ident              |           |                               |  
Sbjct CLNprDNEVLATXIGNFQgpgiagkVQFGSgwwfnDQKDG-------------xlrQLEQ  397
DSSP  ELLhhHHHHHHHHHHHLLlllllllEEELLllhhhLLHHH-------------hhhHHHH


DSSP  HHHHL----LEEELLLLLL-lLLLH-HHHHHHHHHL-------llllhhhlllhHHHHHH
Query LSSIT----KLGFSTDSPI-ePADP-WVSIDAAVNR-------yvvdpgervsrEEALHL  434
ident ||         |  |||                 |                         
Sbjct LSQXGllsqFVGXLTDSRSflSYTRhEYFRRILCNLlgqwaqdgeipddeaxlsRXVQDI  457
DSSP  HHHHLlhhhLLLLLLLLLLllLLHHhHHHHHHHHHHhhhhhhlllllllhhhhhHHHHHH


DSSP  LLHHHHHHLLlllllllllllllleeeellllll
Query YTHGSAQVTLaedlgklergfraeyiildrdplk  468
ident                                   
Sbjct CFNNAQRYFT----------------------ik  469
DSSP  HLHHHHHHLL----------------------ll


No 52: Query=3icjA Sbjct=3f2bA Z-score=9.1

back to top
DSSP  ---------------------------------------------leeeeelleeeeeel
Query ---------------------------------------------cmkalingtiytsfs   15
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  leeeeleeeeelleeeeeelhhhhhhhhhHHLLEEE---elllleEEELEEEEEELHH--
Query pvkkvsglvisnervlyagdsstalriaeLAGGEII---dlkgkfVMPAFFDSHLHLD--   70
ident                                  ||                  |||    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiaNDLNEIAanerqdtapEGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeEEEEEELlllllllllLLLLLLLLLLLLLll


DSSP  ---HHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhhhllllll
Query ---ELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptredldvidrp  127
ident                                                             
Sbjct qmdAVTS-----------------------------------------------------  127
DSSP  lllLLLL-----------------------------------------------------


DSSP  eeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhllllhhhhhh
Query vflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekiltvkdykh  187
ident                                                             
Sbjct ------------------------------------------------------------  127
DSSP  ------------------------------------------------------------


DSSP  hHHHHHHHHHHLLEEEEEEEE-eLHHHHHHHHHHHhlLLLLLEEEEEElhhhhhhhhhhl
Query yIESAQEHLLSLGVHSVGFMS-vGEKALKALFELEreGRLKMNVFAYLspelldkleeln  246
ident       |     |                            | |   |            
Sbjct -VTKLIEQAKKWGHPAIAVTDhaVVQSFPEAYSAA--KKHGMKVIYGL------------  172
DSSP  -HHHHHHHHHHLLLLLEEELLllLLLLHHHHHHHH--HHHLLLEEEEE------------


DSSP  llleellleeeeeeEEEL----------lllllllllllllllllllllllLLLLlhhHH
Query lgkfegrrlriwgvXLFV----------dgslgartallsepytdnpttsgELVMnkdEI  296
ident                                                             
Sbjct --------------EANIvddpfhvtllaqnetglknlfklvslshiqyfhRVPR--iPR  216
DSSP  --------------EEEEellleeeeeeellhhhhhhhhhhhhhhhlllllLLLL--eEH


DSSP  HHHHHHHLlllLEEEeeellhhhhhhhhhhhhhhllllEEEE----LLLLlhhHHHHHhH
Query VEVIERAKplgLDVAvhaigdkavdvaldafeeaefsgRIEH----ASLVrddQLERIkE  352
ident                                                             
Sbjct SVLVKHRD---GLLV-----------------------GSGCdkgeLFDN---VEDIA-R  246
DSSP  HHHHHLLL---LEEE-----------------------ELLLllllLLLL---LLLLH-H


DSSP  HLLEEEELLlhHHHLLLhhHHHHhhHHHHLL-LHHHHHHHL-----LEEELLLLL-----
Query LKVRISAQPhfIVSDWWivNRVGeeRAKWAY-RLKTLSSIT-----KLGFSTDSP-----  401
ident         |            |                                      
Sbjct FYDFLEVHP--PDVYKP--LYVK--DEEMIKnIIRSIVALGekldiPVVATGNVHylnpe  300
DSSP  HLLLEEELL--HHHHLL--LLLL--LHHHHHhHHHHHHHHHhhlllLEEELLLLLlllhh


DSSP  -------------------------LLLLLHHHHHHHHHhlllllhhhLLLHHHHHHHLL
Query -------------------------IEPADPWVSIDAAVnryvvdpgeRVSREEALHLYT  436
ident                                    |                | |     
Sbjct dkiyrkilihsqgganplnrhelpdVYFRTTNEMLDCFS---------FLGPEKAKEIVV  351
DSSP  hhhhhhhhhhllhhhllllllllllLLLLLHHHHHHHHH---------HHHHHHHHHHHL


DSSP  HHHHHhLLLL--------------------------------------------------
Query HGSAQvTLAE--------------------------------------------------  446
ident                                                             
Sbjct DNTQK-IASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerleke  410
DSSP  HHHHH-HHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct lksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcp  470
DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct nckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsg  530
DSSP  lllleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct eyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagc  590
DSSP  llhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct tgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldil  650
DSSP  llleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct ghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgt  710
DSSP  eehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct rfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyl  770
DSSP  hhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct iyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayv  830
DSSP  hhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct lmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakek  890
DSSP  hhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct slltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivra  950
DSSP  hhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhh


DSSP  ----------------------lllllllllllleeeellllll
Query ----------------------dlgklergfraeyiildrdplk  468
ident                                             
Sbjct reegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 53: Query=3icjA Sbjct=3dcpA Z-score=9.0

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh
Query AFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
ident    | | |                                                    
Sbjct XKRDGHTHTEFcpHGTH-------------------------------------------   17
DSSP  LLEEEEELLLLllLLLL-------------------------------------------


DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll
Query ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
ident                                                             
Sbjct ------------------------------------------------------------   17
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEE---------------------------eLHHH
Query tvkdykhYIESAQEHLLSLGVHSVGFMS---------------------------vGEKA  213
ident          |        |                                         
Sbjct ------dDVEEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttasxaxsdLPYY   71
DSSP  ------lLHHHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhlllllhhhHHHH


DSSP  HHHHHHHHhlLLLL--LEEEEEelhhhhhhhhhhlllleellleeeeeEEEELlllllll
Query LKALFELEreGRLK--MNVFAYlspelldkleelnlgkfegrrlriwgVXLFVdgslgar  271
ident  |                                                          
Sbjct FKKXNHIK--KKYAsdLLIHIG--------------------------FEVDY-------   96
DSSP  HHHHHHHH--HHLLllLEEEEE--------------------------EEEEL-------


DSSP  lllllllllllllllllllLLHHhHHHHHHHHLLLLL---eeEEEE--------------
Query tallsepytdnpttsgelvMNKDeIVEVIERAKPLGL---dvAVHA--------------  314
ident                                    |                        
Sbjct -------------------LIGY-EDFTRDFLNEYGPqtddgVLSLhflegqggfrsidf  136
DSSP  -------------------LLLL-HHHHHHHHHHHHHhlleeEEELleeeelleeeelll


DSSP  ---------------------lLHHHHHHHHHHhhHHLL--lLEEEELLL----------
Query ---------------------iGDKAVDVALDAfeEAEF--sGRIEHASL----------  341
ident                           |     |          |  | ||          
Sbjct saedynegivqfyggfeqaqlaYLEGVKQSIEA--DLGLfkpRRXGHISLcqkfqqffge  194
DSSP  lhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHL--LLLLlllLEELLLLHhhllhhhhll


DSSP  -----------lLHHHHHHHHHHLLEEEELLLHHhHLLLHhhhhhhhhhhhllLHHHHHH
Query -----------vRDDQLERIKELKVRISAQPHFIvSDWWIvnrvgeerakwayRLKTLSS  390
ident                 |   |                                     | 
Sbjct dtsdfseevxekFRVILALVKKRDYELDFNTAGL-FKPLC-----getyppkkIVTLASE  248
DSSP  lhhhllhhhhhhHHHHHHHHHHHLLEEEEELHHH-HLLLL-----llllllhhHHHHHHH


DSSP  H-LLEEELLLLL-llLLLHhhHHHHHhhlllllhhhlllHHHHhhhllhhhhhhllllll
Query I-TKLGFSTDSP-iePADPwvSIDAAvnryvvdpgervsREEAlhlythgsaqvtlaedl  448
ident          ||                                                 
Sbjct LqIPFVYGSDSHgvqDIGR--GYSTY-------------CQKL-----------------  276
DSSP  LlLLEEEELLLLlhhHLLL--LHHHH-------------HHHL-----------------


DSSP  lllllllllleeeellllll
Query gklergfraeyiildrdplk  468
ident                     
Sbjct -------------------e  277
DSSP  -------------------l


No 54: Query=3icjA Sbjct=3au2A Z-score=8.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  -------------------leeeeelleeeeeelleeeeleeeeelleeeeeeLHHHhHH
Query -------------------cmkalingtiytsfspvkkvsglvisnervlyagDSSTaLR   41
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRAL-PG  179
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLL-LL


DSSP  HH----------------------------------------------------------
Query IA----------------------------------------------------------   43
ident                                                             
Sbjct VEraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkng  239
DSSP  LLeeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   43
ident                                                             
Sbjct lqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteee  299
DSSP  leeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhh


DSSP  --------------------hhhlleeeelllleeEELEEEEEELH---HHHHhhhhlee
Query --------------------elaggeiidlkgkfvMPAFFDSHLHL---DELGmslemvd   80
ident                                         |   |    |          
Sbjct vyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysDGQN-------  352
DSSP  hhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLlllLLLL-------


DSSP  llllllhhhhhhhhhlllllleeeeeelhhhhlllllhhhhlllllleeeeelllleeee
Query lrgvksmeelvervkkgrgriifgfgwdqdelgrwptredldvidrpvflyrrcfhvavm  140
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhllllllleelllleeehhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHLL
Query nskmidllnlkpskdfdestgivreraleesrkiinekiltvkdykhYIESAQEHLLSLG  200
ident                                                  |   |     |
Sbjct -----------------------------------------------TLEELWEAAKTMG  365
DSSP  -----------------------------------------------LHHHHHHHHHHHL


DSSP  EEEEEEEE--------------eLHHHHHHHHHHHHlLLLLLEEEEEelhhhhhhhhhhl
Query VHSVGFMS--------------vGEKALKALFELEReGRLKMNVFAYlspelldkleeln  246
ident                          |                   |              
Sbjct YRYLAVTDhspavrvaggpspeeALKRVGEIRRFNE-THGPPYLLAG-------------  411
DSSP  LLEEEEEEelhhhhllllllhhhHHHHHHHHHHHHH-HHLLLEEEEE-------------


DSSP  llleellleeeeeEEEELLlllllllllllllllllllllllLLLLhhhhhhHHHHHLll
Query lgkfegrrlriwgVXLFVDgslgartallsepytdnpttsgeLVMNkdeiveVIERAKpl  306
ident                                                             
Sbjct -------------AEVDIH-----------------------PDGT---ldyPDWVLR-e  431
DSSP  -------------EEEELL-----------------------LLLL---lllLHHHHL-l


DSSP  llEEEEEE---------lLHHHHHHHHHHHhhhlLLLEEEELL-----------LLLHHH
Query glDVAVHA---------iGDKAVDVALDAFeeaeFSGRIEHAS-----------LVRDDQ  346
ident    | |              |    ||       |     |                   
Sbjct ldLVLVSVhsrfnlpkadQTKRLLKALENP----FVHVLAHPTarllgrrapieADWEAV  487
DSSP  llEEEEELlllllllhhhHHHHHHHHHLLL----LLLEELLLLlllllllllllLLHHHH


DSSP  HHHHHHHLLEEEELLLHHhhlllhhhhhhhhhhhhllLHHHHHH-HLLEEELLLLL-llL
Query LERIKELKVRISAQPHFIvsdwwivnrvgeerakwayRLKTLSS-ITKLGFSTDSP-ieP  404
ident     ||  |                                          |||      
Sbjct FQKAKEKGVAVEIDGYYD------------rmdlpddLARMAYGmGLWISLSTDAHqtdH  535
DSSP  HHHHHHHLLEEEEELLLL------------lllllhhHHHHHHHlLLLEEEELLLLlhhH


DSSP  LLH-HHHHHHHHHlllllhhHLLLhhhhhHHLLHhhhhhllLLLLlllllllllleeeel
Query ADP-WVSIDAAVNryvvdpgERVSreealHLYTHgsaqvtlAEDLgklergfraeyiild  463
ident           |                   | |         |||               
Sbjct LRFmELAVGTAQR-------AWIG--perVLNTL------dYEDL----------lswlk  570
DSSP  HHHhHHHHHHHHH-------LLLL--lllLHHHL------lHHHH----------hhhhh


DSSP  lllll
Query rdplk  468
ident      
Sbjct arrgv  575
DSSP  lllll


No 55: Query=3icjA Sbjct=1m65A Z-score=7.5

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELH-----HHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlll
Query aFFDSHLHL-----DELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrw  115
ident    | | |                                                    
Sbjct yPVDLHMHTvasthAYST------------------------------------------   18
DSSP  lLEELLLLLlllllLLLL------------------------------------------


DSSP  llhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhh
Query ptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkii  175
ident                                                             
Sbjct ------------------------------------------------------------   18
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhHHHHHHHHHHLLEEEEEEEE------------ELHHhHHHHHhhhhl
Query nekiltvkdykhyIESAQEHLLSLGVHSVGFMS------------VGEKaLKALFelere  223
ident                         |                                   
Sbjct -------------LSDYIAQAKQKGIKLFAITDhgpdmedaphhwHFIN-MRIWP----r   60
DSSP  -------------HHHHHHHHHHHLLLEEEEEEellllllllllhHHHH-HHHLL----l


DSSP  llLLLEEEEEelhhhhhhhhhhlllleellleeeeeEEEELlllllllllllllllllll
Query grLKMNVFAYlspelldkleelnlgkfegrrlriwgVXLFVdgslgartallsepytdnp  283
ident                                                             
Sbjct vvDGVGILRG--------------------------IEANI-------------------   75
DSSP  eeLLEEEEEE--------------------------EEEEL-------------------


DSSP  lllllllLLHHhHHHHhhhHLLLLL----eEEEEE--------llhHHHHHHHHHHHhhL
Query ttsgelvMNKDeIVEVierAKPLGL----dVAVHA--------igdKAVDVALDAFEeaE  331
ident         | |                                                 
Sbjct -------KNVD-GEID---CSGKMFdsldlIIAGFhepvfaphdkaTNTQAMIATIA--S  122
DSSP  -------LLLL-LLLL---LLHHHHhhlleEEEELlllllllllhhHHHHHHHHHHH--L


DSSP  LLL-EEEELLL----lLHHH-HHHHHHHLLEEEELLLHhhhlllhhhhhhhhhhhhllLH
Query FSG-RIEHASL----vRDDQ-LERIKELKVRISAQPHFivsdwwivnrvgeerakwayRL  385
ident      | |              |      |                              
Sbjct GNVhIISHPGNpkyeiDVKAvAEAAAKHQVALEINNSS--------------------NC  162
DSSP  LLLlEELLLLLlllllLHHHhHHHHHHHLLEEEEELLL--------------------LH


DSSP  HHHHH-----HLLEEELLLLLL-lLLLHhhhHHHHHHlllllhhHLLL--hhhhhHHLLH
Query KTLSS-----ITKLGFSTDSPI-ePADPwvsIDAAVNryvvdpgERVS--reealHLYTH  437
ident                   ||                                    |   
Sbjct REVAAavrdaGGWVALGSDSHTafTMGE---FEECLK-------ILDAvdfpperILNVS  212
DSSP  HHHHHhhhhhLLLEEEELLLLLhhHLLL---LHHHHH-------HHHHllllhhhLHHHL


DSSP  hhhhhlLLLLL----llllllLLLLeeeellllll
Query gsaqvtLAEDL----gklergFRAEyiildrdplk  468
ident       |   |          |             
Sbjct ---prrLLNFLesrgmapiaeFADL----------  234
DSSP  ---hhhHHHHHhhllllllhhHLLL----------


No 56: Query=3icjA Sbjct=2yb1A Z-score=5.1

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELH---hHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll
Query aFFDSHLHL---dELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
ident    | | |                                                    
Sbjct aNIDLHFHSrtsdGALT-------------------------------------------   17
DSSP  lLEELLLLLllllLLLL-------------------------------------------


DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhh
Query redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiine  177
ident                                                             
Sbjct ------------------------------------------------------------   17
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhHHHHHHHHLLEEEEEEEE-eLHHHHHHHHHHhhllLLLLEEEEEElh
Query kiltvkdykhyieSAQEHLLSLGVHSVGFMS-vGEKALKALFELeregRLKMNVFAYLsp  236
ident                                      |          |           
Sbjct -----------ptEVIDRAAARAPALLALTDhdCTGGLAEAAAA--aaRRGIPFLNGV--   62
DSSP  -----------hhHHHHHHHLLLLLEEEELLllLLLLHHHHHHH--hhHLLLLEEEEE--


DSSP  hhhhhhhhhlllleellleeeeeeEEELL-------------------------------
Query elldkleelnlgkfegrrlriwgvXLFVD-------------------------------  265
ident                            |                                
Sbjct ------------------------EVSVSwgrhtvhivglgidpaepalaaglksiregr   98
DSSP  ------------------------EEEEEelleeeeeeeellllllhhhhhhhhhhhllh


DSSP  ----------------------------------------------lllllllllllllL
Query ----------------------------------------------gslgartallsepY  279
ident                                                             
Sbjct lerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkylT  158
DSSP  hhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllL


DSSP  LLLLLLLLLLLLlhhHHHHHHHHHLLLLLEEeeeellhhhhhhhhhhhhhhllllEEEEL
Query TDNPTTSGELVMnkdEIVEVIERAKPLGLDVavhaigdkavdvaldafeeaefsgRIEHA  339
ident    |                       |                            | | 
Sbjct PGKPGYVSHQWA---SLEDAVGWIVGAGGMA------------------------VIAHP  191
DSSP  LLLLLLLLLLLL---LHHHHHHHHHHLLLEE------------------------EELLH


DSSP  -LLLLH-HHHHHHHHH-----lLEEE-ELLLHHhhlllhhhhhhhhhhhhllLHHHHHHH
Query -SLVRD-DQLERIKEL-----kVRIS-AQPHFIvsdwwivnrvgeerakwayRLKTLSSI  391
ident           ||            |  |                                
Sbjct gRYDMGrTLIERLILDfqaaggQGIEvASGSHS-----------------ldDMHKFALH  234
DSSP  hHLLLLhHHHHHHHHHhhhlllLEEEeEELLLL-----------------hhHHHHHHHH


DSSP  L-----LEEELLLLLL--lLLLHhhhhhhhhhlllllhhhlllhhhHHHHllhhhhHHLL
Query T-----KLGFSTDSPI--ePADPwvsidaavnryvvdpgervsreeALHLythgsaQVTL  444
ident             |                                               
Sbjct AdrhglYASSGSDFHApgeDVGH----------------------tEDLP--picrPIWR  270
DSSP  HhhhllEEEEELLLLLlllLLLL----------------------lLLLL--llllLHHH


DSSP  -LLLLlllllllllleeeellllll
Query -AEDLgklergfraeyiildrdplk  468
ident   |                      
Sbjct eLEAR-----------ilrpadaen  284
DSSP  hLHHH-----------lllllhhhl


No 57: Query=3icjA Sbjct=2anuA Z-score=4.4

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleEEE
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfVMP   60
ident                                                             
Sbjct ---------------------------------------------------------TEW    3
DSSP  ---------------------------------------------------------LEE


DSSP  LEEEEEEL---hhHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll
Query AFFDSHLH---ldELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
ident    | | |                                                    
Sbjct LLCDFHVHtnxsdGHLP-------------------------------------------   20
DSSP  EEEEEEELlllllLLLL-------------------------------------------


DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhh
Query redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiine  177
ident                                                             
Sbjct ------------------------------------------------------------   20
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhHHHHHHHHHhllEEEEEEEE---------------------------eL
Query kiltvkdykhyIESAQEHLLslgVHSVGFMS---------------------------vG  210
ident                        |  |                                 
Sbjct --------lgeVVDLFGKHG---VDVVSITDhivdrrtleqrkrngeplgaitedkfqdY   69
DSSP  --------hhhHHHHHHHLL---LLEEEEEEeeelhhhhhhhhhllllllllllllhhhH


DSSP  HHHHHHHHHHhhlLLLLLEEEEEElhhhhhhhhhhlllleellleeeeeeEEELLlllll
Query EKALKALFELereGRLKMNVFAYLspelldkleelnlgkfegrrlriwgvXLFVDgslga  270
ident  | |                                                        
Sbjct LKRLWREQKR-awEEYGXILIPGV--------------------------EITNN-----   97
DSSP  HHHHHHHHHH-hhHHHLLEEEEEE--------------------------EEEEL-----


DSSP  lllllllllllllllllllLLLHhHHHHHHHHHLlLLLEEeeeellhhhhhhhhhhhhhh
Query rtallsepytdnpttsgelVMNKdEIVEVIERAKpLGLDVavhaigdkavdvaldafeea  330
ident                            |  |  |                          
Sbjct ----tdlyhivavdvkeyvDPSL-PVEEIVEKLK-EQNAL--------------------  131
DSSP  ----llleeeeeellllllLLLL-LHHHHHHHHH-HLLLE--------------------


DSSP  lllLEEEELL-----lllhHHHHHHHHHLLEEE-ELLLHhhhlllhhhhhhhhhhhhlll
Query efsGRIEHAS-----lvrdDQLERIKELKVRIS-AQPHFivsdwwivnrvgeerakwayr  384
ident        |              || |        |                         
Sbjct ---VIAAHPDrkklswylwANXERFKDTFDAWEiANRDD--------------------l  168
DSSP  ---EEELLLLllllllhhhHLLLLLLLLLLEEEeEELLE--------------------e


DSSP  HHHHH-HHLLEEELLLLLL-LLLLHhhhhhhhhhlllllhhhlllhhhhhhHLLHhhhhh
Query LKTLS-SITKLGFSTDSPI-EPADPwvsidaavnryvvdpgervsreealhLYTHgsaqv  442
ident                |                                            
Sbjct FNSVGvKKYRYVANSDFHElWHVYS-------------------------wKTLV--kse  201
DSSP  LHHHHhLLLLEEEELLLLLhHHHLL-------------------------eEEEE--eel


DSSP  llLLLLlllllllllleeeellllll
Query tlAEDLgklergfraeyiildrdplk  468
ident    |                      
Sbjct knIEAI---keairkntdvaiylxrk  224
DSSP  llHHHH---hhhhhhllleeeeelll


No 58: Query=3icjA Sbjct=3e38A Z-score=4.2

back to top
DSSP  leeeeelleEEEEelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE
Query cmkalingtIYTSfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
ident                                                             
Sbjct -aqrrneiqVPDL------------------------------------------dgyTT   17
DSSP  -llllllllLLLL------------------------------------------lllEE


DSSP  LEEEEEELH---hHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll
Query AFFDSHLHL---dELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
ident    | | |      |                                             
Sbjct LKCDFHXHSvfsdGLVW-------------------------------------------   34
DSSP  EEEELLLLLllllLLLL-------------------------------------------


DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhh
Query redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiine  177
ident                                                             
Sbjct ------------------------------------------------------------   34
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhHHHHHHHHHHLLEEEEEEEEEL----------HHHHHHHHHHHhlLLLL
Query kiltvkdykhyIESAQEHLLSLGVHSVGFMSVG----------EKALKALFELEreGRLK  227
ident                       |                                     
Sbjct -----------PTVRVDEAYRDGLDAISLTEHIeyrphkqdvvSDHNRSFDLCR--EQAE   81
DSSP  -----------HHHHHHHHHHLLLLEELLEEELllllllllllLLLLHHHHHHH--HHHH


DSSP  ---LEEEEEE------------------lHHHHhhhhhhlllleellleeeeeeeeelll
Query ---MNVFAYL------------------sPELLdkleelnlgkfegrrlriwgvxlfvdg  266
ident                                |                            
Sbjct klgILLIKGSeitraxapghfnaiflsdsNPLE---------------------------  114
DSSP  hhlLEELLEEeeelllllleeeeelllllHHHL---------------------------


DSSP  llllllllllllllllllllllllllhHHHHHHHHHHLlLLLEEEeeellhhhhhhhhhh
Query slgartallsepytdnpttsgelvmnkDEIVEVIERAKpLGLDVAvhaigdkavdvalda  326
ident                                     ||                      
Sbjct --------------------------qKDYKDAFREAK-KQGAFX---------------  132
DSSP  --------------------------lLLHHHHHHHHH-HLLLEE---------------


DSSP  hhhhllllEEEELLL---LLHHHHHH-------hhhhlLEEE-ELLLHhhhlllhhhhhh
Query feeaefsgRIEHASL---VRDDQLER-------ikelkVRIS-AQPHFivsdwwivnrvg  375
ident            |        |                   |  |  |             
Sbjct --------FWNHPGWdsqQPDTTKWWpehtalyqegcxHGIEvANGHL------------  172
DSSP  --------EELLLLLlllLLLLLLLLhhhhhhhhllllLEEEeEELLE------------


DSSP  hhhhhhlllHHHHHHHL-----LEEELLLLLL------llllhHHHHhhhhhlllllhhh
Query eerakwayrLKTLSSIT-----KLGFSTDSPI------epadpWVSIdaavnryvvdpge  424
ident                             |                               
Sbjct --------yXPEAIQWCldknlTXIGTSDIHQpiqtdydfekgEHRT-------------  211
DSSP  --------eLLHHHHHHhhhllEEEEELLLLLlhhhhllhhhlLLLL-------------


DSSP  lllhhhhhhHLLHhhhhhllLLLL-----------------------------------l
Query rvsreealhLYTHgsaqvtlAEDL-----------------------------------g  449
ident                                                             
Sbjct ---------XTFV-fakersLQGIrealdnrrtaayfhelligredllrpffekcvkiee  261
DSSP  ---------EEEE-eellllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeee


DSSP  llllllllleeeeLLLLLL-----------------------------------------
Query klergfraeyiilDRDPLK-----------------------------------------  468
ident                  |                                          
Sbjct vsrneqgvtlsitNVTDLVlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdv  321
DSSP  eeeelleeeeeeeELLLLLeeeeelllllleellleeeellleeeeeeeeelllllllee


DSSP  ---------------------
Query ---------------------  468
ident                      
Sbjct nfevtnfivapdkglkytisl  342
DSSP  eeeeeeeeeelleeeeeeeel


No 59: Query=3icjA Sbjct=1bksA Z-score=4.1

back to top
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee
Query cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
ident                                                             
Sbjct -----------------------------------------------meryenlfaqlnd   13
DSSP  -----------------------------------------------lhhhhhhhhhhhh


DSSP  leeeeeelhhHHHH-HHHLeellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh
Query affdshlhldELGM-SLEMvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
ident            ||    |                                          
Sbjct rregafvpfvTLGDpGIEQ-----------------------------------------   32
DSSP  lllleeeeeeELLLlLHHH-----------------------------------------


DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhHHLL
Query dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiiNEKI  179
ident                                                             
Sbjct -----------------------------------slkiidtlidagadalelgvpFSDP   57
DSSP  -----------------------------------hhhhhhhhhhllllleeeellLLLL


DSSP  --------------llhhHHHHHHHHHHHHHHHLLE-EEEEEEeELHHHHH-----hHHH
Query --------------ltvkDYKHYIESAQEHLLSLGV-HSVGFMsVGEKALK-----aLFE  219
ident                                         |                   
Sbjct ladgptiqnanlrafaagVTPAQCFEMLALIREKHPtIPIGLL-MYANLVFnngidaFYA  116
DSSP  llllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHLLlLLEEEE-ELHHHHHlllhhhHHH


DSSP  HHhlllLLLEEEEEELHHHHHHHhhhLLLL---EELLleEEEEEEEELllllllllllll
Query LEregrLKMNVFAYLSPELLDKLeelNLGK---FEGRrlRIWGVXLFVdgslgartalls  276
ident                                                             
Sbjct RC---eQVGVDSVLVADVPVEES---APFRqaaLRHN--IAPIFICPP------------  156
DSSP  HH---hHHLLLEEEELLLLHHHL---HHHHhhhHHLL--LEEEEEELL------------


DSSP  llllllllllllllllhHHHHHHHHHHLlLLLE--EEEEellhhhhhHHHHHHHHHL---
Query epytdnpttsgelvmnkDEIVEVIERAKpLGLD--VAVHaigdkavdVALDAFEEAE---  331
ident                                                      |      
Sbjct -----------------NADDDLLRQVA-SYGRgyTYLL------alPLHHLIEKLKeyh  192
DSSP  -----------------LLLHHHHHHHH-HHLLllEEEL------llLHHHHHHHHHhhl


DSSP  -lLLEEE-ELLLLLhhhhHHHHHHLLEEEE-------------------llLHHHhlllh
Query -fSGRIE-HASLVRddqlERIKELKVRISA-------------------qpHFIVsdwwi  370
ident           |                                                 
Sbjct aaPALQGfGISSPE-qvsAAVRAGAAGAISgsaivkiieknlaspkqmlaeLRSF-----  246
DSSP  llLEEELlLLLLHH-hhhHHHHHLLLEEEEllhhhhhhhhllllhhhhhhhHHHH-----


DSSP  hhhhhhhhhhhlLLHHHHHhhlleeellllllllllhhhhhhhhhhlllllhhhlllhhh
Query vnrvgeerakwaYRLKTLSsitklgfstdspiepadpwvsidaavnryvvdpgervsree  430
ident                                                             
Sbjct ----------vsAMKAASR-----------------------------------------  255
DSSP  ----------hhHHHHLLL-----------------------------------------


DSSP  hhhhllhhhhhhlllllllllllllllleeeellllll
Query alhlythgsaqvtlaedlgklergfraeyiildrdplk  468
ident                                       
Sbjct --------------------------------------  255
DSSP  --------------------------------------