Results: dupa

Query: 3iacA

MOLECULE: GLUCURONATE ISOMERASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3iac-A 65.8  0.0  469   469  100 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
   2:  1j5s-A 49.7  1.3  449   451   33 PDB  MOLECULE: URONATE ISOMERASE;                                         
   3:  2qpx-A 22.2  3.4  324   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
   4:  2ob3-A 14.2  3.3  236   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   5:  3irs-A 14.1  3.5  240   281    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   6:  4dlf-A 14.0  3.0  219   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   7:  1bf6-A 13.7  3.5  238   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   8:  2y1h-B 13.6  3.6  225   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   9:  2vc5-A 13.3  3.5  238   314    8 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  10:  3k2g-B 13.1  3.8  255   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  11:  4mup-B 13.1  3.0  210   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  12:  3cjp-A 13.0  2.8  214   262    9 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  13:  2ffi-A 12.7  2.9  211   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  14:  1gkp-A 12.6  3.9  243   458    7 PDB  MOLECULE: HYDANTOINASE;                                              
  15:  3gri-A 12.3  3.5  226   422   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  16:  2dvt-A 12.3  3.9  228   325   11 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  17:  1itq-A 12.3  3.4  238   369   10 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  18:  3giq-A 12.3  3.5  244   475   14 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  19:  4b3z-D 12.2  4.1  245   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  20:  2vun-A 12.2  3.5  217   385    9 PDB  MOLECULE: ENAMIDASE;                                                 
  21:  3gg7-A 12.1  3.7  216   243   15 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  22:  1onx-A 12.0  3.2  224   390   11 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  23:  3pnu-A 12.0  3.5  220   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  4ofc-A 11.9  3.8  234   335    7 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  25:  4hk5-D 11.9  4.2  237   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  26:  2paj-A 11.9  3.7  225   421    8 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  27:  4qrn-A 11.7  3.8  230   352    7 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  28:  4c5y-A 11.6  4.0  239   436   10 PDB  MOLECULE: OCHRATOXINASE;                                             
  29:  2gwg-A 11.6  3.4  221   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  30:  3ls9-A 11.2  3.9  230   453   11 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  31:  1j6p-A 11.1  3.7  218   407    9 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  3nqb-A 11.1  3.4  217   587   11 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  33:  1yrr-B 10.9  3.4  208   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  34:  2imr-A 10.9  3.5  219   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  35:  1k6w-A 10.8  4.0  228   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  36:  4cqb-A 10.8  3.9  227   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  37:  3mkv-A 10.7  3.8  224   414    8 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  38:  2ogj-A 10.4  3.7  221   379   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  39:  4dzi-C 10.4  4.4  234   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  40:  2oof-A 10.3  4.0  216   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  41:  3mtw-A 10.1  4.0  214   404    7 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  42:  3qy6-A  9.9  3.0  184   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  43:  1a5k-C  9.8  3.6  231   566    9 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  44:  3e74-A  9.7  3.6  224   429   12 PDB  MOLECULE: ALLANTOINASE;                                              
  45:  1a4m-A  9.7  4.2  226   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  46:  3icj-A  9.6  3.6  206   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  47:  2uz9-A  9.5  4.5  230   444    9 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  48:  3au2-A  8.0  4.1  202   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  49:  3ooq-A  7.1  4.0  190   384    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  4rdv-B  6.6  4.2  223   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  51:  2a3l-A  6.6  4.7  265   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  1m65-A  6.4  3.5  167   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  53:  3dcp-A  5.5  3.9  170   277    7 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  3f2b-A  5.5  3.7  162   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1v77-A  5.3  3.7  158   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  56:  3e38-A  4.3  3.8  156   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  57:  2anu-A  4.3  3.6  139   224    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  1bks-A  4.2  3.9  138   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  59:  2yb1-A  3.8  4.3  149   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3iacA Sbjct=3iacA Z-score=65.8

back to top
DSSP  LLLLLLLLLLLLHHHHHHHHHLLLLLLEEELLLLLLHHHHHHLLLLLLHHHHHHLLLLHH
Query ATFXTEDFLLKNDIARTLYHKYAAPXPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYK   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ATFXTEDFLLKNDIARTLYHKYAAPXPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYK   60
DSSP  LLLLLLLLLLLLHHHHHHHHHLLLLLLEEELLLLLLHHHHHHLLLLLLHHHHHHLLLLHH


DSSP  HHHHHHLLLLHHHLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLLLLLL
Query WRALRSAGVDESLITGKETSDYEKYXAWANTVPKTLGNPLYHWTHLELRRPFGITGTLFG  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct WRALRSAGVDESLITGKETSDYEKYXAWANTVPKTLGNPLYHWTHLELRRPFGITGTLFG  120
DSSP  HHHHHHLLLLHHHLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLLLLLL


DSSP  HHHHHHHHHHHHHHHLLHHHLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHLLLLLLEE
Query PDTAESIWTQCNEKLATPAFSARGIXQQXNVRXVGTTDDPIDSLEYHRQIAADDSIDIEV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PDTAESIWTQCNEKLATPAFSARGIXQQXNVRXVGTTDDPIDSLEYHRQIAADDSIDIEV  180
DSSP  HHHHHHHHHHHHHHHLLHHHLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHLLLLLLEE


DSSP  ELLLLLHHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHLLLLEEEEE
Query APSWRPDKVFKIELDGFVDYLRKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHG  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct APSWRPDKVFKIELDGFVDYLRKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHG  240
DSSP  ELLLLLHHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHLLLLEEEEE


DSSP  ELLLLLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEEL
Query IETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVXQLHIG  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IETLRFAPVPDDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVXQLHIG  300
DSSP  ELLLLLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEEL


DSSP  EELLLLHHHHHHHLLLLLLLEELLLLLHHHHHHHHHHHHLLLLLLEEEEEELLHHHHHHH
Query AIRNNNTRXFRLLGPDTGFDSIGDNNISWALSRLLDSXDVTNELPKTILYCLNPRDNEVL  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AIRNNNTRXFRLLGPDTGFDSIGDNNISWALSRLLDSXDVTNELPKTILYCLNPRDNEVL  360
DSSP  EELLLLHHHHHHHLLLLLLLEELLLLLHHHHHHHHHHHHLLLLLLEEEEEELLHHHHHHH


DSSP  HHHHHHLLLLLLLLLEEELLLLHHHLLHHHHHHHHHHHHHHLLHHHLLLLLLLLLLLLLL
Query ATXIGNFQGPGIAGKVQFGSGWWFNDQKDGXLRQLEQLSQXGLLSQFVGXLTDSRSFLSY  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ATXIGNFQGPGIAGKVQFGSGWWFNDQKDGXLRQLEQLSQXGLLSQFVGXLTDSRSFLSY  420
DSSP  HHHHHHLLLLLLLLLEEELLLLHHHLLHHHHHHHHHHHHHHLLHHHLLLLLLLLLLLLLL


DSSP  HHHHHHHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHLHHHHHHLLLL
Query TRHEYFRRILCNLLGQWAQDGEIPDDEAXLSRXVQDICFNNAQRYFTIK  469
ident |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TRHEYFRRILCNLLGQWAQDGEIPDDEAXLSRXVQDICFNNAQRYFTIK  469
DSSP  HHHHHHHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHLHHHHHHLLLL


No 2: Query=3iacA Sbjct=1j5sA Z-score=49.7

back to top
DSSP  LLLLLLLLLLLLHHHHHHHHhLLLLLLEEELLLLLLHHHHHHLLLLLLHHHHHHLLLLHH
Query ATFXTEDFLLKNDIARTLYHkYAAPXPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYK   60
ident   |  || || |  |  |        || | | ||    |                ||| 
Sbjct HMFLGEDYLLTNRAAVRLFN-EVKDLPIVDPHNHLDAKDIVENKPWNDIWEVEGATDHYV   59
DSSP  LLLLLLLLLLLLHHHHHHHH-HHLLLLEEELLLLLLHHHHHHLLLLLLHHHHHLLLLHHH


DSSP  HHHHHHLLLLHHHLLLlLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLlLLLL
Query WRALRSAGVDESLITGkETSDYEKYXAWANTVPKTLGNPLYHWTHLELRRPFGITgTLFG  120
ident |   |  || |  |||   |  ||  | |   |   ||| | | || | | | |      
Sbjct WELMRRCGVSEEYITG-SRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIK-KVIS  117
DSSP  HHHHHHLLLLHHHLLL-LLLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHLLLL-LLLL


DSSP  HHHHHHHHHHHHHHHLLhhHLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHLlLLLLEE
Query PDTAESIWTQCNEKLATpaFSARGIXQQXNVRXVGTTDDPIDSLEYHRQIAADdSIDIEV  180
ident   ||| ||     ||               |    |||||   || ||            
Sbjct EETAEEIWEETKKKLPE--MTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEA-VEGVTI  174
DSSP  HHHHHHHHHHHHHHLLL--LLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHH-LLLLEE


DSSP  ELLLLLHHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHLLLLEEEEE
Query APSWRPDKVFKIELDGFVDYLRKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHG  240
ident  | ||||        |   |  |            |    ||     ||   || |||| 
Sbjct LPTWRPDRAMNVDKEGWREYVEKMGERYGEDTSTLDGFLNALWKSHEHFKEHGCVASDHA  234
DSSP  ELLLLLHHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHLLLLLEEEEE


DSSP  ELLLLLLLLLlHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEEL
Query IETLRFAPVPdDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVXQLHIG  300
ident         |       |   |   || |   ||        |  |       || |||||
Sbjct LLEPSVYYVD-ENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHIG  293
DSSP  ELLLLLLLLL-HHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEEL


DSSP  EELLLLHHHHHHHLLLLLLLEELL-LLLHHHHHHHHHHHHlllLLLEEEEEELLHHHHHH
Query AIRNNNTRXFRLLGPDTGFDSIGD-NNISWALSRLLDSXDvtnELPKTILYCLNPRDNEV  359
ident | |      |  |||| | |       |   |   |   |      |  || | |     
Sbjct ALRDYRDSLFKTLGPDSGGDISTNfLRIAEGLRYFLNEFD---GKLKIVLYVLDPTHLPT  350
DSSP  EELLLLHHHHHHLLLLLLLLEELLlLLHHHHHHHHHHHLL---LLLLEEEEELLHHHHHH


DSSP  HHHHHHHLLllllllLEEELLLLHHHLLHHHHHHHHHHHHHHLLHHHLLLLLLLLLLLLL
Query LATXIGNFQgpgiagKVQFGSGWWFNDQKDGXLRQLEQLSQXGLLSQFVGXLTDSRSFLS  419
ident   |    |        |  |  |||||   |    |  |    ||    |  ||||  ||
Sbjct ISTIARAFP------NVYVGAPWWFNDSPFGMEMHLKYLASVDLLYNLAGMVTDSRKLLS  404
DSSP  HHHHHHHLL------LEEELLLLLLLLLHHHHHHHHHHHHLLLLHHHLLLLLLLLLLLLH


DSSP  L-HHHHHHHHHHHHHHHHHHHLLLLLllHHHHHHHHHHHHLHHHHHHLLll
Query Y-TRHEYFRRILCNLLGQWAQDGEIPddEAXLSRXVQDICFNNAQRYFTik  469
ident    | | ||| | |  |     | ||         |           |   
Sbjct FgSRTEMFRRVLSNVVGEMVEKGQIP--IKEARELVKHVSYDGPKALFF--  451
DSSP  HhHHHHHHHHHHHHHHHHHHHLLLLL--HHHHHHHHHHHHLHHHHHHHL--


No 3: Query=3iacA Sbjct=2qpxA Z-score=22.2

back to top
DSSP  llllllllllllhhhhHHHHhLLLLLLEEELLLLLLhhhhhhlLLLLLhhHHHHL--LLL
Query atfxtedfllkndiarTLYHkYAAPXPIYDFHCHLSpqeiaddRRFDNlgQIWLE--GDH   58
ident                  |        |  | |||                          
Sbjct -------------gxdDLSE-FVDQVPLLDHHCHFL------iDGKVP--NRDDRlaQVS   38
DSSP  -------------lllLLHH-HHHHLLEEEEEELLL------lLLLLL--LHHHHhhHHL


DSSP  H---hhHHHHHllllhhhlllllllhhhhhhhhhhhhhhLLLLHHHHHHHHHHHlLLLLl
Query Y---kwRALRSagvdeslitgketsdyekyxawantvpkTLGNPLYHWTHLELRrPFGIt  115
ident         |                                         |         
Sbjct TeadkdYPLAD---------------------------tKNRLAYHGFLALAKE-FALD-   69
DSSP  LlllllLLHHH---------------------------hLLLHHHHHHHHHHHH-HLLL-


DSSP  lllllhhhhhhhHHHHhhhHLLHHHL--HHHHHHHLLEEEEELLLL--lllllhHHHHHh
Query gtlfgpdtaesiWTQCnekLATPAFS--ARGIXQQXNVRXVGTTDD--pidsleYHRQIa  171
ident                       |        |                         |  
Sbjct ------------ANNPlaaXNDPGYAtyNHRIFGHFHFKELLIDTGfvpddpilDLDQT-  116
DSSP  ------------LLLLlllLLHHHHHhhHHHHHHHLLEEEEEEELLllllllllLHHHH-


DSSP  hllllLLEEELLLLLHHHHllllllhhhHHHHhhhhhlllLLLHHHHHHHHHHHHHHHHH
Query addsiDIEVAPSWRPDKVFkieldgfvdYLRKleaaadvsITRFDDLRQALTRRLDHFAA  231
ident       | |    |                             |    ||         |
Sbjct -aelvGIPVKAIYRLETHA-------edFXLE--------HDNFAAWWQAFSNDVKQAKA  160
DSSP  -hhhhLLLEEEEEEHHHHH-------hhHHLL--------LLLHHHHHHHHHHHHHLLLL


DSSP  LLLLEEEEEEL---LLLLLLLLlHHHHHHHHHHHHLLLLllhhhHHHHHHHHHHHHHHHH
Query CGCRASDHGIE---TLRFAPVPdDAQLDAILGKRLAGETlseleIAQFTTAVLVWLGRQY  288
ident  |             |   ||       |                       |       
Sbjct HGFVGFXSIAAyrvGLHLEPVN-VIEAAAGFDTWKHSGE-krltSKPLIDYXLYHVAPFI  218
DSSP  LLLLLEEELHHhhlLLLLLLLL-HHHHHHHHHHHHHHLL-llllLHHHHHHHHHHHHHHH


DSSP  HHHLLEEEEEEL-EELLllhhhhhhhllllllleELLLL-LHHHHHHHHHHHHllLLLLE
Query AARGWVXQLHIG-AIRNnntrxfrllgpdtgfdsIGDNN-ISWALSRLLDSXDvtNELPK  346
ident  |     | | |                                    |          |
Sbjct IAQDXPLQFHVGyGDAD-----------------TDXYLgNPLLXRDYLKAFT--KKGLK  259
DSSP  HHHLLLEEEEELlLLLL-----------------LLHHHlLHHHHHHHHHHHH--HHLLL


DSSP  EEE-EELLhhHHHHHHHHHHHLLllllllLEEELLlLHHH--LLHHhHHHHHHHHHHHLL
Query TIL-YCLNprDNEVLATXIGNFQgpgiagKVQFGSgWWFN--DQKDgXLRQLEQLSQXGL  403
ident   |  |               |          |                |          
Sbjct VVLlHCYP--YHREAGYLASVFP------NLYFDI-SLLDnlGPSG-ASRVFNEAVELAP  309
DSSP  EEEeELLL--LHHHHHHHHHHLL------LEEEEL-LLHHhhLHHH-HHHHHHHHLLLLL


DSSP  HhHLLLLLLLLL-LLLL-LHHHHHHHHHHHHHHHHHhhlllLLLLHHHHHHHHHHHHLHH
Query LsQFVGXLTDSR-SFLS-YTRHEYFRRILCNLLGQWaqdgeIPDDEAXLSRXVQDICFNN  461
ident          |              |   |     |         | |        ||   
Sbjct Y-TRILFASDAStYPEXyGLAARQFKQALVAHFNQL-----PFVDLAQKKAWINAICWQT  363
DSSP  H-HHEELLLLLLlLHHHhHHHHHHHHHHHHHHHHLL-----LLLLHHHHHHHHHHHHLHH


DSSP  HHHHLL-----ll
Query AQRYFT-----ik  469
ident              
Sbjct SAKLYHqerelrv  376
DSSP  HHHHLLlhhhhll


No 4: Query=3iacA Sbjct=2ob3A Z-score=14.2

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL---------------hhhhHHLLl
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLS---------------pqeiADDRr   45
ident                                | |                          
Sbjct -----------drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkaLAEK-   48
DSSP  -----------lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhHHHH-


DSSP  lllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhh
Query fdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwth  105
ident                                                             
Sbjct ------------------------------------------------------------   48
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLL--LLL
Query lelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDP--IDS  163
ident                                              ||             
Sbjct ---------------------------------avRGLRRARAAGVRTIVDVSTFdiGRD   75
DSSP  ---------------------------------hhHHHHHHHHLLLLEEEELLLHhhLLL


DSSP  LHHHHHHHHLllLLLEEELLLLLHHHhllllllHHHHHHhhhhhhllllllhhhHHHHHH
Query LEYHRQIAADdsIDIEVAPSWRPDKVfkieldgFVDYLRkleaaadvsitrfddLRQALT  223
ident              |                                            ||
Sbjct VSLLAEVSRA--ADVHIVAATGLWFD------pPLSMRL--------------rSVEELT  113
DSSP  HHHHHHHHHH--HLLEEELEEELLLL------lLHHHHL--------------lLHHHHH


DSSP  HHHHHHHH-------LLLLEEEEEELLLLllllllhhhhhhhhhhhhllllllhhhhHHH
Query RRLDHFAA-------CGCRASDHGIETLRfapvpddaqldailgkrlagetlseleiAQF  276
ident                                                            |
Sbjct QFFLREIQygiedtgIRAGIIXVATTGKA----------------------------TPF  145
DSSP  HHHHHHHHlllllllLLLLEEEEELLLLL----------------------------LHH


DSSP  HHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleelLLLLHHHHHHHHH
Query TTAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigDNNISWALSRLLD  336
ident    ||    |   | |     |                                      
Sbjct QELVLKAAARASLATGVPVTTHTA----------------------aSQRDGEQQAAIFE  183
DSSP  HHHHHHHHHHHHHHHLLLEEEELL----------------------hHHLHHHHHHHHHH


DSSP  HHhllLLLL-EEEEEE--LLHHhHHHHHHHHHHllllllllLEEELL-LLHH--------
Query SXdvtNELP-KTILYC--LNPRdNEVLATXIGNfqgpgiagKVQFGS-GWWF--------  384
ident |       |                 |                  |              
Sbjct SE---GLSPsRVCIGHsdDTDD-LSYLTALAAR--------GYLIGLdHIPYsaigledn  231
DSSP  HL---LLLHhHEEELLhhHLLL-HHHHHHHHHL--------LLEEEElLLLLllllllll


DSSP  ---------hlLHHHHHhHHHHHHHHLLHhHLLLLLLLLLL------------------l
Query ---------ndQKDGXLrQLEQLSQXGLLsQFVGXLTDSRS------------------f  417
ident                 |     |   |          |                      
Sbjct asasallgirsWQTRAL-LIKALIDQGYM-KQILVSNDWTFgfssyvtnimdvmdrvnpd  289
DSSP  hhhhhhhllllHHHHHH-HHHHHHHLLLH-HHEEELLLLLLeellllllhhhhhhhhlll


DSSP  LLLHHHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLLL--
Query LSYTRHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTIK--  469
ident             |                          |   |  |       
Sbjct GMAFIPLRVIPFLREKG--------------vPQETLAGITVTNPARFLSPTlr  329
DSSP  HHHHHHHLHHHHHHHLL--------------lLHHHHHHHHLHHHHHHHLLLll


No 5: Query=3iacA Sbjct=3irsA Z-score=14.1

back to top
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLLLHHhhhhllllllhhhhHHLLL-LH
Query atfxtedfllkndiartlyhkyaapXPIYDFHCHLSPQeiaddrrfdnlgqiWLEGD-HY   59
ident                            | ||                             
Sbjct -------------------------LKIIDFRLRPPAM----gflnariytrPDIRNrFT   31
DSSP  -------------------------LLLEELLLLLLLH----hhhhlhhhhlHHHHHhHH


DSSP  HHhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhHHHHhhhhllllllllll
Query KWralrsagvdeslitgketsdyekyxawantvpktlgnplyHWTHlelrrpfgitgtlf  119
ident                                                             
Sbjct RQ---------------------------------------lGFEP--------------   38
DSSP  HH---------------------------------------hLLLL--------------


DSSP  lhhhhhhhhhhhhhhhllhhHLHHHHHHHLLEEEEELLLLL------lLLLHHHHHHHHl
Query gpdtaesiwtqcneklatpaFSARGIXQQXNVRXVGTTDDP------iDSLEYHRQIAAd  173
ident                                                           | 
Sbjct -----------apsaeekslELMFEEMAAAGIEQGVCVGRNssvlgsvSNADVAAVAKA-   86
DSSP  -----------lhhhhhllhHHHHHHHHHLLLLEEEEELLEellleelLHHHHHHHHHH-


DSSP  llLLLEEELLLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHHLL
Query dsIDIEVAPSWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLDHFAACG  233
ident         |                                    |             |
Sbjct --YPDKFHPVGSIEAA----------------------------TRKEAMAQMQEILDLG  116
DSSP  --LLLLEEEEEELLLL----------------------------LHHHHHHHHHHHHHLL


DSSP  LLEEEEEEL-----LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHH
Query CRASDHGIE-----TLRFapvpddaqldailgkrlagetlseleiaqftTAVLVWLGRQY  288
ident  |                                                  |  |    
Sbjct IRIVNLEPGvwatpMHVD-------------------------------DRRLYPLYAFC  145
DSSP  LLLEEELHHhllllLLLL-------------------------------LHHHHHHHHHH


DSSP  HHHLLEEEEEE---LEELlllhhhhhhhllllllleeLLLLLHHHHHHHHHHHHllllLL
Query AARGWVXQLHI---GAIRnnntrxfrllgpdtgfdsiGDNNISWALSRLLDSXDvtneLP  345
ident    |                                           | |          
Sbjct EDNGIPVIMMTggnAGPD-------------------ITYTNPEHIDRVLGDFP----DL  182
DSSP  HHLLLLEEEELlllLLLL-------------------HHHHLHHHHHHHHHHLL----LL


DSSP  EEEE--EELLhhHHHHHHHHHHHLLllllllLEEELLlLHHHLLHHHHHHHHHHHHHhlL
Query KTIL--YCLNprDNEVLATXIGNFQgpgiagKVQFGSgWWFNDQKDGXLRQLEQLSQxgL  403
ident                                               |             
Sbjct TVVSshGNWP--WVQEIIHVAFRRP------NLYLSP-DMYLYNLPGHADFIQAANS--F  231
DSSP  LEEEehHHLL--LHHHHHHHHHHLL------LEEEEL-HHHHLLLLLHHHHHHHHLL--H


DSSP  HHHLLLLLLLLLLlLLLHHHHHHHHHHHhhhhhhhhlllllllhhhHHHHHHHHHLHHHH
Query LSQFVGXLTDSRSfLSYTRHEYFRRILCnllgqwaqdgeipddeaxLSRXVQDICFNNAQ  463
ident |       |           | |                              |   || 
Sbjct LADRMLFGTAYPMcPLKEYTEWFLTLPI------------------KPDAMEKILHGNAE  273
DSSP  HHHLLLLLLLLLLlLHHHHHHHHHLLLL------------------LHHHHHHHHLHHHH


DSSP  HHLLLL--
Query RYFTIK--  469
ident |       
Sbjct RLLAQAgr  281
DSSP  HHHHHLll


No 6: Query=3iacA Sbjct=4dlfA Z-score=14.0

back to top
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLLLhhhhhhllllllhhhhHHLLllhh
Query atfxtedfllkndiartlyhkyaapXPIYDFHCHLSpqeiaddrrfdnlgqiWLEGdhyk   60
ident                              | | |                          
Sbjct -------------------------ALRIDSHQHFW---ryraadypwigagMGVL----   28
DSSP  -------------------------LLLEEEEELLL---lllhhhlllllllLHHH----


DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll
Query wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
ident                                                             
Sbjct ------------------------------------------------------------   28
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL---LLLL---lLHHHHHHhhll
Query pdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD---DPID---sLEYHRQIaadd  174
ident                                                  ||         
Sbjct -------------ardylpdALHPLMHAQALGASIAVQaraGRDEtaflLELACDE----   71
DSSP  -------------lllllhhHHHHHHHHLLLLEEEEELlllLHHHhhhhHHHHLLL----


DSSP  llLLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHLLL
Query siDIEVAPSWRPDkvfkieldgfvdylrkleaaadvsitrfddlRQALTRRLDHFAACGC  234
ident       |     |                                  |  |         
Sbjct --ARIAAVVGWED-----------------------------lrAPQLAERVAEWRGTKL  100
DSSP  --LLEEEEEELLL-----------------------------llLLLHHHHHHLLLLLLE


DSSP  LEEEEEEL---LLLLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHH
Query RASDHGIE---TLRFapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAAR  291
ident |   |        |                                 |          | 
Sbjct RGFRHQLQdeaDVRA----------------------------fvDDADFARGVAWLQAN  132
DSSP  EEEEELHHhllLHHH----------------------------hhHLHHHHHHHHHHHHL


DSSP  LLEEEEEELeellllhhhhhhhllllllleelllLLHHHHHHHHHHHHllllLLEEEEE-
Query GWVXQLHIGairnnntrxfrllgpdtgfdsigdnNISWALSRLLDSXDvtneLPKTILY-  350
ident   |                                            |         |  
Sbjct DYVYDVLVF------------------------eRQLPDVQAFCARHD----AHWLVLDh  164
DSSP  LLEEEELLL------------------------hHHHHHHHHHHHHLL----LLLEEEHh


DSSP  -ELLH------------HHHHHHhHHHHHLLllllllLEEELL-lLHHH---------lL
Query -CLNP------------RDNEVLaTXIGNFQgpgiagKVQFGS-gWWFN---------dQ  387
ident                  |    |               |                     
Sbjct aGKPAlaefdrddtalaRWRAAL-RELAALP------HVVCKLsgLVTEadwrrglrasD  217
DSSP  hHLLLhhhllllllhhhHHHHHH-HHHHLLL------LEEEEEllLLLLllllllllhhH


DSSP  HHHHHHHHHHHHHHLLhHHLLLLLLLLLL----lLLLHHHHHHHHHHHHHHhhhhhllll
Query KDGXLRQLEQLSQXGLlSQFVGXLTDSRS----fLSYTRHEYFRRILCNLLgqwaqdgei  443
ident        |          |      |                  |     |         
Sbjct LRHIEQCLDAALDAFG-PQRLMFGSDWPVcllaaSYDEVASLVERWAESRL---------  267
DSSP  HHHHHHHHHHHHHHHL-HHHEEELLLLLHhhhllLHHHHHHHHHHHHHHHL---------


DSSP  lllhhhHHHHHHHHHLHHHHHHLLll
Query pddeaxLSRXVQDICFNNAQRYFTik  469
ident                   | |     
Sbjct ------SAAERSALWGGTAARCYAlp  287
DSSP  ------LHHHHHHHLLHHHHHHLLll


No 7: Query=3iacA Sbjct=1bf6A Z-score=13.7

back to top
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLLL------------hhHHHHLlllll
Query atfxtedfllkndiartlyhkyaapXPIYDFHCHLS------------pqEIADDrrfdn   48
ident                                | ||                         
Sbjct ---------------------sfdpTGYTLAHEHLHidlsgfknnvdcrlDQYAF-----   34
DSSP  ---------------------llllLLEEEEEELLLeelhhhhllhhheeLLHHH-----


DSSP  hhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhh
Query lgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlel  108
ident                                                             
Sbjct ------------------------------------------------------------   34
DSSP  ------------------------------------------------------------


DSSP  hlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLLL--LLLHH
Query rrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDPI--DSLEY  166
ident                                           || |              
Sbjct ------------------------------icQEMNDLMTRGVRNVIEMTNRYmgRNAQF   64
DSSP  ------------------------------hhHHHHHHHHLLEEEEEELLLHHhlLLHHH


DSSP  HHHHHHLllLLLEEELLLLLHhhHLLLlllhhhHHHHhhhhhllllllHHHHHHHHHHHH
Query HRQIAADdsIDIEVAPSWRPDkvFKIEldgfvdYLRKleaaadvsitrFDDLRQALTRRL  226
ident            | |                                       | |    
Sbjct MLDVMRE--TGINVVACTGYY--QDAF------FPEH----------vATRSVQELAQEM  104
DSSP  HHHHHHH--HLLEEEEEELLL--LHHH------LLLH----------hHHLLHHHHHHHH


DSSP  HHHHH-------LLLLEE-EEEE-LLLLllllllhhhhhhhhhhhhllllllhhhhHHHH
Query DHFAA-------CGCRAS-DHGI-ETLRfapvpddaqldailgkrlagetlseleiAQFT  277
ident                      |  |                                   
Sbjct VDEIEqgidgteLKAGIIaEIGTsEGKI----------------------------TPLE  136
DSSP  HHHHHlllllllLLEEEEeEEELlLLLL----------------------------LHHH


DSSP  HHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhhllllllleellllLHHHHHHHHHH
Query TAVLVWLGRQYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDS  337
ident   |           |     |                                   ||  
Sbjct EKVFIAAALAHNQTGRPISTHTSF-----------------------stMGLEQLALLQA  173
DSSP  HHHHHHHHHHHHHHLLLEEEELHH-----------------------hlLHHHHHHHHHH


DSSP  HhllLLLL-EEEE--EELLHhHHHHHHHHHHHLllllllllEEELLLL----hHHLLhHH
Query XdvtNELP-KTIL--YCLNPrDNEVLATXIGNFqgpgiagkVQFGSGW----wFNDQkDG  390
ident                  |           |                              
Sbjct H---GVDLsRVTVghCDLKD-NLDNILKMIDLG--------AYVQFDTigknsYYPD-EK  220
DSSP  L---LLLHhHEEEllLLLLL-LHHHHHHHHHLL--------LEEEELLlllllLLLH-HH


DSSP  HHHHHHHHHHHLLHhHLLLLLLLLLL---------lLLLHHHHHHHHHHHHHHhhhhhll
Query XLRQLEQLSQXGLLsQFVGXLTDSRS---------fLSYTRHEYFRRILCNLLgqwaqdg  441
ident     |  |   |||   |    |                     |   |           
Sbjct RIAMLHALRDRGLL-NRVMLSMDITRrshlkanggyGYDYLLTTFIPQLRQSG-------  272
DSSP  HHHHHHHHHHLLLH-HHEEELLLLLLhhhlhhhlllLLLHHHHLHHHHHHHLL-------


DSSP  lllllhhhHHHHHHHHHLHHHHHHLLll
Query eipddeaxLSRXVQDICFNNAQRYFTik  469
ident             |      |    |   
Sbjct -------fSQADVDVMLRENPSQFFQ--  291
DSSP  -------lLHHHHHHHHLHHHHHHLL--


No 8: Query=3iacA Sbjct=2y1hB Z-score=13.6

back to top
DSSP  llllllllllllhhhhhhhhhlllLLLEEELLLLLLhhhhHHLLllllhhhhhhllllhh
Query atfxtedfllkndiartlyhkyaaPXPIYDFHCHLSpqeiADDRrfdnlgqiwlegdhyk   60
ident                              | |||||      |                 
Sbjct ------------------------GVGLVDCHCHLSapdfDRDL----------------   20
DSSP  ------------------------LLLEEEEEELLLlhhhLLLH----------------


DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll
Query wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
ident                                                             
Sbjct ------------------------------------------------------------   20
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL-LLLL---lLHHHHHHHhllll
Query pdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD-DPID---sLEYHRQIAaddsi  176
ident                              ||                             
Sbjct -------------------dDVLEKAKKANVVALVAVAeHSGEfekiMQLSERYN-----   56
DSSP  -------------------hHHHHHHHHLLEEEEEELLlLHHHhhhhHHHHHHLL-----


DSSP  lLEEELLLLLHhhHLLLLLLHhhhhhhhhhhhllllllhhHHHHHHHHHHHHHHHlLLLE
Query dIEVAPSWRPDkvFKIELDGFvdylrkleaaadvsitrfdDLRQALTRRLDHFAAcGCRA  236
ident    | |           ||                                        |
Sbjct -GFVLPCLGVH--PVQGLDQR---------------svtlKDLDVALPIIENYKD-RLLA   97
DSSP  -LLEEEEELLL--LEELLLLE---------------ellhHHHHHHHHHHHHHLL-LLLE


DSSP  E-EEEELLllllllllhhhhhhhhhhhhlllllLHHHHHHHHHHHHHHHHHHHHHHLLEE
Query S-DHGIETlrfapvpddaqldailgkrlagetlSELEIAQFTTAVLVWLGRQYAARGWVX  295
ident     |                               |       ||              
Sbjct IgEVGLDF--------------------sprfaGTGEQKEEQRQVLIRQIQLAKRLNLPV  137
DSSP  EeEEEEEL--------------------lllllLLHHHHHHHHHHHHHHHHHHHHHLLLE


DSSP  EEEELEellllhhhhhhhllllllleellllLHHHHHHHHHHHHllllLLEEE-EEELlh
Query QLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXDvtneLPKTI-LYCLnp  354
ident   |                                   ||          |         
Sbjct NVHSRS-------------------------AGRPTINLLQEQG----AEKVLlHAFD--  166
DSSP  EEEEEL-------------------------LHHHHHHHHHHLL----LLLEEeELLL--


DSSP  hHHHHHHHHHHHLLlllllllEEELLllhhhLLHHH--HHHHHHHHhhhllHHHLLLLLL
Query rDNEVLATXIGNFQgpgiagkVQFGSgwwfnDQKDG--XLRQLEQLsqxglLSQFVGXLT  412
ident       |                |                    ||             |
Sbjct -GRPSVAMEGVRAG-------YFFSI---ppSIIRSgqKQKLVKQL-----PLTSICLET  210
DSSP  -LLHHHHHHHHHLL-------LEEEE---lhHHHLLhhHHHHHHHL-----LHHHEEELL


DSSP  LLL-------llLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHH
Query DSR-------sfLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRY  465
ident ||                           |                  |      ||   
Sbjct DSPalgpekqvrNEPWNISISAEYIAQVKG-------------iSVEEVIEVTTQNALKL  257
DSSP  LLLlllllllllLLHHHHHHHHHHHHHHHL-------------lLHHHHHHHHHHHHHHH


DSSP  LLL----l
Query FTI----k  469
ident |       
Sbjct FPKlrhll  265
DSSP  LLLhhhhl


No 9: Query=3iacA Sbjct=2vc5A Z-score=13.3

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL--------------hhhhHHLLll
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLS--------------pqeiADDRrf   46
ident                                | ||                         
Sbjct ----------mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeEFRN--   48
DSSP  ----------llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhHHHH--


DSSP  llhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhh
Query dnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthl  106
ident                                                             
Sbjct ------------------------------------------------------------   48
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLL--LLLL
Query elrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDP--IDSL  164
ident                                          |  |               
Sbjct --------------------------------avNEVKRAMQFGVKTIVDPTVMglGRDI   76
DSSP  --------------------------------hhHHHHHHHHLLLLEEEELLLLllLLLH


DSSP  HHHHHHHHLllLLLEEELLLLLHhHHLLllllHHHHhhhhhhhhllllLLHHhhHHHHHH
Query EYHRQIAADdsIDIEVAPSWRPDkVFKIeldgFVDYlrkleaaadvsiTRFDdlRQALTR  224
ident              |                                              
Sbjct RFMEKVVKA--TGINLVAGTGIY-IYID---lPFYF------------LNRS--IDEIAD  116
DSSP  HHHHHHHHL--LLLEEEELEELL-LLLL---lLHHH------------LLLL--HHHHHH


DSSP  HHHHHHH-------LLLLEEEEEELLLLLlllllhhhhhhhhhhhhllllllhhhhHHHH
Query RLDHFAA-------CGCRASDHGIETLRFapvpddaqldailgkrlagetlseleiAQFT  277
ident    |                                                        
Sbjct LFIHDIKegiqgtlNKAGFVXIAADEPGI---------------------------TKDV  149
DSSP  HHHHHHHlllllllLLLLLEEEELLLLLL---------------------------LHHH


DSSP  HHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleellLLLHhHHHHHHHH
Query TAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdNNISwALSRLLDS  337
ident   |                 |                                       
Sbjct EKVIRAAAIANKETKVPIITHSN------------------------AHNN-TGLEQQRI  184
DSSP  HHHHHHHHHHHHHHLLLEEEELL------------------------LLLL-HHHHHHHH


DSSP  HHLlLLLL--EEEEEE--LLHHhHHHHHHHHHHLllllllllEEELL-lLHHH---lLHH
Query XDVtNELP--KTILYC--LNPRdNEVLATXIGNFqgpgiagkVQFGS-gWWFN---dQKD  389
ident           |                                  |              
Sbjct LTE-EGVDpgKILIGHlgDTDN-IDYIKKIADKG--------SFIGLdrYGLDlflpVDK  234
DSSP  HHH-LLLLhhHEEELLhhHLLL-HHHHHHHHHLL--------LEEEEllLLLLllllHHH


DSSP  HHHHHHHHHHHhlLHHHLLLLLLLLLL------------------lLLLHHHHHHHHHHH
Query GXLRQLEQLSQxgLLSQFVGXLTDSRS------------------fLSYTRHEYFRRILC  431
ident      |         |       |                            |     | 
Sbjct RNETTLRLIKD--GYSDKIMISHDYCCtidwgtakpeykpklaprwSITLIFEDTIPFLK  292
DSSP  HHHHHHHHHHL--LLLLLEEELLLLLLllllllllhhhhhhhllllLLLHHHHLHHHHHH


DSSP  HHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLll
Query NLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTik  469
ident                          |   |    |   
Sbjct RNG--------------vNEEVIATIFKENPKKFFS--  314
DSSP  LLL--------------lLHHHHHHHHLHHHHHHLL--


No 10: Query=3iacA Sbjct=3k2gB Z-score=13.1

back to top
DSSP  -llllllllllllhhhhhhhhhlllllLEEELLLLLLhhhhhhllllllhhhhhhllllh
Query -atfxtedfllkndiartlyhkyaapxPIYDFHCHLSpqeiaddrrfdnlgqiwlegdhy   59
ident                                 | ||                        
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQ--------------------ndc   40
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL--------------------eel


DSSP  hhhhhhhlllLHHHLLLllLLHHhhHHHHHHHHhhllllhhhhhhhhhhhllllllllll
Query kwralrsagvDESLITGkeTSDYekYXAWANTVpktlgnplyhwthlelrrpfgitgtlf  119
ident                                                             
Sbjct rcwwnppqepERQYLAE--APIS--IEILSELR---------------------------   69
DSSP  hhhllllllhHHHHHHH--LLLL--HHHHHHHH---------------------------


DSSP  lhhhhhhhhhhhhhhhllhhhLHHHHHH---HLLEEEEELLLLL--lLLLHHHHHHHHLl
Query gpdtaesiwtqcneklatpafSARGIXQ---QXNVRXVGTTDDP--iDSLEYHRQIAADd  174
ident                       |            |                 | | |  
Sbjct -----qdpfvnkhnialddldLAIAEVKqfaAVGGRSIVDPTCRgigRDPVKLRRISAE-  123
DSSP  -----llhhhllllleellhhHHHHHHHhhhHLLLLEEEELLLLlllLLHHHHHHHHHH-


DSSP  lLLLEEELLLLLHhhhLLLLllhHHHHhhhhhhhllllllHHHHHHHHHHHHHHHHH---
Query sIDIEVAPSWRPDkvfKIELdgfVDYLrkleaaadvsitrFDDLRQALTRRLDHFAA---  231
ident      |                                                 |    
Sbjct -TGVQVVXGAGYY---LASS--xPETA-------------ARLSADDIADEIVAEALegt  164
DSSP  -HLLEEEELLLLL---LHHH--lLHHH-------------HLLLHHHHHHHHHHHHHlll


DSSP  ----LLLLEE-EEEELLLLllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHH
Query ----CGCRAS-DHGIETLRfapvpddaqldailgkrlagetlseleiAQFTTAVLVWLGR  286
ident              |                                        |    |
Sbjct dgtdARIGLIgEIGVSSDF----------------------------TAEEEKSLRGAAR  196
DSSP  llllLLLLLEeEELLLLLL----------------------------LHHHHHHHHHHHH


DSSP  HHHHHLLEEEEEELEellllhhhhhhhllllllleelLLLLHHHHHHHHHHHhlllLLLE
Query QYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsigDNNISWALSRLLDSXdvtnELPK  346
ident      |     |                                   |            
Sbjct AQVRTGLPLXVHLPG----------------------WFRLAHRVLDLVEEE----GADL  230
DSSP  HHHHHLLLEEELLLL----------------------LLLLHHHHHHHHHHL----LLLH


DSSP  --EEEEE--LLHHHHHHHHHHHHHllllllllLEEELLLL------------hHHLLhHH
Query --TILYC--LNPRDNEVLATXIGNfqgpgiagKVQFGSGW------------wFNDQkDG  390
ident   | |        |    ||                                      | 
Sbjct rhTVLCHxnPSHXDPVYQATLAQR--------GAFLEFDXigxdffyadqgvqCPSD-DE  281
DSSP  hhEEELLlhHHLLLHHHHHHHHHH--------LLEEEELLllllleelllleeLLLH-HH


DSSP  HHHHHHHHHHHLLHhHLLLLLLLLLL---------lLLLHHHHHHHHHHHHHHhhhhhll
Query XLRQLEQLSQXGLLsQFVGXLTDSRS---------fLSYTRHEYFRRILCNLLgqwaqdg  441
ident   |    |   | |        |                     |   |           
Sbjct VARAILGLADHGYL-DRILLSHDVFVkxxltryggnGYAFVTKHFLPRLRRHG-------  333
DSSP  HHHHHHHHHHLLLH-HHEEELLLLLLhhhlhhhlllLLLHHHHLHHHHHHHLL-------


DSSP  lllllhhhHHHHHHHHHLHHHHHHLLLL----
Query eipddeaxLSRXVQDICFNNAQRYFTIK----  469
ident                    |  | |       
Sbjct -------lDDAALETLXVTNPRRVFDASiegh  358
DSSP  -------lLHHHHHHHHLHHHHHHHLLLllll


No 11: Query=3iacA Sbjct=4mupB Z-score=13.1

back to top
DSSP  llllllllllllhhhhhhhhhllLLLL--EEELLLlLLHH-----------------HHH
Query atfxtedfllkndiartlyhkyaAPXP--IYDFHChLSPQ-----------------EIA   41
ident                           |    |                            
Sbjct ------------lvrklsgtapnPAFPrgAVDTQM-HMYLpgypalpggpglppgalPGP   47
DSSP  ------------lllllllllllLLLLllLEELLL-LLLLlllllllllllllllllLLH


DSSP  HLlllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhh
Query DDrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnply  101
ident  |                                                          
Sbjct ED----------------------------------------------------------   49
DSSP  HH----------------------------------------------------------


DSSP  hhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLL---
Query hwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTD---  158
ident                                          |   |      |  |    
Sbjct ----------------------------------------YRRLMQWLGIDRVIITQgna   69
DSSP  ----------------------------------------HHHHHHHHLLLEEEEELlhh


DSSP  -LLLLL--LHHHHHHHhllllllEEELLLLLhhhhllllllhhhhhhhhhhhhllllllh
Query -DPIDS--LEYHRQIAaddsidiEVAPSWRPdkvfkieldgfvdylrkleaaadvsitrf  215
ident         |                                                   
Sbjct hQRDNGntLACVAEMG------eAAHAVVII-----------------------------   94
DSSP  hLLLLHhhHHHHHHHH------hHEEEEELL-----------------------------


DSSP  hhhHHHHHHHHHHHHHLLLLEEEEEELLllllllllhhhhhhhhhhhhllllllhhhhhh
Query ddlRQALTRRLDHFAACGCRASDHGIETlrfapvpddaqldailgkrlagetlseleiaq  275
ident                | |                                          
Sbjct --dATTTEKDMEKLTAAGTVGARIMDLP-----------------------------gga  123
DSSP  --lLLLLHHHHHHHHHLLEEEEEEELLL-----------------------------lll


DSSP  hhHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleelllLLHHHHHHHH
Query ftTAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnNISWALSRLL  335
ident      |        |  |                                |        |
Sbjct vnLSELDAVDERAHAADWMVAVQFD------------------------gNGLLDHLPRL  159
DSSP  llHHHHHHHHHHHHHLLLEEEEELL------------------------hHHHHHHHHHH


DSSP  HHHhllllLLEEEEE--ELLHH-------HHHHHHHHHHHlllllllLLEEELL-lLHHH
Query DSXdvtneLPKTILY--CLNPR-------DNEVLATXIGNfqgpgiaGKVQFGS-gWWFN  385
ident                                  |   |         |   |        
Sbjct QKI-----RSRWVFDhhGKFFKgirtdgpEMAALLKLIDR-------GNLWFKFagVYES  207
DSSP  HLL-----LLEEEELhhHHLLLllllllhHHHHHHHHHHH-------LLEEEEEllHHHL


DSSP  -----lLHHHHHHHHHHHHhhlLHHHLLLLLLLLLL---------lLLLHHHHHHHHHHh
Query -----dQKDGXLRQLEQLSqxgLLSQFVGXLTDSRS---------fLSYTRHEYFRRILc  431
ident         |                      |                    |     | 
Sbjct srkswpYADVAAFSRVIAA---HAPERIVWGTNWPHnsvretaaypDDARLAELTLGWL-  263
DSSP  llllllLHHHHHHHHHHHH---HLHHHEEELLLLLLlllllhhhllLHHHHHHHHHLLL-


DSSP  hhhhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL--ll
Query nllgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT--ik  469
ident                              |    |     
Sbjct -----------------pDEAARHRALVENPEALFKlspv  286
DSSP  -----------------lLHHHHHHHHLHHHHHHHLllll


No 12: Query=3iacA Sbjct=3cjpA Z-score=13.0

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLLhHHHHhllllllhhhhhhllllhh
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLSpQEIAddrrfdnlgqiwlegdhyk   60
ident                            | | | |                          
Sbjct --------------------------LIIDGHTHVI-LPVE-------------------   14
DSSP  --------------------------LLEEEEEELL-LLHH-------------------


DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll
Query wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
ident                                                             
Sbjct ------------------------------------------------------------   14
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL----------------------
Query pdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD----------------------  158
ident                         |     |                             
Sbjct --------------------KHIKIMDEAGVDKTILFStsihpetavnlrdvkkemkkln   54
DSSP  --------------------HHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhhhhhh


DSSP  --------------llLLLL--HHHHHHHhlllllLEEELLLLLhhHHLLllllhhhhhh
Query --------------dpIDSL--EYHRQIAaddsidIEVAPSWRPdkVFKIeldgfvdylr  202
ident                                                             
Sbjct dvvngktnsmidvrrnSIKEltNVIQAYP------SRYVGFGNV--PVGL----------   96
DSSP  hhhlllllllhhhhhhHHHHhhHHHHHLL------LLEEEEELL--LLLL----------


DSSP  hhhhhhllllllHHHHHHHHHHHHHHHHhllLLEEE-EEEL-LLLLlllllhhhhhhhhh
Query kleaaadvsitrFDDLRQALTRRLDHFAacgCRASD-HGIE-TLRFapvpddaqldailg  260
ident               |                                             
Sbjct -----------sENDTNSYIEENIVNNK---LVGIGeLTPAsGQIK--------------  128
DSSP  -----------lHHHHHHHHHHHLLLLL---LLEEEeELLLlLLHH--------------


DSSP  hhhllllllhhhhhhhHHHHHHHHHHHhhHHLLEEEEEELEEllllhhhhhhhlllllll
Query krlagetlseleiaqfTTAVLVWLGRQyaARGWVXQLHIGAIrnnntrxfrllgpdtgfd  320
ident                                      |                      
Sbjct ----------------SLKPIFKYSMD--SGSLPIWIHAFNP------------------  152
DSSP  ----------------HHHHHHHHHHH--LLLLLEEELLLLL------------------


DSSP  eeLLLLLHHHHHHHHHHHHllllLLEEEE--EELLhhHHHHHHHHHHHLLllllllLEEE
Query siGDNNISWALSRLLDSXDvtneLPKTIL--YCLNprDNEVLATXIGNFQgpgiagKVQF  378
ident              |             ||                    |          
Sbjct --LVLQDIKEIAELCKAFP----KVPVILghMGGS--NWMTAVELAKEIQ------NLYL  198
DSSP  --LLHHHHHHHHHHHHHLL----LLLEEEhhHHHH--HHHHHHHHHHHLL------LEEE


DSSP  LLlLHHHllhhHHHHHHHHHHhhlLHHHLLLLLLLLLLllLLHH-HHHHHHHHHhhhhhh
Query GSgWWFNdqkdGXLRQLEQLSqxgLLSQFVGXLTDSRSflSYTR-HEYFRRILCnllgqw  437
ident                          |       ||           |             
Sbjct DT-SAYF----STFVLKIVIN---ELPLKCIFGTDMPF-gDLQLsIEAIKKMSN------  243
DSSP  EL-LLLL----LHHHHHHHHH---HLLLLEELLLLLLL-lLHHHhHHHHHHHLL------


DSSP  hhlllllllhhhHHHHHHHHHLHHHHHHLLll
Query aqdgeipddeaxLSRXVQDICFNNAQRYFTik  469
ident              |         |  |     
Sbjct ------------DSYVANAVLGDNISRLLN-i  262
DSSP  ------------LHHHHHHHHLHHHHHHHL-l


No 13: Query=3iacA Sbjct=2ffiA Z-score=12.7

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL---------------hhHHHHLll
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLS---------------pqEIADDrr   45
ident                              | | |                       |  
Sbjct -----------------------lhlTAIDSHAHVFsrglnlasqrryapnydAPLGD--   35
DSSP  -----------------------lllLLEELLLLLLlhhhhhhllllllllllLLHHH--


DSSP  lllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhh
Query fdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwth  105
ident                                                             
Sbjct ------------------------------------------------------------   35
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLL----LLL
Query lelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTD----DPI  161
ident                                       |                     
Sbjct ------------------------------------YLGQLRAHGFSHGVLVQpsflGTD   59
DSSP  ------------------------------------HHHHHHHLLLLEELLLLlhhhLLL


DSSP  LL--LHHHHHHHhllllllEEELLLLLHHHhllllllhhhhhhhhhhhhllllllhhhhh
Query DS--LEYHRQIAaddsidiEVAPSWRPDKVfkieldgfvdylrkleaaadvsitrfddlr  219
ident     |                                                       
Sbjct NRylLSALQTVP------gQLRGVVXLERD------------------------------   83
DSSP  LHhhHHHHHHLL------lLLLLLLLLLLL------------------------------


DSSP  hhHHHHHHHHHHLLLLEEEEEEL--LLLLlllllhhhhhhhhhhhhllllllhhhhhHHH
Query qaLTRRLDHFAACGCRASDHGIE--TLRFapvpddaqldailgkrlagetlseleiaQFT  277
ident       |   |  | |                                            
Sbjct -vEQATLAEXARLGVRGVRLNLXgqDXPD--------------------------ltGAQ  116
DSSP  -lLHHHHHHHHLLLLLEEELLLLllLLLL--------------------------llLLL


DSSP  HhhhHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleelllLLHHHHHhHHHH
Query TavlVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnNISWALSrLLDS  337
ident       |       ||   ||                            |       |  
Sbjct W---RPLLERIGEQGWHVELHRQ-----------------------vaDIPVLVR-ALQP  149
DSSP  L---HHHHHHHHHHLLEEEELLL-----------------------llLHHHHHH-HHLL


DSSP  HhllllLLEEEEE--ELLH-------HHHHHHHHhhHHLLlllllLLEEELL-lLHHH--
Query XdvtneLPKTILY--CLNP-------RDNEVLATxiGNFQgpgiaGKVQFGS-gWWFN--  385
ident                                | |           |||            
Sbjct Y-----GLDIVIDhfGRPDarrglgqPGFAELLT--LSGR-----GKVWVKVsgIYRLqg  197
DSSP  L-----LLLEEELhhHLLLlllllllLLHHHHLL--LLLL-----LLEEEEEelHHHLll


DSSP  ---lLHHHHHHHHHHHHHhLLHHHLLLLLLLLLL------lLLLHHHHHHHHHHHhhhhh
Query ---dQKDGXLRQLEQLSQxGLLSQFVGXLTDSRS------fLSYTRHEYFRRILCnllgq  436
ident             |  |              |                | |    |     
Sbjct speeNLAFARQALCALEA-HYGAERLXWGSDWPHtqhesevSFGSAVEQFEALGC-----  251
DSSP  lhhhHHHHHHHHHHHHHH-HLLHHHEEEELLLLLlllllllLHHHHHHHHHHHLL-----


DSSP  hhhlllllllhhhHHHHHHHHHLHHHHHHLL--ll
Query waqdgeipddeaxLSRXVQDICFNNAQRYFT--ik  469
ident                   |      |   |     
Sbjct -------------SAQLRQALLLDTARALFGfele  273
DSSP  -------------LHHHHHHHHLHHHHHHLLllll


No 14: Query=3iacA Sbjct=1gkpA Z-score=12.6

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ------------pllikngEIITadsrykadiyaegetitrigqnleappgtevidatgk   48
DSSP  ------------leeeellEEEElleeeeleeeelllllleeellllllllleeeellll


DSSP  -lLLLEEELLLLLL-------hhHHHHLlllllhhhhhhllllhhhhhhhhllllhhhll
Query -aPXPIYDFHCHLS-------pqEIADDrrfdnlgqiwlegdhykwralrsagvdeslit   75
ident        | | |                                                
Sbjct yvFPGFIDPHVHIYlpfmatfakDTHET--------------------------------   76
DSSP  eeEELEEEEEELLLleelleellLLHHH--------------------------------


DSSP  lllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhh
Query gketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekl  135
ident                                                             
Sbjct ------------------------------------------------------------   76
DSSP  ------------------------------------------------------------


DSSP  llhhhlHHHHHHHLLEEEEELLLL------LLLL-LHHHHHHHHLllLLLEEELLLLLHH
Query atpafsARGIXQQXNVRXVGTTDD------PIDS-LEYHRQIAADdsIDIEVAPSWRPDK  188
ident                                                            |
Sbjct ------GSKAALMGGTTTYIEMCCpsrnddALEGyQLWKSKAEGN--SYCDYTFHMAVSK  128
DSSP  ------HHHHHHHLLEEEEEEEELllllllHHHHhHHHHHHHLLL--LLLEEEEEEELLL


DSSP  HhllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHLLLLEEEEEELLlllll
Query VfkieldgfvdylrkleaaadvsitrfddlRQALTRRLDHFAACGCRASDHGIETlrfap  248
ident                                      |    | |               
Sbjct F-----------------------------DEKTEGQLREIVADGISSFXIFLSY-----  154
DSSP  L-----------------------------LLLHHHHHHHHHHLLLLEEEEEELL-----


DSSP  lllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELE---ELLL
Query vpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHIGA---IRNN  305
ident                                      |     |     |          
Sbjct ----------------------knffgvDDGEMYQTLRLAKELGVIVTAHCENaelVGRL  192
DSSP  ----------------------llllllLHHHHHHHHHHHHHHLLEEEEEELLhhhHHHH


DSSP  --LHHH-hHHHLllLLLLEELLL--LLHHHHHHHHHHHhllllLLEEEEE-ELLHHHHHH
Query --NTRX-fRLLGpdTGFDSIGDN--NISWALSRLLDSXdvtneLPKTILY-CLNPRDNEV  359
ident                                   |                         
Sbjct qqKLLSegKTGPewHEPSRPEAVeaEGTARFATFLETT-----GATGYVVhLSCKPALDA  247
DSSP  hhHHHHllLLLHhhLLLLLLHHHhhHHHHHHHHHHHHH-----LLEEEELlLLLHHHHHH


DSSP  HHHHHHHLLllllllLEEELLllhhhLLHH-------------------------HHHHH
Query LATXIGNFQgpgiagKVQFGSgwwfnDQKD-------------------------GXLRQ  394
ident                     |                                       
Sbjct AMAAKARGV------PIYIES--vipHFLLdktyaerggveamkyimspplrdkrNQKVL  299
DSSP  HHHHHHLLL------LEEEEE--ehhHHHLlhhhhhllhhhhhlllllllllllhHHHHH


DSSP  HHHhhhhllHHHLLLLLLLLLL-------------------LLLL-HHHHHHHHHH-HHH
Query LEQlsqxglLSQFVGXLTDSRS-------------------FLSY-TRHEYFRRIL-CNL  433
ident                  ||                            |            
Sbjct WDA----laQGFIDTVGTDHCPfdteqkllgkeaftaipngIPAIeDRVNLLYTYGvSRG  355
DSSP  HHH----hhLLLLLEEELLLLLllhhhhhhhlllhhhllllLLLLlLHHHHHHHHHlLLL


DSSP  HhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL--------------------------
Query LgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT--------------------------  467
ident                       |     |   |                           
Sbjct R--------------lDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgt  401
DSSP  L--------------lLHHHHHHHHLHHHHHHLLllllllllllllllleeeeellllee


DSSP  -------------------------------------------------------ll
Query -------------------------------------------------------ik  469
ident                                                          
Sbjct isvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  llhhhllllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 15: Query=3iacA Sbjct=3griA Z-score=12.3

back to top
DSSP  --------------------------llllllllllllhhhhhhhhhlllLLLEEELLLL
Query --------------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCH   34
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  LLHH------HHHHllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhh
Query LSPQ------EIADdrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxaw   88
ident |          |                                                
Sbjct LREPggeykeTIET----------------------------------------------   74
DSSP  LLLLllllllLHHH----------------------------------------------


DSSP  hhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHH
Query antvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQ  148
ident                                                             
Sbjct -----------------------------------------------------GTKAAAR   81
DSSP  -----------------------------------------------------HHHHHHH


DSSP  LLEEEEELL-----LLLL--LLLHHHHHHHHLllLLLEEELLLLL---HHHHllllllhh
Query XNVRXVGTT-----DDPI--DSLEYHRQIAADdsIDIEVAPSWRP---DKVFkieldgfv  198
ident      |                      |         | |                   
Sbjct GGFTTVCPXpntrpVPDSveHFEALQKLIDDN--AQVRVLPYASIttrQLGK--------  131
DSSP  LLEEEEEELlllllLLLLhhHHHHHHHHHHHH--LLLEELLLEELlhhHLLL--------


DSSP  hhhhhhhhhhllllllhhhhhhHHHHhHHHHHHLLLLEEEEEELlllllllllhhhhhhh
Query dylrkleaaadvsitrfddlrqALTRrLDHFAACGCRASDHGIEtlrfapvpddaqldai  258
ident                        |          |  |                      
Sbjct ----------------------ELVD-FPALVKEGAFAFTDDGV----------------  152
DSSP  ----------------------LLLL-HHHHHLLLLLLEEELLL----------------


DSSP  hhhhhllllllhhhhhhHHHHHHHHHHHHHHHHLLEEEEEEL--eELLLlhhhhhhhlll
Query lgkrlagetlseleiaqFTTAVLVWLGRQYAARGWVXQLHIG--aIRNNntrxfrllgpd  316
ident                   |           |        |                    
Sbjct ---------------gvQTASXXYEGXIEAAKVNKAIVAHCEdnsLIYG-----------  186
DSSP  ---------------llLLHHHHHHHHHHHHHHLLLEEELLLlhhHLLL-----------


DSSP  llLLEE------------LLLL-LHHHHHHHHHHHHllLLLLEEEEEellhhHHHHHHHH
Query tgFDSI------------GDNN-ISWALSRLLDSXDvtNELPKTILYclnprDNEVLATX  363
ident                     |   |    |                              
Sbjct --GAXHegkrskelgipgIPNIcESVQIARDVLLAE--AAGCHYHVC---hvSTKESVRV  239
DSSP  --LLEEllhhhhhhllleELLHhHHHHHHHHHHHHH--HHLLLEEEL---llLLHHHHHH


DSSP  HHHLLllllllLEEELLLlhhHLLHH----------------------hhHHHHHHHHHH
Query IGNFQgpgiagKVQFGSGwwfNDQKD----------------------gxLRQLEQLSQX  401
ident |           |                                        || |   
Sbjct IRDAK--ragiHVTAEVT--pHHLLLteddipgnnaiykxnpplrstedrEALLEGLLDG  295
DSSP  HHHHH--hlllLEEEEEL--hHHHHLlhhhlllllhhhllllllllhhhhHHHHHHHHLL


DSSP  LlhhhlLLLLLLLLL----------------LLLL-HHHHHHHHHHH--HHHHhhhhlll
Query GllsqfVGXLTDSRS----------------FLSY-TRHEYFRRILC--NLLGqwaqdge  442
ident           ||                        |                       
Sbjct T----iDCIATDHAPhardekaqpxekapfgIVGSeTAFPLLYTHFVknGDWT-------  344
DSSP  L----lLEELLLLLLllhhhhllllllllllLLLLlLHHHHHHHHHLllLLLL-------


DSSP  llllhhhhHHHHHHHHLHHHHHHLL-----------------------------------
Query ipddeaxlSRXVQDICFNNAQRYFT-----------------------------------  467
ident              |         |                                    
Sbjct --------LQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskad  396
DSSP  --------HHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllll


DSSP  ------------------------ll
Query ------------------------ik  469
ident                           
Sbjct ntpfigykvygnpiltxvegevkfeg  422
DSSP  llllllleelleeeeeeelleeeeel


No 16: Query=3iacA Sbjct=2dvtA Z-score=12.3

back to top
DSSP  llllllllllllhhhhhhhhhlllLLLEEELLLLLL-----------------------h
Query atfxtedfllkndiartlyhkyaaPXPIYDFHCHLS-----------------------p   37
ident                                  |                          
Sbjct ------------------------MQGKVALEEHFAipetlqdsagfvpgdywkelqhrl   36
DSSP  ------------------------LLLEEEEEEEELlhhhhhhhlllllllhhhhhhhhh


DSSP  HHHHhllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhlll
Query QEIAddrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlg   97
ident   |                                                         
Sbjct LDIQ--------------------------------------------------------   40
DSSP  HLLL--------------------------------------------------------


DSSP  lhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELL
Query nplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTT  157
ident                                                             
Sbjct ------------------------------------------dTRLKLMDAHGIETMILS   58
DSSP  ------------------------------------------lHHHHHHHHLLEEEEEEE


DSSP  L----------------lLLLLLHHHHHHHHLllLLLEEELLLLLhhHHLLllllhhhhh
Query D----------------dPIDSLEYHRQIAADdsIDIEVAPSWRPdkVFKIeldgfvdyl  201
ident                               |                             
Sbjct LnapavqaipdrrkaieiARRANDVLAEECAK--RPDRFLAFAAL--PLQD---------  105
DSSP  ElllhhhhlllhhhhhhhHHHHHHHHHHHHHH--LLLLEEEEELL--LLLL---------


DSSP  hhhhhhhllllllhhhhHHHHHHHHHHHH-HLLLLEEEEEEllllllllllhhhhhhhHH
Query rkleaaadvsitrfddlRQALTRRLDHFA-ACGCRASDHGIetlrfapvpddaqldaiLG  260
ident                    | |  |       |                          |
Sbjct -----------------PDAATEELQRCVnDLGFVGALVNG--------------fsqEG  134
DSSP  -----------------HHHHHHHHHHHHhLLLLLEEEEEL--------------lllLL


DSSP  HHhllllllhHHHHhhhHHHHHHHHHHHHHHLLEEEEEELEE----llLLHHHhhhhlll
Query KRlagetlseLEIAqftTAVLVWLGRQYAARGWVXQLHIGAI----rnNNTRXfrllgpd  316
ident                                     ||                      
Sbjct DG--------QTPLyydLPQYRPFWGEVEKLDVPFYLHPRNPlpqdsrIYDGH-------  179
DSSP  LL--------LLLLlllLHHHHHHHHHHHHHLLLEEEELLLLlhhhlhHHLLL-------


DSSP  lLLLEELLL---llhhhHHHHHHH-HHLLLLLLEEEEEellhhhhhHHHH----------
Query tGFDSIGDN---niswaLSRLLDS-XDVTNELPKTILYclnprdneVLAT----------  362
ident                    ||  |           ||          |            
Sbjct pWLLGPTWAfaqetavhALRLMASgLFDEHPRLNIILG----hmgeGLPYmmwridhrna  235
DSSP  hHHLHHHLHhhhhhhhhHHHHHHLlHHHHLLLLLEEEL----hhhlLHHHhhhhhhhlll


DSSP  ------------hhHHLLlllllLLEEELLLLhhHLLHhhhhHHHHHHHHHLLHhHLLLL
Query ------------xiGNFQgpgiaGKVQFGSGWwfNDQKdgxlRQLEQLSQXGLLsQFVGX  410
ident                                   |         |               
Sbjct wvklpprypakrrfMDYF----nENFHITTSG--NFRT----QTLIDAILEIGA-DRILF  284
DSSP  lllllllllllllhHHHH----hHHEEEELLL--LLLH----HHHHHHHLLLLH-HHEEL


DSSP  LLLLLLlLLLHHHHHHHHHHHhhhhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLll
Query LTDSRSfLSYTRHEYFRRILCnllgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTik  469
ident  ||            |                              |   || | |   
Sbjct STDWPFeNIDHASDWFNATSI------------------AEADRVKIGRTNARRLFKld  325
DSSP  LLLLLLlLHHHHHHHHHHLLL------------------LHHHHHHHHLHHHHHHLLll


No 17: Query=3iacA Sbjct=1itqA Z-score=12.3

back to top
DSSP  lllllLLLLlllhhhhHHHHhLLLL-LLEEELLLLLL-----------hhhhhHLLLLll
Query atfxtEDFLlkndiarTLYHkYAAP-XPIYDFHCHLS-----------pqeiaDDRRFdn   48
ident        |                   |  | |  |                        
Sbjct -----DFFR-------DEAE-RIMRdSPVIDGHNDLPwqlldmfnnrlqderaNLTTL--   45
DSSP  -----LHHH-------HHHH-HHHLlLLEEEEEELHHhhhhhhhllllllhhhLLLLL--


DSSP  hhhhhHLLLlhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhh
Query lgqiwLEGDhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlel  108
ident                                                             
Sbjct -----AGTH---------------------------------------------------   49
DSSP  -----LLLL---------------------------------------------------


DSSP  hlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLL---------
Query rrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTDD---------  159
ident                                           |                 
Sbjct --------------------------------tNIPKLRAGFVGGQFWSVYtpcdtqnkd   77
DSSP  --------------------------------lLHHHHHHLLEEEEEEEELllhhhllll


DSSP  ---lLLLL-HHHHHHHH-LLLL-----------------LLEEELLLLLHHhhllllllh
Query ---pIDSL-EYHRQIAA-DDSI-----------------DIEVAPSWRPDKvfkieldgf  197
ident                                                             
Sbjct avrrTLEQmDVVHRMCRmYPETflyvtssagirqafregKVASLIGVEGGH---------  128
DSSP  hhhhHHHHhHHHHHHHHhLLLLeeelllhhhhhhhhhllLEEEEEEEELHH---------


DSSP  hhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHLLLLEEEEE---------ELLLllll
Query vdylrkleaaadvsitrfddlrqALTRRLDHFAACGCRASDHG---------IETLrfap  248
ident                             |      | |                      
Sbjct --------------------sidSSLGVLRALYQLGMRYLTLThscntpwadNWLV----  164
DSSP  --------------------hllLLHHHHHHHHHLLEEEEELLlllllllllLHHH----


DSSP  lllhhhhhhhhhhhhllllllhhHHHHhHHHHHHHHHHHHHHHLLEEEEEEleellllhh
Query vpddaqldailgkrlagetlselEIAQfTTAVLVWLGRQYAARGWVXQLHIgairnnntr  308
ident                           |                |    |           
Sbjct -----------------dtgdsePQSQgLSPFGQRVVKELNRLGVLIDLAH---------  198
DSSP  -----------------llllllLLLLlLLHHHHHHHHHHHHHLLEEELLL---------


DSSP  hhhhhllllllleellllLHHHHHHHHHHHhllllLLEEEE--EELL------hhHHHHH
Query xfrllgpdtgfdsigdnnISWALSRLLDSXdvtneLPKTIL--YCLN------prDNEVL  360
ident                           |            |                    
Sbjct -----------------vSVATMKATLQLS-----RAPVIFshSSAYsvcasrrnVPDDV  236
DSSP  -----------------lLHHHHHHHHHHL-----LLLLEEllLLLLllllllllLLHHH


DSSP  HHHHHHLlllllllLEEELLLL-HHHL------lHHHHHHHHHHHHHHLLHhHLLLLLLL
Query ATXIGNFqgpgiagKVQFGSGW-WFND------qKDGXLRQLEQLSQXGLLsQFVGXLTD  413
ident                                          |            ||   |
Sbjct LRLVKQT-------DSLVMVNFyNNYIsctnkanLSQVADHLDHIKEVAGA-RAVGFGGD  288
DSSP  HHHHHHH-------LLEEEELLlHHHHlllllllHHHHHHHHHHHHHHLLH-HHEEELLL


DSSP  LL--------llLLLHhHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHH
Query SR--------sfLSYTrHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRY  465
ident                         |                       |      |  | 
Sbjct FDgvprvpegleDVSK-YPDLIAELLRRN--------------wTEAEVKGALADNLLRV  333
DSSP  LLllllllllllLLLL-HHHHHHHHHHLL--------------lLHHHHHHHHLHHHHHH


DSSP  LLLL--------------------------------
Query FTIK--------------------------------  469
ident |                                   
Sbjct FEAVeqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHHHhhllllllllllllllhhhlllllllllllll


No 18: Query=3iacA Sbjct=3giqA Z-score=12.3

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ---------ekldfkitggWIIDgtgaprrradlgvrdgriaaigelgahparhawdasg   51
DSSP  ---------lleeeeeellEELLlllllleeleeeeelleeeeeelllllleeeeeelll


DSSP  --lLLLEEELLLLLLHhHHHHLLllllhhhhhhllllhhhhhhhhllllhhhlllllllh
Query --aPXPIYDFHCHLSPqEIADDRrfdnlgqiwlegdhykwralrsagvdeslitgketsd   81
ident         | | |                                               
Sbjct kivAPGFIDVHGHDDL-MFVEKP-------------------------------------   73
DSSP  leeEELEEELLLLLLL-HHHHLL-------------------------------------


DSSP  hhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhl
Query yekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafs  141
ident                                                             
Sbjct ------------------------------------------------------------   73
DSSP  ------------------------------------------------------------


DSSP  HHHHHHHLLEEEEELL----LLLL---------------------LLLHHHHHHHHLLlL
Query ARGIXQQXNVRXVGTT----DDPI---------------------DSLEYHRQIAADDsI  176
ident             |                                |   |     |    
Sbjct DLRWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfaDVPAYFAALDAQR-P  132
DSSP  LLHHHHLLLEEEEEELllllLLLLllllllllhhhhhhlllllllLHHHHHHHHHHLL-L


DSSP  LLEEELLLLLHHHHllllllHHHHHhhhhhhhllllllHHHHHHHHHHHHHHHHHLLLLE
Query DIEVAPSWRPDKVFkieldgFVDYLrkleaaadvsitrFDDLRQALTRRLDHFAACGCRA  236
ident  | ||                 |                    ||    |      |   
Sbjct MINVAALVGHANLR---laaMRDPQ----------aapTAAEQQAMQDMLQAALEAGAVG  179
DSSP  LLEEEEEEEHHHHH---hhhLLLLL----------lllLHHHHHHHHHHHHHHHHHLLLE


DSSP  EEEEELLllllllllhhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHHHHHHLLEEE
Query SDHGIETlrfapvpddaqldailgkrlagetlseleiaqFTTAVLVWLGRQYAARGWVXQ  296
ident    |                                      | |  | |  | |     
Sbjct FSTGLAY---------------------------qpgavAQAAELEGLARVAAERRRLHT  212
DSSP  EEEELLL---------------------------llhhhLLHHHHHHHHHHHHHLLLEEE


DSSP  EEELEellllhhhhhhhllllllleelLLLLHHHHHHHHHHHHllLLLLEEEEE-ELLH-
Query LHIGAirnnntrxfrllgpdtgfdsigDNNISWALSRLLDSXDvtNELPKTILY-CLNP-  354
ident  ||                              |    |           |         
Sbjct SHIRN---------------------eADGVEAAVEEVLAIGR--GTGCATVVShHKCMm  249
DSSP  EELLL---------------------lLLLHHHHHHHHHHHHH--HHLLEEEELlLLLLl


DSSP  ----HHHHHHHHHHHHLLLLLlllLEEELLllhhhLLHH---------------------
Query ----RDNEVLATXIGNFQGPGiagKVQFGSgwwfnDQKD---------------------  389
ident              |      |    |                                  
Sbjct pqnwGRSRATLANIDRAREQG--vEVALDI----yPYPGsstiliperaetiddiritws  303
DSSP  hhhlLLHHHHHHHHHHHHHLL--lLEEEEE----lLLLEeeeellhhhllllllleeeee


DSSP  ---------------------------------------HHHHHHHHHHhhllHHHLlLL
Query ---------------------------------------GXLRQLEQLSqxglLSQFvGX  410
ident                                                             
Sbjct tphpecsgeyladiaarwgcdkttaarrlapagaiyfamDEDEVKRIFQ----HPCC-MV  358
DSSP  lllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeellLHHHHHHHHH----LLLE-EE


DSSP  LLLLLL------llLLHHHHHHHHHHH-HHHHhhhhlllllllhhhHHHHHHHHHLHHHH
Query LTDSRS------flSYTRHEYFRRILC-NLLGqwaqdgeipddeaxLSRXVQDICFNNAQ  463
ident   |                                                         
Sbjct GSDGLPndarphprLWGSFTRVLGRYVrEARL-------------mTLEQAVARMTALPA  405
DSSP  LLLLLLlllllllhHHHHHHHHHHHHHhHLLL-------------lLHHHHHHHHLHHHH


DSSP  HHLL--------------------------------------------------------
Query RYFT--------------------------------------------------------  467
ident | |                                                         
Sbjct RVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppad  465
DSSP  HHHLlllllllllllllleeeelllllllllllllllllllleeeeeelleeeellllll


DSSP  --------ll
Query --------ik  469
ident           
Sbjct grpgqvlrax  475
DSSP  llllllllll


No 19: Query=3iacA Sbjct=4b3zD Z-score=12.2

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct -----------drllikggRIINddqslyadvyledglikqigenlivpggvktieangr   49
DSSP  -----------leeeeeeeEEELllleeeeeeeeelleeeeeellllllllleeeellll


DSSP  -lLLLEEELLLLLLhhhhhhllllllhhHHHHllllhhhhhhhhllllhhhlllllllhh
Query -aPXPIYDFHCHLSpqeiaddrrfdnlgQIWLegdhykwralrsagvdeslitgketsdy   82
ident        |    |                                               
Sbjct mvIPGGIDVNTYLQ-------------kTAAD----------------------------   68
DSSP  eeEELEEEEEELLL-------------lLLLL----------------------------


DSSP  hhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLH
Query ekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSA  142
ident                                                             
Sbjct -------------------------------------------------------dffQG   73
DSSP  -------------------------------------------------------lhhHH


DSSP  HHHHHHLLEEEEELLLL------LLLLLH-HHHHHHHLllLLLEEELLLLLHHHhlllll
Query RGIXQQXNVRXVGTTDD------PIDSLE-YHRQIAADdsIDIEVAPSWRPDKVfkield  195
ident                           | |  |                            
Sbjct TRAALVGGTTMIIDHVVpepgssLLTSFEkWHEAADTK--SCCDYSLHVDITSW------  125
DSSP  HHHHHHLLEEEEEEEELllllllHHHHHHhHHHHHHLL--LLLEEEEEEELLLL------


DSSP  lhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHH-HLLLLEEEEEELLllllllllhhh
Query gfvdylrkleaaadvsitrfddlRQALTRRLDHFA-ACGCRASDHGIETlrfapvpddaq  254
ident                               |       |                     
Sbjct -----------------------YDGVREELEVLVqDKGVNSFQVYMAY-----------  151
DSSP  -----------------------LLLHHHHHHHHHhLLLLLEEEEELLL-----------


DSSP  hhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEEL---eELLL---LHH
Query ldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHIG---aIRNN---NTR  308
ident                           |          | |   |      |         
Sbjct ----------------kdvyqmSDSQLYEAFTFLKGLGAVILVHAEngdlIAQEqkrILE  195
DSSP  ----------------llllllLHHHHHHHHHHHHHHLLEEEEELLlhhhHHHHhhhHHH


DSSP  HhHHHLllLLLL--EELLL--LLHHHHHHHHHHHHlllllLEEEEE-ELLHHHHHHHHHH
Query XfRLLGpdTGFD--SIGDN--NISWALSRLLDSXDvtnelPKTILY-CLNPRDNEVLATX  363
ident      |   |                                               |  
Sbjct M-GITG-pEGHAlsRPEELeaEAVFRAITIAGRIN-----CPVYITkVMSKSAADIIALA  248
DSSP  L-LLLL-lHHHHhhLLHHHhhHHHHHHHHHHHHHL-----LLEEEEeELLHHHHHHHHHH


DSSP  HHHLLllllllLEEELLllhhHLLH--------------------------HHHHHHHHH
Query IGNFQgpgiagKVQFGSgwwfNDQK--------------------------DGXLRQLEQ  397
ident             |                                               
Sbjct RKKGP------LVFGEP-iaaSLGTdgthywsknwakaaafvtspplspdpTTPDYLTSL  301
DSSP  HHHLL------LEEEEE-lhhHHHLllhhhhlllhhhhhhlllllllllllLHHHHHHHH


DSSP  HHHHLlhhhLLLLLLLLLL-------------------LLLL-HHHHHHHHHHHHHHhhh
Query LSQXGllsqFVGXLTDSRS-------------------FLSY-TRHEYFRRILCNLLgqw  437
ident |                                           |               
Sbjct LACGD----LQVTGSGHCPystaqkavgkdnftlipegVNGIeERMTVVWDKAVATG---  354
DSSP  HHHLL----LLLLLLLLLLllhhhhhhhlllhhhllllLLLLlLHHHHHHHHHLLLL---


DSSP  hhlllllllhhhHHHHHHHHHLHHHHHHLL------------------------------
Query aqdgeipddeaxLSRXVQDICFNNAQRYFT------------------------------  467
ident                        ||   |                               
Sbjct ----------kmDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitak  404
DSSP  ----------llLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct shksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvk  464
DSSP  lllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhh


DSSP  -----------ll
Query -----------ik  469
ident              
Sbjct irnkvfglqgvsr  477
DSSP  hhhhhllllllll


No 20: Query=3iacA Sbjct=2vunA Z-score=12.2

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ----------sktiiknigKIVSgdikspvlqadtivvedgliaaiggeelmkdagdati   50
DSSP  ----------leeeeelllEEELlllllleellleeeeelleeeeeelhhhhllllllee


DSSP  -------lLLLEEELLLLLlHHHHhhllllllhhhHHHLlllhhhhhhhhllllhhhlll
Query -------aPXPIYDFHCHLsPQEIaddrrfdnlgqIWLEgdhykwralrsagvdeslitg   76
ident              | | |                                          
Sbjct idaagstvTPGLLDTHVHV-SGGD--------yapRQKT---------------------   80
DSSP  eelllleeEELEEEEEELL-LLLL--------eehHHLE---------------------


DSSP  llllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhl
Query ketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekla  136
ident                                                             
Sbjct ------------------------------------------------------------   80
DSSP  ------------------------------------------------------------


DSSP  lhhhLHHHHHHHLLEEEEELLL-------------LLLLlLHHHHHHHHLllLLLEEE-L
Query tpafSARGIXQQXNVRXVGTTD-------------DPIDsLEYHRQIAADdsIDIEVA-P  182
ident               |                                         |   
Sbjct ---mDFISSALHGGVTTMISAGsphfpgrpkdaagTKALaITLSKSYYNArpAGVKVHgG  137
DSSP  ---eLHHHHHHLLLEEEEEELLllllllllllhhhHHHHhHHHHHHHHHLlhHHLEEElL


DSSP  LLLLHHHhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHLLLLEE-EEEE
Query SWRPDKVfkieldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAACGCRAS-DHGI  241
ident      |                                            |       | 
Sbjct AVILEKG-------------------------------lTEEDFIEMKKEGVWIVgEVGL  166
DSSP  EELLLLL-------------------------------lLHHHHHHHHHLLLLEEeEELL


DSSP  llllllllllhhhhhhhhhhhhllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEEL-
Query etlrfapvpddaqldailgkrlagetlseleiaqfttAVLVWLGRQYAARGWVXQLHIG-  300
ident                                                   |   | | | 
Sbjct -------------------------------gtiknpEDAAPMVEWAHKHGFKVQMHTGg  195
DSSP  -------------------------------lllllhHHHHHHHHHHHHLLLEEEEELLl


DSSP  EELLllhhhhhhhlllllLLEEllllLHHHHHHHHhhhhlllllleEEEE------eLLH
Query AIRNnntrxfrllgpdtgFDSIgdnnISWALSRLLdsxdvtnelpkTILY------cLNP  354
ident                     |                                       
Sbjct TSIP--------------GSST---vTADDVIKTK----------pDVVShinggptAIS  228
DSSP  LLLL--------------LLLL---lLHHHHHHHL----------lLEEElllllllLLL


DSSP  H-HHHHHHHHHHhlllllllllEEELLllhhhLLHHHHHHHHHHHHHHLLHhHLLLLLLL
Query R-DNEVLATXIGnfqgpgiagkVQFGSgwwfnDQKDGXLRQLEQLSQXGLLsQFVGXLTD  413
ident                                                 | |   |    |
Sbjct VqEVDRIMDETD----------FAMEI--vqcGNPKIADYVARRAAEKGQL-GRVIFGND  275
DSSP  HhHHHHHHHHLL----------LEEEE--ellLLHHHHHHHHHHHHHHLLH-HHEEEELL


DSSP  LLL--lLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL----
Query SRS--fLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT----  467
ident   |   |                                          |          
Sbjct APSgtgLIPLGILRNMCQIASMSD-------------iDPEVAVCMATGNSTAVYGlntg  322
DSSP  LLLlllLLLLHHHHHHHHHHHHLL-------------lLHHHHHHHHLHHHHHHHLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct viapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraa  382
DSSP  llllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllllll


DSSP  -ll
Query -ik  469
ident    
Sbjct kil  385
DSSP  eel


No 21: Query=3iacA Sbjct=3gg7A Z-score=12.1

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL-hHHHHhllllllhhhhhhllllh
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLS-pQEIAddrrfdnlgqiwlegdhy   59
ident                              ||| ||                         
Sbjct --------------------------SLIDFHVHLDlyPDPV------------------   16
DSSP  --------------------------LLEEEEELHHhlLLHH------------------


DSSP  hhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllllllllll
Query kwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlf  119
ident                                                             
Sbjct ------------------------------------------------------------   16
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEeEEELLL-LLLL---lLHHHHhhhhlll
Query gpdtaesiwtqcneklatpafSARGIXQQXNVrXVGTTD-DPID---sLEYHRqiaadds  175
ident                                   |      |      |           
Sbjct ---------------------AVARACEERQL-TVLSVTtTPAAwrgtLALAA-------   47
DSSP  ---------------------HHHHHHHHLLL-EEEELLlLHHHhhhhHHHHL-------


DSSP  LLLEEELLLLLH-HHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHhhhllL
Query IDIEVAPSWRPD-KVFKIeldgfvdylrkleaaadvsitrfdDLRQALTRRLDHfaacgC  234
ident     |         |                                  | |        
Sbjct GRPHVWTALGFHpEVVSE----------------------raADLPWFDRYLPE-----T   80
DSSP  LLLLEEELLLLLhHHLLL----------------------lhHHLHHHHHHHHH-----L


DSSP  LEEE-EEELLLlllllllhhhhhhhhhhhhllllllhHHHHHHHHHHHHHHHHHHHHH-L
Query RASD-HGIETLrfapvpddaqldailgkrlagetlseLEIAQFTTAVLVWLGRQYAAR-G  292
ident |     |                                      ||     |      |
Sbjct RFVGeVGLDGS-----------------------pslRGTWTQQFAVFQHILRRCEDHgG  117
DSSP  LEEEeEELLLL-----------------------hhhHHHHHHHHHHHHHHHHHHHHLlL


DSSP  LEEEEEELEellllhhhhhhhllllllleellllLHHHHHHHHHHHHlllLLLEEEEE-E
Query WVXQLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXDvtnELPKTILY-C  351
ident      |                                    |            ||   
Sbjct RILSIHSRR-------------------------AESEVLNCLEANP---RSGTPILHwY  149
DSSP  EEEEEELLL-------------------------LHHHHHHHHHHLH---HHEEEEEElL


DSSP  LLHhhHHHHhHHHHHLLlllllllEEELLllhhHLLHH-HHHHHHHHHhhhllHHHLLLL
Query LNPrdNEVLaTXIGNFQgpgiagkVQFGSgwwfNDQKD-GXLRQLEQLsqxglLSQFVGX  410
ident         |                 |                              |  
Sbjct SGS--VTEL-RRAISLG-------CWFSV--gpTMVRTqKGAALIRSM-----PRDRVLT  192
DSSP  LLL--HHHH-HHHHHLL-------LEEEE--lhHHHLLhHHHHHHHHL-----LHHHEEE


DSSP  LLLLL-------LLLLLhHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHH
Query LTDSR-------SFLSYtRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQ  463
ident  ||           |           |                       |  |   |  
Sbjct ETDGPfleldgqAALPW-DVKSVVEGLSKIWQ-------------iPASEVERIVKENVS  238
DSSP  LLLLLlleelleELLHH-HHHHHHHHHHHHHL-------------lLHHHHHHHHHHHHH


DSSP  HHLLLl
Query RYFTIk  469
ident |     
Sbjct RLLGT-  243
DSSP  HHHHL-


No 22: Query=3iacA Sbjct=1onxA Z-score=12.0

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ---midytaagftllqgahLYAPedrgicdvlvangkiiavasnipsdivpnctvvdlsg   57
DSSP  ---llllhhhlleeeeeeeEELLleeeeeeeeeelleeeeeellllllllllleeeelll


DSSP  --lLLLEEELLLLLLhhhhhhllllllhhhhhHLLLlhhhhhhhhllllhhhlllllllh
Query --aPXPIYDFHCHLSpqeiaddrrfdnlgqiwLEGDhykwralrsagvdeslitgketsd   81
ident         | | ||                                              
Sbjct qilCPGFIDQHVHLI--------ggggeagptTRTP------------------------   85
DSSP  leeEELEEEEEELLL--------lllllllhhHLLL------------------------


DSSP  hhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhl
Query yekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafs  141
ident                                                             
Sbjct ----------------------------------------------------------ev   87
DSSP  ----------------------------------------------------------ll


DSSP  HHHHHHHLLEEEEELLL-----llLLLL--HHHHHHHHlllLLLEEELLLLLHHHHllll
Query ARGIXQQXNVRXVGTTD-----dpIDSL--EYHRQIAAddsIDIEVAPSWRPDKVFkiel  194
ident |        |  |                    |         |          |     
Sbjct ALSRLTEAGVTSVVGLLgtdsisrHPESllAKTRALNE---EGISAWMLTGAYHVP----  140
DSSP  LHHHHHHLLEEEEEELLlllllllLHHHhhHHHHHHHH---HLLEEEEEEELLLLL----


DSSP  llhhhhhhhhhhhhllllllhhhhhHHHHHHHHHHHhlLLLEEEEEELLllllllllhhh
Query dgfvdylrkleaaadvsitrfddlrQALTRRLDHFAacGCRASDHGIETlrfapvpddaq  254
ident                                               |             
Sbjct --------------------srtitGSVEKDVAIID--RVIGVXCAISD-----------  167
DSSP  --------------------lllllLLHHHHHHHLL--LEEEEEEEELL-----------


DSSP  hhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHL------LEEEEEELEellllhh
Query ldailgkrlagetlseleiaqfTTAVLVWLGRQYAARG------WVXQLHIGAirnnntr  308
ident                           |          |       |   | |        
Sbjct ----------------hrsaapDVYHLANMAAESRVGGllggkpGVTVFHMGD-------  204
DSSP  ----------------llllllLHHHHHHHHHHHHHHHhhhlllLEEEEEELL-------


DSSP  hhhhhllllllleelLLLLHHHHHHHHHHHhllLLLL-EEEEEE--LLHHHHHHHHHHHH
Query xfrllgpdtgfdsigDNNISWALSRLLDSXdvtNELP-KTILYC--LNPRDNEVLATXIG  365
ident                          ||           |        |    |       
Sbjct ---------------SKKALQPIYDLLENC---DVPIsKLLPTHvnRNVPLFEQALEFAR  246
DSSP  ---------------LLLLLHHHHHHHHLL---LLLHhHEEEELhhHLHHHHHHHHHHHH


DSSP  HLllllllllEEELLLlhhhLLHH-HHHHHHHHHHHH-LLHHHLlLLLLLLLL-------
Query NFqgpgiagkVQFGSGwwfnDQKD-GXLRQLEQLSQX-GLLSQFvGXLTDSRS-------  416
ident                                    |    |        |          
Sbjct KG--------GTIDIT--ssIDEPvAPAEGIARAVQAgIPLARV-TLSSDGNGsqpffdd  295
DSSP  LL--------LLEEEE--llLLLLlLHHHHHHHHHHLlLLHHHE-EEELLLLLeeeeell


DSSP  --------lLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-
Query --------fLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-  467
ident                      |                                      
Sbjct egnlthigvAGFETLLETVQVLVKDYD-------------fSISDALRPLTSSVAGFLNl  342
DSSP  llleeeeeeLLLHHHHHHHHHHHHHHL-------------lLHHHHHHHHLHHHHHHLLl


DSSP  ----------------------------------------------ll
Query ----------------------------------------------ik  469
ident                                                 
Sbjct tgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  llllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 23: Query=3iacA Sbjct=3pnuA Z-score=12.0

back to top
DSSP  llllllllllllhhhhhhhHHLLllLLEEELLLLLLHH-HHHHllllllhhhhhhllllh
Query atfxtedfllkndiartlyHKYAapXPIYDFHCHLSPQ-EIADdrrfdnlgqiwlegdhy   59
ident                              | | ||                         
Sbjct -----------enlyfqsnAMKL--KNPLDMHLHLRDNqMLEL-----------------   30
DSSP  -----------llllllllLEEE--ELLEEEEELLLLHhHHHH-----------------


DSSP  hhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllllllllll
Query kwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlf  119
ident                                                             
Sbjct ------------------------------------------------------------   30
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhllhhhlHHHHHHhLLEEEEELLL-----LLLLL--LHHHHHHHH
Query gpdtaesiwtqcneklatpafsARGIXQqXNVRXVGTTD-----DPIDS--LEYHRQIAA  172
ident                                                      |   |  
Sbjct ----------------------IAPLSA-RDFCAAVIMPnlippLCNLEdlKAYKMRILK   67
DSSP  ----------------------HHHHHH-LLLLEEEELLlllllLLLHHhhHHHHHHHHH


DSSP  -lLLLLLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHH
Query -dDSIDIEVAPSWRPDkvfkieldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAA  231
ident                                                       |     
Sbjct acKDENFTPLMTLFFK--------------------------------nyDEKFLYSAKD   95
DSSP  hhLLLLLEEEEEEELL--------------------------------llLHHHHHHHLL


DSSP  lLLLEEEEEEL----------LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHH
Query cGCRASDHGIE----------TLRFapvpddaqldailgkrlagetlseleiaqftTAVL  281
ident                                                            |
Sbjct -EIFGIXLYPAgittnsnggvSSFD-------------------------------IEYL  123
DSSP  -LLLEEEELLLllllllllllLLLL-------------------------------HHHH


DSSP  HHHHHHHHHHLLEEEEEELEELlllhhhhhhhllllllleELLL--LLHHHHHHHHHHHH
Query VWLGRQYAARGWVXQLHIGAIRnnntrxfrllgpdtgfdsIGDN--NISWALSRLLDSXD  339
ident                 |                         |   |       |     
Sbjct KPTLEAMSDLNIPLLVHGETND-----------------fVMDResNFAKIYEKLAKHFP  166
DSSP  HHHHHHHHHLLLLEEELLLLLL-----------------lHHHLlhHHHHHHHHHHHHLL


DSSP  llllLLEEEEEellhhhHHHHHHHHHHLLllllllLEEELLLlhhHLLHH----------
Query vtneLPKTILYclnprdNEVLATXIGNFQgpgiagKVQFGSGwwfNDQKD----------  389
ident       |             |                                       
Sbjct ----RLKIVME---hitTKTLCELLKDYE------NLYATIT--lHHLIItlddviggkm  211
DSSP  ----LLLEEEL---lllLHHHHHHHHHLL------LEEEEEL--lHHHLLlhhhhhllll


DSSP  --------------hHHHHHHHhhhhllHHHLLLLLLLLLL---------LLLLHHHHHH
Query --------------gXLRQLEQlsqxglLSQFVGXLTDSRS---------FLSYTRHEYF  426
ident                     |           |    ||           |         
Sbjct nphlfckpiakryedKEALCEL---afsGYEKVMFGSDSAPhpkgcaagvFSAPVILPVL  268
DSSP  lhhhllllllllhhhHHHHHHH---hhlLLLLEEELLLLLLlllllllllLLHHHHHHHH


DSSP  HHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-------------------
Query RRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-------------------  467
ident                             |     |                         
Sbjct AELFKQNS---------------SEENLQKFLSDNTCKIYDlkfkedkiltleekewqvp  313
DSSP  HHHHHHHL---------------LHHHHHHHHLHHHHHHHLllllllleeeeellleell


DSSP  -----------------------ll
Query -----------------------ik  469
ident                          
Sbjct nvyedkynqvvpymageilkfqlkh  338
DSSP  lleelllleellllllleelleell


No 24: Query=3iacA Sbjct=4ofcA Z-score=11.9

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLlLHHH-------------hhhllllL
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHlSPQE-------------iaddrrfD   47
ident                              | | |                          
Sbjct --------------------------MKIDIHSH-ILPKewpdlkkrfgyggwvqlqhhS   33
DSSP  --------------------------LLEEEEEE-LLLLllllhhhhhllllleeeeeeE


DSSP  LHHH--------hHHLLllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllh
Query NLGQ--------iWLEGdhykwralrsagvdeslitgketsdyekyxawantvpktlgnp   99
ident                                                             
Sbjct KGEAkllkdgkvfRVVR-------------------------------------------   50
DSSP  LLEEeeeelleeeEEEE-------------------------------------------


DSSP  hhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL-
Query lyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD-  158
ident                                                 |  |        
Sbjct ----------------------------------encwdpeVRIREMDQKGVTVQALSTv   76
DSSP  ----------------------------------hhhllhhHHHHHHHHHLLLEEEEELl


DSSP  --------------llLLLL-HHHHHHHHLllLLLEEELLLLLHHHhllllllhhhhhhh
Query --------------dpIDSL-EYHRQIAADdsIDIEVAPSWRPDKVfkieldgfvdylrk  203
ident                    |                                        
Sbjct pvmfsywakpedtlnlCQLLnNDLASTVVS--YPRRFVGLGTLPMQ--------------  120
DSSP  hhhhlllllhhhhhhhHHHHhHHHHHHHHH--LLLLEEEEELLLLL--------------


DSSP  hhhhhllllllhhhHHHHHHHHHHHHH-HLLLLEEEEEEL---LLLLlllllhhhhhhhh
Query leaaadvsitrfddLRQALTRRLDHFA-ACGCRASDHGIE---TLRFapvpddaqldail  259
ident                               |      |                      
Sbjct --------------APELAVKEMERCVkELGFPGVQIGTHvneWDLN-------------  153
DSSP  --------------LHHHHHHHHHHHHhLLLLLEEEEELEellEELL-------------


DSSP  hhhhllllllhhhhhhhHHHHhHHHHHHHHHHLLEEEEEElEELLLLHHHhhhhlllLLL
Query gkrlagetlseleiaqfTTAVlVWLGRQYAARGWVXQLHIgAIRNNNTRXfrllgpdTGF  319
ident                                       |         |           
Sbjct -----------------AQEL-FPVYAAAERLKCSLFVHP-WDMQMDGRM-----akYWL  189
DSSP  -----------------LHHH-HHHHHHHHHHLLEEEEEL-LLLLLLHHH-----hlLLH


DSSP  L---EELL--lLLHHHHH--HHHHHHHllllLLEEEE--EELLhhHHHH-----------
Query D---SIGD--nNISWALS--RLLDSXDvtneLPKTIL--YCLNprDNEV-----------  359
ident                                  |                          
Sbjct PwlvGMPAettIAICSMImgGVFEKFP----KLKVCFahGGGA--FPFTvgrishgfsmr  243
DSSP  HhhlHHHHhhhHHHHHHHllLHHHHLL----LLLEEElhHHLL--HHHHhhhhhhhhhhl


DSSP  ----------hhHHHHhlllllllLLEEELLLlhhHLLHHHHHHHHHHHhhhllHHHLLL
Query ----------laTXIGnfqgpgiaGKVQFGSGwwfNDQKDGXLRQLEQLsqxglLSQFVG  409
ident                         |                                 | 
Sbjct pdlcaqdnpmnpKKYL--------GSFYTDAL---VHDPLSLKLLTDVI-----GKDKVI  287
DSSP  hhhhlllllllhHHHL--------LLLEEELL---LLLHHHHHHHHHHH-----LLLLEE


DSSP  LLLLLLL-llLLHHHHhHHHHhHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLL
Query XLTDSRS-flSYTRHEyFRRIlCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTI  468
ident   ||                                                ||      
Sbjct LGTDYPFplgELEPGK-LIES-MEEF---------------DEETKNKLKAGNALAFLGL  330
DSSP  LLLLLLLlllLLLLLH-HHHH-LLLL---------------LHHHHHHHHLHHHHHHHLL


DSSP  ----l
Query ----k  469
ident      
Sbjct erkqf  335
DSSP  lhhhl


No 25: Query=3iacA Sbjct=4hk5D Z-score=11.9

back to top
DSSP  llllllllllllhhhhhhhhhlllLLLEEELLLLLLH-----------------------
Query atfxtedfllkndiartlyhkyaaPXPIYDFHCHLSP-----------------------   37
ident                              | | |  |                       
Sbjct ------------------------TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqad   36
DSSP  ------------------------LLLLEEEEEEELLhhhhhhhhlllllleeeeellee


DSSP  ----------------------------------HHHHhllllllhhhhhhllllhhhhh
Query ----------------------------------QEIAddrrfdnlgqiwlegdhykwra   63
ident                                      |                      
Sbjct eprlillsselaaldaaladpaaklpgrplsthfASLA----------------------   74
DSSP  eeeeellhhhhhhhhhhhhlllllllleellhhhLLHH----------------------


DSSP  hhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhh
Query lrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdt  123
ident                                                             
Sbjct ------------------------------------------------------------   74
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL---------------lLLLL-LHHH
Query aesiwtqcneklatpafSARGIXQQXNVRXVGTTD---------------dPIDS-LEYH  167
ident                             |                            |  
Sbjct -----------------QKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVnAEFS  117
DSSP  -----------------HHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHhHHHH


DSSP  HHHHHlllLLLEEELLLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHH
Query RQIAAddsIDIEVAPSWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLD  227
ident    |                                                 |      
Sbjct DMCAQ---HVGRLFFFAALPLS---------------------------aPVDAVKASIE  147
DSSP  HHHHL---LLLLEEEEEELLLL---------------------------lLHHHHHHHHH


DSSP  HHHHL-LLLEEEEEEL---LLLLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHhHH
Query HFAAC-GCRASDHGIE---TLRFapvpddaqldailgkrlagetlseleiaqfTTAVlVW  283
ident        ||    |                                              
Sbjct RVKNLkYCRGIILGTSglgKGLD------------------------------DPHL-LP  176
DSSP  HHHLLlLEEEEEELLLlllLLLL------------------------------LHHH-HH


DSSP  HHHHHHHHLLEEEEEELEELLL--LHHHHHHHlllLLLL-EELL----lLLHHHHH--HH
Query LGRQYAARGWVXQLHIGAIRNN--NTRXFRLLgpdTGFD-SIGD----nNISWALS--RL  334
ident      |       ||      |                    |                 
Sbjct VFEAVADAKLLVFLHPHYGLPNevYGPRSEEY--gHVLPlALGFpmettIAVARMYmaGV  234
DSSP  HHHHHHHLLLEEEELLLLLLLHhhHLLLHHHL--lLHHHhHLHHhhhhhHHHHHHHhlLH


DSSP  HHHHHllllLLEEEEEellHHHHHH----------------------hhhhHHHLLllll
Query LDSXDvtneLPKTILYclnPRDNEV----------------------latxIGNFQgpgi  372
ident  |            |                                    |        
Sbjct FDHVR----NLQMLLAhsgGTLPFLagriescivhdghlvktgkvpkdrrtIWTVL----  286
DSSP  HHHLL----LLLEEEHhhhLLHHHHhhhhhhhhhllhhhhhllllllllllHHHHH----


DSSP  lLLEEELLLLhhhllhhhHHHHHHHHHHhLLHHHLLLLLLLLLL--------lLLLHHHH
Query aGKVQFGSGWwfndqkdgXLRQLEQLSQxGLLSQFVGXLTDSRS--------fLSYTRHE  424
ident                       |                ||                   
Sbjct kEQIYLDAVI-------ySEVGLQAAIA-SSGADRLMFGTDHPFfppieedvqGPWDSSR  338
DSSP  hHLEEEELLL-------lLHHHHHHHHH-HHLHHHEELLLLLLLlllllllllLLLHHHH


DSSP  HHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL----------ll
Query YFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT----------ik  469
ident           |               |         || |               
Sbjct LNAQAVIKAVG-------------eGSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  HHHHHHHHHHL-------------lLLHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 26: Query=3iacA Sbjct=2pajA Z-score=11.9

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ----------pstlirnaaAIMTggrgtaddpsrvpgpdirivgdtidaigalaprpget   50
DSSP  ----------leeeeelllEELLlllllllllllllllleeeelleeeeellllllllle


DSSP  --------lLLLEEELLLLLLhhhhhhllllllhhhhhhLLLLHHhhhhhhllllhhhll
Query --------aPXPIYDFHCHLSpqeiaddrrfdnlgqiwlEGDHYKwralrsagvdeslit   75
ident                 | ||                                        
Sbjct ivdatdcviYPAWVNTHHHLF----------------qsLLKGEP---------------   79
DSSP  eeelllleeEELEELLLLLHH----------------hhHLLLLL---------------


DSSP  lllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhh
Query gketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekl  135
ident                                                             
Sbjct --------------------------------------------------fralfderrf   89
DSSP  --------------------------------------------------lhhhllhhhh


DSSP  llhhhLHHHHHHHLLEEEEELLLLLL------LLLHHHHHHHHLllLLLEEELLLLLHhh
Query atpafSARGIXQQXNVRXVGTTDDPI------DSLEYHRQIAADdsIDIEVAPSWRPDkv  189
ident                   |             ||       |                  
Sbjct rlaarIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEK--LGLRFVLLRGGA--  145
DSSP  hhhhhHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHH--LLLEEEEEELLL--


DSSP  HLLLLLL---hHHHHhhhhhhhllllllhhhHHHHHHHHHHHHHHLL---------LLEE
Query FKIELDG---fVDYLrkleaaadvsitrfddLRQALTRRLDHFAACG---------CRAS  237
ident                                   |        ||               
Sbjct TQTRQLEadlpTALR--------------peTLDAYVADIERLAARYhdaspramrRVVM  191
DSSP  LLLLLLLllllHHHL--------------llLHHHHHHHHHHHHHHLlllllllleEEEE


DSSP  E-EEELLllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEE
Query D-HGIETlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQ  296
ident                                                        |    
Sbjct ApTTVLY-------------------------------siSPREMRETAAVARRLGLRMH  220
DSSP  LlLLLLL-------------------------------llLHHHHHHHHHHHHHLLLEEE


DSSP  EEELeellllhhhhhhhllllllleelllllHHHHHHHHHHHhllllllEEEE-EELLhh
Query LHIGairnnntrxfrllgpdtgfdsigdnniSWALSRLLDSXdvtnelpKTIL-YCLNpr  355
ident  |                                                          
Sbjct SHLS--------------------------gKSPVAFCGEHD---wlgsDVWYaHLVK--  249
DSSP  EELL--------------------------lLLHHHHHHHLL---llllLEEEeLLLL--


DSSP  HHHHHHHHHHHLlllllllLEEELL---lLHHHllhhhhhhHHHHHHHHLLhhhLLLLLL
Query DNEVLATXIGNFqgpgiagKVQFGS---gWWFNdqkdgxlrQLEQLSQXGLlsqFVGXLT  412
ident                                                  |     |    
Sbjct VDADEIALLAQT-------GTGVAHcpqsNGRL--------PVREMADAGV---PVSIGV  291
DSSP  LLHHHHHHHHHH-------LLEEEElhhhHHLL--------LLLLHHHHLL---LEEELL


DSSP  LLL--LLLLL--HHHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-
Query DSR--SFLSY--TRHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-  467
ident |                        |                   |         |    
Sbjct DGAasNEAADmiSEVHMTWLAQRARL--------------aSIAEVIHWGTAGGARVMGl  337
DSSP  LHHhhLLLLLhhHHHHHHHHHHHHLL--------------lLHHHHHHHHLHHHHHHHLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct devgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddlie  397
DSSP  llllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelllll


DSSP  ----------------------ll
Query ----------------------ik  469
ident                         
Sbjct gvdikelggearrvvrellrevvv  421
DSSP  lllhhhhhhhhhhhhhhhhhhhhl


No 27: Query=3iacA Sbjct=4qrnA Z-score=11.7

back to top
DSSP  llllLLLLllllhhhhhhhhhllLLLLEEELLLLLL------------------------
Query atfxTEDFllkndiartlyhkyaAPXPIYDFHCHLS------------------------   36
ident                                                             
Sbjct ----SMTQ--------dlktggeQGYLRIATEEAFAtreiidvylrmirdgtadkgmvsl   48
DSSP  ----LLLL--------lllllllLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhh


DSSP  ------------------hHHHHHllllllhhhhhhllllhhhhhhhhllllhhhlllll
Query ------------------pQEIADdrrfdnlgqiwlegdhykwralrsagvdeslitgke   78
ident                                                             
Sbjct wgfyaqspseratqilerlLDLGE------------------------------------   72
DSSP  hhhhhhlllhhhhhhhhhhHLLLH------------------------------------


DSSP  llhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllh
Query tsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatp  138
ident                                                             
Sbjct ------------------------------------------------------------   72
DSSP  ------------------------------------------------------------


DSSP  hhLHHHHHHHLLEEEEELLL----------------lLLLLLHHHHHHHHLllLLLEEEL
Query afSARGIXQQXNVRXVGTTD----------------dPIDSLEYHRQIAADdsIDIEVAP  182
ident                                                             
Sbjct --RRIADMDATGIDKAILALtspgvqplhdldeartlATRANDTLADACQK--YPDRFIG  128
DSSP  --HHHHHHHHLLLLEEEEEEllllllllllhhhhhhhHHHHHHHHHHHHHH--LLLLEEE


DSSP  LLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHH-HLLLLEEEEEE
Query SWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLDHFA-ACGCRASDHGI  241
ident                                          |     |   |        
Sbjct MGTVAPQ----------------------------DPEWSAREIHRGArELGFKGIQINS  160
DSSP  LLLLLLL----------------------------LHHHHHHHHHHHHhLLLLLLEEELL


DSSP  L---LLLLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHhHHHHHHHHHHLLEEEEE
Query E---TLRFapvpddaqldailgkrlagetlseleiaqfTTAVlVWLGRQYAARGWVXQLH  298
ident                                                |           |
Sbjct HtqgRYLD------------------------------EEFF-DPIFRALVEVDQPLYIH  189
DSSP  LlllLLLL------------------------------LHHH-HHHHHHHHHHLLLEEEL


DSSP  ELEEL------LLLHhhhhhhlllllLLEELL---lllhhHHHHHHH-HHHLLLLLLEEE
Query IGAIR------NNNTrxfrllgpdtgFDSIGD---nniswALSRLLD-SXDVTNELPKTI  348
ident                            |             | ||               
Sbjct PATSPdsmidpMLEA----------gLDGAIFgfgvetgmHLLRLITiGIFDKYPSLQIM  239
DSSP  LLLLLllllhhHHHH----------lLLLLLLhhhhhhhhHHHHHHHhLHHHHLLLLLEE


DSSP  EEellhhhhhHHHH--------------------------hhHHLLlllllLLEEELLLl
Query LYclnprdneVLAT--------------------------xiGNFQgpgiaGKVQFGSGw  382
ident            |                                         |      
Sbjct VG----hmgeALPYwlyrldymhqagvrsqryermkplkktiEGYL----kSNVLVTNS-  290
DSSP  EL----hhhhLHHHhhhhhhhhhhhhhhlllllllllllllhHHHH----hHLEEEELL-


DSSP  hhHLLHhhhHHHHHHHHHHLLHhHLLLLLLLLLLlLLLHHHHHHHHhhHHHHhhhhhlll
Query wfNDQKdgxLRQLEQLSQXGLLsQFVGXLTDSRSfLSYTRHEYFRRilCNLLgqwaqdge  442
ident                  |       |    |                             
Sbjct --GVAW---EPAIKFCQQVMGE-DRVMYAMDYPYqYVADEVRAMDA--MDMS--------  334
DSSP  --LLLL---HHHHHHHHHHHLH-HHEELLLLLLLlLLHHHHHHHHL--LLLL--------


DSSP  llllhhhhHHHHHHHHLHHHHHHLLll
Query ipddeaxlSRXVQDICFNNAQRYFTik  469
ident                   ||   |   
Sbjct --------AQTKKKFFQTNAEKWFK-l  352
DSSP  --------HHHHHHHHLHHHHHHLL-l


No 28: Query=3iacA Sbjct=4c5yA Z-score=11.6

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct --------deakvtiiyagLLIPgdgeplrnaalvisdkiiafvgseadipkkylrstqs   52
DSSP  --------lllleeeeeeeEELLllllleeeeeeeeelleeeeeeehhhllhhhhhhlll


DSSP  ------lLLLEEELLLLLLH--------------------HHHHhllllllhhhhhhlll
Query ------aPXPIYDFHCHLSP--------------------QEIAddrrfdnlgqiwlegd   57
ident             | | |                          |                
Sbjct thrvpvlMPGLWDCHMHFGGdddyyndytsglathpassgARLA----------------   96
DSSP  eeeeeeeEELEEEEEELLLLllllllllhhhhhllhhhhhHHHH----------------


DSSP  lhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllllllll
Query hykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgt  117
ident                                                             
Sbjct ------------------------------------------------------------   96
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLlllllLHHHHHHHHLLLLL
Query lfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDdpidsLEYHRQIAADDSID  177
ident                               |                |    |       
Sbjct -----------------------RGCWEALQNGYTSYRDLA--gygCEVAKAINDGTIVG  131
DSSP  -----------------------HHHHHHHHLLEEEEEELL--llhHHHHHHHHLLLLLL


DSSP  LEEELL-LLLHHHHL--LLLLL-HHHHHHHHhhHHLLL--------lllhhhHHHHHHHH
Query IEVAPS-WRPDKVFK--IELDG-FVDYLRKLeaAADVS--------itrfddLRQALTRR  225
ident   |  |                     |                              | 
Sbjct PNVYSSgAALSQTAGhgDIFALpAGEVLGSY--GVMNPrpgywgagplciadGVEEVRRA  189
DSSP  LEEEELlLEEELLLLllLLLLLlHHHHHHHH--LLLLLllllllllleeellLHHHHHHH


DSSP  HHHHHHLLLLEEEEEE----------LLLLllllllhhhhhhhhhhhhllllllhhhhhh
Query LDHFAACGCRASDHGI----------ETLRfapvpddaqldailgkrlagetlseleiaq  275
ident        |                                                    
Sbjct VRLQIRRGAKVIXVMAsggvmsrddnPNFA-----------------------------q  220
DSSP  HHHHHHHLLLLEEEELllllllllllLLLL-----------------------------l


DSSP  hHHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleellllLHHHHHhHH
Query fTTAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnnISWALSrLL  335
ident      |       |        |                                     
Sbjct fSPEELKVIVEEAARQNRIVSAHVH--------------------------GKAGIM-AA  253
DSSP  lLHHHHHHHHHHHHHLLLLEEEEEL--------------------------LHHHHH-HH


DSSP  HHHhlllllLEEEEE-ELLHhhHHHHHHHHHHLlllllllLEEELLLL-HHHL-------
Query DSXdvtnelPKTILY-CLNPrdNEVLATXIGNFqgpgiagKVQFGSGW-WFND-------  386
ident              |         |                                    
Sbjct IKA------GCKSLEhVSYA--DEEVWELMKEK-------GILYVATRsVIEIflasnge  298
DSSP  HHH------LLLEEEeLLLL--LHHHHHHHHHH-------LLEEELLHhHHHHhhhhlll


DSSP  ------------lhHHHHHHHHHHHHHLLhhhLLLLLLLLLLLLLLHHHHHHHHHHhhhh
Query ------------qkDGXLRQLEQLSQXGLlsqFVGXLTDSRSFLSYTRHEYFRRILcnll  434
ident               |  |         |         ||            |        
Sbjct glvkeswaklqalaDSHLKAYQGAIKAGV---TIALGTDTAPGGPTALELQFAVER----  351
DSSP  lllllhhhlllhhhHHHHHHHHHHHHLLL---LEELLLLLLLLLLLHHHHHHHHHL----


DSSP  hhhhhlllllllhhhHHHHHHHHHLHHHHHHLLL--------------------------
Query gqwaqdgeipddeaxLSRXVQDICFNNAQRYFTI--------------------------  468
ident                           ||                                
Sbjct ------------ggmTPLEAIKAATANAPLSVGPqapltgqlregyeadvialeenpled  399
DSSP  ------------lllLHHHHHHHHLLLHHHHHHHhlllllllllllllleeeelllllll


DSSP  ------------------------------------l
Query ------------------------------------k  469
ident                                      
Sbjct ikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  hhhhhlhhheeeeeelleeeellllllllllllllll


No 29: Query=3iacA Sbjct=2gwgA Z-score=11.6

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLLHH----------------------
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLSPQ----------------------   38
ident                            | | | |                          
Sbjct --------------------------XIIDIHGHYTTApkaledwrnrqiagikdpsvxp   34
DSSP  --------------------------LLEEEEEELLLLlhhhhhhhhhhhhhhhlhhhll


DSSP  ---------hhHHLLllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhh
Query ---------eiADDRrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawa   89
ident                                                             
Sbjct kvselkisddeLQAS---------------------------------------------   49
DSSP  lhhhllllhhhHHHH---------------------------------------------


DSSP  hhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhHLHH-HHHHH
Query ntvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpaFSAR-GIXQQ  148
ident                                                          || 
Sbjct -------------------------------------------------iIENQlKKXQE   60
DSSP  -------------------------------------------------hHLLHhHHHHH


DSSP  LLEEEEELLL----------lLLLLLHHHHHHHHLllLLLEEELLLLLHHhhLLLLllhh
Query XNVRXVGTTD----------dPIDSLEYHRQIAADdsIDIEVAPSWRPDKvfKIELdgfv  198
ident                           |                                 
Sbjct RGSDLTVFSPragdfnvsstwAAICNELCYRVSQL--FPDNFIGAAXLPQ--SPGV----  112
DSSP  HLLLEEEEELllllhhhhhhhHHHHHHHHHHHHHH--LLLLEEEEEELLL--LLLL----


DSSP  hhhhhhhhhhllllllhhHHHHhHHHHHHHHH-HLLLLEEEEEEL------LLLLlllll
Query dylrkleaaadvsitrfdDLRQaLTRRLDHFA-ACGCRASDHGIE------TLRFapvpd  251
ident                   |        |       |  |            |        
Sbjct ------------------DPKT-CIPELEKCVkEYGFVAINLNPDpsgghwTSPP-----  148
DSSP  ------------------LHHH-HHHHHHHHHhLLLLLEEEELLLllllllLLLL-----


DSSP  hhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHHHHHLLEEEEEeleellllhhhhh
Query daqldailgkrlagetlseleiaqftTAVLVWLGRQYAARGWVXQLHigairnnntrxfr  311
ident                                               |             
Sbjct ------------------------ltDRIWYPIYEKXVELEIPAXIH-------------  171
DSSP  ------------------------llLHHHHHHHHHHHHHLLLEEEL-------------


DSSP  hhlllllLLEE---lllllhHHHHHhhHHHHLLLLLLEEEEE--ELLHhHHHH-------
Query llgpdtgFDSI---gdnnisWALSRllDSXDVTNELPKTILY--CLNPrDNEV-------  359
ident                                      |                      
Sbjct -----vsTGAHylnadttafXQCVA--GDLFKDFPELKFVIPhgGGAV-PYHWgrfrgla  223
DSSP  -----llLLLHhhhhhhhhhHHHHH--LLHHHHLLLLLEEELhhHLLL-HHHHhhhhhhh


DSSP  ----hhhHHHHLLlllllLLEEELLLLhhhLLHHHHHHHHHHHhhhllHHHLLLLLLLLL
Query ----latXIGNFQgpgiaGKVQFGSGWwfnDQKDGXLRQLEQLsqxglLSQFVGXLTDSR  415
ident                       |           |                 |       
Sbjct qexkkplLEDHVL-----NNIFFDTCV---YHQPGIDLLNTVI-----PVDNVLFASEXI  270
DSSP  hhlllllHHHHLL-----LLEEEELLL---LLHHHHHHHHHHL-----LHHHEELLLLLL


DSSP  L----------lllLHHHhHHHHHhHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHH
Query S----------flsYTRHeYFRRIlCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRY  465
ident                             |                    | |   || | 
Sbjct GavrgidprtgfyyDDTK-RYIEA-STIL---------------TPEEKQQIYEGNARRV  313
DSSP  LlllleelllleelLLLH-HHHHH-LLLL---------------LHHHHHHHHLHHHHHH


DSSP  LLL------------l
Query FTI------------k  469
ident                 
Sbjct YPRldaalkakgkleh  329
DSSP  LHHhhhhhhhhhhhll


No 30: Query=3iacA Sbjct=3ls9A Z-score=11.2

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct -----------milirgltRVITfddqereledadilidgpkivavgkdlsdrsvsrtid   49
DSSP  -----------leeeeeeeEEELlllllleeeeeeeeeelleeeeeellllllllleeee


DSSP  -----lLLLEEELLLLLLhhhhhhllllllhhhHHHLlllHHHHhhhhllllhhhlllll
Query -----aPXPIYDFHCHLSpqeiaddrrfdnlgqIWLEgdhYKWRalrsagvdeslitgke   78
ident              | ||                                           
Sbjct grgmiaLPGLINSHQHLY------------egaMRAI-pqLERV----------------   80
DSSP  llleeeEELEEEEEELHH------------hhhHLLL-hhHLLL----------------


DSSP  llhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllh
Query tsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatp  138
ident                                                             
Sbjct ------------------------------tmaswlegvltrsagwwrdgkfgpdvirev  110
DSSP  ------------------------------lhhhhhhhhhhhhhhhhhlllllhhhhhhh


DSSP  hhLHHHHHHHLLEEEEELLLL-----lLLLL-HHHHHHHHLllLLLEEELLLLLHhhHLL
Query afSARGIXQQXNVRXVGTTDD-----pIDSL-EYHRQIAADdsIDIEVAPSWRPDkvFKI  192
ident                |            ||        | |    |              
Sbjct arAVLLESLLGGITTVADQHLffpgatADSYiDATIEAATD--LGIRFHAARSSM--TLG  166
DSSP  hhHHHHHHHHLLEEEEEEEELllllllLLLHhHHHHHHHHH--HLLEEEEEELLL--LLL


DSSP  LLL---lHHHHHhhhhhhhllllllhhhhhHHHHHHHHHHHHLL---------LLEEE-E
Query ELD---gFVDYLrkleaaadvsitrfddlrQALTRRLDHFAACG---------CRASD-H  239
ident                                                        |    
Sbjct KSEggfcDDLFV---------------epvDRVVQHCLGLIDQYhepepfgmvRIALGpC  211
DSSP  HHHllllLHHHL---------------llhHHHHHHHHHHHHHHlllllllleEEEELlL


DSSP  EELlllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEE
Query GIEtlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHI  299
ident |                                                |        | 
Sbjct GVP--------------------------------ydKPELFEAFAQMAADYDVRLHTHF  239
DSSP  LLL--------------------------------llLHHHHHHHHHHHHHHLLEEEEEE


DSSP  LEellllhhhhhhhllllllleELLL---------LLHHHHHHHHHhhhllllllEEEEE
Query GAirnnntrxfrllgpdtgfdsIGDN---------NISWALSRLLDsxdvtnelpKTILY  350
ident                         |               |                 | 
Sbjct YE--------------------PLDAgmsdhlygmTPWRFLEKHGW------asdRVWLA  273
DSSP  LL--------------------LLHHhhhhhhhllLHHHHHHHLLL------lllLEEEE


DSSP  -ELLHhHHHHhHHHHHHLLlllllllEEELL-llHHHLlhhHHHHhHHHHHHHLLhhhLL
Query -CLNPrDNEVlATXIGNFQgpgiagkVQFGS-gwWFNDqkdGXLRqLEQLSQXGLlsqFV  408
ident     |   |                 |              |           |     |
Sbjct hAVVP-PREE-IPEFADAG-------VAIAHliaPDLRmgwGLAP-IREYLDAGI---TV  320
DSSP  eLLLL-LHHH-HHHHHHHL-------LEEEElhhHHHHlllLLLL-HHHHHHLLL---EE


DSSP  LLLLLLL---LLLLL-HHHHHHHHHH--hhhhHHHHhlllllllhhhhHHHHHHHHLHHH
Query GXLTDSR---SFLSY-TRHEYFRRIL--cnllGQWAqdgeipddeaxlSRXVQDICFNNA  462
ident |  |                                             |          
Sbjct GFGTTGSasnDGGNLlGDLRLAALAHrpadpnEPEK---------wlsARELLRMATRGS  371
DSSP  EELLLLLlllLLLLHhHHHHHHHHHLhhhlllLHHH---------lllHHHHHHHLLHHH


DSSP  HHHLL-------------------------------------------------------
Query QRYFT-------------------------------------------------------  467
ident                                                             
Sbjct AECLGrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlv  431
DSSP  HHHLLlllllllllllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeee


DSSP  --------------------ll
Query --------------------ik  469
ident                       
Sbjct enerpvladlerivanttalip  453
DSSP  elleellllhhhhhhhhhhhll


No 31: Query=3iacA Sbjct=1j6pA Z-score=11.1

back to top
DSSP  llllllllllllhhhhhhhHHLL----------------------------------lLL
Query atfxtedfllkndiartlyHKYA----------------------------------aPX   26
ident                     |                                       
Sbjct ---------hhxiigncliLKDFssepfwgaveiengtikrvlqgevkvdldlsgklvXP   51
DSSP  ---------leeeeeeeeeLLLLlllleeeeeeeelleeeeeeelllllleellleeeEE


DSSP  LEEELLLLLL---------------------------------HHHHHhllllllhhhhh
Query PIYDFHCHLS---------------------------------PQEIAddrrfdnlgqiw   53
ident      | |                                                    
Sbjct ALFNTHTHAPxtllrgvaedlsfeewlfskvlpiedrltekxaYYGTI------------   99
DSSP  LEEEEEELHHhhhhllllllllhhhhhhllhhhhhllllhhhhHHHHH------------


DSSP  hllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllll
Query legdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfg  113
ident                                                             
Sbjct ------------------------------------------------------------   99
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLLllLLLHHHHHHHHl
Query itgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTDDpiDSLEYHRQIAAd  173
ident                             |   |                           
Sbjct ---------------------------lAQXEXARHGIAGFVDXYF--HEEWIAKAVRD-  129
DSSP  ---------------------------hHHHHHHLLLEEEEEEEEL--LHHHHHHHHHH-


DSSP  llLLLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHLL
Query dsIDIEVAPSWRPDkvFKIEldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAACG  233
ident                                                             
Sbjct --FGXRALLTRGLV--DSNG------------------------ddggRLEENLKLYNEW  161
DSSP  --HLLEEEEEEEEL--LLLL------------------------llllHHHHHHHHHHHH


DSSP  -------LLEEE-EEELlllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHH
Query -------CRASD-HGIEtlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLG  285
ident              |                                         |    
Sbjct ngfegriFVGFGpHSPY--------------------------------lcSEEYLKRVF  189
DSSP  llhhhleEEEEEeLLLL--------------------------------llLHHHHHHHH


DSSP  HHHHHHLLEEEEEELEellllhhhhhhhllllllleeLLLLLHhhHHHHHHHHhllllLL
Query RQYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsiGDNNISwaLSRLLDSXdvtneLP  345
ident             |                                |   |          
Sbjct DTAKSLNAPVTIHLYE--------------------tSKEEYD--LEDILNIG---lkEV  224
DSSP  HHHHHHLLLEEEEELL--------------------lLLLLLL--LHHHHLLL---llLL


DSSP  EEEEE-ELLHhHHHHhHHHHHHLlllllllLEEELL--lLHHHllhHHHHhhHHHHHHHL
Query KTILY-CLNPrDNEVlATXIGNFqgpgiagKVQFGS--gWWFNdqkDGXLrqLEQLSQXG  402
ident |||   |                                                    |
Sbjct KTIAAhCVHL-PERY-FGVLKDI-------PFFVSHnpaSNLKlgnGIAP--VQRXIEHG  273
DSSP  LEEEEeLLLL-LHHH-HHHHLLL-------LEEEEElhhHHHHlllLLLL--HHHHHHLL


DSSP  LhhhLLLLLLLLL---LLLLL-HHHHHHHHHHHHHHHHhhhlllllllhhhhHHHHHHHH
Query LlsqFVGXLTDSR---SFLSY-TRHEYFRRILCNLLGQwaqdgeipddeaxlSRXVQDIC  458
ident      |   ||       |                                         
Sbjct X---KVTLGTDGAasnNSLNLfFEXRLASLLQKAQNPR-----------nldVNTCLKXV  319
DSSP  L---EEEELLLLLlllLLLLHhHHHHHHHHHHHLLLLL-----------lllHHHHHHHH


DSSP  LHHHHHHLL---------------------------------------------------
Query FNNAQRYFT---------------------------------------------------  467
ident                                                             
Sbjct TYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkw  379
DSSP  LHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeellee


DSSP  --------------------------ll
Query --------------------------ik  469
ident                             
Sbjct iyfdgeyptidseevkrelariekelys  407
DSSP  eeellllllllhhhhhhhhhhhhhhhhl


No 32: Query=3iacA Sbjct=3nqbA Z-score=11.1

back to top
DSSP  ------------llllllllllllhhhhhhhHHLL-------------------------
Query ------------atfxtedfllkndiartlyHKYA-------------------------   23
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggTLVDvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeellEEELllllleeeleeeeelleeeeeelll


DSSP  ---------------lLLLEEELLLLLL--hHHHHHllllllhhhhhhllllhhhhhhhh
Query ---------------aPXPIYDFHCHLS--pQEIADdrrfdnlgqiwlegdhykwralrs   66
ident                      | | |        |                         
Sbjct srrdaaqvidaggayvSPGLIDTHXHIEssxITPAA------------------------   96
DSSP  lllleeeeeelllleeEELEEEEEELHHhhlLLHHH------------------------


DSSP  llllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhh
Query agvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaes  126
ident                                                             
Sbjct ------------------------------------------------------------   96
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllhhhlHHHHHHHLLEEEEELLLL------LLLL-LHHHHHHHHlllLLLE
Query iwtqcneklatpafsARGIXQQXNVRXVGTTDD------PIDS-LEYHRQIAAddsIDIE  179
ident                         |                |        |         
Sbjct ---------------YAAAVVARGVTTIVWDPHefgnvhGVDGvRWAAKAIEN---LPLR  138
DSSP  ---------------HHHHHHLLLEEEEEELLHhhhhhhLHHHhHHHHHHHLL---LLLE


DSSP  EELLLLLHHHHLLLLLLhHHHHhhhhhhhllllllhhhHHHHHHHHHHhhhHLLLLEE-E
Query VAPSWRPDKVFKIELDGfVDYLrkleaaadvsitrfddLRQALTRRLDhfaACGCRAS-D  238
ident               |                           |   |             
Sbjct AILLAPSCVPSAPGLER-GGAD---------------fDAAILADLLS---WPEIGGIaE  179
DSSP  EEEEELLLLLLLLLLLL-LLLL---------------lLHHHHHHHHL---LLLEEEEeE


DSSP  EEELLllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEE
Query HGIETlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLH  298
ident                                                    |       |
Sbjct IXNXR-----------------------------gvieRDPRXSGIVQAGLAAEKLVCGH  210
DSSP  ELLHH-----------------------------hhhlLLHHHHHHHHHHHHHLLEEEEL


DSSP  ELEellllhhhhhhhllllllleellllLHHHHHHHHHHHhlllllleEEEEELLH-HHH
Query IGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXdvtnelpkTILYCLNP-RDN  357
ident                                 |                    |    | 
Sbjct ARG------------------------lKNADLNAFXAAG-------vSSDHELVSgEDL  239
DSSP  LLL------------------------lLHHHHHHHHHLL-------lLEELLLLLhHHH


DSSP  HHHHHHHhhlllllllllEEELLllhhhLLHHHHHHHHHHHhhhlLHHHLLLLLLLLLL-
Query EVLATXIgnfqgpgiagkVQFGSgwwfnDQKDGXLRQLEQLsqxgLLSQFVGXLTDSRS-  416
ident                                         |     | | |   ||    
Sbjct XAKLRAG-----------LTIEL---rgSHDHLLPEFVAALntlgHLPQTVTLCTDDVFp  285
DSSP  HHHHHLL-----------LEEEE---elLLHHHHHHHHHHHhhhlLLLLLEEEELLLLLh


DSSP  -----lLLLHHHHHHHHHHHhhhhhhhhlllllllhhhhhHHHHHHHLHHHHHHLL----
Query -----fLSYTRHEYFRRILCnllgqwaqdgeipddeaxlsRXVQDICFNNAQRYFT----  467
ident                                                  ||         
Sbjct ddllqgGGLDDVVRRLVRYG-----------------lkpEWALRAATLNAAQRLGrsdl  328
DSSP  hhhhhlLLHHHHHHHHHHLL-----------------llhHHHHHHHLHHHHHHHLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct gliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrx  388
DSSP  lllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct andflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaeptt  448
DSSP  hhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct ktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvta  508
DSSP  eeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct ilplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtd  568
DSSP  eeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleell


DSSP  -----------------ll
Query -----------------ik  469
ident                    
Sbjct xgiadvltgkvxespviev  587
DSSP  lleeelllleeellleeel


No 33: Query=3iacA Sbjct=1yrrB Z-score=10.9

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct -------------yaltqgRIFTgheflddhavviadgliksvcpvaelppeieqrslng   47
DSSP  -------------leeellEEELllleelleeeeeelleeeeeeehhhlllllleeelll


DSSP  --LLLLEEELLLLL-------------lHHHHHhllllllhhhhhhllllhhhhhhhhll
Query --APXPIYDFHCHL-------------sPQEIAddrrfdnlgqiwlegdhykwralrsag   68
ident         |                                                   
Sbjct aiLSPGFIDVQLNGcggvqfndtaeavsVETLE---------------------------   80
DSSP  leEEELEEEEEELEelleelllllllllHHHHH---------------------------


DSSP  llhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhh
Query vdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiw  128
ident                                                             
Sbjct ------------------------------------------------------------   80
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllhhhLHHHHHHHLLEEEEELLLLL-----LLLL-HHHHHHHHLLlLLLEEEL
Query tqcneklatpafSARGIXQQXNVRXVGTTDDP-----IDSL-EYHRQIAADDsIDIEVAP  182
ident                             |                |   |          
Sbjct ------------IMQKANEKSGCTNYLPTLITtsdelMKQGvRVMREYLAKH-PNQALGL  127
DSSP  ------------HHHHHHHLLLEEEEEEEELLllhhhHHHHhHHHHHHHHHL-LLLLLLE


DSSP  LLLLHHhhllllllhhhhhhhhhhhhllllllhhhhhHHHHHHHHHHHHlLLLEEEEEel
Query SWRPDKvfkieldgfvdylrkleaaadvsitrfddlrQALTRRLDHFAAcGCRASDHGie  242
ident                                       ||   |   |            
Sbjct HLEGPW-----------------------------lnAALVDFLCENAD-VITKVTLA--  155
DSSP  EEELLL-----------------------------llLHHHHHHHHLHH-HEEEEEEL--


DSSP  lllllllllhhhhhhhhhhhhllllllhhhhhhhhhhHHHHHHHHHHHHLLEEE-EEELe
Query tlrfapvpddaqldailgkrlagetlseleiaqfttaVLVWLGRQYAARGWVXQ-LHIGa  301
ident                                      |        |  | |    |   
Sbjct ----------------------------------pemVPAEVISKLANAGIVVSaGHSN-  180
DSSP  ----------------------------------hhhLLHHHHHHHHHHLLEEEeLLLL-


DSSP  ellllhhhhhhhllllllleellllLHHHHHhHHHHHhllllLLEEEE---EELLHH---
Query irnnntrxfrllgpdtgfdsigdnnISWALSrLLDSXdvtneLPKTIL---YCLNPR---  355
ident                                                             
Sbjct ------------------------aTLKEAK-AGFRA-----GITFAThlyNAMPYItgr  210
DSSP  ------------------------lLHHHHH-HHHHH-----LEEEELlllLLLLLLlll


DSSP  --hhhHHHHHHHhllllllllLEEELLllhhhLLHHHHHHHHHHHHHHLLhhHLLLLLLL
Query --dneVLATXIGnfqgpgiagKVQFGSgwwfnDQKDGXLRQLEQLSQXGLlsQFVGXLTD  413
ident                          |      |                         ||
Sbjct epglaGAILDEA---------DIYCGI---iaDGLHVDYANIRNAKRLKG--DKLCLVTD  256
DSSP  llhhhHHHHHLL---------LLEEEE---elLLLLLLHHHHHHHHHHHH--HHEEEELL


DSSP  LLlllLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL------
Query SRsflSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT------  467
ident      |        | |    |                  |         |         
Sbjct AT-sgSSLTMIEGVRNLVEHCG-------------iALDEVLRMATLYPARAIGvekrlg  302
DSSP  LL-llLLLLHHHHHHHHHHHHL-------------lLHHHHHHHHLHHHHHHLLllllll


DSSP  ------------------------------ll
Query ------------------------------ik  469
ident                                 
Sbjct tlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  llllllllleeeellllleeeeeelleeeeel


No 34: Query=3iacA Sbjct=2imrA Z-score=10.9

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct -----------htprlltcDVLYtgaqspggvvvvgetvaaaghpdelrrqyphaaeera   49
DSSP  -----------lleeeeeeLEEElleelleeeeeelleeeeeelhhhhhhhlllleeeel


DSSP  ---LLLLEEELLLLLL------------------------------HHHHhhllllllhh
Query ---APXPIYDFHCHLS------------------------------PQEIaddrrfdnlg   50
ident       |    | ||                                |            
Sbjct gavIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrgvaaAQAG----------   99
DSSP  lleELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllhhhhHHHH----------


DSSP  hhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhl
Query qiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrr  110
ident                                                             
Sbjct ------------------------------------------------------------   99
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhhhhhhllhhhlhhHHHHHLLEEEEELLLLlLLLL-HHHHH
Query pfgitgtlfgpdtaesiwtqcneklatpafsarGIXQQXNVRXVGTTDDpIDSL-EYHRQ  169
ident                                            ||               
Sbjct --------------------------------aDTLTRLGAGGVGDIVW-APEVmDALLA  126
DSSP  --------------------------------hHHHHHLLLLLEEEEEL-LHHHhHHHHL


DSSP  HhhlllLLLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllllllhHHHHHHHHHHHHHH
Query IaaddsIDIEVAPSWRPDkvFKIEldgfvdylrkleaaadvsitrfDDLRQALTRRLDHF  229
ident        |                                      |    |    |   
Sbjct R-----EDLSGTLYFEVL--NPFP-------------------dkaDEVFAAARTHLERW  160
DSSP  L-----LLLLEEEEEEEL--LLLH-------------------hhhHHHHHHHHHHHHHH


DSSP  HHLL----LLEEE-EEELlllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHH
Query AACG----CRASD-HGIEtlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWL  284
ident               |                                            |
Sbjct RRLErpglRLGLSpHTPF--------------------------------tvSHRLMRLL  188
DSSP  HLLLllleEEEEEeLLLL--------------------------------llLHHHHHHH


DSSP  HHHHHHHLLEEEEEELeellllhhhhhhhllllllleELLL-------------------
Query GRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsIGDN-------------------  325
ident     |  |   | |                                              
Sbjct SDYAAGEGLPLQIHVA-------------------ehPTELemfrtgggplwdnrmpaly  229
DSSP  HHHHHHHLLLLEEEEL-------------------llHHHHhhhhhlllllhhhllhhhl


DSSP  ----------------LLHHHHHHHHhhhhllllLLEEEE-EELLhhHHHHHHHHHHHLL
Query ----------------NISWALSRLLdsxdvtneLPKTIL-YCLNprDNEVLATXIGNFQ  368
ident                      |  |              |    |               
Sbjct phtlaevigrepgpdlTPVRYLDELG------vlAARPTLvHMVN--VTPDDIARVARAG  281
DSSP  lllhhhhhllllllllLHHHHHHHHL------lhHHLLEEeELLL--LLHHHHHHHHHHL


DSSP  lllllllEEELL-llHHHL-lHHHHhhHHHHHHHHLLhhhLLLLLLLLLL-lLLLHhHHH
Query gpgiagkVQFGS-gwWFND-qKDGXlrQLEQLSQXGLlsqFVGXLTDSRS-fLSYTrHEY  425
ident                                    |     |   |||            
Sbjct -------CAVVTcprSNHHleCGTF--DWPAFAAAGV---EVALGTDSVAsgETLN-VRE  328
DSSP  -------LLEEElhhHHHHllLLLL--LHHHHHHLLL---LEEELLLLHHhhLLLL-LHH


DSSP  HHHHHHHHHHHhhhlllllllhhhhHHHHHHHHLHHHHHHLL------------------
Query FRRILCNLLGQwaqdgeipddeaxlSRXVQDICFNNAQRYFT------------------  467
ident        |                  |          ||                     
Sbjct EVTFARQLYPG------------ldPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwel  376
DSSP  HHHHHHHHLLL------------llHHHHHHHHHHHHHHHHLlllllllllllhhhlhhh


DSSP  --ll
Query --ik  469
ident     
Sbjct srdl  380
DSSP  llll


No 35: Query=3iacA Sbjct=1k6wA Z-score=10.8

back to top
DSSP  --------------------------llllllllllllhhhhhhhhhlllLLLEEELLLL
Query --------------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCH   34
ident                                                     |    | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  LLhhhhhhllllllhhhHHHLlllhHHHHhhhllllhhhlllllllhhhhhhhhhhhhhh
Query LSpqeiaddrrfdnlgqIWLEgdhyKWRAlrsagvdeslitgketsdyekyxawantvpk   94
ident |                                                           
Sbjct LD------------ttqTAGQ-pnwNQSG-------------------------------   76
DSSP  LL------------lllLLLL-lllLLLL-------------------------------


DSSP  llllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEE
Query tlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXV  154
ident                                                            |
Sbjct --------------------tlfegierwaerkallthddvkqrawQTLKWQIANGIQHV  116
DSSP  --------------------lhhhhhhhhhllhhhllhhhhhhhhhHHHHHHHHLLEEEE


DSSP  ELLLLL------LLLL--HHHHHHHhlllLLLEEELLLLLHHHHLLLLllhhhhhhhhhh
Query GTTDDP------IDSL--EYHRQIAaddsIDIEVAPSWRPDKVFKIELdgfvdylrklea  206
ident  |  |             |     |      |       |                    
Sbjct RTHVDVsdatltALKAmlEVKQEVA----PWIDLQIVAFPQEGILSYP------------  160
DSSP  EEEEELlllllhHHHHhhHHHHHHL----LLLEEEEEEELLLLLLLLL------------


DSSP  hhllllllhhhhhhHHHHHHHHHhhllLLEEEEEEL--LLLLlllllhhhhhhhhhhhhl
Query aadvsitrfddlrqALTRRLDHFaacgCRASDHGIE--TLRFapvpddaqldailgkrla  264
ident                |   |                    |                   
Sbjct ----------ngeaLLEEALRLG----ADVVGAIPHfeFTRE------------------  188
DSSP  ----------lhhhHHHHHHHLL----LLEEEELHHhlLLHH------------------


DSSP  lllllhhhhhhhHHHHHHHHHHHHHHHLLEEEE-EELEellllhhhhhhhllllllleeL
Query getlseleiaqfTTAVLVWLGRQYAARGWVXQL-HIGAirnnntrxfrllgpdtgfdsiG  323
ident                 |                                           
Sbjct -----------yGVESLHKTFALAQKYDRLIDVhCDEI---------------------D  216
DSSP  -----------hHHHHHHHHHHHHHHHLLEEEEeELLL---------------------L


DSSP  LLLLHhhHHHHHHHHHLlLLLL-EEEE-EELLHHH-----hhhhHHHHHHLLlllllllE
Query DNNISwaLSRLLDSXDVtNELP-KTIL-YCLNPRD-----nevlATXIGNFQgpgiagkV  376
ident |                                                           
Sbjct DEQSR-fVETVAALAHH-EGMGaRVTAsHTTAMHSyngaytsrlFRLLKMSG-------I  267
DSSP  LLLLL-hHHHHHHHHHH-HLLHhHEEEeELHHHHHllhhhhhhhHHHHHHHL-------L


DSSP  EELL-llHHHL---------lHHHHhhHHHHHHHHLLhhhLLLLLLLLLL-----lLLLH
Query QFGS-gwWFND---------qKDGXlrQLEQLSQXGLlsqFVGXLTDSRS-----fLSYT  421
ident  |                     |           |     |    |             
Sbjct NFVAnplVNIHlqgrfdtypkRRGI-tRVKEMLESGI---NVCFGHDDVFdpwyplGTAN  323
DSSP  EEEElhhHHHHhlllllllllLLLL-lLHHHHHHLLL---LEEELLLLLLllllllLLLL


DSSP  hHHHHHHHHHH--HHHHhhhlllllllhHHHHHHHHHHHLHHHHH-HLLL----------
Query rHEYFRRILCN--LLGQwaqdgeipddeAXLSRXVQDICFNNAQR-YFTI----------  468
ident               |                             |               
Sbjct -MLQVLHMGLHvcQLMG-----------YGQINDGLNLITHHSARtLNLQdygiaagnsa  371
DSSP  -HHHHHHHHHHhlLLLL-----------HHHHHHHHHHHLHHHHHhLLLLllllllllll


DSSP  ---------------------------------------------------l
Query ---------------------------------------------------k  469
ident                                                     
Sbjct nliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  leeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeellll


No 36: Query=3iacA Sbjct=4cqbA Z-score=10.8

back to top
DSSP  llllllllllllhhhhhhHHHL----------------------------------llLL
Query atfxtedfllkndiartlYHKY----------------------------------aaPX   26
ident                   |                                         
Sbjct -------skdfdliirnaYLSEkdsvydigivgdriikieakiegtvkdeidakgnlvSP   53
DSSP  -------llleeeeeeeeEELLlleeeeeeeelleeeeeelllllleeeeeellllleEE


DSSP  LEEELLLLLL---------------------------------------HHHHHhlllll
Query PIYDFHCHLS---------------------------------------PQEIAddrrfd   47
ident    | | |                                                    
Sbjct GFVDAHTHMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeiKRHVI------  107
DSSP  LEEEEEELHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhhHHHHH------


DSSP  lhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhh
Query nlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthle  107
ident                                                             
Sbjct ------------------------------------------------------------  107
DSSP  ------------------------------------------------------------


DSSP  hhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLL----LLL
Query lrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDP----IDS  163
ident                                                 |  |        
Sbjct ---------------------------------EHAHMQVLHGTLYTRTHVDVdsvaKTK  134
DSSP  ---------------------------------HHHHHHHHLLEEEEEEEEELllllLLH


DSSP  L-HHHHHHHHLlLLLLEEELLLLLHHHHLLllllhhhhhhhhhhhhllllllhhhhhhhH
Query L-EYHRQIAADdSIDIEVAPSWRPDKVFKIeldgfvdylrkleaaadvsitrfddlrqaL  222
ident   |            |           |                                
Sbjct AvEAVLEAKEElKDLIDIQVVAFAQSGFFV--------------------------dleS  168
DSSP  HhHHHHHHHHHlLLLLEEEEEEELLLLLLL--------------------------lllH


DSSP  HHHHHHHHHLLLLEEEEEELLLlllllllhhhhhhhhhhhhllllllhhhhhhHHHHHHH
Query TRRLDHFAACGCRASDHGIETLrfapvpddaqldailgkrlagetlseleiaqFTTAVLV  282
ident           ||                                              | 
Sbjct ESLIRKSLDMGCDLVGGVDPAT----------------------------renNVEGSLD  200
DSSP  HHHHHHHHHHLLLEEELLLLLL----------------------------lllLHHHHHH


DSSP  HHHHHHHHHLLEEEEEELEellllhhhhhhhllllllleelLLLLHHHHHHHHHHHHlLL
Query WLGRQYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsigDNNISWALSRLLDSXDvTN  342
ident                ||                                 ||       |
Sbjct LCFKLAKEYDVDIDYHIHD---------------------iGTVGVYSINRLAQKTI-EN  238
DSSP  HHHHHHHHLLLEEEEEELL---------------------lHHHHHHHHHHHHHHHH-HL


DSSP  LL-lEEEE-EELL-HHHH-hHHHHHHHHLLLlllllLEEELLllhhHLLHHHhhhHHHHH
Query EL-pKTIL-YCLN-PRDN-eVLATXIGNFQGpgiagKVQFGSgwwfNDQKDGxlrQLEQL  398
ident                      |   |             |                   |
Sbjct GYkgRVTTsHAWCfADAPseWLDEAIPLYKD----sGMKFVT-cfsSTPPTM---PVIKL  290
DSSP  LLllLEEEeELLHhHHLLhhHHHHHHHHHHH----hLLEEEE-ellLLLLLL---LHHHH


DSSP  HHHLLhhhLLLLLLLLLL------LLLL-HHHHHHHHHhhHHHHHHhhlllllllhhhhh
Query SQXGLlsqFVGXLTDSRS------FLSY-TRHEYFRRIlcNLLGQWaqdgeipddeaxls  451
ident    |      |   |                          |                  
Sbjct LEAGI---NLGCASDNIRdfwvpfGNGDmVQGALIETQrlELKTNR------------dl  335
DSSP  HHLLL---EEEEELLLLLllllllLLLLhHHHHHHHHHhhLLLLHH------------hh


DSSP  hhhhHHHLHHHHHHLL--------------------------------------------
Query rxvqDICFNNAQRYFT--------------------------------------------  467
ident             |                                               
Sbjct gliwKMITSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriiv  395
DSSP  hhhhHHHLHHHHHHHLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeee


DSSP  -----ll
Query -----ik  469
ident        
Sbjct kdeviva  402
DSSP  elleell


No 37: Query=3iacA Sbjct=3mkvA Z-score=10.7

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ---------lttflfrngaLLDPdhpdllqgfeiliedgfirevsdkpikssnahvidvk   51
DSSP  ---------lleeeeeeeeELLLllllleeeeeeeeelleeeeeellllllllleeeell


DSSP  ---lLLLEEELLLLLL-----------------hhHHHHllllllhhhhhhllllhhhhh
Query ---aPXPIYDFHCHLS-----------------pqEIADdrrfdnlgqiwlegdhykwra   63
ident          | | |                                              
Sbjct gktiMPGLIDLHVHVVaiefnlprvatlpnvlvtlRAVP---------------------   90
DSSP  lleeEELEEEEEELLLlllllhhhhllllhhhhhhHHHH---------------------


DSSP  hhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhh
Query lrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdt  123
ident                                                             
Sbjct ------------------------------------------------------------   90
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLLllllLHHHHHHHHLLLLLLEEELL
Query aesiwtqcneklatpafsARGIXQQXNVRXVGTTDDpidsLEYHRQIAADDSIDIEVAPS  183
ident                               |                            |
Sbjct ------------------IMRAMLRRGFTTVRDAGG--agYPFKQAVESGLVEGPRLFVS  130
DSSP  ------------------HHHHHHHLLEEEEEELLL--llHHHHHHHHLLLLLLLEEEEL


DSSP  -LLLHHHHL--LLLL---lhHHHHHHhHHHH----llllllhhHHHHHH-HHHHHHHhhl
Query -WRPDKVFK--IELD---gfVDYLRKlEAAA----dvsitrfdDLRQAL-TRRLDHFaac  232
ident                                            |         |      
Sbjct gRALSQTGGhaDPRArsdymPPDSPC-GCCVrvgalgrvadgvDEVRRAvREELQMG---  186
DSSP  lLEEELLLLllLLLLlllllLLLLLL-LLLLllllleeelllhHHHHHHhHHHHHHL---


DSSP  lLLEEEEEE-----------LLLLllllllhhhhhhhhhhhhllllllhhhhhhhHHHHH
Query gCRASDHGI-----------ETLRfapvpddaqldailgkrlagetlseleiaqfTTAVL  281
ident                                                             
Sbjct -ADQIXIMAsggvasptdpvGVFG------------------------------ySEDEI  215
DSSP  -LLLEEEELlllllllllllLLLL------------------------------lLHHHH


DSSP  HHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleellllLHHHHHHHHHHHhll
Query VWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXdvt  341
ident          ||     |                               |  |        
Sbjct RAIVAEAQGRGTYVLAHAY--------------------------TPAAIARAVRCG---  246
DSSP  HHHHHHHHLLLLLEEEEEL--------------------------LHHHHHHHHHLL---


DSSP  lllleEEEE-ELLHhhHHHHHHHHHHLLlllllllEEELLLL------------------
Query nelpkTILY-CLNPrdNEVLATXIGNFQgpgiagkVQFGSGW------------------  382
ident                     |                                       
Sbjct ----vRTIEhGNLI--DDETARLVAEHG-------AYVVPTLvtydalasegekyglppe  293
DSSP  ----lLEEEeLLLL--LHHHHHHHHHHL-------LEEELLHhhhhhhhhhlllllllhh


DSSP  ---hhhllhHHHHHHHHHHHHHLlhhHLLLlLLLLL--LLLLLHHHHHHHHHHHHhhhhh
Query ---wfndqkDGXLRQLEQLSQXGllsQFVGxLTDSR--SFLSYTRHEYFRRILCNllgqw  437
ident             |   |     |         ||                          
Sbjct siakiadvhGAGLHSIEIMKRAG--vKMGF-GTDLLgeAQRLQSDEFRILAEVLS-----  345
DSSP  hhllhhhhhLLHHHHHHHHHHHL--lLLLL-LLLLLhhHHHHLLHHHHHHHLLLL-----


DSSP  hhlllllllhhhhhHHHHHHHLHHHHHHLL------------------------------
Query aqdgeipddeaxlsRXVQDICFNNAQRYFT------------------------------  467
ident                 |                                           
Sbjct -------------pAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplksvdcl  392
DSSP  -------------hHHHHHHLLHHHHHHLLllllllllllllllleeeelllllllllll


DSSP  --------------------ll
Query --------------------ik  469
ident                       
Sbjct lgqgehiplvmkdgrlfvnele  414
DSSP  lllllllleeeelleeeeelll


No 38: Query=3iacA Sbjct=2ogjA Z-score=10.4

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ----------qapilltnvKPVGfgkgasqsstdiliggdgkiaavgsalqapadtqrid   50
DSSP  ----------llleeeeeeEELLllllllllleeeeellllleeeeelllllllleeell


DSSP  ---LLLLEEELLLLLLHHHhhhllllllhhhhhhllllhhhhhhhhllllhhhlllllll
Query ---APXPIYDFHCHLSPQEiaddrrfdnlgqiwlegdhykwralrsagvdeslitgkets   80
ident          | | |                                              
Sbjct aafISPGWVDLHVHIWHGG-----------------------------------------   69
DSSP  lleEEELEEEEEELLLLLL-----------------------------------------


DSSP  hhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhh
Query dyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpaf  140
ident                                                             
Sbjct --------------------------------------------------------tdis   73
DSSP  --------------------------------------------------------llll


DSSP  lHHHH-HHHLLEEEEELL--LLLLLLLHHHHHHHHLllLLLEEELLLLLH----------
Query sARGI-XQQXNVRXVGTT--DDPIDSLEYHRQIAADdsIDIEVAPSWRPD----------  187
ident            |                    |                           
Sbjct iRPSEcGAERGVTTLVDAgsAGEANFHGFREYIIEP--SRERIKAFLNLGsiglvacnrv  131
DSSP  lLHHHlLHHHLEEEEEEEllLLLLLHHHHHHHLLLL--LLLEEEEEEELLllllllllll


DSSP  HHHLLLLllhhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHL--LLLEEEEEELLll
Query KVFKIELdgfvdylrkleaaadvsitrfddlrqALTRRLDHFAAC--GCRASDHGIETlr  245
ident                                   | | |   |                 
Sbjct PELRDIK------------------------diDLDRILECYAENseHIVGLXVRASH--  165
DSSP  LLLLLHH------------------------hlLHHHHHHHHHLLllLEEEEEEEELH--


DSSP  llllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHHHHHHLLEEEEEELEelll
Query fapvpddaqldailgkrlagetlseleiAQFTTAVLVWLGRQYAARGWVXQLHIGAirnn  305
ident                                                  |  | |     
Sbjct -------------------------vitGSWGVTPVKLGKKIAKILKVPXXVHVGE----  196
DSSP  -------------------------hhhLLLLLHHHHHHHHHHHHHLLLEEEEELL----


DSSP  lhhhhhhhllllllleelllllhhHHHHHHHHhhllllLLEEEEE--eLLHH--HHHH--
Query ntrxfrllgpdtgfdsigdnniswALSRLLDSxdvtneLPKTILY--cLNPR--DNEV--  359
ident                              |         |                    
Sbjct ---------------------ppaLYDEVLEI-----lGPGDVVThcfNGKSgsSIXEde  230
DSSP  ---------------------lllLHHHHHHH-----lLLLLEEElllLLLLllLLLLlh


DSSP  -hHHHHHHLLllllllLEEELL-LLHHHLlhhhHHHHHHHHHHHLLHhhLLLLLLLLLL-
Query -lATXIGNFQgpgiagKVQFGS-GWWFNDqkdgXLRQLEQLSQXGLLsqFVGXLTDSRS-  416
ident                                       |     |||       ||    
Sbjct dlFNLAERCE------GIRLDIgHGGASF----SFKVAEAAIARGLL--PFSISTDLHGh  278
DSSP  hhHHHHHHLL------LLEEELlLLLLLL----LHHHHHHHHHLLLL--LLLLLLLLLLl


DSSP  --llllHHHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-------
Query --flsyTRHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-------  467
ident                |                       |      |             
Sbjct sxnfpvWDLATTXSKLLSVD--------------xPFENVVEAVTRNPASVIRldxenrl  324
DSSP  llllllLLHHHHHHHHHHLL--------------lLHHHHHHLLLHHHHHHLLlllllll


DSSP  -----------------------------------------------------ll
Query -----------------------------------------------------ik  469
ident                                                        
Sbjct dvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  lllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 39: Query=3iacA Sbjct=4dziC Z-score=10.4

back to top
DSSP  llllllllllllhhhhhhhhhllLLLLEEELLLLLL------------------------
Query atfxtedfllkndiartlyhkyaAPXPIYDFHCHLS------------------------   36
ident                              |   |                          
Sbjct ----------------------aLNYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsd   38
DSSP  ----------------------lLLLLEEEEEEELLlllllllllllhhhlllleeeeel


DSSP  --------hhhhhhlllllLHHHhhHLLLLHH---------hhhHHHLlllhhhllllll
Query --------pqeiaddrrfdNLGQiwLEGDHYK---------wraLRSAgvdeslitgket   79
ident                                                             
Sbjct gkrtwavigdrvnhfipnpTFDP--IIVPGCLdllfrgeipdgvDPAS------------   84
DSSP  llleeeeelleelllllllLLLL--EELLLLLhhhhhlllllllLHHH------------


DSSP  lhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhh
Query sdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpa  139
ident                                                             
Sbjct --------------------------------------------lmkverladhpeyqnr  100
DSSP  --------------------------------------------llleelhhhlhhhllh


DSSP  hLHHHHHHHLLEEEEELLL----------------------llLLLL-HHHHhhhhlllL
Query fSARGIXQQXNVRXVGTTD----------------------dpIDSL-EYHRqiaaddsI  176
ident                                               | |           
Sbjct dARIAVMDEQDIETAFMLPtfgcgveealkhdieatmasvhafNLWLdEDWG----fdrP  156
DSSP  hHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhhhhhhHHHHhHHLL----lllL


DSSP  LLEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHLLLLE
Query DIEVAPSWRPdkVFKIeldgfvdylrkleaaadvsitrfddlRQALTRRLDHFAACGCRA  236
ident |                                                 |   | |   
Sbjct DHRIIAAPIV--SLAD--------------------------PTRAVEEVDFVLARGAKL  188
DSSP  LLLEEELLLL--LLLL--------------------------HHHHHHHHHHHHHLLLLL


DSSP  EEEEELLllllllllhhhhhhhhhhhhllllllhhHHHHhhHHHHHHHHHHHHHHLLEEE
Query SDHGIETlrfapvpddaqldailgkrlagetlselEIAQftTAVLVWLGRQYAARGWVXQ  296
ident                                                     |  |    
Sbjct VLVRPAP-----------------------vpglvKPRSlgDRSHDPVWARLAEAGVPVG  225
DSSP  EELLLLL-----------------------lllllLLLLllLHHHHHHHHHHHHHLLLEE


DSSP  EEELE-ELLL----lhhHHHHhllllllleelLLLL-HHHHHHHHH-HHHLLLLLLEEEE
Query LHIGA-IRNN----ntrXFRLlgpdtgfdsigDNNI-SWALSRLLD-SXDVTNELPKTIL  349
ident  |                              |                       |   
Sbjct FHLSDsGYLHiaaawggAKDP-----ldqvllDDRAiHDTMASMIVhGVFTRHPKLKAVS  280
DSSP  EELLLlLLHHhhhhlllLLLH-----hhhhhhLLHHhHHHHHHHHHlLHHHHLLLLLEEE


DSSP  EellhHHHHHH---------------hhhhHHLLlllllLLEEELLLlhhhllhhHHHHh
Query YclnpRDNEVL---------------atxiGNFQgpgiaGKVQFGSGwwfndqkdGXLRq  394
ident           |                              |                  
Sbjct IengsYFVHRLikrlkkaantqpqyfpedpVEQL----rNNVWIAPY--------YEDD-  327
DSSP  EllllLHHHHHhhhhhhhhhhlhhhllllhHHHH----hHHEEELLL--------LLLL-


DSSP  HHHHHHHLLHhHLLLLLLLLLL-llLLHHHHhHHHHHHHHhhhhhhlllllllhhhHHHH
Query LEQLSQXGLLsQFVGXLTDSRS-flSYTRHEyFRRILCNLlgqwaqdgeipddeaxLSRX  453
ident |  |              |             |   |                       
Sbjct LPELARVIGV-DKILFGSDWPHgegLASPVS-FTAELKGF----------------SESD  369
DSSP  HHHHHHHHLH-HHLLLLLLLLLlllLLLHHH-HHHHHLLL----------------LHHH


DSSP  HHHHHLHHHHHHLLLL---
Query VQDICFNNAQRYFTIK---  469
ident    |   ||          
Sbjct IRKIMRDNALDLLGVQvgs  388
DSSP  HHHHHLHHHHHHHLLLlll


No 40: Query=3iacA Sbjct=2oofA Z-score=10.3

back to top
DSSP  ---llllllllllllhhhhHHHHH---------------------------------lll
Query ---atfxtedfllkndiarTLYHK---------------------------------yaa   24
ident                      |                                      
Sbjct lncervwlnvtpatlrsdlADYGLlephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeelllllllLLLLLllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLEEELLLLLLH-------------------------------------------HHHH
Query PXPIYDFHCHLSP-------------------------------------------QEIA   41
ident      | | ||                                                 
Sbjct TPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfELAL  120
DSSP  EELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhHHHH


DSSP  hllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhh
Query ddrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnply  101
ident                                                             
Sbjct ------------------------------------------------------------  120
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLL--
Query hwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTDD--  159
ident                                                  |  |       
Sbjct ---------------------------------------pRVKSLIREGVTTVEIKSGyg  141
DSSP  ---------------------------------------hHHHHHHHHLEEEEEEELLll


DSSP  ----lLLLL-HHHHHHHHLllLLLEEELLLL-LHHHhllllllHHHHHHhhhhhhlllll
Query ----pIDSL-EYHRQIAADdsIDIEVAPSWR-PDKVfkieldgFVDYLRkleaaadvsit  213
ident              |         | |         |          |             
Sbjct ltledELKXlRVARRLGEA--LPIRVKTTLLaAHAV-------PPEYRD-----------  181
DSSP  llhhhHHHHhHHHHHHHHH--LLLEEEEEEEeELLL-------LHHHLL-----------


DSSP  lhhhHHHHH-HHHHHHHH-HLLLLEEEEEELLLlllllllhhhhhhhhhhhhllllllhh
Query rfddLRQAL-TRRLDHFA-ACGCRASDHGIETLrfapvpddaqldailgkrlagetlsel  271
ident                  | |    | |   |                             
Sbjct dpdsWVETIcQEIIPAAAeAGLADAVDVFCEHI---------------------------  214
DSSP  lhhhHHHHHhHLHHHHHHhLLLLLEEEEEELLL---------------------------


DSSP  hhhhhHHHHHHHHHHHHHH-HLLEEEEEELEellllhhhhhhhllllllleelllllhhh
Query eiaqfTTAVLVWLGRQYAA-RGWVXQLHIGAirnnntrxfrllgpdtgfdsigdnniswa  330
ident        |               |                                    
Sbjct ---gfSLAQTEQVYLAADQyGLAVKGHXDQL--------------------------snl  245
DSSP  ---llLHHHHHHHHHHHHHlLLEEEEEELLL--------------------------lll


DSSP  HHHHhhhhhllllLLEEEE-EELLhhHHHHHHHHHHHLlllllllLEEELL--lLHHH-l
Query LSRLldsxdvtneLPKTIL-YCLNprDNEVLATXIGNFqgpgiagKVQFGS--gWWFN-d  386
ident                                               |             
Sbjct GGST-----laanFGALSVdHLEY--LDPEGIQALAHR-------GVVATLlptAFYFlk  291
DSSP  LHHH-----hhhhLLLLEEeELLL--LLHHHHHHHHHH-------LLEEEElhhHHHHll


DSSP  lHHHHhhHHHHHHHHLLhhhLLLLLLLLL-----LLLLLHHHHHHHH--HHHHhhhhhhh
Query qKDGXlrQLEQLSQXGLlsqFVGXLTDSR-----SFLSYTRHEYFRR--ILCNllgqwaq  439
ident            |   |          |                       |         
Sbjct eTKLP--PVVALRKAGV---PXAVSSDINpgtapIVSLRXAXNXACTlfGLTP-------  339
DSSP  lLLLL--LHHHHHHLLL---LEEELLLLLlllllLLLHHHHHHHHHHhhLLLH-------


DSSP  lllllllhhhhhhHHHHHHLHHHHHHLL--------------------------------
Query dgeipddeaxlsrXVQDICFNNAQRYFT--------------------------------  467
ident                       | |                                   
Sbjct ------------vEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsylig  387
DSSP  ------------hHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlll


DSSP  --------------ll
Query --------------ik  469
ident                 
Sbjct vdqlvsrvvngeetlh  403
DSSP  llleeeeeelleelll


No 41: Query=3iacA Sbjct=3mtwA Z-score=10.1

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ---------aeikavsaarLLDVasgkyvdnplvivtdgritsigkkgdavpagatavdl   51
DSSP  ---------lleeeeeeeeEEELllleeeeleeeeeelleeeeeeellllllllleeeee


DSSP  ----lLLLEEELLLLLLhhhhhhllllllhhhhhhlLLLHHHHHhhhllllhhhllllll
Query ----aPXPIYDFHCHLSpqeiaddrrfdnlgqiwleGDHYKWRAlrsagvdeslitgket   79
ident           | | ||                                            
Sbjct pgvtlLPGLIDMHVHLD------------------sLAEVGGYN----------------   77
DSSP  eeeeeEELEEEEEELLL------------------lLLLLLHHH----------------


DSSP  lhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhh
Query sdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpa  139
ident                                                             
Sbjct -----------------------------------------------sleysdrfwsvvq   90
DSSP  -----------------------------------------------hhhllhhhhhhhh


DSSP  hLHHHHHHHLLEEEEELLLLLLL-lLHHHHHHHHLLLLLLEEELL-LLLH----------
Query fSARGIXQQXNVRXVGTTDDPID-sLEYHRQIAADDSIDIEVAPS-WRPD----------  187
ident               |                | |                          
Sbjct tANAKKTLEAGFTTVRNVGAADYddVGLREAIDAGYVPGPRIVTAaISFGatgghcdstf  150
DSSP  hHHHHHHHHLLEEEEEELLLLLLhhHHHHHHHHLLLLLLLEEEELlLLEEllllllllll


DSSP  ----------HHHLLllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHhhllLLEE
Query ----------KVFKIeldgfvdylrkleaaadvsitrfddlrqalTRRLDHFaacgCRAS  237
ident                                                             
Sbjct fppsmdqknpFNSDS----------------------pdearkavRTLKKYG----AQVI  184
DSSP  llhhhlllllLLLLL----------------------hhhhhhhhHHHHHLL----LLEE


DSSP  EEEEL------------LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHH
Query DHGIE------------TLRFapvpddaqldailgkrlagetlseleiaqftTAVLVWLG  285
ident                                                             
Sbjct XICATggvfsrgnepgqQQLT-------------------------------YEEMKAVV  213
DSSP  EEELLllllllllllllLLLL-------------------------------HHHHHHHH


DSSP  HHHHHHLLEEEEEELeellllhhhhhhhllllllleelllllhhHHHHHHhhhhllllll
Query RQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnniswALSRLLdsxdvtnelp  345
ident       |     |                                  |            
Sbjct DEAHMAGIKVAAHAH-----------------------gasgirEAVRAG----------  240
DSSP  HHHHHLLLEEEEEEL-----------------------lhhhhhHHHHLL----------


DSSP  EEEE-EELLhhHHHHHHHHHHHLlllllllLEEELL-LLHH-------------------
Query KTIL-YCLNprDNEVLATXIGNFqgpgiagKVQFGS-GWWF-------------------  384
ident                                  |                          
Sbjct VDTIeHASL--VDDEGIKLAVQK-------GAYFSMdIYNTdytqaegkkngvlednlrk  291
DSSP  LLEEeELLL--LLHHHHHHHHHH-------LLEEELlLLLHhhhhhhhhhhlllhhhhhh


DSSP  -hlLHHHHHHHHHHHHHHLLhhHLLLlLLLLL--LLLLLHHhhhHHHHHHHHHhhhhhll
Query -ndQKDGXLRQLEQLSQXGLlsQFVGxLTDSR--SFLSYTRheyFRRILCNLLgqwaqdg  441
ident                   |     |   ||                              
Sbjct drdIGELQRENFRKALKAGV--KMVY-GTDAGiyPHGDNAK---QFAVMVRYG-------  338
DSSP  hhhHHHHHHHHHHHHHHHLL--EEEL-LLLLLllLLLLHHH---HHHHHHHLL-------


DSSP  lllllhhhHHHHHHHHHLHHHHHHLL----------------------------------
Query eipddeaxLSRXVQDICFNNAQRYFT----------------------------------  467
ident                     |                                       
Sbjct -------aTPLQAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpv  391
DSSP  -------lLHHHHHHHLLHHHHHHHLllllllllllllllleeeelllllllhhhhhlll


DSSP  -----------ll
Query -----------ik  469
ident              
Sbjct fvmkggavvkapx  404
DSSP  eeeelleeeelll


No 42: Query=3iacA Sbjct=3qy6A Z-score=9.9

back to top
DSSP  llllllllllllhhhhhhhhhllllllEEELLLLLLHH----hhHHLLllllhhhhhhll
Query atfxtedfllkndiartlyhkyaapxpIYDFHCHLSPQ----eiADDRrfdnlgqiwleg   56
ident                              | |||  |                       
Sbjct ---------------------------MIDIHCHILPAmddgagDSAD------------   21
DSSP  ---------------------------LEELLLLLLLLllllllLHHH------------


DSSP  llhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllll
Query dhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitg  116
ident                                                             
Sbjct ------------------------------------------------------------   21
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL---------LLLLlLHHH
Query tlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD---------DPIDsLEYH  167
ident                                    |    |           |    |  
Sbjct ----------------------siEMARAAVRQGIRTIIATPhhnngvyknEPAAvREAA   59
DSSP  ----------------------hhHHHHHHHHLLLLEEELLLeelllllllLHHHhHHHH


DSSP  HHHHHL---LLLLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhh
Query RQIAAD---DSIDIEVAPSWrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltr  224
ident  |         |   | |                                          
Sbjct DQLNKRlikEDIPLHVLPGQ----------------------------------------   79
DSSP  HHHHHHhhhLLLLLEEELLL----------------------------------------


DSSP  hhhhhhhlllleeEEEEllllllllllhhhhhhhhhhhhllllllhhhhhhhhhhHHHHH
Query rldhfaacgcrasDHGIetlrfapvpddaqldailgkrlagetlseleiaqfttaVLVWL  284
ident                 |                                           
Sbjct -------------EIRI------------------------------------ygEVEQD   90
DSSP  -------------EEEL------------------------------------llLHHHH


DSSP  HHH----hhhhLLEEEEEELEellllhhhhhhhllllllleelLLLLhHHHHHHHHHHHl
Query GRQ----yaarGWVXQLHIGAirnnntrxfrllgpdtgfdsigDNNIsWALSRLLDSXDv  340
ident                                            |         |      
Sbjct LAKrqllslndTKYILIEFPF----------------------DHVP-RYAEQLFYDLQ-  126
DSSP  HHLlllllhhhLLEEEEELLL----------------------LLLL-LLHHHHHHHHH-


DSSP  lLLLLEEEE--EELLHHH---HHHHHHHHHHLllllllllEEELL------llhhhlLHH
Query tNELPKTIL--YCLNPRD---NEVLATXIGNFqgpgiagkVQFGS------gwwfndQKD  389
ident               |         |                                 | 
Sbjct -LKGYIPVIahPERNREIrenPSLLYHLVEKG--------AASQItsgslagifgkqLKA  177
DSSP  -HLLLEEEEelHHHLHHHhhlLHHHHHHHHLL--------LEEEEehhhhlllllhhHHH


DSSP  HHHHHHHHHhhhllhhhLLLLLLLLLLL--LLLHhHHHHHHHHHHHHHhhhhlllllllh
Query GXLRQLEQLsqxgllsqFVGXLTDSRSF--LSYTrHEYFRRILCNLLGqwaqdgeipdde  447
ident   ||  |                |                  |    |            
Sbjct FSLRLVEAN-------lIHFVASDAHNVktRNFH-TQEALYVLEKEFG------------  217
DSSP  HHHHHHHLL-------lLLEEELLLLLLllLLLL-HHHHHHHHHHHHL------------


DSSP  hhhHHHHHHHhLHHHHHHLLLL------------
Query axlSRXVQDIcFNNAQRYFTIK------------  469
ident    |         ||                   
Sbjct ---SELPYML-TENAELLLRNQtifrqppqpvkr  247
DSSP  ---LHHHHHH-HHHHHHHHLLLllllllllllll


No 43: Query=3iacA Sbjct=1a5kC Z-score=9.8

back to top
DSSP  ---------------llllllLLLLllhHHHH----------------------------
Query ---------------atfxteDFLLkndIART----------------------------   17
ident                                                             
Sbjct snisrqayadmfgptvgdkvrLADT---ELWIeveddlttygeevkfgggkvirdgmgqg   57
DSSP  leeehhhhhhhhlllllleeeLLLL---LLEEelleelllllllllllllllllllllll


DSSP  --------------hhHHLL----------------------------------------
Query --------------lyHKYA----------------------------------------   23
ident                                                             
Sbjct qmlaadcvdlvltnalIVDHwgivkadigvkdgrifaigkagnpdiqpnvtipigaatev  117
DSSP  lllhhhllleeeeeeeEEELleeeeeeeeeelleeeeeeleellllllllleelllllee


DSSP  -------lLLLEEELLLLLLHHHhhhllllllhhhhhhllllhhhhhhhhllllhhhlll
Query -------aPXPIYDFHCHLSPQEiaddrrfdnlgqiwlegdhykwralrsagvdeslitg   76
ident              | | |                                          
Sbjct iaaegkivTAGGIDTHIHWICPQ-------------------------------------  140
DSSP  eelllleeEELEEEEEEELLLLL-------------------------------------


DSSP  llllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhl
Query ketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekla  136
ident                                                             
Sbjct ------------------------------------------------------------  140
DSSP  ------------------------------------------------------------


DSSP  lhhhlHHHHHHHLLEEEEELL------------LLLLLL--LHHHHHHHHlllLLLEEEL
Query tpafsARGIXQQXNVRXVGTT------------DDPIDS--LEYHRQIAAddsIDIEVAP  182
ident               |                    |                        
Sbjct -----QAEEALVSGVTTMVGGgtgpaagthattCTPGPWyiSRMLQAADS---LPVNIGL  192
DSSP  -----HHHHHHHHLEEEEEEElllllhhhhhllLLLHHHhhHHHHHHHLL---LLLEEEE


DSSP  LLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHhhllLLEEEEEEL
Query SWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLDHFaacgCRASDHGIE  242
ident                                       ||                    
Sbjct LGKGNVS----------------------------QPDALREQVAAG----VIGLEIHED  220
DSSP  EEELLLL----------------------------LHHHHHHHHHHL----LLEEEEEHH


DSSP  lllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEe
Query tlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHIGAi  302
ident                                   | |                 ||    
Sbjct -------------------------------wgaTPAAIDCALTVADEMDIQVALHSDT-  248
DSSP  -------------------------------hllLHHHHHHHHHHHHHHLLEEEEELLL-


DSSP  llllhhhhhhhllllllleeLLLL-LHHHHHHHHHHHhllllllEEEEE-------ELLH
Query rnnntrxfrllgpdtgfdsiGDNN-ISWALSRLLDSXdvtnelpKTILY-------CLNP  354
ident                                                            |
Sbjct --------------------LNESgFVEDTLAAIGGR-------TIHTFhtegaggGHAP  281
DSSP  --------------------LLLLlLHHHHHHHHLLL-------LEEELlllllllLLLL


DSSP  HHHhHHHHHHhhllllllllLEEELLllhhhLLHH-------------------------
Query RDNeVLATXIgnfqgpgiagKVQFGSgwwfnDQKD-------------------------  389
ident                          |                                  
Sbjct DII-TACAHP----------NILPSS--tnpTLPYtlntidehldmlmvchhldpdiaed  328
DSSP  LHH-HHHHLL----------LEEEEE--ehhHLLLlllhhhhhhhhhhhhhllllllhhh


DSSP  -----------HHHHHHHHhhhhllHHHLLLLLLLLLL-lLLLHHHHHHHHHHHHHHHHH
Query -----------GXLRQLEQlsqxglLSQFVGXLTDSRS-fLSYTRHEYFRRILCNLLGQW  437
ident                          |  |     ||                      | 
Sbjct vafaesrirreTIAAEDVL----hdLGAFSLTSSDSQAmgRVGEVILRTWQVAHRMKVQR  384
DSSP  hhlllllllhhHHHHHHHH----hhLLLLLEEELLLLLllLLLLHHHHHHHHHHHHHHHH


DSSP  HHlllLLLL---HHHHHHHHHHHHLHHHHHHLLL--------------------------
Query AQdgeIPDD---EAXLSRXVQDICFNNAQRYFTI--------------------------  468
ident                           |      |                          
Sbjct GA--lAEETgdnDNFRVKRYIAKYTINPALTHGIahevgsievgkladlvvwspaffgvk  442
DSSP  LL--lLLLLlllLHHHHHHHHHLLLHHHHHHLLLlllllllllllllleeeelhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct patvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvae  502
DSSP  lleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct rlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqr  562
DSSP  hllllleeeellllllllhhhllllllllleeelllllleeelleellllllllllllll


DSSP  ---l
Query ---k  469
ident     
Sbjct yflf  566
DSSP  llll


No 44: Query=3iacA Sbjct=3e74A Z-score=9.7

back to top
DSSP  ----------------------------llllllllllllhhhhhhhHHLLllLLEEELL
Query ----------------------------atfxtedfllkndiartlyHKYAapXPIYDFH   32
ident                                                          | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasgLVVS--PGXVDAH   58
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllLEEE--ELEEEEE


DSSP  LLLlhhhHHHLlllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhh
Query CHLspqeIADDrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantv   92
ident  |                                                          
Sbjct THI----GYET-------------------------------------------------   65
DSSP  ELL----LHHH-------------------------------------------------


DSSP  hhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEE
Query pktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVR  152
ident                                                             
Sbjct -------------------------------------------------GTRAAAKGGIT   76
DSSP  -------------------------------------------------HHHHHHHLLEE


DSSP  EEELLL------LLLLL-LHHHHHHHhLLLLLLEEELLLLLHHHhllllllhhhhhhhhh
Query XVGTTD------DPIDS-LEYHRQIAaDDSIDIEVAPSWRPDKVfkieldgfvdylrkle  205
ident                    |     |      |  |                        
Sbjct TXIEXPlnqlpaTVDRAsIELKFDAA-KGKLTIDAAQLGGLVSY----------------  119
DSSP  EEEELLllllllLLLHHhHHHHHHHH-LLLLLLEEEELEELLLL----------------


DSSP  hhhllllllhhhhhhhHHHHHHHHHHLLLLEEEEEEllllllllllhhhhhhhhhhhhll
Query aaadvsitrfddlrqaLTRRLDHFAACGCRASDHGIetlrfapvpddaqldailgkrlag  265
ident                    ||      |                                
Sbjct ----------------NIDRLHELDEVGVVGFXCFV------------------------  139
DSSP  ----------------LLLLHHHHHHHLLLLEEEEL------------------------


DSSP  llllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELE--ELLL--lhhhhhhhllllllle
Query etlseleiaqfTTAVLVWLGRQYAARGWVXQLHIGA--IRNN--ntrxfrllgpdtgfds  321
ident                           |     |     |                     
Sbjct --------rdvNDWQFFKGAQKLGELGQPVLVHCENalICDElgeeakregrvtahdyva  191
DSSP  --------lllLHHHHHHHHHHHHHHLLLEEEELLLhhHHHHhhhhhhhhllllhhhhhh


DSSP  eLLLL-LHHHHHHHHHHHHLllLLLEEEEEEllhhHHHHHHHHHHHLLllllllLEEELL
Query iGDNN-ISWALSRLLDSXDVtnELPKTILYClnprDNEVLATXIGNFQgpgiagKVQFGS  380
ident          |  | |    |                                       |
Sbjct sRPVFtEVEAIRRVLYLAKV-aGCRLHVCHV----SSPEGVEEVTRAR--qegqDITCES  244
DSSP  lLLHHhHHHHHHHHHHHHHH-hLLLEEELLL----LLHHHHHHHHHHH--hlllLEEEEE


DSSP  LlhhHLLHH----------------------hhHHHHHHHHHHLlhhhLLLLLLLLLL--
Query GwwfNDQKD----------------------gxLRQLEQLSQXGllsqFVGXLTDSRS--  416
ident                                      | |              |     
Sbjct C--pHYFVLdtdqfeeigtlakcsppirdlenqKGXWEKLFNGE----IDCLVSDHSPcp  298
DSSP  L--lHHHHLlhhhhhhhlhhhllllllllhhhhHHHHHHHHLLL----LLEELLLLLLll


DSSP  ---------------LLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHH
Query ---------------FLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNN  461
ident                                  |                 |       |
Sbjct pexkagnixkawggiAGLQSCXDVXFDEAVQKRG-------------xSLPXFGKLXATN  345
DSSP  lllllllllllllllLLHHHHHHHHHHHHLLLLL-------------lLHHHHHHHHLHH


DSSP  HHHHLL------------------------------------------------------
Query AQRYFT------------------------------------------------------  467
ident |   |                                                       
Sbjct AADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktil  405
DSSP  HHHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeee


DSSP  ----------------------ll
Query ----------------------ik  469
ident                         
Sbjct rgdviydieqgfpvapkgqfilkh  429
DSSP  lleeeeelllllllllllleelll


No 45: Query=3iacA Sbjct=1a4mA Z-score=9.7

back to top
DSSP  llllllllllllhhhhhhhhHLLLLLLEEELLLLLLhhhhhhlLLLL-------------
Query atfxtedfllkndiartlyhKYAAPXPIYDFHCHLSpqeiaddRRFD-------------   47
ident                       |   |    | ||                         
Sbjct --------------------TPAFNKPKVELHVHLD-----gaIKPEtilyfgkkrgial   35
DSSP  --------------------LLLLLLLEEEEEEEHH-----hlLLHHhhhhhhhhhllll


DSSP  ----LHHHH-HHLLllHHHHhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhh
Query ----NLGQI-WLEGdhYKWRalrsagvdeslitgketsdyekyxawantvpktlgnplyh  102
ident                  |                                          
Sbjct padtVEELRnIIGM--DKPL----------------------------------------   53
DSSP  llllHHHHHhHHLL--LLLL----------------------------------------


DSSP  hhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlhhHHHHHLLEEEEELLLLL--
Query wthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsarGIXQQXNVRXVGTTDDP--  160
ident                                                 |  |     |  
Sbjct ----------slpgflakfdyympviagcreaikriayefvEMKAKEGVVYVEVRYSPhl  103
DSSP  ----------lhhhhhllhhhhhhhhlllhhhhhhhhhhhhHHHHHLLEEEEEEEELLhh


DSSP  ----------------------LLLL--HHHHHHHHLllLLLEEELLLLLH-HHHLllll
Query ----------------------IDSL--EYHRQIAADdsIDIEVAPSWRPD-KVFKield  195
ident                          |               | |                
Sbjct lanskvdpmpwnqtegdvtpddVVDLvnQGLQEGEQA--FGIKVRSILCCMrHQPS----  157
DSSP  hllllllllhhhlllllllhhhHHHHhhHHHHHHHHH--HLLEEEEEEEEElLLHH----


DSSP  lhhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHLLLLEEEEE--ELLLLllllllhh
Query gfvdylrkleaaadvsitrfddlrqALTRRLDHFAACGCRASDHG--IETLRfapvpdda  253
ident                                         | |                 
Sbjct ----------------------wslEVLELCKKYNQKTVVAMDLAgdETIEG--------  187
DSSP  ----------------------hhhHHHHHHHHLLLLLEEEEEEEllLLLLL--------


DSSP  hhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHH-HHLLeEEEEELEEllllhhhhhh
Query qldailgkrlagetlseleiaqfTTAVLVWLGRQYA-ARGWvXQLHIGAIrnnntrxfrl  312
ident                             |                | |            
Sbjct ---------------------ssLFPGHVEAYEGAVkNGIH-RTVHAGEV----------  215
DSSP  ---------------------hhHLHHHHHHHHHHHhHLLE-EEEEELLL----------


DSSP  hllllllleellllLHHHHHHHHHHHhlllllLEEEE-EELL-HHHHHHHHHHHHHllll
Query lgpdtgfdsigdnnISWALSRLLDSXdvtnelPKTIL-YCLN-PRDNEVLATXIGNfqgp  370
ident                        |                     |              
Sbjct -------------gSPEVVREAVDIL------KTERVgHGYHtIEDEALYNRLLKE----  252
DSSP  -------------lLHHHHHHHHHLL------LLLEEeELHHhHHLHHHHHHHHHL----


DSSP  lllllEEELL--lLHHH------llHHHHHHHHHHHhhhllhhhLLLLLLLLLL--LLLL
Query giagkVQFGS--gWWFN------dqKDGXLRQLEQLsqxgllsqFVGXLTDSRS--FLSY  420
ident        |                      |                  ||         
Sbjct ----nMHFEVcpwSSYLtgawdpktTHAVVRFKNDK-------aNYSLNTDDPLifKSTL  301
DSSP  ----lLEEEElhhHHHHllllllllLLHHHHHHHLL-------lLEEELLLLLLllLLLH


DSSP  -HHHHHHHH--HHHHhhhhhhhlllllllhhhhhHHHHHHhLHHHHHH-LLLL-------
Query -TRHEYFRR--ILCNllgqwaqdgeipddeaxlsRXVQDIcFNNAQRY-FTIK-------  469
ident  |                                         ||    |          
Sbjct dTDYQMTKKdmGFTE-------------------EEFKRL-NINAAKSsFLPEeekkell  341
DSSP  hHHHHHHHHllLLLH-------------------HHHHHH-HHHHHHLlLLLHhhhhhhh


DSSP  --------
Query --------  469
ident         
Sbjct erlyreyq  349
DSSP  hhhhhhll


No 46: Query=3iacA Sbjct=3icjA Z-score=9.6

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct ----------cmkalingtIYTSfspvkkvsglvisnervlyagdsstalriaelaggei   50
DSSP  ----------leeeeelleEEEEelleeeeleeeeelleeeeeelhhhhhhhhhhhllee


DSSP  -------lLLLEEELLLLLL----------------------------------------
Query -------aPXPIYDFHCHLS----------------------------------------   36
ident              | | ||                                         
Sbjct idlkgkfvMPAFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqd  110
DSSP  eelllleeEELEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   36
ident                                                             
Sbjct elgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreralee  170
DSSP  hhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhh


DSSP  ---------------hHHHHhllllllhhhhhhllllhhhhhhhhllllhhhlllllllh
Query ---------------pQEIAddrrfdnlgqiwlegdhykwralrsagvdeslitgketsd   81
ident                   |                                         
Sbjct srkiinekiltvkdykHYIE----------------------------------------  190
DSSP  hhhhhhhllllhhhhhHHHH----------------------------------------


DSSP  hhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhl
Query yekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafs  141
ident                                                             
Sbjct -----------------------------------------------------------s  191
DSSP  -----------------------------------------------------------h


DSSP  HHHHHHHLLEEEEEL-LLLLlLLLHHHHHHHHLLLLLLEEELLLLLhhhhllllllhhhh
Query ARGIXQQXNVRXVGT-TDDPiDSLEYHRQIAADDSIDIEVAPSWRPdkvfkieldgfvdy  200
ident |        |  ||         |               |     |              
Sbjct AQEHLLSLGVHSVGFmSVGE-KALKALFELEREGRLKMNVFAYLSP--------------  236
DSSP  HHHHHHHLLEEEEEEeEELH-HHHHHHHHHHHLLLLLLEEEEEELH--------------


DSSP  hhhhhhhhllllllhhhhhhhHHHH---hHHHHH---lLLLEEEEEEL------------
Query lrkleaaadvsitrfddlrqaLTRR---lDHFAA---cGCRASDHGIE------------  242
ident                      |                                      
Sbjct -------------------elLDKLeelnLGKFEgrrlRIWGVXLFVDgslgartallse  277
DSSP  -------------------hhHHHHhhhlLLLEEllleEEEEEEEELLllllllllllll


DSSP  -----------LLLLlllllhhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHHHHH
Query -----------TLRFapvpddaqldailgkrlagetlseleiaqftTAVLVWLGRQYAAR  291
ident                                                   |         
Sbjct pytdnpttsgeLVMN-------------------------------KDEIVEVIERAKPL  306
DSSP  lllllllllllLLLL-------------------------------HHHHHHHHHHHLLL


DSSP  LLEEEEEELEellllhhhhhhhllllllleelllLLHHHHHHHHHHHHlllllLEEEE-E
Query GWVXQLHIGAirnnntrxfrllgpdtgfdsigdnNISWALSRLLDSXDvtnelPKTIL-Y  350
ident |     |                                                     
Sbjct GLDVAVHAIG-----------------------dKAVDVALDAFEEAE-----FSGRIeH  338
DSSP  LLEEEEEELL-----------------------hHHHHHHHHHHHHHL-----LLLEEeE


DSSP  ELLhhHHHHHHHHHHHLLlllllllEEELLllhhhLLHHH-------------hhhHHHH
Query CLNprDNEVLATXIGNFQgpgiagkVQFGSgwwfnDQKDG-------------xlrQLEQ  397
ident              |           |                               |  
Sbjct ASL--VRDDQLERIKELK-------VRISA--qphFIVSDwwivnrvgeerakwayRLKT  387
DSSP  LLL--LLHHHHHHHHHHL-------LEEEE--lllHHHHLllhhhhhhhhhhhhllLHHH


DSSP  HHHHLlhhhLLLLLLLLLLllLLHHhHHHHHHHHHHhhhhhhlllllllhhhhhHHHHHH
Query LSQXGllsqFVGXLTDSRSflSYTRhEYFRRILCNLlgqwaqdgeipddeaxlsRXVQDI  457
ident ||         |  |||                 |                         
Sbjct LSSIT----KLGFSTDSPI-ePADP-WVSIDAAVNR-------yvvdpgervsrEEALHL  434
DSSP  HHHHL----LEEELLLLLL-lLLLH-HHHHHHHHHL-------llllhhhlllhHHHHHH


DSSP  HLHHHHHHLL----------------------ll
Query CFNNAQRYFT----------------------ik  469
ident                                   
Sbjct YTHGSAQVTLaedlgklergfraeyiildrdplk  468
DSSP  LLHHHHHHLLlllllllllllllleeeellllll


No 47: Query=3iacA Sbjct=2uz9A Z-score=9.5

back to top
DSSP  -------------------------------------------llllllllllllhhhhh
Query -------------------------------------------atfxtedfllkndiart   17
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  hhhhlllLLLEEELLLLLLhhhhhhllllllhhhhhhLLLLHHHHhhhhllllhhhllll
Query lyhkyaaPXPIYDFHCHLSpqeiaddrrfdnlgqiwlEGDHYKWRalrsagvdeslitgk   77
ident             | | | |                                         
Sbjct lshheffMPGLVDTHIHAS---------------qysFAGSSIDL---------------   90
DSSP  llllleeEELEEEEEEEHH---------------hhhHLLLLLLL---------------


DSSP  lllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhll
Query etsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklat  137
ident                                                             
Sbjct -----------------------------------pllewltkytfpaehrfqnidfaee  115
DSSP  -----------------------------------lhhhhhhhlhhhhhhhhhlhhhhhh


DSSP  hhhlhhHHHHHLLEEEEELLLLLLLL--LHHHHHHHHlllLLLEEELLLLLhhHHLLlLL
Query pafsarGIXQQXNVRXVGTTDDPIDS--LEYHRQIAAddsIDIEVAPSWRPdkVFKIeLD  195
ident                             |                               
Sbjct vytrvvRRTLKNGTTTACYFATIHTDssLLLADITDK---FGQRAFVGKVC--MDLN-DT  169
DSSP  hhhhhhHHHHHLLEEEEEEELLLLHHhhHHHHHHHHH---HLLEEEEELEE--LLLL-LL


DSSP  LHHHHhhhhhhhhllllllhhhhHHHHHHHHHHHHHLL--------LLEEE-EEELllll
Query GFVDYlrkleaaadvsitrfddlRQALTRRLDHFAACG--------CRASD-HGIEtlrf  246
ident                                  |                          
Sbjct FPEYK----------------etTEESIKETERFVSEMlqknysrvKPIVTpRFSL----  209
DSSP  LLLLL----------------llHHHHHHHHHHHHHHHhhhlllleEEEEEeLLHH----


DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEE-LEELll
Query apvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHI-GAIRnn  305
ident                                      ||     |    | ||       
Sbjct ----------------------------scSETLMGELGNIAKTRDLHIQSHIsENRD--  239
DSSP  ----------------------------hlLHHHHHHHHHHHHHHLLEEEEEElLLHH--


DSSP  lhhhhhhhllllllleELLL------llHHHHHHHHHHHhllllLLEEEE-EELLhhHHH
Query ntrxfrllgpdtgfdsIGDN------niSWALSRLLDSXdvtneLPKTIL-YCLNprDNE  358
ident                                 |             ||            
Sbjct ----------------EVEAvknlypsyKNYTSVYDKNN---llTNKTVMaHGCY--LSA  278
DSSP  ----------------HHHHhhhhllllLLHHHHHHHLL---llLLLEEEeELLL--LLH


DSSP  HHHHHHHHLlllllllLEEELL-llHHHL-lhHHHHhhHHHHHHHLlhhhLLLLLLLLL-
Query VLATXIGNFqgpgiagKVQFGS-gwWFND-qkDGXLrqLEQLSQXGllsqFVGXLTDSR-  415
ident                                                     |  ||   
Sbjct EELNVFHER-------GASIAHcpnSNLSlssGFLN--VLEVLKHE---vKIGLGTDVAg  326
DSSP  HHHHHHHHH-------LLEEEElhhHHHHlllLLLL--HHHHHHLL---lEEEELLLLLl


DSSP  lLLLL-HHHHHHHHHHHHHHHHHHhlllllllhhhHHHHHHHHHLHHHHHHLL-------
Query sFLSY-TRHEYFRRILCNLLGQWAqdgeipddeaxLSRXVQDICFNNAQRYFT-------  467
ident                  | |                   |                    
Sbjct gYSYSmLDAIRRAVMVSNILLINK-----vnekslTLKEVFRLATLGGSQALGldgeign  381
DSSP  lLLLLhHHHHHHHHHHHHHHHHLL-----llllllLHHHHHHHHLHHHHHHLLlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  467
ident                                                             
Sbjct fevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvv  441
DSSP  lllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeee


DSSP  -ll
Query -ik  469
ident    
Sbjct pfs  444
DSSP  lll


No 48: Query=3iacA Sbjct=3au2A Z-score=8.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  --LLLLLLLLLL------------------------------------------------
Query --ATFXTEDFLL------------------------------------------------   10
ident   |                                                         
Sbjct erAELCGSARRYkdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leEEELHHHHLLlleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   10
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -------lLHHHH-------------hhhhhlLLLLLEEELLLLL------LHHHHhhll
Query -------kNDIAR-------------tlyhkyAAPXPIYDFHCHL------SPQEIaddr   44
ident                                   |    |   |          |     
Sbjct yaalglpwIPPPLredqgeveaalegrlpkllELPQVKGDLQVHStysdgqNTLEE----  356
DSSP  hhhlllllLLHHHlllllhhhhhhllllllllLHHHLLEEEEELLllllllLLHHH----


DSSP  llllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhh
Query rfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwt  104
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLLllllll
Query hlelrrpfgitgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTDdpidsl  164
ident                                                |    ||      
Sbjct -------------------------------------lWEAAKTMGYRYLAVTD------  373
DSSP  -------------------------------------hHHHHHHHLLLEEEEEE------


DSSP  hhhhhhhhlllllleeelllLLHH-HHLLllllhhhhhhhhhhhhllllllhhhhhhhHH
Query eyhrqiaaddsidievapswRPDK-VFKIeldgfvdylrkleaaadvsitrfddlrqaLT  223
ident                                                             
Sbjct --------------------HSPAvRVAG---------------------------gpSP  386
DSSP  --------------------ELHHhHLLL---------------------------llLH


DSSP  HHHHHHHHLL------------lLEEEEEElLLLLlllllhhhhhhhhhhhhllllllhh
Query RRLDHFAACG------------cRASDHGIeTLRFapvpddaqldailgkrlagetlsel  271
ident                              |                              
Sbjct EEALKRVGEIrrfnethgppyllAGAEVDI-HPDG-------------------------  420
DSSP  HHHHHHHHHHhhhhhhhllleeeEEEEEEL-LLLL-------------------------


DSSP  hhhhhhhhhhhhHHHHHHhHLLEEEEEELEEllllhhhhhhhllllllleeLLLL--LHH
Query eiaqfttavlvwLGRQYAaRGWVXQLHIGAIrnnntrxfrllgpdtgfdsiGDNN--ISW  329
ident                                                             
Sbjct --------tldyPDWVLR-ELDLVLVSVHSR-------------------fNLPKadQTK  452
DSSP  --------llllLHHHHL-LLLEEEEELLLL-------------------lLLLHhhHHH


DSSP  HHHHHHHhhhllllLLEEEE--EELL--------hHHHHHHHHHHHHLlllllllLEEEL
Query ALSRLLDsxdvtneLPKTIL--YCLN--------pRDNEVLATXIGNFqgpgiagKVQFG  379
ident  |   |             |                | |                 |   
Sbjct RLLKALE------nPFVHVLahPTARllgrrapieADWEAVFQKAKEK-------GVAVE  499
DSSP  HHHHHHL------lLLLLEEllLLLLlllllllllLLHHHHHHHHHHH-------LLEEE


DSSP  L-llhHHLLhhhHHHHHHHHHHHLLhhhLLLLLLLLLLLLLLHHHHHHHHHHHHHHhhhh
Query S-gwwFNDQkdgXLRQLEQLSQXGLlsqFVGXLTDSRSFLSYTRHEYFRRILCNLLgqwa  438
ident                        ||        ||          |              
Sbjct IdgyyDRMD--lPDDLARMAYGMGL---WISLSTDAHQTDHLRFMELAVGTAQRAW----  550
DSSP  EelllLLLL--lLHHHHHHHHHLLL---LEEEELLLLLHHHHHHHHHHHHHHHHLL----


DSSP  hlllllllhhhhhhHHHH--HHLH---hHHHHLLLL---
Query qdgeipddeaxlsrXVQD--ICFN---nAQRYFTIK---  469
ident                                        
Sbjct --------------IGPErvLNTLdyedLLSWLKARrgv  575
DSSP  --------------LLLLllHHHLlhhhHHHHHHLLlll


No 49: Query=3iacA Sbjct=3ooqA Z-score=7.1

back to top
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------
Query atfxtedfllkndiartlyHKYA-------------------------------------   23
ident                                                             
Sbjct -----------kilfknatVFPItsrpfkgdvlvsngkvekvgeniedpdaeivdltgkf   49
DSSP  -----------leeeeeeeELLLlllleeeeeeeelleeeeeelllllllleeeelllle


DSSP  lLLLEEELLLLLLHHH---------------------------HHHLlllllhhhhhhll
Query aPXPIYDFHCHLSPQE---------------------------IADDrrfdnlgqiwleg   56
ident       | | |    |                              |             
Sbjct lFPGFVDAHSHIGLFEegvgyyysdgneatdpvtphvkaldgfNPQD-------------   96
DSSP  eEELEEEEEELLLLLLllllhhhlllllllllllllllhhhhlLLLL-------------


DSSP  llhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllll
Query dhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitg  116
ident                                                             
Sbjct ------------------------------------------------------------   96
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL--------llllllhhhh
Query tlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD--------dpidsleyhr  168
ident                          |        |  |                      
Sbjct ------------------------PAIERALAGGVTSVXIVPgsanpvggqgsvikfrsi  132
DSSP  ------------------------HHHHHHHLLLEEEEEELLllllleeeeeeeeellll


DSSP  HHHHllllllEEELllllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhh
Query QIAAddsidiEVAPswrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltrrldh  228
ident                                                             
Sbjct IVEE------CIVK----------------------------------------------  140
DSSP  LHHH------HEEE----------------------------------------------


DSSP  hhhlLLLEEEEEELLllllllllhhhhhhhhhhhhllllLLHH---hhhHHHHHHH----
Query faacGCRASDHGIETlrfapvpddaqldailgkrlagetLSEL---eiaQFTTAVL----  281
ident                                                             
Sbjct ----DPAGLKXAFGE--------------npkrvygerkQTPStrxgtaGVIRDYFtkvk  182
DSSP  ----EEEEEEEELLH--------------hhhhhhhhllLLLLlhhhhhHHHHHHHhhhh


DSSP  ----------------------hhHHHHHHHHLLEEEEEELeellllhhhhhhhllllll
Query ----------------------vwLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgf  319
ident                          |            |                     
Sbjct nyxkkkelaqkegkeftetdlkxeVGEXVLRKKIPARXHAH-------------------  223
DSSP  hhhhhhhhhhhlllllllllhhhhHHHHHHLLLLLEEEEEL-------------------


DSSP  leelllLLHHHHHHHHHHHHlllllLEEEE-EELLhhHHHHhHHHHHHLLlllllllEEE
Query dsigdnNISWALSRLLDSXDvtnelPKTIL-YCLNprDNEVlATXIGNFQgpgiagkVQF  378
ident              |                                              
Sbjct ----raDDILTAIRIAEEFG-----FNLVIeHGTE--AYKI-SKVLAEKK-------IPV  264
DSSP  ----lhHHHHHHHHHHHHHL-----LLEEEeELLL--HHHH-HHHHHHHL-------LLE


DSSP  LLLlhhhLLHH---------HHHHHHHHHHHHLLhhhLLLLLLLLLlllLLHHHHHHHHH
Query GSGwwfnDQKD---------GXLRQLEQLSQXGLlsqFVGXLTDSRsflSYTRHEYFRRI  429
ident   |                         |   |          |                
Sbjct VVG----PLLTfrtklelkdLTXETIAKLLKDGV---LIALXCDHP-viPLEFATVQAAT  316
DSSP  EEL----LLLLllllhhhllLLLLHHHHHHHLLL---LEEELLLLL-llLHHHHHHHHHH


DSSP  HHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL----------------------
Query LCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT----------------------  467
ident                            |   |                            
Sbjct AXRYG--------------aKEEDLLKILTVNPAKILGledrigsiepgkdadlvvwsgh  362
DSSP  HHHHL--------------lLHHHHHHLLLHHHHHHLLllllllllllllllleeeelll


DSSP  --------------------ll
Query --------------------ik  469
ident                       
Sbjct pfdxksvvervyidgvevfrre  384
DSSP  llllllleeeeeelleeeeell


No 50: Query=3iacA Sbjct=4rdvB Z-score=6.6

back to top
DSSP  -----------------------llllllllllllhhhhhhhhhlllLLLEEELLLLLLh
Query -----------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCHLSp   37
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-


DSSP  hhhhhllllllhhhHHHLlllhHHHHhhHLLLlhhhlllllllhhhhhhhhhhhhhhlll
Query qeiaddrrfdnlgqIWLEgdhyKWRAlrSAGVdeslitgketsdyekyxawantvpktlg   97
ident                          |                                  
Sbjct -----------qraMAGL----AEVA--GNPN----------------------------   74
DSSP  -----------hhhHLLL----LLLL--LLLL----------------------------


DSSP  lhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELL
Query nplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTT  157
ident                                                         |   
Sbjct ----------------dsfwtwrelmyrmvarlspeqieviacQLYIEMLKAGYTAVAEF  118
DSSP  ----------------llhhhhhhhhhhhhllllhhhhhhhhhHHHHHHHHHLEEEEEEE


DSSP  LL------------lLLLL-HHHHHHHHlllLLLEEELLLLLHH----hhllllLLHHhh
Query DD------------pIDSL-EYHRQIAAddsIDIEVAPSWRPDK----vfkielDGFVdy  200
ident                        |   |     |                     |    
Sbjct HYvhhdldgrsyadpAELSlRISRAASA---AGIGLTLLPVLYShagfggqpasEGQR--  173
DSSP  ELlllllllllllllLHHHhHHHHHHHH---HLLEEEEEELLLLeeellleellHHHL--


DSSP  hhhhhhhhllllllhhhhHHHHHHHHHHHHHL-LLLEEE-EEELlllllllllhhhhhhh
Query lrkleaaadvsitrfddlRQALTRRLDHFAAC-GCRASD-HGIEtlrfapvpddaqldai  258
ident                      | |      |         |                   
Sbjct ---------rfingseayLELLQRLRAPLEAAgHSLGLCfHSLR----------------  208
DSSP  ---------lllllhhhhHHHHHHHHHHHHHHlLEELEEeLLLL----------------


DSSP  hhhhhllllllhhhHHHHHHHHHHHhhHHHHhhlLEEEEEELEEllllhhhhhhhlllll
Query lgkrlagetlseleIAQFTTAVLVWlgRQYAargWVXQLHIGAIrnnntrxfrllgpdtg  318
ident                 |    ||                ||                   
Sbjct ------------avTPQQIATVLAA--GHDD---LPVHIHIAEQ----------------  235
DSSP  ------------llLHHHHHHHHLL--LLLL---LLEEEEELLL----------------


DSSP  llEELL---------LLLHHHHHHHHhhhhllllllEEEEE-ELLHH--HHHHHHHHHhh
Query fdSIGD---------NNISWALSRLLdsxdvtnelpKTILY-CLNPR--DNEVLATXIgn  366
ident                    |                   |              |     
Sbjct --QKEVddcqawsgrRPLQWLYENVA-------vdqRWCLVhATHADpaEVAAMARSG--  284
DSSP  --HHHHhhhhhhhllLHHHHHHHHLL-------lllLEEEEeLLLLLhhHHHHHHHHL--


DSSP  lllllllllEEELL-------llHHHLlhhHHHHHHHHHhhhllhhhLLLLLLLlLLLLL
Query fqgpgiagkVQFGS-------gwWFNDqkdGXLRQLEQLsqxgllsqFVGXLTDsRSFLS  419
ident             |                      | |           |   |      
Sbjct ---------AVAGLclsteanlgDGIF---PATDFLAQG-------gRLGIGSD-SHVSL  324
DSSP  ---------LEEEElhhhhhhllLLLL---LHHHHHHLL-------lEEEELLL-LLLLL


DSSP  L--HHHHHHHHH-------hHHHH-HHHHhlllllllhhHHHHHHHHHHLHHHHH-HLLL
Query Y--TRHEYFRRI-------lCNLL-GQWAqdgeipddeaXLSRXVQDICFNNAQR-YFTI  468
ident                       |                   |   |             
Sbjct SvvEELRWLEYGqrlrdrkrNRLYrDDQP----------MIGRTLYDAALAGGAQaLGQP  374
DSSP  LhhHHHHHHHHHhhhhhlllLLLLlLLLL----------LHHHHHHHHHHHHHHHhHLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct igslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrha  434
DSSP  llllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeellllll


DSSP  ----------------l
Query ----------------k  469
ident                  
Sbjct geersarafvqvlgell  451
DSSP  lhhhhhhhhhhhhhhhl


No 51: Query=3iacA Sbjct=2a3lA Z-score=6.6

back to top
DSSP  lllllllllLLLH-----------------------------------------------
Query atfxtedflLKND-----------------------------------------------   13
ident             |                                               
Sbjct -----qpdpIAADilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqet   55
DSSP  -----llllLLLLllllllllllllllllllllllllllllhhhhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   13
ident                                                             
Sbjct vapwekeepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkv  115
DSSP  llllllllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhh


DSSP  ----------------------------------hhhhhhhHLLLLLLEEELLLLLLhhh
Query ----------------------------------iartlyhKYAAPXPIYDFHCHLSpqe   39
ident                                                   | | | |   
Sbjct iaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaphRDFYNVRKVDTHVHHS---  172
DSSP  lllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllLLLLLLLEEEEEEELL---


DSSP  hhhllllllhhHHHHL----------lllhhhhhhhhllLLHHHllLLLLLHHHHHhhhh
Query iaddrrfdnlgQIWLE----------gdhykwralrsagVDESLitGKETSDYEKYxawa   89
ident               |                          |          |       
Sbjct ------acmnqKHLLRfiksklrkepdevvifrdgtyltLREVF-eSLDLTGYDLN---v  222
DSSP  ------llllhHHHHHhhhhhhhllllllleeelleeelHHHHH-hHHLLLLLLLL---l


DSSP  hhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHL
Query ntvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQX  149
ident                                                             
Sbjct dlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeitkQVFSDLEAS  282
DSSP  llllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhhhhHHHHHHLLL


DSSP  LeEEEELLLLL-------LLLL-HHHH-HHHHllllLLEEELLLLLHhhHLLLllLHHHh
Query NvRXVGTTDDP-------IDSL-EYHR-QIAAddsiDIEVAPSWRPDkvFKIEldGFVDy  200
ident                    | |                 |                  | 
Sbjct KyQMAEYRISIygrkmseWDQLaSWIVnNDLY----SENVVWLIQLP--RLYN--IYKD-  333
DSSP  LlEEEEEEEELllllllhHHHHhHHHHlLLLL----LLLEEEEEEEE--LLHH--HHLL-


DSSP  hhhhhhhhllllLLHHHHHHHHHHHHH------------hhhHLLLLEEEEEELLL-LLL
Query lrkleaaadvsiTRFDDLRQALTRRLD------------hfaACGCRASDHGIETL-RFA  247
ident             | |          |                       |          
Sbjct --------mgivTSFQNILDNIFIPLFeatvdpdshpqlhvfLKQVVGFDLVDDESkPER  385
DSSP  --------llllLLLHHHHHHHLLHHHhhhhlhhhllllhhhHLLEEEEEEELLLLlLLL


DSSP  LLL-LHHHHHHhHHHHhllllllhhHHHHhHHHHHHHHHHHHHH-----------HLLEE
Query PVP-DDAQLDAiLGKRlagetlselEIAQfTTAVLVWLGRQYAA-----------RGWVX  295
ident                                                             
Sbjct RPTkHMPTPAQ-WTNA---------FNPA-FSYYVYYCYANLYVlnklreskgmtTITLR  434
DSSP  LLLlLLLLLLL-LLLL---------LLLL-HHHHHHHHHHHHHHhhhhhllllllLLEEL


DSSP  EEEELEellllhhhhhhhllllllleellllLHHHHHHHHHhhhllllLLEEEEEELlhh
Query QLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDsxdvtneLPKTILYCLnpr  355
ident      |                             |                |       
Sbjct PHSGEA------------------------gDIDHLAATFL-------TCHSIAHGI--n  461
DSSP  LLLLLL------------------------lLLHHHHHHHH-------HLLLLLLLH--h


DSSP  HHHHhhHHHHHLLLlllllLEEELL-LLHHH---lLHHHhhHHHHHHHHHLLhhhLLLLL
Query DNEVlaTXIGNFQGpgiagKVQFGS-GWWFN---dQKDGxlRQLEQLSQXGLlsqFVGXL  411
ident                               |                   ||    |   
Sbjct LRKS-pVLQYLYYL----aQIGLAMsPLSNNslflDYHR--NPFPVFFLRGL---NVSLS  511
DSSP  HHHL-hHHHHHHHH----hLLLEEElHHHHLllllLLLL--LLHHHHHHLLL---LEEEL


DSSP  LLLLL---lLLLHHHHHHHHHHHHHHhhhhhlllllllhhhhHHHHHHHhLHHHHHHLL-
Query TDSRS---fLSYTRHEYFRRILCNLLgqwaqdgeipddeaxlSRXVQDIcFNNAQRYFT-  467
ident ||             |                                |   |       
Sbjct TDDPLqihlTKEPLVEEYSIAASVWK--------------lsACDLCEI-ARNSVYQSGf  556
DSSP  LLLHHhhllLLLHHHHHHHHHHHHHL--------------llHHHHHHH-HHHHHHHLLl


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------ik  469
ident                                                             
Sbjct shalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lhhhhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=3iacA Sbjct=1m65A Z-score=6.4

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLL--------LHHHhhhllllllhhhh
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHL--------SPQEiaddrrfdnlgqi   52
ident                              | | |                          
Sbjct --------------------------YPVDLHMHTvasthaysTLSD-------------   21
DSSP  --------------------------LLEELLLLLllllllllLHHH-------------


DSSP  hhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlll
Query wlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpf  112
ident                                                             
Sbjct ------------------------------------------------------------   21
DSSP  ------------------------------------------------------------


DSSP  llllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLL---------LLLL-
Query gitgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTD---------DPID-  162
ident                                    |        ||              
Sbjct -----------------------------yIAQAKQKGIKLFAITDhgpdmedapHHWHf   52
DSSP  -----------------------------hHHHHHHHLLLEEEEEEellllllllLLHHh


DSSP  -LLHHhHHHHhlllLLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhh
Query -SLEYhRQIAaddsIDIEVAPSWrpdkvfkieldgfvdylrkleaaadvsitrfddlrqa  221
ident                                                             
Sbjct iNMRI-WPRV---vDGVGILRGI-------------------------eaniknvdgeid   83
DSSP  hHHHH-LLLE---eLLEEEEEEE-------------------------eeelllllllll


DSSP  hHHHHHHhhhllLLEEeeeellllllllllhhhhhhhhhhhhllllllhhhhhhhhhhhh
Query lTRRLDHfaacgCRASdhgietlrfapvpddaqldailgkrlagetlseleiaqfttavl  281
ident                                                             
Sbjct cSGKMFD----sLDLI--------------------------------------------   95
DSSP  lLHHHHH----hLLEE--------------------------------------------


DSSP  hhhhhhhhhhlleeEEEElEELLllhhhhhhhllllllleeLLLL--LHHHHHHhhhhhh
Query vwlgrqyaargwvxQLHIgAIRNnntrxfrllgpdtgfdsiGDNN--ISWALSRlldsxd  339
ident                                                   |         
Sbjct --------------IAGF-HEPV----------------faPHDKatNTQAMIA------  118
DSSP  --------------EEEL-LLLL----------------llLLLHhhHHHHHHH------


DSSP  llllLLEEEE--EELL--hHHHHHHHHHHHHLlllllllLEEELLLLHHhllhhHHHHHH
Query vtneLPKTIL--YCLN--pRDNEVLATXIGNFqgpgiagKVQFGSGWWFndqkdGXLRQL  395
ident         |           |    |              |                   
Sbjct tiasGNVHIIshPGNPkyeIDVKAVAEAAAKH-------QVALEINNSS-----NCREVA  166
DSSP  hhhlLLLLEEllLLLLlllLLHHHHHHHHHHH-------LLEEEEELLL-----LHHHHH


DSSP  HHHHHHLLhhhllLLLLLLLLLLLLhHHHHHHHHHHHHHhhhhhlllllllhhhhhhHHH
Query EQLSQXGLlsqfvGXLTDSRSFLSYtRHEYFRRILCNLLgqwaqdgeipddeaxlsrXVQ  455
ident       |          ||         |    ||                         
Sbjct AAVRDAGG---wvALGSDSHTAFTMgEFEECLKILDAVD-----------------fPPE  206
DSSP  HHHHHHLL---leEEELLLLLHHHLlLLHHHHHHHHHLL-----------------lLHH


DSSP  HHHLH---HHHHHLLL-----------l
Query DICFN---NAQRYFTI-----------k  469
ident  |                          
Sbjct RILNVsprRLLNFLESrgmapiaefadl  234
DSSP  HLHHHlhhHHHHHHHHllllllhhhlll


No 53: Query=3iacA Sbjct=3dcpA Z-score=5.5

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL------hhHHHHllllllhhhhhh
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHLS------pqEIADdrrfdnlgqiwl   54
ident                              | | |                          
Sbjct --------------------------XKRDGHTHTEfcphgthdDVEE------------   22
DSSP  --------------------------LLEEEEELLLllllllllLHHH------------


DSSP  llllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllll
Query egdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgi  114
ident                                                             
Sbjct ------------------------------------------------------------   22
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLL----------------
Query tgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTD----------------  158
ident                                                             
Sbjct ---------------------------XVLKAIELDFDEYSIVEhaplssefxkntagdk   55
DSSP  ---------------------------HHHHHHHLLLLEEEEEEellllhhhhhllllll


DSSP  --------lLLLL---LHHHHHHHHLllLLLEEELLLllhhhhllllllhhhhhhhhhhh
Query --------dPIDS---LEYHRQIAADdsIDIEVAPSWrpdkvfkieldgfvdylrkleaa  207
ident            |          |      |                              
Sbjct eavttasxaXSDLpyyFKKXNHIKKKyaSDLLIHIGF-----------------------   92
DSSP  hhhhlllllHHHHhhhHHHHHHHHHHllLLLEEEEEE-----------------------


DSSP  hllllllhhhhhhhhhhhhhhhhhlllleeEEEEllllllllllhhhhhhhhhhhhllll
Query advsitrfddlrqaltrrldhfaacgcrasDHGIetlrfapvpddaqldailgkrlaget  267
ident                                                             
Sbjct ------------------------------EVDY--------------------------   96
DSSP  ------------------------------EEEL--------------------------


DSSP  llhhhhhhhhHHHHhHHHHHHHHHLL----eeEEEE-----------LEELLLLhhhhhh
Query lseleiaqftTAVLvWLGRQYAARGW----vxQLHI-----------GAIRNNNtrxfrl  312
ident                   |              |                          
Sbjct ---------lIGYE-DFTRDFLNEYGpqtddgVLSLhflegqggfrsIDFSAED--yneg  144
DSSP  ---------lLLLH-HHHHHHHHHHHhhlleeEEELleeeelleeeeLLLLHHH--hhhh


DSSP  hllllllleelLLLLHHHHHHHHHHHhlllllLEEEE--EELLH---------------h
Query lgpdtgfdsigDNNISWALSRLLDSXdvtnelPKTIL--YCLNP---------------r  355
ident                                          |                  
Sbjct ivqfyggfeqaQLAYLEGVKQSIEAD--lglfKPRRXghISLCQkfqqffgedtsdfsee  202
DSSP  lhhhhllhhhhHHHHHHHHHHHHHLL--llllLLLEEllLLHHHllhhhhlllhhhllhh


DSSP  hhhHHHHHHHHLLLlllllLEEELLllhHHLL---HHHHhhHHHHHHhhLLHH--HLLLL
Query dneVLATXIGNFQGpgiagKVQFGSgwwFNDQ---KDGXlrQLEQLSqxGLLS--QFVGX  410
ident                                                             
Sbjct vxeKFRVILALVKK----rDYELDF-ntAGLFkplCGETypPKKIVT--LASElqIPFVY  255
DSSP  hhhHHHHHHHHHHH----hLLEEEE-elHHHHlllLLLLllLHHHHH--HHHHllLLEEE


DSSP  LLLLLLLLL-LHHHHHHHHHHHhhhhhhhhlllllllhhhhhhhhhhhhlhhhhhhllll
Query LTDSRSFLS-YTRHEYFRRILCnllgqwaqdgeipddeaxlsrxvqdicfnnaqryftik  469
ident   ||                |                                       
Sbjct GSDSHGVQDiGRGYSTYCQKLE--------------------------------------  277
DSSP  ELLLLLHHHlLLLHHHHHHHLL--------------------------------------


No 54: Query=3iacA Sbjct=3f2bA Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ----------------------llllllllllllhhhhhhhhhlllLLLEEELLLLLL--
Query ----------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCHLS--   36
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLll


DSSP  ----hHHHHhllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhh
Query ----pQEIAddrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantv   92
ident                                                             
Sbjct qmdavTSVT---------------------------------------------------  129
DSSP  lllllLLHH---------------------------------------------------


DSSP  hhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEE
Query pktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVR  152
ident                                                             
Sbjct ------------------------------------------------kLIEQAKKWGHP  141
DSSP  ------------------------------------------------hHHHHHHHLLLL


DSSP  EEELLLLLlllLHHHHHHHHL-LLLLLEEELLLllhhhhllllllhhhhhhhhhhhhlll
Query XVGTTDDPidsLEYHRQIAAD-DSIDIEVAPSWrpdkvfkieldgfvdylrkleaaadvs  211
ident     ||                      |                               
Sbjct AIAVTDHA--vVQSFPEAYSAaKKHGMKVIYGL---------------------------  172
DSSP  LEEELLLL--lLLLHHHHHHHhHHHLLLEEEEE---------------------------


DSSP  lllhhhhhhhhhhhhhhhhhlllleeEEEEllllllllllhhhhhhhhhhhhllllllhh
Query itrfddlrqaltrrldhfaacgcrasDHGIetlrfapvpddaqldailgkrlagetlsel  271
ident                              |                              
Sbjct --------------------------EANIvddpfhvtllaqnetglknlfklvslshiq  206
DSSP  --------------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhll


DSSP  hhhhhhhhHHHHHHHHHhhHLLEEEeeeleellllhhhhhhhllllllleelllllhhhh
Query eiaqfttaVLVWLGRQYaaRGWVXQlhigairnnntrxfrllgpdtgfdsigdnniswal  331
ident             |       |                                       
Sbjct yfhrvpriPRSVLVKHR--DGLLVG-----------------------------------  229
DSSP  llllllleEHHHHHHLL--LLEEEE-----------------------------------


DSSP  hhhhhhhhlllllleeEEEELlhhHHHHhhhhHHHLLLlllllLEEELL--lLHHH----
Query srlldsxdvtnelpktILYCLnprDNEVlatxIGNFQGpgiagKVQFGS--gWWFN----  385
ident                                                             
Sbjct ----------------SGCDK-geLFDN----VEDIAR----fYDFLEVhppDVYKplyv  264
DSSP  ----------------LLLLL-llLLLL----LLLLHH----hLLLEEEllhHHHLllll


DSSP  llHHHHHHHHHHHHHHLL--hhHLLLlLLLLLLLL-------------------------
Query dqKDGXLRQLEQLSQXGL--lsQFVGxLTDSRSFL-------------------------  418
ident                 |       |                                   
Sbjct kdEEMIKNIIRSIVALGEkldiPVVA-TGNVHYLNpedkiyrkilihsqgganplnrhel  323
DSSP  llHHHHHHHHHHHHHHHHhlllLEEE-LLLLLLLLhhhhhhhhhhhhllhhhllllllll


DSSP  ---LLHHHHHHHHHHHHHHhhhhhlllllllhhhhHHHHHHHHLHHHHHHLLL-------
Query ---SYTRHEYFRRILCNLLgqwaqdgeipddeaxlSRXVQDICFNNAQRYFTI-------  468
ident                  |                       |   | |            
Sbjct pdvYFRTTNEMLDCFSFLG----------------PEKAKEIVVDNTQKIASLigdvkpi  367
DSSP  lllLLLLHHHHHHHHHHHH----------------HHHHHHHHLHHHHHHHHLlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct kdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylish  427
DSSP  lllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct klvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgf  487
DSSP  hhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct dlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfged  547
DSSP  hllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct nvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivv  607
DSSP  leeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct pdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgi  667
DSSP  lllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct dpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfse  727
DSSP  lhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct lvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesv  787
DSSP  hhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct rkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhplly  847
DSSP  lllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct yasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergf  907
DSSP  hhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  468
ident                                                             
Sbjct sfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgk  967
DSSP  eellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhl


DSSP  --------------------------l
Query --------------------------k  469
ident                            
Sbjct lsktlleylesrgcldslpdhnqlslf  994
DSSP  llhhhhhhhhhllllllllllllllll


No 55: Query=3iacA Sbjct=1v77A Z-score=5.3

back to top
DSSP  llllllllllllhhhhhhhhhlllllleEELLLLLLhhhhhhllllllhhhhhhllllhh
Query atfxtedfllkndiartlyhkyaapxpiYDFHCHLSpqeiaddrrfdnlgqiwlegdhyk   60
ident                                                             
Sbjct -------------------------vkfIEMDIRDK------------------------   11
DSSP  -------------------------lllEEEEELLH------------------------


DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll
Query wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
ident                                                             
Sbjct ------------------------------------------------------------   11
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhllhhhlhhhhhhhLLEEEEELllllllllhhhhhhhhllllllee
Query pdtaesiwtqcneklatpafsargixqqXNVRXVGTtddpidsleyhrqiaaddsidiev  180
ident                                  |                          
Sbjct ---------------------eayelakEWFDEVVV------------------------   26
DSSP  ---------------------hhhhhhhHHLLEEEE------------------------


DSSP  elLLLLHHHhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHL-LLLEEEE
Query apSWRPDKVfkieldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAAC-GCRASDH  239
ident   |                                          |       |  |   
Sbjct --SIKFNEE-------------------------------vDKEKLREARKEyGKVAILL   53
DSSP  --EEEELLL-------------------------------lLHHHHHHHHHHhLLEEEEE


DSSP  EEllLLLLllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHhhhllEEEEEE
Query GIetLRFApvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYaargwVXQLHI  299
ident                                           |     |           
Sbjct SN--PKPS-----------------------------LVRDTVQKFKSY-----LIYVES   77
DSSP  EL--LLHH-----------------------------HHHHHHHHLLLL-----EEEEEL


DSSP  LeellllhhhhhhhllllllleellllLHHHHHHHHHHhhllllLLEEEEEE-LLHHHHh
Query GairnnntrxfrllgpdtgfdsigdnnISWALSRLLDSxdvtneLPKTILYC-LNPRDNe  358
ident                                                 |     |  |  
Sbjct N--------------------------DLRVIRYSIEK------GVDAIISPwVNRKDP-  104
DSSP  L--------------------------LHHHHHHHHHL------LLLEEELLlLLLLLL-


DSSP  HHHH-HHHHLLLlllllLEEELLllHHHLLH---HHHHHH--HHHHHHHLL--hhhLLLL
Query VLAT-XIGNFQGpgiagKVQFGSgwWFNDQK---DGXLRQ--LEQLSQXGL--lsqFVGX  410
ident                       |                                     
Sbjct GIDHvLAKLMVK---knVALGFS-lRPLLYSnpyERANLLrfMMKAWKLVEkykvrRFLT  160
DSSP  LLLHhHHHHHHH---hlLEEEEE-lHHHHHLlhhHHHHHHhhHHHHHHHHHhhlllEEEE


DSSP  LLLLLlllLLHHHhhhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHlHHHH---HHLL
Query LTDSRsflSYTRHeyfrrilcnllgqwaqdgeipddeaxlsrXVQDICfNNAQ---RYFT  467
ident                                                             
Sbjct SSAQE---KWDVR---------------yprdlislgvvigmEIPQAK-ASISmypEIIL  201
DSSP  LLLLL---HHHLL---------------lhhhhhhhhhhlllLHHHHH-HLLLhhhHHHH


DSSP  Ll
Query Ik  469
ident   
Sbjct K-  202
DSSP  L-


No 56: Query=3iacA Sbjct=3e38A Z-score=4.3

back to top
DSSP  llllllllllllhhhhhhhhhLLLL-----LLEEELLLLLL----hhHHHHllllllhhh
Query atfxtedfllkndiartlyhkYAAP-----XPIYDFHCHLS----pqEIADdrrfdnlgq   51
ident                                   ||| |                     
Sbjct --------------aqrrneiQVPDldgytTLKCDFHXHSVfsdglvWPTV---------   37
DSSP  --------------lllllllLLLLlllleEEEEELLLLLLllllllLHHH---------


DSSP  hhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhll
Query iwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrp  111
ident                                                             
Sbjct ------------------------------------------------------------   37
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLLLL----------l
Query fgitgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTDDP----------i  161
ident                                              |              
Sbjct ------------------------------rVDEAYRDGLDAISLTEHIeyrphkqdvvs   67
DSSP  ------------------------------hHHHHHHLLLLEELLEEELlllllllllll


DSSP  LLLHHHHHHHHL-LLLLLEEELLLLLHHhhllllllhhhhhhhhhhhhllllllhhhhhh
Query DSLEYHRQIAAD-DSIDIEVAPSWRPDKvfkieldgfvdylrkleaaadvsitrfddlrq  220
ident |                |                                          
Sbjct DHNRSFDLCREQaEKLGILLIKGSEITR--------------------------axapgh  101
DSSP  LLLHHHHHHHHHhHHHLLEELLEEEEEL--------------------------llllle


DSSP  hhhhhhHHHHhlllleeeeeellllllllllhhhhhhhhhhhhllllllhhhhhhhhhhH
Query altrrlDHFAacgcrasdhgietlrfapvpddaqldailgkrlagetlseleiaqfttaV  280
ident                                                             
Sbjct fnaiflSDSN--------------------------------------------pleqkD  117
DSSP  eeeellLLLH--------------------------------------------hhlllL


DSSP  HHHHHHHHHHHLLEEEEE-ELEEllllhhhhhhhlllllllEELLLLLHhhHHHHHHHHH
Query LVWLGRQYAARGWVXQLH-IGAIrnnntrxfrllgpdtgfdSIGDNNISwaLSRLLDSXD  339
ident      |     |  |     |                    |                  
Sbjct YKDAFREAKKQGAFXFWNhPGWD------------------SQQPDTTK--WWPEHTALY  157
DSSP  HHHHHHHHHHLLLEEEELlLLLL------------------LLLLLLLL--LLHHHHHHH


DSSP  LllLLLEEEEE-ellhhhHHHHHHHHHHLLlllllllEEELLllhhhllhhhhhhhhhhh
Query VtnELPKTILY-clnprdNEVLATXIGNFQgpgiagkVQFGSgwwfndqkdgxlrqleql  398
ident    |                                                        
Sbjct Q--EGCXHGIEvanghlyXPEAIQWCLDKN-------LTXIG------------------  190
DSSP  H--LLLLLEEEeeelleeLLHHHHHHHHHL-------LEEEE------------------


DSSP  hhhllhhhllllLLLLLLLL--------------------------------llhhhhhH
Query sqxgllsqfvgxLTDSRSFL--------------------------------sytrheyF  426
ident               |                                            |
Sbjct ------------TSDIHQPIqtdydfekgehrtxtfvfakerslqgirealdnrrtaayF  238
DSSP  ------------ELLLLLLHhhhllhhhllllleeeeeellllhhhhhhhhhllleeeeE


DSSP  HHHH------------------------------------HHHHH---------------
Query RRIL------------------------------------CNLLG---------------  435
ident    |                                      |                 
Sbjct HELLigredllrpffekcvkieevsrneqgvtlsitnvtdLVLKLkktahdtllvyfrdx  298
DSSP  LLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeelllLLEEEeelllllleelllee


DSSP  --------------------------------hhhhllLLLLlhhhhhhhhhhhhlhhhh
Query --------------------------------qwaqdgEIPDdeaxlsrxvqdicfnnaq  463
ident                                                             
Sbjct tlkphtrytvrigfkqgikggdvnfevtnfivapdkglKYTI------------------  340
DSSP  eellleeeeeeeeellllllleeeeeeeeeeeelleeeEEEE------------------


DSSP  hhllll
Query ryftik  469
ident       
Sbjct ----sl  342
DSSP  ----el


No 57: Query=3iacA Sbjct=2anuA Z-score=4.3

back to top
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLL-------LHHHHhhllllllhhhhh
Query atfxtedfllkndiartlyhkyaapXPIYDFHCHL-------SPQEIaddrrfdnlgqiw   53
ident                              ||| |           |              
Sbjct -----------------------teWLLCDFHVHTnxsdghlPLGEV-------------   24
DSSP  -----------------------leEEEEEEEELLlllllllLHHHH-------------


DSSP  hllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllll
Query legdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfg  113
ident                                                             
Sbjct ------------------------------------------------------------   24
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLLLL-------------
Query itgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTDDP-------------  160
ident                                      |  |  ||               
Sbjct -----------------------------VDLFGKHGVDVVSITDHIvdrrtleqrkrng   55
DSSP  -----------------------------HHHHHHLLLLEEEEEEEEelhhhhhhhhhll


DSSP  ----------LLLL-HHHHHHHHL--LLLLLEEELLLLLHH----------------HHL
Query ----------IDSL-EYHRQIAAD--DSIDIEVAPSWRPDK----------------VFK  191
ident                                   |                         
Sbjct eplgaitedkFQDYlKRLWREQKRawEEYGXILIPGVEITNntdlyhivavdvkeyvDPS  115
DSSP  llllllllllHHHHhHHHHHHHHHhhHHHLLEEEEEEEEEElllleeeeeellllllLLL


DSSP  Lllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhlllleeeeeellllllllll
Query Ieldgfvdylrkleaaadvsitrfddlrqaltrrldhfaacgcrasdhgietlrfapvpd  251
ident                                                             
Sbjct L-----------------------------------------------------------  116
DSSP  L-----------------------------------------------------------


DSSP  hhhhhhhhhhhhllllllhhhhhhhhhhHHHHHHHHHHHHLLEEEEEELeellllhhhhh
Query daqldailgkrlagetlseleiaqfttaVLVWLGRQYAARGWVXQLHIGairnnntrxfr  311
ident                                                             
Sbjct ----------------------------PVEEIVEKLKEQNALVIAAHP-----------  137
DSSP  ----------------------------LHHHHHHHHHHLLLEEEELLL-----------


DSSP  hhlllllllEELLlllhhHHHHHHHhhhlllllleEEEEellhhhhhhhhhhhhhlllll
Query llgpdtgfdSIGDnniswALSRLLDsxdvtnelpkTILYclnprdnevlatxignfqgpg  371
ident                      |  |                                   
Sbjct -------drKKLSwylwaNXERFKD--------tfDAWE---------------------  161
DSSP  -------llLLLLlhhhhLLLLLLL--------llLEEE---------------------


DSSP  lllleeelLLLHHHLlhhhHHHHHHHHhhhllhhhllLLLLLLLLLLLLHHHhhhhhhhh
Query iagkvqfgSGWWFNDqkdgXLRQLEQLsqxgllsqfvGXLTDSRSFLSYTRHeyfrrilc  431
ident                                          |                  
Sbjct --------IANRDDL----FNSVGVKK-------yryVANSDFHELWHVYSW--------  194
DSSP  --------EEELLEE----LHHHHHLL-------lleEEELLLLLHHHHLLE--------


DSSP  hhhhhhhhlllllllhhhhhhhhhhhHLHH---hhHHLL-------------ll
Query nllgqwaqdgeipddeaxlsrxvqdiCFNN---aqRYFT-------------ik  469
ident                                                       
Sbjct ------------------------ktLVKSeknieAIKEairkntdvaiylxrk  224
DSSP  ------------------------eeEEEElllhhHHHHhhhhllleeeeelll


No 58: Query=3iacA Sbjct=1bksA Z-score=4.2

back to top
DSSP  llllllllllllhhhhhhhhhlllllleeellllllhhhhhhllllllhhhhhhllllhh
Query atfxtedfllkndiartlyhkyaapxpiydfhchlspqeiaddrrfdnlgqiwlegdhyk   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll
Query wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhllhhhlhhhhhhhlleeeeelllllllllhhhhhhhhlllLLLEE
Query pdtaesiwtqcneklatpafsargixqqxnvrxvgttddpidsleyhrqiaaddsIDIEV  180
ident                                                           | 
Sbjct -------------------------------------------meryenlfaqlnDRREG   17
DSSP  -------------------------------------------lhhhhhhhhhhhHLLLL


DSSP  ELLLLLHhHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHHhhllLLEEEEE
Query APSWRPDkVFKIeldgfvdylrkleaaadvsitrfdDLRQALTRRLDHFaacgCRASDHG  240
ident |                                             |        |   |
Sbjct AFVPFVT-LGDP---------------------gieQSLKIIDTLIDAG----ADALELG   51
DSSP  EEEEEEE-LLLL---------------------lhhHHHHHHHHHHHLL----LLLEEEE


DSSP  ELLllllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHHHHHhhLLEEEEEEL
Query IETlrfapvpddaqldailgkrlagetlseleIAQFTTAVLVWLGRQYAarGWVXQLHIG  300
ident                                         |               |   
Sbjct VPF-------sdpladgptiqnanlrafaagvTPAQCFEMLALIREKHP--TIPIGLLMY  102
DSSP  LLL-------lllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL--LLLEEEEEL


DSSP  eellllhhhhhhhllllllleelLLLL-----HHHHHHHHHHHhlllllleEEEEELLHH
Query airnnntrxfrllgpdtgfdsigDNNI-----SWALSRLLDSXdvtnelpkTILYCLNPR  355
ident                         |            |                      
Sbjct -----------------------ANLVfnngiDAFYARCEQVG-------vDSVLVADVP  132
DSSP  -----------------------HHHHhlllhHHHHHHHHHHL-------lLEEEELLLL


DSSP  --hHHHHHHHHHHLLlllllllEEELLLlhhhLLHHHHHHHHHHHhhhllhhhlLLLLLl
Query --dNEVLATXIGNFQgpgiagkVQFGSGwwfnDQKDGXLRQLEQLsqxgllsqfVGXLTd  413
ident                                    |                     |  
Sbjct veeSAPFRQAALRHN-------IAPIFIcppnADDDLLRQVASYG-------rgYTYLL-  177
DSSP  hhhLHHHHHHHHHLL-------LEEEEEelllLLHHHHHHHHHHL-------llLEEEL-


DSSP  llllLLLHHHHHHHHHH------------------------hhhhhhhhhlllllllhhh
Query srsfLSYTRHEYFRRIL------------------------cnllgqwaqdgeipddeax  449
ident           |                                                 
Sbjct --alPLHHLIEKLKEYHaapalqgfgisspeqvsaavragaagaisgsaivkiieknlas  235
DSSP  --llLHHHHHHHHHHHLllleeellllllhhhhhhhhhhllleeeellhhhhhhhhllll


DSSP  hhhhhhhhhlhhhhhhllll
Query lsrxvqdicfnnaqryftik  469
ident                     
Sbjct pkqmlaelrsfvsamkaasr  255
DSSP  hhhhhhhhhhhhhhhhhlll


No 59: Query=3iacA Sbjct=2yb1A Z-score=3.8

back to top
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLL-------LHHHHhhllllllhhhhh
Query atfxtedfllkndiartlyhkyaapxPIYDFHCHL-------SPQEIaddrrfdnlgqiw   53
ident                              | | |         | |              
Sbjct --------------------------ANIDLHFHSrtsdgalTPTEV-------------   21
DSSP  --------------------------LLEELLLLLlllllllLHHHH-------------


DSSP  hllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllll
Query legdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfg  113
ident                                                             
Sbjct ------------------------------------------------------------   21
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhhhhhhhllhhhlhhhHHHHLLEEEEELLL--lllllLHHHHHHH
Query itgtlfgpdtaesiwtqcneklatpafsargIXQQXNVRXVGTTD--dpidsLEYHRQIA  171
ident                                            ||        |     |
Sbjct -----------------------------idRAAARAPALLALTDhdctgglAEAAAAAA   52
DSSP  -----------------------------hhHHHLLLLLEEEELLllllllhHHHHHHHH


DSSP  HlllLLLEEELLlllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhh
Query AddsIDIEVAPSwrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltrrldhfaa  231
ident       |                                                     
Sbjct R---RGIPFLNG------------------------------------------------   61
DSSP  H---LLLLEEEE------------------------------------------------


DSSP  lllleEEEEElLLLLlllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhhh
Query cgcraSDHGIeTLRFapvpddaqldailgkrlagetlseleiaqfttavlvwlgrqyaar  291
ident                                                             
Sbjct -----VEVSV-SWGR----------------------------htvhivglgidpaepal   87
DSSP  -----EEEEE-EELL----------------------------eeeeeeeellllllhhh


DSSP  lleeeeeeleellLLHHHH-----------HHHL-----------LLLLL----------
Query gwvxqlhigairnNNTRXF-----------RLLG-----------PDTGF----------  319
ident                                                             
Sbjct aaglksiregrleRARQMGasleaagiagcFDGAmrwcdnpemisRTHFArhlvdsgavk  147
DSSP  hhhhhhhhllhhhHHHHHHhhhhhlllllhHHHHhlllllhhhllHHHHHhhhhhlllll


DSSP  -------------leelllllhhHHHHHHHhhhllLLLLEEEEE--eLLHH---HHHHHH
Query -------------dsigdnniswALSRLLDsxdvtNELPKTILY--cLNPR---DNEVLA  361
ident                         |                               | | 
Sbjct dmrtvfrkyltpgkpgyvshqwaSLEDAVG--wivGAGGMAVIAhpgRYDMgrtLIERLI  205
DSSP  lhhhhhhhlllllllllllllllLHHHHHH--hhhHLLLEEEELlhhHLLLlhhHHHHHH


DSSP  HHHHHLLlllllllEEELLllhhhLLHHHHHHHHHHHHhHLLHhhLLLLLLLLLLL-lll
Query TXIGNFQgpgiagkVQFGSgwwfnDQKDGXLRQLEQLSqXGLLsqFVGXLTDSRSF-lsy  420
ident                            |              |        |        
Sbjct LDFQAAG------gQGIEV-asgsHSLDDMHKFALHAD-RHGL--YASSGSDFHAPgedv  255
DSSP  HHHHHLL------lLEEEE-eellLLHHHHHHHHHHHH-HHLL--EEEEELLLLLLllll


DSSP  hhHHHHHhhhhhhhhhhhhlllllllhhhhhhhhhhhhlhHHHHHLLL---------l
Query trHEYFRrilcnllgqwaqdgeipddeaxlsrxvqdicfnNAQRYFTI---------k  469
ident    |                                       |              
Sbjct ghTEDLP-----------------------------picrPIWRELEArilrpadaen  284
DSSP  llLLLLL-----------------------------llllLHHHHLHHhlllllhhhl