Results: dupa

Query: 3griA

MOLECULE: DIHYDROOROTASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3gri-A 75.8  0.0  422   422  100 PDB  MOLECULE: DIHYDROOROTASE;                                            
   2:  3e74-A 47.8  2.1  394   429   27 PDB  MOLECULE: ALLANTOINASE;                                              
   3:  1gkp-A 43.9  2.4  401   458   29 PDB  MOLECULE: HYDANTOINASE;                                              
   4:  4b3z-D 40.4  2.7  399   477   24 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   5:  3pnu-A 32.2  2.7  311   338   20 PDB  MOLECULE: DIHYDROOROTASE;                                            
   6:  3giq-A 30.5  2.7  335   475   19 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   7:  1onx-A 28.1  2.9  314   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   8:  2vun-A 27.4  3.0  317   385   19 PDB  MOLECULE: ENAMIDASE;                                                 
   9:  3nqb-A 26.8  3.2  305   587   19 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  10:  4cqb-A 26.2  3.6  322   402   16 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  11:  1yrr-B 25.9  3.2  296   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  12:  2ogj-A 25.9  3.3  312   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  13:  3mtw-A 25.2  3.7  319   404   18 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  14:  2paj-A 25.2  3.2  309   421   16 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  15:  3mkv-A 23.9  3.0  304   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  16:  1k6w-A 23.4  3.9  317   423   16 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  17:  2oof-A 23.0  3.8  312   403   17 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  18:  1j6p-A 22.7  3.2  303   407   17 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  19:  3ooq-A 22.3  3.3  280   384   20 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  20:  3ls9-A 22.3  3.5  317   453   20 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  21:  3icj-A 22.1  3.3  288   468   19 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  22:  4c5y-A 21.1  3.6  308   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  23:  1a5k-C 21.1  2.9  322   566   15 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  24:  2uz9-A 19.6  4.0  305   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  25:  4rdv-B 18.7  3.5  302   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  26:  3irs-A 16.5  3.1  230   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  27:  3cjp-A 16.3  3.0  214   262   10 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  28:  2ob3-A 16.3  3.6  237   329    9 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  29:  2ffi-A 15.6  3.2  228   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  30:  1bf6-A 15.5  3.2  226   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  31:  2imr-A 15.5  4.4  266   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  32:  2dvt-A 15.4  3.2  232   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  33:  4qrn-A 15.3  3.1  236   352    7 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  34:  2vc5-A 15.1  3.1  223   314   14 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  35:  3k2g-B 15.1  3.2  229   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  36:  4mup-B 15.0  3.2  225   286    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  37:  1a4m-A 15.0  3.4  236   349   14 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  38:  4ofc-A 14.9  3.1  227   335   11 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  39:  4hk5-D 14.4  3.7  240   380    9 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  40:  2y1h-B 14.3  3.2  220   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  41:  4dlf-A 14.2  3.3  228   287    7 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  42:  4dzi-C 13.7  3.7  229   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  43:  1itq-A 13.7  3.3  228   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  44:  2qpx-A 13.6  3.4  221   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  45:  3gg7-A 13.5  3.4  214   243   11 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  46:  3qy6-A 13.0  3.3  197   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  2gwg-A 12.7  3.7  221   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  48:  1j5s-A 12.6  3.4  230   451   14 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  3iac-A 12.3  3.5  226   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  1v77-A 11.3  3.9  183   202   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A  9.7  3.9  227   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3au2-A  8.9  8.1  184   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  1m65-A  8.6  3.4  177   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3f2b-A  8.1  6.5  197   994    7 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  3dcp-A  8.0  4.0  177   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  56:  1bks-A  6.6  3.6  166   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  6.0  3.7  152   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  5.4  4.9  169   342   13 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  4.5  4.2  144   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3griA Sbjct=3griA Z-score=75.8

back to top
DSSP  LEEEELLEEEELLEEEELEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEEL
Query XKLIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHVH   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct XKLIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHVH   60
DSSP  LEEEELLEEEELLEEEELEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEEL


DSSP  LLLLLLLLLLLHHHHHHHHHHLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHLLLEELL
Query LREPGGEYKETIETGTKAAARGGFTTVCPXPNTRPVPDSVEHFEALQKLIDDNAQVRVLP  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LREPGGEYKETIETGTKAAARGGFTTVCPXPNTRPVPDSVEHFEALQKLIDDNAQVRVLP  120
DSSP  LLLLLLLLLLLHHHHHHHHHHLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHLLLEELL


DSSP  LEELLHHHLLLLLLLHHHHHLLLLLLEEELLLLLLLHHHHHHHHHHHHHHLLLEEELLLL
Query YASITTRQLGKELVDFPALVKEGAFAFTDDGVGVQTASXXYEGXIEAAKVNKAIVAHCED  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YASITTRQLGKELVDFPALVKEGAFAFTDDGVGVQTASXXYEGXIEAAKVNKAIVAHCED  180
DSSP  LEELLHHHLLLLLLLHHHHHLLLLLLEEELLLLLLLHHHHHHHHHHHHHHLLLEEELLLL


DSSP  HHHLLLLLEELLHHHHHHLLLEELLHHHHHHHHHHHHHHHHHLLLEEELLLLLHHHHHHH
Query NSLIYGGAXHEGKRSKELGIPGIPNICESVQIARDVLLAEAAGCHYHVCHVSTKESVRVI  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NSLIYGGAXHEGKRSKELGIPGIPNICESVQIARDVLLAEAAGCHYHVCHVSTKESVRVI  240
DSSP  HHHLLLLLEELLHHHHHHLLLEELLHHHHHHHHHHHHHHHHHLLLEEELLLLLHHHHHHH


DSSP  HHHHHLLLLEEEEELHHHHHLLHHHLLLLLHHHLLLLLLLLHHHHHHHHHHHHLLLLLEE
Query RDAKRAGIHVTAEVTPHHLLLTEDDIPGNNAIYKXNPPLRSTEDREALLEGLLDGTIDCI  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RDAKRAGIHVTAEVTPHHLLLTEDDIPGNNAIYKXNPPLRSTEDREALLEGLLDGTIDCI  300
DSSP  HHHHHLLLLEEEEELHHHHHLLHHHLLLLLHHHLLLLLLLLHHHHHHHHHHHHLLLLLEE


DSSP  LLLLLLLLHHHHLLLLLLLLLLLLLLLLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHL
Query ATDHAPHARDEKAQPXEKAPFGIVGSETAFPLLYTHFVKNGDWTLQQLVDYLTIKPCETF  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ATDHAPHARDEKAQPXEKAPFGIVGSETAFPLLYTHFVKNGDWTLQQLVDYLTIKPCETF  360
DSSP  LLLLLLLLHHHHLLLLLLLLLLLLLLLLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHL


DSSP  LLLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLLEELLEEEEEEELLEEEE
Query NLEYGTLKENGYADLTIIDLDSEQEIKGEDFLSKADNTPFIGYKVYGNPILTXVEGEVKF  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NLEYGTLKENGYADLTIIDLDSEQEIKGEDFLSKADNTPFIGYKVYGNPILTXVEGEVKF  420
DSSP  LLLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLLEELLEEEEEEELLEEEE


DSSP  EL
Query EG  422
ident ||
Sbjct EG  422
DSSP  EL


No 2: Query=3griA Sbjct=3e74A Z-score=47.8

back to top
DSSP  --LEEEELLEE-EELLeEEELEEEEELLEEEEEELLLLLlllLEEEELLLLEEEELEEEE
Query --XKLIKNGKV-LQNGeLQQADILIDGKVIKQIAPAIEPsngVDIIDAKGHFVSPGFVDV   57
ident      |||| | | |      ||   |  |  |             || |  |||| || 
Sbjct sfDLIIKNGTViLENE-ARVVDIAVKGGKIAAIGQDLGD--aKEVXDASGLVVSPGXVDA   57
DSSP  leEEEEELLEEeLLLL-EEELEEEEELLEEEEEELLLLL--eEEEEELLLLEEEELEEEE


DSSP  EELLlllllllllLHHHHHHHHHHLLEEEEEELLL-LLLLLLLHHHHHHHHHHHHHHLLL
Query HVHLrepggeykeTIETGTKAAARGGFTTVCPXPN-TRPVPDSVEHFEALQKLIDDNAQV  116
ident | |            |||| ||| || ||   ||    |        |            
Sbjct HTHI---------GYETGTRAAAKGGITTXIEXPLnQLPATVDRASIELKFDAAKGKLTI  108
DSSP  EELL---------LHHHHHHHHHHLLEEEEEELLLlLLLLLLLHHHHHHHHHHHLLLLLL


DSSP  EELLLEELLhhhlLLLLLLHHHHHLLLLLLEEELLLLLlLHHHHHHHHHHHHHHLLLEEE
Query RVLPYASITtrqlGKELVDFPALVKEGAFAFTDDGVGVqTASXXYEGXIEAAKVNKAIVA  176
ident                       |   |   |      |        |             
Sbjct DAAQLGGLV----SYNIDRLHELDEVGVVGFXCFVRDV-NDWQFFKGAQKLGELGQPVLV  163
DSSP  EEEELEELL----LLLLLLHHHHHHHLLLLEEEELLLL-LHHHHHHHHHHHHHHLLLEEE


DSSP  LLLLHHHLLLL-------------LEELlhhhhhhlllEELLHHHHHHHHHHHHHHHHHL
Query HCEDNSLIYGG-------------AXHEgkrskelgipGIPNICESVQIARDVLLAEAAG  223
ident |||                                     |   |   | |   ||  ||
Sbjct HCENALICDELgeeakregrvtahDYVA----------SRPVFTEVEAIRRVLYLAKVAG  213
DSSP  ELLLHHHHHHHhhhhhhhllllhhHHHH----------LLLHHHHHHHHHHHHHHHHHHL


DSSP  LLEEELLLLLHHHHHHHHHHHHLLLLEEEEELHHHHHLLHHHLLLLLHHHLLLLLLLLHH
Query CHYHVCHVSTKESVRVIRDAKRAGIHVTAEVTPHHLLLTEDDIPGNNAIYKXNPPLRSTE  283
ident |  ||||||  | |     |   |   | |  ||   |  |         |  || |  |
Sbjct CRLHVCHVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLE  273
DSSP  LLEEELLLLLHHHHHHHHHHHHLLLLEEEEELLHHHHLLHHHHHHHLHHHLLLLLLLLHH


DSSP  HHHHHHHHHHLLLLLEELLLLLLLLHHHHLLLLLLLLLLLLLLLLHHHHHHHHHLLLLLL
Query DREALLEGLLDGTIDCIATDHAPHARDEKAQPXEKAPFGIVGSETAFPLLYTHFVKNGDW  343
ident       | |  | |||   || |     ||    ||  || |            |     
Sbjct NQKGXWEKLFNGEIDCLVSDHSPCPPEXKAGNIXKAWGGIAGLQSCXDVXFDEAVQKRGX  333
DSSP  HHHHHHHHHHLLLLLEELLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLL


DSSP  LHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLL
Query TLQQLVDYLTIKPCETFNLE-YGTLKENGYADLTIIDLDSEQEIKGEDFLSKADNTPFIG  402
ident  |              | |   |       ||   |   |       |        |  |
Sbjct SLPXFGKLXATNAADIFGLQqKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVG  393
DSSP  LHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLL


DSSP  LEELLEEEEEEELLEEEEEL----------------
Query YKVYGNPILTXVEGEVKFEG----------------  422
ident          |   | |                    
Sbjct RTIGARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
DSSP  LEELLEEEEEEELLEEEEELllllllllllleelll


No 3: Query=3griA Sbjct=1gkpA Z-score=43.9

back to top
DSSP  LEEEELLEEEelLEEEELEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEEL
Query XKLIKNGKVLqnGELQQADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHVH   60
ident   |||||          |||   |  |  |    |   |   ||| |  | ||| | |||
Sbjct PLLIKNGEIItaDSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVH   60
DSSP  LEEEELLEEEelLEEEELEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEEL


DSSP  LlLLLL---LLLLLHHHHHHHHHHLLEEEEEELLLLllllLLHHHHHHHHHHHHHHLLLE
Query LrEPGG---EYKETIETGTKAAARGGFTTVCPXPNTrpvpDSVEHFEALQKLIDDNAQVR  117
ident            | | ||| |||  || ||           |  |           |    
Sbjct I-YLPFmatFAKDTHETGSKAALMGGTTTYIEMCCPsrndDALEGYQLWKSKAEGNSYCD  119
DSSP  L-LLEElleELLLLHHHHHHHHHHLLEEEEEEEELLllllLHHHHHHHHHHHHLLLLLLE


DSSP  ELLLEELlhhHLLL--LLLLHHHHHLLLLLLEEEL-----LLLLlLHHHHHHHHHHHHHH
Query VLPYASIttrQLGK--ELVDFPALVKEGAFAFTDD-----GVGVqTASXXYEGXIEAAKV  170
ident                         |  |   |          ||      |     |   
Sbjct YTFHMAV---SKFDekTEGQLREIVADGISSFXIFlsyknFFGV-DDGEMYQTLRLAKEL  175
DSSP  EEEEEEL---LLLLllHHHHHHHHHHLLLLEEEEEellllLLLL-LHHHHHHHHHHHHHH


DSSP  LLLEEELLLLHHHLLLL-------------LEELlhhhhhhlllEELLHHHHHHHHHHHH
Query NKAIVAHCEDNSLIYGG-------------AXHEgkrskelgipGIPNICESVQIARDVL  217
ident      ||||   |                                 |   |    ||   
Sbjct GVIVTAHCENAELVGRLqqkllsegktgpeWHEP----------SRPEAVEAEGTARFAT  225
DSSP  LLEEEEEELLHHHHHHHhhhhhhlllllhhHLLL----------LLLHHHHHHHHHHHHH


DSSP  HHHHHLLLEEELLLLLHHHHHHHHHHHHLLLLEEEEELHHHHHLLHHHL-LLLL--HHHL
Query LAEAAGCHYHVCHVSTKESVRVIRDAKRAGIHVTAEVTPHHLLLTEDDI-PGNN--AIYK  274
ident   |  |    | | | |        ||  |     |    | ||       |      | 
Sbjct FLETTGATGYVVHLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAeRGGVeaMKYI  285
DSSP  HHHHHLLEEEELLLLLHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHhLLHHhhHLLL


DSSP  LLLLLLLHHHHHHHHHHHHLLLLLEELLLLLLLLHHHHLLL---LLLLLLLLLLLLLHHH
Query XNPPLRSTEDREALLEGLLDGTIDCIATDHAPHARDEKAQP---XEKAPFGIVGSETAFP  331
ident   ||||       |   |  | ||   ||| |     |          | ||   |    
Sbjct MSPPLRDKRNQKVLWDALAQGFIDTVGTDHCPFDTEQKLLGkeaFTAIPNGIPAIEDRVN  345
DSSP  LLLLLLLLHHHHHHHHHHHLLLLLEEELLLLLLLHHHHHHHlllHHHLLLLLLLLLLHHH


DSSP  HHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLLLEELLHH
Query LLYTHFVKNGDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDSEQEIKGE  389
ident ||||  |  |       ||    |    | |    ||      |||   |      |   
Sbjct LLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFprKGTIAVGSDADLVVYDPQYRGTISVK  405
DSSP  HHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLllLLLLLLLLLLLEEEEELLLLEELLHH


DSSP  HLLLLLLLLLLLLLEELLEEEEEEELLEEEEEL--------------------
Query DFLSKADNTPFIGYKVYGNPILTXVEGEVKFEG--------------------  422
ident       |   | |    | |    | | |                        
Sbjct TQHVNNDYNGFEGFEIDGRPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
DSSP  HLLLLLLLLLLLLLEELLEEEEEEELLEEEEELleelllllllllllllllll


No 4: Query=3griA Sbjct=4b3zD Z-score=40.4

back to top
DSSP  -LEEEELLEEEelLEEEELEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query -XKLIKNGKVLqnGELQQADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHV   59
ident    ||| |          ||       ||||        ||  | | |  | ||  ||  
Sbjct dRLLIKGGRIIndDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNT   60
DSSP  lEEEEEEEEEEllLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LLLlllLLLLLLHHHHHHHHHHLLEEEEEELLLLLlllLLHHHHHHHHHHHHHHLLLEEL
Query HLRepgGEYKETIETGTKAAARGGFTTVCPXPNTRpvpDSVEHFEALQKLIDDNAQVRVL  119
ident  |             || ||  || |                 ||      |        
Sbjct YLQ---KTAADDFFQGTRAALVGGTTMIIDHVVPEpgsSLLTSFEKWHEAADTKSCCDYS  117
DSSP  LLL---LLLLLLHHHHHHHHHHLLEEEEEEEELLLlllLHHHHHHHHHHHHHLLLLLEEE


DSSP  LLEELlhhHLLL--LLLLHHHHHL-LLLLLEEEL-----LLLLlLHHHHHHHHHHHHHHL
Query PYASIttrQLGK--ELVDFPALVK-EGAFAFTDD-----GVGVqTASXXYEGXIEAAKVN  171
ident     |                ||   |   |               |  ||         
Sbjct LHVDI---TSWYdgVREELEVLVQdKGVNSFQVYmaykdVYQM-SDSQLYEAFTFLKGLG  173
DSSP  EEEEL---LLLLllHHHHHHHHHHlLLLLEEEEElllllLLLL-LHHHHHHHHHHHHHHL


DSSP  LLEEELLLLHHHLLLL-------------LEELlhhhhhhlllEELLHHHHHHHHHHHHH
Query KAIVAHCEDNSLIYGG-------------AXHEgkrskelgipGIPNICESVQIARDVLL  218
ident   |  | |   ||                                |   |     |    
Sbjct AVILVHAENGDLIAQEqkrilemgitgpeGHAL----------SRPEELEAEAVFRAITI  223
DSSP  LEEEEELLLHHHHHHHhhhhhhllllllhHHHH----------HLLHHHHHHHHHHHHHH


DSSP  HHHHLLLEEELLLLLHHHHHHHHHHHHLLLLEEEEELHHHHHLLHHHLLL----lLHHHL
Query AEAAGCHYHVCHVSTKESVRVIRDAKRAGIHVTAEVTPHHLLLTEDDIPG----nNAIYK  274
ident |    |      |  |     |  |   |  |  |     |               |   
Sbjct AGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSknwakAAAFV  283
DSSP  HHHHLLLEEEEEELLHHHHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLllhhhHHHLL


DSSP  LLLLLL-LHHHHHHHHHHHHLLLLLEELLLLLLLLHHHHLLL---LLLLLLLLLLLLLHH
Query XNPPLR-STEDREALLEGLLDGTIDCIATDHAPHARDEKAQP---XEKAPFGIVGSETAF  330
ident   |||         |   |  |        | |     ||         | |  | |   
Sbjct TSPPLSpDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGkdnFTLIPEGVNGIEERM  343
DSSP  LLLLLLlLLLHHHHHHHHHHHLLLLLLLLLLLLLLHHHHHHHlllHHHLLLLLLLLLLHH


DSSP  HHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLLLEELLH
Query PLLYTHFVKNGDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDSEQEIKG  388
ident        |  |     | |          |||    |       ||  | | |    |  
Sbjct TVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYprKGRIAVGSDADVVIWDPDKLKTITA  403
DSSP  HHHHHHHLLLLLLLHHHHHHHHLHHHHHHHLLLllLLLLLLLLLLLEEEEEEEEEEELLL


DSSP  HHLLLLLLLLLLLLLEELLEEEEEEELLEEEEEL--------------------------
Query EDFLSKADNTPFIGYKVYGNPILTXVEGEVKFEG--------------------------  422
ident     |      | |    | |      |   ||                           
Sbjct KSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDgninvnkgmgrfiprkafpehlyqrv  463
DSSP  LLLLLLLLLLLLLLLEEEEEEEEEEELLEEEEELleellllllllllllllllhhhhhhh


DSSP  --------------
Query --------------  422
ident               
Sbjct kirnkvfglqgvsr  477
DSSP  hhhhhhllllllll


No 5: Query=3griA Sbjct=3pnuA Z-score=32.2

back to top
DSSP  leeeelleeeellEEEEleeeeelleeeeeellllllllleeeelLLLEEEELEEEEEEL
Query xklikngkvlqngELQQadilidgkvikqiapaiepsngvdiidaKGHFVSPGFVDVHVH   60
ident              |                                         | | |
Sbjct -------------ENLY--------------------------fqSNAMKLKNPLDMHLH   21
DSSP  -------------LLLL--------------------------llLLLEEEELLEEEEEL


DSSP  LLLLllllllLHHHHHHHHHHlLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHL---LLE
Query LREPggeykeTIETGTKAAARgGFTTVCPXPNTRPVPDSVEHFEALQKLIDDNA---QVR  117
ident ||          |      ||  |      ||  |     |   |    |          
Sbjct LRDN-----qMLELIAPLSAR-DFCAAVIMPNLIPPLCNLEDLKAYKMRILKACkdeNFT   75
DSSP  LLLH-----hHHHHHHHHHHL-LLLEEEELLLLLLLLLLHHHHHHHHHHHHHHHlllLLE


DSSP  ELLLEELLhhhlllLLLL--HHHHHLlLLLLEEELLL--------LLLLHH--HHHHHHH
Query VLPYASITtrqlgkELVD--FPALVKeGAFAFTDDGV--------GVQTAS--XXYEGXI  165
ident  |                           |               ||             
Sbjct PLMTLFFK------NYDEkfLYSAKD-EIFGIXLYPAgittnsngGVSSFDieYLKPTLE  128
DSSP  EEEEEELL------LLLHhhHHHHLL-LLLEEEELLLllllllllLLLLLLhhHHHHHHH


DSSP  HHHHHLLLEEELLLLHHhllllleellhhhhhhlllEELLhHHHHHHHHHHHHHHHHL-L
Query EAAKVNKAIVAHCEDNSliyggaxhegkrskelgipGIPNiCESVQIARDVLLAEAAG-C  224
ident      |     | | |                          ||        ||      
Sbjct AMSDLNIPLLVHGETND-------------------FVMD-RESNFAKIYEKLAKHFPrL  168
DSSP  HHHHLLLLEEELLLLLL-------------------LHHH-LLHHHHHHHHHHHHHLLlL


DSSP  LEEELLLLLHHHHHHHHHHhhllLLEEEEELHHHHHLLHHHL--LLLLHHHLLLLLLLLH
Query HYHVCHVSTKESVRVIRDAkragIHVTAEVTPHHLLLTEDDI--PGNNAIYKXNPPLRST  282
ident      |  ||       |         |  | |||  | ||      |      |     
Sbjct KIVMEHITTKTLCELLKDY----ENLYATITLHHLIITLDDVigGKMNPHLFCKPIAKRY  224
DSSP  LEEELLLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHhlLLLLHHHLLLLLLLLH


DSSP  HHHHHHHHHHHL-LLLLEELLLLLLLLHhhhlllllLLLLLLLLLLLHHHHHHHHHLllL
Query EDREALLEGLLD-GTIDCIATDHAPHARdekaqpxeKAPFGIVGSETAFPLLYTHFVknG  341
ident || ||| |             | |||              |        | |   |    
Sbjct EDKEALCELAFSgYEKVMFGSDSAPHPK--------GCAAGVFSAPVILPVLAELFK--Q  274
DSSP  HHHHHHHHHHHLlLLLEEELLLLLLLLL--------LLLLLLLLHHHHHHHHHHHHH--H


DSSP  LLLHHHHHHHHLHHHHHHLLLLLllllllLLLLEEEEELlLLEELLHHH--lllLLLLLl
Query DWTLQQLVDYLTIKPCETFNLEYgtlkenGYADLTIIDLdSEQEIKGED--flsKADNTp  399
ident       |   |    |    |                    |                  
Sbjct NSSEENLQKFLSDNTCKIYDLKF------KEDKILTLEE-KEWQVPNVYedkynQVVPY-  326
DSSP  HLLHHHHHHHHLHHHHHHHLLLL------LLLLEEEEEL-LLEELLLLEellllEELLL-


DSSP  LLLLEELLEEEEeeelleeeeel
Query FIGYKVYGNPILtxvegevkfeg  422
ident   |                    
Sbjct MAGEILKFQLKH-----------  338
DSSP  LLLLEELLEELL-----------


No 6: Query=3griA Sbjct=3giqA Z-score=30.5

back to top
DSSP  ---LEEEELLEEE--eLLEEEELEEEEELLEEEEEELLLLLLllLEEEELLLLEEEELEE
Query ---XKLIKNGKVL--qNGELQQADILIDGKVIKQIAPAIEPSngVDIIDAKGHFVSPGFV   55
ident       |  |            ||       |  |             || |  | ||| 
Sbjct eklDFKITGGWIIdgtGAPRRRADLGVRDGRIAAIGELGAHP-aRHAWDASGKIVAPGFI   59
DSSP  lleEEEEELLEELlllLLLLEELEEEEELLEEEEEELLLLLL-eEEEEELLLLEEEELEE


DSSP  EEEELLLLlllllllLHHHhHHHHHHLLEEEEEELLllllLLLL----------------
Query DVHVHLREpggeykeTIETgTKAAARGGFTTVCPXPntrpVPDS----------------   99
ident ||| |                      | |||                            
Sbjct DVHGHDDL----mfvEKPD-LRWKTSQGITTVVVGNcgvsAAPAplpgntaaalallget  114
DSSP  ELLLLLLL----hhhHLLL-LHHHHLLLEEEEEELLllllLLLLlllllllhhhhhhlll


DSSP  --hHHHHHHHHHHH-HHLLLEELLLEELLHHHL---------------llLLLLHHHHHL
Query --vEHFEALQKLID-DNAQVRVLPYASITTRQL---------------gkELVDFPALVK  141
ident        |     |       |          |                       |   
Sbjct plfADVPAYFAALDaQRPMINVAALVGHANLRLaamrdpqaaptaaeqqaMQDMLQAALE  174
DSSP  lllLLHHHHHHHHHhLLLLLEEEEEEEHHHHHHhhlllllllllhhhhhhHHHHHHHHHH


DSSP  LLLLLEEEL--LLLL--LLHHHHHHHHHHHHHHLLLEEELLLLhhhllllleellhhhhh
Query EGAFAFTDD--GVGV--QTASXXYEGXIEAAKVNKAIVAHCEDnsliyggaxhegkrske  197
ident  ||  |             |         ||        |                    
Sbjct AGAVGFSTGlaYQPGavAQAAELEGLARVAAERRRLHTSHIRN-----------------  217
DSSP  HLLLEEEEEllLLLHhhLLHHHHHHHHHHHHHLLLEEEEELLL-----------------


DSSP  hllleelLHHHHHHHHHHHHHHHHHLLLEEELLLLL---------HHHHHHHHHHHHLLL
Query lgipgipNICESVQIARDVLLAEAAGCHYHVCHVST---------KESVRVIRDAKRAGI  248
ident                          ||   | |                  |  |   | 
Sbjct ------eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDRAREQGV  271
DSSP  ------lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHHHHHLLL


DSSP  LEEEEELHHH-----hhllhhhlLLLLH--------------------------------
Query HVTAEVTPHH-----lllteddiPGNNA--------------------------------  271
ident  |     |                                                    
Sbjct EVALDIYPYPgsstiliperaetIDDIRitwstphpecsgeyladiaarwgcdkttaarr  331
DSSP  LEEEEELLLLeeeeellhhhlllLLLLEeeeelllhhhllllhhhhhhhhlllhhhhhhh


DSSP  ----HHLLllLLLLhhhHHHHHHHHHLLlLLEELLLLLLLLHhhhlllllllllLLLLLL
Query ----IYKXnpPLRStedREALLEGLLDGtIDCIATDHAPHARdekaqpxekapfGIVGSE  327
ident                                    |  |                     
Sbjct lapaGAIY--FAMD---EDEVKRIFQHP-CCMVGSDGLPNDA-----------rPHPRLW  374
DSSP  hlleEEEE--ELLL---HHHHHHHHHLL-LEEELLLLLLLLL-----------lLLLHHH


DSSP  LHHHHHHHHHLLLLL-LLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLEEEEELLL---
Query TAFPLLYTHFVKNGD-WTLQQLVDYLTIKPCETFNLE-YGTLKENGYADLTIIDLDS---  382
ident   |       |      || | |   |  |   |     | |     ||    | |    
Sbjct GSFTRVLGRYVREARlMTLEQAVARMTALPARVFGFAeRGVLQPGAWADVVVFDPDTvad  434
DSSP  HHHHHHHHHHHHHLLlLLHHHHHHHHLHHHHHHHLLLlLLLLLLLLLLLEEEELLLLlll


DSSP  -leelLHHHLlllllllllllleelLEEEEEEELLEEEEEL--------------
Query -eqeiKGEDFlskadntpfigykvyGNPILTXVEGEVKFEG--------------  422
ident                                 | |   |                
Sbjct ratwdEPTLA--------------sVGIAGVLVNGAEVFPQppadgrpgqvlrax  475
DSSP  lllllLLLLL--------------lLLEEEEEELLEEEELLllllllllllllll


No 7: Query=3griA Sbjct=1onxA Z-score=28.1

back to top
DSSP  --------LEEEELLEEEELLEEEELEEEEELLEEEEEELLLLL--LLLLEEEELLLLEE
Query --------XKLIKNGKVLQNGELQQADILIDGKVIKQIAPAIEP--SNGVDIIDAKGHFV   50
ident           |               | |     |   |  |           |  |   
Sbjct midytaagFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSdiVPNCTVVDLSGQIL   60
DSSP  llllhhhlLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLllLLLLEEEELLLLEE


DSSP  EELEEEEEELLLL-----llllLLLLHhhHHHHHHHLLEEEEEELLL---lLLLLllhhh
Query SPGFVDVHVHLRE-----pggeYKETIetGTKAAARGGFTTVCPXPN---tRPVPdsveh  102
ident  ||| | ||||                          | | |            |     
Sbjct CPGFIDQHVHLIGgggeagpttRTPEV--ALSRLTEAGVTSVVGLLGtdsiSRHP-----  113
DSSP  EELEEEEEELLLLllllllhhhLLLLL--LHHHHHHLLEEEEEELLLllllLLLH-----


DSSP  hHHHHHHHHHHL--LLEELLLEEllhhHLLLLLL---LHHHHH--LLLLLLEEEL----L
Query fEALQKLIDDNA--QVRVLPYASittrQLGKELV---DFPALV--KEGAFAFTDD----G  151
ident  | |                                      |                 
Sbjct -ESLLAKTRALNeeGISAWMLTG---aYHVPSRTitgSVEKDVaiIDRVIGVXCAisdhR  169
DSSP  -HHHHHHHHHHHhhLLEEEEEEE---lLLLLLLLlllLHHHHHhhLLLEEEEEEEelllL


DSSP  LLLLLHHHHHHHHHHHHHHL------LLEEELLLlhhhllllleellhhhhhhllleelL
Query VGVQTASXXYEGXIEAAKVN------KAIVAHCEdnsliyggaxhegkrskelgipgipN  205
ident               |              | |                            
Sbjct SAAPDVYHLANMAAESRVGGllggkpGVTVFHMG-------------------------D  204
DSSP  LLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEEL-------------------------L


DSSP  HHHHhhHHHHHHHHH-HHLL--LEEELLL-LLHHHHHHHHHHHHLLllEEEEELHHHHhl
Query ICESvqIARDVLLAE-AAGC--HYHVCHV-STKESVRVIRDAKRAGihVTAEVTPHHLll  261
ident             | |            ||              | |   |   |      
Sbjct SKKA--LQPIYDLLEnCDVPisKLLPTHVnRNVPLFEQALEFARKG--GTIDITSSID--  258
DSSP  LLLL--LHHHHHHHHlLLLLhhHEEEELHhHLHHHHHHHHHHHHLL--LLEEEELLLL--


DSSP  lhhhlllllhhhllllllllhhhHHHHH-HHHHLL-------llLEELLLLLLLlhhhhl
Query teddipgnnaiykxnpplrstedREALL-EGLLDG-------tiDCIATDHAPHardeka  313
ident                              ||                  |          
Sbjct -----------------------EPVAPaEGIARAvqagiplarVTLSSDGNGSqpffdd  295
DSSP  -----------------------LLLLHhHHHHHHhhllllhhhEEEELLLLLEeeeell


DSSP  llLLLLLLLLLLlLLHHhHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLL
Query qpXEKAPFGIVGsETAFpLLYTHFVKNGDWTLQQLVDYLTIKPCETFNLE-YGTLKENGY  372
ident              ||         ||  |         ||       ||   |       
Sbjct egNLTHIGVAGF-ETLL-ETVQVLVKDYDFSISDALRPLTSSVAGFLNLTgKGEILPGND  353
DSSP  llLEEEEEELLL-HHHH-HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLL


DSSP  LLEEEEELLlleellhhhllllllllllllleelLEEEEEEELLEEEEEL----------
Query ADLTIIDLDseqeikgedflskadntpfigykvyGNPILTXVEGEVKFEG----------  422
ident |||                                        |                
Sbjct ADLLVMTPE-------------------------LRIEQVYARGKLMVKDgkacvkgtfe  388
DSSP  LLEEEELLL-------------------------LLEEEEEELLEEEEELleelllllll


DSSP  --
Query --  422
ident   
Sbjct td  390
DSSP  ll


No 8: Query=3griA Sbjct=2vunA Z-score=27.4

back to top
DSSP  -LEEEEL-LEEE----eLLEEEELEEEEELLEEEEEEL-LLLL-LLLLEEEELLLLEEEE
Query -XKLIKN-GKVL----qNGELQQADILIDGKVIKQIAP-AIEP-SNGVDIIDAKGHFVSP   52
ident     ||| ||          ||   |      |  |             |||| |  | |
Sbjct sKTIIKNiGKIVsgdikSPVLQADTIVVEDGLIAAIGGeELMKdAGDATIIDAAGSTVTP   60
DSSP  lEEEEELlLEEElllllLLEELLLEEEEELLEEEEEELhHHHLlLLLLEEEELLLLEEEE


DSSP  LEEEEEELLLL---lLLLLLLlhhHHHHHHHHLLEEEEEE-LLLLLL------llLLHHH
Query GFVDVHVHLRE---pGGEYKEtieTGTKAAARGGFTTVCP-XPNTRP------vpDSVEH  102
ident |  | |||                     |  || ||         |             
Sbjct GLLDTHVHVSGgdyaPRQKTM---DFISSALHGGVTTMISaGSPHFPgrpkdaagTKALA  117
DSSP  LEEEEEELLLLlleeHHHLEE---LHHHHHHLLLEEEEEElLLLLLLlllllhhhHHHHH


DSSP  HHHHHHHHHHHL-LLEELL-LEELLhhhllLLLL--LHHHHHLLLLLLEE-ELLLLLLLH
Query FEALQKLIDDNA-QVRVLP-YASITtrqlgKELV--DFPALVKEGAFAFT-DDGVGVQTA  157
ident               | |             | |   ||    |||               
Sbjct ITLSKSYYNARPaGVKVHGgAVILE-----KGLTeeDFIEMKKEGVWIVGeVGLGTIKNP  172
DSSP  HHHHHHHHHLLHhHLEEELlEELLL-----LLLLhhHHHHHHHLLLLEEEeELLLLLLLH


DSSP  HHHHHHHHHHHHHLLLEEELL--LLHHHLlllleellhhhhhhllleellHHHHhhHHHH
Query SXXYEGXIEAAKVNKAIVAHC--EDNSLIyggaxhegkrskelgipgipnICESvqIARD  215
ident          | |       |                                        
Sbjct EDAAPMVEWAHKHGFKVQMHTggTSIPGS---------------------STVT--ADDV  209
DSSP  HHHHHHHHHHHHLLLEEEEELllLLLLLL---------------------LLLL--HHHH


DSSP  HHHHhhhllLEEELLL-----LLHH-HHHHHHHHHhlllLEEEEELHHHHHllhhhllll
Query VLLAeaagcHYHVCHV-----STKE-SVRVIRDAKragiHVTAEVTPHHLLlteddipgn  269
ident             | |            |  | |          |                
Sbjct IKTK-----PDVVSHInggptAISVqEVDRIMDET----DFAMEIVQCGNP---------  251
DSSP  HHHL-----LLEEELLlllllLLLHhHHHHHHHHL----LLEEEEELLLLH---------


DSSP  lhhhllllllllhhhhHHHHHHHHLL------lLLEELLLLLLllhhhhllllllllLLL
Query naiykxnpplrstedrEALLEGLLDG------tIDCIATDHAPhardekaqpxekapFGI  323
ident                                        |                    
Sbjct ----------------KIADYVARRAaekgqlgRVIFGNDAPS--------------GTG  281
DSSP  ----------------HHHHHHHHHHhhhllhhHEEEELLLLL--------------LLL


DSSP  LLLLLHHhHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLEEEEElLLL
Query VGSETAFpLLYTHFVKNGDWTLQQLVDYLTIKPCETFNLEYGTLKENGYADLTIIDlDSE  383
ident                   |      |   |        |  |       ||| | |    
Sbjct LIPLGIL-RNMCQIASMSDIDPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMD-TPL  339
DSSP  LLLLHHH-HHHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEE-LLL


DSSP  EEllhhhllllllllllllleELLEEEEEEELLEEEEEL--------------
Query QEikgedflskadntpfigykVYGNPILTXVEGEVKFEG--------------  422
ident                                 ||                   
Sbjct GS-------vaedamgaiaagDIPGISVVLIDGEAVVTKsrntppakraakil  385
DSSP  LL-------llllhhhhhhhlLLLEEEEEEELLEEEELLllllllllllleel


No 9: Query=3griA Sbjct=3nqbA Z-score=26.8

back to top
DSSP  ------------------------LEEEELLEEEE--LLEEEELEEEEELLEEEEEELL-
Query ------------------------XKLIKNGKVLQ--NGELQQADILIDGKVIKQIAPA-   33
ident                           ||  |       |||  ||| | |  |       
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDvvTGELRPADIGIVGALIASVHEPa   60
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELllLLLEEELEEEEELLEEEEEELLl


DSSP  LLLLllLEEEELLLLEEEELEEEEEELLLllllllLLLHHHHHHHHHHLLEEEEEELLLL
Query IEPSngVDIIDAKGHFVSPGFVDVHVHLRepggeyKETIETGTKAAARGGFTTVCPXPNT   93
ident          ||| |  ||||  | | |          |      |    | ||    |  
Sbjct SRRD-aAQVIDAGGAYVSPGLIDTHXHIE----ssXITPAAYAAAVVARGVTTIVWDPHE  115
DSSP  LLLL-eEEEEELLLLEEEELEEEEEELHH----hhLLLHHHHHHHHHLLLEEEEEELLHH


DSSP  LLLllLHHHHHHHHHHHHhHLLLEELLLEELLHHHL--------llLLLLHHHHHLL-LL
Query RPVpdSVEHFEALQKLIDdNAQVRVLPYASITTRQL--------gkELVDFPALVKE-GA  144
ident       |       | |  |   |    |                        |      
Sbjct FGNvhGVDGVRWAAKAIE-NLPLRAILLAPSCVPSApglerggadfDAAILADLLSWpEI  174
DSSP  HHHhhLHHHHHHHHHHHL-LLLLEEEEEELLLLLLLllllllllllLHHHHHHHHLLlLE


DSSP  LLEEELLlLLLLH----HHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhll
Query FAFTDDGvGVQTA----SXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgi  200
ident                    |           |    |                       
Sbjct GGIAEIX-NXRGVierdPRXSGIVQAGLAAEKLVCGHAR---------------------  212
DSSP  EEEEEEL-LHHHHhlllHHHHHHHHHHHHHLLEEEELLL---------------------


DSSP  leellhHHHH-HHHHHHHHHhhhllLEEELLLLLHHHHHHHHHHHhllllEEEEELHHHH
Query pgipniCESV-QIARDVLLAeaagcHYHVCHVSTKESVRVIRDAKragihVTAEVTPHHL  259
ident                                    |       |       | |    | 
Sbjct ------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-----LTIELRGSHD  256
DSSP  ------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-----LEEEEELLLH


DSSP  HLlhhhlllllhhhllllllllhhhHHHHHHHH----HLLLLLEELLLLLLLLhhhhlll
Query LLteddipgnnaiykxnpplrstedREALLEGL----LDGTIDCIATDHAPHArdekaqp  315
ident  |                              |             ||            
Sbjct HL-----------------------LPEFVAALntlgHLPQTVTLCTDDVFPD-------  286
DSSP  HH-----------------------HHHHHHHHhhhlLLLLLEEEELLLLLHH-------


DSSP  lllllllLLLL-LLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLL
Query xekapfgIVGS-ETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLE-YGTLKENGYA  373
ident          |        |                   |            |       |
Sbjct ----dllQGGGlDDVVRRLVRYG-----LKPEWALRAATLNAAQRLGRSdLGLIAAGRRA  337
DSSP  ----hhhHLLLhHHHHHHHHHLL-----LLHHHHHHHHLHHHHHHHLLLlLLLLLLLLLL


DSSP  LEEEEELllleellhhhllllllllllllleELLEEEEEEELLEEEEEL-----------
Query DLTIIDLdseqeikgedflskadntpfigykVYGNPILTXVEGEVKFEG-----------  422
ident |                                         |    ||           
Sbjct DIVVFED-----------------------lNGFSARHVLASGRAVAEGgrxlvdiptcd  374
DSSP  LEEEELL-----------------------lLLLLEEEEEELLEEEEELleellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  422
ident                                                             
Sbjct ttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatx  434
DSSP  lhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  422
ident                                                             
Sbjct isvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigt  494
DSSP  eeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  422
ident                                                             
Sbjct gggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacf  554
DSSP  lleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhh


DSSP  ---------------------------------
Query ---------------------------------  422
ident                                  
Sbjct gatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllllllleelllleeelllleeellleeel


No 10: Query=3griA Sbjct=4cqbA Z-score=26.2

back to top
DSSP  ----LEEEELLEEEEllEEEELEEEEELLEEEEEELLLLLLlLLEEEELLLLEEEELEEE
Query ----XKLIKNGKVLQngELQQADILIDGKVIKQIAPAIEPSnGVDIIDAKGHFVSPGFVD   56
ident        | |            || | |  |  |   ||     | |||||  |||||||
Sbjct skdfDLIIRNAYLSE--KDSVYDIGIVGDRIIKIEAKIEGT-VKDEIDAKGNLVSPGFVD   57
DSSP  llleEEEEEEEEELL--LLEEEEEEEELLEEEEEELLLLLL-EEEEEELLLLLEEELEEE


DSSP  EEELLLLllLLLL----------------------------------lLHHHHHHHHHHL
Query VHVHLREpgGEYK----------------------------------eTIETGTKAAARG   82
ident  | |                                                        
Sbjct AHTHMDK-sFTSTgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLH  116
DSSP  EEELHHH-lLLLLlllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHL


DSSP  LEEEEEELLllllLLLL---HHHHHHHHHHHHHHL-LLEELLLEELlhHHLLLL----LL
Query GFTTVCPXPntrpVPDS---VEHFEALQKLIDDNA-QVRVLPYASIttRQLGKE----LV  134
ident |              ||       ||                 |                
Sbjct GTLYTRTHV----DVDSvakTKAVEAVLEAKEELKdLIDIQVVAFA--QSGFFVdlesES  170
DSSP  LEEEEEEEE----ELLLlllLHHHHHHHHHHHHLLlLLEEEEEEEL--LLLLLLlllhHH


DSSP  LHHHHHLLLLLLEEEL---lLLLLLHHHHHHHHHHHHHHLLLEEELLLLhhhllllleel
Query DFPALVKEGAFAFTDD---gVGVQTASXXYEGXIEAAKVNKAIVAHCEDnsliyggaxhe  191
ident         |                          |      |  |  |           
Sbjct LIRKSLDMGCDLVGGVdpatRENNVEGSLDLCFKLAKEYDVDIDYHIHD-----------  219
DSSP  HHHHHHHHLLLEEELLllllLLLLHHHHHHHHHHHHHHLLLEEEEEELL-----------


DSSP  lhhhhhhllleelLHHHHHHHHHHHHHHHHHLL--LEEELLLLLH-----hhHHHHHHHH
Query gkrskelgipgipNICESVQIARDVLLAEAAGC--HYHVCHVSTK-----esVRVIRDAK  244
ident                     | |        |        |                   
Sbjct ------------iGTVGVYSINRLAQKTIENGYkgRVTTSHAWCFadapsewLDEAIPLY  267
DSSP  ------------lHHHHHHHHHHHHHHHHHLLLllLEEEEELLHHhhllhhhHHHHHHHH


DSSP  HlLLLEEEEELHHHHHLlhhhlllllhhhllllllllhhhHHHHHHHHHLLLLLEELLLL
Query RaGIHVTAEVTPHHLLLteddipgnnaiykxnpplrstedREALLEGLLDGTIDCIATDH  304
ident                                                |  |     | | 
Sbjct K-DSGMKFVTCFSSTPP-----------------------TMPVIKLLEAGINLGCASDN  303
DSSP  H-HHLLEEEEELLLLLL-----------------------LLLHHHHHHLLLEEEEELLL


DSSP  LLLlhhhhlllllllLLLL-LLLLlHHHHHHHHH---llLLLLLHHHHHHHHLHHHHHHL
Query APHardekaqpxekaPFGI-VGSEtAFPLLYTHF---vkNGDWTLQQLVDYLTIKPCETF  360
ident                                             |       |       
Sbjct IRD------------FWVPfGNGD-MVQGALIETqrlelKTNRDLGLIWKMITSEGARVL  350
DSSP  LLL------------LLLLlLLLL-HHHHHHHHHhhhllLLHHHHHHHHHHHLHHHHHHH


DSSP  LLL-LLLLLLLLLLLEEEEELLlleellhhhlllllllllllllEELLEEEEEEELLEEE
Query NLE-YGTLKENGYADLTIIDLDseqeikgedflskadntpfigyKVYGNPILTXVEGEVK  419
ident   |          |||                                        |   
Sbjct GIEkNYGIEVGKKADLVVLNSL----------------spqwaiIDQAKRLCVIKNGRII  394
DSSP  LLHhHLLLLLLLLLLEEEELLL----------------lhhhhhHHLLLEEEEEELLEEE


DSSP  EEL-----
Query FEG-----  422
ident         
Sbjct VKDeviva  402
DSSP  EELleell


No 11: Query=3griA Sbjct=1yrrB Z-score=25.9

back to top
DSSP  lEEEELLEEEELLEEEE-LEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query xKLIKNGKVLQNGELQQ-ADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHV   59
ident       |      |        |    ||   |  |           |   |||| ||  
Sbjct -YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL   59
DSSP  -LEEELLEEELLLLEELlEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEEE


DSSP  LL----LLLLLLLL---lLHHHHHHHHHHLLEEEEEELLLLlllllLHHHHHHHHHHHHH
Query HL----REPGGEYK---eTIETGTKAAARGGFTTVCPXPNTrpvpdSVEHFEALQKLIDD  112
ident                   | |   ||    | |   |   |                   
Sbjct NGcggvQFNDTAEAvsveTLEIMQKANEKSGCTNYLPTLITtsdelMKQGVRVMREYLAK  119
DSSP  LEelleELLLLLLLllhhHHHHHHHHHHLLLEEEEEEEELLllhhhHHHHHHHHHHHHHH


DSSP  HllLEEL-LLEEllhHHLL-LLLL-LHHHHHlLLLLLEEElllllLLHHhhHHHHHHHHH
Query NaqVRVL-PYASittRQLG-KELV-DFPALVkEGAFAFTDdgvgvQTASxxYEGXIEAAK  169
ident       |               ||              |             |     | 
Sbjct H-pNQALgLHLE---GPWLnAALVdFLCENA-DVITKVTL---apEMVP--AEVISKLAN  169
DSSP  L-lLLLLlEEEE---LLLLlLHHHhHHHHLH-HHEEEEEE---lhHHLL--HHHHHHHHH


DSSP  HLLLEEELLLlhhhllllleellhhhhhhllleellhhhhHHHH-HHHHHHHhhLLLEEE
Query VNKAIVAHCEdnsliyggaxhegkrskelgipgipnicesVQIA-RDVLLAEaaGCHYHV  228
ident       |                                                     
Sbjct AGIVVSAGHS------------------------------NATLkEAKAGFR--AGITFA  197
DSSP  HLLEEEELLL------------------------------LLLHhHHHHHHH--HLEEEE


DSSP  LLLL---------lhHHHHHHHHHHhlllLEEEEELHH--HHHLlhhhlllllhhhllll
Query CHVS---------tkESVRVIRDAKragiHVTAEVTPH--HLLLteddipgnnaiykxnp  277
ident  |                  | |                 |                   
Sbjct THLYnampyitgrepGLAGAILDEA----DIYCGIIADglHVDY----------------  237
DSSP  LLLLlllllllllllHHHHHHHHLL----LLEEEEELLllLLLH----------------


DSSP  llllhhhhHHHHHHHHLLL-LLEELLLLLlllhhhhllllllllLLLLLL-LLHHHHHHH
Query plrstedrEALLEGLLDGT-IDCIATDHAphardekaqpxekapFGIVGS-ETAFPLLYT  335
ident                       |  ||                  |           |  
Sbjct --------ANIRNAKRLKGdKLCLVTDAT---------------SGSSLTmIEGVRNLVE  274
DSSP  --------HHHHHHHHHHHhHEEEELLLL---------------LLLLLLhHHHHHHHHH


DSSP  HHllllLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELllleellhhhlll
Query HFvkngDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLdseqeikgedfls  393
ident |        |       |  |      |   |||     | ||                 
Sbjct HC----GIALDEVLRMATLYPARAIGVEkrLGTLAAGKVANLTAFTP-------------  317
DSSP  HH----LLLHHHHHHHHLHHHHHHLLLLllLLLLLLLLLLLEEEELL-------------


DSSP  lllllllllleeLLEEEEEEELLEEEEEL
Query kadntpfigykvYGNPILTXVEGEVKFEG  422
ident                   | | |      
Sbjct ------------DFKITKTIVNGNEVVTQ  334
DSSP  ------------LLLEEEEEELLEEEEEL


No 12: Query=3griA Sbjct=2ogjA Z-score=25.9

back to top
DSSP  --LEEEELLEEE--ELLE-EEELEEEEE-LLEEEEEELLLLLLlLLEEEELLlLEEEELE
Query --XKLIKNGKVL--QNGE-LQQADILID-GKVIKQIAPAIEPSnGVDIIDAKgHFVSPGF   54
ident     |  | |      |      ||||     |     |               | ||| 
Sbjct qaPILLTNVKPVgfGKGAsQSSTDILIGgDGKIAAVGSALQAP-ADTQRIDA-AFISPGW   58
DSSP  llLEEEEEEEELllLLLLlLLLEEEEELlLLLEEEEELLLLLL-LLEEELLL-LEEEELE


DSSP  EEEEELLLLLLLLlLLLHhhHHHHHHHLLEEEEEELLLlllLLLLhhHHHHHHH-HHHHh
Query VDVHVHLREPGGEyKETIetGTKAAARGGFTTVCPXPNtrpVPDSveHFEALQK-LIDDn  113
ident || |||    |              |  | ||                |       |   
Sbjct VDLHVHIWHGGTD-ISIR--PSECGAERGVTTLVDAGS---AGEA--NFHGFREyIIEP-  109
DSSP  EEEEELLLLLLLL-LLLL--HHHLLHHHLEEEEEEELL---LLLL--LHHHHHHhLLLL-


DSSP  LLLEELLLEELLHH---------HLLL--LLLL--HHHHHLLL---LLLEEEL--lLLLL
Query AQVRVLPYASITTR---------QLGK--ELVD--FPALVKEG---AFAFTDD--gVGVQ  155
ident    |                    |                |              |   
Sbjct SRERIKAFLNLGSIglvacnrvpELRDikDIDLdrILECYAENsehIVGLXVRashVITG  169
DSSP  LLLEEEEEEELLLLlllllllllLLLLhhHLLHhhHHHHHHLLlllEEEEEEEelhHHHL


DSSP  --LHHHHHHHHHHHHHHLLLEEELLLLHhhllllleellhhhhhhllleellhhhhhHHH
Query --TASXXYEGXIEAAKVNKAIVAHCEDNsliyggaxhegkrskelgipgipnicesvQIA  213
ident          |   |         |                                    
Sbjct swGVTPVKLGKKIAKILKVPXXVHVGEP---------------------------paLYD  202
DSSP  llLLHHHHHHHHHHHHHLLLEEEEELLL---------------------------llLHH


DSSP  HHHHHHHhhllLEEELLL-------LLHH---HHHHHHHHHhlllLEEEEELHhhhhllh
Query RDVLLAEaagcHYHVCHV-------STKE---SVRVIRDAKragiHVTAEVTPhhlllte  263
ident               | |        |  |                               
Sbjct EVLEILG---pGDVVTHCfngksgsSIXEdedLFNLAERCE----GIRLDIGH-------  248
DSSP  HHHHHLL---lLLEEELLlllllllLLLLlhhHHHHHHHLL----LLEEELLL-------


DSSP  hhlllllhhhlLLLLLLLhhhHHHH-HHHHhlllLLEELLLLLLllhhhhllllllllLL
Query ddipgnnaiykXNPPLRStedREAL-LEGLldgtIDCIATDHAPhardekaqpxekapFG  322
ident                        |     |       | ||                   
Sbjct ----------gGASFSFK-vaEAAIaRGLL----PFSISTDLHG--------------HS  279
DSSP  ----------lLLLLLHH-hhHHHHhLLLL----LLLLLLLLLL--------------LL


DSSP  LL----LLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLL-lLLLLLLLLLEEE
Query IV----GSETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLEY-gTLKENGYADLTI  377
ident          |    |               |   |  |     |     |     || | 
Sbjct XNfpvwDLATTXSKLLSVD-----XPFENVVEAVTRNPASVIRLDXenRLDVGQRADFTV  334
DSSP  LLllllLHHHHHHHHHHLL-----LLHHHHHHLLLHHHHHHLLLLLllLLLLLLLLEEEE


DSSP  EELlLLEELlhhhlllllllllllLLEELLEEEEEEELLEEEEEL------
Query IDLdSEQEIkgedflskadntpfiGYKVYGNPILTXVEGEVKFEG------  422
ident  ||                       |    |       |           
Sbjct FDL-VDADL-----eatdsngdvsRLKRLFEPRYAVIGAEAIAASryipra  379
DSSP  EEE-EEEEE-----eeellllleeEEEEEEEEEEEEELLEEEELLllllll


No 13: Query=3griA Sbjct=3mtwA Z-score=25.2

back to top
DSSP  --LEEEELLEEEE--LLEEEE-LEEEEELLEEEEEELL-LLLLLLLEEEELLLLEEEELE
Query --XKLIKNGKVLQ--NGELQQ-ADILIDGKVIKQIAPA-IEPSNGVDIIDAKGHFVSPGF   54
ident    |       |    |              |  |         |    |  |    || 
Sbjct aeIKAVSAARLLDvaSGKYVDnPLVIVTDGRITSIGKKgDAVPAGATAVDLPGVTLLPGL   60
DSSP  llEEEEEEEEEEEllLLEEEElEEEEEELLEEEEEEELlLLLLLLLEEEEEEEEEEEELE


DSSP  EEEEELLLL--------------lLLLLllLHHHHHHHHHHLLEEEEEELLLLLlllllh
Query VDVHVHLRE--------------pGGEYkeTIETGTKAAARGGFTTVCPXPNTRpvpdsv  100
ident  | ||||                             |     |||||             
Sbjct IDMHVHLDSlaevggynsleysdrFWSV--VQTANAKKTLEAGFTTVRNVGAAD------  112
DSSP  EEEEELLLLlllllhhhhhhllhhHHHH--HHHHHHHHHHHLLEEEEEELLLLL------


DSSP  hhhHHHHHHHHHH-----LLLEELLL-EELL------------------HHHLLL---LL
Query ehfEALQKLIDDN-----AQVRVLPY-ASIT------------------TRQLGK---EL  133
ident         |            |      |                             | 
Sbjct ---YDDVGLREAIdagyvPGPRIVTAaISFGatgghcdstffppsmdqkNPFNSDspdEA  169
DSSP  ---LHHHHHHHHHhllllLLLEEEELlLLEEllllllllllllhhhlllLLLLLLlhhHH


DSSP  LL-HHHHHLLLLLLEEEL------------llllLLHHHHHHHHHHHHHHLLLEEELLLl
Query VD-FPALVKEGAFAFTDD------------gvgvQTASXXYEGXIEAAKVNKAIVAHCEd  180
ident       | | ||                       |         ||        ||   
Sbjct RKaVRTLKKYGAQVIXICatggvfsrgnepgqqqLTYEEMKAVVDEAHMAGIKVAAHAH-  228
DSSP  HHhHHHHHHLLLLEEEEEllllllllllllllllLLHHHHHHHHHHHHHLLLEEEEEEL-


DSSP  hhhllllleellhhhhhhllleellhhHHHHHHHHHHHHhhhllLEEELLLLLhhHHHHH
Query nsliyggaxhegkrskelgipgipnicESVQIARDVLLAeaagcHYHVCHVSTkeSVRVI  240
ident                                |   |             | |        
Sbjct ---------------------------GASGIREAVRAG-----VDTIEHASL--VDDEG  254
DSSP  ---------------------------LHHHHHHHHHLL-----LLEEEELLL--LLHHH


DSSP  HHHHHlLLLEEEEELhhHHHL--lHHHLL----LLLHHHLLllLLLLhhHHHHHHHHHHL
Query RDAKRaGIHVTAEVTphHLLL--tEDDIP----GNNAIYKXnpPLRSteDREALLEGLLD  294
ident                                        |          ||     |  
Sbjct IKLAV-QKGAYFSMD--IYNTdytQAEGKkngvLEDNLRKDrdIGEL--QRENFRKALKA  309
DSSP  HHHHH-HHLLEEELL--LLLHhhhHHHHHhhllLHHHHHHHhhHHHH--HHHHHHHHHHH


DSSP  LLLLEELLLLLlllhhhhlllllllllLLLLlLLHHhHHHHHHLlllLLLHHHHHHHHLH
Query GTIDCIATDHAphardekaqpxekapfGIVGsETAFpLLYTHFVkngDWTLQQLVDYLTI  354
ident |      ||                                  |     |  |     | 
Sbjct GVKMVYGTDAG----------------IYPH-GDNA-KQFAVMV-ryGATPLQAIQSATL  350
DSSP  LLEEELLLLLL----------------LLLL-LLHH-HHHHHHH-hlLLLHHHHHHHLLH


DSSP  HHHHHLLLL--LLLLLLLLLLLEEEEELLlleellhhhllllllllllllleELLE--EE
Query KPCETFNLE--YGTLKENGYADLTIIDLDseqeikgedflskadntpfigykVYGN--PI  410
ident    |        |      | |      |                       |     | 
Sbjct TAAEALGRSkdVGQVAVGRYGDMIAVAGD-------------------pladVTTLekPV  391
DSSP  HHHHHHLLLllLLLLLLLLLLLEEEELLL-------------------llllHHHHhlLL


DSSP  EEEELLEEEEEL-
Query LTXVEGEVKFEG-  422
ident      | |     
Sbjct FVMKGGAVVKAPx  404
DSSP  EEEELLEEEELLl


No 14: Query=3griA Sbjct=2pajA Z-score=25.2

back to top
DSSP  -LEEEELL-EEEE--------LLEEEELEEEEELLEEEEEElLLLLLLLLEEEELLLLEE
Query -XKLIKNG-KVLQ--------NGELQQADILIDGKVIKQIApAIEPSNGVDIIDAKGHFV   50
ident    || |                     || | |  |  |  |  |  |  | ||     
Sbjct pSTLIRNAaAIMTggrgtaddPSRVPGPDIRIVGDTIDAIG-ALAPRPGETIVDATDCVI   59
DSSP  lEEEEELLlEELLllllllllLLLLLLLLEEEELLEEEEEL-LLLLLLLLEEEELLLLEE


DSSP  EELEEEEEELLL--------------llLLLLllLHHHHHHHHHHLLEEEEEELLLLLLl
Query SPGFVDVHVHLR--------------epGGEYkeTIETGTKAAARGGFTTVCPXPNTRPv   96
ident  |  |  | ||                           |    || |  ||         
Sbjct YPAWVNTHHHLFqsllkgepfralfderRFRL--AARIGLIELARSGCATVADHNYVYYp  117
DSSP  EELEELLLLLHHhhhllllllhhhllhhHHHH--HHHHHHHHHHLLLEEEEEELLLLLLl


DSSP  lllhHHHHHHHHHHHhHLLLEELLLEEllhhHLLL------------------LLLL-HH
Query pdsvEHFEALQKLIDdNAQVRVLPYASittrQLGK------------------ELVD-FP  137
ident          |          |                                  |    
Sbjct gmpfDSSAILFEEAE-KLGLRFVLLRG----GATQtrqleadlptalrpetldAYVAdIE  172
DSSP  llllLHHHHHHHHHH-HLLLEEEEEEL----LLLLlllllllllhhhllllhhHHHHhHH


DSSP  HHHLLLL---------LLEEELL--LLLLlHHHHHHHHHHHHHHLLLEEELLLlhhhlll
Query ALVKEGA---------FAFTDDG--VGVQtASXXYEGXIEAAKVNKAIVAHCEdnsliyg  186
ident  |                                 |    |         |         
Sbjct RLAARYHdaspramrrVVMAPTTvlYSIS-PREMRETAAVARRLGLRMHSHLS-------  224
DSSP  HHHHHLLllllllleeEEELLLLllLLLL-HHHHHHHHHHHHHLLLEEEEELL-------


DSSP  lleellhhhhhhllleellhhhhHHHHHHHHHHhhhllLEEELLLLLHHhhHHHHHHHHl
Query gaxhegkrskelgipgipnicesVQIARDVLLAeaagcHYHVCHVSTKEsvRVIRDAKRa  246
ident                           |                |         |      
Sbjct ---------------------gkSPVAFCGEHD-wlgsDVWYAHLVKVD-aDEIALLAQ-  260
DSSP  ---------------------llLHHHHHHHLL-llllLEEEELLLLLL-hHHHHHHHH-


DSSP  lLLEEEEELHHHhhllhhhlllllhhhlllLLLLlhhhhhHHHHHHHLLLLLEELLLLLL
Query gIHVTAEVTPHHlllteddipgnnaiykxnPPLRstedreALLEGLLDGTIDCIATDHAP  306
ident          |                                 |    |    |  | | 
Sbjct -TGTGVAHCPQS------------------NGRL------PVREMADAGVPVSIGVDGAA  295
DSSP  -HLLEEEELHHH------------------HHLL------LLLLHHHHLLLEEELLLHHH


DSSP  llhhhhllllllllLLLLLL-LLHHHHHHHHHllLLLLLHHHHHHHHLHHHHHHLLLL-L
Query hardekaqpxekapFGIVGS-ETAFPLLYTHFvkNGDWTLQQLVDYLTIKPCETFNLE-Y  364
ident                                                |        |   
Sbjct --------------SNEAADmISEVHMTWLAQ-rARLASIAEVIHWGTAGGARVMGLDeV  340
DSSP  --------------HLLLLLhHHHHHHHHHHH-hHLLLLHHHHHHHHLHHHHHHHLLLlL


DSSP  LLLLLLLLLLEEEEELLLLEellhhhllllllllllllLEEL-LEEEEEEELLEEEEEL-
Query GTLKENGYADLTIIDLDSEQeikgedflskadntpfigYKVY-GNPILTXVEGEVKFEG-  422
ident |       ||     ||                                   |       
Sbjct GKVAVGYAADIAVYRLDDPR------yfglhdpaigpvASGGrPSVMALFSAGKRVVVDd  394
DSSP  LLLLLLLLLLEEEEELLLHH------hlllllhhhhhhHLLLlLEEEEEEELLEEEEELl


DSSP  ---------------------------
Query ---------------------------  422
ident                            
Sbjct liegvdikelggearrvvrellrevvv  421
DSSP  llllllhhhhhhhhhhhhhhhhhhhhl


No 15: Query=3griA Sbjct=3mkvA Z-score=23.9

back to top
DSSP  --LEEEELLEEEE--LLEEEE-LEEEEELLEEEEEEL-LLLLLlLLEEEELLLLEEEELE
Query --XKLIKNGKVLQ--NGELQQ-ADILIDGKVIKQIAP-AIEPSnGVDIIDAKGHFVSPGF   54
ident     |  ||  |      | |   |||    |       |  |     || ||    || 
Sbjct ltTFLFRNGALLDpdHPDLLQgFEILIEDGFIREVSDkPIKSS-NAHVIDVKGKTIMPGL   59
DSSP  llEEEEEEEEELLllLLLLEEeEEEEEELLEEEEEELlLLLLL-LLEEEELLLLEEEELE


DSSP  EEEEELLL-------------llLLLLLLLhhHHHHHHHHLLEEEEEELLLlllllllhh
Query VDVHVHLR-------------epGGEYKETieTGTKAAARGGFTTVCPXPNtrpvpdsve  101
ident  | |||                              |  | |||||              
Sbjct IDLHVHVVaiefnlprvatlpnvLVTLRAV--PIMRAMLRRGFTTVRDAGG---------  108
DSSP  EEEEELLLlllllhhhhllllhhHHHHHHH--HHHHHHHHLLEEEEEELLL---------


DSSP  hHHHHHHHHH--HHLLLEELLL-EELL-----------------------------hHHL
Query hFEALQKLID--DNAQVRVLPY-ASIT-----------------------------tRQL  129
ident                  |                                          
Sbjct aGYPFKQAVEsgLVEGPRLFVSgRALSqtgghadprarsdymppdspcgccvrvgalGRV  168
DSSP  lLHHHHHHHHllLLLLLEEEELlLEEEllllllllllllllllllllllllllllllEEE


DSSP  LL---LLLL-HHHHHLLLLLLEEEL------------lllLLLHHHHHHHHHHHHHHLLL
Query GK---ELVD-FPALVKEGAFAFTDD------------gvgVQTASXXYEGXIEAAKVNKA  173
ident      |           ||                                 ||      
Sbjct ADgvdEVRRaVREELQMGADQIXIMasggvasptdpvgvfGYSEDEIRAIVAEAQGRGTY  228
DSSP  LLlhhHHHHhHHHHHHHLLLLEEEElllllllllllllllLLLHHHHHHHHHHHHLLLLL


DSSP  EEELLLlhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHhhhllLEEELLLLL
Query IVAHCEdnsliyggaxhegkrskelgipgipnicESVQIARDVLLAeaagcHYHVCHVST  233
ident   ||                                  ||| |             |   
Sbjct VLAHAY----------------------------TPAAIARAVRCG-----VRTIEHGNL  255
DSSP  EEEEEL----------------------------LHHHHHHHHHLL-----LLEEEELLL


DSSP  HHhHHHHHHHHHllLLEEEEELHHhhhllhhhlllllHHHL------------lllLLLL
Query KEsVRVIRDAKRagIHVTAEVTPHhlllteddipgnnAIYK------------xnpPLRS  281
ident        |             |               |                      
Sbjct ID-DETARLVAE--HGAYVVPTLV--------tydalASEGekyglppesiakiadVHGA  304
DSSP  LL-HHHHHHHHH--HLLEEELLHH--------hhhhhHHHLllllllhhhhllhhhHHLL


DSSP  hhhHHHHHHHHHLLLLLEELLLLLLllhhhhlllllllllLLLL-LLLHHHHHhHHHLll
Query tedREALLEGLLDGTIDCIATDHAPhardekaqpxekapfGIVG-SETAFPLLyTHFVkn  340
ident              |      ||                           |  |       
Sbjct --gLHSIEIMKRAGVKMGFGTDLLG---------------EAQRlQSDEFRIL-AEVL--  344
DSSP  --hHHHHHHHHHHLLLLLLLLLLLH---------------HHHHhLLHHHHHH-HLLL--


DSSP  lllLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLlleellhhhllllllll
Query gdwTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDseqeikgedflskadnt  398
ident             ||   |        |       ||    |                   
Sbjct ---SPAEVIASATIVSAEVLGMQdkLGRIVPGAHADVLVVDGN-----------------  384
DSSP  ---LHHHHHHHLLHHHHHHLLLLllLLLLLLLLLLLEEEELLL-----------------


DSSP  llllleELLE------EEEEEELLEEEEEL--
Query pfigykVYGN------PILTXVEGEVKFEG--  422
ident       |           |    |        
Sbjct --plksVDCLlgqgehIPLVMKDGRLFVNEle  414
DSSP  --llllLLLLllllllLLEEEELLEEEEELll


No 16: Query=3griA Sbjct=1k6wA Z-score=23.4

back to top
DSSP  -LEEEELLEEEEllEEEELEEEEELLEEEEEELL-lllllLLEEEELLLLEEEELEEEEE
Query -XKLIKNGKVLQngELQQADILIDGKVIKQIAPA-iepsnGVDIIDAKGHFVSPGFVDVH   58
ident     | |       |     |      |  |              ||    | | ||  |
Sbjct aLQTIINARLPG--EEGLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEPH   58
DSSP  lLLEEEEELLLL--LLLEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEEE


DSSP  ELLLLllLLLL-------------------------------lLHHHHHHHHHHLLEEEE
Query VHLREpgGEYK-------------------------------eTIETGTKAAARGGFTTV   87
ident  ||                                              |     |   |
Sbjct IHLDT--TQTAgqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHV  116
DSSP  ELLLL--LLLLllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEE


DSSP  EELLllllLLLL--HHHHHHHHHHHHHHL-LLEELLLEELlhHHLLL----LLLLHHHHH
Query CPXPntrpVPDS--VEHFEALQKLIDDNA-QVRVLPYASIttRQLGK----ELVDFPALV  140
ident                    |        |        |                      
Sbjct RTHV----DVSDatLTALKAMLEVKQEVApWIDLQIVAFP--QEGILsypnGEALLEEAL  170
DSSP  EEEE----ELLLllLHHHHHHHHHHHHHLlLLEEEEEEEL--LLLLLllllHHHHHHHHH


DSSP  LLLLLLEEELLLL----lLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhh
Query KEGAFAFTDDGVG----vQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrsk  196
ident   ||                          | |    |  ||                  
Sbjct RLGADVVGAIPHFeftreYGVESLHKTFALAQKYDRLIDVHCD-----------------  213
DSSP  HLLLLEEEELHHHlllhhHHHHHHHHHHHHHHHHLLEEEEEEL-----------------


DSSP  hhllleELLHHhhHHHHHHHHHHHHHLL--LEEELLLL-LHHH----hhhHHHHHHlLLL
Query elgipgIPNICesVQIARDVLLAEAAGC--HYHVCHVS-TKES----vrvIRDAKRaGIH  249
ident                      ||   |        |                        
Sbjct ----eiDDEQS--RFVETVAALAHHEGMgaRVTASHTTaMHSYngaytsrLFRLLK-MSG  266
DSSP  ----llLLLLL--LHHHHHHHHHHHHLLhhHEEEEELHhHHHLlhhhhhhHHHHHH-HHL


DSSP  EEEEELHHhhhllhhhlllllhhhlLLLLLLL------HHHH-hHHHHHHHLLLLLEELL
Query VTAEVTPHhlllteddipgnnaiykXNPPLRS------TEDR-eALLEGLLDGTIDCIAT  302
ident       |                   |  |                 | |  |   |   
Sbjct INFVANPL-----------------VNIHLQGrfdtypKRRGitRVKEMLESGINVCFGH  309
DSSP  LEEEELHH-----------------HHHHHLLllllllLLLLllLHHHHHHLLLLEEELL


DSSP  LLLLLlhhhhlllllllLLLL-LLLLlHHHHHH----hhhllLLLLLHhHHHHHHLHHHH
Query DHAPHardekaqpxekaPFGI-VGSEtAFPLLY----thfvkNGDWTLqQLVDYLTIKPC  357
ident |                |             |                       |    
Sbjct DDVFD------------PWYPlGTAN-MLQVLHmglhvcqlmGYGQIN-DGLNLITHHSA  355
DSSP  LLLLL------------LLLLlLLLL-HHHHHHhhhhhllllLHHHHH-HHHHHHLHHHH


DSSP  HHLLLLLLLLLLLLLLLEEEEELLlleellhhhlllllllllllllEELLEEEEEEELLE
Query ETFNLEYGTLKENGYADLTIIDLDseqeikgedflskadntpfigyKVYGNPILTXVEGE  417
ident  | ||          | | |                                      | 
Sbjct RTLNLQDYGIAAGNSANLIILPAE----------------ngfdalRRQVPVRYSVRGGK  399
DSSP  HHLLLLLLLLLLLLLLLEEEELLL----------------lhhhhhHHLLLLLEEEELLE


DSSP  EEEEL-------------------
Query VKFEG-------------------  422
ident |                       
Sbjct VIASTqpaqttvyleqpeaidykr  423
DSSP  EEEELlllleeeellleeeellll


No 17: Query=3griA Sbjct=2oofA Z-score=23.0

back to top
DSSP  ---LEEEELLEEE------eLLEEE-ELEEEEELLEEEEEELL--LLLLllLEEEELLLL
Query ---XKLIKNGKVL------qNGELQ-QADILIDGKVIKQIAPA--IEPSngVDIIDAKGH   48
ident         |              |            |    |             | || 
Sbjct lncERVWLNVTPAtlrsdlaDYGLLePHALGVHEGRIHALVPXqdLKYP--AHWQDXKGK   58
DSSP  lllLEEEEEEEELlllllllLLLLLlLEEEEEELLEEEEEEEHhhLLLL--LLLEELLLL


DSSP  EEEELEEEEEELLLLL---------------------------------------LLLLL
Query FVSPGFVDVHVHLREP---------------------------------------GGEYK   69
ident  | ||  | | ||                                               
Sbjct LVTPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedQLFEL  118
DSSP  EEEELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhHHHHH


DSSP  LlhHHHHHHHHHLLEEEEEELLLLL----LLLLlhhHHHHHHHHHHhHLLLEELLLEELL
Query EtiETGTKAAARGGFTTVCPXPNTR----PVPDsveHFEALQKLIDdNAQVRVLPYASIT  125
ident        |   | | |||                         |       ||       
Sbjct A--LPRVKSLIREGVTTVEIKSGYGltleDELK---XLRVARRLGE-ALPIRVKTTLLAA  172
DSSP  H--HHHHHHHHHHLEEEEEEELLLLllhhHHHH---HHHHHHHHHH-HLLLEEEEEEEEE


DSSP  hHHLL----------LLLL---LHHHHH-LLLLLLEEEL--lLLLLlHHHHHHHHHHHHH
Query tRQLG----------KELV---DFPALV-KEGAFAFTDD--gVGVQtASXXYEGXIEAAK  169
ident                 |       ||      | |        |             |  
Sbjct -HAVPpeyrddpdswVETIcqeIIPAAAeAGLADAVDVFcehIGFS-LAQTEQVYLAADQ  230
DSSP  -LLLLhhhlllhhhhHHHHhhlHHHHHHhLLLLLEEEEEellLLLL-HHHHHHHHHHHHH


DSSP  HLLLEEELLLlhhhllllleellhhhhhhllleellhHHHHHHHHHHhhhhhhLLLE-EE
Query VNKAIVAHCEdnsliyggaxhegkrskelgipgipniCESVQIARDVllaeaaGCHY-HV  228
ident    |   |                                                   |
Sbjct YGLAVKGHXD-------------------------qlSNLGGSTLAA------NFGAlSV  259
DSSP  LLLEEEEEEL-------------------------llLLLLHHHHHH------HLLLlEE


DSSP  LLLLLhhHHHHHHHHHhlLLLEEEEELHHHHHLlhhhlllllhhhllllLLLLhhHHHHh
Query CHVSTkeSVRVIRDAKraGIHVTAEVTPHHLLLteddipgnnaiykxnpPLRSteDREAl  288
ident  |            |      | |   |                                
Sbjct DHLEY--LDPEGIQAL-aHRGVVATLLPTAFYF----------------LKET--KLPP-  297
DSSP  EELLL--LLHHHHHHH-hHHLLEEEELHHHHHH----------------LLLL--LLLL-


DSSP  HHHHHL-LLLLEELLLLLLllhhhhlllllllLLLLL-LLLLHHHHHHHHhlllllLLHH
Query LEGLLD-GTIDCIATDHAPhardekaqpxekaPFGIV-GSETAFPLLYTHfvkngdWTLQ  346
ident    |   |       |  |                       |     |        |  
Sbjct VVALRKaGVPXAVSSDINP-------------GTAPIvSLRXAXNXACTL----fgLTPV  340
DSSP  HHHHHHlLLLEEELLLLLL-------------LLLLLlLHHHHHHHHHHH----hlLLHH


DSSP  HHHHHHLHHHHHHLLL--LLLLLLLLLLLLEEEEELL-----llEELLhhhlllllllll
Query QLVDYLTIKPCETFNL--EYGTLKENGYADLTIIDLD-----seQEIKgedflskadntp  399
ident       |             | |     ||                              
Sbjct EAXAGVTRHAARALGEqeQLGQLRVGXLADFLVWNCGhpaelsyLIGV------------  388
DSSP  HHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELLLlllhhhhLLLL------------


DSSP  lllleellEEEEEEELLEEEEEl
Query figykvygNPILTXVEGEVKFEg  422
ident               | ||     
Sbjct -------dQLVSRVVNGEETLH-  403
DSSP  -------lLEEEEEELLEELLL-


No 18: Query=3griA Sbjct=1j6pA Z-score=22.7

back to top
DSSP  -LEEEELLEEE--eLLEEEELEEEEELLEEEEEE-LLLLllllleEEELLLLEEEELEEE
Query -XKLIKNGKVL--qNGELQQADILIDGKVIKQIA-PAIEpsngvdIIDAKGHFVSPGFVD   56
ident     | |   |     |       |    ||                |  |  | |    
Sbjct hHXIIGNCLILkdfSSEPFWGAVEIENGTIKRVLqGEVK-----vDLDLSGKLVXPALFN   55
DSSP  lEEEEEEEEELlllLLLLEEEEEEEELLEEEEEEeLLLL-----lLEELLLEEEEELEEE


DSSP  EEELLLlllLLLL-----------------------------lLHHHHHHHHHHLLEEEE
Query VHVHLRepgGEYK-----------------------------eTIETGTKAAARGGFTTV   87
ident  | |                                                || |    
Sbjct THTHAP--xTLLRgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGF  113
DSSP  EEELHH--hHHHLlllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEE


DSSP  EELLLlllllllhhHHHHHHHHHHHhLLLEELLLEELlhhHLLL----LLLL-HHHHHLL
Query CPXPNtrpvpdsveHFEALQKLIDDnAQVRVLPYASIttrQLGK----ELVD-FPALVKE  142
ident   |           | |   |   |    | |                        |  |
Sbjct VDXYF---------HEEWIAKAVRD-FGXRALLTRGL---VDSNgddgGRLEeNLKLYNE  160
DSSP  EEEEL---------LHHHHHHHHHH-HLLEEEEEEEE---LLLLllllLHHHhHHHHHHH


DSSP  LL-------LLEEELL-LLLLlHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhh
Query GA-------FAFTDDG-VGVQtASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkr  194
ident            |                    |   |     |                 
Sbjct WNgfegrifVGFGPHSpYLCS-EEYLKRVFDTAKSLNAPVTIHLY---------------  204
DSSP  HLlhhhleeEEEEELLlLLLL-HHHHHHHHHHHHHHLLLEEEEEL---------------


DSSP  hhhhllleelLHHHhHHHHHHHHHHHhhLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEE
Query skelgipgipNICEsVQIARDVLLAEaaGCHYHVCHVSTkeSVRVIRDAKRaGIHVTAEV  254
ident              |                     |                 |      
Sbjct --------etSKEE-YDLEDILNIGL-kEVKTIAAHCVH--LPERYFGVLK-DIPFFVSH  251
DSSP  --------llLLLL-LLLHHHHLLLL-lLLLEEEEELLL--LLHHHHHHHL-LLLEEEEE


DSSP  LHHhhhllhhhlllllhhhLLLLLLLlhhhhhHHHHHHHLLLLLEELLLLLLllhhhhll
Query TPHhlllteddipgnnaiyKXNPPLRstedreALLEGLLDGTIDCIATDHAPhardekaq  314
ident  |                                      |      || |         
Sbjct NPA--------------snLKLGNGI-----aPVQRXIEHGXKVTLGTDGAA--------  284
DSSP  LHH--------------hhHHLLLLL-----lLHHHHHHLLLEEEELLLLLL--------


DSSP  lllllllLLLLLLlHHHHHH-----hhhlllLLLLHHHHHHHHLHHHHHHLLLLLLLLLL
Query pxekapfGIVGSEtAFPLLY-----thfvknGDWTLQQLVDYLTIKPCETFNLEYGTLKE  369
ident                |                           |           |   |
Sbjct -------SNNSLN-LFFEXRlasllqkaqnpRNLDVNTCLKXVTYDGAQAXGFKSGKIEE  336
DSSP  -------LLLLLL-HHHHHHhhhhhhhllllLLLLHHHHHHHHLHHHHHHHLLLLLLLLL


DSSP  LLLLLEEEEELLLLEellhhhlllllllllllllEELL-EEEEEEELLEEEEEL------
Query NGYADLTIIDLDSEQeikgedflskadntpfigyKVYG-NPILTXVEGEVKFEG------  422
ident    |||  ||||                               ||| |            
Sbjct GWNADLVVIDLDLPE-------xfpvqniknhlvHAFSgEVFATXVAGKWIYFDgeypti  389
DSSP  LLLLLEEEEELLLHH-------hllhhhhhhhhhHLLLlLLLEEEELLEEEEELllllll


DSSP  ------------------
Query ------------------  422
ident                   
Sbjct dseevkrelariekelys  407
DSSP  lhhhhhhhhhhhhhhhhl


No 19: Query=3griA Sbjct=3ooqA Z-score=22.3

back to top
DSSP  LEEEELLEEE-elLEEEELEEEEELLEEEEEELLLLLLlLLEEEELLLLEEEELEEEEEE
Query XKLIKNGKVL-qnGELQQADILIDGKVIKQIAPAIEPSnGVDIIDAKGHFVSPGFVDVHV   59
ident   | ||  |          | |            ||      | |  | |  ||||| | 
Sbjct KILFKNATVFpitSRPFKGDVLVSNGKVEKVGENIEDP-DAEIVDLTGKFLFPGFVDAHS   59
DSSP  LEEEEEEEELlllLLLEEEEEEEELLEEEEEELLLLLL-LLEEEELLLLEEEELEEEEEE


DSSP  -LLLL------LLLL---------------lLLLH-HHHHHHHHHLLEEEEEELLL-lll
Query -HLRE------PGGE---------------yKETI-ETGTKAAARGGFTTVCPXPN-trp   95
ident                                           |  || | |   |     
Sbjct hIGLFeegvgyYYSDgneatdpvtphvkaldGFNPqDPAIERALAGGVTSVXIVPGsanp  119
DSSP  lLLLLlllllhHHLLlllllllllllllhhhHLLLlLHHHHHHHLLLEEEEEELLLllll


DSSP  llllhhhhhhhhhHHHHhlllEELLleellhhhlllllllhhhhhllLLLLEEEL--LLL
Query vpdsvehfealqkLIDDnaqvRVLPyasittrqlgkelvdfpalvkeGAFAFTDD--GVG  153
ident                                                             
Sbjct vggqgsvikfrsiIVEE----CIVK----------------------DPAGLKXAfgENP  153
DSSP  eeeeeeeeellllLHHH----HEEE----------------------EEEEEEEEllHHH


DSSP  L--------------LLHHHHHH------------------------------hhhHHHH
Query V--------------QTASXXYE------------------------------gxiEAAK  169
ident                 ||                                          
Sbjct KrvygerkqtpstrxGTAGVIRDyftkvknyxkkkelaqkegkeftetdlkxevgeXVLR  213
DSSP  HhhhhhlllllllhhHHHHHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhhhHHHL


DSSP  HLLLEEELLllhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHHHHLLLEEEL
Query VNKAIVAHCednsliyggaxhegkrskelgipgipnicESVQIARDVLLAEAAGCHYHVC  229
ident        |                                  |      ||  |      
Sbjct KKIPARXHA----------------------------hRADDILTAIRIAEEFGFNLVIE  245
DSSP  LLLLEEEEE----------------------------lLHHHHHHHHHHHHHHLLLEEEE


DSSP  LLLLhhHHHHHHHHHHllLLEEEEELHHhhHLLHhhlllllhhhlllLLLLlhhHHHHH-
Query HVSTkeSVRVIRDAKRagIHVTAEVTPHhlLLTEddipgnnaiykxnPPLRsteDREAL-  288
ident |                       | |   |                             
Sbjct HGTE--AYKISKVLAE--KKIPVVVGPL--LTFR----------tklELKD---LTXETi  286
DSSP  ELLL--HHHHHHHHHH--HLLLEEELLL--LLLL----------llhHHLL---LLLLHh


DSSP  HHHHHLLLLLEELLLLLlllhhhhllllllllllLLLLLLHHHHHHHHHllLLLLLHHHH
Query LEGLLDGTIDCIATDHAphardekaqpxekapfgIVGSETAFPLLYTHFvkNGDWTLQQL  348
ident    | ||       ||                      | |     |            |
Sbjct AKLLKDGVLIALXCDHP-----------------VIPLEFATVQAATAX--RYGAKEEDL  327
DSSP  HHHHHLLLLEEELLLLL-----------------LLLHHHHHHHHHHHH--HHLLLHHHH


DSSP  HHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLlleellhhhllllllllllllleEL
Query VDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDseqeikgedflskadntpfigykVY  406
ident    ||  |     ||   |       |||                               
Sbjct LKILTVNPAKILGLEdrIGSIEPGKDADLVVWSGH--------------------pfdXK  367
DSSP  HHLLLHHHHHHLLLLllLLLLLLLLLLLEEEELLL--------------------lllLL


DSSP  LEEEEEEELLEEEEEL-
Query GNPILTXVEGEVKFEG-  422
ident          |   |   
Sbjct SVVERVYIDGVEVFRRe  384
DSSP  LLEEEEEELLEEEEELl


No 20: Query=3griA Sbjct=3ls9A Z-score=22.3

back to top
DSSP  LEEEEL-LEEE---eLLEEEE-LEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEE
Query XKLIKN-GKVL---qNGELQQ-ADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFV   55
ident   ||     |            |||||||  |               ||  |    ||  
Sbjct MILIRGlTRVItfddQERELEdADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGLI   60
DSSP  LEEEEEeEEEEllllLLLEEEeEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELEE


DSSP  EEEELLL-----------------------------------lLLLLllLLHHHHHHHHH
Query DVHVHLR-----------------------------------ePGGEykETIETGTKAAA   80
ident   | ||                                     |     |          
Sbjct NSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgPDVI-rEVARAVLLESL  119
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllHHHH-hHHHHHHHHHHH


DSSP  HLLEEEEEELLLLLLlllLHHHHHHHHHHHHhHLLLEELLLEELlhhHLLL---------
Query RGGFTTVCPXPNTRPvpdSVEHFEALQKLIDdNAQVRVLPYASIttrQLGK---------  131
ident  || |||       |         |           |     |                 
Sbjct LGGITTVADQHLFFPgatADSYIDATIEAAT-DLGIRFHAARSS---MTLGkseggfcdd  175
DSSP  HLLEEEEEEEELLLLlllLLLHHHHHHHHHH-HHLLEEEEEELL---LLLLhhhlllllh


DSSP  -------LLLL-HHHHHLLLL---------LLEEELL-LLLLlHHHHHHHHHHHHHHLLL
Query -------ELVD-FPALVKEGA---------FAFTDDG-VGVQtASXXYEGXIEAAKVNKA  173
ident          |     |               |    |                ||     
Sbjct lfvepvdRVVQhCLGLIDQYHepepfgmvrIALGPCGvPYDK-PELFEAFAQMAADYDVR  234
DSSP  hhlllhhHHHHhHHHHHHHHLllllllleeEEELLLLlLLLL-HHHHHHHHHHHHHHLLE


DSSP  EEELLllhhhllllleellhhhhhhllleelLHHH--------hHHHHHHH-HHHHhhll
Query IVAHCednsliyggaxhegkrskelgipgipNICE--------sVQIARDV-LLAEaagc  224
ident    |                                                        
Sbjct LHTHF------------------------yePLDAgmsdhlygmTPWRFLEkHGWA--sd  268
DSSP  EEEEE------------------------llLLHHhhhhhhhllLHHHHHHhLLLL--ll


DSSP  LEEELLLLLHHhhHHHHHHHHllLLEEEEELHHHHHLlhhhlllllhhhllllLLLLhhh
Query HYHVCHVSTKEsvRVIRDAKRagIHVTAEVTPHHLLLteddipgnnaiykxnpPLRSted  284
ident      |         |         |         |                        
Sbjct RVWLAHAVVPP-rEEIPEFAD--AGVAIAHLIAPDLR----------------MGWG---  306
DSSP  LEEEEELLLLL-hHHHHHHHH--HLLEEEELHHHHHH----------------LLLL---


DSSP  HHHHHHHHHLLLLLEELLLLLLllhhhhlllllllllLLLLLlLHHHHHHhHHLL-----
Query REALLEGLLDGTIDCIATDHAPhardekaqpxekapfGIVGSeTAFPLLYtHFVK-----  339
ident      | |  |      |                      |       |           
Sbjct LAPIREYLDAGITVGFGTTGSA---------------SNDGG-NLLGDLR-LAALahrpa  349
DSSP  LLLHHHHHHLLLEEEELLLLLL---------------LLLLL-LHHHHHH-HHHHhlhhh


DSSP  -----llLLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLEEEEELLL-----------
Query -----ngDWTLQQLVDYLTIKPCETFNLE-YGTLKENGYADLTIIDLDS-----------  382
ident              |    |    |       | | |   ||     ||            
Sbjct dpnepekWLSARELLRMATRGSAECLGRPdLGVLEEGRAADIACWRLDGvdrvgvhdpai  409
DSSP  llllhhhLLLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLEEEEELLLhhhlllllhhh


DSSP  ----LEELlhhhllllllllllllleelLEEEEEEELLEEEEEL----------------
Query ----EQEIkgedflskadntpfigykvyGNPILTXVEGEVKFEG----------------  422
ident                                 |  | | |  |                 
Sbjct glimTGLS--------------------DRASLVVVNGQVLVENerpvladlerivantt  449
DSSP  hhhhLLLL--------------------LLLLEEEELLEEEEELleellllhhhhhhhhh


DSSP  ----
Query ----  422
ident     
Sbjct alip  453
DSSP  hhll


No 21: Query=3griA Sbjct=3icjA Z-score=22.1

back to top
DSSP  -LEEEELLEEE---eLLEEeELEEEEELLEEEEEEL---LLLL--LLLLEEEELLLLEEE
Query -XKLIKNGKVL---qNGELqQADILIDGKVIKQIAP---AIEP--SNGVDIIDAKGHFVS   51
ident   |   ||                 |             |       |  ||| || || 
Sbjct cMKALINGTIYtsfsPVKK-VSGLVISNERVLYAGDsstALRIaeLAGGEIIDLKGKFVM   59
DSSP  lEEEEELLEEEeeelLEEE-ELEEEEELLEEEEEELhhhHHHHhhHHLLEEEELLLLEEE


DSSP  ELEEEEEELLLLllLLLL------------------------------------------
Query PGFVDVHVHLREpgGEYK------------------------------------------   69
ident | | | | || |                                                
Sbjct PAFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   69
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll


DSSP  -------lLHHHHHHHHHHLLEEEEEELLlllllLLLHhHHHHHHHHHH-HHLLLEELLL
Query -------eTIETGTKAAARGGFTTVCPXPntrpvPDSVeHFEALQKLID-DNAQVRVLPY  121
ident          ||         |   |                 ||  |         |  |
Sbjct ltvkdykhYIESAQEHLLSLGVHSVGFMS-----VGEK-ALKALFELEReGRLKMNVFAY  233
DSSP  llhhhhhhHHHHHHHHHHHLLEEEEEEEE-----ELHH-HHHHHHHHHHlLLLLLEEEEE


DSSP  EELLHhhlllllLLHH----HHHL----lLLLLEEEL-----------------------
Query ASITTrqlgkelVDFP----ALVK----eGAFAFTDD-----------------------  150
ident  |           |                                              
Sbjct LSPEL-------LDKLeelnLGKFegrrlRIWGVXLFvdgslgartallsepytdnptts  286
DSSP  ELHHH-------HHHHhhhlLLLEellleEEEEEEEElllllllllllllllllllllll


DSSP  lllLLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhhHHH
Query gvgVQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnicESV  210
ident    |       |    |         |                                 
Sbjct gelVMNKDEIVEVIERAKPLGLDVAVHAI----------------------------GDK  318
DSSP  lllLLLHHHHHHHHHHHLLLLLEEEEEEL----------------------------LHH


DSSP  HHHHHHHHHHHHLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEELHHHHHLlhhhlllll
Query QIARDVLLAEAAGCHYHVCHVSTkeSVRVIRDAKRaGIHVTAEVTPHHLLLteddipgnn  270
ident          | |       | |                 |     ||             
Sbjct AVDVALDAFEEAEFSGRIEHASL--VRDDQLERIK-ELKVRISAQPHFIVS---------  366
DSSP  HHHHHHHHHHHHLLLLEEEELLL--LLHHHHHHHH-HHLLEEEELLLHHHH---------


DSSP  hhhlllllLLLHH------hHHHHHhHHHLL---LLLEELLLLLlllhhhhlllllllll
Query aiykxnppLRSTE------dREALLeGLLDG---TIDCIATDHAphardekaqpxekapf  321
ident                            |      |     ||                  
Sbjct --------DWWIVnrvgeerAKWAY-RLKTLssiTKLGFSTDSP----------------  401
DSSP  --------LLLHHhhhhhhhHHHLL-LHHHHhhhLLEEELLLLL----------------


DSSP  LLLLllLHHHHHHhHHLL------llLLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLL
Query GIVGseTAFPLLYtHFVK------ngDWTLQQLVDYLTIKPCETFNLE-YGTLKENGYAD  374
ident                 |                    |         |  | |     | 
Sbjct IEPA--DPWVSID-AAVNryvvdpgeRVSREEALHLYTHGSAQVTLAEdLGKLERGFRAE  458
DSSP  LLLL--LHHHHHH-HHHHlllllhhhLLLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLL


DSSP  EEEEELLlleellhhhllllllllllllleelleeeeeeelleeeeel
Query LTIIDLDseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident   | | |                                         
Sbjct YIILDRD--------------------------------------plk  468
DSSP  EEEELLL--------------------------------------lll


No 22: Query=3griA Sbjct=4c5yA Z-score=21.1

back to top
DSSP  ----LEEEELLEEE-elLEEEE-LEEEEELLEEEEEEL--LLLL--LLLL-EEEELllLE
Query ----XKLIKNGKVL-qnGELQQ-ADILIDGKVIKQIAP--AIEP--SNGV-DIIDAkgHF   49
ident        |  |      ||    |   |  | |        |                  
Sbjct deakVTIIYAGLLIpgdGEPLRnAALVISDKIIAFVGSeaDIPKkyLRSTqSTHRV--PV   58
DSSP  llllEEEEEEEEELlllLLLEEeEEEEEELLEEEEEEEhhHLLHhhHHHLlLEEEE--EE


DSSP  EEELEEEEEELLLLL----------------LLLLllLHHHHHHHHHHLLEEEEEELLLL
Query VSPGFVDVHVHLREP----------------GGEYkeTIETGTKAAARGGFTTVCPXPNT   93
ident   ||  | | |                              |   |   | |        
Sbjct LMPGLWDCHMHFGGDddyyndytsglathpaSSGA--RLARGCWEALQNGYTSYRDLAGY  116
DSSP  EEELEEEEEELLLLLlllllllhhhhhllhhHHHH--HHHHHHHHHHHLLEEEEEELLLL


DSSP  llllllhhhhhHHHHHHHH--HLLLEELLL-EELL-------------------------
Query rpvpdsvehfeALQKLIDD--NAQVRVLPY-ASIT-------------------------  125
ident               | | |       |    |                            
Sbjct ---------gcEVAKAINDgtIVGPNVYSSgAALSqtaghgdifalpagevlgsygvmnp  167
DSSP  ---------hhHHHHHHHLllLLLLEEEELlLEEEllllllllllllhhhhhhhhlllll


DSSP  --------hHHLLL---LLLL-HHHHHLLLLLLEEEL------------lllLLLHHHHH
Query --------tRQLGK---ELVD-FPALVKEGAFAFTDD------------gvgVQTASXXY  161
ident                  |           ||                             
Sbjct rpgywgagpLCIADgveEVRRaVRLQIRRGAKVIXVMasggvmsrddnpnfaQFSPEELK  227
DSSP  lllllllllEEELLlhhHHHHhHHHHHHHLLLLEEEElllllllllllllllLLLHHHHH


DSSP  HHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHhh
Query EGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnicESVQIARDVLLAea  221
ident     |||  |    ||                                  |         
Sbjct VIVEEAARQNRIVSAHVH----------------------------GKAGIMAAIKAG--  257
DSSP  HHHHHHHHLLLLEEEEEL----------------------------LHHHHHHHHHHL--


DSSP  hllLEEELLLLLhhHHHHHHHHHHlLLLEEEEELHHHHHLlhHHLLllLHHH---lllll
Query agcHYHVCHVSTkeSVRVIRDAKRaGIHVTAEVTPHHLLLteDDIPgnNAIY---kxnpp  278
ident         |||                      |                          
Sbjct ---CKSLEHVSY--ADEEVWELMK-EKGILYVATRSVIEI-fLASN--GEGLvkeswakl  308
DSSP  ---LLEEEELLL--LLHHHHHHHH-HHLLEEELLHHHHHH-hHHHL--LLLLlllhhhll


DSSP  lLLHHH-HHHHHHHHHLLLLLEELLLLLlllhhhhlllllllllllLLLLLHHhHHHHHH
Query lRSTED-REALLEGLLDGTIDCIATDHAphardekaqpxekapfgiVGSETAFpLLYTHF  337
ident          |       |      || |                                
Sbjct qALADShLKAYQGAIKAGVTIALGTDTA----------------pgGPTALEL-QFAVER  351
DSSP  lHHHHHhHHHHHHHHHLLLLEELLLLLL----------------llLLLHHHH-HHHHHL


DSSP  lllllLLHHHHHHHHLHHHHHHL---LLLLLLLLLLLLLLEEEEELLlleellhhhllll
Query vkngdWTLQQLVDYLTIKPCETF---NLEYGTLKENGYADLTIIDLDseqeikgedflsk  394
ident       |        |              | | |   ||                    
Sbjct ---ggMTPLEAIKAATANAPLSVgpqAPLTGQLREGYEADVIALEEN-------------  395
DSSP  ---llLLHHHHHHHHLLLHHHHHhhhLLLLLLLLLLLLLLEEEELLL-------------


DSSP  llllllllleELLE-----EEEEEELLEEEEEL--------------
Query adntpfigykVYGN-----PILTXVEGEVKFEG--------------  422
ident                           |                    
Sbjct ------pledIKVFqepkaVTHVWKGGKLFKGPgigpwgedarnpfl  436
DSSP  ------llllHHHHhlhhhEEEEEELLEEEELLllllllllllllll


No 23: Query=3griA Sbjct=1a5kC Z-score=21.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -----LEEEELLEEEelLEEEELEEEEELLEEEEEELL----------LLLLLLLEEEEL
Query -----XKLIKNGKVLqnGELQQADILIDGKVIKQIAPA----------IEPSNGVDIIDA   45
ident           |           |||      |  |  |          |        | |
Sbjct aadcvDLVLTNALIVdhWGIVKADIGVKDGRIFAIGKAgnpdiqpnvtIPIGAATEVIAA  120
DSSP  hhhllLEEEEEEEEEelLEEEEEEEEEELLEEEEEELEelllllllllEELLLLLEEEEL


DSSP  LLLEEEELEEEEEELLLLllllllllhHHHHHHHHHLLEEEEEELLLLLL-------lLL
Query KGHFVSPGFVDVHVHLREpggeyketiETGTKAAARGGFTTVCPXPNTRP-------vPD   98
ident  |  |  |  | | |                  |   | ||                   
Sbjct EGKIVTAGGIDTHIHWIC---------PQQAEEALVSGVTTMVGGGTGPAagthattcTP  171
DSSP  LLLEEEELEEEEEEELLL---------LLHHHHHHHHLEEEEEEELLLLLhhhhhlllLL


DSSP  LHHHHHHHHHHHHhHLLLEELLLEELLhhhlLLLLLLHHHHHLLLLLLEEELLLLLLLHH
Query SVEHFEALQKLIDdNAQVRVLPYASITtrqlGKELVDFPALVKEGAFAFTDDGVGVQTAS  158
ident             |    |                       |  |            |  
Sbjct GPWYISRMLQAAD-SLPVNIGLLGKGN----VSQPDALREQVAAGVIGLEIHEDWGATPA  226
DSSP  HHHHHHHHHHHHL-LLLLEEEEEEELL----LLLHHHHHHHHHHLLLEEEEEHHHLLLHH


DSSP  HHHHHHHHHHHHLLLEEELLLLHHHllllleellhhhhhhllleellhhhhHHHHHHHHH
Query XXYEGXIEAAKVNKAIVAHCEDNSLiyggaxhegkrskelgipgipnicesVQIARDVLL  218
ident         |         |                                         
Sbjct AIDCALTVADEMDIQVALHSDTLNE-------------------------sGFVEDTLAA  261
DSSP  HHHHHHHHHHHHLLEEEEELLLLLL-------------------------lLLHHHHHHH


DSSP  HHhhLLLEEELLLLL------hHHHHhHHHHHhlllLEEEEELHHHHHL---LHHHLlll
Query AEaaGCHYHVCHVST------kESVRvIRDAKragiHVTAEVTPHHLLL---TEDDIpgn  269
ident     |   |  |                              |   |     | |     
Sbjct IG--GRTIHTFHTEGaggghapDIIT-ACAHP----NILPSSTNPTLPYtlnTIDEH---  311
DSSP  HL--LLLEEELLLLLlllllllLHHH-HHHLL----LEEEEEEHHHLLLlllHHHHH---


DSSP  lHHHL---------------lllllLLHHHHHHHHHHHHLLLLLEELLLLLlllhhhhll
Query nAIYK---------------xnpplRSTEDREALLEGLLDGTIDCIATDHAphardekaq  314
ident                             |   |       |       |           
Sbjct -LDMLmvchhldpdiaedvafaesrIRRETIAAEDVLHDLGAFSLTSSDSQ---------  361
DSSP  -HHHHhhhhllllllhhhhhlllllLLHHHHHHHHHHHHLLLLLEEELLLL---------


DSSP  lllllllLLLLLLLHHHHHHHHHlLLLL---------------LLHHHHHHHHLHHHHHH
Query pxekapfGIVGSETAFPLLYTHFvKNGD---------------WTLQQLVDYLTIKPCET  359
ident                                                      || |  |
Sbjct -------AMGRVGEVILRTWQVA-HRMKvqrgalaeetgdndnFRVKRYIAKYTINPALT  413
DSSP  -------LLLLLLLHHHHHHHHH-HHHHhhhlllllllllllhHHHHHHHHLLLHHHHHH


DSSP  LLLL--LLLLLLLLLLLEEEEELLLleellhhhllllllllllllleeLLEEEEEEELLE
Query FNLE--YGTLKENGYADLTIIDLDSeqeikgedflskadntpfigykvYGNPILTXVEGE  417
ident        |       |||                                 |      | 
Sbjct HGIAheVGSIEVGKLADLVVWSPAF----------------------fGVKPATVIKGGM  451
DSSP  LLLLllLLLLLLLLLLLEEEELHHH----------------------lLLLLLEEEELLE


DSSP  EEEEL-------------------------------------------------------
Query VKFEG-------------------------------------------------------  422
ident                                                             
Sbjct IAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaia  511
DSSP  EEEEEellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleee


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  422
ident                                                        
Sbjct vvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  ellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 24: Query=3griA Sbjct=2uz9A Z-score=19.6

back to top
DSSP  --LEEEElLEEE-----elLEEEE-LEEEEEL-LEEEEEELL-------lLLLLL-lEEE
Query --XKLIKnGKVL-----qnGELQQ-ADILIDG-KVIKQIAPA-------iEPSNG-vDII   43
ident         |           |              |     |        |       | 
Sbjct plAHIFR-GTFVhstwtcpMEVLRdHLLGVSDsGKIVFLEEAsqqeklakEWCFKpcEIR   59
DSSP  llLEEEE-EEEEellllllLEEEEeEEEEELLlLLEEEEEEHhhhhhhhhHHLLLhhHEE


DSSP  ELL-LLEEEELEEEEEELLLLllLLLL------------------------------lLH
Query DAK-GHFVSPGFVDVHVHLREpgGEYK------------------------------eTI   72
ident       |  || || | |                                          
Sbjct ELShHEFFMPGLVDTHIHASQ--YSFAgssidlpllewltkytfpaehrfqnidfaeeVY  117
DSSP  ELLlLLEEEELEEEEEEEHHH--HHHLlllllllhhhhhhhlhhhhhhhhhlhhhhhhHH


DSSP  HHHHHHHHHLLEEEEEELLllllLLLLHhHHHHHHHHHHhHLLLEELLLEELlhhHLLL-
Query ETGTKAAARGGFTTVCPXPntrpVPDSVeHFEALQKLIDdNAQVRVLPYASIttrQLGK-  131
ident           | || |                 |    |     |               
Sbjct TRVVRRTLKNGTTTACYFA----TIHTD-SSLLLADITD-KFGQRAFVGKVC---MDLNd  168
DSSP  HHHHHHHHHLLEEEEEEEL----LLLHH-HHHHHHHHHH-HHLLEEEEELEE---LLLLl


DSSP  -----------LLLLHHHHHLLL--------LLLEEELL-LLLLlHHHHHHHHHHHHHHL
Query -----------ELVDFPALVKEG--------AFAFTDDG-VGVQtASXXYEGXIEAAKVN  171
ident                    | |             |              |    |    
Sbjct tfpeyketteeSIKETERFVSEMlqknysrvKPIVTPRFsLSCS-ETLMGELGNIAKTRD  227
DSSP  llllllllhhhHHHHHHHHHHHHhhhlllleEEEEEELLhHHLL-HHHHHHHHHHHHHHL


DSSP  LLEEELLLlhhhllllleellhhhhhhllleELLHH--------hhHHHHHHHHHHhhhl
Query KAIVAHCEdnsliyggaxhegkrskelgipgIPNIC--------esVQIARDVLLAeaag  223
ident   |  |                                                      
Sbjct LHIQSHIS---------------------enRDEVEavknlypsykNYTSVYDKNN-llt  265
DSSP  LEEEEEEL---------------------llHHHHHhhhhhlllllLHHHHHHHLL-lll


DSSP  lLEEELLLLLhhHHHHHHHHHhlLLLEEEEELHHhhhllhhhlllllhhHLLLLLLllhh
Query cHYHVCHVSTkeSVRVIRDAKraGIHVTAEVTPHhlllteddipgnnaiYKXNPPLrste  283
ident       |                         |                           
Sbjct nKTVMAHGCY--LSAEELNVF-hERGASIAHCPN-------------snLSLSSGF----  305
DSSP  lLEEEEELLL--LLHHHHHHH-hHHLLEEEELHH-------------hhHHLLLLL----


DSSP  hhhhHHHHHHL-LLLLEELLLLLlllhhhhlllllllllLLLLlLLHHHHHH--------
Query dreaLLEGLLD-GTIDCIATDHAphardekaqpxekapfGIVGsETAFPLLY--------  334
ident          |         || |                |                    
Sbjct ---lNVLEVLKhEVKIGLGTDVA----------------GGYS-YSMLDAIRravmvsni  345
DSSP  ---lLHHHHHHlLLEEEELLLLL----------------LLLL-LLHHHHHHhhhhhhhh


DSSP  --hhhlllLLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELL---LLEE-l
Query --thfvknGDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLD---SEQE-i  386
ident            ||       |        |    |        |   |      |     
Sbjct llinkvneKSLTLKEVFRLATLGGSQALGLDgeIGNFEVGKEFDAILINPKasdSPIDlf  405
DSSP  hhhlllllLLLLHHHHHHHHLHHHHHHLLLLllLLLLLLLLLLLEEEELLLlllLLLLll


DSSP  lhhhlllllllllllllEELL--EEEEEEELLEEEEE-l
Query kgedflskadntpfigyKVYG--NPILTXVEGEVKFE-g  422
ident                        |     | |       
Sbjct ygdffgdiseaviqkflYLGDdrNIEEVYVGGKQVVPfs  444
DSSP  lhhhhlllllhhhhhhhHHLLhhHEEEEEELLEEEELll


No 25: Query=3griA Sbjct=4rdvB Z-score=18.7

back to top
DSSP  lEEEEL-LEEEELlEEEE-LEEEEEL-LEEEEEEL-LLLLLllleEEELLlLEEEELEEE
Query xKLIKN-GKVLQNgELQQ-ADILIDG-KVIKQIAP-AIEPSngvdIIDAKgHFVSPGFVD   56
ident    |      |            |    |   | | |                | ||   
Sbjct -SAIFAeRALLPE-GWARnVRFEISAdGVLAEIRPdANADG----AERLG-GAVLPGMPN   53
DSSP  -LEEEEeEEEELL-EEEEeEEEEELLlLLEEEEELlLLLLL----LEELL-LLEEELEEE


DSSP  EEELLLlllLLLL----------------------------------lLHHHHHHHHHHL
Query VHVHLRepgGEYK----------------------------------eTIETGTKAAARG   82
ident  | |                                                        
Sbjct LHSHAF---QRAMaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKA  110
DSSP  EEELHH---HHHHlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHH


DSSP  LEEEEEELLLLLL------lllLHHHHHHHHHHHHhHLLLEELLLEELLH----------
Query GFTTVCPXPNTRP------vpdSVEHFEALQKLIDdNAQVRVLPYASITT----------  126
ident | | |                   |            |                      
Sbjct GYTAVAEFHYVHHdldgrsyadPAELSLRISRAAS-AAGIGLTLLPVLYShagfggqpas  169
DSSP  LEEEEEEEELLLLlllllllllLLHHHHHHHHHHH-HHLLEEEEEELLLLeeellleell


DSSP  -----HHLLLLLL--LHHHHHLLL-----lLLEEELL-LLLLlHHHHHHHHHHhHHHLLL
Query -----RQLGKELV--DFPALVKEG-----aFAFTDDG-VGVQtASXXYEGXIEaAKVNKA  173
ident         | |        |                    |                   
Sbjct egqrrFINGSEAYleLLQRLRAPLeaaghsLGLCFHSlRAVT-PQQIATVLAA-GHDDLP  227
DSSP  hhhllLLLLHHHHhhHHHHHHHHHhhhlleELEEELLlLLLL-HHHHHHHHLL-LLLLLL


DSSP  EEELLLlhhhllllleellhhhhhhllleelLHHH--------hHHHHHHHHHHHhhllL
Query IVAHCEdnsliyggaxhegkrskelgipgipNICE--------sVQIARDVLLAEaagcH  225
ident    |                                                        
Sbjct VHIHIA-----------------------eqQKEVddcqawsgrRPLQWLYENVA-vdqR  263
DSSP  EEEEEL-----------------------llHHHHhhhhhhhllLHHHHHHHHLL-lllL


DSSP  EEELLLLLhhHHHHHHHHHhlLLLEEEEELHHhhhllhhhlllllhhhLLLLLLLlhhhh
Query YHVCHVSTkeSVRVIRDAKraGIHVTAEVTPHhlllteddipgnnaiyKXNPPLRstedr  285
ident     |            |        |                                 
Sbjct WCLVHATH--ADPAEVAAM-aRSGAVAGLCLS--------------teANLGDGI-----  301
DSSP  EEEEELLL--LLHHHHHHH-hHHLLEEEELHH--------------hhHHLLLLL-----


DSSP  hHHHHHHHLLLlLEELLLLLLllhhhhlllllllllllLLLLlhHHHH------------
Query eALLEGLLDGTiDCIATDHAPhardekaqpxekapfgiVGSEtaFPLL------------  333
ident       |  |                            |                     
Sbjct fPATDFLAQGG-RLGIGSDSH-----------------VSLS--VVEElrwleygqrlrd  341
DSSP  lLHHHHHHLLL-EEEELLLLL-----------------LLLL--HHHHhhhhhhhhhhhh


DSSP  ---hhhhlllLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLEEEEELLLLEellhhh
Query ---ythfvknGDWTLQQLVDYLTIKPCETFNLEYGTLKENGYADLTIIDLDSEQeikged  390
ident                  | |              | |     |||   |           
Sbjct rkrnrlyrddQPMIGRTLYDAALAGGAQALGQPIGSLAVGRRADLLVLDGNDPY----la  397
DSSP  llllllllllLLLHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLEEEELLLLHH----hh


DSSP  llllllllllllLEEL-lEEEEEEELLEEEEEL---------------------
Query flskadntpfigYKVY-gNPILTXVEGEVKFEG---------------------  422
ident                         | |                           
Sbjct saegdallnrwlFAGGdrQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
DSSP  llllhhhhhhhhHHLLhhHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl


No 26: Query=3griA Sbjct=3irsA Z-score=16.5

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
ident                                                        |    
Sbjct ---------------------------------------------------LKIIDFRLR    9
DSSP  ---------------------------------------------------LLLEELLLL


DSSP  LLLLLLL---------------------------LLLLhHHHHHHHHHLLEEEEEELLL-
Query LREPGGE---------------------------YKETiETGTKAAARGGFTTVCPXPN-   92
ident     |                              |   |      |  |          
Sbjct PPAMGFLnariytrpdirnrftrqlgfepapsaeEKSL-ELMFEEMAAAGIEQGVCVGRn   68
DSSP  LLLHHHHhlhhhhlhhhhhhhhhhhlllllhhhhHLLH-HHHHHHHHHLLLLEEEEELLe


DSSP  ---LLLLlllhhHHHHHHHHHHHHLlLEELLLEELlhhHLLL--LLLL-HHHHHLLLLLL
Query ---TRPVpdsveHFEALQKLIDDNAqVRVLPYASIttrQLGK--ELVD-FPALVKEGAFA  146
ident       |                       |  ||         |           |   
Sbjct ssvLGSV-----SNADVAAVAKAYP-DKFHPVGSI---EAATrkEAMAqMQEILDLGIRI  119
DSSP  ellLEEL-----LHHHHHHHHHHLL-LLEEEEEEL---LLLLhhHHHHhHHHHHHLLLLL


DSSP  EEELLL---LLLL--HHHHHHHHHHHHHHLLLEEELL---LLHHHLlllleellhhhhhh
Query FTDDGV---GVQT--ASXXYEGXIEAAKVNKAIVAHC---EDNSLIyggaxhegkrskel  198
ident                    |                                        
Sbjct VNLEPGvwaTPMHvdDRRLYPLYAFCEDNGIPVIMMTggnAGPDIT--------------  165
DSSP  EEELHHhllLLLLllLHHHHHHHHHHHHLLLLEEEELlllLLLLHH--------------


DSSP  llleellhHHHHHHHHHHHHHHhhLLLEEELLLL---LHHHHHHHHHHHhlllLEEEEEL
Query gipgipniCESVQIARDVLLAEaaGCHYHVCHVS---TKESVRVIRDAKragiHVTAEVT  255
ident              | |               |       |   |                
Sbjct -------yTNPEHIDRVLGDFP--DLTVVSSHGNwpwVQEIIHVAFRRP----NLYLSPD  212
DSSP  -------hHLHHHHHHHHHHLL--LLLEEEEHHHlllHHHHHHHHHHLL----LEEEELH


DSSP  hHHHHLLhhhlllllhhhllllllllhHHHHHHHHHHHLLL--LLEELLLLLlllhhhhl
Query pHHLLLTeddipgnnaiykxnpplrstEDREALLEGLLDGT--IDCIATDHAphardeka  313
ident    |                                            |           
Sbjct -MYLYNL--------------------PGHADFIQAANSFLadRMLFGTAYP--------  243
DSSP  -HHHLLL--------------------LLHHHHHHHHLLHHhhLLLLLLLLL--------


DSSP  lllllllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllllll
Query qpxekapfgIVGSETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLeygtlkengya  373
ident                      |                |                     
Sbjct ---------MCPLKEYTEWFLTLP-----IKPDAMEKILHGNAERLLAQ-----------  278
DSSP  ---------LLLHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHHH-----------


DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel
Query dltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                                  
Sbjct ----------------------------------------------agr  281
DSSP  ----------------------------------------------lll


No 27: Query=3griA Sbjct=3cjpA Z-score=16.3

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------LIIDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LLlllllllLLHHHHHHHHHHLLEEEEEELLLLL--------------------------
Query LRepggeykETIETGTKAAARGGFTTVCPXPNTR--------------------------   94
ident             |   |     |                                     
Sbjct VI-------LPVEKHIKIMDEAGVDKTILFSTSIhpetavnlrdvkkemkklndvvngkt   61
DSSP  LL-------LLHHHHHHHHHHHLLLEEEEELLLLlhhhlllhhhhhhhhhhhhhhhllll


DSSP  --llllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLLL-----lLHHH-HHLLLLLL
Query --pvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKEL-----vDFPA-LVKEGAFA  146
ident              |   |      |                            |      
Sbjct nsmidvRRNSIKELTNVIQAYP-SRYVGFGNVP----VGLSendtnsYIEEnIVNNKLVG  116
DSSP  lllhhhHHHHHHHHHHHHHHLL-LLEEEEELLL----LLLLhhhhhhHHHHhLLLLLLLE


DSSP  EE-ELLLllLLHHHHHHHHHHHHHH-LLLEEELLLLHhhllllleellhhhhhhllleel
Query FT-DDGVgvQTASXXYEGXIEAAKV-NKAIVAHCEDNsliyggaxhegkrskelgipgip  204
ident                              |  |                           
Sbjct IGeLTPA-sGQIKSLKPIFKYSMDSgSLPIWIHAFNP-----------------------  152
DSSP  EEeELLL-lLLHHHHHHHHHHHHHLlLLLEEELLLLL-----------------------


DSSP  lhHHHHHHHHHHHHHHHHL-LLEEELLLL---LHHHHHHHHHHHhlllLEEEEELhHHHH
Query niCESVQIARDVLLAEAAG-CHYHVCHVS---TKESVRVIRDAKragiHVTAEVTpHHLL  260
ident        |     |  |         |         |                       
Sbjct --LVLQDIKEIAELCKAFPkVPVILGHMGgsnWMTAVELAKEIQ----NLYLDTS-AYFS  205
DSSP  --LLHHHHHHHHHHHHHLLlLLEEEHHHHhhhHHHHHHHHHHLL----LEEEELL-LLLL


DSSP  llhhhlllllhhhllllllllhhhHHHHHHHHHLL-lLLEELLLLLlllhhhhlllllll
Query lteddipgnnaiykxnpplrstedREALLEGLLDG-tIDCIATDHAphardekaqpxeka  319
ident                            |              ||                
Sbjct ------------------------TFVLKIVINELplKCIFGTDMP--------------  227
DSSP  ------------------------HHHHHHHHHHLllLEELLLLLL--------------


DSSP  lllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllllllleeeee
Query pfgIVGSETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLeygtlkengyadltiid  379
ident                                 |        |                  
Sbjct ---FGDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI-----------------  262
DSSP  ---LLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL-----------------


DSSP  lllleellhhhllllllllllllleelleeeeeeelleeeeel
Query ldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                            
Sbjct -------------------------------------------  262
DSSP  -------------------------------------------


No 28: Query=3griA Sbjct=2ob3A Z-score=16.3

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                     ||   | |
Sbjct -------------------------------------drintvrgpitiseaGFTLTHEH   23
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL


DSSP  LL---------------lllLLLLLLhHHHHHHHHHLLEEEEEELLLlLLLLllhhhhhh
Query LR---------------epgGEYKETiETGTKAAARGGFTTVCPXPNtRPVPdsvehfea  105
ident                              |   |   |  |                   
Sbjct ICgssagflrawpeffgsrkALAEKA-VRGLRRARAAGVRTIVDVSTfDIGR--------   74
DSSP  LEellllhhhhlhhhhllhhHHHHHH-HHHHHHHHHLLLLEEEELLLhHHLL--------


DSSP  HHHHHHHHL---LLEELLLEELlhhHLLL----------LLLLHHHHHL-------LLLL
Query LQKLIDDNA---QVRVLPYASIttrQLGK----------ELVDFPALVK-------EGAF  145
ident    |         |                             |              | 
Sbjct DVSLLAEVSraaDVHIVAATGL--wFDPPlsmrlrsveeLTQFFLREIQygiedtgIRAG  132
DSSP  LHHHHHHHHhhhLLEEELEEEL--lLLLLhhhhlllhhhHHHHHHHHHHlllllllLLLL


DSSP  LEEEL---llllLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllle
Query AFTDD---gvgvQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipg  202
ident                                   |                         
Sbjct IIXVAttgkatpFQELVLKAAARASLATGVPVTTHTA-----------------------  169
DSSP  EEEEEllllllhHHHHHHHHHHHHHHHHLLLEEEELL-----------------------


DSSP  ellhhHHHHHHHHHHHHHHHLL---LEEELLL-LLHHhHHHHHHHHHllLLEEEEE-LHH
Query ipnicESVQIARDVLLAEAAGC---HYHVCHV-STKEsVRVIRDAKRagIHVTAEV-TPH  257
ident                  |  |         |   |                         
Sbjct ----aSQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLdHIP  222
DSSP  ----hHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEElLLL


DSSP  HhhlLHHHLLLLLHHHLLllLLLLHhhHHHHHHHHHLL------lLLEELLLLLLLlhhh
Query HlllTEDDIPGNNAIYKXnpPLRSTedREALLEGLLDG------tIDCIATDHAPHarde  311
ident            |                                       |        
Sbjct Y---SAIGLEDNASASAL--LGIRS--WQTRALLIKALidqgymkQILVSNDWTFG----  271
DSSP  L---LLLLLLLLHHHHHH--HLLLL--HHHHHHHHHHHhhlllhhHEEELLLLLLE----


DSSP  hllllLLLLL------lllLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLllll
Query kaqpxEKAPF------givGSETAFPLLYTHFVkNGDWTLQQLVDYLTIKPCETFNleyg  365
ident                    |                      |       |         
Sbjct -fssyVTNIMdvmdrvnpdGMAFIPLRVIPFLR-EKGVPQETLAGITVTNPARFLS----  325
DSSP  -elllLLLHHhhhhhhlllHHHHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL----


DSSP  llllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel
Query tlkengyadltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                                          
Sbjct -----------------------------------------------------ptlr  329
DSSP  -----------------------------------------------------llll


No 29: Query=3griA Sbjct=2ffiA Z-score=15.6

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
ident                                                        | | |
Sbjct -------------------------------------------------lhLTAIDSHAH   11
DSSP  -------------------------------------------------llLLLEELLLL


DSSP  LLL----------llLLLLLLHHHHHHHHHHLLEEEEEELLLLLLLLllhhHHHHHHHHH
Query LRE----------pgGEYKETIETGTKAAARGGFTTVCPXPNTRPVPdsveHFEALQKLI  110
ident                  |              ||                     |    
Sbjct VFSrglnlasqrryaPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGT----DNRYLLSAL   67
DSSP  LLLhhhhhhllllllLLLLLLHHHHHHHHHHLLLLEELLLLLHHHLL----LLHHHHHHH


DSSP  HHHlllEELLLEELLhhhllLLLL--LHHHHHLLLLLLEEELLL--llLLHH--HHHHHH
Query DDNaqvRVLPYASITtrqlgKELV--DFPALVKEGAFAFTDDGV--gvQTAS--XXYEGX  164
ident                                   |                         
Sbjct QTV-pgQLRGVVXLE-----RDVEqaTLAEXARLGVRGVRLNLXgqdxPDLTgaQWRPLL  121
DSSP  HHL-llLLLLLLLLL-----LLLLhhHHHHHHLLLLLEEELLLLllllLLLLllLLHHHH


DSSP  HHHHHHLLLEEELLllhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHHHHLL
Query IEAAKVNKAIVAHCednsliyggaxhegkrskelgipgipnicESVQIARDVLLAEAAGC  224
ident             |                                  |   |      | 
Sbjct ERIGEQGWHVELHR-----------------------------QVADIPVLVRALQPYGL  152
DSSP  HHHHHHLLEEEELL-----------------------------LLLLHHHHHHHHLLLLL


DSSP  LEEELL-LLLH-------HHHHHHHHHhHLLLLEEEEELHHHhhllhhhlllllhhhlll
Query HYHVCH-VSTK-------ESVRVIRDAkRAGIHVTAEVTPHHlllteddipgnnaiykxn  276
ident      |                           |   |                      
Sbjct DIVIDHfGRPDarrglgqPGFAELLTL-SGRGKVWVKVSGIY------------------  193
DSSP  LEEELHhHLLLlllllllLLHHHHLLL-LLLLLEEEEEELHH------------------


DSSP  LLLL----lhHHHHHHHHHHHLLL---lLEELLLLLLllhhhhlllllllLLLL--LLLL
Query PPLR----stEDREALLEGLLDGT---iDCIATDHAPhardekaqpxekaPFGI--VGSE  327
ident                 |  |             |                      |   
Sbjct RLQGspeenlAFARQALCALEAHYgaerLXWGSDWPH-------------TQHEseVSFG  240
DSSP  HLLLlhhhhhHHHHHHHHHHHHHLlhhhEEEELLLLL-------------LLLLllLLHH


DSSP  LHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLLlllllllllleeeeelllleell
Query TAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLEYgtlkengyadltiidldseqeik  387
ident  |                |     |       |  |                        
Sbjct SAVEQFEALG-----CSAQLRQALLLDTARALFGFEL-----------------------  272
DSSP  HHHHHHHHHL-----LLHHHHHHHHLHHHHHHLLLLL-----------------------


DSSP  hhhllllllllllllleelleeeeeeelleeeeel
Query gedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                    
Sbjct ----------------------------------e  273
DSSP  ----------------------------------l


No 30: Query=3griA Sbjct=1bf6A Z-score=15.5

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
ident                                                     |    | |
Sbjct -----------------------------------------------sfdpTGYTLAHEH   13
DSSP  -----------------------------------------------llllLLEEEEEEL


DSSP  LLLL----------LLLLllLHHHHHHHHHHLLEEEEEELLLlLLLLllhhhhhhHHHHH
Query LREP----------GGEYkeTIETGTKAAARGGFTTVCPXPNtRPVPdsvehfeaLQKLI  110
ident |                    |          |   |    |                  
Sbjct LHIDlsgfknnvdcRLDQyaFICQEMNDLMTRGVRNVIEMTNrYMGR--------NAQFM   65
DSSP  LLEElhhhhllhhhEELLhhHHHHHHHHHHHLLEEEEEELLLhHHLL--------LHHHH


DSSP  HHHL---LLEELLLEELlhhHLLL-------------LLLLHHHHHL-------LLLLLE
Query DDNA---QVRVLPYASIttrQLGK-------------ELVDFPALVK-------EGAFAF  147
ident  |        |                                             |   
Sbjct LDVMretGINVVACTGY---YQDAffpehvatrsvqeLAQEMVDEIEqgidgteLKAGII  122
DSSP  HHHHhhhLLEEEEEELL---LLHHhlllhhhhllhhhHHHHHHHHHHlllllllLLEEEE


DSSP  E-ELLL----llLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllle
Query T-DDGV----gvQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipg  202
ident                                |  |                         
Sbjct AeIGTSegkitpLEEKVFIAAALAHNQTGRPISTHTS-----------------------  159
DSSP  EeEELLlllllhHHHHHHHHHHHHHHHHLLLEEEELH-----------------------


DSSP  ellhHHHHhHHHHHHHHHHHLL---LEEELLLL---LHHHHHHHHHHHhllllEEEEE-L
Query ipniCESVqIARDVLLAEAAGC---HYHVCHVS---TKESVRVIRDAKragihVTAEV-T  255
ident                |  | |       | |              |             |
Sbjct ----FSTM-GLEQLALLQAHGVdlsRVTVGHCDlkdNLDNILKMIDLG-----AYVQFdT  209
DSSP  ----HHLL-HHHHHHHHHHLLLlhhHEEELLLLlllLHHHHHHHHHLL-----LEEEElL


DSSP  HHHhhllhhhlllllhhhllllLLLLHHHHHHHHHHH--HLLLLLEELLLLLLLLhhhhl
Query PHHlllteddipgnnaiykxnpPLRSTEDREALLEGL--LDGTIDCIATDHAPHArdeka  313
ident                                 |                |          
Sbjct IGK-----------------nsYYPDEKRIAMLHALRdrGLLNRVMLSMDITRRS-----  247
DSSP  LLL-----------------llLLLHHHHHHHHHHHHhlLLHHHEEELLLLLLHH-----


DSSP  lllllllllLLLLlLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLllllllllllll
Query qpxekapfgIVGSeTAFPLLYTHFVkNGDWTLQQLVDYLTIKPCETFNleygtlkengya  373
ident                                       |   |   |             
Sbjct --hlkanggYGYD-YLLTTFIPQLR-QSGFSQADVDVMLRENPSQFFQ------------  291
DSSP  --hlhhhllLLLL-HHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHLL------------


DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel
Query dltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                                  
Sbjct -------------------------------------------------  291
DSSP  -------------------------------------------------


No 31: Query=3griA Sbjct=2imrA Z-score=15.5

back to top
DSSP  leeeELLE---eeelLEEEELEEEeelleeEEEELL--------LLLLllleeeelLLLE
Query xkliKNGK---vlqnGELQQADILidgkviKQIAPA--------IEPSngvdiidaKGHF   49
ident                                  | |          |             
Sbjct htprLLTCdvlytgaQSPGGVVVV-----gETVAAAghpdelrrQYPH----aaeeRAGA   51
DSSP  lleeEEEEleeelleELLEEEEEE-----lLEEEEEelhhhhhhHLLL----leeeELLL


DSSP  -EEELEEEEEELLL------------------------LLLLLlllLHHHHHHHHHHLLE
Query -VSPGFVDVHVHLR------------------------EPGGEykeTIETGTKAAARGGF   84
ident    |  |  | ||                           |         |     | | 
Sbjct vIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhLRGVA---AAQAGADTLTRLGA  108
DSSP  eELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllLLHHH---HHHHHHHHHHHLLL


DSSP  EEEEELLLLLLllllhhhHHHHHhHHHHhllLEELLLEELlhhHLLL--------LLLL-
Query TTVCPXPNTRPvpdsvehFEALQkLIDDnaqVRVLPYASIttrQLGK--------ELVD-  135
ident   |                 ||     |        |                       
Sbjct GGVGDIVWAPE------vMDALL-ARED---LSGTLYFEV---LNPFpdkadevfAAARt  155
DSSP  LLEEEEELLHH------hHHHHH-LLLL---LLEEEEEEE---LLLLhhhhhhhhHHHHh


DSSP  -HHHHHLLL----LLLEEELL-LLLLlHHHHHHHHHHHHHHLLLEEELLL----LHHH--
Query -FPALVKEG----AFAFTDDG-VGVQtASXXYEGXIEAAKVNKAIVAHCE----DNSL--  183
ident                         |            ||        |            
Sbjct hLERWRRLErpglRLGLSPHTpFTVS-HRLMRLLSDYAAGEGLPLQIHVAehptELEMfr  214
DSSP  hHHHHHLLLllleEEEEEELLlLLLL-HHHHHHHHHHHHHHLLLLEEEELllhhHHHHhh


DSSP  -----LLLLleellhhhhhhllleellhhhhHHHHHHH--HHHHhhlLLEEELLLLLHHh
Query -----IYGGaxhegkrskelgipgipnicesVQIARDV--LLAEaagCHYHVCHVSTKEs  236
ident                                                      |      
Sbjct tgggpLWDNrmpalyphtlaevigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVT-  270
DSSP  hllllLHHHllhhhllllhhhhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLL-


DSSP  hHHHHHHHHllLLEEEEELHHHHHLlhhhlllllhhhlllLLLLlhhhhhhHHHHHHL-L
Query vRVIRDAKRagIHVTAEVTPHHLLLteddipgnnaiykxnPPLRstedreaLLEGLLD-G  295
ident    |    |          |                                       |
Sbjct pDDIARVAR--AGCAVVTCPRSNHH---------------LECG-----tfDWPAFAAaG  308
DSSP  hHHHHHHHH--HLLLEEELHHHHHH---------------LLLL-----llLHHHHHHlL


DSSP  LLLEELLLLLLllhhhhlllllllllLLLLLL--LHHHHHHHHHlllLLLLHHHHHHHHL
Query TIDCIATDHAPhardekaqpxekapfGIVGSE--TAFPLLYTHFvknGDWTLQQLVDYLT  353
ident       ||                                              ||    
Sbjct VEVALGTDSVA---------------SGETLNvrEEVTFARQLY---PGLDPRVLVRAAV  350
DSSP  LLEEELLLLHH---------------HHLLLLlhHHHHHHHHHL---LLLLHHHHHHHHH


DSSP  HHHHHHLLlllLLLLL--lllllEEEEElllleellhhhllllllllllllleelleeEE
Query IKPCETFNleyGTLKE--ngyadLTIIDldseqeikgedflskadntpfigykvygnpIL  411
ident                                                             
Sbjct KGGQRVVG---TPFLRrgetwqeGFRWE------------------------------LS  377
DSSP  HHHHHHHL---LLLLLllllllhHHLHH------------------------------HL


DSSP  EEelleeeeel
Query TXvegevkfeg  422
ident            
Sbjct RD--------l  380
DSSP  LL--------l


No 32: Query=3griA Sbjct=2dvtA Z-score=15.4

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                     | |    |
Sbjct --------------------------------------------------MQGKVALEEH   10
DSSP  --------------------------------------------------LLLEEEEEEE


DSSP  lLLLL----------------lLLLL--LHHH-HHHHHHHLLEEEEEELLL---------
Query lREPG----------------gEYKE--TIET-GTKAAARGGFTTVCPXPN---------   92
ident                              |     |     |  |     |         
Sbjct -FAIPetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSLNapavqaipd   69
DSSP  -ELLHhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEELllhhhhlll


DSSP  -llllllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLLL----LLHHHHHL-LLLLL
Query -trpvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKEL----VDFPALVK-EGAFA  146
ident               |          | |  |                     |   |   
Sbjct rrkaieiARRANDVLAEECAKRP-DRFLAFAALP----LQDPdaatEELQRCVNdLGFVG  124
DSSP  hhhhhhhHHHHHHHHHHHHHHLL-LLEEEEELLL----LLLHhhhhHHHHHHHHlLLLLE


DSSP  EEELLLL--------lLLHH-HHHHHHHHHHHHLLLEEELLLLHH--------hlLLLLE
Query FTDDGVG--------vQTAS-XXYEGXIEAAKVNKAIVAHCEDNS--------liYGGAX  189
ident     |                       |  |       |                    
Sbjct ALVNGFSqegdgqtplYYDLpQYRPFWGEVEKLDVPFYLHPRNPLpqdsriydghPWLLG  184
DSSP  EEEELLLlllllllllLLLLhHHHHHHHHHHHHLLLEEEELLLLLhhhlhhhlllHHHLH


DSSP  EllhhhhhhlllEELL-HHHHHHHHHHH--HHHHHHL-LLEEEL-LLLLhhHHHH-----
Query HegkrskelgipGIPN-ICESVQIARDV--LLAEAAG-CHYHVC-HVSTkeSVRV-----  239
ident                      |   |     |                            
Sbjct P-----------TWAFaQETAVHALRLMasGLFDEHPrLNIILGhMGEG--LPYMmwrid  231
DSSP  H-----------HLHHhHHHHHHHHHHHhlLHHHHLLlLLEEELhHHLL--HHHHhhhhh


DSSP  -----------------hHHHHHllLLEEEEELhHHHHllhhhlllllhhhllllllllh
Query -----------------iRDAKRagIHVTAEVTpHHLLlteddipgnnaiykxnpplrst  282
ident                    |                                        
Sbjct hrnawvklpprypakrrfMDYFN--ENFHITTS-GNFR----------------------  266
DSSP  hllllllllllllllllhHHHHH--HHEEEELL-LLLL----------------------


DSSP  hhhHHHHHHhHLLL---LLEELLLLLlllhhhhlllllllllLLLLlLLHHHHHHHHHll
Query edrEALLEGlLDGT---IDCIATDHAphardekaqpxekapfGIVGsETAFPLLYTHFvk  339
ident      |                ||                         |          
Sbjct --tQTLIDA-ILEIgadRILFSTDWP----------------FENI-DHASDWFNATS--  304
DSSP  --hHHHHHH-HLLLlhhHEELLLLLL----------------LLLH-HHHHHHHHHLL--


DSSP  lllLLHHHHHHHHLHHHHHHLLLLllllllllllleeeeelllleellhhhlllllllll
Query ngdWTLQQLVDYLTIKPCETFNLEygtlkengyadltiidldseqeikgedflskadntp  399
ident          |          | |                                     
Sbjct ---IAEADRVKIGRTNARRLFKLD------------------------------------  325
DSSP  ---LLHHHHHHHHLHHHHHHLLLL------------------------------------


DSSP  lllleelleeeeeeelleeeeel
Query figykvygnpiltxvegevkfeg  422
ident                        
Sbjct -----------------------  325
DSSP  -----------------------


No 33: Query=3griA Sbjct=4qrnA Z-score=15.3

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeellllEEEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghFVSPGFVDVHVH   60
ident                                                             
Sbjct --------------------------------------smtqdlktggEQGYLRIATEEA   22
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE


DSSP  lLLLL------------------------------------LLLL-LLHH-HHHHHHHHL
Query lREPG------------------------------------GEYK-ETIE-TGTKAAARG   82
ident                                                             
Sbjct -FATReiidvylrmirdgtadkgmvslwgfyaqspseratqILERlLDLGeRRIADMDAT   81
DSSP  -ELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhHHHHhHLLLhHHHHHHHHL


DSSP  LEEEEEELLL----------llllllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLL
Query GFTTVCPXPN----------trpvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKE  132
ident |                                |          |               
Sbjct GIDKAILALTspgvqplhdldeartlATRANDTLADACQKYP-DRFIGMGTVA----PQD  136
DSSP  LLLEEEEEELlllllllllhhhhhhhHHHHHHHHHHHHHHLL-LLEEELLLLL----LLL


DSSP  L----LLHHHHHL-LLLLLEEELLLL--lLLHH-HHHHHHHHHHHHLLLEEELLLLHH--
Query L----VDFPALVK-EGAFAFTDDGVG--vQTAS-XXYEGXIEAAKVNKAIVAHCEDNS--  182
ident                |                             |      |       
Sbjct PewsaREIHRGAReLGFKGIQINSHTqgrYLDEeFFDPIFRALVEVDQPLYIHPATSPds  196
DSSP  HhhhhHHHHHHHHlLLLLLEEELLLLlllLLLLhHHHHHHHHHHHHLLLEEELLLLLLll


DSSP  HLLLLLeellhhhhhhlLLEE-----lLHHHHHHHHHHH--HHHHHHL-LLEEELLLLLh
Query LIYGGAxhegkrskelgIPGI-----pNICESVQIARDV--LLAEAAG-CHYHVCHVSTk  234
ident  |                                  |                | |    
Sbjct MIDPML----------eAGLDgaifgfGVETGMHLLRLItiGIFDKYPsLQIMVGHMGE-  245
DSSP  LLHHHH----------hHLLLllllhhHHHHHHHHHHHHhhLHHHHLLlLLEEELHHHH-


DSSP  HHHH--------------------------hhHHHHHllLLEEEEELhHHHHllhhhlll
Query ESVR--------------------------viRDAKRagIHVTAEVTpHHLLlteddipg  268
ident                                          |                  
Sbjct ALPYwlyrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW--------  294
DSSP  LHHHhhhhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL--------


DSSP  llhhhllllllllhhhhHHHHHHHHLLL--LLEELLLLLlllhhhhlllllllllLLLLl
Query nnaiykxnpplrstedrEALLEGLLDGT--IDCIATDHAphardekaqpxekapfGIVGs  326
ident                   |               | |                       
Sbjct ----------------ePAIKFCQQVMGedRVMYAMDYP----------------YQYV-  321
DSSP  ----------------hHHHHHHHHHHLhhHEELLLLLL----------------LLLL-


DSSP  LLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllllllleeeeelllleel
Query ETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLeygtlkengyadltiidldseqei  386
ident                    |             | |                        
Sbjct ADEVRAMDAMD-----MSAQTKKKFFQTNAEKWFKL------------------------  352
DSSP  HHHHHHHHLLL-----LLHHHHHHHHLHHHHHHLLL------------------------


DSSP  lhhhllllllllllllleelleeeeeeelleeeeel
Query kgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                     
Sbjct ------------------------------------  352
DSSP  ------------------------------------


No 34: Query=3griA Sbjct=2vc5A Z-score=15.1

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                     ||   | |
Sbjct ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL


DSSP  LLLLL-------------lllllLHHHHHHHHHHLLEEEEEELL---LLLLllllhhhhh
Query LREPG-------------geykeTIETGTKAAARGGFTTVCPXP---NTRPvpdsvehfe  104
ident ||                           | |   |  |          |          
Sbjct LRVFSeavrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTvmgLGRD---------   75
DSSP  LLLLLhhhhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLlllLLLL---------


DSSP  hhHHHHHHHL---LLEELLLEELlhhHLLL-------------LLLLHHHHHL-------
Query alQKLIDDNA---QVRVLPYASIttrQLGK-------------ELVDFPALVK-------  141
ident                       |                        |    |       
Sbjct --IRFMEKVVkatGINLVAGTGI---YIYIdlpfyflnrsideIADLFIHDIKegiqgtl  130
DSSP  --HHHHHHHHhllLLEEEELEEL---LLLLlllhhhllllhhhHHHHHHHHHHlllllll


DSSP  LLLLLEEEL----llllLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhh
Query EGAFAFTDD----gvgvQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrske  197
ident   |                        |        |  |                    
Sbjct NKAGFVXIAadepgitkDVEKVIRAAAIANKETKVPIITHSN------------------  172
DSSP  LLLLLEEEElllllllhHHHHHHHHHHHHHHHHLLLEEEELL------------------


DSSP  hllleellhHHHHHHHHHHHHHHHHLL---LEEELLLL---LHHHHHHHHHHHhllllEE
Query lgipgipniCESVQIARDVLLAEAAGC---HYHVCHVS---TKESVRVIRDAKragihVT  251
ident                          |         |            | |         
Sbjct ---------AHNNTGLEQQRILTEEGVdpgKILIGHLGdtdNIDYIKKIADKG-----SF  218
DSSP  ---------LLLLHHHHHHHHHHHLLLlhhHEEELLHHhllLHHHHHHHHHLL-----LE


DSSP  EEELhhhhhllhhhlllllhhhLLLLLLllhhhHHHHHHHHHLLL--LLEELLLLLL---
Query AEVTphhlllteddipgnnaiyKXNPPLrstedREALLEGLLDGT--IDCIATDHAP---  306
ident                                   |  |    ||      |  |      
Sbjct IGLD---------------rygLDLFLP-vdkrNETTLRLIKDGYsdKIMISHDYCCtid  262
DSSP  EEEL---------------lllLLLLLL-hhhhHHHHHHHHHLLLllLEEELLLLLLlll


DSSP  ---LLHHHHlllllLLLL-lLLLLlLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLl
Query ---HARDEKaqpxeKAPF-gIVGSeTAFPLLYTHFVkNGDWTLQQLVDYLTIKPCETFNl  362
ident         |                  |                         |   |  
Sbjct wgtAKPEYK-----PKLAprWSIT-LIFEDTIPFLK-RNGVNEEVIATIFKENPKKFFS-  314
DSSP  lllLLHHHH-----HHHLllLLLL-HHHHLHHHHHH-LLLLLHHHHHHHHLHHHHHHLL-


DSSP  lllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel
Query eygtlkengyadltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


No 35: Query=3griA Sbjct=3k2gB Z-score=15.1

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                     |    | |
Sbjct -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL


DSSP  LLLL----------------------------------------LLLLllLHHHHHHHHH
Query LREP----------------------------------------GGEYkeTIETGTKAAA   80
ident |                                                       |  |
Sbjct LQNDcrcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDldLAIAEVKQFA   95
DSSP  LLEElhhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLhhHHHHHHHHHH


DSSP  HLLEEEEEELLLlLLLLllhhhhhhHHHHHHHHL---LLEELLLEEllhHHLL-------
Query RGGFTTVCPXPNtRPVPdsvehfeaLQKLIDDNA---QVRVLPYASittRQLG-------  130
ident   |                                   | |   |      |        
Sbjct AVGGRSIVDPTCrGIGR--------DPVKLRRISaetGVQVVXGAG---YYLAssxpeta  144
DSSP  HLLLLEEEELLLlLLLL--------LHHHHHHHHhhhLLEEEELLL---LLLHhhllhhh


DSSP  -----LLLL-LHHHHHL-------LLLLLEE-ELLL---llLLHHHHHHHHHHHHHHLLL
Query -----KELV-DFPALVK-------EGAFAFT-DDGV---gvQTASXXYEGXIEAAKVNKA  173
ident              |                                              
Sbjct arlsaDDIAdEIVAEALegtdgtdARIGLIGeIGVSsdftaEEEKSLRGAARAQVRTGLP  204
DSSP  hlllhHHHHhHHHHHHHlllllllLLLLLEEeELLLllllhHHHHHHHHHHHHHHHHLLL


DSSP  EEELLLlhhhllllleellhhhhhhllleellhHHHHhHHHHHHHHHHHLLL---EEELL
Query IVAHCEdnsliyggaxhegkrskelgipgipniCESVqIARDVLLAEAAGCH---YHVCH  230
ident    |                                    |   | |  |        ||
Sbjct LXVHLP--------------------------gWFRL-AHRVLDLVEEEGADlrhTVLCH  237
DSSP  EEELLL--------------------------lLLLL-HHHHHHHHHHLLLLhhhEEELL


DSSP  L-LLHH---HHHHHHHHHhllllEEEEE-LHHHhhllhhhlllllhHHLL---llLLLL-
Query V-STKE---SVRVIRDAKragihVTAEV-TPHHlllteddipgnnaIYKX---npPLRS-  281
ident                           |                               | 
Sbjct XnPSHXdpvYQATLAQRG-----AFLEFdXIGX-------------DFFYadqgvQCPSd  279
DSSP  LhHHLLlhhHHHHHHHHL-----LEEEElLLLL-------------LLEElllleELLLh


DSSP  hhhHHHHHHHHHLLL--LLEELLLLLLLLhhhhllllllllllLLLLLLHHHHHHHHHLl
Query tedREALLEGLLDGT--IDCIATDHAPHArdekaqpxekapfgIVGSETAFPLLYTHFVk  339
ident      | |     |         |                     |              
Sbjct devARAILGLADHGYldRILLSHDVFVKX--------xltrygGNGYAFVTKHFLPRLR-  330
DSSP  hhhHHHHHHHHHLLLhhHEEELLLLLLHH--------hlhhhlLLLLLHHHHLHHHHHH-


DSSP  LLLLLHHHHHHHHLHHHHHHLLLLllllllllllleeeeelllleellhhhlllllllll
Query NGDWTLQQLVDYLTIKPCETFNLEygtlkengyadltiidldseqeikgedflskadntp  399
ident         |       |   |                                       
Sbjct RHGLDDAALETLXVTNPRRVFDAS------------------------------------  354
DSSP  HLLLLHHHHHHHHLHHHHHHHLLL------------------------------------


DSSP  lllleelleeeeeeelleeeeel
Query figykvygnpiltxvegevkfeg  422
ident                        
Sbjct -------------------iegh  358
DSSP  -------------------llll


No 36: Query=3griA Sbjct=4mupB Z-score=15.0

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                     | ||   |
Sbjct ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
DSSP  ------------------------------------llllllllllllllLLLLEELLLL


DSSP  lLLLL------------llLLLLHHHHHHHHHHLLEEEEEELLLLLLLlLLHHHHHHHHH
Query lREPG------------geYKETIETGTKAAARGGFTTVCPXPNTRPVpDSVEHFEALQK  108
ident                         |         |   |                 |   
Sbjct -MYLPgypalpggpglppgALPGPEDYRRLMQWLGIDRVIITQGNAHQ-RDNGNTLACVA   82
DSSP  -LLLLllllllllllllllLLLLHHHHHHHHHHHLLLEEEEELLHHHL-LLLHHHHHHHH


DSSP  HHHhhlllEELLLEELLhhhlllLLLL---HHHHHLLLLLLEEEL----LLLLLLhhHHH
Query LIDdnaqvRVLPYASITtrqlgkELVD---FPALVKEGAFAFTDD----GVGVQTasXXY  161
ident                |                 |   |           |          
Sbjct EMG----eAAHAVVIID------ATTTekdMEKLTAAGTVGARIMdlpgGAVNLS--ELD  130
DSSP  HHH----hHEEEEELLL------LLLLhhhHHHHHHLLEEEEEEEllllLLLLHH--HHH


DSSP  HHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhHHHHhHHHHHHHHhh
Query EGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipniCESVqIARDVLLAea  221
ident      |                                                      
Sbjct AVDERAHAADWMVAVQFD--------------------------gNGLLdHLPRLQKI--  162
DSSP  HHHHHHHHLLLEEEEELL--------------------------hHHHHhHHHHHHLL--


DSSP  hLLLEEELLLL--------lhHHHHHHHHHHHlLLLEEEEELHHhhhllhhhlllllhhh
Query aGCHYHVCHVS--------tkESVRVIRDAKRaGIHVTAEVTPHhlllteddipgnnaiy  273
ident         |                                                   
Sbjct -RSRWVFDHHGkffkgirtdgPEMAALLKLID-RGNLWFKFAGV----------------  204
DSSP  -LLEEEELHHHhlllllllllHHHHHHHHHHH-HLLEEEEELLH----------------


DSSP  lllLLLLL----HHHHHHHHHHHHLL-llLEELLLLLLLlhhHHLLlllllllLLLLlLL
Query kxnPPLRS----TEDREALLEGLLDG-tiDCIATDHAPHardEKAQpxekapfGIVGsET  328
ident       |                          |                          
Sbjct --yESSRKswpyADVAAFSRVIAAHAperIVWGTNWPHN-svRETA------aYPDD-AR  254
DSSP  --hHLLLLllllHHHHHHHHHHHHHLhhhEEELLLLLLL-llLLHH------hLLLH-HH


DSSP  HHHHHHHhhlllllLLHHHHHHHHLHHHHHHLLLLLLllllllllleeeeelllleellh
Query AFPLLYThfvkngdWTLQQLVDYLTIKPCETFNLEYGtlkengyadltiidldseqeikg  388
ident    |                   |   |   | |                          
Sbjct LAELTLG-----wlPDEAARHRALVENPEALFKLSPV-----------------------  286
DSSP  HHHHHHL-----llLLHHHHHHHHLHHHHHHHLLLLL-----------------------


DSSP  hhllllllllllllleelleeeeeeelleeeeel
Query edflskadntpfigykvygnpiltxvegevkfeg  422
ident                                   
Sbjct ----------------------------------  286
DSSP  ----------------------------------


No 37: Query=3griA Sbjct=1a4mA Z-score=15.0

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                       |  |||
Sbjct ----------------------------------------------tpafNKPKVELHVH   14
DSSP  ----------------------------------------------llllLLLEEEEEEE


DSSP  LLlllLLLL---------------------------------------------------
Query LRepgGEYK---------------------------------------------------   69
ident |                                                           
Sbjct LD-gaIKPEtilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcr   73
DSSP  HH-hlLLHHhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllh


DSSP  ----lLHHHHHHHHHHLLEEEEEELLLLLLL----------------llLHHHHHHHHHH
Query ----eTIETGTKAAARGGFTTVCPXPNTRPV----------------pdSVEHFEALQKL  109
ident               |  |   |                                      
Sbjct eaikrIAYEFVEMKAKEGVVYVEVRYSPHLLanskvdpmpwnqtegdvtPDDVVDLVNQG  133
DSSP  hhhhhHHHHHHHHHHHLLEEEEEEEELLHHHllllllllhhhlllllllHHHHHHHHHHH


DSSP  HHHHL---LLEELLLEELLhhHLLL-LLLL-HHHHHLLL---LLLEEELLL---llLLHH
Query IDDNA---QVRVLPYASITtrQLGK-ELVD-FPALVKEG---AFAFTDDGV---gvQTAS  158
ident            |                        |       |    |          
Sbjct LQEGEqafGIKVRSILCCM--RHQPsWSLEvLELCKKYNqktVVAMDLAGDetiegSSLF  191
DSSP  HHHHHhhhLLEEEEEEEEE--LLLHhHHHHhHHHHHHLLlllEEEEEEELLlllllHHHL


DSSP  -HHHHHHHHHHHHLLLEEELLllhhhllllleellhhhhhhllleellhHHHHHHHHHHH
Query -XXYEGXIEAAKVNKAIVAHCednsliyggaxhegkrskelgipgipniCESVQIARDVL  217
ident     |    | |       |                                      | 
Sbjct pGHVEAYEGAVKNGIHRTVHA-------------------------gevGSPEVVREAVD  226
DSSP  hHHHHHHHHHHHHLLEEEEEE-------------------------lllLLHHHHHHHHH


DSSP  HHhhhlLLEEELLLLlhHHHH---HHHHHHHLlllEEEEELHHhhhllhhhlllllhhhl
Query LAeaagCHYHVCHVStkESVR---VIRDAKRAgihVTAEVTPHhlllteddipgnnaiyk  274
ident           | |                         || |                  
Sbjct IL----KTERVGHGY--HTIEdeaLYNRLLKE--nMHFEVCPW--------------ssy  264
DSSP  LL----LLLEEEELH--HHHHlhhHHHHHHHL--lLEEEELHH--------------hhh


DSSP  LLLLLLLHHHHhHHHHHHHLLLLLEELLLLLLLlhhhhlllllllllLLLLLLLHHHHHH
Query XNPPLRSTEDReALLEGLLDGTIDCIATDHAPHardekaqpxekapfGIVGSETAFPLLY  334
ident             |      |       ||                        |      
Sbjct LTGAWDPKTTH-AVVRFKNDKANYSLNTDDPLI--------------FKSTLDTDYQMTK  309
DSSP  HLLLLLLLLLL-HHHHHHHLLLLEEELLLLLLL--------------LLLLHHHHHHHHH


DSSP  HHHLllllLLHHHHHHHHlHHHHHHLLL------LLLL--LLLLlllleeeeelllleel
Query THFVkngdWTLQQLVDYLtIKPCETFNL------EYGT--LKENgyadltiidldseqei  386
ident          |         |       |      |       |                 
Sbjct KDMG----FTEEEFKRLN-INAAKSSFLpeeekkELLErlYREY----------------  348
DSSP  HLLL----LLHHHHHHHH-HHHHHLLLLlhhhhhHHHHhhHHHL----------------


DSSP  lhhhllllllllllllleelleeeeeeelleeeeel
Query kgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                     
Sbjct -----------------------------------q  349
DSSP  -----------------------------------l


No 38: Query=3griA Sbjct=4ofcA Z-score=14.9

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------MKIDIHSH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  lLLLL-----------------------------------lLLLL--LHHHHHHHHHHLL
Query lREPG-----------------------------------gEYKE--TIETGTKAAARGG   83
ident    |                                             |         |
Sbjct -ILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvVRENcwDPEVRIREMDQKG   67
DSSP  -LLLLllllhhhhhllllleeeeeeelleeeeeelleeeeeEEHHhlLHHHHHHHHHHHL


DSSP  EEEEEELLL----------llllllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLLL
Query FTTVCPXPN----------trpvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKEL  133
ident  |                              |          |                
Sbjct VTVQALSTVpvmfsywakpedtlnlCQLLNNDLASTVVSYP-RRFVGLGTLP----MQAP  122
DSSP  LLEEEEELLhhhhlllllhhhhhhhHHHHHHHHHHHHHHLL-LLEEEEELLL----LLLH


DSSP  ----LLHHHHHL-LLLLLEEELLLL----llLHHHhHHHHHHHHHHLLLEEELLLLhhHL
Query ----VDFPALVK-EGAFAFTDDGVG----vqTASXxYEGXIEAAKVNKAIVAHCEDnsLI  184
ident           ||  |                           |         |  |    
Sbjct elavKEMERCVKeLGFPGVQIGTHVnewdlnAQEL-FPVYAAAERLKCSLFVHPWD--MQ  179
DSSP  hhhhHHHHHHHHlLLLLEEEEELEElleellLHHH-HHHHHHHHHHLLEEEEELLL--LL


DSSP  LL-------LLEELlhhhhhhllleelLHHHHHHHHHHH--HHHHHHL-LLEEEL-LLLL
Query YG-------GAXHEgkrskelgipgipNICESVQIARDV--LLAEAAG-CHYHVC-HVST  233
ident                                   |         |               
Sbjct MDgrmakywLPWLV-----------gmPAETTIAICSMImgGVFEKFPkLKVCFAhGGGA  228
DSSP  LLhhhhlllHHHHL-----------hhHHHHHHHHHHHHllLHHHHLLlLLEEELhHHLL


DSSP  hhHHHH----------------------hHHHHhlllLEEEEELhHHHHllhhhlllllh
Query keSVRV----------------------iRDAKragiHVTAEVTpHHLLlteddipgnna  271
ident                                               |             
Sbjct --FPFTvgrishgfsmrpdlcaqdnpmnpKKYL---gSFYTDAL-VHDP-----------  271
DSSP  --HHHHhhhhhhhhhhlhhhhlllllllhHHHL---lLLEEELL-LLLH-----------


DSSP  hhllllllllhhhhHHHHHHHhLLLL---LEELLLLLLllhhhhlllllllllLLLLlLL
Query iykxnpplrstedrEALLEGLlDGTI---DCIATDHAPhardekaqpxekapfGIVGsET  328
ident                 |     |          ||                         
Sbjct --------------LSLKLLT-DVIGkdkVILGTDYPF---------------PLGE-LE  300
DSSP  --------------HHHHHHH-HHHLlllEELLLLLLL---------------LLLL-LL


DSSP  HHHHHHHHHllllLLLHHHHHHHHLHHHHHHLLLLLlllllllllleeeeelllleellh
Query AFPLLYTHFvkngDWTLQQLVDYLTIKPCETFNLEYgtlkengyadltiidldseqeikg  388
ident    |                             ||                         
Sbjct PGKLIESME----EFDEETKNKLKAGNALAFLGLER------------------------  332
DSSP  LLHHHHHLL----LLLHHHHHHHHLHHHHHHHLLLH------------------------


DSSP  hhllllllllllllleelleeeeeeelleeeeel
Query edflskadntpfigykvygnpiltxvegevkfeg  422
ident                                   
Sbjct -------------------------------kqf  335
DSSP  -------------------------------hhl


No 39: Query=3griA Sbjct=4hk5D Z-score=14.4

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                    |  || | |
Sbjct --------------------------------------------------TPVVVDIHTH   10
DSSP  --------------------------------------------------LLLLEEEEEE


DSSP  lLLLL---------------------------------------------------LLLL
Query lREPG---------------------------------------------------GEYK   69
ident    |                                                        
Sbjct -MYPPsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpLSTH   69
DSSP  -ELLHhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleeLLHH


DSSP  L-LHHHHHHHHHHLLEEEEEELLL---------llllllLHHHHHHHHHHHHHhLLLEEL
Query E-TIETGTKAAARGGFTTVCPXPN---------trpvpdSVEHFEALQKLIDDnAQVRVL  119
ident               |                                          |  
Sbjct FaSLAQKMHFMDTNGIRVSVISLAnpwfdflapdeapgiADAVNAEFSDMCAQ-HVGRLF  128
DSSP  HlLHHHHHHHHHHLLLLEEEEEELlllllllllllhhhhHHHHHHHHHHHHHL-LLLLEE


DSSP  LLEELlhhhLLLL-----LLLHHHHHLLL-LLLEEELllLLLL----HHHHHHHHHHHHH
Query PYASIttrqLGKE-----LVDFPALVKEG-AFAFTDDgvGVQT----ASXXYEGXIEAAK  169
ident   |                                                       | 
Sbjct FFAAL----PLSApvdavKASIERVKNLKyCRGIILG-tSGLGkgldDPHLLPVFEAVAD  183
DSSP  EEEEL----LLLLlhhhhHHHHHHHHLLLlEEEEEEL-lLLLLllllLHHHHHHHHHHHH


DSSP  HLLLEEELLLLhhHLLL----------lLEELlhhhhhhlllEELL-HHHHHHHHHHH--
Query VNKAIVAHCEDnsLIYG----------gAXHEgkrskelgipGIPN-ICESVQIARDV--  216
ident        |                                              ||    
Sbjct AKLLVFLHPHY--GLPNevygprseeygHVLP---------lALGFpMETTIAVARMYma  232
DSSP  LLLEEEELLLL--LLLHhhhlllhhhllLHHH---------hHLHHhHHHHHHHHHHHhl


DSSP  HHHHHH-LLLEEEL-LLLLhhHHHH--------------------------hHHHHhllL
Query LLAEAA-GCHYHVC-HVSTkeSVRV--------------------------iRDAKragI  248
ident                   |                                         
Sbjct GVFDHVrNLQMLLAhSGGT--LPFLagriescivhdghlvktgkvpkdrrtiWTVL--kE  288
DSSP  LHHHHLlLLLEEEHhHHLL--HHHHhhhhhhhhhllhhhhhllllllllllhHHHH--hH


DSSP  LEEEEELhHHHHllhhhlllllhhhllllllllhhhhhhHHHHHHLLL---LLEELLLLL
Query HVTAEVTpHHLLlteddipgnnaiykxnpplrstedreaLLEGLLDGT---IDCIATDHA  305
ident                                         |               ||| 
Sbjct QIYLDAV-IYSE--------------------------vGLQAAIASSgadRLMFGTDHP  321
DSSP  LEEEELL-LLLH--------------------------hHHHHHHHHHlhhHEELLLLLL


DSSP  L-LLHHHHllllllllllllLLLLHHHHHHHHHLllllLLHHHHHHHHLHHHHHHLLLLl
Query P-HARDEKaqpxekapfgivGSETAFPLLYTHFVkngdWTLQQLVDYLTIKPCETFNLEy  364
ident       |              |                                   |  
Sbjct FfPPIEED------vqgpwdSSRLNAQAVIKAVG----EGSSDAAAVMGLNAVRVLSLK-  370
DSSP  LlLLLLLL------lllllhHHHHHHHHHHHHHL----LLLHHHHHHHLHHHHHHLLLH-


DSSP  lllllLLLLleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel
Query gtlkeNGYAdltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                                           
Sbjct -aeleHHHH-----------------------------------------------hh  380
DSSP  -hhhhHHHH-----------------------------------------------hl


No 40: Query=3griA Sbjct=2y1hB Z-score=14.3

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                     | || | |
Sbjct --------------------------------------------------GVGLVDCHCH   10
DSSP  --------------------------------------------------LLLEEEEEEL


DSSP  LLLLLLLLllLHHHHHHHHHHLLEEEEEELLLlllLLLLhhhHHHHHHHHHhhlllEELL
Query LREPGGEYkeTIETGTKAAARGGFTTVCPXPNtrpVPDSvehFEALQKLIDdnaqvRVLP  120
ident |  |              |                          |           |||
Sbjct LSAPDFDR--DLDDVLEKAKKANVVALVAVAE-hsGEFE--kIMQLSERYN----gFVLP   61
DSSP  LLLHHHLL--LHHHHHHHHHHLLEEEEEELLL-lhHHHH--hHHHHHHHLL----lLEEE


DSSP  LEEL----------lhhhLLLLLL-LHHHHHLlLLLLEEEL------------llllLLH
Query YASI----------ttrqLGKELV-DFPALVKeGAFAFTDD------------gvgvQTA  157
ident                                     |                       
Sbjct CLGVhpvqgldqrsvtlkDLDVALpIIENYKD-RLLAIGEVgldfsprfagtgeqkeEQR  120
DSSP  EELLlleelllleellhhHHHHHHhHHHHHLL-LLLEEEEEeeellllllllhhhhhHHH


DSSP  HHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhhhhHHHHHHHH
Query SXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnicesVQIARDVL  217
ident          |   |     |                                        
Sbjct QVLIRQIQLAKRLNLPVNVHSR------------------------------SAGRPTIN  150
DSSP  HHHHHHHHHHHHHLLLEEEEEE------------------------------LLHHHHHH


DSSP  HHHHHLL-LEEELLLLLhhHHHHHHHHHHllLLEEEEELHHhHHLLhhhlllllhhhlll
Query LAEAAGC-HYHVCHVSTkeSVRVIRDAKRagIHVTAEVTPHhLLLTeddipgnnaiykxn  276
ident |    |                |     |          |                    
Sbjct LLQEQGAeKVLLHAFDG--RPSVAMEGVR--AGYFFSIPPS-IIRS--------------  191
DSSP  HHHHLLLlLEEEELLLL--LHHHHHHHHH--LLLEEEELHH-HHLL--------------


DSSP  lllllhHHHHHHHHHHHLLlLLEELLLLLlllhhhhlllllllLLLLLLLLLHHHHHHhH
Query pplrstEDREALLEGLLDGtIDCIATDHAphardekaqpxekaPFGIVGSETAFPLLYtH  336
ident            |   |      |  ||                                 
Sbjct ------GQKQKLVKQLPLT-SICLETDSP---------algpeKQVRNEPWNISISAE-Y  234
DSSP  ------HHHHHHHHHLLHH-HEEELLLLL---------lllllLLLLLLHHHHHHHHH-H


DSSP  HLLlLLLLHHHHHHHHLHHHHHHL-LLLLlllllllllleeeeelllleellhhhlllll
Query FVKnGDWTLQQLVDYLTIKPCETF-NLEYgtlkengyadltiidldseqeikgedflska  395
ident                 |      |  |                                 
Sbjct IAQvKGISVEEVIEVTTQNALKLFpKLRH-------------------------------  263
DSSP  HHHhHLLLHHHHHHHHHHHHHHHLlLHHH-------------------------------


DSSP  lllllllleelleeeeeeelleeeeel
Query dntpfigykvygnpiltxvegevkfeg  422
ident                            
Sbjct -------------------------ll  265
DSSP  -------------------------hl


No 41: Query=3griA Sbjct=4dlfA Z-score=14.2

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
ident                                                        | | |
Sbjct ---------------------------------------------------ALRIDSHQH    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  lLLLL--------------LLLLLLHHHHHHHHHHLLEEEEEELLLlllLLLLhHHHHHH
Query lREPG--------------GEYKETIETGTKAAARGGFTTVCPXPNtrpVPDSvEHFEAL  106
ident                                                            |
Sbjct -FWRYraadypwigagmgvLARDYLPDALHPLMHAQALGASIAVQA---RAGR-DETAFL   64
DSSP  -LLLLlhhhllllllllhhHLLLLLHHHHHHHHHHLLLLEEEEELL---LLLH-HHHHHH


DSSP  HHHHHHhLLLEELLLEELLhhhlLLLL---lLHHHhHLLL-LLLEEELLLL-----lLLH
Query QKLIDDnAQVRVLPYASITtrqlGKEL---vDFPAlVKEG-AFAFTDDGVG-----vQTA  157
ident   |  |                                      |               
Sbjct LELACD-EARIAAVVGWED----LRAPqlaeRVAE-WRGTkLRGFRHQLQDeadvraFVD  118
DSSP  HHHHLL-LLLEEEEEELLL----LLLLlhhhHHHL-LLLLlEEEEEELHHHlllhhhHHH


DSSP  H-HHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellHHHHHHHHHHH
Query S-XXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnICESVQIARDV  216
ident       |                                                     
Sbjct DaDFARGVAWLQANDYVYDVLVF--------------------------ERQLPDVQAFC  152
DSSP  LhHHHHHHHHHHHLLLEEEELLL--------------------------HHHHHHHHHHH


DSSP  HHHHhhLLLEEELLLL----------------LHHHHHHHHHHHhlllLEEEEELHHhhh
Query LLAEaaGCHYHVCHVS----------------TKESVRVIRDAKragiHVTAEVTPHhll  260
ident              |                       |          ||          
Sbjct ARHD--AHWLVLDHAGkpalaefdrddtalarWRAALRELAALP----HVVCKLSGL---  203
DSSP  HHLL--LLLEEEHHHHlllhhhllllllhhhhHHHHHHHHHLLL----LEEEEELLL---


DSSP  llhhhllllLHHHllllllllhHHHHHHHHHHHLLlLLEELLLLLLllhhhhllllllll
Query lteddipgnNAIYkxnpplrstEDREALLEGLLDGtIDCIATDHAPhardekaqpxekap  320
ident                           | |             |                 
Sbjct ---vteadwRRGLrasdlrhieQCLDAALDAFGPQ-RLMFGSDWPV------------cl  247
DSSP  ---llllllLLLLlhhhhhhhhHHHHHHHHHHLHH-HEEELLLLLH------------hh


DSSP  LLLLLlLLHHHHHHHHHLllLLLLHHHHHHHHLHHHHHHLLLLllllllllllleeeeel
Query FGIVGsETAFPLLYTHFVknGDWTLQQLVDYLTIKPCETFNLEygtlkengyadltiidl  380
ident            |                             |                  
Sbjct LAASY-DEVASLVERWAE--SRLSAAERSALWGGTAARCYALP-----------------  287
DSSP  HLLLH-HHHHHHHHHHHH--HHLLHHHHHHHLLHHHHHHLLLL-----------------


DSSP  llleellhhhllllllllllllleelleeeeeeelleeeeel
Query dseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                           
Sbjct ------------------------------------------  287
DSSP  ------------------------------------------


No 42: Query=3griA Sbjct=4dziC Z-score=13.7

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeellllEEEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghFVSPGFVDVHVH   60
ident                                                        ||  |
Sbjct ------------------------------------------------ALNYRVIDVDNH   12
DSSP  ------------------------------------------------LLLLLEEEEEEE


DSSP  lLLLL-------------------------------------------------------
Query lREPG-------------------------------------------------------   65
ident                                                             
Sbjct -YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldll   71
DSSP  -LLLLlllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhh


DSSP  --------------------llLLLL--HHHHHHHHHHLLEEEEEELLLLL---------
Query --------------------geYKET--IETGTKAAARGGFTTVCPXPNTR---------   94
ident                         |                 |    |            
Sbjct frgeipdgvdpaslmkverladHPEYqnRDARIAVMDEQDIETAFMLPTFGcgveealkh  131
DSSP  hhllllllllhhhllleelhhhLHHHllHHHHHHHHHHHLEEEEEEELLHHhhhhhhlll


DSSP  ----llllLHHHHHHHHHHH-hhhllLEELLLEELLhhhLLLL---LLLHHHHHLLLLLL
Query ----pvpdSVEHFEALQKLI-ddnaqVRVLPYASITtrqLGKE---LVDFPALVKEGAFA  146
ident                |           |           |                ||  
Sbjct dieatmasVHAFNLWLDEDWgfdrpdHRIIAAPIVS---LADPtraVEEVDFVLARGAKL  188
DSSP  lhhhhhhhHHHHHHHHHHHLllllllLLEEELLLLL---LLLHhhhHHHHHHHHHLLLLL


DSSP  EEELlLLLL---------LHHHhHHHHHHHHHHLLLEEELLllHHHLLLL----------
Query FTDDgVGVQ---------TASXxYEGXIEAAKVNKAIVAHCedNSLIYGG----------  187
ident        |            |         |        |                    
Sbjct VLVRpAPVPglvkprslgDRSH-DPVWARLAEAGVPVGFHLsdSGYLHIAaawggakdpl  247
DSSP  EELLlLLLLlllllllllLHHH-HHHHHHHHHHLLLEEEELllLLLHHHHhhllllllhh


DSSP  LEELlhhhhhhllleELLHHHHHHHHHHH--HHHHHHL-LLEEEL-LLLLhhHHHHHHH-
Query AXHEgkrskelgipgIPNICESVQIARDV--LLAEAAG-CHYHVC-HVSTkeSVRVIRD-  242
ident                          |                      |    |      
Sbjct DQVL-----------LDDRAIHDTMASMIvhGVFTRHPkLKAVSIeNGSY--FVHRLIKr  294
DSSP  HHHH-----------HLLHHHHHHHHHHHhlLHHHHLLlLLEEEElLLLL--HHHHHHHh


DSSP  --------------hhHLLL--LEEEEELhHHHHllhhhlllllhhhllllllllhhhhh
Query --------------akRAGI--HVTAEVTpHHLLlteddipgnnaiykxnpplrstedre  286
ident                        |                                    
Sbjct lkkaantqpqyfpedpVEQLrnNVWIAPY-YEDD--------------------------  327
DSSP  hhhhhhhlhhhllllhHHHHhhHEEELLL-LLLL--------------------------


DSSP  hHHHHhHLLL---LLEELLLLLLllhhhhlllllllllLLLLllLHHHHHhHHHLlllLL
Query aLLEGlLDGT---IDCIATDHAPhardekaqpxekapfGIVGseTAFPLLyTHFVkngDW  343
ident  | |               |                  |                     
Sbjct -LPEL-ARVIgvdKILFGSDWPH---------------GEGL-aSPVSFT-AELK---GF  365
DSSP  -HHHH-HHHHlhhHLLLLLLLLL---------------LLLL-lLHHHHH-HHHL---LL


DSSP  LHHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhlllllllllllll
Query TLQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigy  403
ident                                                             
Sbjct SESDIRKIMRDNALDLLG------------------------------------------  383
DSSP  LHHHHHHHHLHHHHHHHL------------------------------------------


DSSP  eelleeeeeeelleeeeel
Query kvygnpiltxvegevkfeg  422
ident                    
Sbjct --------------vqvgs  388
DSSP  --------------lllll


No 43: Query=3griA Sbjct=1itqA Z-score=13.7

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleEEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfVSPGFVDVHVH   60
ident                                                        | |  
Sbjct --------------------------------------dffrdeaerimRDSPVIDGHND   22
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL


DSSP  L-LLLLL---------------LLLLlhhHHHHHHHHLLEEEEEELLLLL-------lll
Query L-REPGG---------------EYKEtieTGTKAAARGGFTTVCPXPNTR-------pvp   97
ident |                            |       |          |           
Sbjct LpWQLLDmfnnrlqderanlttLAGT--hTNIPKLRAGFVGGQFWSVYTPcdtqnkdavr   80
DSSP  HhHHHHHhhllllllhhhllllLLLL--lLLHHHHHHLLEEEEEEEELLLhhhllllhhh


DSSP  lLHHHHHHHHHHHHHH-------------------lLLEELLLEELLHHhllLLLL-LHH
Query dSVEHFEALQKLIDDN-------------------aQVRVLPYASITTRqlgKELV-DFP  137
ident    |                                 |  |                   
Sbjct rTLEQMDVVHRMCRMYpetflyvtssagirqafregKVASLIGVEGGHS--iDSSLgVLR  138
DSSP  hHHHHHHHHHHHHHHLllleeelllhhhhhhhhhllLEEEEEEEELHHH--lLLLHhHHH


DSSP  HHHLLLLLLEEE-LLLLLLL------------------HHHHHHHHHHHHHHLLLEEELL
Query ALVKEGAFAFTD-DGVGVQT------------------ASXXYEGXIEAAKVNKAIVAHC  178
ident ||   |    |                                    |       |    
Sbjct ALYQLGMRYLTLtHSCNTPWadnwlvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLAH  198
DSSP  HHHHLLEEEEELlLLLLLLLlllhhhllllllllllllLHHHHHHHHHHHHHLLEEELLL


DSSP  LlhhhllllleellhhhhhhllleellhhhhhHHHHHHHHHHHHLLLEEE-LLLLLH---
Query EdnsliyggaxhegkrskelgipgipnicesvQIARDVLLAEAAGCHYHV-CHVSTK---  234
ident                                   |                         
Sbjct V-------------------------------SVATMKATLQLSRAPVIFsHSSAYSvca  227
DSSP  L-------------------------------LHHHHHHHHHHLLLLLEElLLLLLLlll


DSSP  ---hHHHHHHHHHhlLLLEEEEELHHhhhllhhhlllllhhhlLLLLLL----lhhhhhH
Query ---eSVRVIRDAKraGIHVTAEVTPHhlllteddipgnnaiykXNPPLR----stedreA  287
ident                       |                     |               
Sbjct srrnVPDDVLRLV-kQTDSLVMVNFY-----------------NNYISCtnkanlsqvaD  269
DSSP  llllLLHHHHHHH-hHHLLEEEELLL-----------------HHHHLLlllllhhhhhH


DSSP  HHHHHHLLL---LLEELLLLLlllhhhhlllllllLLLL----LLLLLHHHHHhHHHLlL
Query LLEGLLDGT---IDCIATDHAphardekaqpxekaPFGI----VGSETAFPLLyTHFVkN  340
ident  |                |                                |        
Sbjct HLDHIKEVAgarAVGFGGDFD-------------gVPRVpeglEDVSKYPDLI-AELL-R  314
DSSP  HHHHHHHHLlhhHEEELLLLL-------------lLLLLllllLLLLLHHHHH-HHHH-H


DSSP  LLLLHHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllll
Query GDWTLQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpf  400
ident   ||       |       |                                        
Sbjct RNWTEAEVKGALADNLLRVFE---------------------------aveqasnltqap  347
DSSP  LLLLHHHHHHHHLHHHHHHHH---------------------------hhhhllllllll


DSSP  llleelleeeeeeelleeeeel
Query igykvygnpiltxvegevkfeg  422
ident                       
Sbjct eeepipldqlggscrthygyss  369
DSSP  llllllhhhlllllllllllll


No 44: Query=3griA Sbjct=2qpxA Z-score=13.6

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleEEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfVSPGFVDVHVH   60
ident                                                        | | |
Sbjct ----------------------------------------gxddlsefvDQVPLLDHHCH   20
DSSP  ----------------------------------------lllllhhhhHHLLEEEEEEL


DSSP  LLlllLLLL---------------------------------------------------
Query LRepgGEYK---------------------------------------------------   69
ident         |                                                   
Sbjct FL---IDGKvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaax   77
DSSP  LL---LLLLlllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhlllllllllll


DSSP  ---llhhhhhHHHHHLLEEEEEELLLLLlllllhhhhhhhhhHHHHHL---LLEELLLEE
Query ---etietgtKAAARGGFTTVCPXPNTRpvpdsvehfealqkLIDDNA---QVRVLPYAS  123
ident                  |                          |  |      |     
Sbjct ndpgyatynhRIFGHFHFKELLIDTGFV--------pddpilDLDQTAelvGIPVKAIYR  129
DSSP  lhhhhhhhhhHHHHHLLEEEEEEELLLL--------llllllLHHHHHhhhLLLEEEEEE


DSSP  LLHHHL-------------llLLLLHHHHHLLLLLLEEELL-------------------
Query ITTRQL-------------gkELVDFPALVKEGAFAFTDDG-------------------  151
ident   |                     |       |   |                       
Sbjct LETHAEdfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIAayrvglhlepvnvieaaag  189
DSSP  HHHHHHhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELHhhhlllllllllhhhhhhh


DSSP  -------------lllLLHHHHHHHHHHHHHHLLLEEELL----llHHHLlllleellhh
Query -------------vgvQTASXXYEGXIEAAKVNKAIVAHC----edNSLIyggaxhegkr  194
ident                     | |               |                     
Sbjct fdtwkhsgekrltskpLIDYXLYHVAPFIIAQDXPLQFHVgygdadTDXY----------  239
DSSP  hhhhhhhlllllllhhHHHHHHHHHHHHHHHHLLLEEEEEllllllLLHH----------


DSSP  hhhhllleellHHHHHHhHHHHHHHHHHLLLEEELLLL--LHHHHHHHHHHhhllLLEEE
Query skelgipgipnICESVQiARDVLLAEAAGCHYHVCHVS--TKESVRVIRDAkragIHVTA  252
ident                             |      |      |                 
Sbjct ----------lGNPLLX-RDYLKAFTKKGLKVVLLHCYpyHREAGYLASVF----PNLYF  284
DSSP  ----------hLLHHHH-HHHHHHHHHHLLLEEEEELLllHHHHHHHHHHL----LLEEE


DSSP  EELHHH------HHLLhhhlllllhhhllllllllhhhHHHHHHHHHLLlLLEELLLLLL
Query EVTPHH------LLLTeddipgnnaiykxnpplrstedREALLEGLLDGtIDCIATDHAP  306
ident                                            |          | |   
Sbjct DISLLDnlgpsgASRV----------------------FNEAVELAPYT-RILFASDAST  321
DSSP  ELLLHHhhlhhhHHHH----------------------HHHHLLLLLHH-HEELLLLLLL


DSSP  LlhhhhlllllllllllLLLLLH---HHHHHHHHLLLLL-----lLHHHHHHHHLHHHHH
Query HardekaqpxekapfgiVGSETA---FPLLYTHFVKNGD-----wTLQQLVDYLTIKPCE  358
ident                       |   |                                 
Sbjct Y---------------pEXYGLAarqFKQALVAHFNQLPfvdlaqKKAWINAICWQTSAK  366
DSSP  L---------------hHHHHHHhhhHHHHHHHHHHLLLlllhhhHHHHHHHHHLHHHHH


DSSP  HLLLL-LLLLllllllleeeeelllleellhhhllllllllllllleelleeeeeeelle
Query TFNLE-YGTLkengyadltiidldseqeikgedflskadntpfigykvygnpiltxvege  417
ident     |                                                       
Sbjct LYHQErELRV--------------------------------------------------  376
DSSP  HLLLHhHHLL--------------------------------------------------


DSSP  eeeel
Query vkfeg  422
ident      
Sbjct -----  376
DSSP  -----


No 45: Query=3griA Sbjct=3gg7A Z-score=13.5

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                        | |||
Sbjct ----------------------------------------------------SLIDFHVH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  LLLlllllLLLHHHHHHHHHHLLEeEEEELLllllLLLLhhHHHHHHHHHHHhlLLEELL
Query LREpggeyKETIETGTKAAARGGFtTVCPXPntrpVPDSveHFEALQKLIDDnaQVRVLP  120
ident |                |       ||                     |        |  
Sbjct LDL-----YPDPVAVARACEERQL-TVLSVT----TTPA--AWRGTLALAAG--RPHVWT   54
DSSP  HHH-----LLLHHHHHHHHHHLLL-EEEELL----LLHH--HHHHHHHHHLL--LLLEEE


DSSP  LEELlhhHLLL----lLLLHHHHHLlLLLLEEEL---------llllLLHHHHHHHHHHH
Query YASIttrQLGK----eLVDFPALVKeGAFAFTDD---------gvgvQTASXXYEGXIEA  167
ident                 |  |                           |            
Sbjct ALGF-hpEVVSeraadLPWFDRYLP-ETRFVGEVgldgspslrgtwtQQFAVFQHILRRC  112
DSSP  LLLL-lhHHLLllhhhLHHHHHHHH-HLLEEEEEellllhhhhhhhhHHHHHHHHHHHHH


DSSP  HHH-LLLEEELLLlhhhllllleellhhhhhhllleellhHHHHHHHHHHHhhHHHLL-L
Query AKV-NKAIVAHCEdnsliyggaxhegkrskelgipgipniCESVQIARDVLlaEAAGC-H  225
ident           |                                                 
Sbjct EDHgGRILSIHSR---------------------------RAESEVLNCLE--ANPRSgT  143
DSSP  HHLlLEEEEEELL---------------------------LLHHHHHHHHH--HLHHHeE


DSSP  EEELLLLL-HHHHHHHHHHHhllllEEEEELHHHHHLLhhhlllllhhhllllllllhhH
Query YHVCHVST-KESVRVIRDAKragihVTAEVTPHHLLLTeddipgnnaiykxnpplrsteD  284
ident       |      |               | |                            
Sbjct PILHWYSGsVTELRRAISLG-----CWFSVGPTMVRTQ---------------------K  177
DSSP  EEEELLLLlHHHHHHHHHLL-----LEEEELHHHHLLH---------------------H


DSSP  HHHHHHHHHLLlLLEELLLLLLllhhhhllllllLLLLLLlLLLHHHHHHhHHLLllLLL
Query REALLEGLLDGtIDCIATDHAPhardekaqpxekAPFGIVgSETAFPLLYtHFVKngDWT  344
ident   ||             ||                                   |     
Sbjct GAALIRSMPRD-RVLTETDGPF---------lelDGQAAL-PWDVKSVVE-GLSKiwQIP  225
DSSP  HHHHHHHLLHH-HEEELLLLLL---------leeLLEELL-HHHHHHHHH-HHHHhhLLL


DSSP  HHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllllllle
Query LQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigyk  404
ident                                                             
Sbjct ASEVERIVKENVSRLLG-------------------------------------------  242
DSSP  HHHHHHHHHHHHHHHHH-------------------------------------------


DSSP  elleeeeeeelleeeeel
Query vygnpiltxvegevkfeg  422
ident                   
Sbjct -----------------t  243
DSSP  -----------------l


No 46: Query=3griA Sbjct=3qy6A Z-score=13.0

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeelEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgFVDVHVH   60
ident                                                        | | |
Sbjct -----------------------------------------------------MIDIHCH    7
DSSP  -----------------------------------------------------LEELLLL


DSSP  LLLL-----LLLLllLHHHHHHHHHHLLEEEEEELLL----lllLLLLHhhHHHHHHHHH
Query LREP-----GGEYkeTIETGTKAAARGGFTTVCPXPN----trpVPDSVehFEALQKLID  111
ident          |            || | |  |    |                ||   |  
Sbjct ILPAmddgaGDSA--DSIEMARAAVRQGIRTIIATPHhnngvykNEPAA-vREAADQLNK   64
DSSP  LLLLlllllLLHH--HHHHHHHHHHHLLLLEEELLLEellllllLLHHH-hHHHHHHHHH


DSSP  HH----LLLEELLLeellhhhlllllllhhhhhllllllEEELlllLLLHhhHHHHHHH-
Query DN----AQVRVLPYasittrqlgkelvdfpalvkegafaFTDDgvgVQTAsxXYEGXIE-  166
ident           |||                                               
Sbjct RLikedIPLHVLPG-------------------------QEIR---IYGE--VEQDLAKr   94
DSSP  HHhhllLLLEEELL-------------------------LEEE---LLLL--HHHHHHLl


DSSP  ---hhhhLLLEEELLLlhhhllllleellhhhhhhllleellHHHHHHHHHHHHHHHHHL
Query ---aakvNKAIVAHCEdnsliyggaxhegkrskelgipgipnICESVQIARDVLLAEAAG  223
ident         | |                                                |
Sbjct qllslndTKYILIEFP-------------------------fDHVPRYAEQLFYDLQLKG  129
DSSP  llllhhhLLEEEEELL-------------------------lLLLLLLHHHHHHHHHHLL


DSSP  LLEEELLLL-------lHHHHHHHHHHHhllllEEEEELHHHHHLlhhhlllllhhhlll
Query CHYHVCHVS-------tKESVRVIRDAKragihVTAEVTPHHLLLteddipgnnaiykxn  276
ident       |                               |   |                 
Sbjct YIPVIAHPErnreirenPSLLYHLVEKG-----AASQITSGSLAG---------------  169
DSSP  LEEEEELHHhlhhhhhlLHHHHHHHHLL-----LEEEEEHHHHLL---------------


DSSP  llLLLHhhHHHHHHHHHLLLLLEELLLLLLllhhhhlllllllllLLLLllLHHHHHHhH
Query ppLRSTedREALLEGLLDGTIDCIATDHAPhardekaqpxekapfGIVGseTAFPLLYtH  336
ident             |       |   | |                             ||  
Sbjct -iFGKQ-lKAFSLRLVEANLIHFVASDAHN-------------vkTRNF--HTQEALY-V  211
DSSP  -lLLHH-hHHHHHHHHHLLLLLEEELLLLL-------------llLLLL--LHHHHHH-H


DSSP  HLLllLLLHHHHHHHHlHHHHHHLLLLllllllllllleeeeelllleellhhhllllll
Query FVKngDWTLQQLVDYLtIKPCETFNLEygtlkengyadltiidldseqeikgedflskad  396
ident   |                                                         
Sbjct LEK--EFGSELPYMLT-ENAELLLRNQ---------------------------------  235
DSSP  HHH--HHLLHHHHHHH-HHHHHHHLLL---------------------------------


DSSP  llllllleelleeeeeeelleeeeel
Query ntpfigykvygnpiltxvegevkfeg  422
ident                           
Sbjct --------------tifrqppqpvkr  247
DSSP  --------------llllllllllll


No 47: Query=3griA Sbjct=2gwgA Z-score=12.7

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------XIIDIHGH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LLLLL------------------------------lllllLHHH-HHHHHHHLLEEEEEE
Query LREPG------------------------------geykeTIET-GTKAAARGGFTTVCP   89
ident                                          |     |     |      
Sbjct YTTAPkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVF   68
DSSP  LLLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEE


DSSP  LLLL----lllllLHHHHHHHHHHHHHHLlLEELLLEELlhHHLL----LLLL-LHHHHH
Query XPNT----rpvpdSVEHFEALQKLIDDNAqVRVLPYASIttRQLG----KELV-DFPALV  140
ident  |                |                 |     |      |         |
Sbjct SPRAgdfnvsstwAAICNELCYRVSQLFP-DNFIGAAXL--PQSPgvdpKTCIpELEKCV  125
DSSP  ELLLllhhhhhhhHHHHHHHHHHHHHHLL-LLEEEEEEL--LLLLlllhHHHHhHHHHHH


DSSP  L-LLLLLEEELLLL---------llLHHHhHHHHHHHHHHLLLEEELlllhhhlllLLEE
Query K-EGAFAFTDDGVG---------vqTASXxYEGXIEAAKVNKAIVAHcednsliygGAXH  190
ident |  |  |                       |               |            |
Sbjct KeYGFVAINLNPDPsgghwtsppltDRIW-YPIYEKXVELEIPAXIH-------vsTGAH  177
DSSP  HlLLLLEEEELLLLlllllllllllLHHH-HHHHHHHHHHLLLEEEL-------llLLLH


DSSP  llhhhhhhllleellHHHHHHHHHH--hHHHHHHL-LLEEEL-LLLLhhHHHH-------
Query egkrskelgipgipnICESVQIARD--vLLAEAAG-CHYHVC-HVSTkeSVRV-------  239
ident                              |                              
Sbjct -------------ylNADTTAFXQCvagDLFKDFPeLKFVIPhGGGA--VPYHwgrfrgl  222
DSSP  -------------hhHHHHHHHHHHhhlLHHHHLLlLLEEELhHHLL--LHHHhhhhhhh


DSSP  ----hhhhHHLLL--LEEEEELhHHHHLlhhhlllllhhhllllllllhhhhHHHHHHHH
Query ----irdaKRAGI--HVTAEVTpHHLLLteddipgnnaiykxnpplrstedrEALLEGLL  293
ident                                                       |     
Sbjct aqexkkplLEDHVlnNIFFDTC-VYHQP----------------------giDLLNTVIP  259
DSSP  hhhlllllHHHHLllLEEEELL-LLLHH----------------------hhHHHHHHLL


DSSP  LLlLLEELLLLLlllhhhhllllllllLLLL--------lllLHHHHHHHHhlllLLLLH
Query DGtIDCIATDHAphardekaqpxekapFGIV--------gseTAFPLLYTHfvknGDWTL  345
ident        |                                                  | 
Sbjct VD-NVLFASEXI---------------GAVRgidprtgfyydDTKRYIEAS----TILTP  299
DSSP  HH-HEELLLLLL---------------LLLLleelllleellLLHHHHHHL----LLLLH


DSSP  HHHHHHHLHHHHHHL---LLLLlllLLLLllleeeeelllleellhhhllllllllllll
Query QQLVDYLTIKPCETF---NLEYgtlKENGyadltiidldseqeikgedflskadntpfig  402
ident                                                             
Sbjct EEKQQIYEGNARRVYprlDAALkakGKLE-------------------------------  328
DSSP  HHHHHHHLHHHHHHLhhhHHHHhhhHHHL-------------------------------


DSSP  leelleeeeeeelleeeeel
Query ykvygnpiltxvegevkfeg  422
ident                     
Sbjct -------------------h  329
DSSP  -------------------l


No 48: Query=3griA Sbjct=1j5sA Z-score=12.6

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                       || | |
Sbjct ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL


DSSP  LLLLllllllLHHH----------------------------------------------
Query LREPggeykeTIET----------------------------------------------   74
ident |          |                                                
Sbjct LDAK------DIVEnkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlala   87
DSSP  LLHH------HHHHllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhh


DSSP  -------------------------------------------------HHHHHHHLLEE
Query -------------------------------------------------GTKAAARGGFT   85
ident                                                    |        
Sbjct kvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVE  147
DSSP  hhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEE


DSSP  EEEELLlllllLLLHHhhHHHHHHHHHHL-LLEELLLEELLhhHLLL-------------
Query TVCPXPntrpvPDSVEhfEALQKLIDDNA-QVRVLPYASITtrQLGK-------------  131
ident   |                            |  ||                        
Sbjct ILCTTD-----DPVST--LEHHRKAKEAVeGVTILPTWRPD--RAMNvdkegwreyvekm  198
DSSP  EEELLL-----LLLLL--LHHHHHHHHHLlLLEEELLLLLH--HHHLlllllhhhhhhhh


DSSP  ----------------LLLL-HHHHHLLLLLLEEEL------------------------
Query ----------------ELVD-FPALVKEGAFAFTDD------------------------  150
ident                  |          |  |                            
Sbjct gerygedtstldgflnALWKsHEHFKEHGCVASDHAllepsvyyvdenraravhekafsg  258
DSSP  hhhhllllllhhhhhhHHHHhHHHHHLLLLLEEEEEelllllllllhhhhhhhhhhhlll


DSSP  ------llllLLHHHHHHHHHHHHHHLLLEEELLLLhhHLLL------------LLEEll
Query ------gvgvQTASXXYEGXIEAAKVNKAIVAHCEDnsLIYG------------GAXHeg  192
ident             |             |     |     |               |     
Sbjct ekltqdeindYKAFMMVQFGKMNQETNWVTQLHIGA--LRDYrdslfktlgpdsGGDI--  314
DSSP  llllhhhhhhHHHHHHHHHHHHHHHHLLEEEEEELE--ELLLlhhhhhhlllllLLLE--


DSSP  hhhhhhllleELLHhhhHHHH-HHHHHHHHH--LLLEEELlLLLHHHHHHHHHHHHLLLL
Query krskelgipgIPNIcesVQIA-RDVLLAEAA--GCHYHVChVSTKESVRVIRDAKRAGIH  249
ident             |      ||                    |        |    ||   
Sbjct ----------STNF---LRIAeGLRYFLNEFdgKLKIVLY-VLDPTHLPTISTIARAFPN  360
DSSP  ----------ELLL---LLHHhHHHHHHHHLllLLLEEEE-ELLHHHHHHHHHHHHHLLL


DSSP  EEEEEL--hhHHHLlhhhlllllhhhllllllllhhhHHHHHHHhHLLL----LLEELLL
Query VTAEVT--phHLLLteddipgnnaiykxnpplrstedREALLEGlLDGT----IDCIATD  303
ident |                                       |                 ||
Sbjct VYVGAPwwfnDSPF---------------------gmEMHLKYL-ASVDllynLAGMVTD  398
DSSP  EEELLLllllLLHH---------------------hhHHHHHHH-HLLLlhhhLLLLLLL


DSSP  LLLllhhhhlllllllllllLLLLLHHHHHHHHHLlLLLL------------LHHHHHHH
Query HAPhardekaqpxekapfgiVGSETAFPLLYTHFVkNGDW------------TLQQLVDY  351
ident                                     |                       
Sbjct SRK----------------lLSFGSRTEMFRRVLS-NVVGemvekgqipikeARELVKHV  441
DSSP  LLL----------------lLHHHHHHHHHHHHHH-HHHHhhhhlllllhhhHHHHHHHH


DSSP  HLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllllllleelleeee
Query LTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigykvygnpil  411
ident     |   |                                                   
Sbjct SYDGPKALFF--------------------------------------------------  451
DSSP  HLHHHHHHHL--------------------------------------------------


DSSP  eeelleeeeel
Query txvegevkfeg  422
ident            
Sbjct -----------  451
DSSP  -----------


No 49: Query=3griA Sbjct=3iacA Z-score=12.3

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
ident                                                        | | |
Sbjct --------------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCH   34
DSSP  --------------------------llllllllllllhhhhhhhhhlllLLLEEELLLL


DSSP  LLLLllllllLHHH----------------------------------------------
Query LREPggeykeTIET----------------------------------------------   74
ident |          |                                                
Sbjct LSPQ------EIADdrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxaw   88
DSSP  LLHH------HHHHllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhh


DSSP  -----------------------------------------------------HHHHHHH
Query -----------------------------------------------------GTKAAAR   81
ident                                                             
Sbjct antvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQ  148
DSSP  hhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHH


DSSP  LLEEEEEELlllllLLLLhhHHHHHHHHHHHH--LLLEELLLEELlhhHLLL--------
Query GGFTTVCPXpntrpVPDSveHFEALQKLIDDN--AQVRVLPYASIttrQLGK--------  131
ident      |                      |         | |                   
Sbjct XNVRXVGTT-----DDPI--DSLEYHRQIAADdsIDIEVAPSWRP---DKVFkieldgfv  198
DSSP  LLEEEEELL-----LLLL--LLLHHHHHHHHLllLLLEEELLLLL---HHHHllllllhh


DSSP  ----------------------LLLL-HHHHHLLLLLLEEELLL----------------
Query ----------------------ELVD-FPALVKEGAFAFTDDGV----------------  152
ident                        |          |  |                      
Sbjct dylrkleaaadvsitrfddlrqALTRrLDHFAACGCRASDHGIEtlrfapvpddaqldai  258
DSSP  hhhhhhhhhhllllllhhhhhhHHHHhHHHHHHLLLLEEEEEELlllllllllhhhhhhh


DSSP  ---------------llLLHHHHHHHHHHHHHHLLLEEELLLlhhHLLL-----------
Query ---------------gvQTASXXYEGXIEAAKVNKAIVAHCEdnsLIYG-----------  186
ident                   |           |        |                    
Sbjct lgkrlagetlseleiaqFTTAVLVWLGRQYAARGWVXQLHIG--aIRNNntrxfrllgpd  316
DSSP  hhhhhllllllhhhhhhHHHHHHHHHHHHHHHHLLEEEEEEL--eELLLlhhhhhhhlll


DSSP  --LLEEllhhhhhhllleELLHhHHHHHHHHHHHHH--HHLLLEEEL---llLLHHHHHH
Query --GAXHegkrskelgipgIPNIcESVQIARDVLLAE--AAGCHYHVC---hvSTKESVRV  239
ident                     |   |    |                              
Sbjct tgFDSI------------GDNN-ISWALSRLLDSXDvtNELPKTILYclnprDNEVLATX  363
DSSP  llLLEE------------LLLL-LHHHHHHHHHHHHllLLLLEEEEEellhhHHHHHHHH


DSSP  HHHHH--hlllLEEEEEL--hHHHHLlhhhlllllhhhllllllllhhhhHHHHHHHHLL
Query IRDAK--ragiHVTAEVT--pHHLLLteddipgnnaiykxnpplrstedrEALLEGLLDG  295
ident |           |                                        || |   
Sbjct IGNFQgpgiagKVQFGSGwwfNDQKD----------------------gxLRQLEQLSQX  401
DSSP  HHHLLllllllLEEELLLlhhHLLHH----------------------hhHHHHHHHHHH


DSSP  L----lLEELLLLLLllhhhhllllllllllLLLLlLHHHHHHHHHLllLLLL-------
Query T----iDCIATDHAPhardekaqpxekapfgIVGSeTAFPLLYTHFVknGDWT-------  344
ident           ||                        |                       
Sbjct GllsqfVGXLTDSRS----------------FLSY-TRHEYFRRILC--NLLGqwaqdge  442
DSSP  LlhhhlLLLLLLLLL----------------LLLL-HHHHHHHHHHH--HHHHhhhhlll


DSSP  --------HHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllll
Query --------LQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskad  396
ident              |         |                                    
Sbjct ipddeaxlSRXVQDICFNNAQRYFT-----------------------------------  467
DSSP  llllhhhhHHHHHHHHLHHHHHHLL-----------------------------------


DSSP  llllllleelleeeeeeelleeeeel
Query ntpfigykvygnpiltxvegevkfeg  422
ident                           
Sbjct ------------------------ik  469
DSSP  ------------------------ll


No 50: Query=3griA Sbjct=1v77A Z-score=11.3

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
ident                                                      |      
Sbjct ---------------------------------------------------VKFIEMDIR    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LLlllllllllhhhHHHHHHHLlEEEEEELLllllllllhhhhhhhhhhhhhhllleell
Query LRepggeyketietGTKAAARGgFTTVCPXPntrpvpdsvehfealqkliddnaqvrvlp  120
ident                   |    |  |                                 
Sbjct DK-----------eAYELAKEW-FDEVVVSI-----------------------------   28
DSSP  LH-----------hHHHHHHHH-LLEEEEEE-----------------------------


DSSP  leELLHhhllllLLLHhHHHLLLL-----LLEEELllLLLLhHHHHHHHHHHHhhLLLEE
Query yaSITTrqlgkeLVDFpALVKEGA-----FAFTDDgvGVQTaSXXYEGXIEAAkvNKAIV  175
ident              ||      |        |           |               | 
Sbjct --KFNE------EVDK-EKLREARkeygkVAILLS--NPKP-SLVRDTVQKFK--SYLIY   74
DSSP  --EELL------LLLH-HHHHHHHhhhllEEEEEE--LLLH-HHHHHHHHHLL--LLEEE


DSSP  ELLLLhhhllllleellhhhhhhllleellhhhHHHHHHHHHHHhhhllLEEELLLLL--
Query AHCEDnsliyggaxhegkrskelgipgipniceSVQIARDVLLAeaagcHYHVCHVST--  233
ident     |                               |                       
Sbjct VESND----------------------------LRVIRYSIEKG-----VDAIISPWVnr  101
DSSP  EELLL----------------------------HHHHHHHHHLL-----LLEEELLLLll


DSSP  -HHHHH-hHHHHHHlLLLEEEEELHHHHHLLHHHlllllhhhllllllLLHHHHHHHHHH
Query -KESVR-vIRDAKRaGIHVTAEVTPHHLLLTEDDipgnnaiykxnpplRSTEDREALLEG  291
ident                   |        ||                               
Sbjct kDPGIDhvLAKLMV-KKNVALGFSLRPLLYSNPY--------------ERANLLRFMMKA  146
DSSP  lLLLLLhhHHHHHH-HHLLEEEEELHHHHHLLHH--------------HHHHHHHHHHHH


DSSP  HHLL----LLLEELLLLLLllhhhhllllllllllLLLLllHHHHHHHHHLllllLLHHH
Query LLDG----TIDCIATDHAPhardekaqpxekapfgIVGSetAFPLLYTHFVkngdWTLQQ  347
ident                                              |    |        |
Sbjct WKLVekykVRRFLTSSAQE---------------kWDVR--YPRDLISLGV-vigMEIPQ  188
DSSP  HHHHhhhlLLEEEELLLLL---------------hHHLL--LHHHHHHHHH-hllLLHHH


DSSP  HHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllllllleell
Query LVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigykvyg  407
ident         |                                                   
Sbjct AKASISMYPEIILK----------------------------------------------  202
DSSP  HHHLLLHHHHHHHL----------------------------------------------


DSSP  eeeeeeelleeeeel
Query npiltxvegevkfeg  422
ident                
Sbjct ---------------  202
DSSP  ---------------


No 51: Query=3griA Sbjct=2a3lA Z-score=9.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------leeeeLLEEEelleeeeleeeeelleeeeeel
Query ----------------------------xklikNGKVLqngelqqadilidgkvikqiap   32
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhLLLLL----------------------


DSSP  lllllllleeeelllleeEELEEEEEELLL------------------------------
Query aiepsngvdiidakghfvSPGFVDVHVHLR------------------------------   62
ident                       || |||                                
Sbjct ----------------fyNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgt  202
DSSP  ----------------llLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelle


DSSP  ---------------------------------------------------llLLLL---
Query ---------------------------------------------------epGGEY---   68
ident                                                             
Sbjct yltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiFLKQdnl  262
DSSP  eelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhhhhHLLLlll


DSSP  ------llLHHHHHHHHH-HLLEeEEEELLllllLLLL-----HHHHHHHHHhhHHHLLL
Query ------keTIETGTKAAA-RGGFtTVCPXPntrpVPDS-----VEHFEALQKliDDNAQV  116
ident                                                        |    
Sbjct iqgrflgeITKQVFSDLEaSKYQ-MAEYRI----SIYGrkmseWDQLASWIV-nNDLYSE  316
DSSP  lllllhhhHHHHHHHHHLlLLLE-EEEEEE----ELLLllllhHHHHHHHHH-lLLLLLL


DSSP  EELLLEELlhhHLLL---------------llLLHHH---------------hhLLLLLL
Query RVLPYASIttrQLGK---------------elVDFPA---------------lvKEGAFA  146
ident  |                                |                         
Sbjct NVVWLIQL---PRLYniykdmgivtsfqnildNIFIPlfeatvdpdshpqlhvfLKQVVG  373
DSSP  LEEEEEEE---ELLHhhhlllllllllhhhhhHHLLHhhhhhhlhhhllllhhhHLLEEE


DSSP  EEELLL----------------------llLLHHHHHHHHHHHHHHL----------LLE
Query FTDDGV----------------------gvQTASXXYEGXIEAAKVN----------KAI  174
ident |                                   |         |             
Sbjct FDLVDDeskperrptkhmptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmttITL  433
DSSP  EEEELLllllllllllllllllllllllllLHHHHHHHHHHHHHHHHhhhlllllllLEE


DSSP  EELLLlhhhllllleellhhhhhhllleellHHHHHHHHHHHHHhhhhllLEEELLLLLh
Query VAHCEdnsliyggaxhegkrskelgipgipnICESVQIARDVLLaeaagcHYHVCHVSTk  234
ident   |                                   |   |            |    
Sbjct RPHSG-------------------------eAGDIDHLAATFLT------CHSIAHGIN-  461
DSSP  LLLLL-------------------------lLLLLHHHHHHHHH------LLLLLLLHH-


DSSP  hHHHH--HHHHHHlLLLEEEEELHHHhhllhhhlllllhhhllllLLLLHHHHhHHHHHH
Query eSVRV--IRDAKRaGIHVTAEVTPHHlllteddipgnnaiykxnpPLRSTEDReALLEGL  292
ident                        |                                    
Sbjct -LRKSpvLQYLYY-LAQIGLAMSPLS----------------nnsLFLDYHRN-PFPVFF  502
DSSP  -HHHLhhHHHHHH-HHLLLEEELHHH----------------hllLLLLLLLL-LHHHHH


DSSP  HLLLLLEELLLLLlllhhhhllllllllLLLL----LLLLHHHHHHHHHLllllLLHHHH
Query LDGTIDCIATDHAphardekaqpxekapFGIV----GSETAFPLLYTHFVkngdWTLQQL  348
ident | |      ||                   |                            |
Sbjct LRGLNVSLSTDDP---------------LQIHltkePLVEEYSIAASVWK----LSACDL  543
DSSP  HLLLLEEELLLLH---------------HHHLllllHHHHHHHHHHHHHL----LLHHHH


DSSP  HHHHlHHHHHHLLLL----llLLLLllllleeeeelllleellhhhllllllllllllle
Query VDYLtIKPCETFNLE----ygTLKEngyadltiidldseqeikgedflskadntpfigyk  404
ident                                                             
Sbjct CEIA-RNSVYQSGFShalkshWIGK----dyykrgpdgndihktnvphirvefrdtiwke  598
DSSP  HHHH-HHHHHHLLLLhhhhhhHLLL----llllllhhhllhhhhlllhhhhhhhhhhhhh


DSSP  elleeeeeeelleeeeel
Query vygnpiltxvegevkfeg  422
ident                   
Sbjct emqqvylgkavisdevvp  616
DSSP  hhhhhlllllllllllll


No 52: Query=3griA Sbjct=3au2A Z-score=8.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ---------------------leeeelleeeelleeeeleeeeelleeeeeellLLLL--
Query ---------------------xklikngkvlqngelqqadilidgkvikqiapaIEPS--   37
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaiRALPgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhHLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   37
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   37
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------llleeeelllleeeelEEEEEELlLLLLLllLLLHHHHH
Query ---------------------ngvdiidakghfvspgFVDVHVHlREPGGeyKETIETGT   76
ident                                        |  ||          | |   
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVH-STYSD-gQNTLEELW  358
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEEL-LLLLL-lLLLHHHHH


DSSP  HHHHHLLEEEEEELLL----llllllLHHHHHHHHHHHHHHL----lLEEL-LLEELlhh
Query KAAARGGFTTVCPXPN----trpvpdSVEHFEALQKLIDDNA----qVRVL-PYASIttr  127
ident  ||   |                   | |        |            |         
Sbjct EAAKTMGYRYLAVTDHspavrvaggpSPEEALKRVGEIRRFNethgpPYLLaGAEVD---  415
DSSP  HHHHHHLLLEEEEEEElhhhhlllllLHHHHHHHHHHHHHHHhhhllLEEEeEEEEE---


DSSP  HLLL-LLLLHHHHHLLLLLLEEELLL-----llLLHHHHHHHHHHHhhhLLLEEELLLLH
Query QLGK-ELVDFPALVKEGAFAFTDDGV-----gvQTASXXYEGXIEAakvNKAIVAHCEDN  181
ident       |        |                                      ||    
Sbjct IHPDgTLDYPDWVLRELDLVLVSVHSrfnlpkaDQTKRLLKALENP---FVHVLAHPTAR  472
DSSP  LLLLlLLLLLHHHHLLLLEEEEELLLlllllhhHHHHHHHHHHLLL---LLLEELLLLLL


DSSP  hHLLLLleellhhhhhhllleellhhhhhhHHHHHHHHHhhLLLEEELL-------llLH
Query sLIYGGaxhegkrskelgipgipnicesvqIARDVLLAEaaGCHYHVCH-------vsTK  234
ident  |                                   |        |             
Sbjct -LLGRR------------------apieadWEAVFQKAK--EKGVAVEIdgyydrmdlPD  511
DSSP  -LLLLL------------------llllllHHHHHHHHH--HHLLEEEEellllllllLH


DSSP  HHHHHHHHHHhllllEEEEE------------LHHHHhllhhhlllllhhhllllllllh
Query ESVRVIRDAKragihVTAEV------------TPHHLllteddipgnnaiykxnpplrst  282
ident    |                                                        
Sbjct DLARMAYGMG-----LWISLstdahqtdhlrfMELAV-----------------------  543
DSSP  HHHHHHHHLL-----LLEEEelllllhhhhhhHHHHH-----------------------


DSSP  hhhHHHHH-HHHLLlLLEEllllllllhhhhllllllllllllllllhhhhhhhhhllll
Query edrEALLE-GLLDGtIDCIatdhaphardekaqpxekapfgivgsetafpllythfvkng  341
ident                                                             
Sbjct ---GTAQRaWIGPE-RVLN-----------------------------------------  558
DSSP  ---HHHHHlLLLLL-LLHH-----------------------------------------


DSSP  lllhhhhhhHHLH-HHHHHLLLlllllllllllleeeeelllleellhhhllllllllll
Query dwtlqqlvdYLTI-KPCETFNLeygtlkengyadltiidldseqeikgedflskadntpf  400
ident           |                                                 
Sbjct ---------TLDYeDLLSWLKA--------------------------------------  571
DSSP  ---------HLLHhHHHHHHHL--------------------------------------


DSSP  llleelleeeeeeelleeeeel
Query igykvygnpiltxvegevkfeg  422
ident                       
Sbjct ------------------rrgv  575
DSSP  ------------------llll


No 53: Query=3griA Sbjct=1m65A Z-score=8.6

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeelEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgFVDVHVH   60
ident                                                       || | |
Sbjct ----------------------------------------------------yPVDLHMH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  lLLLLLllLLLHHHHHHHHHHLLEEEEEELLllllLLLL------HHHHHHhHHHHH-hh
Query lREPGGeyKETIETGTKAAARGGFTTVCPXPntrpVPDS------VEHFEAlQKLID-dn  113
ident           |       |   |                        ||           
Sbjct -TVASThaYSTLSDYIAQAKQKGIKLFAITD----HGPDmedaphHWHFIN-MRIWPrvv   62
DSSP  -LLLLLllLLLHHHHHHHHHHHLLLEEEEEE----ELLLllllllLHHHHH-HHHLLlee


DSSP  llLEEL-LLEELLhhhLLLL-LLLHHH-HHLLLLLLEEELLL-------llLLHHHHHHH
Query aqVRVL-PYASITtrqLGKE-LVDFPA-LVKEGAFAFTDDGV-------gvQTASXXYEG  163
ident   |  |                 |                                    
Sbjct dgVGILrGIEANI---KNVDgEIDCSGkMFDSLDLIIAGFHEpvfaphdkaTNTQAMIAT  119
DSSP  llEEEEeEEEEEL---LLLLlLLLLLHhHHHHLLEEEEELLLlllllllhhHHHHHHHHH


DSSP  HHHHhhhLLLEEEL-LLLHhhllllleellhhhhhhllleellhhhhHHHHHHHHHHHhh
Query XIEAakvNKAIVAH-CEDNsliyggaxhegkrskelgipgipnicesVQIARDVLLAEaa  222
ident        |  |  |                                          |   
Sbjct IASG---NVHIISHpGNPK--------------------------yeIDVKAVAEAAA--  148
DSSP  HHLL---LLLEELLlLLLL--------------------------llLLHHHHHHHHH--


DSSP  LLLEEELL---llLHHHHHHHHHHHhllllEEEE------------eLHHHHhllhhhll
Query GCHYHVCH---vsTKESVRVIRDAKragihVTAE------------vTPHHLllteddip  267
ident                |     |||                           |        
Sbjct KHQVALEInnssnCREVAAAVRDAG-----GWVAlgsdshtaftmgeFEECL--------  195
DSSP  HHLLEEEEellllHHHHHHHHHHHL-----LLEEeelllllhhhlllLHHHH--------


DSSP  lllhhhllllllllhhhhHHHHH-HHHLLlLLEEllllllllhhhhllllllllllllll
Query gnnaiykxnpplrstedrEALLE-GLLDGtIDCIatdhaphardekaqpxekapfgivgs  326
ident                     |                                       
Sbjct ------------------KILDAvDFPPE-RILN--------------------------  210
DSSP  ------------------HHHHHlLLLHH-HLHH--------------------------


DSSP  llhhhhhhhhhlllllllhhhhhhHHLHHHHHHLLlllllllllLLLLeeeeelllleel
Query etafpllythfvkngdwtlqqlvdYLTIKPCETFNleygtlkenGYADltiidldseqei  386
ident                                                             
Sbjct ------------------------VSPRRLLNFLEsrgmapiaeFADL------------  234
DSSP  ------------------------HLHHHHHHHHHhllllllhhHLLL------------


DSSP  lhhhllllllllllllleelleeeeeeelleeeeel
Query kgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                     
Sbjct ------------------------------------  234
DSSP  ------------------------------------


No 54: Query=3griA Sbjct=3f2bA Z-score=8.1

back to top
DSSP  ------------------------------------------------------leeeel
Query ------------------------------------------------------xklikn    6
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  leeeelleeeeleeeeelleeeeeelllllLLLLEEE--ellllEEEELEEEEEELlLLL
Query gkvlqngelqqadilidgkvikqiapaiepSNGVDII--dakghFVSPGFVDVHVHlREP   64
ident                                                   |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAAnerqdtaPEGEKRVELHLH-TPM  119
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELLlllllllLLLLLLLLLLLL-LLL


DSSP  LL-llLLLHHHHHHHHHHLLEEEEEELLLlllllllhhhhhhHHHHHHHHL---LLEELL
Query GG-eyKETIETGTKAAARGGFTTVCPXPNtrpvpdsvehfeaLQKLIDDNA---QVRVLP  120
ident                |   |                              |      |  
Sbjct SQmdaVTSVTKLIEQAKKWGHPAIAVTDH---------avvqSFPEAYSAAkkhGMKVIY  170
DSSP  LLlllLLLHHHHHHHHHHLLLLLEEELLL---------llllLHHHHHHHHhhhLLLEEE


DSSP  LE-------------------------eLLHHHLLLLlllhhhhhlllllleeelLLLLl
Query YA-------------------------sITTRQLGKElvdfpalvkegafaftddGVGVq  155
ident                                                             
Sbjct GLeanivddpfhvtllaqnetglknlfkLVSLSHIQY---------------fhrVPRI-  214
DSSP  EEeeeeellleeeeeeellhhhhhhhhhHHHHHHLLL---------------lllLLLE-


DSSP  lhhHHHHHHHHHhhHLLLEeellllhhhllllleellhhhhhhllleellhhhhhhhhhh
Query tasXXYEGXIEAakVNKAIvahcednsliyggaxhegkrskelgipgipnicesvqiard  215
ident                                                             
Sbjct ---PRSVLVKHR--DGLLV-----------------------------------------  228
DSSP  ---EHHHHHHLL--LLEEE-----------------------------------------


DSSP  hhhhhhhllleEELLLllhhHHHHhHHHHhllLLEE-EEELHHHhhllhhhlllllhhhl
Query vllaeaagchyHVCHVstkeSVRViRDAKragIHVT-AEVTPHHlllteddipgnnaiyk  274
ident                                       || |                  
Sbjct -----------GSGCD-kgeLFDN-VEDI--aRFYDfLEVHPPD----------------  257
DSSP  -----------ELLLL-lllLLLL-LLLL--hHHLLlEEELLHH----------------


DSSP  llLLLL----LHHHHHHHHHHHHLL----LLLEELLLLLL-------lLHHHHLL-LLLL
Query xnPPLR----STEDREALLEGLLDG----TIDCIATDHAP-------hARDEKAQ-PXEK  318
ident                         |                                   
Sbjct -vYKPLyvkdEEMIKNIIRSIVALGekldIPVVATGNVHYlnpedkiyRKILIHSqGGAN  316
DSSP  -hHLLLllllHHHHHHHHHHHHHHHhhllLLEEELLLLLLllhhhhhhHHHHHHLlHHHL


DSSP  LL----LLLLLLlLHHHHHHHHHLlllLLLHHHHHHHHLHHHHHHLLL------------
Query AP----FGIVGSeTAFPLLYTHFVkngDWTLQQLVDYLTIKPCETFNL------------  362
ident          |            |                        |            
Sbjct PLnrheLPDVYF-RTTNEMLDCFS---FLGPEKAKEIVVDNTQKIASLigdvkpikdely  372
DSSP  LLllllLLLLLL-LLHHHHHHHHH---HHHHHHHHHHHLHHHHHHHHLllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct tpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkk  432
DSSP  llllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct slddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdk  492
DSSP  hhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct ncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyra  552
DSSP  llllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct gtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdyme  612
DSSP  eeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct iydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpkti  672
DSSP  hhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct ptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqis  732
DSSP  llllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct glshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkg  792
DSSP  hhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct ltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyf  852
DSSP  llhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct tvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfkni  912
DSSP  hhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelll


DSSP  ----------------------lllllllllllleeeeelllleellhhhllllllllll
Query ----------------------eygtlkengyadltiidldseqeikgedflskadntpf  400
ident                                                             
Sbjct dlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktl  972
DSSP  lllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhh


DSSP  llleelleeeeeeelleeeeel
Query igykvygnpiltxvegevkfeg  422
ident                       
Sbjct leylesrgcldslpdhnqlslf  994
DSSP  hhhhhhllllllllllllllll


No 55: Query=3griA Sbjct=3dcpA Z-score=8.0

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------XKRDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  LLlllllLLLLHHHHHHHHHHLLEEEEEELLL---------------------lllllLL
Query LRepggeYKETIETGTKAAARGGFTTVCPXPN---------------------trpvpDS   99
ident             |     |    |                                  | 
Sbjct TEfcphgTHDDVEEXVLKAIELDFDEYSIVEHaplssefxkntagdkeavttasxaxsDL   68
DSSP  LLlllllLLLLHHHHHHHHHHLLLLEEEEEEEllllhhhhhllllllhhhhlllllhhHH


DSSP  HHHHHHHHHHHHHHL-LLEELLLeellhhhlllllllhhhhhllllllEEELllLLLLHH
Query VEHFEALQKLIDDNA-QVRVLPYasittrqlgkelvdfpalvkegafaFTDDgvGVQTAS  158
ident    |          |                                 |  |        
Sbjct PYYFKKXNHIKKKYAsDLLIHIG-------------------------FEVD-yLIGYED  102
DSSP  HHHHHHHHHHHHHLLlLLEEEEE-------------------------EEEE-lLLLLHH


DSSP  HHHHHHHHHhhhllleEELLLLHH---------------hlLLLLeellhhhhhhllLEE
Query XXYEGXIEAakvnkaiVAHCEDNS---------------liYGGAxhegkrskelgiPGI  203
ident        |        |                                           
Sbjct FTRDFLNEYgpqtddgVLSLHFLEgqggfrsidfsaedyneGIVQ------fyggfeQAQ  156
DSSP  HHHHHHHHHhhhlleeEEELLEEEelleeeellllhhhhhhHLHH------hhllhhHHH


DSSP  L--LHHHHHHHHhhHHHHhhhLLLE-EELLLL-----------------------LHHHH
Query P--NICESVQIArdVLLAeaaGCHY-HVCHVS-----------------------TKESV  237
ident           |     |            | |                            
Sbjct LayLEGVKQSIE--ADLG---LFKPrRXGHISlcqkfqqffgedtsdfseevxekFRVIL  211
DSSP  HhhHHHHHHHHH--LLLL---LLLLlEELLLLhhhllhhhhlllhhhllhhhhhhHHHHH


DSSP  HHHHHHHhllllEEEEELH----------HHHHllhhhlllllhhhllllllllhhhHHH
Query RVIRDAKragihVTAEVTP----------HHLLlteddipgnnaiykxnpplrstedREA  287
ident                                                             
Sbjct ALVKKRD-----YELDFNTaglfkplcgeTYPP------------------------KKI  242
DSSP  HHHHHHL-----LEEEEELhhhhllllllLLLL------------------------HHH


DSSP  HHHHHHLLLLLEELLLLLLllhhhhllllllllllLLLLlLHHHHHHHHHLllllllhhh
Query LLEGLLDGTIDCIATDHAPhardekaqpxekapfgIVGSeTAFPLLYTHFVkngdwtlqq  347
ident                |                                            
Sbjct VTLASELQIPFVYGSDSHG---------------vQDIG-RGYSTYCQKLE---------  277
DSSP  HHHHHHLLLLEEEELLLLL---------------hHHLL-LLHHHHHHHLL---------


DSSP  hhhhhlhhhhhhllllllllllllllleeeeelllleellhhhllllllllllllleell
Query lvdyltikpcetfnleygtlkengyadltiidldseqeikgedflskadntpfigykvyg  407
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelleeeeel
Query npiltxvegevkfeg  422
ident                
Sbjct ---------------  277
DSSP  ---------------


No 56: Query=3griA Sbjct=1bksA Z-score=6.6

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeleeEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgfvDVHVH   60
ident                                                         |   
Sbjct -------------------------------------meryenlfaqlndrregaFVPFV   23
DSSP  -------------------------------------lhhhhhhhhhhhhlllleEEEEE


DSSP  lLLLLLLlllLHHHHHHHHHHLleeEEEELlLLLL----------------llllhhHHH
Query lREPGGEykeTIETGTKAAARGgftTVCPXpNTRP----------------vpdsveHFE  104
ident                      |                                      
Sbjct -TLGDPGieqSLKIIDTLIDAG--aDALEL-GVPFsdpladgptiqnanlrafaagvTPA   79
DSSP  -ELLLLLhhhHHHHHHHHHHLL--lLLEEE-ELLLlllllllhhhhhhhhhhhhhllLHH


DSSP  HHHHHHHHH--lllEELLLEE-lLHHHlllLLLL-HHHHHLLLLLLEEEllLLLLlHHHH
Query ALQKLIDDN--aqvRVLPYAS-iTTRQlgkELVD-FPALVKEGAFAFTDdgVGVQtASXX  160
ident                                           |          |      
Sbjct QCFEMLALIrekhpTIPIGLLmyANLVfnnGIDAfYARCEQVGVDSVLV--ADVP-VEES  136
DSSP  HHHHHHHHHhhhllLLLEEEEelHHHHhllLHHHhHHHHHHHLLLEEEE--LLLL-HHHL


DSSP  HHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellHHHHH-HHHHHHHHH
Query YEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnICESV-QIARDVLLA  219
ident       |   | |    |                                          
Sbjct APFRQAALRHNIAPIFICP--------------------------PNADDdLLRQVASYG  170
DSSP  HHHHHHHHHLLLEEEEEEL--------------------------LLLLHhHHHHHHHHL


DSSP  hhhllLEEELLL--lLHHHHHHHHHHHhllllEEEEEL------hHHHHllhhhlllllh
Query eaagcHYHVCHV--sTKESVRVIRDAKragihVTAEVT------pHHLLlteddipgnna  271
ident                                   |                         
Sbjct -----RGYTYLLalpLHHLIEKLKEYH----aAPALQGfgisspeQVSA-----------  210
DSSP  -----LLLEEELlllHHHHHHHHHHHL----lLLEEELlllllhhHHHH-----------


DSSP  hhllllllllhhhhhhhHHHHhllllLEELLLLLL--llhhhhllllllllllllLLLLH
Query iykxnpplrstedrealLEGLldgtiDCIATDHAP--hardekaqpxekapfgivGSETA  329
ident                    |             |                          
Sbjct ---------------avRAGA-----AGAISGSAIvkiieknlaspkqmlaelrsFVSAM  250
DSSP  ---------------hhHHLL-----LEEEELLHHhhhhhhllllhhhhhhhhhhHHHHH


DSSP  HHHHHhhhlllllllhhhhhhhhlhhhhhhllllllllllllllleeeeelllleellhh
Query FPLLYthfvkngdwtlqqlvdyltikpcetfnleygtlkengyadltiidldseqeikge  389
ident                                                             
Sbjct KAASR-------------------------------------------------------  255
DSSP  HHLLL-------------------------------------------------------


DSSP  hllllllllllllleelleeeeeeelleeeeel
Query dflskadntpfigykvygnpiltxvegevkfeg  422
ident                                  
Sbjct ---------------------------------  255
DSSP  ---------------------------------


No 57: Query=3griA Sbjct=2anuA Z-score=6.0

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleEEELEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfVSPGFVDVHVH   60
ident                                                        | |||
Sbjct -------------------------------------------------TEWLLCDFHVH   11
DSSP  -------------------------------------------------LEEEEEEEEEL


DSSP  LLLlllllLLLHHHHHHHHHHLLEEEEEELLL-----------------LLLL-lLLHHH
Query LREpggeyKETIETGTKAAARGGFTTVCPXPN-----------------TRPV-pDSVEH  102
ident                       |   |                                 
Sbjct TNX--sdgHLPLGEVVDLFGKHGVDVVSITDHivdrrtleqrkrngeplGAITedKFQDY   69
DSSP  LLL--lllLLLHHHHHHHHHHLLLLEEEEEEEeelhhhhhhhhhlllllLLLLllLHHHH


DSSP  HHHHHHhHHHHLL----LEELLLEellhhhlllllllhhhhhlllllleEELLL------
Query FEALQKlIDDNAQ----VRVLPYAsittrqlgkelvdfpalvkegafafTDDGV------  152
ident    |       |         |                                      
Sbjct LKRLWR-EQKRAWeeygXILIPGV-------------------------EITNNtdlyhi  103
DSSP  HHHHHH-HHHHHHhhhlLEEEEEE-------------------------EEEELllleee


DSSP  ---------LLLLhhHHHHHHHHHHHHLLLEeellllhhhllllleellhhhhhhlllee
Query ---------GVQTasXXYEGXIEAAKVNKAIvahcednsliyggaxhegkrskelgipgi  203
ident                   |        |                                
Sbjct vavdvkeyvDPSL--PVEEIVEKLKEQNALV-----------------------------  132
DSSP  eeellllllLLLL--LHHHHHHHHHHLLLEE-----------------------------


DSSP  llhhhhhhhhhhhhhhhhhllleEELLLL----lhhHHHHhHHHHhlLLLE-EEEE-LHH
Query pnicesvqiardvllaeaagchyHVCHVS----tkeSVRViRDAKraGIHV-TAEV-TPH  257
ident                           |                           |     
Sbjct -----------------------IAAHPDrkklswyLWAN-XERF--KDTFdAWEIaNRD  166
DSSP  -----------------------EELLLLllllllhHHHL-LLLL--LLLLlEEEEeELL


DSSP  HHhllhhhlllllhhhllllllllhhhhhhHHHHHHLLLLLEELLLLLLllhhhhlllll
Query HLllteddipgnnaiykxnpplrstedreaLLEGLLDGTIDCIATDHAPhardekaqpxe  317
ident  |                                           |              
Sbjct DL----------------------------FNSVGVKKYRYVANSDFHE-----------  187
DSSP  EE----------------------------LHHHHHLLLLEEEELLLLL-----------


DSSP  lllllLLLLLLHhhhhhhhhlllllllhhhhhhhHLHH--------hhHHLLllllllll
Query kapfgIVGSETAfpllythfvkngdwtlqqlvdyLTIK--------pcETFNleygtlke  369
ident                                      |                      
Sbjct -----LWHVYSW---------------------kTLVKseknieaikeAIRK--------  213
DSSP  -----HHHHLLE---------------------eEEEEelllhhhhhhHHHH--------


DSSP  llllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel
Query ngyadltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
ident                                                      
Sbjct ------------------------------------------ntdvaiylxrk  224
DSSP  ------------------------------------------llleeeeelll


No 58: Query=3griA Sbjct=3e38A Z-score=5.4

back to top
DSSP  --leeeelleEEELleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEE
Query --xklikngkVLQNgelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVH   58
ident            |                                             | |
Sbjct aqrrneiqvpDLDG-------------------------------------ytTLKCDFH   23
DSSP  llllllllllLLLL-------------------------------------leEEEEELL


DSSP  ELlLLLLlllLLLHHHHHHHHHHLLEEEEEELL---LLLLllllhHHHHHHHHHHHHHLL
Query VHlREPGgeyKETIETGTKAAARGGFTTVCPXP---NTRPvpdsvEHFEALQKLIDDNAQ  115
ident  |                  | | |                            |    | 
Sbjct XH-SVFS-dgLVWPTVRVDEAYRDGLDAISLTEhieYRPHkqdvvSDHNRSFDLCREQAE   81
DSSP  LL-LLLL-llLLLHHHHHHHHHHLLLLEELLEEellLLLLlllllLLLLHHHHHHHHHHH


DSSP  ---LEELLLEELlhhhlllllllhhhhhlllllleeelllLLLLH---------------
Query ---VRVLPYASIttrqlgkelvdfpalvkegafaftddgvGVQTA---------------  157
ident            |                                |               
Sbjct klgILLIKGSEI----------------------------TRAXApghfnaiflsdsnpl  113
DSSP  hhlLEELLEEEE----------------------------ELLLLlleeeeelllllhhh


DSSP  --hHHHHHHHHHHHHLLLEEE-LLLL--HHHLlllleellhhhhhhllleellhHHHHhh
Query --sXXYEGXIEAAKVNKAIVA-HCED--NSLIyggaxhegkrskelgipgipniCESVqi  212
ident           || |        |                                     
Sbjct eqkDYKDAFREAKKQGAFXFWnHPGWdsQQPD----------------------TTKW--  149
DSSP  lllLHHHHHHHHHHLLLEEEElLLLLllLLLL----------------------LLLL--


DSSP  HHHHHHHHHhLLLE-EELLL----LLHHHHHHHHHHHhllllEEEEelhhhhhllhhhll
Query ARDVLLAEAaGCHY-HVCHV----STKESVRVIRDAKragihVTAEvtphhlllteddip  267
ident                            |      |        |                
Sbjct WPEHTALYQ-EGCXhGIEVAnghlYXPEAIQWCLDKN-----LTXI--------------  189
DSSP  LHHHHHHHH-LLLLlEEEEEelleELLHHHHHHHHHL-----LEEE--------------


DSSP  lllhhhllllllllhhhhhhhhhhhhllllleELLLLLLLlhhhhlllllllllllllll
Query gnnaiykxnpplrstedrealleglldgtidcIATDHAPHardekaqpxekapfgivgse  327
ident                                    |                        
Sbjct --------------------------------GTSDIHQP-------------------i  198
DSSP  --------------------------------EELLLLLL-------------------h


DSSP  lhhhHHHHHHlllllllhhhhhhhHLHH---------hHHHLL-----------------
Query tafpLLYTHFvkngdwtlqqlvdyLTIK---------pCETFN-----------------  361
ident                                           |                 
Sbjct qtdyDFEKGE----------hrtxTFVFakerslqgirEALDNrrtaayfhelligredl  248
DSSP  hhhlLHHHLL----------llleEEEEellllhhhhhHHHHLlleeeeelleeellhhh


DSSP  ------------llllllllllllleeeEELL---------------------LLEEllh
Query ------------leygtlkengyadltiIDLD---------------------SEQEikg  388
ident                              ||                             
Sbjct lrpffekcvkieevsrneqgvtlsitnvTDLVlklkktahdtllvyfrdxtlkPHTRytv  308
DSSP  hhhhhhhheeeeeeeeelleeeeeeeelLLLLeeeeelllllleellleeeelLLEEeee


DSSP  hhllllllllllllleelleeeeeeelleeeeel
Query edflskadntpfigykvygnpiltxvegevkfeg  422
ident                                   
Sbjct rigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=3griA Sbjct=2yb1A Z-score=4.5

back to top
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeelEEEEEEL
Query xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgFVDVHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------aNIDLHFH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  lLLLLLllLLLHHHHHHHHHHLLEEEEEELLLlllllllhhhhhhHHHHHHHHLL---LE
Query lREPGGeyKETIETGTKAAARGGFTTVCPXPNtrpvpdsvehfeaLQKLIDDNAQ---VR  117
ident           |       ||                                 |      
Sbjct -SRTSD-gALTPTEVIDRAAARAPALLALTDH---------dctgGLAEAAAAAArrgIP   57
DSSP  -LLLLL-lLLLHHHHHHHHHLLLLLEEEELLL---------llllLHHHHHHHHHhllLL


DSSP  ELLL--------------------------eeLLHHHLLL--------------------
Query VLPY--------------------------asITTRQLGK--------------------  131
ident  |                                                          
Sbjct FLNGvevsvswgrhtvhivglgidpaepalaaGLKSIREGrlerarqmgasleaagiagc  117
DSSP  EEEEeeeeeeelleeeeeeeellllllhhhhhHHHHHHLLhhhhhhhhhhhhhhlllllh


DSSP  ------------------------llllhhhhhlllllleeellllllLHHHHH-hhhhh
Query ------------------------elvdfpalvkegafaftddgvgvqTASXXY-egxie  166
ident                                                             
Sbjct fdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQWASledavg  177
DSSP  hhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLLLLLhhhhhh


DSSP  hhhHLLLeeellllhhhllllleellhhhhhhllleellhhhhhhhhhhhhhhhhhlllE
Query aakVNKAivahcednsliyggaxhegkrskelgipgipnicesvqiardvllaeaagchY  226
ident                                                             
Sbjct wivGAGG---------------------------------------------------mA  186
DSSP  hhhHLLL---------------------------------------------------eE


DSSP  EELLLL----lHHHHHHHHHHHHlLLLE-EEEE-LHHHHHLlhhhlllllhhhlllllll
Query HVCHVS----tKESVRVIRDAKRaGIHV-TAEV-TPHHLLLteddipgnnaiykxnpplr  280
ident    |                           ||    | |                    
Sbjct VIAHPGrydmgRTLIERLILDFQ-AAGGqGIEVaSGSHSLD-------------------  226
DSSP  EELLHHhllllHHHHHHHHHHHH-HLLLlEEEEeELLLLHH-------------------


DSSP  lhhhHHHHHHHHHLLLLLE-ELLLLLLLLhhhhlllllllllllLLLLlhhhhhhhhhll
Query stedREALLEGLLDGTIDC-IATDHAPHArdekaqpxekapfgiVGSEtafpllythfvk  339
ident                        |                                    
Sbjct ---dMHKFALHADRHGLYAsSGSDFHAPG---------------EDVG------------  256
DSSP  ---hHHHHHHHHHHHLLEEeEELLLLLLL---------------LLLL------------


DSSP  lllllhhhhhhhhlhHHHHhlLLLLlllllllllleeeeelllleellhhhlllllllll
Query ngdwtlqqlvdyltiKPCEtfNLEYgtlkengyadltiidldseqeikgedflskadntp  399
ident                       ||                                    
Sbjct -----htedlppicrPIWR--ELEA-----------------------------------  274
DSSP  -----llllllllllLHHH--HLHH-----------------------------------


DSSP  lllleelleeeeeeELLEeeeel
Query figykvygnpiltxVEGEvkfeg  422
ident                        
Sbjct -----------rilRPAD--aen  284
DSSP  -----------hllLLLH--hhl