Results: dupa

Query: 3giqA

MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3giq-A 78.3  0.0  475   475  100 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   2:  3e74-A 34.0  2.5  345   429   24 PDB  MOLECULE: ALLANTOINASE;                                              
   3:  1gkp-A 32.7  2.7  358   458   20 PDB  MOLECULE: HYDANTOINASE;                                              
   4:  4b3z-D 30.6  2.9  363   477   21 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   5:  3gri-A 30.5  2.7  335   422   19 PDB  MOLECULE: DIHYDROOROTASE;                                            
   6:  3nqb-A 29.6  3.4  322   587   21 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   7:  1onx-A 29.0  3.0  321   390   18 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   8:  2vun-A 28.8  3.0  317   385   20 PDB  MOLECULE: ENAMIDASE;                                                 
   9:  1yrr-B 27.4  3.0  300   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  10:  3mkv-A 26.8  3.3  327   414   17 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  11:  4cqb-A 26.8  3.9  335   402   16 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  12:  2paj-A 26.7  3.3  314   421   18 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  13:  3mtw-A 25.6  3.4  322   404   18 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  14:  2oof-A 24.8  3.9  328   403   20 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  15:  2ogj-A 24.8  3.2  312   379   19 PDB  MOLECULE: DIHYDROOROTASE;                                            
  16:  4c5y-A 24.4  3.8  328   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  17:  1j6p-A 23.7  3.7  313   407   15 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  18:  3ls9-A 23.6  3.7  328   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  19:  3icj-A 23.6  3.5  294   468   17 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  20:  1k6w-A 23.3  4.1  336   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  21:  3ooq-A 23.2  3.2  281   384   17 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  22:  2uz9-A 21.6  3.9  308   444   18 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  23:  1a5k-C 21.5  3.0  331   566   22 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  24:  3pnu-A 20.2  3.4  270   338    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  4rdv-B 19.9  3.4  307   451   16 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  26:  1bf6-A 17.9  3.0  236   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  27:  2ob3-A 17.8  3.1  244   329   16 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  28:  2qpx-A 17.3  3.3  241   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  29:  3k2g-B 16.7  3.1  235   358   16 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  30:  2vc5-A 16.3  3.1  234   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  31:  2imr-A 16.3  4.1  267   380   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  32:  3cjp-A 16.1  2.9  221   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  33:  4dlf-A 15.7  3.4  237   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  34:  3irs-A 15.6  2.9  221   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  35:  1a4m-A 15.0  3.6  239   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  36:  2y1h-B 14.9  3.4  227   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  37:  4mup-B 14.7  3.3  226   286   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  38:  4hk5-D 14.7  3.6  239   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  39:  2ffi-A 14.6  3.3  232   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  40:  4ofc-A 14.5  3.2  224   335   10 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  41:  4qrn-A 14.2  3.4  227   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  42:  2gwg-A 14.2  3.4  235   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  43:  2dvt-A 14.2  3.3  226   325    9 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  44:  1itq-A 14.0  3.6  235   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  45:  4dzi-C 13.1  3.5  216   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  46:  3gg7-A 13.1  3.3  209   243   17 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  47:  3iac-A 12.3  3.5  244   469   14 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  1j5s-A 12.1  3.3  234   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  3qy6-A 11.6  3.2  198   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1v77-A 10.2  3.7  181   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A  9.6  4.2  247   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  1bks-A  7.6  3.9  186   255    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  53:  3au2-A  7.5  7.0  189   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  1m65-A  7.2  3.7  174   234   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3dcp-A  7.2  4.0  178   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  56:  3f2b-A  6.2  6.1  175   994    8 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  57:  3e38-A  4.7  3.7  161   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2yb1-A  4.3  3.9  150   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  2anu-A  4.1  4.2  149   224   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3giqA Sbjct=3giqA Z-score=78.3

back to top
DSSP  LLEEEEEELLEELLLLLLLLEELEEEEELLEEEEEELLLLLLEEEEEELLLLEEEELEEE
Query EKLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGELGAHPARHAWDASGKIVAPGFID   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EKLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGELGAHPARHAWDASGKIVAPGFID   60
DSSP  LLEEEEEELLEELLLLLLLLEELEEEEELLEEEEEELLLLLLEEEEEELLLLEEEELEEE


DSSP  LLLLLLLHHHHLLLLHHHHLLLEEEEEELLLLLLLLLLLLLLLLLHHHHHHLLLLLLLLH
Query VHGHDDLMFVEKPDLRWKTSQGITTVVVGNCGVSAAPAPLPGNTAAALALLGETPLFADV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VHGHDDLMFVEKPDLRWKTSQGITTVVVGNCGVSAAPAPLPGNTAAALALLGETPLFADV  120
DSSP  LLLLLLLHHHHLLLLHHHHLLLEEEEEELLLLLLLLLLLLLLLLLHHHHHHLLLLLLLLH


DSSP  HHHHHHHHHLLLLLEEEEEEEHHHHHHHHLLLLLLLLLHHHHHHHHHHHHHHHHHLLLEE
Query PAYFAALDAQRPMINVAALVGHANLRLAAMRDPQAAPTAAEQQAMQDMLQAALEAGAVGF  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PAYFAALDAQRPMINVAALVGHANLRLAAMRDPQAAPTAAEQQAMQDMLQAALEAGAVGF  180
DSSP  HHHHHHHHHLLLLLEEEEEEEHHHHHHHHLLLLLLLLLHHHHHHHHHHHHHHHHHLLLEE


DSSP  EEELLLLLHHHLLHHHHHHHHHHHHHLLLEEEEELLLLLLLHHHHHHHHHHHHHHHLLEE
Query STGLAYQPGAVAQAAELEGLARVAAERRRLHTSHIRNEADGVEAAVEEVLAIGRGTGCAT  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct STGLAYQPGAVAQAAELEGLARVAAERRRLHTSHIRNEADGVEAAVEEVLAIGRGTGCAT  240
DSSP  EEELLLLLHHHLLHHHHHHHHHHHHHLLLEEEEELLLLLLLHHHHHHHHHHHHHHHLLEE


DSSP  EELLLLLLLHHHLLLHHHHHHHHHHHHHLLLLEEEEELLLLEEEEELLHHHLLLLLLLEE
Query VVSHHKCMMPQNWGRSRATLANIDRAREQGVEVALDIYPYPGSSTILIPERAETIDDIRI  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VVSHHKCMMPQNWGRSRATLANIDRAREQGVEVALDIYPYPGSSTILIPERAETIDDIRI  300
DSSP  EELLLLLLLHHHLLLHHHHHHHHHHHHHLLLLEEEEELLLLEEEEELLHHHLLLLLLLEE


DSSP  EEELLLHHHLLLLHHHHHHHHLLLHHHHHHHHLLEEEEEELLLHHHHHHHHHLLLEEELL
Query TWSTPHPECSGEYLADIAARWGCDKTTAARRLAPAGAIYFAMDEDEVKRIFQHPCCMVGS  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TWSTPHPECSGEYLADIAARWGCDKTTAARRLAPAGAIYFAMDEDEVKRIFQHPCCMVGS  360
DSSP  EEELLLHHHLLLLHHHHHHHHLLLHHHHHHHHLLEEEEEELLLHHHHHHHHHLLLEEELL


DSSP  LLLLLLLLLLLHHHHHHHHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLL
Query DGLPNDARPHPRLWGSFTRVLGRYVREARLMTLEQAVARMTALPARVFGFAERGVLQPGA  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DGLPNDARPHPRLWGSFTRVLGRYVREARLMTLEQAVARMTALPARVFGFAERGVLQPGA  420
DSSP  LLLLLLLLLLLHHHHHHHHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLL


DSSP  LLLEEEELLLLLLLLLLLLLLLLLLLLEEEEEELLEEEELLLLLLLLLLLLLLLL
Query WADVVVFDPDTVADRATWDEPTLASVGIAGVLVNGAEVFPQPPADGRPGQVLRAX  475
ident |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct WADVVVFDPDTVADRATWDEPTLASVGIAGVLVNGAEVFPQPPADGRPGQVLRAX  475
DSSP  LLLEEEELLLLLLLLLLLLLLLLLLLLEEEEEELLEEEELLLLLLLLLLLLLLLL


No 2: Query=3giqA Sbjct=3e74A Z-score=34.0

back to top
DSSP  lLEEEEEELLEELLllLLLLEELEEEEELLEEEEEELlLLLLEEEEEELLLLEEEELEEE
Query eKLDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGElGAHPARHAWDASGKIVAPGFID   60
ident    |  |  |  |       |  |  |  | |||||      |    ||||  | ||  |
Sbjct -SFDLIIKNGTVIL--ENEARVVDIAVKGGKIAAIGQ-DLGDAKEVXDASGLVVSPGXVD   56
DSSP  -LEEEEEELLEEEL--LLLEEELEEEEELLEEEEEEL-LLLLEEEEEELLLLEEEELEEE


DSSP  LLLLLllHHHHlllLHHHHLLLEEEEEELLllLLLLLLlllllllhhhhhhllllllLLH
Query VHGHDdlMFVEkpdLRWKTSQGITTVVVGNcgVSAAPAplpgntaaalallgetplfADV  120
ident  | |           |     ||||           ||                   |  
Sbjct AHTHI--GYET--gTRAAAKGGITTXIEXP--LNQLPA---------------tvdrASI   95
DSSP  EEELL--LHHH--hHHHHHHLLEEEEEELL--LLLLLL---------------lllhHHH


DSSP  HHHHHHHhHLLLLLEEEEEEEHHhhhhhhlllllllllhhhhhHHHHHHHHHHHHLLLEE
Query PAYFAALdAQRPMINVAALVGHAnlrlaamrdpqaaptaaeqqAMQDMLQAALEAGAVGF  180
ident    | |       |  | | |                         | |    | | |||
Sbjct ELKFDAA-KGKLTIDAAQLGGLV-------------------sYNIDRLHELDEVGVVGF  135
DSSP  HHHHHHH-LLLLLLEEEELEELL-------------------lLLLLLHHHHHHHLLLLE


DSSP  EEELlllLHHHllHHHHHHHHHHHHHLLLEEEEELLL-----------------------
Query STGLayqPGAVaqAAELEGLARVAAERRRLHTSHIRN-----------------------  217
ident                     |    |       |  |                       
Sbjct XCFV---RDVN--DWQFFKGAQKLGELGQPVLVHCENalicdelgeeakregrvtahdyv  190
DSSP  EEEL---LLLL--HHHHHHHHHHHHHHLLLEEEELLLhhhhhhhhhhhhhhllllhhhhh


DSSP  ---lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHHHHHLLLLEE
Query ---eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDRAREQGVEVA  274
ident           |   ||      ||   | |                    |||  |    
Sbjct asrpVFTEVEAIRRVLYLAKVAGCRLHVCHVSS---------PEGVEEVTRARQEGQDIT  241
DSSP  hlllHHHHHHHHHHHHHHHHHHLLLEEELLLLL---------HHHHHHHHHHHHLLLLEE


DSSP  EEELLLLeeeeellhhhlllllLLEEeeelllhhhllllhhhhhhhhlllhhhhhhhhll
Query LDIYPYPgsstiliperaetidDIRItwstphpecsgeyladiaarwgcdkttaarrlap  334
ident     |                                                       
Sbjct CESCPHY-------fvldtdqfEEIG----------------------------------  260
DSSP  EEELLHH-------hhllhhhhHHHL----------------------------------


DSSP  eEEEE----ELLL--HHHHHHHHH-LLLEEELLLLLLLLL-----------lLLLHHHHH
Query aGAIY----FAMD--EDEVKRIFQ-HPCCMVGSDGLPNDA-----------rPHPRLWGS  376
ident                                 ||  |                   |   
Sbjct -TLAKcsppIRDLenQKGXWEKLFnGEIDCLVSDHSPCPPexkagnixkawgGIAGLQSC  319
DSSP  -HHHLllllLLLHhhHHHHHHHHHlLLLLEELLLLLLLLLllllllllllllLLLLHHHH


DSSP  HHHHHHHHHHHLLlLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLLL-----
Query FTRVLGRYVREARlMTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVFDPDT-----  431
ident         |       |           |  ||    |   ||  || |   |       
Sbjct XDVXFDEAVQKRG-XSLPXFGKLXATNAADIFGLQQKGRIAPGKDADFVFIQPNSsyvlt  378
DSSP  HHHHHHHHLLLLL-LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLleell


DSSP  -------llllLLLLLlllllLLEEEEEELLEEEE----LLLLllLLLLLLLLLl
Query -------vadrATWDEptlasVGIAGVLVNGAEVF----PQPPadGRPGQVLRAx  475
ident                        |      |          |      ||     
Sbjct nddleyrhkvsPYVGR--tigARITKTILRGDVIYdieqGFPV--APKGQFILKh  429
DSSP  hhhllllllllLLLLL--eelLEEEEEEELLEEEEelllLLLL--LLLLLEELLl


No 3: Query=3giqA Sbjct=1gkpA Z-score=32.7

back to top
DSSP  lleEEEEELLEELLllLLLLEELEEEEELLEEEEEELLLLLL-EEEEEELLLLEEEELEE
Query eklDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGELGAHP-ARHAWDASGKIVAPGFI   59
ident       |  | ||      |  ||       |  ||     |      || || | ||||
Sbjct ---PLLIKNGEIIT--ADSRYKADIYAEGETITRIGQNLEAPpGTEVIDATGKYVFPGFI   55
DSSP  ---LEEEELLEEEE--LLEEEELEEEELLLLLLEEELLLLLLlLLEEEELLLLEEEELEE


DSSP  ELLLLLLL------hhhHLLL-LHHHHLLLEEEEEELllllLLLLLLLlllllhhhhhhl
Query DVHGHDDL------mfvEKPD-LRWKTSQGITTVVVGncgvSAAPAPLpgntaaalallg  112
ident | | |  |                     | ||                           
Sbjct DPHVHIYLpfmatfakdTHETgSKAALMGGTTTYIEM----CCPSRND------------   99
DSSP  EEEELLLLeelleelllLHHHhHHHHHHLLEEEEEEE----ELLLLLL------------


DSSP  lllllLLHHHHHHHHHhLLLLLEEEEEEEHHhhhhhhlllllllllhhhHHHHHHHHHHH
Query etplfADVPAYFAALDaQRPMINVAALVGHAnlrlaamrdpqaaptaaeQQAMQDMLQAA  172
ident                                                         |   
Sbjct --dalEGYQLWKSKAE-GNSYCDYTFHMAVS----------------kfDEKTEGQLREI  140
DSSP  --lhhHHHHHHHHHHL-LLLLLEEEEEEELL----------------llLLLHHHHHHHH


DSSP  HHHLLLEEEEELLL-LLHHhLLHHHHHHHHHHHHHLLLEEEEELLL--------------
Query LEAGAVGFSTGLAY-QPGAvAQAAELEGLARVAAERRRLHTSHIRN--------------  217
ident    |   |   | |          |     | | |     | |  |              
Sbjct VADGISSFXIFLSYkNFFG-VDDGEMYQTLRLAKELGVIVTAHCENaelvgrlqqkllse  199
DSSP  HHLLLLEEEEEELLlLLLL-LLHHHHHHHHHHHHHHLLEEEEEELLhhhhhhhhhhhhhl


DSSP  ------------lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHH
Query ------------eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDR  265
ident                               ||    | |  |            |     
Sbjct gktgpewhepsrpEAVEAEGTARFATFLETTGATGYVVHLSC---------KPALDAAMA  250
DSSP  llllhhhllllllHHHHHHHHHHHHHHHHHHLLEEEELLLLL---------HHHHHHHHH


DSSP  HHHLLLLEEEEELL--LLEEeeellhhhlllLLLL------EEEEelllhhhllllhhhh
Query AREQGVEVALDIYP--YPGSstiliperaetIDDI------RITWstphpecsgeyladi  317
ident |   ||                                                      
Sbjct AKARGVPIYIESVIphFLLD-----------KTYAerggveAMKY---------------  284
DSSP  HHHLLLLEEEEEEHhhHHLL-----------HHHHhllhhhHHLL---------------


DSSP  hhhhlllhhhhhhhhlleeeeEELL-LHHHHHHHHH-LLLEEELLLLLlLLLL-------
Query aarwgcdkttaarrlapagaiYFAM-DEDEVKRIFQ-HPCCMVGSDGLpNDAR-------  368
ident                                           || |              
Sbjct ----------------imsppLRDKrNQKVLWDALAqGFIDTVGTDHC-PFDTeqkllgk  327
DSSP  ----------------lllllLLLLhHHHHHHHHHHlLLLLEEELLLL-LLLHhhhhhhl


DSSP  --------LLLHHHHHHHHHHHHHHHHLlLLLHHHHHHHHLHHHHHHHLLL-LLLLLLLL
Query --------PHPRLWGSFTRVLGRYVREArLMTLEQAVARMTALPARVFGFA-ERGVLQPG  419
ident           |             |           |       |  ||     |    |
Sbjct eaftaipnGIPAIEDRVNLLYTYGVSRG-RLDIHRFVDAASTKAAKLFGLFpRKGTIAVG  386
DSSP  llhhhlllLLLLLLLHHHHHHHHHLLLL-LLLHHHHHHHHLHHHHHHLLLLlLLLLLLLL


DSSP  LLLLEEEELLLLlllLLLL-------LLLL----lllLLEEEEEELLEEEE----LLLLl
Query AWADVVVFDPDTvadRATW-------DEPT----lasVGIAGVLVNGAEVF----PQPPa  464
ident   || || ||                |               | | |             
Sbjct SDADLVVYDPQY-rgTISVktqhvnnDYNGfegfeidGRPSVVTVRGKVAVrdgqFVGE-  444
DSSP  LLLLEEEEELLL-leELLHhhlllllLLLLlllleelLEEEEEEELLEEEEelleELLL-


DSSP  lLLLLLLLLL----l
Query dGRPGQVLRA----x  475
ident     |  ||      
Sbjct -KGWGKLLRRepmyf  458
DSSP  -LLLLLLLLLlllll


No 4: Query=3giqA Sbjct=4b3zD Z-score=30.6

back to top
DSSP  lleEEEEELLEELLllLLLLEELEEEEELLEEEEEELLLLLL-eEEEEELLLLEEEELEE
Query eklDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGELGAHP-aRHAWDASGKIVAPGFI   59
ident       | || ||         ||    || |  |||    |       | |  | || |
Sbjct --dRLLIKGGRIIN--DDQSLYADVYLEDGLIKQIGENLIVPggVKTIEANGRMVIPGGI   56
DSSP  --lEEEEEEEEEEL--LLLEEEEEEEEELLEEEEEELLLLLLllLEEEELLLLEEEELEE


DSSP  ELLLLLLL-hhhHLLL-LHHHHLLLEEEEEELlllllLLLLLLlllllhhhhhhlllllL
Query DVHGHDDL-mfvEKPD-LRWKTSQGITTVVVGncgvsAAPAPLpgntaaalallgetplF  117
ident ||                |     | |            | |                  
Sbjct DVNTYLQKtaadDFFQgTRAALVGGTTMIIDH-----VVPEPG-------------sslL   98
DSSP  EEEELLLLllllLHHHhHHHHHHLLEEEEEEE-----ELLLLL-------------llhH


DSSP  LLHHHHHHHHHhLLLLLEEEEEEEHHhhHHHHlllllllllhhhhhHHHHHHHHHHH-HL
Query ADVPAYFAALDaQRPMINVAALVGHAnlRLAAmrdpqaaptaaeqqAMQDMLQAALE-AG  176
ident         | |           |                            |       |
Sbjct TSFEKWHEAAD-TKSCCDYSLHVDIT--SWYD--------------GVREELEVLVQdKG  141
DSSP  HHHHHHHHHHH-LLLLLEEEEEEELL--LLLL--------------LHHHHHHHHHHlLL


DSSP  LLEEEEELLL-LLHHhLLHHHHHHHHHHHHHLLLEEEEELLL------------------
Query AVGFSTGLAY-QPGAvAQAAELEGLARVAAERRRLHTSHIRN------------------  217
ident    |    ||           |                |  |                  
Sbjct VNSFQVYMAYkDVYQ-MSDSQLYEAFTFLKGLGAVILVHAENgdliaqeqkrilemgitg  200
DSSP  LLEEEEELLLlLLLL-LLHHHHHHHHHHHHHHLLEEEEELLLhhhhhhhhhhhhhlllll


DSSP  --------lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHHHHHL
Query --------eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDRAREQ  269
ident                ||     |     |                        |  ||  
Sbjct peghalsrpEELEAEAVFRAITIAGRINCPVYITKVMS---------KSAADIIALARKK  251
DSSP  lhhhhhhllHHHHHHHHHHHHHHHHHHLLLEEEEEELL---------HHHHHHHHHHHHH


DSSP  LLLEEEEEL---LLLEeeeellhhhllllLLLEeeeelllhHHLLLlhhhhhhhhlllhh
Query GVEVALDIY---PYPGsstiliperaetiDDIRitwstphpECSGEyladiaarwgcdkt  326
ident |  |                                                        
Sbjct GPLVFGEPIaasLGTD------------gTHYW------skNWAKA--------------  279
DSSP  LLLEEEEELhhhHHLL------------lHHHH------llLHHHH--------------


DSSP  hhhhhhlleEEEE------ELLL-HHHHHHHHHLL-LEEELLLLLLLLL-----------
Query taarrlapaGAIY------FAMD-EDEVKRIFQHP-CCMVGSDGLPNDA-----------  367
ident           |              |              ||   |              
Sbjct ---------AAFVtspplsPDPTtPDYLTSLLACGdLQVTGSGHCPYSTaqkavgkdnft  330
DSSP  ---------HHLLllllllLLLLhHHHHHHHHHHLlLLLLLLLLLLLLHhhhhhhlllhh


DSSP  ---llLLHHHHHHHHHHHHHHHhLLLLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLL
Query ---rpHPRLWGSFTRVLGRYVReARLMTLEQAVARMTALPARVFGFA-ERGVLQPGAWAD  423
ident              | |    |     |   | ||      |  |      |    |  ||
Sbjct lipegVNGIEERMTVVWDKAVA-TGKMDENQFVAVTSTNAAKIFNLYpRKGRIAVGSDAD  389
DSSP  hllllLLLLLLHHHHHHHHHLL-LLLLLHHHHHHHHLHHHHHHHLLLlLLLLLLLLLLLL


DSSP  EEEELLLLllLLLLllLLLLL-------------lLLEEEEEELLEEEEL---LLLLlLL
Query VVVFDPDTvaDRATwdEPTLA-------------sVGIAGVLVNGAEVFP---QPPAdGR  467
ident ||  |||      |                          |   |  ||           
Sbjct VVIWDPDK-lKTIT--AKSHKsaveynifegmechGSPLVVISQGKIVFEdgnINVN-KG  445
DSSP  EEEEEEEE-eEELL--LLLLLllllllllllleeeEEEEEEEELLEEEEElleELLL-LL


DSSP  LLLLLLL------------------------l
Query PGQVLRA------------------------x  475
ident  |                              
Sbjct MGRFIPRkafpehlyqrvkirnkvfglqgvsr  477
DSSP  LLLLLLLllllhhhhhhhhhhhhhllllllll


No 5: Query=3giqA Sbjct=3griA Z-score=30.5

back to top
DSSP  lleEEEEELLEELlllLLLLEELEEEEELLEEEEEELLLLLL-eEEEEELLLLEEEELEE
Query eklDFKITGGWIIdgtGAPRRRADLGVRDGRIAAIGELGAHP-aRHAWDASGKIVAPGFI   59
ident       |  |            ||       |  |             || |  | ||| 
Sbjct ---XKLIKNGKVL--qNGELQQADILIDGKVIKQIAPAIEPSngVDIIDAKGHFVSPGFV   55
DSSP  ---LEEEELLEEE--eLLEEEELEEEEELLEEEEEELLLLLLllLEEEELLLLEEEELEE


DSSP  ELLLLLLL----hhhHLLL-LHHHHLLLEEEEEELLllllLLLLlllllllhhhhhhlll
Query DVHGHDDL----mfvEKPD-LRWKTSQGITTVVVGNcgvsAAPAplpgntaaalallget  114
ident ||| |                      | |||                            
Sbjct DVHVHLREpggeykeTIETgTKAAARGGFTTVCPXPntrpVPDS----------------   99
DSSP  EEEELLLLlllllllLHHHhHHHHHHLLEEEEEELLllllLLLL----------------


DSSP  lllLLHHHHHHHHHhLLLLLEEEEEEEHHHHHHhhlllllllllhhhhhhHHHHHHHHHH
Query plfADVPAYFAALDaQRPMINVAALVGHANLRLaamrdpqaaptaaeqqaMQDMLQAALE  174
ident        |     |       |          |                       |   
Sbjct --vEHFEALQKLID-DNAQVRVLPYASITTRQL---------------gkELVDFPALVK  141
DSSP  --hHHHHHHHHHHH-HHLLLEELLLEELLHHHL---------------llLLLLHHHHHL


DSSP  HLLLEEEEEllLLLHhhLLHHHHHHHHHHHHHLLLEEEEELLL-----------------
Query AGAVGFSTGlaYQPGavAQAAELEGLARVAAERRRLHTSHIRN-----------------  217
ident  ||  |             |         ||        |                    
Sbjct EGAFAFTDD--GVGV--QTASXXYEGXIEAAKVNKAIVAHCEDnsliyggaxhegkrske  197
DSSP  LLLLLEEEL--LLLL--LLHHHHHHHHHHHHHHLLLEEELLLLhhhllllleellhhhhh


DSSP  ------lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHHHHHLLL
Query ------eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDRAREQGV  271
ident                          ||   | |                  |  |   | 
Sbjct lgipgipNICESVQIARDVLLAEAAGCHYHVCHVST---------KESVRVIRDAKRAGI  248
DSSP  hllleelLHHHHHHHHHHHHHHHHHLLLEEELLLLL---------HHHHHHHHHHHHLLL


DSSP  LEEEEELLLLeeeeellhhhlllLLLLEeeeelllhhhllllhhhhhhhhlllhhhhhhh
Query EVALDIYPYPgsstiliperaetIDDIRitwstphpecsgeyladiaarwgcdkttaarr  331
ident  |     |                                                    
Sbjct HVTAEVTPHH-----lllteddiPGNNA--------------------------------  271
DSSP  LEEEEELHHH-----hhllhhhlLLLLH--------------------------------


DSSP  hlleEEEE--ELLL---HHHHHHHHHLL-LEEELLLLLLLLL-----------lLLLHHH
Query lapaGAIY--FAMD---EDEVKRIFQHP-CCMVGSDGLPNDA-----------rPHPRLW  374
ident                                    |  |                     
Sbjct ----IYKXnpPLRStedREALLEGLLDGtIDCIATDHAPHARdekaqpxekapfGIVGSE  327
DSSP  ----HHLLllLLLLhhhHHHHHHHHHLLlLLEELLLLLLLLHhhhlllllllllLLLLLL


DSSP  HHHHHHHHHHHHHLLlLLHHHHHHHHLHHHHHHHLLLlLLLLLLLLLLLEEEELLLLlll
Query GSFTRVLGRYVREARlMTLEQAVARMTALPARVFGFAeRGVLQPGAWADVVVFDPDTvad  434
ident   |       |      || | |   |  |   |     | |     ||    | |    
Sbjct TAFPLLYTHFVKNGD-WTLQQLVDYLTIKPCETFNLE-YGTLKENGYADLTIIDLDS---  382
DSSP  LHHHHHHHHHLLLLL-LLHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLEEEEELLL---


DSSP  lllllLLLLL--------------lLLEEEEEELLEEEELLllllllllllllll
Query ratwdEPTLA--------------sVGIAGVLVNGAEVFPQppadgrpgqvlrax  475
ident                                 | |   |                
Sbjct -eqeiKGEDFlskadntpfigykvyGNPILTXVEGEVKFEG--------------  422
DSSP  -leelLHHHLlllllllllllleelLEEEEEEELLEEEEEL--------------


No 6: Query=3giqA Sbjct=3nqbA Z-score=29.6

back to top
DSSP  ---------------------LLEEEEEELLEELLLLLLLLEELEEEEELLEEEEEELLL
Query ---------------------EKLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGELG   39
ident                         |  ||||   |      | || |     ||   |  
Sbjct epadlnddtlraravaaargdQRFDVLITGGTLVDVVTGELRPADIGIVGALIASVHEPA   60
DSSP  llhhhllhhhhhhhhhhhhllLLEEEEEELLEEELLLLLLEEELEEEEELLEEEEEELLL


DSSP  LL-LEEEEEELLLLEEEELEEELLLLLL---LHHHhlLLLHHHHLLLEEEEEELllllLL
Query AH-PARHAWDASGKIVAPGFIDVHGHDD---LMFVekPDLRWKTSQGITTVVVGncgvSA   95
ident     |    || |  | || || | |                    | || |        
Sbjct SRrDAAQVIDAGGAYVSPGLIDTHXHIEssxITPA--AYAAAVVARGVTTIVWD---pHE  115
DSSP  LLlLEEEEEELLLLEEEELEEEEEELHHhhlLLHH--HHHHHHHLLLEEEEEEL---lHH


DSSP  LLLLllllllhhhhhhlllLLLLLHHHHHHHHHhlLLLLEEEEEEEHHHHHHhhLLLLll
Query APAPlpgntaaalallgetPLFADVPAYFAALDaqRPMINVAALVGHANLRLaaMRDPqa  155
ident                         |     |            |                
Sbjct FGNV---------------HGVDGVRWAAKAIE--NLPLRAILLAPSCVPSA--PGLE--  154
DSSP  HHHH---------------HLHHHHHHHHHHHL--LLLLEEEEEELLLLLLL--LLLL--


DSSP  lllhhhhhHHHHHHHHHHHHL-LLEEEEELllllHHHL--LHHH-HHHHHHHHHHLLLEE
Query aptaaeqqAMQDMLQAALEAG-AVGFSTGLayqpGAVA--QAAE-LEGLARVAAERRRLH  211
ident              |   |      |                      |          | 
Sbjct ---rggadFDAAILADLLSWPeIGGIAEIX----NXRGviERDPrXSGIVQAGLAAEKLV  207
DSSP  ---lllllLLHHHHHHHHLLLlEEEEEEEL----LHHHhhLLLHhHHHHHHHHHHHLLEE


DSSP  EEELLLLlllHHHHHHHHHHHHhhhllEEEElLLLLllhhhLLLH-HHHHHHHhhhhhll
Query TSHIRNEadgVEAAVEEVLAIGrgtgcATVVsHHKCmmpqnWGRS-RATLANIdrareqg  270
ident   | |       |      | |          |         |    | |          
Sbjct CGHARGL---KNADLNAFXAAG-----VSSD-HELV-----SGEDlXAKLRAG-------  246
DSSP  EELLLLL---LHHHHHHHHHLL-----LLEE-LLLL-----LHHHhHHHHHLL-------


DSSP  llEEEEELLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhh
Query veVALDIYPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaar  330
ident                                                             
Sbjct --LTIELRGSHD------------------------------------------------  256
DSSP  --LEEEEELLLH------------------------------------------------


DSSP  hhlleeeeeelLLHHHHHH-----hhHLLLEEELLLLLLllllLLLH-hHHHHHHHHHHH
Query rlapagaiyfaMDEDEVKR-----ifQHPCCMVGSDGLPndarPHPR-lWGSFTRVLGRY  384
ident                |                   |       |      |    |  | 
Sbjct -----------HLLPEFVAalntlghLPQTVTLCTDDVF----PDDLlqGGGLDDVVRRL  301
DSSP  -----------HHHHHHHHhhhhhllLLLLEEEELLLLL----HHHHhhLLLHHHHHHHH


DSSP  HhHLLLlLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEL-LLLLlllllllllll
Query VrEARLmTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVFD-PDTVadratwdeptl  443
ident |    |   | |    |   |   |    |    |  || |||                 
Sbjct V-RYGL-KPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEdLNGF-----------  348
DSSP  H-HLLL-LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELlLLLL-----------


DSSP  lllLEEEEEELLEEEEL---LLLLLL----------------------------------
Query asvGIAGVLVNGAEVFP---QPPADG----------------------------------  466
ident        ||  |  |                                             
Sbjct ---SARHVLASGRAVAEggrXLVDIPtcdttvlkgsxklplrxandflvksqgakvrlat  405
DSSP  ---LEEEEEELLEEEEElleELLLLLllllhhhllllllllllhhhhllllllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  466
ident                                                             
Sbjct idrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafat  465
DSSP  eellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  466
ident                                                             
Sbjct tvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdaplee  525
DSSP  lllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhh


DSSP  -----------------------------------------------------lllllll
Query -----------------------------------------------------rpgqvlr  473
ident                                                             
Sbjct varafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespvi  585
DSSP  hhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeelllee


DSSP  ll
Query ax  475
ident   
Sbjct ev  587
DSSP  el


No 7: Query=3giqA Sbjct=1onxA Z-score=29.0

back to top
DSSP  -----LLEEEEEELLEELLLllLLLEELEEEEELLEEEEEE-LLLLLLE--EEEEELLLL
Query -----EKLDFKITGGWIIDGtgAPRRRADLGVRDGRIAAIG-ELGAHPA--RHAWDASGK   52
ident              |          |   |  |  | | |                | || 
Sbjct midytAAGFTLLQGAHLYAP--EDRGICDVLVANGKIIAVAsNIPSDIVpnCTVVDLSGQ   58
DSSP  llllhHHLLEEEEEEEEELL--LEEEEEEEEEELLEEEEEElLLLLLLLllLEEEELLLL


DSSP  EEEELEEELLLLLLL--------hhhHLLLLHHHHLLLEEEEEELLLlllllllllllll
Query IVAPGFIDVHGHDDL--------mfvEKPDLRWKTSQGITTVVVGNCgvsaapaplpgnt  104
ident |  ||||| | |                  |   |  | | ||                 
Sbjct ILCPGFIDQHVHLIGgggeagpttrtPEVALSRLTEAGVTSVVGLLG-------------  105
DSSP  EEEELEEEEEELLLLllllllhhhllLLLLHHHHHHLLEEEEEELLL-------------


DSSP  lhHHHHhlllllllLHHHHHHHHHH-lLLLLEEEEEEEHHHHHhhhlllllllllhhhhh
Query aaALALlgetplfaDVPAYFAALDA-qRPMINVAALVGHANLRlaamrdpqaaptaaeqq  163
ident                     |   |     |    | |                      
Sbjct -tDSIS-------rHPESLLAKTRAlnEEGISAWMLTGAYHVP---------------sr  142
DSSP  -lLLLL-------lLHHHHHHHHHHhhHHLLEEEEEEELLLLL---------------ll


DSSP  hhhHHHHHHHHHL--LLEEEEEL-LLLLhHHLLHHHHHHHHHHHHHLL------LEEEEE
Query amqDMLQAALEAG--AVGFSTGL-AYQPgAVAQAAELEGLARVAAERR------RLHTSH  214
ident                  |           |      |   |                  |
Sbjct titGSVEKDVAIIdrVIGVXCAIsDHRS-AAPDVYHLANMAAESRVGGllggkpGVTVFH  201
DSSP  lllLLHHHHHHHLllEEEEEEEElLLLL-LLLLHHHHHHHHHHHHHHHhhhlllLEEEEE


DSSP  LlLLLLlhhHHHHHHHHHHH-HHLL--EEEELLLLLLlhhhLLLHHHHHHHHHHHhhlll
Query IrNEADgveAAVEEVLAIGR-GTGC--ATVVSHHKCMmpqnWGRSRATLANIDRAreqgv  271
ident           |                     |               |           
Sbjct M-GDSK---KALQPIYDLLEnCDVPisKLLPTHVNRN----VPLFEQALEFARKG-----  248
DSSP  E-LLLL---LLLHHHHHHHHlLLLLhhHEEEELHHHL----HHHHHHHHHHHHLL-----


DSSP  lEEEEE-LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhh
Query eVALDI-YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaar  330
ident     ||                                                      
Sbjct -GTIDItSSID-------------------------------------------------  258
DSSP  -LLEEEeLLLL-------------------------------------------------


DSSP  hhlleeeeeelllHHHH-HHHHHL--------LLEEELLLLLLL-----------lLLLL
Query rlapagaiyfamdEDEV-KRIFQH--------PCCMVGSDGLPN-----------dARPH  370
ident              |                        |||                   
Sbjct -------------EPVApAEGIARavqagiplARVTLSSDGNGSqpffddegnlthIGVA  305
DSSP  -------------LLLLhHHHHHHhhhllllhHHEEEELLLLLEeeeellllleeeEEEL


DSSP  lhHHHHHHHHHHHHHHHLLlLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLL
Query prLWGSFTRVLGRYVREARlMTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVFDPD  430
ident               |          |    |   |        |   ||  ||  |  | 
Sbjct --GFETLLETVQVLVKDYD-FSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPE  362
DSSP  --LLHHHHHHHHHHHHHHL-LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEELLL


DSSP  LlllllllllllllllLEEEEEELLEEEEL---LLLLLLlllllllll
Query TvadratwdeptlasvGIAGVLVNGAEVFP---QPPADGrpgqvlrax  475
ident                  |  |   |                       
Sbjct L---------------RIEQVYARGKLMVKdgkACVKGT-----fetd  390
DSSP  L---------------LEEEEEELLEEEEElleELLLLL-----llll


No 8: Query=3giqA Sbjct=2vunA Z-score=28.8

back to top
DSSP  llEEEEEELL-EELLLLL-LLLE-ELEEEEELLEEEEEEL--LLLLL-eEEEEELLLLEE
Query ekLDFKITGG-WIIDGTG-APRR-RADLGVRDGRIAAIGE--LGAHP-aRHAWDASGKIV   54
ident       |     |  |    |        | || |||||   |          || |  |
Sbjct --SKTIIKNIgKIVSGDIkSPVLqADTIVVEDGLIAAIGGeeLMKDAgdATIIDAAGSTV   58
DSSP  --LEEEEELLlEEELLLLlLLEElLLEEEEELLEEEEEELhhHHLLLllLEEEELLLLEE


DSSP  EELEEELLLLLLLHHHH-----LLLLHHHHLLLEEEEEELLlllllllllllllllhhhh
Query APGFIDVHGHDDLMFVE-----KPDLRWKTSQGITTVVVGNcgvsaapaplpgntaaala  109
ident  ||  | | |                      | ||                        
Sbjct TPGLLDTHVHVSGGDYAprqktMDFISSALHGGVTTMISAG------------------s  100
DSSP  EELEEEEEELLLLLLEEhhhleELHHHHHHLLLEEEEEELL------------------l


DSSP  HHLLLLL------lLLHHHHHHHHHHLLL-LLEEE-EEEEHhhHHHHhlllllllllhhh
Query LLGETPL------fADVPAYFAALDAQRP-MINVA-ALVGHanLRLAamrdpqaaptaae  161
ident               |            ||    |    |                     
Sbjct PHFPGRPkdaagtkALAITLSKSYYNARPaGVKVHgGAVIL--EKGL-------------  145
DSSP  LLLLLLLllhhhhhHHHHHHHHHHHHLLHhHLEEElLEELL--LLLL-------------


DSSP  hhhHHHHHHHHHHHLLLEEEEELllLLHHhlLHHHHHHHHHHHHHLLLEEEEELLLL---
Query qqaMQDMLQAALEAGAVGFSTGLayQPGAvaQAAELEGLARVAAERRRLHTSHIRNE---  218
ident               |                           |         |       
Sbjct ---TEEDFIEMKKEGVWIVGEVG-lGTIK--NPEDAAPMVEWAHKHGFKVQMHTGGTsip  199
DSSP  ---LHHHHHHHHHLLLLEEEEEL-lLLLL--LHHHHHHHHHHHHHLLLEEEEELLLLlll


DSSP  lLLHHhHHHHHHHHHhhhllEEEELLLLlllhhhllLHHHHHHHHHHHHhlllLEEEEEL
Query aDGVEaAVEEVLAIGrgtgcATVVSHHKcmmpqnwgRSRATLANIDRAReqgvEVALDIY  278
ident           |           ||||           |      |          |  | 
Sbjct gSSTV-TADDVIKTK-----PDVVSHIN---ggptaISVQEVDRIMDET----DFAMEIV  246
DSSP  lLLLL-LHHHHHHHL-----LLEEELLL---lllllLLHHHHHHHHHHL----LLEEEEE


DSSP  LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee
Query PYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
ident                                                             
Sbjct QCGN--------------------------------------------------------  250
DSSP  LLLL--------------------------------------------------------


DSSP  eelllHHHHHHHHH-------LLLEEELLLLLlllllLLLHHHHHHHHHHHHHHhHLLLL
Query yfamdEDEVKRIFQ-------HPCCMVGSDGLpndarPHPRLWGSFTRVLGRYVrEARLM  391
ident                            | |                 |            
Sbjct -----PKIADYVARraaekgqLGRVIFGNDAP----sGTGLIPLGILRNMCQIA-SMSDI  300
DSSP  -----HHHHHHHHHhhhhhllHHHEEEELLLL----lLLLLLLLHHHHHHHHHH-HHLLL


DSSP  LHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEEEEL----------LLLLlllllllll
Query TLEQAVARMTALPARVFGFaERGVLQPGAWADVVVFD----------PDTVadratwdep  441
ident   | ||   |     | |    ||  ||  ||    |                       
Sbjct DPEVAVCMATGNSTAVYGL-NTGVIAPGKEADLIIMDtplgsvaedaMGAI--------a  351
DSSP  LHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEElllllllllhHHHH--------h


DSSP  lllLLLEEEEEELLEEEELLllllllllllllll
Query tlaSVGIAGVLVNGAEVFPQppadgrpgqvlrax  475
ident      ||  ||  |  |                 
Sbjct agdIPGISVVLIDGEAVVTKsrntppakraakil  385
DSSP  hllLLEEEEEEELLEEEELLllllllllllleel


No 9: Query=3giqA Sbjct=1yrrB Z-score=27.4

back to top
DSSP  lleeEEEELLEELLLLllLLEE-LEEEEELLEEEEEELLLLLL-eEEEEELLLLEEEELE
Query ekldFKITGGWIIDGTgaPRRR-ADLGVRDGRIAAIGELGAHP-aRHAWDASGKIVAPGF   58
ident        | | |  |              || |         |         | |  |||
Sbjct ----YALTQGRIFTGH--EFLDdHAVVIADGLIKSVCPVAELPpeIEQRSLNGAILSPGF   54
DSSP  ----LEEELLEEELLL--LEELlEEEEEELLEEEEEEEHHHLLllLLEEELLLLEEEELE


DSSP  EELLLLL-----------lLHHHHLLLL-HHHHLLLEEEEEELllllLLLLLLLlllllh
Query IDVHGHD-----------dLMFVEKPDL-RWKTSQGITTVVVGncgvSAAPAPLpgntaa  106
ident |||                                | |                      
Sbjct IDVQLNGcggvqfndtaeaVSVETLEIMqKANEKSGCTNYLPT----LITTSDE------  104
DSSP  EEEEELEelleelllllllLLHHHHHHHhHHHHLLLEEEEEEE----ELLLLHH------


DSSP  hhhhhllllLLLLHHHHHHHHHHLLLlLEEE-EEEEHHhhhhhhlllllllllhhhhHHH
Query alallgetpLFADVPAYFAALDAQRPmINVA-ALVGHAnlrlaamrdpqaaptaaeqQAM  165
ident          |            |  |                                | 
Sbjct ---------LMKQGVRVMREYLAKHP-NQALgLHLEGP----------------wlnAAL  138
DSSP  ---------HHHHHHHHHHHHHHHLL-LLLLlEEEELL----------------lllLHH


DSSP  HHHHHHHHhHLLLEEEEElllllhhhLLHHhhHHHHHHHHHLLLEEEEELLlllllhhHH
Query QDMLQAALeAGAVGFSTGlayqpgavAQAAelEGLARVAAERRRLHTSHIRneadgveAA  225
ident  | |                                   |                   |
Sbjct VDFLCENA-DVITKVTLA-------pEMVP--AEVISKLANAGIVVSAGHS-------NA  181
DSSP  HHHHHHLH-HHEEEEEEL-------hHHLL--HHHHHHHHHHLLEEEELLL-------LL


DSSP  HH-HHHHHHHhhLLEEEELLLLlllhhhllLHHH-----HHHHHHHHHhlllLEEEEELL
Query VE-EVLAIGRgtGCATVVSHHKcmmpqnwgRSRA-----TLANIDRAReqgvEVALDIYP  279
ident    |  |  |     |   |                       |             |  
Sbjct TLkEAKAGFR--AGITFATHLY-----namPYITgrepgLAGAILDEA----DIYCGIIA  230
DSSP  LHhHHHHHHH--HLEEEELLLL-----lllLLLLllllhHHHHHHHLL----LLEEEEEL


DSSP  LLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeee
Query YPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiy  339
ident                                                             
Sbjct DGLH--------------------------------------------------------  234
DSSP  LLLL--------------------------------------------------------


DSSP  elLLHHHHHHHHH--LLLEEELLLLLllllLLLLHhhhHHHHHHHHHHhHLLLLLHHHHH
Query faMDEDEVKRIFQ--HPCCMVGSDGLpndaRPHPRlwgSFTRVLGRYVrEARLMTLEQAV  397
ident    |                   |                       | |     |    
Sbjct --VDYANIRNAKRlkGDKLCLVTDAT----SGSSL---TMIEGVRNLV-EHCGIALDEVL  284
DSSP  --LLHHHHHHHHHhhHHHEEEELLLL----LLLLL---LHHHHHHHHH-HHHLLLHHHHH


DSSP  HHHLHHHHHHHLL-LLLLLLLLLLLLLEEEElLLLLllllllllllllllLEEEEEELLE
Query ARMTALPARVFGF-AERGVLQPGAWADVVVFdPDTVadratwdeptlasvGIAGVLVNGA  456
ident    |  |||  |     | |  |  |    |                    |    ||| 
Sbjct RMATLYPARAIGVeKRLGTLAAGKVANLTAF-TPDF--------------KITKTIVNGN  329
DSSP  HHHLHHHHHHLLLlLLLLLLLLLLLLLEEEE-LLLL--------------LEEEEEELLE


DSSP  EEELlllllllllllllll
Query EVFPqppadgrpgqvlrax  475
ident ||                 
Sbjct EVVT--------------q  334
DSSP  EEEE--------------l


No 10: Query=3giqA Sbjct=3mkvA Z-score=26.8

back to top
DSSP  lLEEEEEELLEELLLLLLLLEE-LEEEEELLEEEEEEL-LLLLLEEEEEELLLLEEEELE
Query eKLDFKITGGWIIDGTGAPRRR-ADLGVRDGRIAAIGE-LGAHPARHAWDASGKIVAPGF   58
ident     |    |   |               || |             |  |  ||   || 
Sbjct -LTTFLFRNGALLDPDHPDLLQgFEILIEDGFIREVSDkPIKSSNAHVIDVKGKTIMPGL   59
DSSP  -LLEEEEEEEEELLLLLLLLEEeEEEEEELLEEEEEELlLLLLLLLEEEELLLLEEEELE


DSSP  EELLLLLLLH---------------hHHLLL-LHHHHLLLEEEEEELlllLLLLllllll
Query IDVHGHDDLM---------------fVEKPD-LRWKTSQGITTVVVGncgVSAApaplpg  102
ident || | |                           |     | |||        |       
Sbjct IDLHVHVVAIefnlprvatlpnvlvtLRAVPiMRAMLRRGFTTVRDA---GGAG------  110
DSSP  EEEEELLLLLlllhhhhllllhhhhhHHHHHhHHHHHHLLEEEEEEL---LLLL------


DSSP  lllhhhhhhllllllllhHHHHHHHHH-LLLLLEEEEE-EEHH-----------------
Query ntaaalallgetplfadvPAYFAALDA-QRPMINVAAL-VGHA-----------------  143
ident                        |                                    
Sbjct ------------------YPFKQAVESgLVEGPRLFVSgRALSqtgghadprarsdympp  152
DSSP  ------------------HHHHHHHHLlLLLLLEEEELlLEEElllllllllllllllll


DSSP  -------------HHHHhhlllllllllhhHHHHHHHHHHHHHHHLLLEEEEELLL----
Query -------------NLRLaamrdpqaaptaaEQQAMQDMLQAALEAGAVGFSTGLAY----  186
ident                                           |  ||             
Sbjct dspcgccvrvgalGRVA------------dGVDEVRRAVREELQMGADQIXIMASGgvas  200
DSSP  lllllllllllllEEEL------------lLHHHHHHHHHHHHHHLLLLEEEELLLllll


DSSP  ----llhHHLLHHHHHHHHHHHHHLLLEEEEELllllllHHHHHHHHHHHHhhhllEEEE
Query ----qpgAVAQAAELEGLARVAAERRRLHTSHIrneadgVEAAVEEVLAIGrgtgcATVV  242
ident              |       |  |      |         ||       |         
Sbjct ptdpvgvFGYSEDEIRAIVAEAQGRGTYVLAHA-----yTPAAIARAVRCG-----VRTI  250
DSSP  lllllllLLLLHHHHHHHHHHHHLLLLLEEEEE-----lLHHHHHHHHHLL-----LLEE


DSSP  LLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELLL-LEEEeellhhhlllllllEEE
Query SHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYPY-PGSStiliperaetiddiRIT  301
ident  |              |                                           
Sbjct EHGNL-------iDDETARLVAEHG-----AYVVPTLVtYDAL----------asegEKY  288
DSSP  EELLL-------lLHHHHHHHHHHL-----LEEELLHHhHHHH----------hhhlLLL


DSSP  EelllhhhllllhhhhhhhhlllhhhhhhhhLLEEE-eEELLLHhHHHHHHH-----LLL
Query WstphpecsgeyladiaarwgcdkttaarrlAPAGA-iYFAMDEdEVKRIFQ-----HPC  355
ident                                 |                           
Sbjct G-----------------------------lPPESIakIADVHG-AGLHSIEimkraGVK  318
DSSP  L-----------------------------lLHHHHllHHHHHL-LHHHHHHhhhhhLLL


DSSP  EEELLLLLLLllllllhHHHHHhHHHHHHHhhlLLLLHHHHHHHHLHHHHHHHLLL-LLL
Query CMVGSDGLPNdarphprLWGSFtRVLGRYVreaRLMTLEQAVARMTALPARVFGFA-ERG  414
ident    | | |                                  |  |   | | |     |
Sbjct MGFGTDLLGE------aQRLQS-DEFRILA---EVLSPAEVIASATIVSAEVLGMQdKLG  368
DSSP  LLLLLLLLHH------hHHHLL-HHHHHHH---LLLLHHHHHHHLLHHHHHHLLLLlLLL


DSSP  LLLLLLLLLEEEELLL-----LLLLLllllllllLLLLEEEEEELLEEEELLllllllll
Query VLQPGAWADVVVFDPD-----TVADRatwdeptlASVGIAGVLVNGAEVFPQppadgrpg  469
ident    ||| ||| | |                        |  |   |              
Sbjct RIVPGAHADVLVVDGNplksvDCLLG--------QGEHIPLVMKDGRLFVNE--------  412
DSSP  LLLLLLLLLEEEELLLlllllLLLLL--------LLLLLLEEEELLEEEEEL--------


DSSP  llllll
Query qvlrax  475
ident       
Sbjct ----le  414
DSSP  ----ll


No 11: Query=3giqA Sbjct=4cqbA Z-score=26.8

back to top
DSSP  -LLEEEEEELLEELllllLLLEELEEEEELLEEEEEELLLLLLEEEEEELLLLEEEELEE
Query -EKLDFKITGGWIIdgtgAPRRRADLGVRDGRIAAIGELGAHPARHAWDASGKIVAPGFI   59
ident     |  |                | |    ||  |            || |  | ||| 
Sbjct sKDFDLIIRNAYLS----EKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFV   56
DSSP  lLLEEEEEEEEEEL----LLLEEEEEEEELLEEEEEELLLLLLEEEEEELLLLLEEELEE


DSSP  ELLLLLLLH-------------------------------------hHHLLL-LHHHHLL
Query DVHGHDDLM-------------------------------------fVEKPD-LRWKTSQ   81
ident | | | |                                                     
Sbjct DAHTHMDKSftstgerlpkfwsrpytrdaaiedglkyyknatheeikRHVIEhAHMQVLH  116
DSSP  EEEELHHHLlllllllllllllllllhhhhhhhhhhhhhhllhhhhhHHHHHhHHHHHHL


DSSP  LEEEEEELllllLLLLLlllllllhhhhhhllllLLLL--HHHHHHHHHhLLLL-LEEEE
Query GITTVVVGncgvSAAPAplpgntaaalallgetpLFAD--VPAYFAALDaQRPM-INVAA  138
ident |                                       | |   |        |    
Sbjct GTLYTRTH----VDVDS-----------------VAKTkaVEAVLEAKE-ELKDlIDIQV  154
DSSP  LEEEEEEE----EELLL-----------------LLLLhhHHHHHHHHH-HLLLlLEEEE


DSSP  EEEHHH-HHHHHlllllllllhhhhhHHHHHHHHHHHHLLLEEEEEL-LLLLhhHLLHHH
Query LVGHAN-LRLAAmrdpqaaptaaeqqAMQDMLQAALEAGAVGFSTGL-AYQPgaVAQAAE  196
ident                                    |  |         |           
Sbjct VAFAQSgFFVDL--------------ESESLIRKSLDMGCDLVGGVDpATRE--NNVEGS  198
DSSP  EEELLLlLLLLL--------------LHHHHHHHHHHHLLLEEELLLlLLLL--LLHHHH


DSSP  HHHHHHHHHHLLLEEEEELLLLLLLHHHHHHHHHHHHHHHLL--EEEELLL--LLLLhhH
Query LEGLARVAAERRRLHTSHIRNEADGVEAAVEEVLAIGRGTGC--ATVVSHH--KCMMpqN  252
ident |      | |       ||                     |       ||          
Sbjct LDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYkgRVTTSHAwcFADA--P  256
DSSP  HHHHHHHHHHLLLEEEEEELLLHHHHHHHHHHHHHHHHHLLLllLEEEEELlhHHHL--L


DSSP  LLLHHHHHHHHHHHHhllllEEEEELLLLeeeeellhhhllllllleeeeelllhhhlll
Query WGRSRATLANIDRAReqgveVALDIYPYPgsstiliperaetiddiritwstphpecsge  312
ident                                                             
Sbjct SEWLDEAIPLYKDSG-----MKFVTCFSS-------------------------------  280
DSSP  HHHHHHHHHHHHHHL-----LEEEEELLL-------------------------------


DSSP  lhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHhHHHHLL----LEEELLLLLLLLll
Query yladiaarwgcdkttaarrlapagaiyfamdEDEVkRIFQHP----CCMVGSDGLPNDar  368
ident                                                    ||       
Sbjct ------------------------------tPPTM-PVIKLLeagiNLGCASDNIRDF-w  308
DSSP  ------------------------------lLLLL-LHHHHHhlllEEEEELLLLLLL-l


DSSP  LLLHHHHhHHHHHHHHH--hHLLL-LLHHHHHHHHLHHHHHHHL-LLLLlLLLLLLLLLE
Query PHPRLWGsFTRVLGRYV--rEARL-MTLEQAVARMTALPARVFG-FAERgVLQPGAWADV  424
ident                     |      |       |   ||| |          |  || 
Sbjct VPFGNGD-MVQGALIETqrlELKTnRDLGLIWKMITSEGARVLGiEKNY-GIEVGKKADL  366
DSSP  LLLLLLL-HHHHHHHHHhhhLLLLhHHHHHHHHHHLHHHHHHHLlHHHL-LLLLLLLLLE


DSSP  EEELL---LLLLlllllllllllLLLEEEEEELLEEEEL--LLLLlllllllllll
Query VVFDP---DTVAdratwdeptlaSVGIAGVLVNGAEVFP--QPPAdgrpgqvlrax  475
ident ||                           |  ||          |           
Sbjct VVLNSlspQWAI---------idQAKRLCVIKNGRIIVKdeVIVA-----------  402
DSSP  EEELLllhHHHH---------hhLLLEEEEEELLEEEEEllEELL-----------


No 12: Query=3giqA Sbjct=2pajA Z-score=26.7

back to top
DSSP  llEEEEEELL-EELLLLLL-----LLEE-LEEEEELLEEEEEELlLLLL-eEEEEELLLL
Query ekLDFKITGG-WIIDGTGA-----PRRR-ADLGVRDGRIAAIGElGAHP-aRHAWDASGK   52
ident       |     |  |         |    |       | |||   |        ||   
Sbjct --PSTLIRNAaAIMTGGRGtaddpSRVPgPDIRIVGDTIDAIGA-LAPRpgETIVDATDC   57
DSSP  --LEEEEELLlEELLLLLLlllllLLLLlLLEEEELLEEEEELL-LLLLllLEEEELLLL


DSSP  EEEELEEELLLLLLLH----------------HHHLLL-LHHHHLLLEEEEEELllllLL
Query IVAPGFIDVHGHDDLM----------------FVEKPD-LRWKTSQGITTVVVGncgvSA   95
ident    |     | |                           |      |  ||         
Sbjct VIYPAWVNTHHHLFQSllkgepfralfderrfRLAARIgLIELARSGCATVADH----NY  113
DSSP  EEEELEELLLLLHHHHhllllllhhhllhhhhHHHHHHhHHHHHLLLEEEEEEL----LL


DSSP  LLLLLlllllhhhhhhllllllllhhHHHHHHHHLLL--LLEEEEEEEHH----------
Query APAPLpgntaaalallgetplfadvpAYFAALDAQRP--MINVAALVGHA----------  143
ident    |                         | |             | | |          
Sbjct VYYPG------------------mpfDSSAILFEEAEklGLRFVLLRGGAtqtrqleadl  155
DSSP  LLLLL------------------lllLHHHHHHHHHHhlLLEEEEEELLLllllllllll


DSSP  -hhhHHHLllllllllhhhHHHHHHHHHHHHHHLL---------LEEE-EELLlllhHHL
Query -nlrLAAMrdpqaaptaaeQQAMQDMLQAALEAGA---------VGFS-TGLAyqpgAVA  192
ident                      |                      |    |          
Sbjct ptalRPET-----------LDAYVADIERLAARYHdaspramrrVVMApTTVL----YSI  200
DSSP  lhhhLLLL-----------HHHHHHHHHHHHHHLLllllllleeEEELlLLLL----LLL


DSSP  LHHHHHHHHHHHHHLLLEEEEELLlllllhhHHHHHHHHHHhhhllEEEELLLLLllhhh
Query QAAELEGLARVAAERRRLHTSHIRneadgveAAVEEVLAIGrgtgcATVVSHHKCmmpqn  252
ident    |    | ||        ||           |                 |        
Sbjct SPREMRETAAVARRLGLRMHSHLS-----gkSPVAFCGEHD-wlgsDVWYAHLVK-----  249
DSSP  LHHHHHHHHHHHHHLLLEEEEELL-----llLHHHHHHHLL-llllLEEEELLLL-----


DSSP  llLHHHHHHHHHHHHhllllEEEEELL--LLEEeeellhhhllllllleeeeelllhhhl
Query wgRSRATLANIDRAReqgveVALDIYP--YPGSstiliperaetiddiritwstphpecs  310
ident         |                 |                                 
Sbjct --VDADEIALLAQTG-----TGVAHCPqsNGRL---------------------------  275
DSSP  --LLHHHHHHHHHHL-----LEEEELHhhHHLL---------------------------


DSSP  lllhhhhhhhhlllhhhhhhhhlleeeeeelllhhhhhHHHHLL----LEEELLLlLLLL
Query geyladiaarwgcdkttaarrlapagaiyfamdedevkRIFQHP----CCMVGSDgLPND  366
ident                                                     | |     
Sbjct --------------------------------------PVREMAdagvPVSIGVD-GAAS  296
DSSP  --------------------------------------LLLLHHhhllLEEELLL-HHHH


DSSP  lllLLHHH--HHHHHHHhHHHHHLLlLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLE
Query arpHPRLW--GSFTRVLgRYVREARlMTLEQAVARMTALPARVFGFAERGVLQPGAWADV  424
ident                      |              ||  ||| |  | |    |  || 
Sbjct ---NEAADmiSEVHMTW-LAQRARL-ASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADI  351
DSSP  ---LLLLLhhHHHHHHH-HHHHHLL-LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLE


DSSP  EEE------------LLLL--LLLLlllllllllLLLEEEEEELLEEEE--LLLLLL---
Query VVF------------DPDT--VADRatwdeptlaSVGIAGVLVNGAEVF--PQPPAD---  465
ident  |                                          |  |            
Sbjct AVYrlddpryfglhdPAIGpvASGG---------RPSVMALFSAGKRVVvdDLIEGVdik  402
DSSP  EEEelllhhhlllllHHHHhhHLLL---------LLEEEEEEELLEEEEelLLLLLLlhh


DSSP  ---------llllllllll
Query ---------grpgqvlrax  475
ident                    
Sbjct elggearrvvrellrevvv  421
DSSP  hhhhhhhhhhhhhhhhhhl


No 13: Query=3giqA Sbjct=3mtwA Z-score=25.6

back to top
DSSP  lleEEEEELLEELLLLLLLLEE-LEEEEELLEEEEEELLLLLLE--EEEEELLLLEEEEL
Query eklDFKITGGWIIDGTGAPRRR-ADLGVRDGRIAAIGELGAHPA--RHAWDASGKIVAPG   57
ident              |             | ||||  ||  |        | |  |    ||
Sbjct -aeIKAVSAARLLDVASGKYVDnPLVIVTDGRITSIGKKGDAVPagATAVDLPGVTLLPG   59
DSSP  -llEEEEEEEEEEELLLLEEEElEEEEEELLEEEEEEELLLLLLllLEEEEEEEEEEEEL


DSSP  EEELLLLLLL----------------hhHHLLL-LHHHHLLLEEEEEELLlllLLLLlll
Query FIDVHGHDDL----------------mfVEKPD-LRWKTSQGITTVVVGNcgvSAAPapl  100
ident  || | | |                   |            | |||        |     
Sbjct LIDMHVHLDSlaevggynsleysdrfwsVVQTAnAKKTLEAGFTTVRNVG---AADY---  113
DSSP  EEEEEELLLLlllllhhhhhhllhhhhhHHHHHhHHHHHHLLEEEEEELL---LLLL---


DSSP  lllllhhhhhhllllllllhhHHHHHHHH-LLLLLEEEEE-EEHH---------------
Query pgntaaalallgetplfadvpAYFAALDA-QRPMINVAAL-VGHA---------------  143
ident                          | ||   |                           
Sbjct ------------------ddvGLREAIDAgYVPGPRIVTAaISFGatgghcdstffppsm  155
DSSP  ------------------hhhHHHHHHHLlLLLLLEEEELlLLEEllllllllllllhhh


DSSP  -hhHHHHlllllllllhhHHHHHHHHHHHHHHHLLLEEEEELLL--------llhHHLLH
Query -nlRLAAmrdpqaaptaaEQQAMQDMLQAALEAGAVGFSTGLAY--------qpgAVAQA  194
ident                                  ||                         
Sbjct dqkNPFN---------sdSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqQQLTY  206
DSSP  lllLLLL---------llLHHHHHHHHHHHHHLLLLEEEEELLLlllllllllllLLLLH


DSSP  HHHHHHHHHHHHLLLEEEEELllllllHHHHHHHHHHHHhhhllEEEELLLLLllhhhll
Query AELEGLARVAAERRRLHTSHIrneadgVEAAVEEVLAIGrgtgcATVVSHHKCmmpqnwg  254
ident  |       |         |             |    |          |          
Sbjct EEMKAVVDEAHMAGIKVAAHA-----hGASGIREAVRAG-----VDTIEHASL-------  249
DSSP  HHHHHHHHHHHHLLLEEEEEE-----lLHHHHHHHHHLL-----LLEEEELLL-------


DSSP  lHHHHHHHHHHHHhllllEEEEELLL-LEEEeellhhhlllllllEEEEelllhhhLLLL
Query rSRATLANIDRAReqgveVALDIYPY-PGSStiliperaetiddiRITWstphpecSGEY  313
ident                          |                                  
Sbjct vDDEGIKLAVQKG-----AYFSMDIYnTDYT-----------qaeGKKN-------GVLE  286
DSSP  lLHHHHHHHHHHL-----LEEELLLLlHHHH-----------hhhHHHH-------LLLH


DSSP  HhhhhhhhlllhhhhhhhhlleeeeEELLLH---HHHHHHHH-LLLEEELLLLLllllll
Query LadiaarwgcdkttaarrlapagaiYFAMDE---DEVKRIFQ-HPCCMVGSDGLpndarp  369
ident                               |                  | |        
Sbjct D--------------------nlrkDRDIGElqrENFRKALKaGVKMVYGTDAG------  320
DSSP  H--------------------hhhhHHHHHHhhhHHHHHHHHhLLEEELLLLLL------


DSSP  LLHHHHHHhHHHHHHHhhLLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEEL
Query HPRLWGSFtRVLGRYVreARLMTLEQAVARMTALPARVFGF-AERGVLQPGAWADVVVFD  428
ident                |      |  ||    |   |   |     |    |   |     
Sbjct IYPHGDNA-KQFAVMV--RYGATPLQAIQSATLTAAEALGRsKDVGQVAVGRYGDMIAVA  377
DSSP  LLLLLLHH-HHHHHHH--HLLLLHHHHHHHLLHHHHHHHLLlLLLLLLLLLLLLLEEEEL


DSSP  LL-----LLLLllllllllllllLEEEEEELLEEEELlllllllllllllll
Query PD-----TVADratwdeptlasvGIAGVLVNGAEVFPqppadgrpgqvlrax  475
ident  |     |                   |   || |                 
Sbjct GDpladvTTLE------------KPVFVMKGGAVVKA-------------px  404
DSSP  LLllllhHHHH------------LLLEEEELLEEEEL-------------ll


No 14: Query=3giqA Sbjct=2oofA Z-score=24.8

back to top
DSSP  LLEEEEEELLEELLLL----LLLLE-ELEEEEELLEEEEEELL--LLLLeeEEEELLLLE
Query EKLDFKITGGWIIDGT----GAPRR-RADLGVRDGRIAAIGEL--GAHParHAWDASGKI   53
ident                              |||  ||| |         |  |  |  || 
Sbjct LNCERVWLNVTPATLRsdlaDYGLLePHALGVHEGRIHALVPXqdLKYP-aHWQDXKGKL   59
DSSP  LLLLEEEEEEEELLLLllllLLLLLlLEEEEEELLEEEEEEEHhhLLLL-lLLEELLLLE


DSSP  EEELEEELLLLLLL-----------------------------------------hHHHL
Query VAPGFIDVHGHDDL-----------------------------------------mFVEK   72
ident | || || | |                                             |   
Sbjct VTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlFELA  119
DSSP  EEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhHHHH


DSSP  LL-LHHHHLLLEEEEEELllllLLLLLLllllllhhhhhhlllllLLLHHHHHHHHH-hL
Query PD-LRWKTSQGITTVVVGncgvSAAPAPlpgntaaalallgetplFADVPAYFAALD-aQ  130
ident           | |||       |                               |     
Sbjct LPrVKSLIREGVTTVEIK----SGYGLT----------------lEDELKXLRVARRlgE  159
DSSP  HHhHHHHHHHLEEEEEEE----LLLLLL----------------hHHHHHHHHHHHHhhH


DSSP  LLLLEEEEEEEHHHHHHhhLLLLLLLLlhHHHHHHH-HHHHHHHH-HLLLEEEEELLLLL
Query RPMINVAALVGHANLRLaaMRDPQAAPtaAEQQAMQ-DMLQAALE-AGAVGFSTGLAYQP  188
ident    | |      |                            || |   |           
Sbjct ALPIRVKTTLLAAHAVP--PEYRDDPD--SWVETICqEIIPAAAEaGLADAVDVFCEHIG  215
DSSP  HLLLEEEEEEEEELLLL--HHHLLLHH--HHHHHHHhLHHHHHHHlLLLLEEEEEELLLL


DSSP  HhhlLHHHHHHHHHHHHHLLLEEEEELLLLlllHHHHhhHHHHHHHhhLLEEEELLLLLl
Query GavaQAAELEGLARVAAERRRLHTSHIRNEadgVEAAveEVLAIGRgtGCATVVSHHKCm  248
ident       |  |     |         |                        |  | |    
Sbjct F---SLAQTEQVYLAADQYGLAVKGHXDQL---SNLG--GSTLAAN--FGALSVDHLEY-  264
DSSP  L---LHHHHHHHHHHHHHLLLEEEEEELLL---LLLL--HHHHHHH--LLLLEEEELLL-


DSSP  lhhhlllhhhHHHHHHHHHHlLLLEEEEELL-LLEEeeellhhhllllllleeeeelllh
Query mpqnwgrsraTLANIDRAREqGVEVALDIYP-YPGSstiliperaetiddiritwstphp  307
ident                  |      |     |                             
Sbjct ----------LDPEGIQALA-HRGVVATLLPtAFYF------------------------  289
DSSP  ----------LLHHHHHHHH-HHLLEEEELHhHHHH------------------------


DSSP  hhllllhhhhhhhhlllhhhhhhhhlleeeeEELLLhhHHHH---hhhLLLEEELLLLLL
Query ecsgeyladiaarwgcdkttaarrlapagaiYFAMDedEVKR---ifqHPCCMVGSDGLP  364
ident                                                      | ||  |
Sbjct -------------------------------LKETK--LPPVvalrkaGVPXAVSSDINP  316
DSSP  -------------------------------LLLLL--LLLHhhhhhlLLLEEELLLLLL


DSSP  lllllLLHHHhHHHHHhHHHHhhlLLLLHhHHHHHHLHHHHHHHLL-LLLLLLLLLLLLL
Query ndarpHPRLWgSFTRVlGRYVreaRLMTLeQAVARMTALPARVFGF-AERGVLQPGAWAD  423
ident       |                  |     | |  |   ||  |     | |  |  ||
Sbjct ---gtAPIVS-LRXAX-NXACtlfGLTPV-EAXAGVTRHAARALGEqEQLGQLRVGXLAD  370
DSSP  ---llLLLLL-HHHHH-HHHHhhhLLLHH-HHHHHLLHHHHHHLLLlLLLLLLLLLLLLL


DSSP  EEEELLL-----lLLLLlllllllllLLLEEEEEELLEEEELlllllllllllllll
Query VVVFDPD-----tVADRatwdeptlaSVGIAGVLVNGAEVFPqppadgrpgqvlrax  475
ident   |                               ||| |                  
Sbjct FLVWNCGhpaelsYLIG---------VDQLVSRVVNGEETLH---------------  403
DSSP  EEEELLLlllhhhHLLL---------LLLEEEEEELLEELLL---------------


No 15: Query=3giqA Sbjct=2ogjA Z-score=24.8

back to top
DSSP  llEEEEEELLEELlLLLLL--LEELEEEEE-LLEEEEEELLLLLLEEEEEELLlLEEEEL
Query ekLDFKITGGWIIdGTGAP--RRRADLGVR-DGRIAAIGELGAHPARHAWDASgKIVAPG   57
ident        |      | |        |     || ||| |     ||            ||
Sbjct -qAPILLTNVKPV-GFGKGasQSSTDILIGgDGKIAAVGSALQAPADTQRIDA-AFISPG   57
DSSP  -lLLEEEEEEEEL-LLLLLllLLLEEEEELlLLLEEEEELLLLLLLLEEELLL-LEEEEL


DSSP  EEELLLLLLL--hhhhlLLLHHHHLLLEEEEEELLlllLLLLLlllllllhhhhhhllll
Query FIDVHGHDDL--mfvekPDLRWKTSQGITTVVVGNcgvSAAPAplpgntaaalallgetp  115
ident   | | |                   | || |      ||  |                 
Sbjct WVDLHVHIWHggtdisiRPSECGAERGVTTLVDAG---SAGEA-----------------   97
DSSP  EEEEEELLLLlllllllLHHHLLHHHLEEEEEEEL---LLLLL-----------------


DSSP  lllLHHHHHHHHhhLLLLLEEEEEEEHHH-------------hHHHHlllllllllhhhh
Query lfaDVPAYFAALdaQRPMINVAALVGHAN-------------lRLAAmrdpqaaptaaeq  162
ident                       |                                     
Sbjct ---NFHGFREYI-iEPSRERIKAFLNLGSiglvacnrvpelrdIKDI-------------  140
DSSP  ---LHHHHHHHL-lLLLLLEEEEEEELLLllllllllllllllHHHL-------------


DSSP  hhHHHHHH-HHHHHL--LLEEEEELLLLLHHHLLHHHHHHHHHHHHHLLLEEEEELLLLl
Query qaMQDMLQ-AALEAG--AVGFSTGLAYQPGAVAQAAELEGLARVAAERRRLHTSHIRNEa  219
ident     |       |     ||                        |         |     
Sbjct --DLDRILeCYAENSehIVGLXVRASHVITGSWGVTPVKLGKKIAKILKVPXXVHVGEP-  197
DSSP  --LHHHHHhHHHLLLllEEEEEEEELHHHHLLLLLHHHHHHHHHHHHHLLLEEEEELLL-


DSSP  llhhhHHHHHHHHHhhhLLEEEELLL-LLLLhhhlLLHHHHHHHHHHHHhlllLEEEEEL
Query dgveaAVEEVLAIGrgtGCATVVSHH-KCMMpqnwGRSRATLANIDRAReqgvEVALDIY  278
ident         ||| |    |   || |                     |         ||| 
Sbjct ---paLYDEVLEIL---GPGDVVTHCfNGKSgssiXEDEDLFNLAERCE----GIRLDIG  247
DSSP  ---llLHHHHHHHL---LLLLEEELLlLLLLllllLLLHHHHHHHHHLL----LLEEELL


DSSP  LLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee
Query PYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
ident     |                                                       
Sbjct HGGAS-------------------------------------------------------  252
DSSP  LLLLL-------------------------------------------------------


DSSP  eellLHHHHHHH--hhLLLEEELLLLLLLlllLLLHhhHHHHHHHHHHHhhLLLLLHHHH
Query yfamDEDEVKRI--fqHPCCMVGSDGLPNdarPHPRlwGSFTRVLGRYVreARLMTLEQA  396
ident                         |         |                      |  
Sbjct ---fSFKVAEAAiargLLPFSISTDLHGH-sxNFPV--WDLATTXSKLL--SVDXPFENV  304
DSSP  ---lLHHHHHHHhhllLLLLLLLLLLLLL-llLLLL--LLHHHHHHHHH--HLLLLHHHH


DSSP  HHHHLHHHHHHHLLLLllLLLLLLLLLEEEELLLLlllLLLL-----llllllllLEEEE
Query VARMTALPARVFGFAErgVLQPGAWADVVVFDPDTvadRATW-----deptlasvGIAGV  451
ident |   |  || |        |  |  ||  |||                            
Sbjct VEAVTRNPASVIRLDXenRLDVGQRADFTVFDLVD-adLEATdsngdvsrlkrlfEPRYA  363
DSSP  HHLLLHHHHHHLLLLLllLLLLLLLLEEEEEEEEE-eeEEEEllllleeeeeeeeEEEEE


DSSP  EELLEEEELlllllllllllllll
Query LVNGAEVFPqppadgrpgqvlrax  475
ident                         
Sbjct VIGAEAIAA--------sryipra  379
DSSP  EELLEEEEL--------lllllll


No 16: Query=3giqA Sbjct=4c5yA Z-score=24.4

back to top
DSSP  -LLEEEEEELLEELLLLlLLLEE-LEEEEELLEEEEEEL---LLLL---LEEEEEELllL
Query -EKLDFKITGGWIIDGTgAPRRR-ADLGVRDGRIAAIGE---LGAH---PARHAWDAsgK   52
ident  |     |  |  | |      | | |   |  ||  |                      
Sbjct dEAKVTIIYAGLLIPGD-GEPLRnAALVISDKIIAFVGSeadIPKKylrSTQSTHRV--P   57
DSSP  lLLLEEEEEEEEELLLL-LLLEEeEEEEEELLEEEEEEEhhhLLHHhhhHLLLEEEE--E


DSSP  EEEELEEELLLLLLL------------------HHHHLLL-LHHHHLLLEEEEEELlllL
Query IVAPGFIDVHGHDDL------------------MFVEKPD-LRWKTSQGITTVVVGncgV   93
ident    ||  | | |                                    | |         
Sbjct VLMPGLWDCHMHFGGdddyyndytsglathpasSGARLARgCWEALQNGYTSYRDL---A  114
DSSP  EEEELEEEEEELLLLllllllllhhhhhllhhhHHHHHHHhHHHHHHLLEEEEEEL---L


DSSP  LLLlllllllllhhhhhhllllllllhhHHHHHHHH-LLLLLEEEEE-EEHH--------
Query SAApaplpgntaaalallgetplfadvpAYFAALDA-QRPMINVAAL-VGHA--------  143
ident                                 |         ||                
Sbjct GYG------------------------cEVAKAINDgTIVGPNVYSSgAALSqtaghgdi  150
DSSP  LLH------------------------hHHHHHHHLlLLLLLEEEELlLEEEllllllll


DSSP  --------------------------HHHHhhlllllllllhhHHHHHHHHHHHHHHHLL
Query --------------------------NLRLaamrdpqaaptaaEQQAMQDMLQAALEAGA  177
ident                                                           ||
Sbjct falpagevlgsygvmnprpgywgagpLCIA------------dGVEEVRRAVRLQIRRGA  198
DSSP  llllhhhhhhhhllllllllllllllEEEL------------lLHHHHHHHHHHHHHHLL


DSSP  LEEEEELLL--------llhHHLLHHHHHHHHHHHHHLLLEEEEELllllllHHHHHHHH
Query VGFSTGLAY--------qpgAVAQAAELEGLARVAAERRRLHTSHIrneadgVEAAVEEV  229
ident                     |     ||      ||   |    |         |     
Sbjct KVIXVMASGgvmsrddnpnfAQFSPEELKVIVEEAARQNRIVSAHV-----hGKAGIMAA  253
DSSP  LLEEEELLLlllllllllllLLLLHHHHHHHHHHHHHLLLLEEEEE-----lLHHHHHHH


DSSP  HHHHhhhllEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELL-LLEEeeell
Query LAIGrgtgcATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYP-YPGSstili  288
ident    |          |                                             
Sbjct IKAG-----CKSLEHVSY-------aDEEVWELMKEKG-----ILYVATRsVIEI-----  291
DSSP  HHHL-----LLEEEELLL-------lLHHHHHHHHHHL-----LEEELLHhHHHH-----


DSSP  hhhllllllLEEEEElllhhhllllhhhhhhhhlllhhhhhhhhlLEEEEE--ELLL--H
Query peraetiddIRITWStphpecsgeyladiaarwgcdkttaarrlaPAGAIY--FAMD--E  344
ident                                                         |   
Sbjct -----flasNGEGLV------------------------------KESWAKlqALADshL  316
DSSP  -----hhhhLLLLLL------------------------------LLHHHLllHHHHhhH


DSSP  HHHHHHHH-LLLEEELLLLLllllllllhHHHHHhHHHHHHHhhllLLLHHHHHHHHLHH
Query DEVKRIFQ-HPCCMVGSDGLpndarphprLWGSFtRVLGRYVrearLMTLEQAVARMTAL  403
ident                | |                   |   |     ||   |    || 
Sbjct KAYQGAIKaGVTIALGTDTA--------pGGPTA-LELQFAV-ergGMTPLEAIKAATAN  366
DSSP  HHHHHHHHlLLLEELLLLLL--------lLLLLH-HHHHHHH-hllLLLHHHHHHHHLLL


DSSP  HHHHH--LLLLLLLLLLLLLLLEEEELLLL-----LLLLlllllllllLLLEEEEEELLE
Query PARVF--GFAERGVLQPGAWADVVVFDPDT-----VADRatwdeptlaSVGIAGVLVNGA  456
ident             | |  |  |||            |                  |   | 
Sbjct APLSVgpQAPLTGQLREGYEADVIALEENPledikVFQE---------PKAVTHVWKGGK  417
DSSP  HHHHHhhHLLLLLLLLLLLLLLEEEELLLLlllhhHHHL---------HHHEEEEEELLE


DSSP  EEELL-----LLLLLlllllllll
Query EVFPQ-----PPADGrpgqvlrax  475
ident                         
Sbjct LFKGPgigpwGEDAR-----npfl  436
DSSP  EEELLlllllLLLLL-----llll


No 17: Query=3giqA Sbjct=1j6pA Z-score=23.7

back to top
DSSP  llEEEEEELLEELLLLLLLLEELEEEEELLEEEEEEL-LLLLleeeEEELLLLEEEELEE
Query ekLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGE-LGAHparhAWDASGKIVAPGFI   59
ident       |    |                 | |                | ||| | |   
Sbjct --HHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQgEVKV----DLDLSGKLVXPALF   54
DSSP  --LEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEElLLLL----LEELLLEEEEELEE


DSSP  ELLLLLL-----------------------------------LHHHhlllLHHHHLLLEE
Query DVHGHDD-----------------------------------LMFVekpdLRWKTSQGIT   84
ident   | |                                                    || 
Sbjct NTHTHAPxtllrgvaedlsfeewlfskvlpiedrltekxayyGTIL---aQXEXARHGIA  111
DSSP  EEEELHHhhhhllllllllhhhhhhllhhhhhllllhhhhhhHHHH---hHHHHHLLLEE


DSSP  EEEELllllLLLLllllllllhhhhhhllllllllhHHHHHHHHhlLLLLEEEEEEEHHh
Query TVVVGncgvSAAPaplpgntaaalallgetplfadvPAYFAALDaqRPMINVAALVGHAn  144
ident   |                                      |              |   
Sbjct GFVDX----YFHE-----------------------EWIAKAVR--DFGXRALLTRGLV-  141
DSSP  EEEEE----ELLH-----------------------HHHHHHHH--HHLLEEEEEEEEL-


DSSP  hhhhhllllLLLLlhhhHHHHHHHHHHHHHHLL-------LEEEE-ELLLllhhhLLHHH
Query lrlaamrdpQAAPtaaeQQAMQDMLQAALEAGA-------VGFST-GLAYqpgavAQAAE  196
ident                                         |||                 
Sbjct --------dSNGD----DGGRLEENLKLYNEWNgfegrifVGFGPhSPYL-----CSEEY  184
DSSP  --------lLLLL----LLLHHHHHHHHHHHHLlhhhleeEEEEElLLLL-----LLHHH


DSSP  HHHHHHHHHHLLLEEEEELLLLLLLHHHhHHHHH-HHHHhhLLEEEELLLLLllhhhlll
Query LEGLARVAAERRRLHTSHIRNEADGVEAaVEEVL-AIGRgtGCATVVSHHKCmmpqnwgr  255
ident |      |       | |            |  |          |   |           
Sbjct LKRVFDTAKSLNAPVTIHLYETSKEEYD-LEDILnIGLK--EVKTIAAHCVH-------l  234
DSSP  HHHHHHHHHHHLLLEEEEELLLLLLLLL-LHHHHlLLLL--LLLEEEEELLL-------l


DSSP  HHHHHHHHHHhhhllLLEEEEELLL-LEEEeellhhhllllllleeeeelllhhhllllh
Query SRATLANIDRareqgVEVALDIYPY-PGSStiliperaetiddiritwstphpecsgeyl  314
ident                        |                                    
Sbjct PERYFGVLKD-----IPFFVSHNPAsNLKL------------------------------  259
DSSP  LHHHHHHHLL-----LLEEEEELHHhHHHL------------------------------


DSSP  hhhhhhhlllhhhhhhhhlleeeeeeLLLHhhhHHHHHLL----LEEELLLLLlllllLL
Query adiaarwgcdkttaarrlapagaiyfAMDEdevKRIFQHP----CCMVGSDGLpndarPH  370
ident                                                 | ||        
Sbjct --------------------------GNGI---APVQRXIehgxKVTLGTDGA-----AS  285
DSSP  --------------------------LLLL---LLHHHHHhlllEEEELLLLL-----LL


DSSP  LHHHHHHHHHHhHHHHHLL-----LLLHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEE
Query PRLWGSFTRVLgRYVREAR-----LMTLEQAVARMTALPARVFGFaERGVLQPGAWADVV  425
ident       |                            |   |   ||   |    |  || |
Sbjct NNSLNLFFEXR-LASLLQKaqnprNLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLV  343
DSSP  LLLLLHHHHHH-HHHHHHHlllllLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEE


DSSP  EEL----------------lLLLLllllllllllllLLEEEEEELLEEEEL--LLLLLL-
Query VFD----------------pDTVAdratwdeptlasVGIAGVLVNGAEVFP--QPPADG-  466
ident | |                                        | |         |    
Sbjct VIDldlpexfpvqniknhlvHAFS------------GEVFATXVAGKWIYFdgEYPTIDs  391
DSSP  EEElllhhhllhhhhhhhhhHLLL------------LLLLEEEELLEEEEEllLLLLLLh


DSSP  -------lllllllll
Query -------rpgqvlrax  475
ident                 
Sbjct eevkrelariekelys  407
DSSP  hhhhhhhhhhhhhhhl


No 18: Query=3giqA Sbjct=3ls9A Z-score=23.6

back to top
DSSP  lleEEEEELL-EELLLLL-LLLEE-LEEEEELLEEEEEE-LLLLLLEEEEEELLLLEEEE
Query eklDFKITGG-WIIDGTG-APRRR-ADLGVRDGRIAAIG-ELGAHPARHAWDASGKIVAP   56
ident       | |    |           ||       | | |  |         |  | |  |
Sbjct ---MILIRGLtRVITFDDqERELEdADILIDGPKIVAVGkDLSDRSVSRTIDGRGMIALP   57
DSSP  ---LEEEEEEeEEELLLLlLLEEEeEEEEEELLEEEEEElLLLLLLLLEEEELLLEEEEE


DSSP  LEEELLLLLLLH--------------------------------------hHHLLL-LHH
Query GFIDVHGHDDLM--------------------------------------fVEKPD-LRW   77
ident | |  | |                                                 |  
Sbjct GLINSHQHLYEGamraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAvLLE  117
DSSP  LEEEEEELHHHHhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHhHHH


DSSP  HHLLLEEEEEELlllllLLLLLLLllllhhhhhhlllllLLLHHHHHHHHHhlLLLLEEE
Query KTSQGITTVVVGncgvsAAPAPLPgntaaalallgetplFADVPAYFAALDaqRPMINVA  137
ident     |||||            |                      |   |       |   
Sbjct SLLGGITTVADQ-----HLFFPGA-------------taDSYIDATIEAAT--DLGIRFH  157
DSSP  HHHLLEEEEEEE-----ELLLLLL-------------llLLHHHHHHHHHH--HHLLEEE


DSSP  EEEEHHhhhhhhlllLLLL------llhhhHHHHHHHHHHHHHHL---------LLEEEE
Query ALVGHAnlrlaamrdPQAA------ptaaeQQAMQDMLQAALEAG---------AVGFST  182
ident |                                                           
Sbjct AARSSM-------tlGKSEggfcddlfvepVDRVVQHCLGLIDQYhepepfgmvRIALGP  210
DSSP  EEELLL-------llLHHHlllllhhhlllHHHHHHHHHHHHHHHlllllllleEEEELL


DSSP  -ELLLllhhhLLHHHHHHHHHHHHHLLLEEEEELlLLLLLH--------hHHHHHHH-HH
Query -GLAYqpgavAQAAELEGLARVAAERRRLHTSHIrNEADGV--------eAAVEEVL-AI  232
ident  |  |           |  |  ||        |   |                       
Sbjct cGVPY-----DKPELFEAFAQMAADYDVRLHTHF-YEPLDAgmsdhlygmTPWRFLEkHG  264
DSSP  lLLLL-----LLHHHHHHHHHHHHHHLLEEEEEE-LLLLHHhhhhhhhllLHHHHHHhLL


DSSP  HHhhllEEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEELLL-LEEEeellhhh
Query GRgtgcATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDIYPY-PGSStiliper  291
ident            |            |        |      ||                  
Sbjct WA--sdRVWLAHAVV-------PPREEIPEFADAG-----VAIAHLIApDLRM-------  303
DSSP  LL--llLEEEEELLL-------LLHHHHHHHHHHL-----LEEEELHHhHHHL-------


DSSP  llllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHhhhHHHH
Query aetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEdevKRIF  351
ident                                                           | 
Sbjct -------------------------------------------------GWGL---APIR  311
DSSP  -------------------------------------------------LLLL---LLHH


DSSP  HLL----LEEELLLLLlllllLLLHHHHHHHHHhHHHHHHLL---------LLLHHHHHH
Query QHP----CCMVGSDGLpndarPHPRLWGSFTRVlGRYVREAR---------LMTLEQAVA  398
ident            |  |                          |                  
Sbjct EYLdagiTVGFGTTGS-----ASNDGGNLLGDL-RLAALAHRpadpnepekWLSARELLR  365
DSSP  HHHhlllEEEELLLLL-----LLLLLLLHHHHH-HHHHHHLHhhllllhhhLLLHHHHHH


DSSP  HHLHHHHHHHLLLLLLLLLLLLLLLEEEEL------------LLLLLlllllllllLLLL
Query RMTALPARVFGFAERGVLQPGAWADVVVFD------------PDTVAdratwdeptLASV  446
ident   |   |   |    |||  |  ||                               |   
Sbjct MATRGSAECLGRPDLGVLEEGRAADIACWRldgvdrvgvhdpAIGLI------mtgLSDR  419
DSSP  HLLHHHHHHLLLLLLLLLLLLLLLLEEEEElllhhhlllllhHHHHH------hllLLLL


DSSP  lEEEEEELLEEEEL---LLLLLL---lllllllll
Query gIAGVLVNGAEVFP---QPPADG---rpgqvlrax  475
ident     | |||           ||             
Sbjct -ASLVVVNGQVLVEnerPVLADLerivanttalip  453
DSSP  -LLEEEELLEEEEElleELLLLHhhhhhhhhhhll


No 19: Query=3giqA Sbjct=3icjA Z-score=23.6

back to top
DSSP  llEEEEEELLEELLLLLLLLEELEEEEELLEEEEEEL---LLLL---LEEEEEELLLLEE
Query ekLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGE---LGAH---PARHAWDASGKIV   54
ident          | |            |     |    |                 |  || |
Sbjct --CMKALINGTIYTSFSPVKKVSGLVISNERVLYAGDsstALRIaelAGGEIIDLKGKFV   58
DSSP  --LEEEEELLEEEEEELLEEEELEEEEELLEEEEEELhhhHHHHhhhHLLEEEELLLLEE


DSSP  EELEEELLLLLLLHH---------------------------------------------
Query APGFIDVHGHDDLMF---------------------------------------------   69
ident  | | | | | |                                                
Sbjct MPAFFDSHLHLDELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptr  118
DSSP  EELEEEEEELHHHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   69
ident                                                             
Sbjct edldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinek  178
DSSP  hhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhl


DSSP  --------HHLLL-LHHHHLLLEEEEEELllllLLLLllllllllhhhhhhllllllLLH
Query --------VEKPD-LRWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfADV  120
ident                    | |   |       |                          
Sbjct iltvkdykHYIESaQEHLLSLGVHSVGFM----SVGE--------------------KAL  214
DSSP  lllhhhhhHHHHHhHHHHHHLLEEEEEEE----EELH--------------------HHH


DSSP  HHHHHHHHHLLLLLEEEEEEEHHHHhhhhlllllllllhhhhhHHHHhhhHHHH----hL
Query PAYFAALDAQRPMINVAALVGHANLrlaamrdpqaaptaaeqqAMQDmlqAALE----aG  176
ident  | |      |   || |      |                                   
Sbjct KALFELEREGRLKMNVFAYLSPELL------------------DKLEelnLGKFegrrlR  256
DSSP  HHHHHHHHLLLLLLEEEEEELHHHH------------------HHHHhhlLLLEellleE


DSSP  LLEEEEELLL-------------------llhHHLLHHHHHHHHHHHHHLLLEEEEELll
Query AVGFSTGLAY-------------------qpgAVAQAAELEGLARVAAERRRLHTSHIrn  217
ident   |                              |    |       |         |   
Sbjct IWGVXLFVDGslgartallsepytdnpttsgeLVMNKDEIVEVIERAKPLGLDVAVHA--  314
DSSP  EEEEEEELLLllllllllllllllllllllllLLLLHHHHHHHHHHHLLLLLEEEEEE--


DSSP  llllHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEE
Query eadgVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDI  277
ident        ||   |             |               |  |         |    
Sbjct ---iGDKAVDVALDAFEEAEFSGRIEHASL-------vRDDQLERIKELK-----VRISA  359
DSSP  ---lLHHHHHHHHHHHHHHLLLLEEEELLL-------lLHHHHHHHHHHL-----LEEEE


DSSP  L-LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhllee
Query Y-PYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapag  336
ident                                                             
Sbjct QpHFIV------------------------------------------------------  365
DSSP  LlLHHH------------------------------------------------------


DSSP  eEEELL-------lHHHHHhHHHLL----LEEELLLLLlllllllLHHHHhHHHHHHHHH
Query aIYFAM-------dEDEVKrIFQHP----CCMVGSDGLpndarphPRLWGsFTRVLGRYV  385
ident                                    |                       |
Sbjct -SDWWIvnrvgeerAKWAY-RLKTLssitKLGFSTDSP-------IEPAD-PWVSIDAAV  415
DSSP  -HLLLHhhhhhhhhHHHLL-LHHHHhhhlLEEELLLLL-------LLLLL-HHHHHHHHH


DSSP  HH-----llLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEE--LLLLlllllll
Query RE-----arLMTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVF--DPDTvadratw  438
ident              | |    |   | |      | |  |  |       ||         
Sbjct NRyvvdpgeRVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILdrDPLK-------  468
DSSP  HLllllhhhLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEllLLLL-------


DSSP  llllllllleeeeeelleeeellllllllllllllll
Query deptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                      
Sbjct -------------------------------------  468
DSSP  -------------------------------------


No 20: Query=3giqA Sbjct=1k6wA Z-score=23.3

back to top
DSSP  llEEEEEELLEElllllLLLE-ELEEEEELLEEEEEEL---lLLLLeEEEEELLLLEEEE
Query ekLDFKITGGWIidgtgAPRR-RADLGVRDGRIAAIGE---lGAHPaRHAWDASGKIVAP   56
ident       |                      || | ||               ||    | |
Sbjct --ALQTIINARL-----PGEEgLWQIHLQDGKISAIDAqsgvMPIT-ENSLDAEQGLVIP   52
DSSP  --LLLEEEEELL-----LLLLlEEEEEEELLEEEEEEEelllLLLL-LLEEELLLLEEEL


DSSP  LEEELLLLLLLH---------------------------------hHHLLL-LHHHHLLL
Query GFIDVHGHDDLM---------------------------------fVEKPD-LRWKTSQG   82
ident  |   | | |                                          | |    |
Sbjct PFVEPHIHLDTTqtagqpnwnqsgtlfegierwaerkallthddvkQRAWQtLKWQIANG  112
DSSP  LEEEEEELLLLLlllllllllllllhhhhhhhhhllhhhllhhhhhHHHHHhHHHHHHLL


DSSP  EEEEEELllllLLLLLLllllllhhhhhhlllllLLLHHHHHHHHHhLLLL-LEEEEEEE
Query ITTVVVGncgvSAAPAPlpgntaaalallgetplFADVPAYFAALDaQRPM-INVAALVG  141
ident |  |                                   |            |       
Sbjct IQHVRTH----VDVSDA----------------tLTALKAMLEVKQ-EVAPwIDLQIVAF  151
DSSP  EEEEEEE----EELLLL----------------lLHHHHHHHHHHH-HHLLlLEEEEEEE


DSSP  HHH-HHHHHlllllllllhhhhhHHHHHHHHHHHHLLLEEEEELLllLHHH--LLHHHHH
Query HAN-LRLAAmrdpqaaptaaeqqAMQDMLQAALEAGAVGFSTGLAyqPGAV--AQAAELE  198
ident                             |  ||  ||                     | 
Sbjct PQEgILSYP--------------NGEALLEEALRLGADVVGAIPH--FEFTreYGVESLH  195
DSSP  LLLlLLLLL--------------LHHHHHHHHHHLLLLEEEELHH--HLLLhhHHHHHHH


DSSP  HHHHHHHHLLLEEEEELL-LLLLLHhHHHHHHHHHHHHHLL--EEEELLL--LLLLhhHL
Query GLARVAAERRRLHTSHIR-NEADGVeAAVEEVLAIGRGTGC--ATVVSHH--KCMMpqNW  253
ident      |    ||   |            || | |     |       ||         | 
Sbjct KTFALAQKYDRLIDVHCDeIDDEQS-RFVETVAALAHHEGMgaRVTASHTtaMHSY--NG  252
DSSP  HHHHHHHHHLLEEEEEELlLLLLLL-LHHHHHHHHHHHHLLhhHEEEEELhhHHHL--LH


DSSP  LLHHHHHHHHHHHHhllllEEEEELLLlEEEEellHHHLLLLllleeeeelllhhhllll
Query GRSRATLANIDRAReqgveVALDIYPYpGSSTiliPERAETIddiritwstphpecsgey  313
ident                          |                                  
Sbjct AYTSRLFRLLKMSG-----INFVANPLvNIHL-qgRFDTYPK------------------  288
DSSP  HHHHHHHHHHHHHL-----LEEEELHHhHHHH-llLLLLLLL------------------


DSSP  hhhhhhhhlllhhhhhhhhlleeeeEELLlhhHHHHHHH-LLLEEELLLLLLLLlLLLLh
Query ladiaarwgcdkttaarrlapagaiYFAMdedEVKRIFQ-HPCCMVGSDGLPNDaRPHPr  372
ident                                  ||           | |       |   
Sbjct -------------------------RRGI--tRVKEMLEsGINVCFGHDDVFDPwYPLG-  320
DSSP  -------------------------LLLL--lLHHHHHHlLLLEEELLLLLLLLlLLLL-


DSSP  HHHHHHHHH----hhhHHHLLLLLhhHHHHHHLHHHHHHHLLLLLlLLLLLLLLLEEEEL
Query LWGSFTRVL----gryVREARLMTleQAVARMTALPARVFGFAERgVLQPGAWADVVVFD  428
ident                                 |   ||            |  |      
Sbjct TANMLQVLHmglhvcqLMGYGQIN--DGLNLITHHSARTLNLQDY-GIAAGNSANLIILP  377
DSSP  LLLHHHHHHhhhhhllLLLHHHHH--HHHHHHLHHHHHHLLLLLL-LLLLLLLLLEEEEL


DSSP  L---LLLLlllllllllllLLLEEEEEELLEEEELL-----llllllllllllll
Query P---DTVAdratwdeptlaSVGIAGVLVNGAEVFPQ-----ppadgrpgqvlrax  475
ident                     |        |                         
Sbjct AengFDAL---------rrQVPVRYSVRGGKVIASTqpaqttvyleqpeaidykr  423
DSSP  LllhHHHH---------hhLLLLLEEEELLEEEEELlllleeeellleeeellll


No 21: Query=3giqA Sbjct=3ooqA Z-score=23.2

back to top
DSSP  lleEEEEELLEELLLLlLLLEELEEEEELLEEEEEE-LLLLLLEeEEEELLLLEEEELEE
Query eklDFKITGGWIIDGTgAPRRRADLGVRDGRIAAIG-ELGAHPArHAWDASGKIVAPGFI   59
ident                |       |  |  |     |       |    |  ||   ||| 
Sbjct ---KILFKNATVFPIT-SRPFKGDVLVSNGKVEKVGeNIEDPDA-EIVDLTGKFLFPGFV   55
DSSP  ---LEEEEEEEELLLL-LLLEEEEEEEELLEEEEEElLLLLLLL-EEEELLLLEEEELEE


DSSP  ELLLLLL-----------------------------LHHHhLLLLHHHHLLLEEEEEELL
Query DVHGHDD-----------------------------LMFVeKPDLRWKTSQGITTVVVGN   90
ident | | |                                     |        | | |    
Sbjct DAHSHIGlfeegvgyyysdgneatdpvtphvkaldgFNPQ-DPAIERALAGGVTSVXIVP  114
DSSP  EEEELLLlllllllhhhlllllllllllllllhhhhLLLL-LHHHHHHHLLLEEEEEELL


DSSP  LLlllllllllllllhhhhhhllllllllhhhhhHHHHhlllllEEEEeeehhhhhhhhl
Query CGvsaapaplpgntaaalallgetplfadvpayfAALDaqrpmiNVAAlvghanlrlaam  150
ident                                                             
Sbjct GS-----------------anpvggqgsvikfrsIIVE-----eCIVK------------  140
DSSP  LL-----------------llleeeeeeeeelllLLHH-----hHEEE------------


DSSP  llllllllhhhhhhhhhhhhhhhhhLLLEEEEEL--LLLL----------hHHLLHHHHH
Query rdpqaaptaaeqqamqdmlqaaleaGAVGFSTGL--AYQP----------gAVAQAAELE  198
ident                             |                          |    
Sbjct -------------------------DPAGLKXAFgeNPKRvygerkqtpstRXGTAGVIR  175
DSSP  -------------------------EEEEEEEELlhHHHHhhhhlllllllHHHHHHHHH


DSSP  HH------------------------------hHHHHHLLLEEEEELllllllHHHHHHH
Query GL------------------------------aRVAAERRRLHTSHIrneadgVEAAVEE  228
ident                                              |              
Sbjct DYftkvknyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHA-----hRADDILT  230
DSSP  HHhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEE-----lLHHHHHH


DSSP  HHHHHHHHLLEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEE-LLLLeeeeel
Query VLAIGRGTGCATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDI-YPYPgsstil  287
ident    |    |   |  |                                            
Sbjct AIRIAEEFGFNLVIEHGTE--------AYKISKVLAEKK-----IPVVVgPLLT------  271
DSSP  HHHHHHHHLLLEEEEELLL--------HHHHHHHHHHHL-----LLEEElLLLL------


DSSP  lhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeEEEL---LLH
Query iperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaIYFA---MDE  344
ident                                                           | 
Sbjct --------------------------------------------------FRTKlelKDL  281
DSSP  --------------------------------------------------LLLLhhhLLL


DSSP  HhhHHHHHL-----LLEEELLLLLllllllLLHHHHhHHHHHHHHHhHLLLLLHhHHHHH
Query DevKRIFQH-----PCCMVGSDGLpndarpHPRLWGsFTRVLGRYVrEARLMTLeQAVAR  399
ident                      |           |    |                     
Sbjct T--XETIAKllkdgVLIALXCDHP------VIPLEF-ATVQAATAX-RYGAKEE-DLLKI  330
DSSP  L--LLHHHHhhhllLLEEELLLLL------LLLHHH-HHHHHHHHH-HHLLLHH-HHHHL


DSSP  HLHHHHHHHLL-LLLLLLLLLLLLLEEEELLlLLLLLllllllllllLLEEEEEELLEEE
Query MTALPARVFGF-AERGVLQPGAWADVVVFDPdTVADRatwdeptlasVGIAGVLVNGAEV  458
ident  |  ||   |     |   ||  || ||       |                |   | ||
Sbjct LTVNPAKILGLeDRIGSIEPGKDADLVVWSG-HPFDX---------kSVVERVYIDGVEV  380
DSSP  LLHHHHHHLLLlLLLLLLLLLLLLLEEEELL-LLLLL---------lLLEEEEEELLEEE


DSSP  ELLllllllllllllll
Query FPQppadgrpgqvlrax  475
ident |                
Sbjct FRR-------------e  384
DSSP  EEL-------------l


No 22: Query=3giqA Sbjct=2uz9A Z-score=21.6

back to top
DSSP  lLEEEEEELlEELLLL---LLLLEE-LEEEEE-LLEEEEEELLLLL---------leeEE
Query eKLDFKITGgWIIDGT---GAPRRR-ADLGVR-DGRIAAIGELGAH---------parHA   46
ident   |     |      |        |   |||   | |    |                  
Sbjct -PLAHIFRG-TFVHSTwtcPMEVLRdHLLGVSdSGKIVFLEEASQQeklakewcfkpcEI   58
DSSP  -LLLEEEEE-EEEELLlllLLEEEEeEEEEELlLLLEEEEEEHHHHhhhhhhhlllhhHE


DSSP  EELL-LLEEEELEEELLLLLLLH--------------------------------hHHLL
Query WDAS-GKIVAPGFIDVHGHDDLM--------------------------------fVEKP   73
ident    |      ||  | | |                                         
Sbjct RELShHEFFMPGLVDTHIHASQYsfagssidlpllewltkytfpaehrfqnidfaeEVYT  118
DSSP  EELLlLLEEEELEEEEEEEHHHHhhllllllllhhhhhhhlhhhhhhhhhlhhhhhHHHH


DSSP  L-LHHHHLLLEEEEEELllllLLLLllllllllhhhhhhllllllLLHHHHHHHHHhlLL
Query D-LRWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfADVPAYFAALDaqRP  132
ident    |     | ||                                          |    
Sbjct RvVRRTLKNGTTTACYF----ATIH-------------------tDSSLLLADITD--KF  153
DSSP  HhHHHHHHLLEEEEEEE----LLLL-------------------hHHHHHHHHHHH--HH


DSSP  LLEEEEEEEHH-----hhhHHHLllllllllhhhHHHHHHHHHHHHHHL--------LLE
Query MINVAALVGHA-----nlrLAAMrdpqaaptaaeQQAMQDMLQAALEAG--------AVG  179
ident                                                             
Sbjct GQRAFVGKVCMdlndtfpeYKET-----------TEESIKETERFVSEMlqknysrvKPI  202
DSSP  LLEEEEELEELllllllllLLLL-----------HHHHHHHHHHHHHHHhhhlllleEEE


DSSP  EEE-ELLLllhhhLLHHHHHHHHHHHHHLLLEEEEELllLLLLH----------hHHHHH
Query FST-GLAYqpgavAQAAELEGLARVAAERRRLHTSHIrnEADGV----------eAAVEE  228
ident                      |   |  |     |||    | |                
Sbjct VTPrFSLS-----CSETLMGELGNIAKTRDLHIQSHIseNRDEVeavknlypsykNYTSV  257
DSSP  EEElLHHH-----LLHHHHHHHHHHHHHHLLEEEEEEllLHHHHhhhhhhlllllLHHHH


DSSP  HHHHHhhhllEEEELLLLLllhhhlllHHHHHHHHHHHhhlllLEEEEELL--LLEEeee
Query VLAIGrgtgcATVVSHHKCmmpqnwgrSRATLANIDRAreqgvEVALDIYP--YPGSsti  286
ident            ||  |           |   |                  |         
Sbjct YDKNN-lltnKTVMAHGCY-------lSAEELNVFHER-----GASIAHCPnsNLSL---  301
DSSP  HHHLL-llllLEEEEELLL-------lLHHHHHHHHHH-----LLEEEELHhhHHHL---


DSSP  llhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHhh
Query liperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEde  346
ident                                                             
Sbjct ------------------------------------------------------SSGF--  305
DSSP  ------------------------------------------------------LLLL--


DSSP  hHHHHHLL----LEEELLLLLllllllLLHHhhHHHHHHHHHH----------hhllLLL
Query vKRIFQHP----CCMVGSDGLpndarpHPRLwgSFTRVLGRYV----------rearLMT  392
ident                 | |              |      | |                |
Sbjct -LNVLEVLkhevKIGLGTDVA-----gGYSY--SMLDAIRRAVmvsnillinkvnekSLT  357
DSSP  -LLHHHHHhlllEEEELLLLL-----lLLLL--LHHHHHHHHHhhhhhhhhllllllLLL


DSSP  HHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEEL-----------------------
Query LEQAVARMTALPARVFGF-AERGVLQPGAWADVVVFD-----------------------  428
ident |       |       |   | |    |   |                            
Sbjct LKEVFRLATLGGSQALGLdGEIGNFEVGKEFDAILINpkasdspidlfygdffgdiseav  417
DSSP  HHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLLEEEELllllllllllllhhhhlllllhh


DSSP  -LLLLLllllllllllLLLLEEEEEELLEEEELLLlllllllllllll
Query -PDTVAdratwdeptlASVGIAGVLVNGAEVFPQPpadgrpgqvlrax  475
ident                     |  | | |  | |               
Sbjct iQKFLY--------lgDDRNIEEVYVGGKQVVPFS-------------  444
DSSP  hHHHHH--------hlLHHHEEEEEELLEEEELLL-------------


No 23: Query=3giqA Sbjct=1a5kC Z-score=21.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  --LLEEEEEELLEELLllLLLLEELEEEEELLEEEEEELLL--------LLLE---EEEE
Query --EKLDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGELG--------AHPA---RHAW   47
ident      |   |   | |        || || |||| |||  |          |        
Sbjct aaDCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGnpdiqpnvTIPIgaaTEVI  118
DSSP  hhHLLLEEEEEEEEEE--LLEEEEEEEEEELLEEEEEELEEllllllllLEELlllLEEE


DSSP  ELLLLEEEELEEELLLLlLLHHhhlLLLHHHHLLLEEEEEEL--------llLLLLLLLl
Query DASGKIVAPGFIDVHGHdDLMFvekPDLRWKTSQGITTVVVG--------ncGVSAAPAp   99
ident  | ||||  | || | |                 | || | |                  
Sbjct AAEGKIVTAGGIDTHIH-WICP---QQAEEALVSGVTTMVGGgtgpaagthaTTCTPGP-  173
DSSP  ELLLLEEEELEEEEEEE-LLLL---LHHHHHHHHLEEEEEEElllllhhhhhLLLLLHH-


DSSP  llllllhhhhhhllllllLLHHHHHHHHHhlLLLLEEEEEEEHHhhhhhhlllllllllh
Query lpgntaaalallgetplfADVPAYFAALDaqRPMINVAALVGHAnlrlaamrdpqaapta  159
ident                           | |      |   |                    
Sbjct ------------------WYISRMLQAAD--SLPVNIGLLGKGN----------------  197
DSSP  ------------------HHHHHHHHHHL--LLLLEEEEEEELL----------------


DSSP  hhhhhHHHHHHHHHHHLLLEEEEELlLLLHhhlLHHHHHHHHHHHHHLLLEEEEELLLll
Query aeqqaMQDMLQAALEAGAVGFSTGLaYQPGavaQAAELEGLARVAAERRRLHTSHIRNea  219
ident        | |     ||  |               |       || |       |     
Sbjct ---vsQPDALREQVAAGVIGLEIHE-DWGA---TPAAIDCALTVADEMDIQVALHSDT--  248
DSSP  ---llLHHHHHHHHHHLLLEEEEEH-HHLL---LHHHHHHHHHHHHHHLLEEEEELLL--


DSSP  llhhHHHHHHHHHHHhhLLEEEELLLLLLlhhhlllhhHHHHhHHHHHhlllLEEEEELL
Query dgveAAVEEVLAIGRgtGCATVVSHHKCMmpqnwgrsrATLAnIDRAReqgvEVALDIYP  279
ident       ||  ||     |      |                                   
Sbjct lnesGFVEDTLAAIG--GRTIHTFHTEGA---ggghapDIIT-ACAHP----NILPSSTN  298
DSSP  llllLLHHHHHHHHL--LLLEEELLLLLL---llllllLHHH-HHHLL----LEEEEEEH


DSSP  LL--------------eeeEELLH----HHLLLLLlleeeeelllhhhllllhhhhhhhh
Query YP--------------gssTILIP----ERAETIDdiritwstphpecsgeyladiaarw  321
ident                             |                               
Sbjct PTlpytlntidehldmlmvCHHLDpdiaEDVAFAE-------------------------  333
DSSP  HHllllllhhhhhhhhhhhHHLLLlllhHHHHLLL-------------------------


DSSP  lllhhhhhhhhlleeeeEELL-LHHHHHHHHH-LLLEEELLLLLllllllllHHHHHHHH
Query gcdkttaarrlapagaiYFAM-DEDEVKRIFQ-HPCCMVGSDGLpndarphpRLWGSFTR  379
ident                                         ||          |      |
Sbjct ----------------sRIRReTIAAEDVLHDlGAFSLTSSDSQ-----amgRVGEVILR  372
DSSP  ----------------lLLLHhHHHHHHHHHHlLLLLEEELLLL-----lllLLLLHHHH


DSSP  HHhHHHHHLL--------------lLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLE
Query VLgRYVREAR--------------lMTLEQAVARMTALPARVFGF-AERGVLQPGAWADV  424
ident                                 |  |  ||   |   | |    |  || 
Sbjct TW-QVAHRMKvqrgalaeetgdndnFRVKRYIAKYTINPALTHGIaHEVGSIEVGKLADL  431
DSSP  HH-HHHHHHHhhhlllllllllllhHHHHHHHHLLLHHHHHHLLLlLLLLLLLLLLLLLE


DSSP  EEELLLLLLllllllllllllLLEEEEEELLEEEEL--------------------LLLL
Query VVFDPDTVAdratwdeptlasVGIAGVLVNGAEVFP--------------------QPPA  464
ident ||  |                |  | |   |                             
Sbjct VVWSPAFFG------------VKPATVIKGGMIAIApmgdinasiptpqpvhyrpmFGAL  479
DSSP  EEELHHHLL------------LLLLEEEELLEEEEEeellllllllllllleeeelHHHL


DSSP  LL---LLLLLLLL-----------------------------------------------
Query DG---RPGQVLRA-----------------------------------------------  474
ident                                                             
Sbjct GSarhHCRLTFLSqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt  539
DSSP  HHhhhHHLEEEELhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellll


DSSP  --------------------------l
Query --------------------------x  475
ident                            
Sbjct yevrvdgelitsepadvlpmaqryflf  566
DSSP  lleeelleellllllllllllllllll


No 24: Query=3giqA Sbjct=3pnuA Z-score=20.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelLLLEEEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdaSGKIVAPGFID   60
ident                                                  |         |
Sbjct -------------------------------------------enlyfqSNAMKLKNPLD   17
DSSP  -------------------------------------------llllllLLLEEEELLEE


DSSP  LLLLLllHHHHLLL--LHHHHLlLEEEEEEL-llllLLLLllllllllhhhhhhllllll
Query VHGHDdlMFVEKPD--LRWKTSqGITTVVVG-ncgvSAAPaplpgntaaalallgetplf  117
ident  | |                        |                               
Sbjct MHLHL--RDNQMLEliAPLSAR-DFCAAVIMpnlipPLCN--------------------   54
DSSP  EEELL--LLHHHHHhhHHHHHL-LLLEEEELlllllLLLL--------------------


DSSP  llHHHHHHHHHH-LLLL----LEEEEEEEHHHHhhhhlllllllllhhhhhhHHHHHHHH
Query adVPAYFAALDA-QRPM----INVAALVGHANLrlaamrdpqaaptaaeqqaMQDMLQAA  172
ident        |                       |                        |  |
Sbjct --LEDLKAYKMRiLKACkdenFTPLMTLFFKNY-------------------DEKFLYSA   93
DSSP  --HHHHHHHHHHhHHHHllllLEEEEEEELLLL-------------------LHHHHHHH


DSSP  HhHLLLEEEEELLL------LLHHHLLHHHHHHHHHHHHHLLLEEEEELLL---lLLLHH
Query LeAGAVGFSTGLAY------QPGAVAQAAELEGLARVAAERRRLHTSHIRN---eADGVE  223
ident       |     |                 |                |        |   
Sbjct K-DEIFGIXLYPAGittnsnGGVSSFDIEYLKPTLEAMSDLNIPLLVHGETndfvMDRES  152
DSSP  L-LLLLEEEELLLLllllllLLLLLLLHHHHHHHHHHHHHLLLLEEELLLLlllhHHLLH


DSSP  HHHHHHHHHHHHH-LLEEEELLLLLllhhhlllhHHHHHHHHHHHhlllLEEEEELLLLe
Query AAVEEVLAIGRGT-GCATVVSHHKCmmpqnwgrsRATLANIDRAReqgvEVALDIYPYPg  282
ident                   |  |                                |     
Sbjct NFAKIYEKLAKHFpRLKIVMEHITT---------KTLCELLKDYE----NLYATITLHH-  198
DSSP  HHHHHHHHHHHHLlLLLEEELLLLL---------HHHHHHHHHLL----LEEEEELLHH-


DSSP  eeeellhhhllLLLLLEEeeelllhhhllllhhhhhhhhlllhhhhhhhhlleEEEE---
Query sstiliperaeTIDDIRItwstphpecsgeyladiaarwgcdkttaarrlapaGAIY---  339
ident                                                             
Sbjct ---liitlddvIGGKMNP-----------------------------------HLFCkpi  220
DSSP  ---hlllhhhhHLLLLLH-----------------------------------HHLLlll


DSSP  ELLL--HHHHHHHHH--LLLEEELLLLLLLLL---lLLLHHHHHHHHHHhHHHHhlLLLL
Query FAMD--EDEVKRIFQ--HPCCMVGSDGLPNDA---rPHPRLWGSFTRVLgRYVReaRLMT  392
ident                      | |||  |                               
Sbjct AKRYedKEALCELAFsgYEKVMFGSDSAPHPKgcaaGVFSAPVILPVLA-ELFK--QNSS  277
DSSP  LLLHhhHHHHHHHHHllLLLEEELLLLLLLLLllllLLLLHHHHHHHHH-HHHH--HHLL


DSSP  HHHHHHHHLHHHHHHHLLLLlllllllLLLLEEEELLLL------llllllllLLLL---
Query LEQAVARMTALPARVFGFAErgvlqpgAWADVVVFDPDT------vadratwdEPTL---  443
ident  |                                                    |     
Sbjct EENLQKFLSDNTCKIYDLKF-------KEDKILTLEEKEwqvpnvyedkynqvVPYMage  330
DSSP  HHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELLLeelllleelllleeLLLLlll


DSSP  -llLLEEEeeelleeeellllllllllllllll
Query -asVGIAGvlvngaevfpqppadgrpgqvlrax  475
ident                                  
Sbjct ilkFQLKH-------------------------  338
DSSP  eelLEELL-------------------------


No 25: Query=3giqA Sbjct=4rdvB Z-score=19.9

back to top
DSSP  lleeEEEELLEELLllLLLLEE-LEEEEE-LLEEEEEE--LLLLLleeeEEELLlLEEEE
Query ekldFKITGGWIIDgtGAPRRR-ADLGVR-DGRIAAIG--ELGAHparhAWDASgKIVAP   56
ident       |              |        ||  | |            |       | |
Sbjct ----SAIFAERALL--PEGWARnVRFEISaDGVLAEIRpdANADG----AERLG-GAVLP   49
DSSP  ----LEEEEEEEEE--LLEEEEeEEEEELlLLLEEEEEllLLLLL----LEELL-LLEEE


DSSP  LEEELLLLLL-----------------------------------lHHHHLLL-LHHHHL
Query GFIDVHGHDD-----------------------------------lMFVEKPD-LRWKTS   80
ident |    | |                                        |           
Sbjct GMPNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeqIEVIACQlYIEMLK  109
DSSP  LEEEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhhHHHHHHHhHHHHHH


DSSP  LLEEEEEELlllLLLLlLLLLllllhhhhhhllllllLLHHHHHHHHH-hlLLLLEEEEE
Query QGITTVVVGncgVSAApAPLPgntaaalallgetplfADVPAYFAALD-aqRPMINVAAL  139
ident  | | |             |                                  |    |
Sbjct AGYTAVAEF---HYVH-HDLD-----------grsyaDPAELSLRISRaasAAGIGLTLL  154
DSSP  HLEEEEEEE---ELLL-LLLL-----------lllllLLLHHHHHHHHhhhHHLLEEEEE


DSSP  EEHHhhhhhhllLLLLlllhhhhhhHHHHHHHHHHHL----------LLEEEEELLLllh
Query VGHAnlrlaamrDPQAaptaaeqqaMQDMLQAALEAG----------AVGFSTGLAYqpg  189
ident                                  |                    |     
Sbjct PVLYshagfggqPASE--gqrrfinGSEAYLELLQRLrapleaaghsLGLCFHSLRA---  209
DSSP  ELLLleeellleELLH--hhlllllLHHHHHHHHHHHhhhhhhhlleELEEELLLLL---


DSSP  hhLLHHHHHHHHHHhHHLLLEEEEELLLLLLLH--------hHHHHHHH-HHHHhhllEE
Query avAQAAELEGLARVaAERRRLHTSHIRNEADGV--------eAAVEEVL-AIGRgtgcAT  240
ident                         ||      |                           
Sbjct --VTPQQIATVLAA-GHDDLPVHIHIAEQQKEVddcqawsgrRPLQWLYeNVAV--dqRW  264
DSSP  --LLHHHHHHHHLL-LLLLLLEEEEELLLHHHHhhhhhhhllLHHHHHHhHLLL--llLE


DSSP  EELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELL--LLEEeeellhhhlllllll
Query VVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYP--YPGSstiliperaetiddi  298
ident    |             |  |   |                                   
Sbjct CLVHATH-------aDPAEVAAMARSG-----AVAGLCLstEANL---------------  297
DSSP  EEEELLL-------lLHHHHHHHHHHL-----LEEEELHhhHHHL---------------


DSSP  eeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHhhhhHHHH-----L
Query ritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEdevkRIFQ-----H  353
ident                                                             
Sbjct ------------------------------------------GDGI----FPATdflaqG  311
DSSP  ------------------------------------------LLLL----LLHHhhhhlL


DSSP  LLEEELLLLLllllllllHHHHhHHHHHHHHH--------hhLLLL------LHHHHHHH
Query PCCMVGSDGLpndarphpRLWGsFTRVLGRYV--------reARLM------TLEQAVAR  399
ident      |||                   |               ||               
Sbjct GRLGIGSDSH--------VSLS-VVEELRWLEygqrlrdrkrNRLYrddqpmIGRTLYDA  362
DSSP  LEEEELLLLL--------LLLL-HHHHHHHHHhhhhhhhlllLLLLllllllHHHHHHHH


DSSP  HLHHHHHHHLLlLLLLLLLLLLLLEEEEL--------------LLLLLllllllllllLL
Query MTALPARVFGFaERGVLQPGAWADVVVFD--------------PDTVAdratwdeptlAS  445
ident   |  |   |    | |  |  ||  | |                               
Sbjct ALAGGAQALGQ-PIGSLAVGRRADLLVLDgndpylasaegdalLNRWL-------fagGD  414
DSSP  HHHHHHHHHLL-LLLLLLLLLLLLEEEELlllhhhhllllhhhHHHHH-------hhlLH


DSSP  LLEEEEEELLEEEEL--LLLLL-----llllllllll
Query VGIAGVLVNGAEVFP--QPPAD-----grpgqvlrax  475
ident      | | |  |                        
Sbjct RQVRDVMVAGRWVVRdgRHAGEersarafvqvlgell  451
DSSP  HHEEEEEELLEEEELllLLLLHhhhhhhhhhhhhhhl


No 26: Query=3giqA Sbjct=1bf6A Z-score=17.9

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
ident                                                         |   
Sbjct ---------------------------------------------------sfdpTGYTL    9
DSSP  ---------------------------------------------------llllLLEEE


DSSP  LLLLLLL-------------HHHHLLL--LHHHHLLLEEEEEELllllLLLLllllllll
Query VHGHDDL-------------MFVEKPD--LRWKTSQGITTVVVGncgvSAAPaplpgnta  105
ident  | |                                |   |                   
Sbjct AHEHLHIdlsgfknnvdcrlDQYAFICqeMNDLMTRGVRNVIEM----TNRY--------   57
DSSP  EEELLLEelhhhhllhhheeLLHHHHHhhHHHHHHLLEEEEEEL----LLHH--------


DSSP  hhhhhhllllllllhhhHHHHHhHLLL---LLEEEEEEEHH-hhhHHHLlllllLLLHhH
Query aalallgetplfadvpaYFAALdAQRP---MINVAALVGHA-nlrLAAMrdpqaAPTAaE  161
ident                                ||| |  |                 |   
Sbjct --------------mgrNAQFM-LDVMretGINVVACTGYYqdafFPEH-----VATR-S   96
DSSP  --------------hllLHHHH-HHHHhhhLLEEEEEELLLlhhhLLLH-----HHHL-L


DSSP  HHHHHHHHHHHHHH-------LLLEEE-EELLLllhHHLLHHHHHHHHHHHHHLLLEEEE
Query QQAMQDMLQAALEA-------GAVGFS-TGLAYqpgAVAQAAELEGLARVAAERRRLHTS  213
ident  |          |         |      |                 |       |    
Sbjct VQELAQEMVDEIEQgidgtelKAGIIAeIGTSEgkiTPLEEKVFIAAALAHNQTGRPIST  156
DSSP  HHHHHHHHHHHHHLlllllllLEEEEEeEELLLlllLHHHHHHHHHHHHHHHHHLLLEEE


DSSP  ELLLLlllhhHHHHHHHHHHHHHLL---EEEELLLLLLlhhhllLHHHHHHHHHHHHhll
Query HIRNEadgveAAVEEVLAIGRGTGC---ATVVSHHKCMmpqnwgRSRATLANIDRAReqg  270
ident |             | ||     |       | |                          
Sbjct HTSFS-----TMGLEQLALLQAHGVdlsRVTVGHCDLK------DNLDNILKMIDLG---  202
DSSP  ELHHH-----LLHHHHHHHHHHLLLlhhHEEELLLLLL------LLHHHHHHHHHLL---


DSSP  llEEEEE-LLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhh
Query veVALDI-YPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaa  329
ident                                                             
Sbjct --AYVQFdTIGKN-----------------------------------------------  213
DSSP  --LEEEElLLLLL-----------------------------------------------


DSSP  hhhlleeeeeELLLHHHHHHHHH-------LLLEEELLLLLLLL----LLLLLhHHHHHH
Query rrlapagaiyFAMDEDEVKRIFQ-------HPCCMVGSDGLPND----ARPHPrLWGSFT  378
ident                                   |   |                    |
Sbjct ----------SYYPDEKRIAMLHalrdrglLNRVMLSMDITRRShlkaNGGYG-YDYLLT  262
DSSP  ----------LLLLHHHHHHHHHhhhhlllHHHEEELLLLLLHHhlhhHLLLL-LLHHHH


DSSP  HHHHHHhHHLLlLLHHHHHHHHLHHHHHHHLlllllllllllllleeeelllllllllll
Query RVLGRYvREARlMTLEQAVARMTALPARVFGfaergvlqpgawadvvvfdpdtvadratw  438
ident        |                 |   |                              
Sbjct TFIPQL-RQSG-FSQADVDVMLRENPSQFFQ-----------------------------  291
DSSP  LHHHHH-HHLL-LLHHHHHHHHLHHHHHHLL-----------------------------


DSSP  llllllllleeeeeelleeeellllllllllllllll
Query deptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                      
Sbjct -------------------------------------  291
DSSP  -------------------------------------


No 27: Query=3giqA Sbjct=2ob3A Z-score=17.8

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                         ||  
Sbjct -----------------------------------------drintvrgpitiseaGFTL   19
DSSP  -----------------------------------------lleeelleeelhhhhLLEE


DSSP  LLLLLL------------------lhHHHLLL-LHHHHLLLEEEEEELllllLLLLllll
Query VHGHDD------------------lmFVEKPD-LRWKTSQGITTVVVGncgvSAAPaplp  101
ident  | |                             ||     |  | |      |       
Sbjct THEHICgssagflrawpeffgsrkalAEKAVRgLRRARAAGVRTIVDV----STFD----   71
DSSP  EEELLEellllhhhhlhhhhllhhhhHHHHHHhHHHHHHLLLLEEEEL----LLHH----


DSSP  llllhhhhhhllllllllhhhHHHHHhHLLL---LLEEEEEEEHHhhHHHHLllllllLL
Query gntaaalallgetplfadvpaYFAALdAQRP---MINVAALVGHAnlRLAAMrdpqaaPT  158
ident                          | |           |  |                 
Sbjct ------------------igrDVSLL-AEVSraaDVHIVAATGLW-fDPPLS-----mRL  106
DSSP  ------------------hllLHHHH-HHHHhhhLLEEELEEELL-lLLLHH-----hHL


DSSP  HHhHHHHHHHHHHHHHH-------LLLEEEEELLLllhHHLL-HHHHHHHHHHHHHLLLE
Query AAeQQAMQDMLQAALEA-------GAVGFSTGLAYqpgAVAQ-AAELEGLARVAAERRRL  210
ident                          |            |       |   ||        
Sbjct RS-VEELTQFFLREIQYgiedtgiRAGIIXVATTG--kATPFqELVLKAAARASLATGVP  163
DSSP  LL-HHHHHHHHHHHHHLlllllllLLLEEEEELLL--lLLHHhHHHHHHHHHHHHHHLLL


DSSP  EEEELlLLLLlhhHHHHHHHHHHHHHLL---EEEELLLLLLlhhhllLHHHHHHHHHHHH
Query HTSHIrNEADgveAAVEEVLAIGRGTGC---ATVVSHHKCMmpqnwgRSRATLANIDRAR  267
ident  | |            |   ||    |         |               |       
Sbjct VTTHT-AASQ---RDGEQQAAIFESEGLspsRVCIGHSDDT------DDLSYLTALAARG  213
DSSP  EEEEL-LHHH---LHHHHHHHHHHHLLLlhhHEEELLHHHL------LLHHHHHHHHHLL


DSSP  hllllEEEEE-LLLLEeeeellhhhlllLLLLEEeeelllhhhllllhhhhhhhhlllhh
Query eqgveVALDI-YPYPGsstiliperaetIDDIRItwstphpecsgeyladiaarwgcdkt  326
ident                              |                              
Sbjct -----YLIGLdHIPYS--------aiglEDNASA--------------------------  234
DSSP  -----LEEEElLLLLL--------llllLLLHHH--------------------------


DSSP  hhhhhhlleeEEEELLLHHHHHHHHH-------LLLEEELLLLLLL--------LLLL--
Query taarrlapagAIYFAMDEDEVKRIFQ-------HPCCMVGSDGLPN--------DARP--  369
ident           |                           |  |                  
Sbjct ---------sALLGIRSWQTRALLIKalidqgyMKQILVSNDWTFGfssyvtniMDVMdr  285
DSSP  ---------hHHHLLLLHHHHHHHHHhhhhlllHHHEEELLLLLLEellllllhHHHHhh


DSSP  -LLHH-HHHHHHHHHHHhHHLLlLLHHHHHHHHLHHHHHHHLlllllllllllllleeee
Query -HPRL-WGSFTRVLGRYvREARlMTLEQAVARMTALPARVFGfaergvlqpgawadvvvf  427
ident   |        ||     ||      |         |||                     
Sbjct vNPDGmAFIPLRVIPFL-REKG-VPQETLAGITVTNPARFLS------------------  325
DSSP  hLLLHhHHHHHLHHHHH-HHLL-LLHHHHHHHHLHHHHHHHL------------------


DSSP  lllllllllllllllllllleeeeeelleeeellllllllllllllll
Query dpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                                 
Sbjct --------------------------------------------ptlr  329
DSSP  --------------------------------------------llll


No 28: Query=3giqA Sbjct=2qpxA Z-score=17.3

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllLEEE--ELE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgKIVA--PGF   58
ident                                                             
Sbjct ----------------------------------------------gxddlSEFVdqVPL   14
DSSP  ----------------------------------------------lllllHHHHhhLLE


DSSP  EELLLLLllHHHH-----------------------------------------------
Query IDVHGHDdlMFVE-----------------------------------------------   71
ident  | | |                                                      
Sbjct LDHHCHF--LIDGkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldann   72
DSSP  EEEEELL--LLLLllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllll


DSSP  -----------llLLHHHHLLLEEEEEELllllllllllllllllhhhhHHLLLlllllh
Query -----------kpDLRWKTSQGITTVVVGncgvsaapaplpgntaaalaLLGETplfadv  120
ident                |                                            
Sbjct plaaxndpgyatyNHRIFGHFHFKELLID------------------tgFVPDD------  108
DSSP  llllllhhhhhhhHHHHHHHLLEEEEEEE------------------llLLLLL------


DSSP  hhhhHHHHhLLLL---LEEEEEEEHHHHHHHHLLLlllllLHHHHHHHHHHHHHHHHHLL
Query payfAALDaQRPM---INVAALVGHANLRLAAMRDpqaapTAAEQQAMQDMLQAALEAGA  177
ident       || |      | | |                    ||  ||       |   | 
Sbjct --piLDLD-QTAElvgIPVKAIYRLETHAEDFXLE--hdnFAAWWQAFSNDVKQAKAHGF  163
DSSP  --llLLHH-HHHHhhlLLEEEEEEHHHHHHHHHLL--lllHHHHHHHHHHHHHLLLLLLL


DSSP  LEEEEELLLL--------------------------LHHH--LLHHHHHHHHHHHHHLLL
Query VGFSTGLAYQ--------------------------PGAV--AQAAELEGLARVAAERRR  209
ident |||    ||                                      |   |        
Sbjct VGFXSIAAYRvglhlepvnvieaaagfdtwkhsgekRLTSkpLIDYXLYHVAPFIIAQDX  223
DSSP  LLEEELHHHHlllllllllhhhhhhhhhhhhhhlllLLLLhhHHHHHHHHHHHHHHHHLL


DSSP  EEEEEL-----lllLLLHH-HHHHHHHH-HHHHhLLEEEELLLLLllhhhllLHHHHHHH
Query LHTSHI-----rneADGVE-AAVEEVLA-IGRGtGCATVVSHHKCmmpqnwgRSRATLAN  262
ident     |                     |       |   |  |            |     
Sbjct PLQFHVgygdadtdXYLGNpLLXRDYLKaFTKK-GLKVVLLHCYP-------YHREAGYL  275
DSSP  LEEEEEllllllllHHHLLhHHHHHHHHhHHHH-LLLEEEEELLL-------LHHHHHHH


DSSP  HHHHHhlllLEEEEEL--LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhh
Query IDRAReqgvEVALDIY--PYPGsstiliperaetiddiritwstphpecsgeyladiaar  320
ident              ||      |                                      
Sbjct ASVFP----NLYFDISllDNLG--------------------------------------  293
DSSP  HHHLL----LEEEELLlhHHHL--------------------------------------


DSSP  hlllhhhhhhhhlleeeeeelllHHHHHHHH---hLLLEEELLLLLLllllLLLHHHHHH
Query wgcdkttaarrlapagaiyfamdEDEVKRIF---qHPCCMVGSDGLPndarPHPRLWGSF  377
ident                                           ||                
Sbjct -------------------psgaSRVFNEAVelapYTRILFASDAST----YPEXYGLAA  330
DSSP  -------------------hhhhHHHHHHHLllllHHHEELLLLLLL----LHHHHHHHH


DSSP  HHHHHhHHHHLL--------llLHHHHHHHHLHHHHHHHLLLLLLLLllllllleeeell
Query TRVLGrYVREAR--------lmTLEQAVARMTALPARVFGFAERGVLqpgawadvvvfdp  429
ident                             |      |                        
Sbjct RQFKQ-ALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQERELRV-------------  376
DSSP  HHHHH-HHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLHHHHLL-------------


DSSP  lllllllllllllllllleeeeeelleeeellllllllllllllll
Query dtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                               
Sbjct ----------------------------------------------  376
DSSP  ----------------------------------------------


No 29: Query=3giqA Sbjct=3k2gB Z-score=16.7

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                         |   
Sbjct -----------------------------slselspchvrsgrixtvdgpipssalGHTL   31
DSSP  -----------------------------llllllllllllleeeelleeeehhhlLLEE


DSSP  LLLLLLL-------------------------------------------hhHHLLL--L
Query VHGHDDL-------------------------------------------mfVEKPD--L   75
ident  | |                                                        
Sbjct XHEHLQNdcrcwwnppqeperqylaeapisieilselrqdpfvnkhnialddLDLAIaeV   91
DSSP  LLLLLLEelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleellHHHHHhhH


DSSP  HHHHLLLEEEEEELllllLLLLllllllllhhhhhhllllllllhhhHHHHHhHLLL---
Query RWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfadvpaYFAALdAQRP---  132
ident       |    |                                       |        
Sbjct KQFAAVGGRSIVDP----TCRG----------------------igrDPVKL-RRISaet  124
DSSP  HHHHHLLLLEEEEL----LLLL----------------------lllLHHHH-HHHHhhh


DSSP  LLEEEEEEEHH-hhhHHHLllllllllHHHH-HHHHHHHHHHHH-------HLLLEEE-E
Query MINVAALVGHA-nlrLAAMrdpqaaptAAEQ-QAMQDMLQAALE-------AGAVGFS-T  182
ident    |    |                  |        |   |          |        
Sbjct GVQVVXGAGYYlassXPET-------aARLSaDDIADEIVAEALegtdgtdARIGLIGeI  177
DSSP  LLEEEELLLLLlhhhLLHH-------hHLLLhHHHHHHHHHHHHlllllllLLLLLEEeE


DSSP  ELLLllhHHLL-HHHHHHHHHHHHHLLLEEEEELlLLLLlhhHHHHHHHHHHHHHLL---
Query GLAYqpgAVAQ-AAELEGLARVAAERRRLHTSHIrNEADgveAAVEEVLAIGRGTGC---  238
ident |        |     | | ||           |              ||      |    
Sbjct GVSS--dFTAEeEKSLRGAARAQVRTGLPLXVHL-PGWF---RLAHRVLDLVEEEGAdlr  231
DSSP  LLLL--lLLHHhHHHHHHHHHHHHHHLLLEEELL-LLLL---LLHHHHHHHHHHLLLlhh


DSSP  EEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEE-LLLLEEeeellhhhllllll
Query ATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDI-YPYPGSstiliperaetidd  297
ident  ||  |                |             |                       
Sbjct HTVLCHXNP-----shXDPVYQATLAQRG-----AFLEFdXIGXDF--------------  267
DSSP  HEEELLLHH-----hlLLHHHHHHHHHHL-----LEEEElLLLLLL--------------


DSSP  leeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeEELLLHHHHHHHHH-----
Query iritwstphpecsgeyladiaarwgcdkttaarrlapagaiYFAMDEDEVKRIFQ-----  352
ident                                                ||| |        
Sbjct -----------------------------------fyadqgVQCPSDDEVARAILgladh  292
DSSP  -----------------------------------eellllEELLLHHHHHHHHHhhhhl


DSSP  --LLLEEELLLLLLLL----LLLLLhHHHHHHHHHHHHHhhLLLLLHHHHHHHHLHHHHH
Query --HPCCMVGSDGLPND----ARPHPrLWGSFTRVLGRYVreARLMTLEQAVARMTALPAR  406
ident           |                       | |                    | |
Sbjct gyLDRILLSHDVFVKXxltrYGGNG-YAFVTKHFLPRLR--RHGLDDAALETLXVTNPRR  349
DSSP  llHHHEEELLLLLLHHhlhhHLLLL-LLHHHHLHHHHHH--HLLLLHHHHHHHHLHHHHH


DSSP  HHLLLlllllllllllleeeelllllllllllllllllllleeeeeelleeeelllllll
Query VFGFAergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadg  466
ident ||                                                          
Sbjct VFDAS-------------------------------------------------------  354
DSSP  HHLLL-------------------------------------------------------


DSSP  lllllllll
Query rpgqvlrax  475
ident          
Sbjct -----iegh  358
DSSP  -----llll


No 30: Query=3giqA Sbjct=2vc5A Z-score=16.3

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                         ||  
Sbjct ----------------------------------------mriplvgkdsieskdiGFTL   20
DSSP  ----------------------------------------llllllllllllhhhlLLEE


DSSP  LLLLLLL----------------hhHHLLL--LHHHHLLLEEEEEELLllLLLLllllll
Query VHGHDDL----------------mfVEKPD--LRWKTSQGITTVVVGNcgVSAApaplpg  102
ident  | |                                   |  | |               
Sbjct IHEHLRVfseavrqqwphlynedeeFRNAVneVKRAMQFGVKTIVDPTvmGLGR------   74
DSSP  LLLLLLLllhhhhhhlhhhllhhhhHHHHHhhHHHHHHLLLLEEEELLllLLLL------


DSSP  lllhhhhhhllllllllhhhHHHHHhHLLL---LLEEEEEEEHHhhhhhhlllLLLLLLH
Query ntaaalallgetplfadvpaYFAALdAQRP---MINVAALVGHAnlrlaamrdPQAAPTA  159
ident                                   ||  |  |                  
Sbjct --------------------DIRFM-EKVVkatGINLVAGTGIY-----iyidLPFYFLN  108
DSSP  --------------------LHHHH-HHHHhllLLEEEELEELL-----llllLLHHHLL


DSSP  HHHHHHHHHHHHHHHH-------LLLEEEEELLlllhHHLLHHHHHHHHHHHHHLLLEEE
Query AEQQAMQDMLQAALEA-------GAVGFSTGLAyqpgAVAQAAELEGLARVAAERRRLHT  212
ident        |                |                       |    |      
Sbjct RSIDEIADLFIHDIKEgiqgtlnKAGFVXIAADepgiTKDVEKVIRAAAIANKETKVPII  168
DSSP  LLHHHHHHHHHHHHHLlllllllLLLLEEEELLllllLHHHHHHHHHHHHHHHHHLLLEE


DSSP  EElLLLLllhHHHHHHHHHHHHHHLL---EEEELL-LLLLlhhhlllHHHHHHHHHHHHh
Query SHiRNEAdgvEAAVEEVLAIGRGTGC---ATVVSH-HKCMmpqnwgrSRATLANIDRARe  268
ident  |  |          |   |    |         |                   |     
Sbjct TH-SNAH---NNTGLEQQRILTEEGVdpgKILIGHlGDTD-------NIDYIKKIADKG-  216
DSSP  EE-LLLL---LLHHHHHHHHHHHLLLlhhHEEELLhHHLL-------LHHHHHHHHHLL-


DSSP  llllEEEEE-LLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhh
Query qgveVALDI-YPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdktt  327
ident                                                             
Sbjct ----SFIGLdRYGLD---------------------------------------------  227
DSSP  ----LEEEElLLLLL---------------------------------------------


DSSP  hhhhhlleeeeeELLLHHHHHHHHH-------LLLEEELLLLLLL-------LLLL----
Query aarrlapagaiyFAMDEDEVKRIFQ-------HPCCMVGSDGLPN-------DARP----  369
ident                  |                  |   |                   
Sbjct ------------LFLPVDKRNETTLrlikdgySDKIMISHDYCCTidwgtakPEYKpkla  275
DSSP  ------------LLLLHHHHHHHHHhhhhlllLLLEEELLLLLLLlllllllHHHHhhhl


DSSP  -LLHHHHHHHHHHHHHhHHLLlLLHHHHHHHHLHHHHHHHLlllllllllllllleeeel
Query -HPRLWGSFTRVLGRYvREARlMTLEQAVARMTALPARVFGfaergvlqpgawadvvvfd  428
ident         |                |         |   |                    
Sbjct pRWSITLIFEDTIPFL-KRNG-VNEEVIATIFKENPKKFFS-------------------  314
DSSP  lLLLLLHHHHLHHHHH-HLLL-LLHHHHHHHHLHHHHHHLL-------------------


DSSP  llllllllllllllllllleeeeeelleeeellllllllllllllll
Query pdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                                
Sbjct -----------------------------------------------  314
DSSP  -----------------------------------------------


No 31: Query=3giqA Sbjct=2imrA Z-score=16.3

back to top
DSSP  lleeeeeELLE-eLLLLLLLLEELEEeeelleeEEEE-----lLLLLleeeeeELLLL-E
Query ekldfkiTGGW-iIDGTGAPRRRADLgvrdgriAAIG-----eLGAHparhawDASGK-I   53
ident                                            |                
Sbjct ---htprLLTCdvLYTGAQSPGGVVV----vgeTVAAaghpdeLRRQ-yphaaEERAGaV   52
DSSP  ---lleeEEEEleEELLEELLEEEEE----ellEEEEeelhhhHHHH-lllleEEELLlE


DSSP  EEELEEELLLLLL------------------------lhHHHL--LLLHHHHLLLEEEEE
Query VAPGFIDVHGHDD------------------------lmFVEK--PDLRWKTSQGITTVV   87
ident  ||     | | |                           |          |  |   | 
Sbjct IAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrGVAAaqAGADTLTRLGAGGVG  112
DSSP  ELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllHHHHhhHHHHHHHHLLLLLEE


DSSP  ELllllLLLLllllllllhhhhhhllllllLLHHHHHHhhhhllLLLEEEEEEEHHhhhh
Query VGncgvSAAPaplpgntaaalallgetplfADVPAYFAaldaqrPMINVAALVGHAnlrl  147
ident         ||                        |  |                      
Sbjct DI----VWAP--------------------EVMDALLA-----rEDLSGTLYFEVL----  139
DSSP  EE----ELLH--------------------HHHHHHHL-----lLLLLEEEEEEEL----


DSSP  hhllllLLLLLHHHHHHHHHHHHHHHHHL----LLEEEEELLlllhHHLLHHHHHHHHHH
Query aamrdpQAAPTAAEQQAMQDMLQAALEAG----AVGFSTGLAyqpgAVAQAAELEGLARV  203
ident                 |    |             | |                  |   
Sbjct ----npFPDKADEVFAAARTHLERWRRLErpglRLGLSPHTP----FTVSHRLMRLLSDY  191
DSSP  ----llLHHHHHHHHHHHHHHHHHHHLLLllleEEEEEELLL----LLLLHHHHHHHHHH


DSSP  HHHLLLEEEEELllLLLLH----------------------------------hHHHHHH
Query AAERRRLHTSHIrnEADGV----------------------------------eAAVEEV  229
ident ||        |                                             |   
Sbjct AAGEGLPLQIHVaeHPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYL  251
DSSP  HHHHLLLLEEEEllLHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHH


DSSP  H--HHHHhhlLEEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEELL--LLEEee
Query L--AIGRgtgCATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDIYP--YPGSst  285
ident                 |                |   ||       |    |        
Sbjct DelGVLA---ARPTLVHMVN-------VTPDDIARVARAG-----CAVVTCPrsNHHL--  294
DSSP  HhhLLHH---HLLEEEELLL-------LLHHHHHHHHHHL-----LLEEELHhhHHHL--


DSSP  ellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHh
Query iliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEd  345
ident                                                             
Sbjct -------------------------------------------------------ECGT-  298
DSSP  -------------------------------------------------------LLLL-


DSSP  hhhHHHHL-----LLEEELLLLLllllllLLHHHhHHHHHHHHHHhHLLL-LLHHHHHHH
Query evkRIFQH-----PCCMVGSDGLpndarpHPRLWgSFTRVLGRYVrEARL-MTLEQAVAR  399
ident                   | |                                    |  
Sbjct ---FDWPAfaaagVEVALGTDSV------ASGETlNVREEVTFAR-QLYPgLDPRVLVRA  348
DSSP  ---LLHHHhhhllLLEEELLLLH------HHHLLlLLHHHHHHHH-HHLLlLLHHHHHHH


DSSP  HLHHHHHHHLllllLLLLL--lllllEEEEllllllllllllllllllllEEEEeellee
Query MTALPARVFGfaerGVLQP--gawadVVVFdpdtvadratwdeptlasvgIAGVlvngae  457
ident       || |                                                  
Sbjct AVKGGQRVVG----TPFLRrgetwqeGFRW--------------------ELSR------  378
DSSP  HHHHHHHHHL----LLLLLllllllhHHLH--------------------HHLL------


DSSP  eellllllllllllllll
Query vfpqppadgrpgqvlrax  475
ident                   
Sbjct ----------------dl  380
DSSP  ----------------ll


No 32: Query=3giqA Sbjct=3cjpA Z-score=16.1

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                           ||
Sbjct --------------------------------------------------------LIID    4
DSSP  --------------------------------------------------------LLEE


DSSP  LLLLlLLHHhhLLLL-HHHHLLLEEEEEELllllllllllllllllhhHHHHLL------
Query VHGHdDLMFveKPDL-RWKTSQGITTVVVGncgvsaapaplpgntaaaLALLGE------  113
ident  | |                  |                                     
Sbjct GHTH-VILP--VEKHiKIMDEAGVDKTILF----------------stSIHPETavnlrd   45
DSSP  EEEE-LLLL--HHHHhHHHHHHLLLEEEEE----------------llLLLHHHlllhhh


DSSP  --------------------lllLLLHHHHHHHHHhLLLLlEEEEEEEHHhhhhhhllll
Query --------------------tplFADVPAYFAALDaQRPMiNVAALVGHAnlrlaamrdp  153
ident                                       |                     
Sbjct vkkemkklndvvngktnsmidvrRNSIKELTNVIQ-AYPS-RYVGFGNVP----------   93
DSSP  hhhhhhhhhhhhlllllllhhhhHHHHHHHHHHHH-HLLL-LEEEEELLL----------


DSSP  lllllhhHHHHHHHHHHH-HHHHLLLEEE-EELLlllhHHLLHhHHHHHHHHHH-HLLLE
Query qaaptaaEQQAMQDMLQA-ALEAGAVGFS-TGLAyqpgAVAQAaELEGLARVAA-ERRRL  210
ident                          ||      |           |              
Sbjct ----vglSENDTNSYIEEnIVNNKLVGIGeLTPA----SGQIK-SLKPIFKYSMdSGSLP  144
DSSP  ----lllLHHHHHHHHHHhLLLLLLLEEEeELLL----LLLHH-HHHHHHHHHHhLLLLL


DSSP  EEEELllLLLLHHHHHHHHHHHHHHHL-LEEEELLLLLLlhhhllLHHHHHHHHHHHHhl
Query HTSHIrnEADGVEAAVEEVLAIGRGTG-CATVVSHHKCMmpqnwgRSRATLANIDRAReq  269
ident    |       |     |                |                         
Sbjct IWIHA--FNPLVLQDIKEIAELCKAFPkVPVILGHMGGS------NWMTAVELAKEIQ--  194
DSSP  EEELL--LLLLLHHHHHHHHHHHHHLLlLLEEEHHHHHH------HHHHHHHHHHHLL--


DSSP  llLEEEEELLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhh
Query gvEVALDIYPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaa  329
ident      ||   |                                                 
Sbjct --NLYLDTSAYF------------------------------------------------  204
DSSP  --LEEEELLLLL------------------------------------------------


DSSP  hhhlleeeeeellLHHHHHHHHHLL--LEEELLLLLllllllLLHHHHHHHHHhHHHHhh
Query rrlapagaiyfamDEDEVKRIFQHP--CCMVGSDGLpndarpHPRLWGSFTRVlGRYVre  387
ident                   |         |  | |           |  |           
Sbjct -------------STFVLKIVINELplKCIFGTDMP------FGDLQLSIEAI-KKMS--  242
DSSP  -------------LHHHHHHHHHHLllLEELLLLLL------LLLHHHHHHHH-HHHL--


DSSP  lllLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllllllllllllllllll
Query arlMTLEQAVARMTALPARVFGFaergvlqpgawadvvvfdpdtvadratwdeptlasvg  447
ident         | |       |                                         
Sbjct ---NDSYVANAVLGDNISRLLNI-------------------------------------  262
DSSP  ---LLHHHHHHHHLHHHHHHHLL-------------------------------------


DSSP  eeeeeelleeeellllllllllllllll
Query iagvlvngaevfpqppadgrpgqvlrax  475
ident                             
Sbjct ----------------------------  262
DSSP  ----------------------------


No 33: Query=3giqA Sbjct=4dlfA Z-score=15.7

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
ident                                                           ||
Sbjct -------------------------------------------------------ALRID    5
DSSP  -------------------------------------------------------LLLEE


DSSP  LLLLLL--------------------LHHHhlLLLHHHHLLLEEEEEELlllLLLLLLLl
Query VHGHDD--------------------LMFVekPDLRWKTSQGITTVVVGncgVSAAPAPl  100
ident  | |                                    |              |    
Sbjct SHQHFWryraadypwigagmgvlardYLPD--ALHPLMHAQALGASIAV---QARAGRD-   59
DSSP  EEELLLlllhhhllllllllhhhlllLLHH--HHHHHHHHLLLLEEEEE---LLLLLHH-


DSSP  lllllhhhhhhlllllllLHHHHHHHHHhlLLLLEEEEEEEHHhhhhhhlllllllllhh
Query pgntaaalallgetplfaDVPAYFAALDaqRPMINVAALVGHAnlrlaamrdpqaaptaa  160
ident                                     |                       
Sbjct ------------------ETAFLLELAC--DEARIAAVVGWED----------------l   83
DSSP  ------------------HHHHHHHHHL--LLLLEEEEEELLL----------------l


DSSP  hHHHHHHHHHHhHHHL-LLEEEEELLLL--lhhHLLHHHHHHHHHHHHHLLLEEEEElLL
Query eQQAMQDMLQAaLEAG-AVGFSTGLAYQ--pgaVAQAAELEGLARVAAERRRLHTSHiRN  217
ident                    ||   |            |                      
Sbjct rAPQLAERVAE-WRGTkLRGFRHQLQDEadvraFVDDADFARGVAWLQANDYVYDVL-VF  141
DSSP  lLLLHHHHHHL-LLLLlEEEEEELHHHLllhhhHHHLHHHHHHHHHHHHLLLEEEEL-LL


DSSP  LLllHHHHHHHHHHHHHhhLLEEEELLL-LLLL------HHHLLLHHHHHHHHHHHHhll
Query EAdgVEAAVEEVLAIGRgtGCATVVSHH-KCMM------PQNWGRSRATLANIDRAReqg  270
ident |       |    |         |  |  |              | || |          
Sbjct ER--QLPDVQAFCARHD--AHWLVLDHAgKPALaefdrdDTALARWRAALRELAALP---  194
DSSP  HH--HHHHHHHHHHHLL--LLLEEEHHHhLLLHhhllllLLHHHHHHHHHHHHHLLL---


DSSP  lLEEEEELlLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhh
Query vEVALDIYpYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaar  330
ident   |                                                         
Sbjct -HVVCKLSgLVTE-----------------------------------------------  206
DSSP  -LEEEEELlLLLL-----------------------------------------------


DSSP  hhllEEEE---eelLLHHHHHHHHHL---LLEEELLLLLLllllLLLHHHHHHHHHHhHH
Query rlapAGAI---yfaMDEDEVKRIFQH---PCCMVGSDGLPndarPHPRLWGSFTRVLgRY  384
ident                 |               | |||                  |  | 
Sbjct -adwRRGLrasdlrHIEQCLDAALDAfgpQRLMFGSDWPV--clLAASYDEVASLVE-RW  262
DSSP  -lllLLLLlhhhhhHHHHHHHHHHHHhlhHHEEELLLLLH--hhHLLLHHHHHHHHH-HH


DSSP  HHhlLLLLHHHHHHHHLHHHHHHHLLLlllllllllllleeeelllllllllllllllll
Query VReaRLMTLEQAVARMTALPARVFGFAergvlqpgawadvvvfdpdtvadratwdeptla  444
ident              |      ||                                      
Sbjct AE--SRLSAAERSALWGGTAARCYALP---------------------------------  287
DSSP  HH--HHLLHHHHHHHLLHHHHHHLLLL---------------------------------


DSSP  llleeeeeelleeeellllllllllllllll
Query svgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                
Sbjct -------------------------------  287
DSSP  -------------------------------


No 34: Query=3giqA Sbjct=3irsA Z-score=15.6

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
ident                                                           ||
Sbjct -------------------------------------------------------LKIID    5
DSSP  -------------------------------------------------------LLLEE


DSSP  LLLLllLHHH-------------------------------HLLL--LHHHHLLLEEEEE
Query VHGHddLMFV-------------------------------EKPD--LRWKTSQGITTVV   87
ident                                                       ||   |
Sbjct FRLR--PPAMgflnariytrpdirnrftrqlgfepapsaeeKSLElmFEEMAAAGIEQGV   63
DSSP  LLLL--LLLHhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHhhHHHHHHLLLLEEE


DSSP  ELlllllllllllllllLHHHHhhlllllllLHHHHHHHHHhlLLLLEEEEEEEhhHHHH
Query VGncgvsaapaplpgntAAALAllgetplfaDVPAYFAALDaqRPMINVAALVGhaNLRL  147
ident                                      |                      
Sbjct CV-----------grnsSVLGS--------vSNADVAAVAK--AYPDKFHPVGS--IEAA  100
DSSP  EE-----------lleeLLLEE--------lLHHHHHHHHH--HLLLLEEEEEE--LLLL


DSSP  hhlllllllllhhHHHHHHHHHHHHHHHLLLEEEEELLLL-LHHHllHHHHHHHHHHHHH
Query aamrdpqaaptaaEQQAMQDMLQAALEAGAVGFSTGLAYQ-PGAVaqAAELEGLARVAAE  206
ident                       |  |  |                     |  |      
Sbjct -------------TRKEAMAQMQEILDLGIRIVNLEPGVWaTPMHvdDRRLYPLYAFCED  147
DSSP  -------------LHHHHHHHHHHHHHLLLLLEEELHHHLlLLLLllLHHHHHHHHHHHH


DSSP  LLLEEEEEL----lllLLLH-HHHHHHHHHHHHhhLLEEEELLLLLLlhhhllLHHHHHH
Query RRRLHTSHI----rneADGV-EAAVEEVLAIGRgtGCATVVSHHKCMmpqnwgRSRATLA  261
ident                            ||          | ||                 
Sbjct NGIPVIMMTggnagpdITYTnPEHIDRVLGDFP--DLTVVSSHGNWP------WVQEIIH  199
DSSP  LLLLEEEELlllllllHHHHlHHHHHHHHHHLL--LLLEEEEHHHLL------LHHHHHH


DSSP  HHHHHHhlllLEEEEEL--LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhh
Query NIDRAReqgvEVALDIY--PYPGsstiliperaetiddiritwstphpecsgeyladiaa  319
ident    |         |      |                                       
Sbjct VAFRRP----NLYLSPDmyLYNL-------------------------------------  218
DSSP  HHHHLL----LEEEELHhhHLLL-------------------------------------


DSSP  hhlllhhhhhhhhlleeeeeelllhHHHHHHHHLL------LEEELLLLLllllllLLHH
Query rwgcdkttaarrlapagaiyfamdeDEVKRIFQHP------CCMVGSDGLpndarpHPRL  373
ident                                 |            |             |
Sbjct -------------------------PGHADFIQAAnsfladRMLFGTAYP------MCPL  247
DSSP  -------------------------LLHHHHHHHHllhhhhLLLLLLLLL------LLLH


DSSP  HHHHHHHHHHhhhhllLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllll
Query WGSFTRVLGRyvrearLMTLEQAVARMTALPARVFGFaergvlqpgawadvvvfdpdtva  433
ident        |                        |                           
Sbjct KEYTEWFLTL------PIKPDAMEKILHGNAERLLAQ-----------------------  278
DSSP  HHHHHHHHLL------LLLHHHHHHHHLHHHHHHHHH-----------------------


DSSP  lllllllllllllleeeeeelleeeellllllllllllllll
Query dratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                           
Sbjct ---------------------------------------agr  281
DSSP  ---------------------------------------lll


No 35: Query=3giqA Sbjct=1a4mA Z-score=15.0

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
ident                                                             
Sbjct --------------------------------------------------tpafnKPKVE   10
DSSP  --------------------------------------------------lllllLLEEE


DSSP  LLLLLL------------------------------------------------------
Query VHGHDD------------------------------------------------------   66
ident  | | |                                                      
Sbjct LHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympvia   70
DSSP  EEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhl


DSSP  --------LHHHhlllLHHHHLLLEEEEEELllllLLLL-LLLL---LLLLhhhhhhlll
Query --------LMFVekpdLRWKTSQGITTVVVGncgvSAAP-APLP---GNTAaalallget  114
ident                    |   |   | |                              
Sbjct gcreaikrIAYE---fVEMKAKEGVVYVEVR----YSPHlLANSkvdPMPW--nqtegdv  121
DSSP  llhhhhhhHHHH---hHHHHHHLLEEEEEEE----ELLHhHLLLlllLLHH--hllllll


DSSP  llLLLHHHHHHHHHhLLLL---LEEEEEEEHHhhhhhhlllllllllhhhHHHHHHHHHH
Query plFADVPAYFAALDaQRPM---INVAALVGHAnlrlaamrdpqaaptaaeQQAMQDMLQA  171
ident      |      |         | |                                |  
Sbjct tpDDVVDLVNQGLQ-EGEQafgIKVRSILCCM---------------rhqPSWSLEVLEL  165
DSSP  lhHHHHHHHHHHHH-HHHHhhlLEEEEEEEEE---------------lllHHHHHHHHHH


DSSP  HHHHL---LLEEEEE-LLLLlhHHLLHHHHHHHHHHHHHLLLEEEEELLLLLllHHHHHH
Query ALEAG---AVGFSTG-LAYQpgAVAQAAELEGLARVAAERRRLHTSHIRNEAdgVEAAVE  227
ident          |                          |       | |           | 
Sbjct CKKYNqktVVAMDLAgDETI-eGSSLFPGHVEAYEGAVKNGIHRTVHAGEVG--SPEVVR  222
DSSP  HHHLLlllEEEEEEElLLLL-lLHHHLHHHHHHHHHHHHHLLEEEEEELLLL--LHHHHH


DSSP  HHHHHHhhhlLEEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEELL--LLEEee
Query EVLAIGrgtgCATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDIYP--YPGSst  285
ident |   |         | |             |                    |        
Sbjct EAVDIL----KTERVGHGYH-----tiEDEALYNRLLKEN-----MHFEVCPwsSYLT--  266
DSSP  HHHHLL----LLLEEEELHH-----hhHLHHHHHHHHHLL-----LEEEELHhhHHHL--


DSSP  ellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeELLLH-
Query iliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyFAMDE-  344
ident                                                        | |  
Sbjct ------------------------------------------------------GAWDPk  272
DSSP  ------------------------------------------------------LLLLLl


DSSP  -HHHHHHHH--LLLEEELLLLLLllllLLLHHhhhHHHHHHHHHhHLLLLLHHHHHHHHl
Query -DEVKRIFQ--HPCCMVGSDGLPndarPHPRLwgsFTRVLGRYVrEARLMTLEQAVARMt  401
ident        |           |                              | |       
Sbjct tTHAVVRFKndKANYSLNTDDPL----IFKST---LDTDYQMTK-KDMGFTEEEFKRLN-  323
DSSP  lLLHHHHHHhlLLLEEELLLLLL----LLLLL---HHHHHHHHH-HLLLLLHHHHHHHH-


DSSP  HHHHHHHL-----LLLL--LLLLlllllleeeelllllllllllllllllllleeeeeel
Query ALPARVFG-----FAER--GVLQpgawadvvvfdpdtvadratwdeptlasvgiagvlvn  454
ident    |           |                                            
Sbjct INAAKSSFlpeeeKKELleRLYR-------------------------------------  346
DSSP  HHHHHLLLllhhhHHHHhhHHHH-------------------------------------


DSSP  leeeellllllllllllllll
Query gaevfpqppadgrpgqvlrax  475
ident                      
Sbjct ------------------eyq  349
DSSP  ------------------hll


No 36: Query=3giqA Sbjct=2y1hB Z-score=14.9

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                         |  |
Sbjct ------------------------------------------------------GVGLVD    6
DSSP  ------------------------------------------------------LLLEEE


DSSP  LLLLLLL--HHHHLLL-LHHHHLLLEEEEEELllllLLLLLlllllllhhhhhhllllll
Query VHGHDDL--MFVEKPD-LRWKTSQGITTVVVGncgvSAAPAplpgntaaalallgetplf  117
ident  | |           | |           |                              
Sbjct CHCHLSApdFDRDLDDvLEKAKKANVVALVAV----AEHSG-------------------   43
DSSP  EEELLLLhhHLLLHHHhHHHHHHLLEEEEEEL----LLLHH-------------------


DSSP  lLHHHHHHHHHhlLLLLEEEEEEEHH-----------hhHHHHlllllllllhhhhhhHH
Query aDVPAYFAALDaqRPMINVAALVGHA-----------nlRLAAmrdpqaaptaaeqqaMQ  166
ident              |    |    |                |                   
Sbjct -EFEKIMQLSE--RYNGFVLPCLGVHpvqgldqrsvtlkDLDV---------------AL   85
DSSP  -HHHHHHHHHH--HLLLLEEEEELLLleelllleellhhHHHH---------------HH


DSSP  HHHHHHHHhLLLEE-EEELLLL-------lhHHLLHHHHHHHHHHHHHLLLEEEEELLLl
Query DMLQAALEaGAVGF-STGLAYQ-------pgAVAQAAELEGLARVAAERRRLHTSHIRNe  218
ident                  ||               |   |      |         | |  
Sbjct PIIENYKD-RLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSRS-  143
DSSP  HHHHHHLL-LLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEEL-


DSSP  lllhhhHHHHHHHHHHHHLL-EEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEE
Query adgveaAVEEVLAIGRGTGC-ATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDI  277
ident       |           |                            ||          |
Sbjct ------AGRPTINLLQEQGAeKVLLHAFDG--------RPSVAMEGVRAG-----YFFSI  184
DSSP  ------LHHHHHHHHHHLLLlLEEEELLLL--------LHHHHHHHHHLL-----LEEEE


DSSP  LLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleee
Query YPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapaga  337
ident  |                                                          
Sbjct PPSII-------------------------------------------------------  189
DSSP  LHHHH-------------------------------------------------------


DSSP  eeellLHHHHHHHH---HLLLEEELLLLL--llllLLLLhHHHHHHHHHHHHHHhLLLLL
Query iyfamDEDEVKRIF---QHPCCMVGSDGL--pndaRPHPrLWGSFTRVLGRYVReARLMT  392
ident                           |                                 
Sbjct -----RSGQKQKLVkqlPLTSICLETDSPalgpekQVRN-EPWNISISAEYIAQ-VKGIS  242
DSSP  -----LLHHHHHHHhhlLHHHEEELLLLLllllllLLLL-LHHHHHHHHHHHHH-HHLLL


DSSP  HHHHHHHHLHHHHHHHL-LLLLlllllllllleeeelllllllllllllllllllleeee
Query LEQAVARMTALPARVFG-FAERgvlqpgawadvvvfdpdtvadratwdeptlasvgiagv  451
ident  |      |      |                                            
Sbjct VEEVIEVTTQNALKLFPkLRHL--------------------------------------  264
DSSP  HHHHHHHHHHHHHHHLLlHHHH--------------------------------------


DSSP  eelleeeellllllllllllllll
Query lvngaevfpqppadgrpgqvlrax  475
ident                         
Sbjct -----------------------l  265
DSSP  -----------------------l


No 37: Query=3giqA Sbjct=4mupB Z-score=14.7

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                         |  |
Sbjct ----------------------------------------lvrklsgtapnpafPRGAVD   20
DSSP  ----------------------------------------llllllllllllllLLLLEE


DSSP  LLLLLL------------------LHHHhlLLLHHHHLLLEEEEEELLllllllllllll
Query VHGHDD------------------LMFVekPDLRWKTSQGITTVVVGNcgvsaapaplpg  102
ident    |                             |     ||  |                
Sbjct TQMHMYlpgypalpggpglppgalPGPE--DYRRLMQWLGIDRVIITQ------------   66
DSSP  LLLLLLllllllllllllllllllLLHH--HHHHHHHHHLLLEEEEEL------------


DSSP  lllHHHHhhllllllllhHHHHHHHHhlllllEEEEEEEHhhhhhhhlllllllllhhhH
Query ntaAALAllgetplfadvPAYFAALDaqrpmiNVAALVGHanlrlaamrdpqaaptaaeQ  162
ident     |              |  |            | |                      
Sbjct --gNAHQ-----rdngntLACVAEMG-----eAAHAVVII------------------dA   96
DSSP  --lHHHL-----lllhhhHHHHHHHH-----hHEEEEELL------------------lL


DSSP  HHHHHHHHHHHHHLLLEEEEELLLL-lHHHLlhhHHHHHHHHHHHLLLEEEEElLLLLlL
Query QAMQDMLQAALEAGAVGFSTGLAYQ-pGAVAqaaELEGLARVAAERRRLHTSHiRNEAdG  221
ident             || ||                 ||      |                |
Sbjct TTTEKDMEKLTAAGTVGARIMDLPGgaVNLS---ELDAVDERAHAADWMVAVQ-FDGN-G  151
DSSP  LLLHHHHHHHHHLLEEEEEEELLLLllLLHH---HHHHHHHHHHHLLLEEEEE-LLHH-H


DSSP  HHHHhHHHHHHHhhhLLEEEELL-LLLLlhHHLL---LHHHHHHHHHHHHhlllLEEEEE
Query VEAAvEEVLAIGrgtGCATVVSH-HKCMmpQNWG---RSRATLANIDRAReqgvEVALDI  277
ident         |          |  |  |              | |                 
Sbjct LLDH-LPRLQKI---RSRWVFDHhGKFF--KGIRtdgPEMAALLKLIDRG----NLWFKF  201
DSSP  HHHH-HHHHHLL---LLEEEELHhHHLL--LLLLlllHHHHHHHHHHHHL----LEEEEE


DSSP  LLLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleee
Query YPYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapaga  337
ident      |                                                      
Sbjct AGVYES--------------------------------------------------srks  211
DSSP  LLHHHL--------------------------------------------------llll


DSSP  eeELLLHHHHHHHHHLL--LEEELLLL-LLLLL---LLLLHhHHHHHHHHHhhhhhllLL
Query iyFAMDEDEVKRIFQHP--CCMVGSDG-LPNDA---RPHPRlWGSFTRVLGryvrearLM  391
ident    |        |  |       |                         ||       | 
Sbjct wpYADVAAFSRVIAAHApeRIVWGTNWpHNSVRetaAYPDD-ARLAELTLG------wLP  264
DSSP  llLHHHHHHHHHHHHHLhhHEEELLLLlLLLLLlhhHLLLH-HHHHHHHHL------lLL


DSSP  LHHHHHHHHLHHHHHHHLLLLLlllllllllleeeelllllllllllllllllllleeee
Query TLEQAVARMTALPARVFGFAERgvlqpgawadvvvfdpdtvadratwdeptlasvgiagv  451
ident             |   |                                           
Sbjct DEAARHRALVENPEALFKLSPV--------------------------------------  286
DSSP  LHHHHHHHHLHHHHHHHLLLLL--------------------------------------


DSSP  eelleeeellllllllllllllll
Query lvngaevfpqppadgrpgqvlrax  475
ident                         
Sbjct ------------------------  286
DSSP  ------------------------


No 38: Query=3giqA Sbjct=4hk5D Z-score=14.7

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                        |   |
Sbjct ------------------------------------------------------TPVVVD    6
DSSP  ------------------------------------------------------LLLLEE


DSSP  LLLLLLL-----------------------------------------------------
Query VHGHDDL-----------------------------------------------------   67
ident  | |                                                        
Sbjct IHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpl   66
DSSP  EEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleel


DSSP  --HHHHLLL-LHHHHLLLEEEEEELlLLLLllllLLLLLllhhhhhhllllllLLHHHHH
Query --MFVEKPD-LRWKTSQGITTVVVGnCGVSaapaPLPGNtaaalallgetplfADVPAYF  124
ident    |             ||   |             |                |      
Sbjct stHFASLAQkMHFMDTNGIRVSVISlANPW-fdfLAPDE--------apgiadAVNAEFS  117
DSSP  lhHHLLHHHhHHHHHHLLLLEEEEEeLLLL-lllLLLLL--------hhhhhhHHHHHHH


DSSP  HHHHHlllllEEEEEEEHhhHHHHhlllllllllhhHHHHHHHHHHHHHHHL-LLEEEEE
Query AALDAqrpmiNVAALVGHanLRLAamrdpqaaptaaEQQAMQDMLQAALEAG-AVGFSTG  183
ident                        |               |               |   |
Sbjct DMCAQ--hvgRLFFFAAL--PLSA------------PVDAVKASIERVKNLKyCRGIILG  161
DSSP  HHHHL--lllLEEEEEEL--LLLL------------LHHHHHHHHHHHHLLLlEEEEEEL


DSSP  LllllHHHL----LHHHhHHHHHHHHHLLLEEEEEL------------------------
Query LayqpGAVA----QAAElEGLARVAAERRRLHTSHI------------------------  215
ident                          |    |   |                         
Sbjct T----SGLGkgldDPHL-LPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplal  216
DSSP  L----LLLLllllLHHH-HHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhl


DSSP  LLLLlLHHHHHHHHH--HHHHHH-LLEEEEL-LLLLllhhhlllHHHH------------
Query RNEAdGVEAAVEEVL--AIGRGT-GCATVVS-HHKCmmpqnwgrSRAT------------  259
ident          ||                                                 
Sbjct GFPM-ETTIAVARMYmaGVFDHVrNLQMLLAhSGGT-------lPFLAgriescivhdgh  268
DSSP  HHHH-HHHHHHHHHHhlLHHHHLlLLLEEEHhHHLL-------hHHHHhhhhhhhhllhh


DSSP  ----------hhHHHHHHHllLLEEEEELLLLeeeeellhhhllllllleeeeelllhhh
Query ----------laNIDRAREqgVEVALDIYPYPgsstiliperaetiddiritwstphpec  309
ident              |           ||   |                             
Sbjct lvktgkvpkdrrTIWTVLK--EQIYLDAVIYS----------------------------  298
DSSP  hhhlllllllllLHHHHHH--HLEEEELLLLL----------------------------


DSSP  llllhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHHHHHHL---LLEEELLLLLLLL
Query sgeyladiaarwgcdkttaarrlapagaiyfamdEDEVKRIFQH---PCCMVGSDGLPND  366
ident                                   |               | | |     
Sbjct ----------------------------------EVGLQAAIASsgaDRLMFGTDHPFFP  324
DSSP  ----------------------------------HHHHHHHHHHhlhHHEELLLLLLLLL


DSSP  LL------lLLHHHHHHHHHHhHHHHhlllLLHHHHHHHHLHHHHHHHLLLLLlllllLL
Query AR------pHPRLWGSFTRVLgRYVRearlMTLEQAVARMTALPARVFGFAERgvlqpGA  420
ident                    |    |          | | |     ||             
Sbjct PIeedvqgpWDSSRLNAQAVI-KAVG----EGSSDAAAVMGLNAVRVLSLKAE---leHH  376
DSSP  LLlllllllLHHHHHHHHHHH-HHHL----LLLHHHHHHHLHHHHHHLLLHHH---hhHH


DSSP  LLleeeelllllllllllllllllllleeeeeelleeeellllllllllllllll
Query WAdvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                                        
Sbjct HH---------------------------------------------------hh  380
DSSP  HH---------------------------------------------------hl


No 39: Query=3giqA Sbjct=2ffiA Z-score=14.6

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
ident                                                           ||
Sbjct -----------------------------------------------------lhLTAID    7
DSSP  -----------------------------------------------------llLLLEE


DSSP  LLLlLLLH--------------hHHLLL--LHHHHLLLEEEEEELLllLLLLLLllllll
Query VHGhDDLM--------------fVEKPD--LRWKTSQGITTVVVGNcgVSAAPAplpgnt  104
ident  |                            |      |    |                 
Sbjct SHA-HVFSrglnlasqrryapnyDAPLGdyLGQLRAHGFSHGVLVQ-pSFLGTD------   59
DSSP  LLL-LLLLhhhhhhlllllllllLLLHHhhHHHHHHLLLLEELLLL-lHHHLLL------


DSSP  lhhhhhhllllllllHHHHHHHHHhlllllEEEEEEEHhhhhhhhlllllllllhhhHHH
Query aaalallgetplfadVPAYFAALDaqrpmiNVAALVGHanlrlaamrdpqaaptaaeQQA  164
ident                      ||            |                        
Sbjct ---------------NRYLLSALQ--tvpgQLRGVVXL------------------eRDV   84
DSSP  ---------------LHHHHHHHH--hlllLLLLLLLL------------------lLLL


DSSP  HHHHHHHHHHHLLLEEEEELLLLlhHHLLH--HHHHHHHHHHHHLLLEEEEeLLLLlllh
Query MQDMLQAALEAGAVGFSTGLAYQpgAVAQA--AELEGLARVAAERRRLHTShIRNEadgv  222
ident  |  |      |  |    |  |         |    |     |         |      
Sbjct EQATLAEXARLGVRGVRLNLXGQ--DXPDLtgAQWRPLLERIGEQGWHVEL-HRQV----  137
DSSP  LHHHHHHHHLLLLLEEELLLLLL--LLLLLllLLLHHHHHHHHHHLLEEEE-LLLL----


DSSP  HHHHHHHHHHhHHHLLEEEELLL-LLLLHhHLLL---HHHHHHHhhHHHHlllLEEEEEL
Query EAAVEEVLAIgRGTGCATVVSHH-KCMMPqNWGR---SRATLANidRAREqgvEVALDIY  278
ident       | |     |   |  |                   |      |     |     
Sbjct ADIPVLVRAL-QPYGLDIVIDHFgRPDAR-RGLGqpgFAELLTL--SGRG---KVWVKVS  190
DSSP  LLHHHHHHHH-LLLLLLEEELHHhLLLLL-LLLLlllHHHHLLL--LLLL---LEEEEEE


DSSP  LLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee
Query PYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
ident                                                             
Sbjct GIYRL-------------------------------------------------------  195
DSSP  LHHHL-------------------------------------------------------


DSSP  EELL--LHHHHHHHHHL-------LLEEELLLLLLL-LLLLLLhHHHHHHHHhHHHHhhl
Query YFAM--DEDEVKRIFQH-------PCCMVGSDGLPN-DARPHPrLWGSFTRVlGRYVrea  388
ident                              |||                            
Sbjct QGSPeeNLAFARQALCAleahygaERLXWGSDWPHTqHESEVS-FGSAVEQF-EALG---  250
DSSP  LLLHhhHHHHHHHHHHHhhhhllhHHEEEELLLLLLlLLLLLL-HHHHHHHH-HHHL---


DSSP  llLLHHHHHHHHLHHHHHHHLLLLLlllllllllleeeelllllllllllllllllllle
Query rlMTLEQAVARMTALPARVFGFAERgvlqpgawadvvvfdpdtvadratwdeptlasvgi  448
ident          |         |||                                      
Sbjct --CSAQLRQALLLDTARALFGFELE-----------------------------------  273
DSSP  --LLHHHHHHHHLHHHHHHLLLLLL-----------------------------------


DSSP  eeeeelleeeellllllllllllllll
Query agvlvngaevfpqppadgrpgqvlrax  475
ident                            
Sbjct ---------------------------  273
DSSP  ---------------------------


No 40: Query=3giqA Sbjct=4ofcA Z-score=14.5

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                           ||
Sbjct --------------------------------------------------------MKID    4
DSSP  --------------------------------------------------------LLEE


DSSP  LLLLLLL----------------------------------------HHHHLLLL-HHHH
Query VHGHDDL----------------------------------------MFVEKPDL-RWKT   79
ident  | |                                                    |   
Sbjct IHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvreNCWDPEVRiREMD   64
DSSP  EEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeehHHLLHHHHhHHHH


DSSP  LLLEEEEEELlllllllllllllllLHHH----hhhlllllLLLHHHHHHHHHhLLLLlE
Query SQGITTVVVGncgvsaapaplpgntAAAL----allgetplFADVPAYFAALDaQRPMiN  135
ident   | |                                                   |   
Sbjct QKGVTVQALS------------tvpVMFSywakpedtlnlcQLLNNDLASTVV-SYPR-R  110
DSSP  HHLLLEEEEE------------llhHHHLllllhhhhhhhhHHHHHHHHHHHH-HLLL-L


DSSP  EEEEEEhhHHHHhhlllllllllhhHHHHHHHHHHHHHH-HLLLEEEEELLlllHHHL--
Query VAALVGhaNLRLaamrdpqaaptaaEQQAMQDMLQAALE-AGAVGFSTGLAyqpGAVA--  192
ident    |                                     |  |   |           
Sbjct FVGLGT--LPMQ-------------APELAVKEMERCVKeLGFPGVQIGTH---VNEWdl  152
DSSP  EEEEEL--LLLL-------------LHHHHHHHHHHHHHlLLLLEEEEELE---ELLEel


DSSP  -LHHHhHHHHHHHHHLLLEEEEEL-----------------lLLLLLHHHHHHHHH--HH
Query -QAAElEGLARVAAERRRLHTSHI-----------------rNEADGVEAAVEEVL--AI  232
ident             |         |                           |         
Sbjct nAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvGMPAETTIAICSMImgGV  211
DSSP  lLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlHHHHHHHHHHHHHHllLH


DSSP  HHHHL-LEEEEL-LLLLllhhhlllHHHH------------------hhhhHHHHhlllL
Query GRGTG-CATVVS-HHKCmmpqnwgrSRAT------------------laniDRAReqgvE  272
ident                                                             
Sbjct FEKFPkLKVCFAhGGGA-------fPFTVgrishgfsmrpdlcaqdnpmnpKKYL---gS  261
DSSP  HHHLLlLLEEELhHHLL-------hHHHHhhhhhhhhhlhhhhlllllllhHHHL---lL


DSSP  EEEEELLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhh
Query VALDIYPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrl  332
ident    |                                                        
Sbjct FYTDALVHD---------------------------------------------------  270
DSSP  LEEELLLLL---------------------------------------------------


DSSP  lleeeeeelllHHHHHHHHH---LLLEEELLLLLLllllLLLHhHHHHHHHHHHhhhhlL
Query apagaiyfamdEDEVKRIFQ---HPCCMVGSDGLPndarPHPRlWGSFTRVLGRyvreaR  389
ident                |             | |       |                    
Sbjct -----------PLSLKLLTDvigKDKVILGTDYPF----PLGE-LEPGKLIESM-----E  309
DSSP  -----------HHHHHHHHHhhlLLLEELLLLLLL----LLLL-LLLLHHHHHL-----L


DSSP  LLLHHHHHHHHLHHHHHHHLLLLLlllllllllleeeellllllllllllllllllllee
Query LMTLEQAVARMTALPARVFGFAERgvlqpgawadvvvfdpdtvadratwdeptlasvgia  449
ident     |              |                                        
Sbjct EFDEETKNKLKAGNALAFLGLERK------------------------------------  333
DSSP  LLLHHHHHHHHLHHHHHHHLLLHH------------------------------------


DSSP  eeeelleeeellllllllllllllll
Query gvlvngaevfpqppadgrpgqvlrax  475
ident                           
Sbjct ------------------------qf  335
DSSP  ------------------------hl


No 41: Query=3giqA Sbjct=4qrnA Z-score=14.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeellllEEEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkIVAPGFID   60
ident                                                           | 
Sbjct ------------------------------------------smtqdlktggEQGYLRIA   18
DSSP  ------------------------------------------llllllllllLLLLLLEE


DSSP  LLLLL-------------------------------------------LLHHhhLLLL-H
Query VHGHD-------------------------------------------DLMFveKPDL-R   76
ident                                                  |          
Sbjct TEEAFatreiidvylrmirdgtadkgmvslwgfyaqspseratqilerLLDL--GERRiA   76
DSSP  EEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhHHLL--LHHHhH


DSSP  HHHLLLEEEEEEL-LLLLllllllLLLLLlhhhhhhlllllLLLHHHHHHHHHhlLLLLE
Query WKTSQGITTVVVG-NCGVsaapapLPGNTaaalallgetplFADVPAYFAALDaqRPMIN  135
ident      ||                 |                         |         
Sbjct DMDATGIDKAILAlTSPG---vqpLHDLD------eartlaTRANDTLADACQ--KYPDR  125
DSSP  HHHHLLLLEEEEEeLLLL---lllLLLHH------hhhhhhHHHHHHHHHHHH--HLLLL


DSSP  EEEEEEhhHHHHhhlllllllllhhHHHHHHHHHHHHHH-HLLLEEEEELLllLHHHL--
Query VAALVGhaNLRLaamrdpqaaptaaEQQAMQDMLQAALE-AGAVGFSTGLAyqPGAVA--  192
ident                                          |  |               
Sbjct FIGMGT--VAPQ-------------DPEWSAREIHRGAReLGFKGIQINSH--TQGRYld  168
DSSP  EEELLL--LLLL-------------LHHHHHHHHHHHHHlLLLLLEEELLL--LLLLLll


DSSP  LHHHhHHHHHHHHHLLLEEEEEL---------------------lLLLLlhHHHHHHHH-
Query QAAElEGLARVAAERRRLHTSHI---------------------rNEADgvEAAVEEVL-  230
ident          |   |       |                                      
Sbjct EEFF-DPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgFGVE-tGMHLLRLIt  226
DSSP  LHHH-HHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhHHHH-hHHHHHHHHh


DSSP  -HHHHHH-LLEEEEL-LLLLllhhhlllHHHH----------------------hhhHHH
Query -AIGRGT-GCATVVS-HHKCmmpqnwgrSRAT----------------------lanIDR  265
ident   |          |                                           |  
Sbjct iGIFDKYpSLQIMVGhMGEA-------lPYWLyrldymhqagvrsqryermkplkktIEG  279
DSSP  hLHHHHLlLLLEEELhHHHL-------hHHHHhhhhhhhhhhhhlllllllllllllHHH


DSSP  HHHllLLEEEEE-LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlll
Query AREqgVEVALDI-YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcd  324
ident        |                                                    
Sbjct YLK--SNVLVTNsGVAW-------------------------------------------  294
DSSP  HHH--HLEEEELlLLLL-------------------------------------------


DSSP  hhhhhhhhlleeeeeelllHHHHHHHHH---LLLEEELLLLLLlllllllHHHH-HHHHH
Query kttaarrlapagaiyfamdEDEVKRIFQ---HPCCMVGSDGLPndarphpRLWG-SFTRV  380
ident                    |   |   |       |   |                    
Sbjct -------------------EPAIKFCQQvmgEDRVMYAMDYPY-------QYVAdEVRAM  328
DSSP  -------------------HHHHHHHHHhhlHHHEELLLLLLL-------LLLHhHHHHH


DSSP  HHHhhhhllLLLHHHHHHHHLHHHHHHHLLllllllllllllleeeelllllllllllll
Query LGRyvrearLMTLEQAVARMTALPARVFGFaergvlqpgawadvvvfdpdtvadratwde  440
ident           |                |                                
Sbjct DAM------DMSAQTKKKFFQTNAEKWFKL------------------------------  352
DSSP  HLL------LLLHHHHHHHHLHHHHHHLLL------------------------------


DSSP  llllllleeeeeelleeeellllllllllllllll
Query ptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                    
Sbjct -----------------------------------  352
DSSP  -----------------------------------


No 42: Query=3giqA Sbjct=2gwgA Z-score=14.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                           ||
Sbjct --------------------------------------------------------XIID    4
DSSP  --------------------------------------------------------LLEE


DSSP  LLLlLLLH-----------------------------------hHHLLL--LHHHHLLLE
Query VHGhDDLM-----------------------------------fVEKPD--LRWKTSQGI   83
ident  ||                                                |      | 
Sbjct IHG-HYTTapkaledwrnrqiagikdpsvxpkvselkisddelqASIIEnqLKKXQERGS   63
DSSP  EEE-ELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHLlhHHHHHHHLL


DSSP  EEEEELllllllllllLLLLllhhhhhhlllllLLLHHHHHHHHHhlLLLLEEEEEEEhh
Query TTVVVGncgvsaapapLPGNtaaalallgetplFADVPAYFAALDaqRPMINVAALVGha  143
ident    |                                               |        
Sbjct DLTVFS-----pragdFNVS---------stwaAICNELCYRVSQ--LFPDNFIGAAX--  105
DSSP  LEEEEE-----lllllHHHH---------hhhhHHHHHHHHHHHH--HLLLLEEEEEE--


DSSP  HHHHhhllllLLLLlhhhHHHHHHHHHHHHHH-LLLEEEEELlLLLH--HHLL---HHHH
Query NLRLaamrdpQAAPtaaeQQAMQDMLQAALEA-GAVGFSTGLaYQPG--AVAQ---AAEL  197
ident                          |       | |          |             
Sbjct LPQS------PGVD----PKTCIPELEKCVKEyGFVAINLNP-DPSGghWTSPpltDRIW  154
DSSP  LLLL------LLLL----HHHHHHHHHHHHHLlLLLEEEELL-LLLLllLLLLlllLHHH


DSSP  HHHHHHHHHLLLEEEEE--------lLLLLllhhhHHHHH--hHHHHHH-LLEEEEL-LL
Query EGLARVAAERRRLHTSH--------iRNEAdgveaAVEEV--lAIGRGT-GCATVVS-HH  245
ident         |       |                  |                  |     
Sbjct YPIYEKXVELEIPAXIHvstgahylnADTT-----AFXQCvagDLFKDFpELKFVIPhGG  209
DSSP  HHHHHHHHHHLLLEEELlllllhhhhHHHH-----HHHHHhhlLHHHHLlLLLEEELhHH


DSSP  LLllhhhlLLHHHH---------hHHHHHHHhllLLEEEEELLLLeeeeellhhhlllll
Query KCmmpqnwGRSRAT---------lANIDRAReqgVEVALDIYPYPgsstiliperaetid  296
ident                            |           |   |                
Sbjct GA----vpYHWGRFrglaqexkkpLLEDHVL---NNIFFDTCVYH---------------  247
DSSP  LL----lhHHHHHHhhhhhhllllLHHHHLL---LLEEEELLLLL---------------


DSSP  lleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHHHHHH---L
Query diritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdEDEVKRIFQ---H  353
ident                                                             
Sbjct -----------------------------------------------QPGIDLLNTvipV  260
DSSP  -----------------------------------------------HHHHHHHHHhllH


DSSP  LLEEELLLLLLLLLL------LLLHhhHHHHHHHHHhhhhlLLLLHHHHHHHHLHHHHHH
Query PCCMVGSDGLPNDAR------PHPRlwGSFTRVLGRyvreaRLMTLEQAVARMTALPARV  407
ident       |                                     | |           ||
Sbjct DNVLFASEXIGAVRGidprtgFYYD--DTKRYIEAS-----TILTPEEKQQIYEGNARRV  313
DSSP  HHEELLLLLLLLLLLeellllEELL--LLHHHHHHL-----LLLLHHHHHHHHLHHHHHH


DSSP  HL--LLLLlllllLLLLleeeelllllllllllllllllllleeeeeelleeeellllll
Query FG--FAERgvlqpGAWAdvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppad  465
ident      |        |                                             
Sbjct YPrlDAAL-----KAKG-------------------------------------------  325
DSSP  LHhhHHHH-----HHHH-------------------------------------------


DSSP  llllllllll
Query grpgqvlrax  475
ident           
Sbjct ------kleh  329
DSSP  ------hhll


No 43: Query=3giqA Sbjct=2dvtA Z-score=14.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                         |   
Sbjct ------------------------------------------------------MQGKVA    6
DSSP  ------------------------------------------------------LLLEEE


DSSP  LLLLLL-----------------------LHHHhLLLL-HHHHLLLEEEEEEL-------
Query VHGHDD-----------------------LMFVeKPDL-RWKTSQGITTVVVG-------   89
ident    |                         |               || |           
Sbjct LEEHFAipetlqdsagfvpgdywkelqhrLLDI-QDTRlKLMDAHGIETMILSlnapavq   65
DSSP  EEEEELlhhhhhhhlllllllhhhhhhhhHHLL-LLHHhHHHHHLLEEEEEEEelllhhh


DSSP  -----lllllLLLLlllllllhhhhhhlllllllLHHHHHHHHHhlLLLLEEEEEEEhhH
Query -----ncgvsAAPAplpgntaaalallgetplfaDVPAYFAALDaqRPMINVAALVGhaN  144
ident            |                                         |      
Sbjct aipdrrkaieIARR--------------------ANDVLAEECA--KRPDRFLAFAA--L  101
DSSP  hlllhhhhhhHHHH--------------------HHHHHHHHHH--HLLLLEEEEEL--L


DSSP  HHHhhlllllllllhhHHHHHHHHHHHHHH-HLLLEEEEELLLLL----hHHLL-HHHHH
Query LRLaamrdpqaaptaaEQQAMQDMLQAALE-AGAVGFSTGLAYQP----gAVAQ-AAELE  198
ident                    |    ||      | ||       |                
Sbjct PLQ-------------DPDAATEELQRCVNdLGFVGALVNGFSQEgdgqtPLYYdLPQYR  148
DSSP  LLL-------------LHHHHHHHHHHHHHlLLLLEEEEELLLLLlllllLLLLlLHHHH


DSSP  HHHHHHHHLLLEEEEELL----------------------LLLLlHHHHHHHHH--HHHH
Query GLARVAAERRRLHTSHIR----------------------NEADgVEAAVEEVL--AIGR  234
ident                | |                                          
Sbjct PFWGEVEKLDVPFYLHPRnplpqdsriydghpwllgptwaFAQE-TAVHALRLMasGLFD  207
DSSP  HHHHHHHHHLLLEEEELLlllhhhlhhhlllhhhlhhhlhHHHH-HHHHHHHHHhlLHHH


DSSP  HH-LLEEEEL-LLLLllhhhllLHHHH------------------hhhHHHHHHllLLEE
Query GT-GCATVVS-HHKCmmpqnwgRSRAT------------------lanIDRAREqgVEVA  274
ident                                                             
Sbjct EHpRLNIILGhMGEG-------LPYMMwridhrnawvklpprypakrrFMDYFN--ENFH  258
DSSP  HLlLLLEEELhHHLL-------HHHHHhhhhhllllllllllllllllHHHHHH--HHEE


DSSP  EEE-LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhl
Query LDI-YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrla  333
ident                                                             
Sbjct ITTsGNFR----------------------------------------------------  266
DSSP  EELlLLLL----------------------------------------------------


DSSP  leeeeeelllHHHHHHHH---HLLLEEELLLLLllllllLLHHHHHHHHHHHHhhhhllL
Query pagaiyfamdEDEVKRIF---QHPCCMVGSDGLpndarpHPRLWGSFTRVLGRyvrearL  390
ident                               |                             
Sbjct ----------TQTLIDAIleiGADRILFSTDWP------FENIDHASDWFNAT------S  304
DSSP  ----------HHHHHHHHlllLHHHEELLLLLL------LLLHHHHHHHHHHL------L


DSSP  LLHHHHHHHHLHHHHHHHLLLlllllllllllleeeelllllllllllllllllllleee
Query MTLEQAVARMTALPARVFGFAergvlqpgawadvvvfdpdtvadratwdeptlasvgiag  450
ident       |        | |                                          
Sbjct IAEADRVKIGRTNARRLFKLD---------------------------------------  325
DSSP  LLHHHHHHHHLHHHHHHLLLL---------------------------------------


DSSP  eeelleeeellllllllllllllll
Query vlvngaevfpqppadgrpgqvlrax  475
ident                          
Sbjct -------------------------  325
DSSP  -------------------------


No 44: Query=3giqA Sbjct=1itqA Z-score=14.0

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleEEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkiVAPGFID   60
ident                                                           ||
Sbjct ------------------------------------------dffrdeaerimRDSPVID   18
DSSP  ------------------------------------------lhhhhhhhhhhLLLLEEE


DSSP  LLLLLLLH------------hHHLL-------LLHHHHLLLEEEEEELlllLLLLlllll
Query VHGHDDLM------------fVEKP-------DLRWKTSQGITTVVVGncgVSAApaplp  101
ident  |                                                 |        
Sbjct GHNDLPWQlldmfnnrlqderANLTtlagthtNIPKLRAGFVGGQFWS---VYTP-----   70
DSSP  EEELHHHHhhhhhllllllhhHLLLlllllllLHHHHHHLLEEEEEEE---ELLL-----


DSSP  lLLLHhhhhhllllllLLHHHHHHHHHHLL------------------lLLEEEEEEE-H
Query gNTAAalallgetplfADVPAYFAALDAQR------------------pMINVAALVG-H  142
ident   |                                                     |   
Sbjct cDTQN---kdavrrtlEQMDVVHRMCRMYPetflyvtssagirqafregKVASLIGVEgG  127
DSSP  hHHLL---llhhhhhhHHHHHHHHHHHHLLlleeelllhhhhhhhhhllLEEEEEEEElH


DSSP  HHHHhhhlllllllllhhhhhhHHHHHHHHHHHLLLEEEEELlLLLHHHL----------
Query ANLRlaamrdpqaaptaaeqqaMQDMLQAALEAGAVGFSTGLaYQPGAVA----------  192
ident                           | |    |               |          
Sbjct HSID-----------------sSLGVLRALYQLGMRYLTLTH-SCNTPWAdnwlvdtgds  169
DSSP  HHLL-----------------lLHHHHHHHHHLLEEEEELLL-LLLLLLLllhhhlllll


DSSP  ------LHHHHHHHHHHHHHLLLEEEE-ELLLllllhhHHHHHHHHHHhhhLLEEEEL-L
Query ------QAAELEGLARVAAERRRLHTS-HIRNeadgveAAVEEVLAIGrgtGCATVVS-H  244
ident                        |    |         |     |            |  
Sbjct epqsqgLSPFGQRVVKELNRLGVLIDLaHVSV------ATMKATLQLS---RAPVIFShS  220
DSSP  llllllLLHHHHHHHHHHHHHLLEEELlLLLH------HHHHHHHHHL---LLLLEELlL


DSSP  LLLllhhHLLL-----HHHHHHHHHHHHhllllEEEEELLLLEEeeellhhhllllllle
Query HKCmmpqNWGR-----SRATLANIDRAReqgveVALDIYPYPGSstiliperaetiddir  299
ident                     |                   |                   
Sbjct SAY----SVCAsrrnvPDDVLRLVKQTD-----SLVMVNFYNNY----------------  255
DSSP  LLL----LLLLlllllLHHHHHHHHHHL-----LEEEELLLHHH----------------


DSSP  eeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeEEEL--lLHHHHHHHHH----L
Query itwstphpecsgeyladiaarwgcdkttaarrlapagaIYFA--mDEDEVKRIFQ----H  353
ident                                          |                  
Sbjct -----------------------------------iscTNKAnlsQVADHLDHIKevagA  280
DSSP  -----------------------------------hllLLLLlhhHHHHHHHHHHhhllH


DSSP  LLEEELLLLLllllLLLL----HHHHhHHHHHHHHHhHLLLlLHHHHHHHHLHHHHHHHL
Query PCCMVGSDGLpndaRPHP----RLWGsFTRVLGRYVrEARLmTLEQAVARMTALPARVFG  409
ident      | |         |                        |             ||| 
Sbjct RAVGFGGDFD--gvPRVPegleDVSK-YPDLIAELL-RRNW-TEAEVKGALADNLLRVFE  335
DSSP  HHEEELLLLL--llLLLLllllLLLL-HHHHHHHHH-HLLL-LHHHHHHHHLHHHHHHHH


DSSP  lllllllllllllleeeelllllllllllllllllllleeeeeelleeeellllllllll
Query faergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpg  469
ident                                                             
Sbjct --------------------------------aveqasnltqapeeepipldqlggscrt  363
DSSP  --------------------------------hhhhllllllllllllllhhhlllllll


DSSP  llllll
Query qvlrax  475
ident       
Sbjct hygyss  369
DSSP  llllll


No 45: Query=3giqA Sbjct=4dziC Z-score=13.1

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeellllEEEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkIVAPGFID   60
ident                                                           ||
Sbjct ----------------------------------------------------ALNYRVID    8
DSSP  ----------------------------------------------------LLLLLEEE


DSSP  LLLLLLL-----------------------------------------------------
Query VHGHDDL-----------------------------------------------------   67
ident |  |                                                        
Sbjct VDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcl   68
DSSP  EEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllllleelllll


DSSP  ---------------------------HHHHLLL-LHHHHLLLEEEEEELllllllllll
Query ---------------------------MFVEKPD-LRWKTSQGITTVVVGncgvsaapap   99
ident                                          | | |              
Sbjct dllfrgeipdgvdpaslmkverladhpEYQNRDArIAVMDEQDIETAFML----------  118
DSSP  hhhhhllllllllhhhllleelhhhlhHHLLHHHhHHHHHHHLEEEEEEE----------


DSSP  llllllHHHH---------hhlllllllLHHHHHHHHhhlllLLEEEEEEEHhhHHHHhl
Query lpgntaAALA---------llgetplfaDVPAYFAALdaqrpMINVAALVGHanLRLAam  150
ident                                                |            
Sbjct ----ptFGCGveealkhdieatmasvhaFNLWLDEDWgfdrpDHRIIAAPIV--SLAD--  170
DSSP  ----llHHHHhhhhllllhhhhhhhhhhHHHHHHHHLlllllLLLEEELLLL--LLLL--


DSSP  llllllllhhhHHHHHHHHHHHHHHLLLEEEEELllllHHHL---------LHHHhHHHH
Query rdpqaaptaaeQQAMQDMLQAALEAGAVGFSTGLayqpGAVA---------QAAElEGLA  201
ident                       |  ||             |                   
Sbjct -----------PTRAVEEVDFVLARGAKLVLVRP----APVPglvkprslgDRSH-DPVW  214
DSSP  -----------HHHHHHHHHHHHHLLLLLEELLL----LLLLlllllllllLHHH-HHHH


DSSP  HHHHHLLLEEEEE---------------------llllLLLH-HHHHHHHH--HHHHHHL
Query RVAAERRRLHTSH---------------------irneADGV-EAAVEEVL--AIGRGTG  237
ident    ||       |                          |                    
Sbjct ARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllDDRAiHDTMASMIvhGVFTRHP  274
DSSP  HHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhLLHHhHHHHHHHHhlLHHHHLL


DSSP  -LEEEELL-LLLLlhhhlllHHHHH---------------hhhHHHHhllLLEEEEELLL
Query -CATVVSH-HKCMmpqnwgrSRATL---------------aniDRAReqgVEVALDIYPY  280
ident     |                                               |    |  
Sbjct kLKAVSIEnGSYF-------VHRLIkrlkkaantqpqyfpedpVEQL--rNNVWIAPYYE  325
DSSP  lLLEEEELlLLLH-------HHHHHhhhhhhhhhlhhhllllhHHHH--hHHEEELLLLL


DSSP  Leeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeee
Query Pgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyf  340
ident                                                             
Sbjct D-----------------------------------------------------------  326
DSSP  L-----------------------------------------------------------


DSSP  lllhhHHHHHH---HLLLEEELLLLLLllllLLLHhHHHHHhHHHHHHhhllLLLHHHHH
Query amdedEVKRIF---QHPCCMVGSDGLPndarPHPRlWGSFTrVLGRYVrearLMTLEQAV  397
ident                      |||                                    
Sbjct -----DLPELArviGVDKILFGSDWPH----GEGL-ASPVS-FTAELK----GFSESDIR  371
DSSP  -----LHHHHHhhhLHHHLLLLLLLLL----LLLL-LLHHH-HHHHHL----LLLHHHHH


DSSP  HHHLHHHHHHHLlllllllllllllleeeelllllllllllllllllllleeeeeellee
Query ARMTALPARVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngae  457
ident   |        |                                                
Sbjct KIMRDNALDLLG------------------------------------------------  383
DSSP  HHHLHHHHHHHL------------------------------------------------


DSSP  eellllllllllllllll
Query vfpqppadgrpgqvlrax  475
ident                   
Sbjct -------------vqvgs  388
DSSP  -------------lllll


No 46: Query=3giqA Sbjct=3gg7A Z-score=13.1

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                           ||
Sbjct --------------------------------------------------------SLID    4
DSSP  --------------------------------------------------------LLEE


DSSP  LLLLLLLHhHHLLLL-HHHHLLLEeEEEELlllLLLLLllllllllhhhhhhllllllll
Query VHGHDDLMfVEKPDL-RWKTSQGItTVVVGncgVSAAPaplpgntaaalallgetplfad  119
ident  | | ||         |        ||                                 
Sbjct FHVHLDLY-PDPVAVaRACEERQL-TVLSV---TTTPA---------------------a   38
DSSP  EEELHHHL-LLHHHHhHHHHHLLL-EEEEL---LLLHH---------------------h


DSSP  hHHHHHhhhhlLLLLEEEEEEEHH--HHHHHHLllllllllhhhhhhhHHHHHHHHHhLL
Query vPAYFAaldaqRPMINVAALVGHA--NLRLAAMrdpqaaptaaeqqamQDMLQAALEaGA  177
ident      |          |    |         |                       |    
Sbjct wRGTLA---laAGRPHVWTALGFHpeVVSERAA--------------dLPWFDRYLP-ET   80
DSSP  hHHHHH---hhLLLLLEEELLLLLhhHLLLLHH--------------hLHHHHHHHH-HL


DSSP  LEEE-EELL----lllhHHLLHHHHHHHHHHHHHL-LLEEEEELLLllllhhhHHHHHHH
Query VGFS-TGLA----yqpgAVAQAAELEGLARVAAER-RRLHTSHIRNeadgveaAVEEVLA  231
ident       ||            | |      |       |    | |        |  ||| 
Sbjct RFVGeVGLDgspslrgtWTQQFAVFQHILRRCEDHgGRILSIHSRR-------AESEVLN  133
DSSP  LEEEeEELLllhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELLL-------LHHHHHH


DSSP  HHHHHL--LEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELLLleeeeellh
Query IGRGTG--CATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYPYpgsstilip  289
ident                           |   |                  |          
Sbjct CLEANPrsGTPILHWYSG--------SVTELRRAISLG-----CWFSVGPT---------  171
DSSP  HHHHLHhhEEEEEELLLL--------LHHHHHHHHHLL-----LEEEELHH---------


DSSP  hhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHHH
Query eraetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdEDEVKR  349
ident                                                             
Sbjct ---------------------------------------------------mvrTQKGAA  180
DSSP  ---------------------------------------------------hhlLHHHHH


DSSP  HHHLL---LEEELLLLL-lllLLLLlHHHHHHHHHHHHHHhhlLLLL---HHHHHHHhLH
Query IFQHP---CCMVGSDGL-pndARPHpRLWGSFTRVLGRYVreaRLMT---LEQAVARmTA  402
ident               ||           |      |                |        
Sbjct LIRSMprdRVLTETDGPflelDGQA-ALPWDVKSVVEGLS---KIWQipaSEVERIV-KE  235
DSSP  HHHHLlhhHEEELLLLLlleeLLEE-LLHHHHHHHHHHHH---HHHLllhHHHHHHH-HH


DSSP  HHHHHHLlllllllllllllleeeelllllllllllllllllllleeeeeelleeeelll
Query LPARVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqp  462
ident    |  |                                                     
Sbjct NVSRLLG-----------------------------------------------------  242
DSSP  HHHHHHH-----------------------------------------------------


DSSP  lllllllllllll
Query padgrpgqvlrax  475
ident              
Sbjct ------------t  243
DSSP  ------------l


No 47: Query=3giqA Sbjct=3iacA Z-score=12.3

back to top
DSSP  ---------lleeeeeellEELLlllllleeleeeeelleeeeeelllllleeeeeelll
Query ---------ekldfkitggWIIDgtgaprrradlgvrdgriaaigelgahparhawdasg   51
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  leeEELEEELLLLLLL-HHHHLL-------------------------------------
Query kivAPGFIDVHGHDDL-MFVEKP-------------------------------------   73
ident         | | |                                               
Sbjct --aPXPIYDFHCHLSPqEIADDRrfdnlgqiwlegdhykwralrsagvdeslitgketsd   81
DSSP  --lLLLEEELLLLLLHhHHHHLLllllhhhhhhllllhhhhhhhhllllhhhlllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   73
ident                                                             
Sbjct yekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafs  141
DSSP  hhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhl


DSSP  LLHHHHLLLEEEEEELllllLLLLllllllllhhhhhhlllllllLHHHHHHHHHHLL-L
Query DLRWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfaDVPAYFAALDAQR-P  132
ident             |                                |   |     |    
Sbjct ARGIXQQXNVRXVGTT----DDPI---------------------DSLEYHRQIAADDsI  176
DSSP  HHHHHHHLLEEEEELL----LLLL---------------------LLLHHHHHHHHLLlL


DSSP  LLEEEEEEEHHHHH---hhhLLLLL----------lllLHHHHHHHHHHHHHHHHHLLLE
Query MINVAALVGHANLR---laaMRDPQ----------aapTAAEQQAMQDMLQAALEAGAVG  179
ident  | ||                 |                    ||    |      |   
Sbjct DIEVAPSWRPDKVFkieldgFVDYLrkleaaadvsitrFDDLRQALTRRLDHFAACGCRA  236
DSSP  LLEEELLLLLHHHHllllllHHHHHhhhhhhhllllllHHHHHHHHHHHHHHHHHLLLLE


DSSP  EEEELLL---------------------------llhhhLLHHHHHHHHHHHHHLLLEEE
Query FSTGLAY---------------------------qpgavAQAAELEGLARVAAERRRLHT  212
ident    |                                      | |  | |  | |     
Sbjct SDHGIETlrfapvpddaqldailgkrlagetlseleiaqFTTAVLVWLGRQYAARGWVXQ  296
DSSP  EEEEELLllllllllhhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHHHHHHLLEEE


DSSP  EELLL---------------------lLLLHHHHHHHHHHHHH--HHLLEEEELlLLLLl
Query SHIRN---------------------eADGVEAAVEEVLAIGR--GTGCATVVShHKCMm  249
ident  ||                              |    |           |         
Sbjct LHIGAirnnntrxfrllgpdtgfdsigDNNISWALSRLLDSXDvtNELPKTILY-CLNP-  354
DSSP  EEELEellllhhhhhhhllllllleelLLLLHHHHHHHHHHHHllLLLLEEEEE-ELLH-


DSSP  hhhlLLHHHHHHHHHHHHHLL--lLEEEEE----lLLLEeeeellhhhllllllleeeee
Query pqnwGRSRATLANIDRAREQG--vEVALDI----yPYPGsstiliperaetiddiritws  303
ident              |      |    |                                  
Sbjct ----RDNEVLATXIGNFQGPGiagKVQFGSgwwfnDQKD---------------------  389
DSSP  ----HHHHHHHHHHHHLLLLLlllLEEELLllhhhLLHH---------------------


DSSP  lllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeellLHHHHHHHHH----LLLE-EE
Query tphpecsgeyladiaarwgcdkttaarrlapagaiyfamDEDEVKRIFQ----HPCC-MV  358
ident                                                             
Sbjct ---------------------------------------GXLRQLEQLSqxglLSQFvGX  410
DSSP  ---------------------------------------HHHHHHHHHHhhllHHHLlLL


DSSP  LLLLLLlllllllhHHHHHHHHHHHHHhHLLL-------------lLHHHHHHHHLHHHH
Query GSDGLPndarphprLWGSFTRVLGRYVrEARL-------------mTLEQAVARMTALPA  405
ident   |                                                         
Sbjct LTDSRS------flSYTRHEYFRRILC-NLLGqwaqdgeipddeaxLSRXVQDICFNNAQ  463
DSSP  LLLLLL------llLLHHHHHHHHHHH-HHHHhhhhlllllllhhhHHHHHHHHHLHHHH


DSSP  HHHLlllllllllllllleeeelllllllllllllllllllleeeeeelleeeellllll
Query RVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppad  465
ident | |                                                         
Sbjct RYFT--------------------------------------------------------  467
DSSP  HHLL--------------------------------------------------------


DSSP  llllllllll
Query grpgqvlrax  475
ident           
Sbjct --------ik  469
DSSP  --------ll


No 48: Query=3giqA Sbjct=1j5sA Z-score=12.1

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                            |
Sbjct -------------------------------hmflgedylltnraavrlfnevkDLPIVD   29
DSSP  -------------------------------llllllllllllhhhhhhhhhhlLLLEEE


DSSP  LLLLLLL-HHHHL-----------------------------------------------
Query VHGHDDL-MFVEK-----------------------------------------------   72
ident  | | |    ||                                                
Sbjct PHNHLDAkDIVENkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakv   89
DSSP  LLLLLLHhHHHHLlllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhh


DSSP  ----------------------------------------------lLLHHHHLLLEEEE
Query ----------------------------------------------pDLRWKTSQGITTV   86
ident                                                             
Sbjct fprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEIL  149
DSSP  hhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEE


DSSP  EELllllLLLLllllllllhhhhhhlllllllLHHHHHHHHHHLLLLLEEEEEEEHHHHH
Query VVGncgvSAAPaplpgntaaalallgetplfaDVPAYFAALDAQRPMINVAALVGHANLR  146
ident                                                             
Sbjct CTT----DDPV---------------------STLEHHRKAKEAVEGVTILPTWRPDRAM  184
DSSP  ELL----LLLL---------------------LLLHHHHHHHHHLLLLEEELLLLLHHHH


DSSP  H---hhLLLL----------llllLHHHHHHHHHHHHHHHHHLLLEEEEELL--------
Query L---aaMRDP----------qaapTAAEQQAMQDMLQAALEAGAVGFSTGLA--------  185
ident        |                      |         | | |     |         
Sbjct NvdkegWREYvekmgerygedtstLDGFLNALWKSHEHFKEHGCVASDHALLepsvyyvd  244
DSSP  LlllllHHHHhhhhhhhhllllllHHHHHHHHHHHHHHHHLLLLLEEEEEELllllllll


DSSP  ------------------lllhhHLLHHHHHHHHHHHHHLLLEEEEELLL----------
Query ------------------yqpgaVAQAAELEGLARVAAERRRLHTSHIRN----------  217
ident                           |           |       ||            
Sbjct enraravhekafsgekltqdeinDYKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfk  304
DSSP  hhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhh


DSSP  ------------llLLHHHHHHHHHHHHHHhLLEEEEllLLLLlhhhLLLHHHHHHHHHH
Query ------------eaDGVEAAVEEVLAIGRGtGCATVVshHKCMmpqnWGRSRATLANIDR  265
ident                         |    |     |                        
Sbjct tlgpdsggdistnfLRIAEGLRYFLNEFDG-KLKIVL--YVLD----PTHLPTISTIARA  357
DSSP  hlllllllleelllLLHHHHHHHHHHHLLL-LLLEEE--EELL----HHHHHHHHHHHHH


DSSP  HHhlllLEEEEEL----LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhh
Query AReqgvEVALDIY----PYPGsstiliperaetiddiritwstphpecsgeyladiaarw  321
ident        |           |                                        
Sbjct FP----NVYVGAPwwfnDSPF---------------------------------------  374
DSSP  LL----LEEELLLllllLLHH---------------------------------------


DSSP  lllhhhhhhhhlleeeeeelllHHHHHHH---hHLLLE-EELLLLLLlllllllHHHHHH
Query gcdkttaarrlapagaiyfamdEDEVKRI---fQHPCC-MVGSDGLPndarphpRLWGSF  377
ident                       |   |                |                
Sbjct --------------------gmEMHLKYLasvdLLYNLaGMVTDSRK-----llSFGSRT  409
DSSP  --------------------hhHHHHHHHhlllLHHHLlLLLLLLLL-----llHHHHHH


DSSP  HHHHHHHHhHLLL-----------lLHHHHHHHHLHHHHHHHLlllllllllllllleee
Query TRVLGRYVrEARL-----------mTLEQAVARMTALPARVFGfaergvlqpgawadvvv  426
ident                            |         |   |                  
Sbjct EMFRRVLS-NVVGemvekgqipikeARELVKHVSYDGPKALFF-----------------  451
DSSP  HHHHHHHH-HHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-----------------


DSSP  elllllllllllllllllllleeeeeelleeeellllllllllllllll
Query fdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                                  
Sbjct -------------------------------------------------  451
DSSP  -------------------------------------------------


No 49: Query=3giqA Sbjct=3qy6A Z-score=11.6

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeelEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapgFID   60
ident                                                           ||
Sbjct ---------------------------------------------------------MID    3
DSSP  ---------------------------------------------------------LEE


DSSP  LLLLLLL------HHHHLLL--LHHHHLLLEEEEEELLLLllllllllllllLHHHhhhl
Query VHGHDDL------MFVEKPD--LRWKTSQGITTVVVGNCGvsaapaplpgntAAALallg  112
ident  | |                   |    ||| |                           
Sbjct IHCHILPamddgaGDSADSIemARAAVRQGIRTIIATPHH----------nnGVYK----   49
DSSP  LLLLLLLllllllLLHHHHHhhHHHHHHLLLLEEELLLEE----------llLLLL----


DSSP  lllllLLHHHHHHHHHHLL----lLLEEEEEEehhhhhhhhlllllllllhhhhhhhhhh
Query etplfADVPAYFAALDAQR----pMINVAALVghanlrlaamrdpqaaptaaeqqamqdm  168
ident      | |      |            |                                
Sbjct --nepAAVREAADQLNKRLikediPLHVLPGQ----------------------------   79
DSSP  --llhHHHHHHHHHHHHHHhhlllLLEEELLL----------------------------


DSSP  hhhhhhhllleeEEELllllhhhllHHHHHHHHHH----hhhlLLEEEEELLLlllLHHH
Query lqaaleagavgfSTGLayqpgavaqAAELEGLARV----aaerRRLHTSHIRNeadGVEA  224
ident                            | |                              
Sbjct ------------EIRI---------YGEVEQDLAKrqllslndTKYILIEFPF---DHVP  115
DSSP  ------------EEEL---------LLLHHHHHHLlllllhhhLLEEEEELLL---LLLL


DSSP  hhHHHHHHHHHHL---LEEEELLLLLllhhhLLLHhHHHHHHHHHHhllllEEEEEL---
Query avEEVLAIGRGTG---CATVVSHHKCmmpqnWGRSrATLANIDRAReqgveVALDIY---  278
ident                    |  |               |             |  |    
Sbjct --RYAEQLFYDLQlkgYIPVIAHPER-nreiRENP-SLLYHLVEKG-----AASQITsgs  166
DSSP  --LLHHHHHHHHHhllLEEEEELHHH-lhhhHHLL-HHHHHHHHLL-----LEEEEEhhh


DSSP  LLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee
Query PYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
ident                                                             
Sbjct LAGIF-------------------------------------------------------  171
DSSP  HLLLL-------------------------------------------------------


DSSP  eELLLHHHHHHHHHLL-LEEELLLLLLLLllLLLHhhhHHHHHHHHHHhhlLLLLHHHHH
Query yFAMDEDEVKRIFQHP-CCMVGSDGLPNDarPHPRlwgSFTRVLGRYVreaRLMTLEQAV  397
ident           |         | ||                   |            |   
Sbjct -GKQLKAFSLRLVEANlIHFVASDAHNVK--TRNF---HTQEALYVLE---KEFGSELPY  222
DSSP  -LHHHHHHHHHHHHLLlLLEEELLLLLLL--LLLL---LHHHHHHHHH---HHHLLHHHH


DSSP  HHHlHHHHHHHLLLlllllllllllleeeelllllllllllllllllllleeeeeellee
Query ARMtALPARVFGFAergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngae  457
ident                                                             
Sbjct MLT-ENAELLLRNQ----------------------------------------------  235
DSSP  HHH-HHHHHHHLLL----------------------------------------------


DSSP  eellllllllllllllll
Query vfpqppadgrpgqvlrax  475
ident                   
Sbjct ------tifrqppqpvkr  247
DSSP  ------llllllllllll


No 50: Query=3giqA Sbjct=1v77A Z-score=10.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
ident                                                          || 
Sbjct -------------------------------------------------------VKFIE    5
DSSP  -------------------------------------------------------LLLEE


DSSP  LLLLLLLhhhhllllHHHHLlLEEEEEELLLllllllllllllllhhhhhhllllllllh
Query VHGHDDLmfvekpdlRWKTSqGITTVVVGNCgvsaapaplpgntaaalallgetplfadv  120
ident     |                    |||                                
Sbjct MDIRDKE------ayELAKE-WFDEVVVSIK-----------------------------   29
DSSP  EEELLHH------hhHHHHH-HLLEEEEEEE-----------------------------


DSSP  hhhhhhhhhllllleeeeeeeHHHHhhhhlllllllllhhhhhhhhhhHHHHHHHLL---
Query payfaaldaqrpminvaalvgHANLrlaamrdpqaaptaaeqqamqdmLQAALEAGA---  177
ident                                                     |       
Sbjct ---------------------FNEE----------------------vDKEKLREARkey   46
DSSP  ---------------------ELLL----------------------lLHHHHHHHHhhh


DSSP  --LEEEEELllllhhhlLHHHHHHHHHHHHhlLLEEEEELLLllllhHHHHHHHHHHHhh
Query --VGFSTGLayqpgavaQAAELEGLARVAAerRRLHTSHIRNeadgvEAAVEEVLAIGrg  235
ident   |                               |                      |  
Sbjct gkVAILLSN-------pKPSLVRDTVQKFK--SYLIYVESND-----LRVIRYSIEKG--   90
DSSP  llEEEEEEL-------lLHHHHHHHHHHLL--LLEEEEELLL-----HHHHHHHHHLL--


DSSP  hllEEEELLLLLLlhhHLLL--HHHHHHHHHHHhhlllLEEEEELLLLEEeeellhhhll
Query tgcATVVSHHKCMmpqNWGR--SRATLANIDRAreqgvEVALDIYPYPGSstiliperae  293
ident                                        |||     |            
Sbjct ---VDAIISPWVN---RKDPgiDHVLAKLMVKK-----NVALGFSLRPLL----------  129
DSSP  ---LLEEELLLLL---LLLLllLHHHHHHHHHH-----LLEEEEELHHHH----------


DSSP  llllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeEEEL----lLHHHHHH
Query tiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaIYFA----mDEDEVKR  349
ident                                                             
Sbjct --------------------------------------------YSNPyeranLLRFMMK  145
DSSP  --------------------------------------------HLLHhhhhhHHHHHHH


DSSP  HHHLL-----LEEELLLLLLlllllLLHHhHHHHHHHHHHHhhLLLLLHHHHHHHHLHHH
Query IFQHP-----CCMVGSDGLPndarpHPRLwGSFTRVLGRYVreARLMTLEQAVARMTALP  404
ident                |                        |     |   || |     |
Sbjct AWKLVekykvRRFLTSSAQE-----KWDV-RYPRDLISLGV--VIGMEIPQAKASISMYP  197
DSSP  HHHHHhhhllLEEEELLLLL-----HHHL-LLHHHHHHHHH--HLLLLHHHHHHLLLHHH


DSSP  HHHHLlllllllllllllleeeelllllllllllllllllllleeeeeelleeeelllll
Query ARVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppa  464
ident                                                             
Sbjct EIILK-------------------------------------------------------  202
DSSP  HHHHL-------------------------------------------------------


DSSP  lllllllllll
Query dgrpgqvlrax  475
ident            
Sbjct -----------  202
DSSP  -----------


No 51: Query=3giqA Sbjct=2a3lA Z-score=9.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------------------lleeeeeELLEELllllllleeleeeeelleeeee
Query -------------------------ekldfkiTGGWIIdgtgaprrradlgvrdgriaai   35
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  elllllleeeeeelllleEEELEEELLLLLL-----------------------------
Query gelgahparhawdasgkiVAPGFIDVHGHDD-----------------------------   66
ident                         | | |                               
Sbjct -----------------fYNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdg  201
DSSP  -----------------lLLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   66
ident                                                             
Sbjct tyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdn  261
DSSP  eeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhhhhhlllll


DSSP  ----lhHHHL-LLLH-HHHLLLEEEEEELllllLLLLLLLlllllhhhhhhllllllLLH
Query ----lmFVEK-PDLR-WKTSQGITTVVVGncgvSAAPAPLpgntaaalallgetplfADV  120
ident         |                                                   
Sbjct liqgrfLGEItKQVFsDLEASKYQMAEYR----ISIYGRK----------------mSEW  301
DSSP  llllllHHHHhHHHHhHHLLLLLEEEEEE----EELLLLL----------------lLHH


DSSP  HHHHHHHHHL-LLLLEEEEEEEHHhhhhhhLLLLLLlllhHHHHHHHHHHHH--------
Query PAYFAALDAQ-RPMINVAALVGHAnlrlaaMRDPQAaptaAEQQAMQDMLQA--------  171
ident                ||  |                       |   |            
Sbjct DQLASWIVNNdLYSENVVWLIQLP----rlYNIYKDmgivTSFQNILDNIFIplfeatvd  357
DSSP  HHHHHHHHLLlLLLLLEEEEEEEE----llHHHHLLllllLLLHHHHHHHLLhhhhhhhl


DSSP  --------hhhhLLLEEEEELLL------------------llhhHLLHHHHHHHHHHHH
Query --------aleaGAVGFSTGLAY------------------qpgaVAQAAELEGLARVAA  205
ident               |||                             |             
Sbjct pdshpqlhvflkQVVGFDLVDDEskperrptkhmptpaqwtnafnPAFSYYVYYCYANLY  417
DSSP  hhhllllhhhhlLEEEEEEELLLllllllllllllllllllllllLLHHHHHHHHHHHHH


DSSP  HLL----------LEEEEELllLLLLhHHHHHHHHHHHhhhlleEEELLLLLllhhhlLL
Query ERR----------RLHTSHIrnEADGvEAAVEEVLAIGrgtgcaTVVSHHKCmmpqnwGR  255
ident                   |   ||                        |           
Sbjct VLNklreskgmttITLRPHS-gEAGD-IDHLAATFLTC------HSIAHGIN-----lRK  464
DSSP  HHHhhhlllllllLEELLLL-lLLLL-LHHHHHHHHHL------LLLLLLHH-----hHH


DSSP  HHHHHHHHHHHHhllllEEEEELL-LLEEeeellhhhllllllleeeeelllhhhllllh
Query SRATLANIDRAReqgveVALDIYP-YPGSstiliperaetiddiritwstphpecsgeyl  314
ident |         |        |   |    |                               
Sbjct SPVLQYLYYLAQ-----IGLAMSPlSNNS-------------------------------  488
DSSP  LHHHHHHHHHHL-----LLEEELHhHHLL-------------------------------


DSSP  hhhhhhhlllhhhhhhhhlleeeeeELLL--HHHHHHHHH-LLLEEELLLLLllllLLLL
Query adiaarwgcdkttaarrlapagaiyFAMD--EDEVKRIFQ-HPCCMVGSDGLpndaRPHP  371
ident                             |         |          |          
Sbjct -------------------------LFLDyhRNPFPVFFLrGLNVSLSTDDP----LQIH  519
DSSP  -------------------------LLLLllLLLHHHHHHlLLLEEELLLLH----HHHL


DSSP  -hhHHHHHHHHhHHHHHLLlLLHHHHHHHHlHHHHHHHLL-LLLL--LLLLLLllleeee
Query -rlWGSFTRVLgRYVREARlMTLEQAVARMtALPARVFGF-AERG--VLQPGAwadvvvf  427
ident                                       ||                    
Sbjct ltkEPLVEEYS-IAASVWK-LSACDLCEIA-RNSVYQSGFsHALKshWIGKDY-------  569
DSSP  lllLHHHHHHH-HHHHHHL-LLHHHHHHHH-HHHHHHLLLlHHHHhhHLLLLL-------


DSSP  lllllllllllllllllllleeeeeelleeeellllllllllllllll
Query dpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                                 
Sbjct -ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  -llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=3giqA Sbjct=1bksA Z-score=7.6

back to top
DSSP  lleeeeeelleeLLLLlllleeleeeeelleeeeeelllllleeeeeelllleeeeleee
Query ekldfkitggwiIDGTgaprrradlgvrdgriaaigelgahparhawdasgkivapgfid   60
ident              |                                              
Sbjct -meryenlfaqlNDRR-----------------------------------------ega   18
DSSP  -lhhhhhhhhhhHHLL-----------------------------------------lle


DSSP  lLLLLLL----hhHHLLL-LHHHHLllEEEEEELlllllllllllllLLLHHHH-HHLL-
Query vHGHDDL----mfVEKPD-LRWKTSqgITTVVVGncgvsaapaplpgNTAAALA-LLGE-  113
ident       |                                            |        
Sbjct fVPFVTLgdpgieQSLKIiDTLIDA--GADALEL---------gvpfSDPLADGpTIQNa   67
DSSP  eEEEEELllllhhHHHHHhHHHHHL--LLLLEEE---------elllLLLLLLLhHHHHh


DSSP  -------lLLLLLHHHHHHHHHHLllllEEEEEEEHHhHHHHHLllllllllhhhhHHHH
Query -------tPLFADVPAYFAALDAQrpmiNVAALVGHAnLRLAAMrdpqaaptaaeqQAMQ  166
ident            |      |                     |                   
Sbjct nlrafaagVTPAQCFEMLALIREK--hpTIPIGLLMY-ANLVFN------------NGID  112
DSSP  hhhhhhhlLLHHHHHHHHHHHHHH--llLLLEEEEEL-HHHHHL------------LLHH


DSSP  HHHHHHHHHLLLEEEEElllllHHHLLHhhHHHHHHHHHHLLLEEEEELllLLLLHHHHH
Query DMLQAALEAGAVGFSTGlayqpGAVAQAaeLEGLARVAAERRRLHTSHIrnEADGVEAAV  226
ident          |                           |                      
Sbjct AFYARCEQVGVDSVLVA-----DVPVEE--SAPFRQAALRHNIAPIFIC--PPNADDDLL  163
DSSP  HHHHHHHHHLLLEEEEL-----LLLHHH--LHHHHHHHHHLLLEEEEEE--LLLLLHHHH


DSSP  HHHHHHHhhhllEEEELLLllllhHHLL--LHHHHHHHHhhhhhllllEEEEE-------
Query EEVLAIGrgtgcATVVSHHkcmmpQNWG--RSRATLANIdrareqgveVALDI-------  277
ident   |   |                                                     
Sbjct RQVASYG-----RGYTYLL-----ALPLhhLIEKLKEYH--------aAPALQgfgissp  205
DSSP  HHHHHHL-----LLLEEEL-----LLLHhhHHHHHHHHL--------lLLEEEllllllh


DSSP  -LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhllee
Query -YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapag  336
ident                                                             
Sbjct eQVSA-------------------------------------------------------  210
DSSP  hHHHH-------------------------------------------------------


DSSP  eeeelllhhhHHHHhhlllEEELLLLL-LLLL-------------llllhHHHHHHHHHh
Query aiyfamdedeVKRIfqhpcCMVGSDGL-PNDA-------------rphprLWGSFTRVLg  382
ident           |              |                                  
Sbjct ---------aVRAG-----AAGAISGSaIVKIieknlaspkqmlaelrsfVSAMKAASR-  255
DSSP  ---------hHHHL-----LLEEEELLhHHHHhhhllllhhhhhhhhhhhHHHHHHLLL-


DSSP  hhhhhlllllhhhhhhhhlhhhhhhhllllllllllllllleeeelllllllllllllll
Query ryvrearlmtleqavarmtalparvfgfaergvlqpgawadvvvfdpdtvadratwdept  442
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  llllleeeeeelleeeellllllllllllllll
Query lasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                  
Sbjct ---------------------------------  255
DSSP  ---------------------------------


No 53: Query=3giqA Sbjct=3au2A Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ----------------lleeeeeelleelllllllleeleeeeelleeeeeelLLLLL--
Query ----------------ekldfkitggwiidgtgaprrradlgvrdgriaaigeLGAHP--   42
ident                                                        | |  
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   42
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   42
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------eeeeeelllleeEELEEELLLLLL-----LHHHHlllL
Query ----------------------arhawdasgkivAPGFIDVHGHDD-----LMFVEkpdL   75
ident                                        |   |           |    
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysdgqNTLEE--lW  358
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLlllllLLHHH--hH


DSSP  HHHHLLLEEEEEELLLLlllllllllllLLHHHhhhlllllllLHHHHHHHHHHLLLLLE
Query RWKTSQGITTVVVGNCGvsaapaplpgnTAAALallgetplfaDVPAYFAALDAQRPMIN  135
ident       |     |                |                              
Sbjct EAAKTMGYRYLAVTDHS-------pavrVAGGP----speealKRVGEIRRFNETHGPPY  407
DSSP  HHHHHHLLLEEEEEEEL-------hhhhLLLLL----lhhhhhHHHHHHHHHHHHHLLLE


DSSP  EEEEeehhhhhhhhlllllllllhhhhhhhhhhhhhhhhhllleEEEELLlllhhhllhh
Query VAALvghanlrlaamrdpqaaptaaeqqamqdmlqaaleagavgFSTGLAyqpgavaqaa  195
ident   |                                                         
Sbjct LLAG----------------------------------------AEVDIH-------pdg  420
DSSP  EEEE----------------------------------------EEEELL-------lll


DSSP  hhhhHHHHHHhllleEEEELLL----lllLHHHHHHHHHHHHhhhlLEEEELLLLLL---
Query elegLARVAAerrrlHTSHIRN----eadGVEAAVEEVLAIGrgtgCATVVSHHKCM---  248
ident        |                              |          |  |       
Sbjct tldyPDWVLR-eldlVLVSVHSrfnlpkaDQTKRLLKALENP----FVHVLAHPTARllg  475
DSSP  llllLHHHHL-llleEEEELLLlllllhhHHHHHHHHHHLLL----LLLEELLLLLLlll


DSSP  -LHHHLLLHHHHHHHHHHHHhllllEEEEELLLLEEeeellhhhllllllleeeeelllh
Query -MPQNWGRSRATLANIDRAReqgveVALDIYPYPGSstiliperaetiddiritwstphp  307
ident           |              ||  |  |                           
Sbjct rRAPIEADWEAVFQKAKEKG-----VAVEIDGYYDR------------------------  506
DSSP  lLLLLLLLHHHHHHHHHHHL-----LEEEEELLLLL------------------------


DSSP  hhllllhhhhhhhhlllhhhhhhhhlleeeeeelllhhhHHHHHHL-----LLEEELLLL
Query ecsgeyladiaarwgcdkttaarrlapagaiyfamdedeVKRIFQH-----PCCMVGSDG  362
ident                                                           | 
Sbjct ------------------------------------mdlPDDLARMaygmgLWISLSTDA  530
DSSP  ------------------------------------lllLHHHHHHhhhllLLEEEELLL


DSSP  LLllllllLHHHhHHHHHHhHHHHhlLLLLHHHhhHHHLH---hHHHHHLllllllllll
Query LPndarphPRLWgSFTRVLgRYVReaRLMTLEQavARMTA---lPARVFGfaergvlqpg  419
ident           |               |           |                     
Sbjct HQ-----tDHLR-FMELAV-GTAQ--RAWIGPE-rVLNTLdyedLLSWLK----------  570
DSSP  LL-----hHHHH-HHHHHH-HHHH--HLLLLLL-lLHHHLlhhhHHHHHH----------


DSSP  lllleeeelllllllllllllllllllleeeeeelleeeellllllllllllllll
Query awadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
ident                                                         
Sbjct ---------------------------------------------------arrgv  575
DSSP  ---------------------------------------------------lllll


No 54: Query=3giqA Sbjct=1m65A Z-score=7.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeelEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapgFID   60
ident                                                            |
Sbjct --------------------------------------------------------yPVD    4
DSSP  --------------------------------------------------------lLEE


DSSP  LLLLL------lLHHHHlllLHHHHllLEEEEEELLLLLlllllllllllLHHHhhhlll
Query VHGHD------dLMFVEkpdLRWKTsqGITTVVVGNCGVsaapaplpgntAAALallget  114
ident  | |                       ||        |              |       
Sbjct LHMHTvasthaySTLSD--yIAQAKqkGIKLFAITDHGP---------dmEDAP----hh   49
DSSP  LLLLLlllllllLLHHH--hHHHHHhhLLLEEEEEEELL---------llLLLL----ll


DSSP  llllLHHHHHhhhhhlLLLLEEEEEEehhhhhhhhlllllllllhhhhhhhhhhHHHHHH
Query plfaDVPAYFaaldaqRPMINVAALVghanlrlaamrdpqaaptaaeqqamqdmLQAALE  174
ident                                                             
Sbjct whfiNMRIWP----rvVDGVGILRGI---------------eaniknvdgeidcSGKMFD   90
DSSP  hhhhHHHHLL----leELLEEEEEEE---------------eeellllllllllLHHHHH


DSSP  hLLLEeeeelllllhhhllhhhhhhhhhhhhhllleEEEELL------llLLLHHHHHHH
Query aGAVGfstglayqpgavaqaaeleglarvaaerrrlHTSHIR------neADGVEAAVEE  228
ident                                                         |   
Sbjct -SLDL-------------------------------IIAGFHepvfaphdKATNTQAMIA  118
DSSP  -HLLE-------------------------------EEEELLllllllllHHHHHHHHHH


DSSP  HHHHHhhhlLEEEELLLLLLLhhHLLLHHHHHHHHHHHhhlllLEEEEELLLLeeeeell
Query VLAIGrgtgCATVVSHHKCMMpqNWGRSRATLANIDRAreqgvEVALDIYPYPgsstili  288
ident   | |         ||             |              ||| |           
Sbjct TIASG----NVHIISHPGNPK--YEIDVKAVAEAAAKH-----QVALEINNSS-------  160
DSSP  HHHLL----LLLEELLLLLLL--LLLLHHHHHHHHHHH-----LLEEEEELLL-------


DSSP  hhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeelllhhHHH
Query peraetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdedEVK  348
ident                                                             
Sbjct ---------------------------------------------------------NCR  163
DSSP  ---------------------------------------------------------LHH


DSSP  HHHHL-----LLEEELLLLLLlllllllhHHHHHHHHHhHHHHhLLLLlHHHHhHHHLH-
Query RIFQH-----PCCMVGSDGLPndarphprLWGSFTRVLgRYVReARLMtLEQAvARMTA-  402
ident                |||             | |   |      |               
Sbjct EVAAAvrdagGWVALGSDSHT------afTMGEFEECL-KILD-AVDF-PPER-ILNVSp  213
DSSP  HHHHHhhhhlLLEEEELLLLL------hhHLLLLHHHH-HHHH-HLLL-LHHH-LHHHLh


DSSP  -HHHHHHLlllllllllllLLLEeeelllllllllllllllllllleeeeeelleeeell
Query -LPARVFGfaergvlqpgaWADVvvfdpdtvadratwdeptlasvgiagvlvngaevfpq  461
ident                     ||                                      
Sbjct rRLLNFLE--srgmapiaeFADL-------------------------------------  234
DSSP  hHHHHHHH--hllllllhhHLLL-------------------------------------


DSSP  llllllllllllll
Query ppadgrpgqvlrax  475
ident               
Sbjct --------------  234
DSSP  --------------


No 55: Query=3giqA Sbjct=3dcpA Z-score=7.2

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
ident                                                            |
Sbjct --------------------------------------------------------XKRD    4
DSSP  --------------------------------------------------------LLEE


DSSP  LLLLLL-------lHHHHlllLHHHHLLLEEEEEELL-----lllllllllllllLLHHh
Query VHGHDD-------lMFVEkpdLRWKTSQGITTVVVGN-----cgvsaapaplpgnTAAAl  108
ident  | |             |                                        | 
Sbjct GHTHTEfcphgthdDVEE--xVLKAIELDFDEYSIVEhaplssefxkntagdkeaVTTA-   61
DSSP  EEELLLllllllllLHHH--hHHHHHHLLLLEEEEEEellllhhhhhllllllhhHHLL-


DSSP  hhhllllLLLL-HHHHHhHHHHLLL-LLEEEEEEehhhhhhhhlllllllllhhhhhhhh
Query allgetpLFAD-VPAYFaALDAQRP-MINVAALVghanlrlaamrdpqaaptaaeqqamq  166
ident                                                             
Sbjct --sxaxsDLPYyFKKXN-HIKKKYAsDLLIHIGF--------------------------   92
DSSP  --lllhhHHHHhHHHHH-HHHHHLLlLLEEEEEE--------------------------


DSSP  hhhhhhhhhllleeEEELllllhhhllHHHHhHHHHHHHHLLL----eeEEELL------
Query dmlqaaleagavgfSTGLayqpgavaqAAELeGLARVAAERRR----lhTSHIR------  216
ident                                    |                        
Sbjct --------------EVDY--------lIGYE-DFTRDFLNEYGpqtddgVLSLHflegqg  129
DSSP  --------------EEEL--------lLLLH-HHHHHHHHHHHhhlleeEEELLeeeell


DSSP  ------------------------llLLLHHHHHHHHHHHhHHHLLE-EEELLLLLL---
Query ------------------------neADGVEAAVEEVLAIgRGTGCA-TVVSHHKCM---  248
ident                                  |                  |       
Sbjct gfrsidfsaedynegivqfyggfeqaQLAYLEGVKQSIEA-DLGLFKpRRXGHISLCqkf  188
DSSP  eeeellllhhhhhhhlhhhhllhhhhHHHHHHHHHHHHHL-LLLLLLlLEELLLLHHhll


DSSP  ----------lHHHLL-LHHHHHHHHHHHHhllllEEEEELLLLEEEeellhhhllllll
Query ----------mPQNWG-RSRATLANIDRAReqgveVALDIYPYPGSStiliperaetidd  297
ident                    |  ||             ||                     
Sbjct qqffgedtsdfSEEVXeKFRVILALVKKRD-----YELDFNTAGLFK-------------  230
DSSP  hhhhlllhhhlLHHHHhHHHHHHHHHHHHL-----LEEEEELHHHHL-------------


DSSP  leeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeEEEElllhhhHHHHHHL----
Query iritwstphpecsgeyladiaarwgcdkttaarrlapagAIYFamdedeVKRIFQH----  353
ident                                                   | |       
Sbjct ---------------------------------------PLCG--etypPKKIVTLasel  249
DSSP  ---------------------------------------LLLL--llllLHHHHHHhhhl


DSSP  -LLEEELLLLLLLllllllHHHHHHHHHHhHHHHhlllllhhhhhhhhlhhhhhhhllll
Query -PCCMVGSDGLPNdarphpRLWGSFTRVLgRYVRearlmtleqavarmtalparvfgfae  412
ident       |||                                                   
Sbjct qIPFVYGSDSHGV-----qDIGRGYSTYC-QKLE--------------------------  277
DSSP  lLLEEEELLLLLH-----hHLLLLHHHHH-HHLL--------------------------


DSSP  llllllllllleeeelllllllllllllllllllleeeeeelleeeelllllllllllll
Query rgvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvl  472
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lll
Query rax  475
ident    
Sbjct ---  277
DSSP  ---


No 56: Query=3giqA Sbjct=3f2bA Z-score=6.2

back to top
DSSP  ---------------------------------------------------lleeeeeel
Query ---------------------------------------------------ekldfkitg    9
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  leelllllllleeleeeeelleeeeeellllLLEEE-eeellllEEEELEEELLLLL---
Query gwiidgtgaprrradlgvrdgriaaigelgaHPARH-awdasgkIVAPGFIDVHGHD---   65
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIAanerqdtaPEGEKRVELHLHTpms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEELllllllllLLLLLLLLLLLLLlll


DSSP  -----lLHHHhlLLLHhhhlllEEEEEELLLLLLLLlllllllllhhhhhhllllllllh
Query -----dLMFVekPDLRwktsqgITTVVVGNCGVSAApaplpgntaaalallgetplfadv  120
ident                            |    |                           
Sbjct qmdavtSVTKliEQAK---kwgHPAIAVTDHAVVQS------------------------  153
DSSP  llllllLHHHhhHHHH---hllLLLEEELLLLLLLL------------------------


DSSP  hHHHHHHhHLLLlLEEEEEEehhhhhhhhlllllllllhhhhhhhhhhhhhhhhhlllee
Query pAYFAALdAQRPmINVAALVghanlrlaamrdpqaaptaaeqqamqdmlqaaleagavgf  180
ident                |                                            
Sbjct fPEAYSAaKKHG-MKVIYGL----------------------------------------  172
DSSP  hHHHHHHhHHHL-LLEEEEE----------------------------------------


DSSP  EEEL--------------------------------llLLHHhlLHHHHHHHHhhhhhLL
Query STGL--------------------------------ayQPGAvaQAAELEGLArvaaeRR  208
ident                                        |        |           
Sbjct EANIvddpfhvtllaqnetglknlfklvslshiqyfhrVPRI--PRSVLVKHR-----DG  225
DSSP  EEEEellleeeeeeellhhhhhhhhhhhhhhhllllllLLLE--EHHHHHHLL-----LL


DSSP  LEeeeelllllllhhhhhhhhhhhhhhhlleEEELL----LLLLlhhhlllhhhHHHHHH
Query RLhtshirneadgveaaveevlaigrgtgcaTVVSH----HKCMmpqnwgrsraTLANID  264
ident  |                                                          
Sbjct LL-----------------------------VGSGCdkgeLFDN----------VEDIAR  246
DSSP  EE-----------------------------EELLLllllLLLL----------LLLLHH


DSSP  hhhhllllEEEEELLLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlll
Query rareqgveVALDIYPYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcd  324
ident           |   |                                             
Sbjct ------fyDFLEVHPPDVY-----------------------------------------  259
DSSP  ------hlLLEEELLHHHH-----------------------------------------


DSSP  hhhhhhhhlleeeEEEL-----lLHHHHHHHHHLL-----LEEELLLLLL----LLLL--
Query kttaarrlapagaIYFA-----mDEDEVKRIFQHP-----CCMVGSDGLP----NDAR--  368
ident                               |                             
Sbjct -------------KPLYvkdeemIKNIIRSIVALGekldiPVVATGNVHYlnpeDKIYrk  306
DSSP  -------------LLLLlllhhhHHHHHHHHHHHHhhlllLEEELLLLLLllhhHHHHhh


DSSP  ----------------LLLHHHHhHHHHHHHHHhhllLLLHHHHHHHHLHHHHHHHLLll
Query ----------------PHPRLWGsFTRVLGRYVrearLMTLEQAVARMTALPARVFGFae  412
ident                             |            | |                
Sbjct ilihsqgganplnrheLPDVYFRtTNEMLDCFS----FLGPEKAKEIVVDNTQKIASL--  360
DSSP  hhhhllhhhlllllllLLLLLLLlHHHHHHHHH----HHHHHHHHHHHLHHHHHHHHL--


DSSP  llllllllllleeeelllllllllllllllllllleeeeeelleeeelllllllllllLL
Query rgvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqVL  472
ident                                                             
Sbjct ---------------------------------------------------------iGD  363
DSSP  ---------------------------------------------------------lLL


DSSP  LL----------------------------------------------------------
Query RA----------------------------------------------------------  474
ident                                                             
Sbjct VKpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviy  423
DSSP  LLlllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct lishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsv  483
DSSP  hhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct gsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvl  543
DSSP  llhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct fgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpgg  603
DSSP  hlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct iivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqd  663
DSSP  eeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct lsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpk  723
DSSP  hhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct tfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafki  783
DSSP  lhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct mesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhh  843
DSSP  hhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct pllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemc  903
DSSP  hhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  474
ident                                                             
Sbjct ergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlq  963
DSSP  hllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhh


DSSP  ------------------------------l
Query ------------------------------x  475
ident                                
Sbjct qrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhlllhhhhhhhhhllllllllllllllll


No 57: Query=3giqA Sbjct=3e38A Z-score=4.7

back to top
DSSP  lleeeeeelleelLLLLLlleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiiDGTGAprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                            |
Sbjct ----aqrrneiqvPDLDG-----------------------------------yTTLKCD   21
DSSP  ----lllllllllLLLLL-----------------------------------lEEEEEE


DSSP  LLLLL------lLHHHhlllLHHHHLLLEEEEEELllllllllllllllllHHHHhhlll
Query VHGHD------dLMFVekpdLRWKTSQGITTVVVGncgvsaapaplpgntaAALAllget  114
ident  | |           |           |                                
Sbjct FHXHSvfsdglvWPTV---rVDEAYRDGLDAISLT-------------ehiEYRP-hkqd   64
DSSP  LLLLLlllllllLHHH---hHHHHHHLLLLEELLE-------------eelLLLL-llll


DSSP  LLLLLHhHHHHHHHhLLLL---LEEEEEEEHHhhhhhhlllllllllhhhhhhhhhhhhh
Query PLFADVpAYFAALDaQRPM---INVAALVGHAnlrlaamrdpqaaptaaeqqamqdmlqa  171
ident          |            |                                     
Sbjct VVSDHN-RSFDLCR-EQAEklgILLIKGSEIT----------------------------   94
DSSP  LLLLLL-HHHHHHH-HHHHhhlLEELLEEEEE----------------------------


DSSP  hhhhllleeeeelllllHHHL---------------lhhHHHHHHHHHHHLLLEEEEELL
Query aleagavgfstglayqpGAVA---------------qaaELEGLARVAAERRRLHTSHIR  216
ident                   | |                        | |            
Sbjct -----------------RAXApghfnaiflsdsnpleqkDYKDAFREAKKQGAFXFWNHP  137
DSSP  -----------------LLLLlleeeeelllllhhhlllLHHHHHHHHHHLLLEEEELLL


DSSP  LLL----LLHHHhhHHHHHHHHHHLLEEEELLLllllhhhlllhhHHHHHHHHHHhllll
Query NEA----DGVEAavEEVLAIGRGTGCATVVSHHkcmmpqnwgrsrATLANIDRAReqgve  272
ident        |                ||                                  
Sbjct GWDsqqpDTTKW--WPEHTALYQEGCXHGIEVA-----nghlyxpEAIQWCLDKN-----  185
DSSP  LLLllllLLLLL--LHHHHHHHHLLLLLEEEEE-----elleellHHHHHHHHHL-----


DSSP  EEEEElllleeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhh
Query VALDIypypgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrl  332
ident                                                             
Sbjct LTXIG-------------------------------------------------------  190
DSSP  LEEEE-------------------------------------------------------


DSSP  lleeeeeelllhhhhhhhhhllleeeLLLLLLLllLLLL---hhHHHHhhhhhhhhhhll
Query apagaiyfamdedevkrifqhpccmvGSDGLPNdaRPHP---rlWGSFtrvlgryvrear  389
ident                            ||                               
Sbjct --------------------------TSDIHQP-iQTDYdfekgEHRT------------  211
DSSP  --------------------------ELLLLLL-hHHHLlhhhlLLLL------------


DSSP  lllhhhhhhhHLHHhhhhhlLLLL----------------------------------ll
Query lmtleqavarMTALparvfgFAER----------------------------------gv  415
ident                                                             
Sbjct --------xtFVFA--kersLQGIrealdnrrtaayfhelligredllrpffekcvkiee  261
DSSP  --------eeEEEE--llllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeee


DSSP  lllllllleeeelLLLLL---------------------lllllllllllllleeeeeel
Query lqpgawadvvvfdPDTVA---------------------dratwdeptlasvgiagvlvn  454
ident                |                                            
Sbjct vsrneqgvtlsitNVTDLvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdv  321
DSSP  eeeelleeeeeeeELLLLleeeeelllllleellleeeellleeeeeeeeelllllllee


DSSP  leeeellllllllllllllll
Query gaevfpqppadgrpgqvlrax  475
ident                      
Sbjct nfevtnfivapdkglkytisl  342
DSSP  eeeeeeeeeelleeeeeeeel


No 58: Query=3giqA Sbjct=2yb1A Z-score=4.3

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeelEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapgFID   60
ident                                                           ||
Sbjct --------------------------------------------------------aNID    4
DSSP  --------------------------------------------------------lLEE


DSSP  LLLLL------lLHHHhlllLHHHHLLLEEEEEELllLLLLLlllllllllhhhhhhlll
Query VHGHD------dLMFVekpdLRWKTSQGITTVVVGncGVSAApaplpgntaaalallget  114
ident  | |                                                        
Sbjct LHFHSrtsdgalTPTE---vIDRAAARAPALLALT-dHDCTG------------------   42
DSSP  LLLLLlllllllLHHH---hHHHHHLLLLLEEEEL-lLLLLL------------------


DSSP  lllllhhhHHHHhhhLLLL---LEEEEEEEHH--------------------------hH
Query plfadvpaYFAAldaQRPM---INVAALVGHA--------------------------nL  145
ident           |           |     |                               
Sbjct --------GLAE-aaAAAArrgIPFLNGVEVSvswgrhtvhivglgidpaepalaaglkS   93
DSSP  --------LHHH-hhHHHHhllLLEEEEEEEEeeelleeeeeeeellllllhhhhhhhhH


DSSP  HHHHLLL-----------------------------------------------------
Query RLAAMRD-----------------------------------------------------  152
ident                                                             
Sbjct IREGRLErarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvf  153
DSSP  HHLLHHHhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhh


DSSP  ----------lLLLLlhhhhhhhhhhhhhhhhhllleeeeelllllhhhllhhHHHHHHH
Query ----------pQAAPtaaeqqamqdmlqaaleagavgfstglayqpgavaqaaELEGLAR  202
ident                                                       ||    
Sbjct rkyltpgkpgyVSHQ------------------------------------waSLEDAVG  177
DSSP  hhlllllllllLLLL------------------------------------llLHHHHHH


DSSP  HHHHLLLEEEEE-LLLLLlLHHHHHHHHHHHHHHHlLEEEELllllllhhhlLLHHHHHH
Query VAAERRRLHTSH-IRNEAdGVEAAVEEVLAIGRGTgCATVVShhkcmmpqnwGRSRATLA  261
ident                          |                                  
Sbjct WIVGAGGMAVIAhPGRYD-MGRTLIERLILDFQAA-GGQGIE--vasgshslDDMHKFAL  233
DSSP  HHHHLLLEEEELlHHHLL-LLHHHHHHHHHHHHHL-LLLEEE--eeellllhHHHHHHHH


DSSP  HHHHHHhllllEEEEelllleeeeellhhhllllllleeeeelllhhhllllhhhhhhhh
Query NIDRAReqgveVALDiypypgsstiliperaetiddiritwstphpecsgeyladiaarw  321
ident   ||                                                        
Sbjct HADRHG-----LYAS---------------------------------------------  243
DSSP  HHHHHL-----LEEE---------------------------------------------


DSSP  lllhhhhhhhhlleeeeeelllhhhhhhhhhllleeELLLLLLllllLLLHHhhhhhhhh
Query gcdkttaarrlapagaiyfamdedevkrifqhpccmVGSDGLPndarPHPRLwgsftrvl  381
ident                                      |||       |            
Sbjct ------------------------------------SGSDFHA----PGEDV--------  255
DSSP  ------------------------------------EELLLLL----LLLLL--------


DSSP  hhhhhhlllllhhhhhhhhlhHHHHhHLLLlllllllllllleeeellllllllllllll
Query gryvrearlmtleqavarmtaLPARvFGFAergvlqpgawadvvvfdpdtvadratwdep  441
ident                         |    |                              
Sbjct ----------ghtedlppicrPIWR-ELEA------------------------------  274
DSSP  ----------lllllllllllLHHH-HLHH------------------------------


DSSP  lllllleeeeeELLEeeellllllllllllllll
Query tlasvgiagvlVNGAevfpqppadgrpgqvlrax  475
ident               |                   
Sbjct -------rilrPADA-----------------en  284
DSSP  -------hlllLLHH-----------------hl


No 59: Query=3giqA Sbjct=2anuA Z-score=4.1

back to top
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE
Query ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
ident                                                            |
Sbjct -----------------------------------------------------tEWLLCD    7
DSSP  -----------------------------------------------------lEEEEEE


DSSP  LLLLL------lLHHH-hlllLHHHhlllEEEEEELLLL--llllllllLLLLLHHHhhh
Query VHGHD------dLMFV-ekpdLRWKtsqgITTVVVGNCG--vsaapaplPGNTAAALall  111
ident  | |                            |                           
Sbjct FHVHTnxsdghlPLGEvvdlfGKHG----VDVVSITDHIvdrrtleqrkRNGEPLGA--i   61
DSSP  EEELLlllllllLHHHhhhhhHHLL----LLEEEEEEEEelhhhhhhhhHLLLLLLL--l


DSSP  lllllLLLHHHHHHHHhHLLL---LLEEEEEEehhhhhhhhlllllllllhhhhhhhhhh
Query getplFADVPAYFAALdAQRP---MINVAALVghanlrlaamrdpqaaptaaeqqamqdm  168
ident                                |                            
Sbjct tedkfQDYLKRLWREQ-KRAWeeyGXILIPGV----------------------------   92
DSSP  llllhHHHHHHHHHHH-HHHHhhhLLEEEEEE----------------------------


DSSP  hhhhhhhllleeEEELL---------lllhhhllHHHHHHHHHHHHHLLLEeeeelllll
Query lqaaleagavgfSTGLA---------yqpgavaqAAELEGLARVAAERRRLhtshirnea  219
ident                                       |       |   |         
Sbjct ------------EITNNtdlyhivavdvkeyvdpSLPVEEIVEKLKEQNAL---------  131
DSSP  ------------EEEELllleeeeeellllllllLLLHHHHHHHHHHLLLE---------


DSSP  llhhhhhhhhhhhhhhhlleEEELLL-LLLLhhhlllhhhhHHHHHHHHhlLLLEEEE-E
Query dgveaaveevlaigrgtgcaTVVSHH-KCMMpqnwgrsratLANIDRAReqGVEVALD-I  277
ident                         |                 ||  |        |    
Sbjct --------------------VIAAHPdRKKL------swylWANXERFK--DTFDAWEiA  163
DSSP  --------------------EEELLLlLLLL------llhhHHLLLLLL--LLLLEEEeE


DSSP  LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleee
Query YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapaga  337
ident                                                             
Sbjct NRDD--------------------------------------------------------  167
DSSP  ELLE--------------------------------------------------------


DSSP  eeelllhhhHHHHHH--LLLEEELLLLLlllllLLLHhHHHHhhhhhhhhhhlllllhhh
Query iyfamdedeVKRIFQ--HPCCMVGSDGLpndarPHPRlWGSFtrvlgryvrearlmtleq  395
ident                         ||              |                   
Sbjct ---------LFNSVGvkKYRYVANSDFH-----ELWH-VYSW------------------  194
DSSP  ---------ELHHHHhlLLLEEEELLLL-----LHHH-HLLE------------------


DSSP  hhhhHLHHhhhhhllLLLLllllllllleeeelllllLLLLllllllllllleeeeeell
Query avarMTALparvfgfAERGvlqpgawadvvvfdpdtvADRAtwdeptlasvgiagvlvng  455
ident                 |                      |                    
Sbjct ---kTLVK-------SEKN-ieaikeairkntdvaiyLXRK-------------------  224
DSSP  ---eEEEE-------ELLL-hhhhhhhhhhllleeeeELLL-------------------


DSSP  eeeellllllllllllllll
Query aevfpqppadgrpgqvlrax  475
ident                     
Sbjct --------------------  224
DSSP  --------------------