Results: dupa

Query: 3gg7A

MOLECULE: UNCHARACTERIZED METALLOPROTEIN;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3gg7-A 48.3  0.0  243   243  100 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
   2:  2y1h-B 30.5  2.2  239   265   23 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   3:  1bf6-A 18.2  3.0  218   291   16 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   4:  3cjp-A 17.4  3.0  206   262   18 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   5:  3k2g-B 17.4  3.0  223   358   16 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   6:  1k6w-A 17.2  3.6  222   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   7:  4cqb-A 17.2  3.5  223   402    7 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  2vun-A 16.7  3.0  208   385   17 PDB  MOLECULE: ENAMIDASE;                                                 
   9:  2ob3-A 16.7  3.4  220   329   18 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  10:  3irs-A 16.4  3.4  212   281   15 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  11:  2vc5-A 16.2  3.3  217   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  12:  3nqb-A 16.0  3.2  209   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  13:  3mtw-A 16.0  3.4  210   404   17 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  14:  3ls9-A 15.9  2.9  208   453   14 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  15:  2paj-A 15.9  3.1  207   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  16:  2oof-A 15.8  3.4  212   403   11 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  17:  2imr-A 15.6  3.2  202   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  18:  4hk5-D 15.5  3.5  215   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  19:  4dlf-A 15.5  3.2  206   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  20:  1j6p-A 15.3  3.1  210   407   10 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  21:  1gkp-A 15.1  3.2  216   458   13 PDB  MOLECULE: HYDANTOINASE;                                              
  22:  3icj-A 15.1  3.1  204   468   15 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  23:  3mkv-A 15.0  3.3  204   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  24:  2uz9-A 14.7  2.9  208   444   12 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  25:  4b3z-D 14.6  3.4  219   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  26:  2ffi-A 14.6  3.2  208   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  27:  3pnu-A 14.4  3.5  209   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  28:  4c5y-A 14.4  3.4  205   436   10 PDB  MOLECULE: OCHRATOXINASE;                                             
  29:  4mup-B 14.3  3.2  204   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  30:  2ogj-A 14.2  3.1  216   379   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  31:  3qy6-A 14.1  2.9  183   247   16 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  32:  4ofc-A 14.1  3.5  208   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  33:  1onx-A 13.9  3.1  213   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  34:  2gwg-A 13.8  3.9  215   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  35:  2dvt-A 13.8  3.7  209   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  36:  1yrr-B 13.6  3.4  205   334   14 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  37:  3gri-A 13.5  3.4  214   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  38:  1a4m-A 13.5  3.2  213   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  39:  2qpx-A 13.2  3.8  211   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  40:  3giq-A 13.1  3.3  209   475   17 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  41:  4rdv-B 12.9  3.4  206   451   10 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  42:  4qrn-A 12.8  3.3  203   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  43:  1itq-A 12.6  3.7  220   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  44:  1a5k-C 12.5  3.4  203   566   13 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  3e74-A 12.4  3.4  206   429   10 PDB  MOLECULE: ALLANTOINASE;                                              
  46:  4dzi-C 12.3  3.8  208   388   16 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  47:  3iac-A 12.1  3.7  216   469   15 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  1j5s-A 12.1  3.5  211   451    9 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  1v77-A 11.5  3.1  168   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  50:  2a3l-A 11.2  3.5  215   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  3ooq-A 11.1  3.4  185   384   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  52:  3au2-A 10.6  3.3  166   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3dcp-A 10.0  2.8  159   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  9.5  3.2  158   234    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  8.3  3.5  165   994   10 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2yb1-A  7.3  3.6  153   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  57:  2anu-A  6.5  3.2  137   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  1bks-A  6.1  3.5  153   255   14 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  59:  3e38-A  6.1  3.6  145   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3gg7A Sbjct=3gg7A Z-score=48.3

back to top
DSSP  LLEEEEELHHHLLLHHHHHHHHHHLLLEEEELLLLHHHHHHHHHHHLLLLLEEELLLLLH
Query SLIDFHVHLDLYPDPVAVARACEERQLTVLSVTTTPAAWRGTLALAAGRPHVWTALGFHP   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SLIDFHVHLDLYPDPVAVARACEERQLTVLSVTTTPAAWRGTLALAAGRPHVWTALGFHP   60
DSSP  LLEEEEELHHHLLLHHHHHHHHHHLLLEEEELLLLHHHHHHHHHHHLLLLLEEELLLLLH


DSSP  HHLLLLHHHLHHHHHHHHHLLEEEEEELLLLHHHHHHHHHHHHHHHHHHHHHHHLLLEEE
Query EVVSERAADLPWFDRYLPETRFVGEVGLDGSPSLRGTWTQQFAVFQHILRRCEDHGGRIL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EVVSERAADLPWFDRYLPETRFVGEVGLDGSPSLRGTWTQQFAVFQHILRRCEDHGGRIL  120
DSSP  HHLLLLHHHLHHHHHHHHHLLEEEEEELLLLHHHHHHHHHHHHHHHHHHHHHHHLLLEEE


DSSP  EEELLLLHHHHHHHHHHLHHHEEEEEELLLLLHHHHHHHHHLLLEEEELHHHHLLHHHHH
Query SIHSRRAESEVLNCLEANPRSGTPILHWYSGSVTELRRAISLGCWFSVGPTMVRTQKGAA  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SIHSRRAESEVLNCLEANPRSGTPILHWYSGSVTELRRAISLGCWFSVGPTMVRTQKGAA  180
DSSP  EEELLLLHHHHHHHHHHLHHHEEEEEELLLLLHHHHHHHHHLLLEEEELHHHHLLHHHHH


DSSP  HHHHLLHHHEEELLLLLLLEELLEELLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHH
Query LIRSMPRDRVLTETDGPFLELDGQAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRL  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LIRSMPRDRVLTETDGPFLELDGQAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRL  240
DSSP  HHHHLLHHHEEELLLLLLLEELLEELLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHH


DSSP  HHL
Query LGT  243
ident |||
Sbjct LGT  243
DSSP  HHL


No 2: Query=3gg7A Sbjct=2y1hB Z-score=30.5

back to top
DSSP  --LLEEEEELHHHLL---LHHHHHHHHHHLLL-EEEELLLLHHHHHHHHHHHLLL-LLEE
Query --SLIDFHVHLDLYP---DPVAVARACEERQL-TVLSVTTTPAAWRGTLALAAGR-PHVW   53
ident    | | | ||       |   |              |            |       | 
Sbjct gvGLVDCHCHLSAPDfdrDLDDVLEKAKKANVvALVAVAEHSGEFEKIMQLSERYnGFVL   60
DSSP  llLEEEEEELLLLHHhllLHHHHHHHHHHLLEeEEEELLLLHHHHHHHHHHHHHLlLLEE


DSSP  ELLLLLHHH------LLLLHhhLHHHHHHHH----HLLEEEEEELLLLHHHHH---HHHH
Query TALGFHPEV------VSERAadLPWFDRYLP----ETRFVGEVGLDGSPSLRG---TWTQ  100
ident   || ||        |      |                 |||||| ||   |       
Sbjct PCLGVHPVQgldqrsVTLKD--LDVALPIIEnykdRLLAIGEVGLDFSPRFAGtgeQKEE  118
DSSP  EEELLLLEElllleeLLHHH--HHHHHHHHHhhllLLLEEEEEEEELLLLLLLlhhHHHH


DSSP  HHHHHHHHHHHHHHLlLEEEEEELLLLHHHHHHHHHHLHhHEEEEEELLLLLHHHHHHHH
Query QFAVFQHILRRCEDHgGRILSIHSRRAESEVLNCLEANPrSGTPILHWYSGSVTELRRAI  160
ident |  |                  ||| |     | |          ||   |         
Sbjct QRQVLIRQIQLAKRL-NLPVNVHSRSAGRPTINLLQEQG-AEKVLLHAFDGRPSVAMEGV  176
DSSP  HHHHHHHHHHHHHHH-LLLEEEEEELLHHHHHHHHHHLL-LLLEEEELLLLLHHHHHHHH


DSSP  HLLLEEEELHHHHLLHHHHHHHHHLLHHHEEELLLLLLLE-ELLEELLHHHHHHHHHHHH
Query SLGCWFSVGPTMVRTQKGAALIRSMPRDRVLTETDGPFLE-LDGQAALPWDVKSVVEGLS  219
ident   |  ||  |   |      |    |      ||| | |         ||      |   
Sbjct RAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGpEKQVRNEPWNISISAEYIA  236
DSSP  HLLLEEEELHHHHLLHHHHHHHHHLLHHHEEELLLLLLLLlLLLLLLLHHHHHHHHHHHH


DSSP  HHHLLLHHHHHHHHHHHHHHHHHL-----
Query KIWQIPASEVERIVKENVSRLLGT-----  243
ident     |   ||      |   |        
Sbjct QVKGISVEEVIEVTTQNALKLFPKlrhll  265
DSSP  HHHLLLHHHHHHHHHHHHHHHLLLhhhhl


No 3: Query=3gg7A Sbjct=1bf6A Z-score=18.2

back to top
DSSP  -----LLEEEEELHHH------------LLLHHHHHHHHHHLL----LEEEELLlLHHHh
Query -----SLIDFHVHLDL------------YPDPVAVARACEERQ----LTVLSVTtTPAAw   39
ident           | ||                                   |   |      
Sbjct sfdptGYTLAHEHLHIdlsgfknnvdcrLDQYAFICQEMNDLMtrgvRNVIEMT-NRYM-   58
DSSP  lllllLEEEEEELLLEelhhhhllhhheELLHHHHHHHHHHHHhlleEEEEELL-LHHH-


DSSP  hHHHHHHLLLL-----LEEELLLLLHH-HLLLLHH------hlHHHHHHHH--------H
Query rGTLALAAGRP-----HVWTALGFHPE-VVSERAA------dlPWFDRYLP--------E   79
ident                  |    |        |  |                         
Sbjct gRNAQFMLDVMretgiNVVACTGYYQDaFFPEHVAtrsvqelaQEMVDEIEqgidgtelK  118
DSSP  lLLHHHHHHHHhhhllEEEEEELLLLHhHLLLHHHhllhhhhhHHHHHHHHllllllllL


DSSP  LLEEEEEELLLLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL--LLHHHHHHHHHH
Query TRFVGEVGLDGSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR--RAESEVLNCLEA  137
ident      | |                ||           ||  | |        | |  | |
Sbjct AGIIAEIGTSEG----kiTPLEEKVFIAAALAHNQT-GRPISTHTSfsTMGLEQLALLQA  173
DSSP  EEEEEEEELLLL----llLHHHHHHHHHHHHHHHHH-LLLEEEELHhhLLHHHHHHHHHH


DSSP  LHH-heEEEEELLL--lLHHHHHHHHHLLLEEE-ELHH---hhLLHHHHHHHHHL----L
Query NPR-sgTPILHWYS--gSVTELRRAISLGCWFS-VGPT---mvRTQKGAALIRSM----P  186
ident                          | ||                 |  |          
Sbjct HGVdlsRVTVGHCDlkdNLDNILKMIDLGAYVQfDTIGknsyyPDEKRIAMLHALrdrgL  233
DSSP  LLLlhhHEEELLLLlllLHHHHHHHHHLLLEEEeLLLLlllllLHHHHHHHHHHHhhllL


DSSP  HHHEEELLLLLL---leelLEELLhHHHH-HHHHHHHHhHLLLhHHHHHHH-HHHHHHHH
Query RDRVLTETDGPF---leldGQAALpWDVK-SVVEGLSKiWQIPaSEVERIV-KENVSRLL  241
ident   ||    |          |               |                 || |   
Sbjct LNRVMLSMDITRrshlkanGGYGY-DYLLtTFIPQLRQ-SGFS-QADVDVMlRENPSQFF  290
DSSP  HHHEEELLLLLLhhhlhhhLLLLL-LHHHhLHHHHHHH-LLLL-HHHHHHHhLHHHHHHL


DSSP  Hl
Query Gt  243
ident   
Sbjct Q-  291
DSSP  L-


No 4: Query=3gg7A Sbjct=3cjpA Z-score=17.4

back to top
DSSP  LLEEEEELHhhlllHHHHhHHHHHLL-----LEEEELLL---------------------
Query SLIDFHVHLdlypdPVAVaRACEERQ-----LTVLSVTT---------------------   34
ident   || | |         |                    |                     
Sbjct LIIDGHTHV-----ILPV-EKHIKIMdeagvDKTILFSTsihpetavnlrdvkkemkkln   54
DSSP  LLEEEEEEL-----LLLH-HHHHHHHhhhllLEEEEELLlllhhhlllhhhhhhhhhhhh


DSSP  -------------LHHHHHHHHHHHLLL-LLEEELLLLLHhhllllHHHL-HHHHHHHH-
Query -------------TPAAWRGTLALAAGR-PHVWTALGFHPevvserAADL-PWFDRYLP-   78
ident                                                 |           
Sbjct dvvngktnsmidvRRNSIKELTNVIQAYpSRYVGFGNVPV---glsENDTnSYIEENIVn  111
DSSP  hhhlllllllhhhHHHHHHHHHHHHHHLlLLEEEEELLLL---lllHHHHhHHHHHHLLl


DSSP  -HLLEEEEEELLLLhhhhhhhhHHHHhHHHHHHHHHHLLLEEEEEELLL-----LHHHHH
Query -ETRFVGEVGLDGSpslrgtwtQQFAvFQHILRRCEDHGGRILSIHSRR-----AESEVL  132
ident       ||              |       |     | |     ||           |  
Sbjct nKLVGIGELTPASG--------QIKS-LKPIFKYSMDSGSLPIWIHAFNplvlqDIKEIA  162
DSSP  lLLLEEEEELLLLL--------LHHH-HHHHHHHHHHLLLLLEEELLLLlllhhHHHHHH


DSSP  HHHHHLHHhEEEEEEL-LLLL-HHHHHHHHHLL-LEEEELHHHhLLHHHHHHHHHLlHHH
Query NCLEANPRsGTPILHW-YSGS-VTELRRAISLG-CWFSVGPTMvRTQKGAALIRSMpRDR  189
ident     | |     ||         |    |                |      |       
Sbjct ELCKAFPK-VPVILGHmGGSNwMTAVELAKEIQnLYLDTSAYF-STFVLKIVINEL-PLK  219
DSSP  HHHHHLLL-LLEEEHHhHHHHhHHHHHHHHHLLlEEEELLLLL-LHHHHHHHHHHL-LLL


DSSP  EEELLLLLLLeelleellhhHHHHHHHHHHHHHLLLhhHHHHH-HHHHHHHHHHl
Query VLTETDGPFLeldgqaalpwDVKSVVEGLSKIWQIPasEVERI-VKENVSRLLGt  243
ident     || ||           |     |   |        |       | ||||  
Sbjct CIFGTDMPFG----------DLQLSIEAIKKMSNDS--YVANAvLGDNISRLLNi  262
DSSP  EELLLLLLLL----------LHHHHHHHHHHHLLLH--HHHHHhHLHHHHHHHLl


No 5: Query=3gg7A Sbjct=3k2gB Z-score=17.4

back to top
DSSP  ---------------------------LLEEEEELHHH----------------------
Query ---------------------------SLIDFHVHLDL----------------------   11
ident                                 | ||                        
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhlll


DSSP  --------------------LLLH---HHHHHHHHHLLL-EEEELLLL-hhHHHHHHH-H
Query --------------------YPDP---VAVARACEERQL-TVLSVTTT-paAWRGTLA-L   45
ident                       |     |                |          |   
Sbjct sieilselrqdpfvnkhniaLDDLdlaIAEVKQFAAVGGrSIVDPTCRgigRDPVKLRrI  120
DSSP  lhhhhhhhhllhhhllllleELLHhhhHHHHHHHHHLLLlEEEELLLLlllLLHHHHHhH


DSSP  HLL-LLLEEELLLLLHH-HLLLLHH------hlHHHHHHHH--------HLLEEEEEELL
Query AAG-RPHVWTALGFHPE-VVSERAA------dlPWFDRYLP--------ETRFVGEVGLD   89
ident  |     |    |        | ||                             || |  
Sbjct SAEtGVQVVXGAGYYLAsSXPETAArlsaddiaDEIVAEALegtdgtdaRIGLIGEIGVS  180
DSSP  HHHhLLEEEELLLLLLHhHLLHHHHlllhhhhhHHHHHHHHllllllllLLLLEEEELLL


DSSP  LLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL---LLHHHHHHHHHHLHHH-eEEE
Query GSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR---RAESEVLNCLEANPRS-gTPI  145
ident                     |      |  |  |     |    ||   |          
Sbjct SD-----fTAEEEKSLRGAARAQVRT-GLPLXVHLPgwfRLAHRVLDLVEEEGADlrHTV  234
DSSP  LL-----lLHHHHHHHHHHHHHHHHH-LLLEEELLLlllLLHHHHHHHHHHLLLLhhHEE


DSSP  EELLLL---LHHHHHHHHHLLLEEE-ELHH-----------hhLLHHHHHHHHHL----L
Query LHWYSG---SVTELRRAISLGCWFS-VGPT-----------mvRTQKGAALIRSM----P  186
ident |                   |                           |  |        
Sbjct LCHXNPshxDPVYQATLAQRGAFLEfDXIGxdffyadqgvqcpSDDEVARAILGLadhgY  294
DSSP  ELLLHHhllLHHHHHHHHHHLLEEEeLLLLllleelllleellLHHHHHHHHHHHhhllL


DSSP  HHHEEELLLLLLleelLEEL------LHHHHH-HHHHHHHHHHLLlhHHHHHHH-HHHHH
Query RDRVLTETDGPFleldGQAA------LPWDVK-SVVEGLSKIWQIpaSEVERIV-KENVS  238
ident  || |   |                     |       |                  |  
Sbjct LDRILLSHDVFV----KXXLtryggnGYAFVTkHFLPRLRRHGLD--DAALETLxVTNPR  348
DSSP  HHHEEELLLLLL----HHHLhhhlllLLLHHHhLHHHHHHHLLLL--HHHHHHHhLHHHH


DSSP  HHHHL-----
Query RLLGT-----  243
ident |         
Sbjct RVFDAsiegh  358
DSSP  HHHLLlllll


No 6: Query=3gg7A Sbjct=1k6wA Z-score=17.2

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------SLIDFHVH    8
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL


DSSP  HHHLL----------------------------------LHHHHHHHHHHLLL-EEEELL
Query LDLYP----------------------------------DPVAVARACEERQL-TVLSVT   33
ident ||                                                     |    
Sbjct LDTTQtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIqHVRTHV  120
DSSP  LLLLLllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEeEEEEEE


DSSP  LLHH----HHHHHHHHHLLL---LLEEELLLLLhHHLLLLHHHLHHHHHHHH-HLLEEEe
Query TTPA----AWRGTLALAAGR---PHVWTALGFHpEVVSERAADLPWFDRYLP-ETRFVGe   85
ident         |    |                    |               |      || 
Sbjct DVSDatltALKAMLEVKQEVapwIDLQIVAFPQ-EGILSYPNGEALLEEALRlGADVVG-  178
DSSP  ELLLlllhHHHHHHHHHHHHlllLEEEEEEELL-LLLLLLLLHHHHHHHHHHlLLLEEE-


DSSP  EELLllhhhhHHHHHHHHHHHHHHHHHHHLlLEEEEEELL-------LLHHHHHHHHHHL
Query VGLDgspslrGTWTQQFAVFQHILRRCEDHgGRILSIHSR-------RAESEVLNCLEAN  138
ident            |                    |    |         |    |       
Sbjct AIPH----feFTREYGVESLHKTFALAQKY-DRLIDVHCDeiddeqsRFVETVAALAHHE  233
DSSP  ELHH----hlLLHHHHHHHHHHHHHHHHHH-LLEEEEEELlllllllLHHHHHHHHHHHH


DSSP  HHheEEEEELLLL--------LHHHHHHHHHLLLEEEEL-HHHHL----------LHHHh
Query PRsgTPILHWYSG--------SVTELRRAISLGCWFSVG-PTMVR----------TQKGa  179
ident                           |     |  |                        
Sbjct GMgaRVTASHTTAmhsyngayTSRLFRLLKMSGINFVANpLVNIHlqgrfdtypkRRGI-  292
DSSP  LLhhHEEEEELHHhhhllhhhHHHHHHHHHHHLLEEEELhHHHHHhlllllllllLLLL-


DSSP  hHHHHLL--hhHEEELLLLL---LLEElleeLLHHhHHHHHHHHHH-HHLL---LHHHhH
Query aLIRSMP--rdRVLTETDGP---FLELdgqaALPWdVKSVVEGLSK-IWQI---PASEvE  230
ident      |      |    |        |            |                    
Sbjct tRVKEMLesgiNVCFGHDDVfdpWYPL----GTAN-MLQVLHMGLHvCQLMgygQIND-G  346
DSSP  lLHHHHHhlllLEEELLLLLlllLLLL----LLLL-HHHHHHHHHHhLLLLlhhHHHH-H


DSSP  HHH-HHHHHH-HHHL---------------------------------------------
Query RIV-KENVSR-LLGT---------------------------------------------  243
ident          | |                                                
Sbjct LNLiTHHSARtLNLQdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqp  406
DSSP  HHHhLHHHHHhLLLLllllllllllleeeellllhhhhhhhllllleeeelleeeeelll


DSSP  -----------------
Query -----------------  243
ident                  
Sbjct aqttvyleqpeaidykr  423
DSSP  lleeeellleeeellll


No 7: Query=3gg7A Sbjct=4cqbA Z-score=17.2

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------SLIDFHV    7
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  LHHHLL--------------------------------------LHHHHHHHHHHLLL-E
Query HLDLYP--------------------------------------DPVAVARACEERQL-T   28
ident | |                                              |          
Sbjct HMDKSFtstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTlY  120
DSSP  LHHHLLllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEeE


DSSP  EEELLLL-----hHHHHHHHHHHLLL---LLEEELLLLLhHHLLLLHHHLHHHHHHHH-H
Query VLSVTTT-----pAAWRGTLALAAGR---PHVWTALGFHpEVVSERAADLPWFDRYLP-E   79
ident               |    |                                    |   
Sbjct TRTHVDVdsvaktKAVEAVLEAKEELkdlIDIQVVAFAQ-SGFFVDLESESLIRKSLDmG  179
DSSP  EEEEEELllllllHHHHHHHHHHHHLlllLEEEEEEELL-LLLLLLLLHHHHHHHHHHhL


DSSP  LLEEEeEELLLLhhhhhHHHHHHHHHHHHHHHHHHLlLEEEEEELLL-------LHHHHH
Query TRFVGeVGLDGSpslrgTWTQQFAVFQHILRRCEDHgGRILSIHSRR-------AESEVL  132
ident    ||                                      |                
Sbjct CDLVG-GVDPAT-----RENNVEGSLDLCFKLAKEY-DVDIDYHIHDigtvgvySINRLA  232
DSSP  LLEEE-LLLLLL-----LLLLHHHHHHHHHHHHHHL-LLEEEEEELLlhhhhhhHHHHHH


DSSP  HHHHHLHHheEEEEELLLL--------LHHHHHHHHHLLLEEEE-LHHHhlLHHHhhHHH
Query NCLEANPRsgTPILHWYSG--------SVTELRRAISLGCWFSV-GPTMvrTQKGaaLIR  183
ident      |                                |  |                  
Sbjct QKTIENGYkgRVTTSHAWCfadapsewLDEAIPLYKDSGMKFVTcFSST--PPTM--PVI  288
DSSP  HHHHHLLLllLEEEEELLHhhhllhhhHHHHHHHHHHHLLEEEEeLLLL--LLLL--LHH


DSSP  HLL--HHHEEELLLLL---LLEElleeLLHHhHHHHHHHHHH-HHLL---LHHHHHHHHH
Query SMP--RDRVLTETDGP---FLELdgqaALPWdVKSVVEGLSK-IWQI---PASEVERIVK  234
ident              |                                              
Sbjct KLLeaGINLGCASDNIrdfWVPF----GNGD-MVQGALIETQrLELKtnrDLGLIWKMIT  343
DSSP  HHHhlLLEEEEELLLLlllLLLL----LLLL-HHHHHHHHHHhHLLLlhhHHHHHHHHHL


DSSP  HHHHH--HHHL------------------------------------------------
Query ENVSR--LLGT------------------------------------------------  243
ident     |                                                      
Sbjct SEGARvlGIEKnygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  HHHHHhhLLHHhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 8: Query=3gg7A Sbjct=2vunA Z-score=16.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEEEEELHHHLLLH-----hHHHHHHHHLLL-EEEELLL------------LHHHHHHH
Query SLIDFHVHLDLYPDP-----vAVARACEERQL-TVLSVTT------------TPAAWRGT   42
ident  | | |||                         |  |               | |     
Sbjct GLLDTHVHVSGGDYAprqktmDFISSALHGGVtTMISAGSphfpgrpkdaagTKALAITL  120
DSSP  LEEEEEELLLLLLEEhhhleeLHHHHHHLLLEeEEEELLLlllllllllhhhHHHHHHHH


DSSP  H-HHHLLL---LLEEE-LLLLlhhhlllLHHHL-HHHHHHHH-HLLEEEEEEllllhhhh
Query L-ALAAGR---PHVWT-ALGFhpevvseRAADL-PWFDRYLP-ETRFVGEVGldgspslr   95
ident        |     |   |                  |          |||||        
Sbjct SkSYYNARpagVKVHGgAVIL-------EKGLTeEDFIEMKKeGVWIVGEVG--------  165
DSSP  HhHHHHLLhhhLEEELlEELL-------LLLLLhHHHHHHHHlLLLEEEEEL--------


DSSP  hhhhhHHHHHHHHHHHHHHLlLEEEEEELL--------LLHH-HHHHHHhhlhhheEEEE
Query gtwtqQFAVFQHILRRCEDHgGRILSIHSR--------RAES-EVLNCLeanprsgTPIL  146
ident                    | |     |                |               
Sbjct lgtikNPEDAAPMVEWAHKH-GFKVQMHTGgtsipgssTVTAdDVIKTK-------PDVV  217
DSSP  lllllLHHHHHHHHHHHHHL-LLEEEEELLllllllllLLLHhHHHHHL-------LLEE


DSSP  ELL-----LLLHHHHHHHH-HLLLEEEELHHHhLLHHHHHHHHHL----LHHHEEELLLL
Query HWY-----SGSVTELRRAI-SLGCWFSVGPTMvRTQKGAALIRSM----PRDRVLTETDG  196
ident           || |  |                         |         ||    | 
Sbjct SHInggptAISVQEVDRIMdETDFAMEIVQCG-NPKIADYVARRAaekgQLGRVIFGNDA  276
DSSP  ELLlllllLLLHHHHHHHHhHLLLEEEEELLL-LHHHHHHHHHHHhhhlLHHHEEEELLL


DSSP  LLLEelleELLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHH--------------
Query PFLEldgqAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRLLG--------------  242
ident |          |               |           |     |              
Sbjct PSGT----GLIPLGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGlntgviapgkeadl  332
DSSP  LLLL----LLLLLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLllllllllllllle


DSSP  ----------------------------------------------------l
Query ----------------------------------------------------t  243
ident                                                      
Sbjct iimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  eeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 9: Query=3gg7A Sbjct=2ob3A Z-score=16.7

back to top
DSSP  ---------------LLEEEEELHHH-------------------lLLHHHHHHHHHHLL
Query ---------------SLIDFHVHLDL-------------------yPDPVAVARACEERQ   26
ident                     | |                          |   |      
Sbjct drintvrgpitiseaGFTLTHEHICGssagflrawpeffgsrkalaEKAVRGLRRARAAG   60
DSSP  lleeelleeelhhhhLLEEEEELLEEllllhhhhlhhhhllhhhhhHHHHHHHHHHHHLL


DSSP  L-EEEELLLLHHHHhHHHHHHLLL----LLEEELLLLLhHHLL-LLHH-----hlHHHHH
Query L-TVLSVTTTPAAWrGTLALAAGR----PHVWTALGFHpEVVS-ERAA-----dlPWFDR   75
ident   |   | |          ||        |   | |                     | |
Sbjct VrTIVDVSTFDIGR-DVSLLAEVSraadVHIVAATGLW-FDPPlSMRLrsveeltQFFLR  118
DSSP  LlEEEELLLHHHLL-LHHHHHHHHhhhlLEEELEEELL-LLLLhHHHLllhhhhhHHHHH


DSSP  HHH--------HLLEEEeEELLLLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL--
Query YLP--------ETRFVGeVGLDGSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR--  125
ident                   |   |          |  |     |      |     |    
Sbjct EIQygiedtgiRAGIIX-VATTGK-----aTPFQELVLKAAARASLAT-GVPVTTHTAas  171
DSSP  HHHllllllllLLLEEE-EELLLL-----lLHHHHHHHHHHHHHHHHH-LLLEEEELLhh


DSSP  -LLHHHHHHHHHHLHH-heEEEEELL-LLLH-HHHHHHHHLLLEEE-ELHH---------
Query -RAESEVLNCLEANPR-sgTPILHWY-SGSV-TELRRAISLGCWFS-VGPT---------  171
ident  |         |                      |      |                  
Sbjct qRDGEQQAAIFESEGLspsRVCIGHSdDTDDlSYLTALAARGYLIGlDHIPysaigledn  231
DSSP  hLHHHHHHHHHHHLLLlhhHEEELLHhHLLLhHHHHHHHHLLLEEEeLLLLlllllllll


DSSP  --------hhLLHHHHHHHHHL----LHHHEEELLLLL----------lleELLEE-lLH
Query --------mvRTQKGAALIRSM----PRDRVLTETDGP----------fleLDGQA-aLP  208
ident             |  | ||            |   |                |       
Sbjct asasallgirSWQTRALLIKALidqgYMKQILVSNDWTfgfssyvtnimdvMDRVNpdGM  291
DSSP  hhhhhhhlllLHHHHHHHHHHHhhllLHHHEEELLLLLleellllllhhhhHHHHLllHH


DSSP  HHHH-HHHHHHHHhHLLLhHHHHHHH-HHHHHHHHHL---
Query WDVK-SVVEGLSKiWQIPaSEVERIV-KENVSRLLGT---  243
ident       |   |      |  |        |  | |     
Sbjct AFIPlRVIPFLRE-KGVP-QETLAGItVTNPARFLSPtlr  329
DSSP  HHHHhLHHHHHHH-LLLL-HHHHHHHhLHHHHHHHLLlll


No 10: Query=3gg7A Sbjct=3irsA Z-score=16.4

back to top
DSSP  -LLEEEEELHHH-------------------------------lLLHHHHHHHHHHLLL-
Query -SLIDFHVHLDL-------------------------------yPDPVAVARACEERQL-   27
ident    |||                                                      
Sbjct lKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIe   60
DSSP  lLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLl


DSSP  EEEELLLL-----hhHHHHHHHHHLLL-LLEEELLLLlhhHLLLlHHHL-HHHHHHHH-H
Query TVLSVTTT-----paAWRGTLALAAGR-PHVWTALGFhpeVVSErAADL-PWFDRYLP-E   79
ident     |                | |                                |   
Sbjct QGVCVGRNssvlgsvSNADVAAVAKAYpDKFHPVGSI---EAAT-RKEAmAQMQEILDlG  116
DSSP  EEEEELLEellleelLHHHHHHHHHHLlLLEEEEEEL---LLLL-HHHHhHHHHHHHHlL


DSSP  LLEEEeEELLllhhhhHHHH-hhHHHHHHHHHHHHHlLLEEEEEELL---------LLHH
Query TRFVGeVGLDgspslrGTWT-qqFAVFQHILRRCEDhGGRILSIHSR---------RAES  129
ident  | |             |               |||  |                     
Sbjct IRIVN-LEPG----vwATPMhvdDRRLYPLYAFCED-NGIPVIMMTGgnagpdityTNPE  170
DSSP  LLLEE-ELHH----hlLLLLlllLHHHHHHHHHHHH-LLLLEEEELLllllllhhhHLHH


DSSP  HHHHHHHHLHHhEEEEEEL-LLLL-HHHHHHHHHLL-LEEEELHHHHLLHHHHHHHHHL-
Query EVLNCLEANPRsGTPILHW-YSGS-VTELRRAISLG-CWFSVGPTMVRTQKGAALIRSM-  185
ident      |   |   |                 |        |           |  |    
Sbjct HIDRVLGDFPD-LTVVSSHgNWPWvQEIIHVAFRRPnLYLSPDMYLYNLPGHADFIQAAn  229
DSSP  HHHHHHHHLLL-LLEEEEHhHLLLhHHHHHHHHHLLlEEEELHHHHLLLLLHHHHHHHHl


DSSP  --LHHHEEELLLLLLleelleeLLHH-HHHHHHHhhHHHHlllhHHHHHHH-HHHHHHHH
Query --PRDRVLTETDGPFleldgqaALPW-DVKSVVEglSKIWqipaSEVERIV-KENVSRLL  241
ident     || |  |  |                        |               |  |||
Sbjct sfLADRMLFGTAYPM-------CPLKeYTEWFLT--LPIK----PDAMEKIlHGNAERLL  276
DSSP  lhHHHLLLLLLLLLL-------LLHHhHHHHHHL--LLLL----HHHHHHHhLHHHHHHH


DSSP  HL---
Query GT---  243
ident      
Sbjct AQagr  281
DSSP  HHlll


No 11: Query=3gg7A Sbjct=2vc5A Z-score=16.2

back to top
DSSP  ----------------LLEEEEELHHH------------------lLLHHHHHHHHHHLL
Query ----------------SLIDFHVHLDL------------------yPDPVAVARACEERQ   26
ident                      | ||                        |          
Sbjct mriplvgkdsieskdiGFTLIHEHLRVfseavrqqwphlynedeefRNAVNEVKRAMQFG   60
DSSP  llllllllllllhhhlLLEELLLLLLLllhhhhhhlhhhllhhhhhHHHHHHHHHHHHLL


DSSP  L-EEEELLLL-hHHHHHHH-HHHL-LLLLEEELLLLLHHHLLL-------lhhhlHHHHH
Query L-TVLSVTTT-pAAWRGTL-ALAA-GRPHVWTALGFHPEVVSE-------raadlPWFDR   75
ident   |    |                          |                      |  
Sbjct VkTIVDPTVMglGRDIRFMeKVVKaTGINLVAGTGIYIYIDLPfyflnrsideiaDLFIH  120
DSSP  LlEEEELLLLllLLLHHHHhHHHHlLLLEEEELEELLLLLLLLhhhllllhhhhhHHHHH


DSSP  HHH--------HLLEEEeEELLLLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL--
Query YLP--------ETRFVGeVGLDGSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR--  125
ident               ||     |              |                  ||   
Sbjct DIKegiqgtlnKAGFVX-IAADEP----giTKDVEKVIRAAAIANKET-KVPIITHSNah  174
DSSP  HHHllllllllLLLLEE-EELLLL----llLHHHHHHHHHHHHHHHHH-LLLEEEELLll


DSSP  -LLHHHHHHHHHHLHH-heEEEEELL--LLLHHHHHHHHHLLLEEEELHH----hhLLHH
Query -RAESEVLNCLEANPR-sgTPILHWY--SGSVTELRRAISLGCWFSVGPT----mvRTQK  177
ident      |    |                              |                 |
Sbjct nNTGLEQQRILTEEGVdpgKILIGHLgdTDNIDYIKKIADKGSFIGLDRYgldlflPVDK  234
DSSP  lLHHHHHHHHHHHLLLlhhHEEELLHhhLLLHHHHHHHHHLLLEEEELLLllllllLHHH


DSSP  HHHHHHHL----LHHHEEELLLLL-----------lleeLLEELLHHHHH-HHHHHHHHh
Query GAALIRSM----PRDRVLTETDGP-----------flelDGQAALPWDVK-SVVEGLSKi  221
ident               |      |                                  |   
Sbjct RNETTLRLikdgYSDKIMISHDYCctidwgtakpeykpkLAPRWSITLIFeDTIPFLKR-  293
DSSP  HHHHHHHHhhllLLLLEEELLLLLlllllllllhhhhhhHLLLLLLLHHHhLHHHHHHL-


DSSP  HLLLhHHHHHHH-HHHHHHHHHl
Query WQIPaSEVERIV-KENVSRLLGt  243
ident       ||     |||       
Sbjct NGVN-EEVIATIfKENPKKFFS-  314
DSSP  LLLL-HHHHHHHhLHHHHHHLL-


No 12: Query=3gg7A Sbjct=3nqbA Z-score=16.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------LLEEEEELHHHLLL-HHHHHHHHHHLLL-EEEELLL------
Query ------------------SLIDFHVHLDLYPD-PVAVARACEERQL-TVLSVTT------   34
ident                    ||| | |       | | | |   |   |            
Sbjct srrdaaqvidaggayvspGLIDTHXHIESSXItPAAYAAAVVARGVtTIVWDPHefgnvh  120
DSSP  lllleeeeeelllleeeeLEEEEEELHHHHLLlHHHHHHHHHLLLEeEEEELLHhhhhhh


DSSP  lhhHHHHHHHHHLLL-LLEEELLLLLhHHLL----LLHHHL-HHHHHHHHH--LLEEEEE
Query tpaAWRGTLALAAGR-PHVWTALGFHpEVVS----ERAADL-PWFDRYLPE--TRFVGEV   86
ident      |                               |          |         | 
Sbjct gvdGVRWAAKAIENLpLRAILLAPSCvPSAPglerGGADFDaAILADLLSWpeIGGIAEI  180
DSSP  lhhHHHHHHHHHLLLlLEEEEEELLLlLLLLllllLLLLLLhHHHHHHHLLllEEEEEEE


DSSP  ELLLlhhhhhhhhhhHHHHHHHHHHHHHLlLEEEEEELLlLHHH-hHHHHHHLHhheeEE
Query GLDGspslrgtwtqqFAVFQHILRRCEDHgGRILSIHSRrAESE-vLNCLEANPrsgtPI  145
ident                      |              | |       ||   |        
Sbjct XNXR------gvierDPRXSGIVQAGLAA-EKLVCGHAR-GLKNadLNAFXAAG---vSS  229
DSSP  LLHH------hhhllLHHHHHHHHHHHHH-LLEEEELLL-LLLHhhHHHHHHLL---lLE


DSSP  EELLLlLHHHHHHHHHLLLEEEELHHHhlLHHHHHHHHHL-----LHHHEEELLLLLlle
Query LHWYSgSVTELRRAISLGCWFSVGPTMvrTQKGAALIRSM-----PRDRVLTETDGPfle  200
ident  |    |   |      |                               |   ||     
Sbjct DHELV-SGEDLXAKLRAGLTIELRGSH--DHLLPEFVAALntlghLPQTVTLCTDDV---  283
DSSP  ELLLL-LHHHHHHHHHLLLEEEEELLL--HHHHHHHHHHHhhhllLLLLEEEELLLL---


DSSP  ellEELL--hHHHHHHHHHHHHHHlLLHHHHHHHHHHHHHHHHH----------------
Query ldgQAAL--pWDVKSVVEGLSKIWqIPASEVERIVKENVSRLLG----------------  242
ident       |        ||  |            |    |    ||                
Sbjct --fPDDLlqgGGLDDVVRRLVRYG-LKPEWALRAATLNAAQRLGrsdlgliaagrradiv  340
DSSP  --lHHHHhhlLLHHHHHHHHHHLL-LLHHHHHHHHLHHHHHHHLllllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct vfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgak  400
DSSP  eellllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct gafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsd  520
DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee


DSSP  ------l
Query ------t  243
ident        
Sbjct espviev  587
DSSP  llleeel


No 13: Query=3gg7A Sbjct=3mtwA Z-score=16.0

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------SL    2
ident                                                            |
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EEEEELHHHL-----------------LLHHHHHHHHHHLLL-EEEELLllhhHHHHHHH
Query IDFHVHLDLY-----------------PDPVAVARACEERQL-TVLSVTttpaAWRGTLA   44
ident || |||||                       | |    |    ||  |     |      
Sbjct IDMHVHLDSLaevggynsleysdrfwsVVQTANAKKTLEAGFtTVRNVG---aADYDDVG  117
DSSP  EEEEELLLLLllllhhhhhhllhhhhhHHHHHHHHHHHHLLEeEEEELL---lLLLHHHH


DSSP  HHLLL-------LLEEEL-LLLLH---HHLLL--------LHHHL--------HHHHHHH
Query LAAGR-------PHVWTA-LGFHP---EVVSE--------RAADL--------PWFDRYL   77
ident |           |   ||   |        |                             
Sbjct LREAIdagyvpgPRIVTAaISFGAtggHCDSTffppsmdqKNPFNsdspdearKAVRTLK  177
DSSP  HHHHHhllllllLEEEELlLLEELlllLLLLLlllhhhllLLLLLlllhhhhhHHHHHHH


DSSP  H-HLLEEEeEELLL---lHHHH-hhhhhHHHHHHHHHHHHHHLlLEEEEEELLL--LHHH
Query P-ETRFVGeVGLDG---sPSLR-gtwtqQFAVFQHILRRCEDHgGRILSIHSRR--AESE  130
ident              |                              |     |        |
Sbjct KyGAQVIX-ICATGgvfsRGNEpgqqqlTYEEMKAVVDEAHMA-GIKVAAHAHGasGIRE  235
DSSP  HlLLLEEE-EELLLllllLLLLllllllLHHHHHHHHHHHHHL-LLEEEEEELLhhHHHH


DSSP  HHHHHhhlhhheeEEEELLL-LLHHHHHHHHHLLLEEEELHH------------------
Query VLNCLeanprsgtPILHWYS-GSVTELRRAISLGCWFSVGPT------------------  171
ident                    |         |   |  ||                      
Sbjct AVRAG-------vDTIEHASlVDDEGIKLAVQKGAYFSMDIYntdytqaegkkngvledn  288
DSSP  HHHLL-------lLEEEELLlLLHHHHHHHHHHLLEEELLLLlhhhhhhhhhhhlllhhh


DSSP  ----hhlLHHHHHHHHHLL--hhHEEELLLLLLleelleeLLHHHHHHHHHHHHHHHlLL
Query ----mvrTQKGAALIRSMP--rdRVLTETDGPFleldgqaALPWDVKSVVEGLSKIWqIP  225
ident                |            ||              |               
Sbjct lrkdrdiGELQRENFRKALkagvKMVYGTDAGI-------YPHGDNAKQFAVMVRYG-AT  340
DSSP  hhhhhhhHHHHHHHHHHHHhhllEEELLLLLLL-------LLLLLHHHHHHHHHHLL-LL


DSSP  HHHHHHHHHHHHHH-HHHL-----------------------------------------
Query ASEVERIVKENVSR-LLGT-----------------------------------------  243
ident                |                                            
Sbjct PLQAIQSATLTAAEaLGRSkdvgqvavgrygdmiavagdpladvttlekpvfvmkggavv  400
DSSP  HHHHHHHLLHHHHHhHLLLllllllllllllleeeelllllllhhhhhllleeeelleee


DSSP  ----
Query ----  243
ident     
Sbjct kapx  404
DSSP  elll


No 14: Query=3gg7A Sbjct=3ls9A Z-score=15.9

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------SLI    3
ident                                                           ||
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  EEEELHHHLL---------------------------------------LHHHHHHHHHH
Query DFHVHLDLYP---------------------------------------DPVAVARACEE   24
ident   | ||                                              ||      
Sbjct NSHQHLYEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLESLL  120
DSSP  EEEELHHHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHHHH


DSSP  LLL-EEEELLLL------hhHHHHHHHHHLL-LLLEEELLLLlhhHLLL-----------
Query RQL-TVLSVTTT------paAWRGTLALAAG-RPHVWTALGFhpeVVSE-----------   65
ident     ||                  |   |         |                     
Sbjct GGItTVADQHLFfpgatadsYIDATIEAATDlGIRFHAARSS---MTLGkseggfcddlf  177
DSSP  LLEeEEEEEELLllllllllHHHHHHHHHHHhLLEEEEEELL---LLLLhhhlllllhhh


DSSP  --LHHHL-HHHHHHHHH----------LLEEEEEELLllhhhhhhhhhHHHHHHHHHHHH
Query --RAADL-PWFDRYLPE----------TRFVGEVGLDgspslrgtwtqQFAVFQHILRRC  112
ident                                |  |                 |       
Sbjct vePVDRVvQHCLGLIDQyhepepfgmvRIALGPCGVP---------ydKPELFEAFAQMA  228
DSSP  llLHHHHhHHHHHHHHHhlllllllleEEEELLLLLL---------llLHHHHHHHHHHH


DSSP  HHLlLEEEEEELL--------------lLHHHHH-HHHHhlhhheEEEEELLL-LLHHHH
Query EDHgGRILSIHSR--------------rAESEVL-NCLEanprsgTPILHWYS-GSVTEL  156
ident  |     |  |                                     |         | 
Sbjct ADY-DVRLHTHFYepldagmsdhlygmtPWRFLEkHGWA----sdRVWLAHAVvPPREEI  283
DSSP  HHH-LLEEEEEELlllhhhhhhhhhlllHHHHHHhLLLL----llLEEEEELLlLLHHHH


DSSP  HHHHHLLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLLLLLLeelleELLHHhH
Query RRAISLGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETDGPFLeldgqAALPWdV  211
ident       |                     ||        |   | |               
Sbjct PEFADAGVAIAHLiAPDLrmgWGLA--PIREYLdagiTVGFGTTGSAS-----NDGGN-L  335
DSSP  HHHHHHLLEEEELhHHHHhllLLLL--LHHHHHhlllEEEELLLLLLL-----LLLLL-H


DSSP  HHHHHHHHHHH----------LLLHHHHHHHHHHHHHH--HHHL----------------
Query KSVVEGLSKIW----------QIPASEVERIVKENVSR--LLGT----------------  243
ident                         | |  |                              
Sbjct LGDLRLAALAHrpadpnepekWLSARELLRMATRGSAEclGRPDlgvleegraadiacwr  395
DSSP  HHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHHHHHhlLLLLllllllllllleeeee


DSSP  ----------------------------------------------------------
Query ----------------------------------------------------------  243
ident                                                           
Sbjct ldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 15: Query=3gg7A Sbjct=2pajA Z-score=15.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  -LLEEEEELHHHLL-----------------LHHHHHHHHHHLLL-EEEELLLLH-----
Query -SLIDFHVHLDLYP-----------------DPVAVARACEERQL-TVLSVTTTP-----   36
ident       | ||                                    ||            
Sbjct pAWVNTHHHLFQSLlkgepfralfderrfrlAARIGLIELARSGCaTVADHNYVYypgmp  120
DSSP  eLEELLLLLHHHHHllllllhhhllhhhhhhHHHHHHHHHHLLLEeEEEELLLLLlllll


DSSP  -hHHHHHHHHHLLL-LLEEELLLLlhhHLLL-----------LHHHLHHHHHHHHHL---
Query -aAWRGTLALAAGR-PHVWTALGFhpeVVSE-----------RAADLPWFDRYLPET---   80
ident           |           |                   |   |             
Sbjct fdSSAILFEEAEKLgLRFVLLRGG---ATQTrqleadlptalRPETLDAYVADIERLaar  177
DSSP  llHHHHHHHHHHHLlLEEEEEELL---LLLLllllllllhhhLLLLHHHHHHHHHHHhhh


DSSP  -----------LEEE-EEELLllhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL--l
Query -----------RFVG-EVGLDgspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR--r  126
ident                    |                            |     |     
Sbjct yhdaspramrrVVMApTTVLY---------siSPREMRETAAVARRL-GLRMHSHLSgks  227
DSSP  llllllllleeEEELlLLLLL---------llLHHHHHHHHHHHHHL-LLEEEEELLlll


DSSP  LHHHHHHHHhhlhhheEEEEELLL-LLHHHHHHHHHLLLEEEELH-HHHLLhhhhhHHHH
Query AESEVLNCLeanprsgTPILHWYS-GSVTELRRAISLGCWFSVGP-TMVRTqkgaaLIRS  184
ident                              |       |      |    |        | 
Sbjct PVAFCGEHD---wlgsDVWYAHLVkVDADEIALLAQTGTGVAHCPqSNGRL-----PVRE  279
DSSP  HHHHHHHLL---llllLEEEELLLlLLHHHHHHHHHHLLEEEELHhHHHLL-----LLLL


DSSP  LL--hhHEEELLLLLLLEelleELLHH-HHHHHHHHHHHHHLLLhHHHHHHH-HHHHHH-
Query MP--rdRVLTETDGPFLEldgqAALPW-DVKSVVEGLSKIWQIPaSEVERIV-KENVSR-  239
ident |      |    ||         |                                  | 
Sbjct MAdagvPVSIGVDGAASN----EAADMiSEVHMTWLAQRARLAS-IAEVIHWgTAGGARv  334
DSSP  HHhhllLEEELLLHHHHL----LLLLHhHHHHHHHHHHHHLLLL-HHHHHHHhLHHHHHh


DSSP  HHHL--------------------------------------------------------
Query LLGT--------------------------------------------------------  243
ident                                                             
Sbjct MGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvdd  394
DSSP  HLLLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeell


DSSP  ---------------------------
Query ---------------------------  243
ident                            
Sbjct liegvdikelggearrvvrellrevvv  421
DSSP  llllllhhhhhhhhhhhhhhhhhhhhl


No 16: Query=3gg7A Sbjct=2oofA Z-score=15.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --LLEEEEELHHHLL------------------------------------------LHH
Query --SLIDFHVHLDLYP------------------------------------------DPV   16
ident    ||| | ||                                                 
Sbjct tpGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  eeLEEEEEELLLLLLllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHLLL-EEEELLL------lHHHH-HHHHHHHLLL-LLEEELLLLLHhHLLL--
Query AVARACEERQL-TVLSVTT------tPAAW-RGTLALAAGR-PHVWTALGFHPeVVSE--   65
ident             ||                 |    |       | | |      |    
Sbjct PRVKSLIREGVtTVEIKSGygltledELKXlRVARRLGEALpIRVKTTLLAAH-AVPPey  179
DSSP  HHHHHHHHHLEeEEEEELLllllhhhHHHHhHHHHHHHHHLlLEEEEEEEEEL-LLLHhh


DSSP  ------LHHHL--HHHHHHH--HHLLEEEeEELLLLhhhhhhhhhHHHHHHHHHHHHHHL
Query ------RAADL--PWFDRYL--PETRFVGeVGLDGSpslrgtwtqQFAVFQHILRRCEDH  115
ident                            |  |                |            
Sbjct rddpdsWVETIcqEIIPAAAeaGLADAVD-VFCEHI-------gfSLAQTEQVYLAADQY  231
DSSP  lllhhhHHHHHhhLHHHHHHhlLLLLEEE-EEELLL-------llLHHHHHHHHHHHHHL


DSSP  LLEEEeEELL--LLHHhHHHHHHHLHhheEEEEELLL-LLHHHHHHHHHLLLEEEEL-HH
Query GGRILsIHSR--RAESeVLNCLEANPrsgTPILHWYS-GSVTELRRAISLGCWFSVG-PT  171
ident |      |                                          |         
Sbjct GLAVK-GHXDqlSNLG-GSTLAANFG---ALSVDHLEyLDPEGIQALAHRGVVATLLpTA  286
DSSP  LLEEE-EEELllLLLL-HHHHHHHLL---LLEEEELLlLLHHHHHHHHHHLLEEEELhHH


DSSP  HH--LLHHHhhHHHHLL--hhHEEELLLLLLLEelleELLHH-HHHHHH-HHHHhhhlll
Query MV--RTQKGaaLIRSMP--rdRVLTETDGPFLEldgqAALPW-DVKSVV-EGLSkiwqip  225
ident        |                   |                                
Sbjct FYflKETKL-pPVVALRkagvPXAVSSDINPGT---aPIVSLrXAXNXAcTLFG-----l  337
DSSP  HHhlLLLLL-lLHHHHHhlllLEEELLLLLLLL---lLLLLHhHHHHHHhHHHL-----l


DSSP  HHHHHHHH-HHHHHH--HHHL---------------------------------------
Query ASEVERIV-KENVSR--LLGT---------------------------------------  243
ident               |                                             
Sbjct TPVEAXAGvTRHAARalGEQEqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvn  397
DSSP  LHHHHHHHlLHHHHHhlLLLLlllllllllllleeeellllllhhhhlllllleeeeeel


DSSP  ------
Query ------  243
ident       
Sbjct geetlh  403
DSSP  leelll


No 17: Query=3gg7A Sbjct=2imrA Z-score=15.6

back to top
DSSP  -------------------------------------------------------LLEEE
Query -------------------------------------------------------SLIDF    5
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  EELHHH--------------------------lLLHHHHHHHHHHL-LLEEEELLllhhH
Query HVHLDL--------------------------yPDPVAVARACEER-QLTVLSVTttpaA   38
ident | |||                                | |          |         
Sbjct HTHLDMsayefqalpyfqwipevvirgrhlrgvAAAQAGADTLTRLgAGGVGDIV----W  116
DSSP  EEELLLlhhhhhhlhhhhllhhhhhhhllllhhHHHHHHHHHHHHLlLLLEEEEE----L


DSSP  HHHHH-HHHL-LLLLeEELLLLLhhHLLL-LHHHL-HHHHHHHHH---------LLEEEE
Query WRGTL-ALAA-GRPHvWTALGFHpeVVSE-RAADL-PWFDRYLPE---------TRFVGE   85
ident       || |                     |          |                 
Sbjct APEVMdALLArEDLSgTLYFEVL--NPFPdKADEVfAAARTHLERwrrlerpglRLGLSP  174
DSSP  LHHHHhHHHLlLLLLeEEEEEEL--LLLHhHHHHHhHHHHHHHHHhhlllllleEEEEEE


DSSP  EELLllhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL--------------------
Query VGLDgspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR--------------------  125
ident                                |  | ||                      
Sbjct HTPF---------tvSHRLMRLLSDYAAGE-GLPLQIHVAehptelemfrtgggplwdnr  224
DSSP  LLLL---------llLHHHHHHHHHHHHHH-LLLLEEEELllhhhhhhhhhlllllhhhl


DSSP  ---------------------lLHHHHH--HHHHhlhhhEEEEEELLL-LLHHHHHHHHH
Query ---------------------rAESEVL--NCLEanprsGTPILHWYS-GSVTELRRAIS  161
ident                                 |        | |            |   
Sbjct mpalyphtlaevigrepgpdltPVRYLDelGVLA-----ARPTLVHMVnVTPDDIARVAR  279
DSSP  lhhhllllhhhhhlllllllllHHHHHHhhLLHH-----HLLEEEELLlLLHHHHHHHHH


DSSP  LLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLLLLLLeelleeLLHHhHHHHHH
Query LGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETDGPFLeldgqaALPWdVKSVVE  216
ident  ||                              |   ||               |   | 
Sbjct AGCAVVTCpRSNHhleCGTF--DWPAFAaagvEVALGTDSVAS-----gETLN-VREEVT  331
DSSP  HLLLEEELhHHHHhllLLLL--LHHHHHhlllLEEELLLLHHH-----hLLLL-LHHHHH


DSSP  HHHHHHL-LLHHHHHHHHHHHHHHH---------------------hhl
Query GLSKIWQ-IPASEVERIVKENVSRL---------------------lgt  243
ident                |       |                         
Sbjct FARQLYPgLDPRVLVRAAVKGGQRVvgtpflrrgetwqegfrwelsrdl  380
DSSP  HHHHHLLlLLHHHHHHHHHHHHHHHhllllllllllllhhhlhhhllll


No 18: Query=3gg7A Sbjct=4hk5D Z-score=15.5

back to top
DSSP  --LLEEEEELHHH-----------------------------------------------
Query --SLIDFHVHLDL-----------------------------------------------   11
ident      | | |                                                  
Sbjct tpVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  llLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  ---------LLLHHHHHHHHHHLLL-EEEELL---------------llhHHHHHHHHHH
Query ---------YPDPVAVARACEERQL-TVLSVT---------------ttpAAWRGTLALA   46
ident                                                   |         
Sbjct lpgrplsthFASLAQKMHFMDTNGIrVSVISLanpwfdflapdeapgiadAVNAEFSDMC  120
DSSP  llleellhhHLLHHHHHHHHHHLLLlEEEEEEllllllllllllhhhhhhHHHHHHHHHH


DSSP  LLL-LLEEELLLLlhhHLLLLHHHL-HHHHHHHHH--LLEEEeEELLllhhhhhHHHH--
Query AGR-PHVWTALGFhpeVVSERAADL-PWFDRYLPE--TRFVGeVGLDgspslrgTWTQ--  100
ident |                 |           |       |     |               
Sbjct AQHvGRLFFFAAL---PLSAPVDAVkASIERVKNLkyCRGII-LGTS------gLGKGld  170
DSSP  HLLlLLEEEEEEL---LLLLLHHHHhHHHHHHHLLllEEEEE-ELLL------lLLLLll


DSSP  HHHHhHHHHHHHHHLlLEEEEEE------------------------------LLLLHHH
Query QFAVfQHILRRCEDHgGRILSIH------------------------------SRRAESE  130
ident              |        |                                 |   
Sbjct DPHL-LPVFEAVADA-KLLVFLHphyglpnevygprseeyghvlplalgfpmeTTIAVAR  228
DSSP  LHHH-HHHHHHHHHL-LLEEEELllllllhhhhlllhhhlllhhhhhlhhhhhHHHHHHH


DSSP  HH--HHHHHLHHHeEEEEEL-LLLL-HHHH-------------------------HHHHH
Query VL--NCLEANPRSgTPILHW-YSGS-VTEL-------------------------RRAIS  161
ident                  |                                          
Sbjct MYmaGVFDHVRNL-QMLLAHsGGTLpFLAGriescivhdghlvktgkvpkdrrtiWTVLK  287
DSSP  HHhlLHHHHLLLL-LEEEHHhHLLHhHHHHhhhhhhhllhhhhhllllllllllhHHHHH


DSSP  LLLEEEELhhHHLLHHHHHHHHHLLHHHEEELLLLLLlEELL---eellhhHHHHHHHHH
Query LGCWFSVGptMVRTQKGAALIRSMPRDRVLTETDGPFlELDG---qaalpwDVKSVVEGL  218
ident                   | | |   ||    || ||                       
Sbjct EQIYLDAV--IYSEVGLQAAIASSGADRLMFGTDHPF-FPPIeedvqgpwdSSRLNAQAV  344
DSSP  HLEEEELL--LLLHHHHHHHHHHHLHHHEELLLLLLL-LLLLllllllllhHHHHHHHHH


DSSP  HHHHlLLHHHHHHHH-HHHHHHHHH-----------l
Query SKIWqIPASEVERIV-KENVSRLLG-----------t  243
ident  |      |     |   |  | |             
Sbjct IKAV-GEGSSDAAAVmGLNAVRVLSlkaelehhhhhh  380
DSSP  HHHH-LLLLHHHHHHhLHHHHHHLLlhhhhhhhhhhl


No 19: Query=3gg7A Sbjct=4dlfA Z-score=15.5

back to top
DSSP  -LLEEEEELHH----------------hlLLHHhhHHHHHHLL-----LEEEELL-LLHH
Query -SLIDFHVHLD----------------lyPDPVavARACEERQ-----LTVLSVT-TTPA   37
ident    || | |                     |      |               |      
Sbjct aLRIDSHQHFWryraadypwigagmgvlaRDYL--PDALHPLMhaqalGASIAVQaRAGR   58
DSSP  lLLEEEEELLLlllhhhllllllllhhhlLLLL--HHHHHHHHhhlllLEEEEELlLLLH


DSSP  -HHHHHHHHHLLLLLE-EELLLLlhhhllllhhhlhhHHHHHHH-----LLEEEeEELLL
Query -AWRGTLALAAGRPHV-WTALGFhpevvseraadlpwFDRYLPE-----TRFVGeVGLDG   90
ident       | ||                                 |      |      |  
Sbjct dETAFLLELACDEARIaAVVGWE--------dlrapqLAERVAEwrgtkLRGFR-HQLQD  109
DSSP  hHHHHHHHHHLLLLLEeEEEELL--------llllllHHHHHHLlllllEEEEE-ELHHH


DSSP  lhhHHHHHHHHHH-hHHHHHHHHHHlLLEEEEEELL-LLHHHHHHHHHHLHHhEEEEEEL
Query spsLRGTWTQQFA-vFQHILRRCEDhGGRILSIHSR-RAESEVLNCLEANPRsGTPILHW  148
ident                |                     |    |              |  
Sbjct ---EADVRAFVDDadFARGVAWLQA-NDYVYDVLVFeRQLPDVQAFCARHDA-HWLVLDH  164
DSSP  ---LLLHHHHHHLhhHHHHHHHHHH-LLLEEEELLLhHHHHHHHHHHHHLLL-LLEEEHH


DSSP  LLL---------------LHHHHHHHHHLL-LEEEEL---------------hhhhLLHH
Query YSG---------------SVTELRRAISLG-CWFSVG---------------ptmvRTQK  177
ident                       ||    |                             | 
Sbjct AGKpalaefdrddtalarWRAALRELAALPhVVCKLSglvteadwrrglrasdlrhIEQC  224
DSSP  HHLllhhhllllllhhhhHHHHHHHHHLLLlEEEEELlllllllllllllhhhhhhHHHH


DSSP  HHHHHHHLLHHHEEELLLLLLLEEllEELLhhHHHHHHHHHHHHHLLlhhHHHHHH-HHH
Query GAALIRSMPRDRVLTETDGPFLELdgQAALpwDVKSVVEGLSKIWQIpasEVERIV-KEN  236
ident   |        |     | |   |   |        |                       
Sbjct LDAALDAFGPQRLMFGSDWPVCLL--AASYdeVASLVERWAESRLSA---AERSALwGGT  279
DSSP  HHHHHHHHLHHHEEELLLLLHHHH--LLLHhhHHHHHHHHHHHHLLH---HHHHHHlLHH


DSSP  HHHHHH-l
Query VSRLLG-t  243
ident   |     
Sbjct AARCYAlp  287
DSSP  HHHHLLll


No 20: Query=3gg7A Sbjct=1j6pA Z-score=15.3

back to top
DSSP  ---------------------------------------------------LLEEEEELH
Query ---------------------------------------------------SLIDFHVHL    9
ident                                                     |   | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH


DSSP  HHLL--------------------------------LHHHHHHHHHHLLL-EEEELLLlh
Query DLYP--------------------------------DPVAVARACEERQL-TVLSVTTtp   36
ident                                                             
Sbjct PXTLlrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIaGFVDXYF--  118
DSSP  HHHHhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEeEEEEEEL--


DSSP  hHHHHHHHHHL-LLLLEEELLLLlhhHLLL-LHHHL-HHHHHHHHH--------LLEEEe
Query aAWRGTLALAA-GRPHVWTALGFhpeVVSE-RAADL-PWFDRYLPE--------TRFVGe   85
ident                      |    | |                |            | 
Sbjct -HEEWIAKAVRdFGXRALLTRGL---VDSNgDDGGRlEENLKLYNEwngfegriFVGFGp  174
DSSP  -LHHHHHHHHHhHLLEEEEEEEE---LLLLlLLLLHhHHHHHHHHHhllhhhleEEEEEe


DSSP  EELLllhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL----LLHHHhHHHHHHLHhH
Query VGLDgspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR----RAESEvLNCLEANPrS  141
ident                                     ||               |      
Sbjct HSPY---------lcSEEYLKRVFDTAKSL-NAPVTIHLYetskEEYDL-EDILNIGLkE  223
DSSP  LLLL---------llLHHHHHHHHHHHHHH-LLLEEEEELllllLLLLL-HHHHLLLLlL


DSSP  EEEEEELL-LLLHHHHHHHHHLLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLL
Query GTPILHWY-SGSVTELRRAISLGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETD  195
ident    |                      |                           |   ||
Sbjct VKTIAAHCvHLPERYFGVLKDIPFFVSHNpASNLklgNGIA--PVQRXIehgxKVTLGTD  281
DSSP  LLEEEEELlLLLHHHHHHHLLLLEEEEELhHHHHhllLLLL--LHHHHHhlllEEEELLL


DSSP  LLLLEelleeLLHHhHHHHHHHHHHHHL------LLHHHHHHHHHHHHHHHHH-------
Query GPFLEldgqaALPWdVKSVVEGLSKIWQ------IPASEVERIVKENVSRLLG-------  242
ident |                      |                   |        |       
Sbjct GAASN-----NSLN-LFFEXRLASLLQKaqnprnLDVNTCLKXVTYDGAQAXGfksgkie  335
DSSP  LLLLL-----LLLL-HHHHHHHHHHHHHllllllLLHHHHHHHHLHHHHHHHLlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct egwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevk  395
DSSP  lllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhh


DSSP  -----------l
Query -----------t  243
ident             
Sbjct relariekelys  407
DSSP  hhhhhhhhhhhl


No 21: Query=3gg7A Sbjct=1gkpA Z-score=15.1

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------SLIDFHVH    8
ident                                                       || |||
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  HHH------LLLHH-HHHHHHHHLLL-EEEELLLL------HHHHHHHHHHHLL--LLLE
Query LDL------YPDPV-AVARACEERQL-TVLSVTTT------PAAWRGTLALAAG--RPHV   52
ident   |        |       |       |                       | |      
Sbjct IYLpfmatfAKDTHeTGSKAALMGGTtTYIEMCCPsrnddaLEGYQLWKSKAEGnsYCDY  120
DSSP  LLLeelleeLLLLHhHHHHHHHHLLEeEEEEEELLlllllhHHHHHHHHHHHLLllLLEE


DSSP  EELLLLLhhhllllHHHL-HHHHHHHH-HLLEEEeEELLllhhHHHHhhhHHHHHHHHHH
Query WTALGFHpevvserAADL-PWFDRYLP-ETRFVGeVGLDgspsLRGTwtqQFAVFQHILR  110
ident                                      |                    ||
Sbjct TFHMAVS-----kfDEKTeGQLREIVAdGISSFX-IFLS----YKNFfgvDDGEMYQTLR  170
DSSP  EEEEELL-----llLLLHhHHHHHHHHlLLLEEE-EEEL----LLLLlllLHHHHHHHHH


DSSP  HHHHLlLEEEEEELLL---------------------------------LHHHHHHHHHH
Query RCEDHgGRILSIHSRR---------------------------------AESEVLNCLEA  137
ident       | |   |                                            || 
Sbjct LAKEL-GVIVTAHCENaelvgrlqqkllsegktgpewhepsrpeaveaeGTARFATFLET  229
DSSP  HHHHH-LLEEEEEELLhhhhhhhhhhhhhlllllhhhllllllhhhhhhHHHHHHHHHHH


DSSP  lHHHEeEEEELLLLLH--HHHHHHHH--LLLEEEELHHHHLL------------------
Query nPRSGtPILHWYSGSV--TELRRAIS--LGCWFSVGPTMVRT------------------  175
ident             |          |                                    
Sbjct -TGAT-GYVVHLSCKPalDAAMAAKArgVPIYIESVIPHFLLdktyaerggveamkyims  287
DSSP  -HLLE-EEELLLLLHHhhHHHHHHHHllLLEEEEEEHHHHHLlhhhhhllhhhhhlllll


DSSP  ------HHHHHHHHHL-LHHHEEELLLLLL-------------leelleELLHHHHHHHH
Query ------QKGAALIRSM-PRDRVLTETDGPF-------------leldgqAALPWDVKSVV  215
ident            |             ||                           |     
Sbjct pplrdkRNQKVLWDALaQGFIDTVGTDHCPfdteqkllgkeaftaipngIPAIEDRVNLL  347
DSSP  llllllHHHHHHHHHHhLLLLLEEELLLLLllhhhhhhhlllhhhllllLLLLLLHHHHH


DSSP  H-HHHHhHLLLhHHHHHHH-HHHHHHHHH-------------------------------
Query E-GLSKiWQIPaSEVERIV-KENVSRLLG-------------------------------  242
ident                           | |                               
Sbjct YtYGVSrGRLD-IHRFVDAaSTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvkt  406
DSSP  HhHHLLlLLLL-HHHHHHHhLHHHHHHLLllllllllllllllleeeeelllleellhhh


DSSP  ---------------------------------------------------l
Query ---------------------------------------------------t  243
ident                                                     
Sbjct qhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  llllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 22: Query=3gg7A Sbjct=3icjA Z-score=15.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEEEEELHHHLL-----------------------------------------------
Query SLIDFHVHLDLYP-----------------------------------------------   13
ident    | | |||                                                  
Sbjct AFFDSHLHLDELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   13
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  -------LHHHHHHHHHHLLL-EEEELLLlhhhHHHHHHHHL-------LLLLEEELLLL
Query -------DPVAVARACEERQL-TVLSVTTtpaaWRGTLALAA-------GRPHVWTALGF   58
ident                        |             |               |   |  
Sbjct tvkdykhYIESAQEHLLSLGVhSVGFMSV----GEKALKALFeleregrLKMNVFAYLSP  236
DSSP  lhhhhhhHHHHHHHHHHHLLEeEEEEEEE----LHHHHHHHHhhhhlllLLLEEEEEELH


DSSP  lhhhllllhhhlhHHHH------HHHH------LLEEEeEELLL----------------
Query hpevvseraadlpWFDR------YLPE------TRFVGeVGLDG----------------   90
ident                                     |     ||                
Sbjct -------------ELLDkleelnLGKFegrrlrIWGVX-LFVDGslgartallsepytdn  282
DSSP  -------------HHHHhhhhhlLLLEellleeEEEEE-EELLLllllllllllllllll


DSSP  --lHHHHhhhhhHHHHHHHHHHHHHHLLlEEEEEELLL--LHHHHHHHHHHLHHheEEEE
Query --sPSLRgtwtqQFAVFQHILRRCEDHGgRILSIHSRR--AESEVLNCLEANPRsgTPIL  146
ident                       |    |      |     |    |   |          
Sbjct pttSGEL---vmNKDEIVEVIERAKPLG-LDVAVHAIGdkAVDVALDAFEEAEF--SGRI  336
DSSP  lllLLLL---llLHHHHHHHHHHHLLLL-LEEEEEELLhhHHHHHHHHHHHHLL--LLEE


DSSP  ELLL-LLHHHHHHHHHLLLEEEELHHHHL-------------lHHHHhHHHHLLH-hHEE
Query HWYS-GSVTELRRAISLGCWFSVGPTMVR-------------tQKGAaLIRSMPR-dRVL  191
ident    |      | |   |    |  |                                   
Sbjct EHASlVRDDQLERIKELKVRISAQPHFIVsdwwivnrvgeeraKWAY-RLKTLSSitKLG  395
DSSP  EELLlLLHHHHHHHHHHLLEEEELLLHHHhlllhhhhhhhhhhHHLL-LHHHHHHhlLEE


DSSP  ELLLLLlleelleELLHhHHHHHHHHHHH-------HHLLlHHHHHHHHHHHHHH--HHH
Query TETDGPfleldgqAALPwDVKSVVEGLSK-------IWQIpASEVERIVKENVSR--LLG  242
ident   || |            |                        |             |  
Sbjct FSTDSP-------IEPA-DPWVSIDAAVNryvvdpgERVS-REEALHLYTHGSAQvtLAE  446
DSSP  ELLLLL-------LLLL-LHHHHHHHHHHlllllhhHLLL-HHHHHHHLLHHHHHhlLLL


DSSP  L---------------------
Query T---------------------  243
ident                       
Sbjct Dlgklergfraeyiildrdplk  468
DSSP  Lllllllllllleeeellllll


No 23: Query=3gg7A Sbjct=3mkvA Z-score=15.0

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------SLI    3
ident                                                           ||
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  EEEELHHHLL----------------LHHHHHHHHHHLLL-EEEELLllhhhhhhHHHHH
Query DFHVHLDLYP----------------DPVAVARACEERQL-TVLSVTttpaawrgTLALA   46
ident | |||                       |   ||   |   ||                 
Sbjct DLHVHVVAIEfnlprvatlpnvlvtlRAVPIMRAMLRRGFtTVRDAG------gaGYPFK  114
DSSP  EEEELLLLLLllhhhhllllhhhhhhHHHHHHHHHHHLLEeEEEELL------llLHHHH


DSSP  LLLL-------LEEEL-LLLL---HHHL------------------------lLLHH--H
Query AGRP-------HVWTA-LGFH---PEVV------------------------sERAA--D   69
ident                                                             
Sbjct QAVEsglvegpRLFVSgRALSqtgGHADprarsdymppdspcgccvrvgalgrVADGvdE  174
DSSP  HHHHlllllllEEEELlLEEElllLLLLllllllllllllllllllllllleeELLLhhH


DSSP  LHH-HHHHHH-HLLEEEeEELLL---lHHHH-hhhhHHHHHHHHHHHHHHHLLLEeEEEE
Query LPW-FDRYLP-ETRFVGeVGLDG---sPSLR-gtwtQQFAVFQHILRRCEDHGGRiLSIH  123
ident         |             |    |                |       |      |
Sbjct VRRaVREELQmGADQIX-IMASGgvasPTDPvgvfgYSEDEIRAIVAEAQGRGTY-VLAH  232
DSSP  HHHhHHHHHHhLLLLEE-EELLLllllLLLLlllllLLHHHHHHHHHHHHLLLLL-EEEE


DSSP  LLL--LHHHHHHHHhhlhhheeEEEELLL-LLHHHHHHHHHLLLEEEELHH---------
Query SRR--AESEVLNCLeanprsgtPILHWYS-GSVTELRRAISLGCWFSVGPT---------  171
ident      |      |                       |     |                 
Sbjct AYTpaAIARAVRCG-------vRTIEHGNlIDDETARLVAEHGAYVVPTLVtydalaseg  285
DSSP  ELLhhHHHHHHHLL-------lLEEEELLlLLHHHHHHHHHHLLEEELLHHhhhhhhhhl


DSSP  -------------hhlLHHHHHHHHHLL--hhHEEELLLLLlleellEELLhhHHHHHHH
Query -------------mvrTQKGAALIRSMP--rdRVLTETDGPfleldgQAALpwDVKSVVE  216
ident                    |   |  |          ||         |           
Sbjct ekyglppesiakiadvHGAGLHSIEIMKragvKMGFGTDLL-----gEAQR--LQSDEFR  338
DSSP  llllllhhhhllhhhhHLLHHHHHHHHHhhllLLLLLLLLL-----hHHHH--HLLHHHH


DSSP  HHHHHHllLHHHHHHHHHHHHHH-HHHL--------------------------------
Query GLSKIWqiPASEVERIVKENVSR-LLGT--------------------------------  243
ident  |         ||           |                                   
Sbjct ILAEVL--SPAEVIASATIVSAEvLGMQdklgrivpgahadvlvvdgnplksvdcllgqg  396
DSSP  HHHLLL--LHHHHHHHLLHHHHHhLLLLllllllllllllleeeelllllllllllllll


DSSP  ------------------
Query ------------------  243
ident                   
Sbjct ehiplvmkdgrlfvnele  414
DSSP  lllleeeelleeeeelll


No 24: Query=3gg7A Sbjct=2uz9A Z-score=14.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------LLEEEEELHHHLL---------------------------------LHHHH
Query ---------SLIDFHVHLDLYP---------------------------------DPVAV   18
ident           | | | |   |                                      |
Sbjct lshheffmpGLVDTHIHASQYSfagssidlpllewltkytfpaehrfqnidfaeeVYTRV  120
DSSP  llllleeeeLEEEEEEEHHHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHHHHH


DSSP  HHHHHHLLL-EEEELLLLHH-HHHHHHHHHL-LLLLEEELLLLlhhHLLL--------LH
Query ARACEERQL-TVLSVTTTPA-AWRGTLALAA-GRPHVWTALGFhpeVVSE--------RA   67
ident  |        |     |                                           
Sbjct VRRTLKNGTtTACYFATIHTdSSLLLADITDkFGQRAFVGKVC---MDLNdtfpeykeTT  177
DSSP  HHHHHHLLEeEEEEELLLLHhHHHHHHHHHHhHLLEEEEELEE---LLLLllllllllLH


DSSP  HHL-HHHHHHHHH---------LLEEEEEELLllhhhhhhhhhHHHHHHHHHHHHHHLlL
Query ADL-PWFDRYLPE---------TRFVGEVGLDgspslrgtwtqQFAVFQHILRRCEDHgG  117
ident         |   |            |                                  
Sbjct EESiKETERFVSEmlqknysrvKPIVTPRFSL---------scSETLMGELGNIAKTR-D  227
DSSP  HHHhHHHHHHHHHhhhhlllleEEEEEELLHH---------hlLHHHHHHHHHHHHHH-L


DSSP  EEEEEELL-----------------LLHHHHHHHHhhlhhheEEEEELL-LLLHHHHHHH
Query RILSIHSR-----------------RAESEVLNCLeanprsgTPILHWY-SGSVTELRRA  159
ident      |                      |                       |  ||   
Sbjct LHIQSHISenrdeveavknlypsykNYTSVYDKNN---lltnKTVMAHGcYLSAEELNVF  284
DSSP  LEEEEEELllhhhhhhhhhhlllllLHHHHHHHLL---llllLEEEEELlLLLHHHHHHH


DSSP  HHLLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLLLLLLeelleeLLHHhHHHH
Query ISLGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETDGPFLeldgqaALPWdVKSV  214
ident    |                                   ||                   
Sbjct HERGASIAHCpNSNLslsSGFL--NVLEVLkhevKIGLGTDVAGG------YSYS-MLDA  335
DSSP  HHHLLEEEELhHHHHhllLLLL--LHHHHHhlllEEEELLLLLLL------LLLL-HHHH


DSSP  HHHHHHHH-----------LLLHHHHHHHHHHH-HHHHHH--------------------
Query VEGLSKIW-----------QIPASEVERIVKEN-VSRLLG--------------------  242
ident                         || |         |                      
Sbjct IRRAVMVSnillinkvnekSLTLKEVFRLATLGgSQALGLdgeignfevgkefdailinp  395
DSSP  HHHHHHHHhhhhhllllllLLLHHHHHHHHLHHhHHHLLLlllllllllllllleeeell


DSSP  ------------------------------------------------l
Query ------------------------------------------------t  243
ident                                                  
Sbjct kasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  lllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 25: Query=3gg7A Sbjct=4b3zD Z-score=14.6

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------SLIDFHV    7
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  LHHH--lLLHHHHHHHHHHLLL-EEEELLLL------hHHHHHHHHHHLL--LLLEEELL
Query HLDL--yPDPVAVARACEERQL-TVLSVTTT------pAAWRGTLALAAG--RPHVWTAL   56
ident  |      |     ||                               |            
Sbjct YLQKtaaDDFFQGTRAALVGGTtMIIDHVVPepgssllTSFEKWHEAADTksCCDYSLHV  120
DSSP  LLLLlllLLHHHHHHHHHHLLEeEEEEEELLlllllhhHHHHHHHHHHHLllLLEEEEEE


DSSP  LLlhhHLLLlhHHLH-HHHHHHH--HLLEEEeEELLllhhHHHHhhHHHHHHHHHHHHHH
Query GFhpeVVSEraADLP-WFDRYLP--ETRFVGeVGLDgspsLRGTwtQQFAVFQHILRRCE  113
ident                                 |                           
Sbjct DI---TSWY--DGVReELEVLVQdkGVNSFQ-VYMA----YKDVyqMSDSQLYEAFTFLK  170
DSSP  EL---LLLL--LLHHhHHHHHHHllLLLEEE-EELL----LLLLllLLHHHHHHHHHHHH


DSSP  HLlLEEEEEELLL---------------------------------LHHHHHHHHHHLHH
Query DHgGRILSIHSRR---------------------------------AESEVLNCLEANPR  140
ident    |     |                                    |             
Sbjct GL-GAVILVHAENgdliaqeqkrilemgitgpeghalsrpeeleaeAVFRAITIAGRINC  229
DSSP  HH-LLEEEEELLLhhhhhhhhhhhhhllllllhhhhhhllhhhhhhHHHHHHHHHHHHLL


DSSP  heEEEEELLL--LLHHHHHHHHH--LLLEEEELHHHHLL---------------------
Query sgTPILHWYS--GSVTELRRAIS--LGCWFSVGPTMVRT---------------------  175
ident                     |                 |                     
Sbjct --PVYITKVMskSAADIIALARKkgPLVFGEPIAASLGTdgthywsknwakaaafvtspp  287
DSSP  --LEEEEEELlhHHHHHHHHHHHhlLLEEEEELHHHHHLllhhhhlllhhhhhhllllll


DSSP  -----HHHHHHHHHL-LHHHEEELLLLL------------------LLEElleelLHHHH
Query -----QKGAALIRSM-PRDRVLTETDGP------------------FLELdgqaaLPWDV  211
ident           |       |   |                                     
Sbjct lspdpTTPDYLTSLLaCGDLQVTGSGHCpystaqkavgkdnftlipEGVN-----GIEER  342
DSSP  lllllLHHHHHHHHHhHLLLLLLLLLLLlllhhhhhhhlllhhhllLLLL-----LLLLH


DSSP  HHHHH-HHHHHHLLLhHHHHHHH-HHHHHHHHH---------------------------
Query KSVVE-GLSKIWQIPaSEVERIV-KENVSRLLG---------------------------  242
ident   ||                  |   |                                 
Sbjct MTVVWdKAVATGKMD-ENQFVAVtSTNAAKIFNlyprkgriavgsdadvviwdpdklkti  401
DSSP  HHHHHhHHLLLLLLL-HHHHHHHhLHHHHHHHLllllllllllllllleeeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct takshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyq  461
DSSP  llllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhh


DSSP  ---------------l
Query ---------------t  243
ident                 
Sbjct rvkirnkvfglqgvsr  477
DSSP  hhhhhhhhllllllll


No 26: Query=3gg7A Sbjct=2ffiA Z-score=14.6

back to top
DSSP  ---LLEEEEELhHHLL----------------LHHHHHHHHHHLLL-EEEELLL---LHH
Query ---SLIDFHVHlDLYP----------------DPVAVARACEERQL-TVLSVTT---TPA   37
ident      || | |                                        |        
Sbjct lhlTAIDSHAH-VFSRglnlasqrryapnydaPLGDYLGQLRAHGFsHGVLVQPsflGTD   59
DSSP  lllLLEELLLL-LLLHhhhhhlllllllllllLHHHHHHHHHHLLLlEELLLLLhhhLLL


DSSP  HhHHHHHHHLLL-LLEEELLLLlhhhllllhhHLHHHHHHHHH-----LLEEEeEELLLL
Query AwRGTLALAAGR-PHVWTALGFhpevvseraaDLPWFDRYLPE-----TRFVGeVGLDGS   91
ident   |  |                                  | |      | |    | | 
Sbjct N-RYLLSALQTVpGQLRGVVXL----------ERDVEQATLAExarlgVRGVR-LNLXGQ  107
DSSP  L-HHHHHHHHHLlLLLLLLLLL----------LLLLLHHHHHHhhlllLLEEE-LLLLLL


DSSP  hhhhhhhhHHHH----hhHHHHHHHHHLlLEEEEEELL-LLHHHHHHHHHHLHhhEEEEE
Query pslrgtwtQQFA----vfQHILRRCEDHgGRILSIHSR-RAESEVLNCLEANPrsGTPIL  146
ident                      | |     |     |            |           
Sbjct --------DXPDltgaqwRPLLERIGEQ-GWHVELHRQvADIPVLVRALQPYG--LDIVI  156
DSSP  --------LLLLllllllHHHHHHHHHH-LLEEEELLLlLLHHHHHHHHLLLL--LLEEE


DSSP  E-LLLL---------LHHHHH-HHHHLLLEEEELHH-------hhLLHHHHHHHHHL---
Query H-WYSG---------SVTELR-RAISLGCWFSVGPT-------mvRTQKGAALIRSM---  185
ident                   ||         |  |                           
Sbjct DhFGRPdarrglgqpGFAELLtLSGRGKVWVKVSGIyrlqgspeeNLAFARQALCALeah  216
DSSP  LhHHLLlllllllllLHHHHLlLLLLLLEEEEEELHhhllllhhhHHHHHHHHHHHHhhh


DSSP  -LHHHEEELLLLLLLEELLEELLhHHHHHHHHHHhhHHLLlhhHHHHHH-HHHHHHHHH-
Query -PRDRVLTETDGPFLELDGQAALpWDVKSVVEGLskIWQIpasEVERIV-KENVSRLLG-  242
ident     |     | |                  | |                      | | 
Sbjct yGAERLXWGSDWPHTQHESEVSF-GSAVEQFEAL--GCSA---QLRQALlLDTARALFGf  270
DSSP  lLHHHEEEELLLLLLLLLLLLLH-HHHHHHHHHH--LLLH---HHHHHHhLHHHHHHLLl


DSSP  --l
Query --t  243
ident    
Sbjct ele  273
DSSP  lll


No 27: Query=3gg7A Sbjct=3pnuA Z-score=14.4

back to top
DSSP  -------------LLEEEEELHHHlLLHHHHHHHHHHLLLEEEELL----LLHH--HHHH
Query -------------SLIDFHVHLDLyPDPVAVARACEERQLTVLSVT----TTPA--AWRG   41
ident                 | | ||         |                            
Sbjct enlyfqsnamklkNPLDMHLHLRDnQMLELIAPLSARDFCAAVIMPnlipPLCNleDLKA   60
DSSP  llllllllleeeeLLEEEEELLLLhHHHHHHHHHHHLLLLEEEELLllllLLLLhhHHHH


DSSP  HHH-HHLLL----LLEEELLLLlhhhllllhhhlHHHHHHHHHLLEEEeEELLLLhhhhh
Query TLA-LAAGR----PHVWTALGFhpevvseraadlPWFDRYLPETRFVGeVGLDGSpslrg   96
ident                    | |                    |          |      
Sbjct YKMrILKACkdenFTPLMTLFF-------knydeKFLYSAKDEIFGIX-LYPAGIttnsn  112
DSSP  HHHhHHHHHllllLEEEEEEEL-------llllhHHHHHHLLLLLEEE-ELLLLLlllll


DSSP  hhhHHHH--hHHHHHHHHHHLlLEEEEEELLL----------LHHHHHHHHHHLHHHeEE
Query twtQQFA--vFQHILRRCEDHgGRILSIHSRR----------AESEVLNCLEANPRSgTP  144
ident      |        |    |     |  |                         ||    
Sbjct ggvSSFDieyLKPTLEAMSDL-NIPLLVHGETndfvmdresnFAKIYEKLAKHFPRL-KI  170
DSSP  lllLLLLhhhHHHHHHHHHHL-LLLEEELLLLlllhhhllhhHHHHHHHHHHHLLLL-LE


DSSP  EEELLLlLHHHHHHHHHLL-LEEEELHHHHLL----------------------HHHHHH
Query ILHWYSgSVTELRRAISLG-CWFSVGPTMVRT----------------------QKGAAL  181
ident          |                                                  
Sbjct VMEHIT-TKTLCELLKDYEnLYATITLHHLIItlddviggkmnphlfckpiakrYEDKEA  229
DSSP  EELLLL-LHHHHHHHHHLLlEEEEELLHHHLLlhhhhhlllllhhhllllllllHHHHHH


DSSP  HHHL---lHHHEEELLLLLL-leeLLEE-LLHHHHHHhHHHHHHhHLLLhHHHHHHH-HH
Query IRSM---pRDRVLTETDGPF-lelDGQA-ALPWDVKSvVEGLSKiWQIPaSEVERIV-KE  235
ident            |    |                        | |       |        
Sbjct LCELafsgYEKVMFGSDSAPhpkgCAAGvFSAPVILPvLAELFK-QNSS-EENLQKFlSD  287
DSSP  HHHHhhllLLLEEELLLLLLllllLLLLlLLHHHHHHhHHHHHH-HHLL-HHHHHHHhLH


DSSP  HHHHHHH-------------------------------------------l
Query NVSRLLG-------------------------------------------t  243
ident |                                                  
Sbjct NTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  HHHHHHLllllllleeeeellleelllleelllleellllllleelleell


No 28: Query=3gg7A Sbjct=4c5yA Z-score=14.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -LLEEEEELhHHLL--------------------LHHHHHHHHHHLLL-EEEELLllhhh
Query -SLIDFHVHlDLYP--------------------DPVAVARACEERQL-TVLSVTttpaa   38
ident   | | | |                                                   
Sbjct pGLWDCHMH-FGGDddyyndytsglathpassgaRLARGCWEALQNGYtSYRDLA-----  114
DSSP  eLEEEEEEL-LLLLlllllllhhhhhllhhhhhhHHHHHHHHHHHLLEeEEEELL-----


DSSP  hhHHHHHHLLL-------LLEEEL-LLLL---HHHL----------lLLHH---------
Query wrGTLALAAGR-------PHVWTA-LGFH---PEVV----------sERAA---------   68
ident        |          | |                                       
Sbjct -gYGCEVAKAIndgtivgPNVYSSgAALSqtaGHGDifalpagevlgSYGVmnprpgywg  173
DSSP  -lLHHHHHHHHhllllllLEEEELlLEEElllLLLLlllllhhhhhhHHLLlllllllll


DSSP  -----------HLHHH-HHHHH-HLLEEEeEELLL---lHHHH-hhhhhHHHHHHHHHHH
Query -----------DLPWF-DRYLP-ETRFVGeVGLDG---sPSLR-gtwtqQFAVFQHILRR  111
ident                               |   |                     |   
Sbjct agplciadgveEVRRAvRLQIRrGAKVIX-VMASGgvmsRDDNpnfaqfSPEELKVIVEE  232
DSSP  llleeelllhhHHHHHhHHHHHhLLLLEE-EELLLllllLLLLllllllLHHHHHHHHHH


DSSP  HHHLlLEEEEEELLL--LHHHHHHHHhhlhhheeEEEELLL-LLHHHHHHHHHLLLEEEE
Query CEDHgGRILSIHSRR--AESEVLNCLeanprsgtPILHWYS-GSVTELRRAISLGCWFSV  168
ident       || | |                        |   |             |     
Sbjct AARQ-NRIVSAHVHGkaGIMAAIKAG-------cKSLEHVSyADEEVWELMKEKGILYVA  284
DSSP  HHHL-LLLEEEEELLhhHHHHHHHHL-------lLEEEELLlLLHHHHHHHHHHLLEEEL


DSSP  L-HHHH--------------------lLHHHHHHHHHLL--hhHEEELLLLLlleellee
Query G-PTMV--------------------rTQKGAALIRSMP--rdRVLTETDGPfleldgqa  205
ident                                                 ||          
Sbjct TrSVIEiflasngeglvkeswaklqalADSHLKAYQGAIkagvTIALGTDTA--------  336
DSSP  LhHHHHhhhhhllllllllhhhlllhhHHHHHHHHHHHHhlllLEELLLLLL--------


DSSP  lLHHHhHHHHHHHHHHHLLLHHHHHHHHHHHHHH--HHHL--------------------
Query aLPWDvKSVVEGLSKIWQIPASEVERIVKENVSR--LLGT--------------------  243
ident                       |       |                             
Sbjct pGGPT-ALELQFAVERGGMTPLEAIKAATANAPLsvGPQApltgqlregyeadvialeen  395
DSSP  lLLLL-HHHHHHHHHLLLLLHHHHHHHHLLLHHHhhHHHLllllllllllllleeeelll


DSSP  -----------------------------------------
Query -----------------------------------------  243
ident                                          
Sbjct pledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  llllhhhhhlhhheeeeeelleeeellllllllllllllll


No 29: Query=3gg7A Sbjct=4mupB Z-score=14.3

back to top
DSSP  ----------------LLEEEEELHH---------------hlLLHHHHHHHHHH--LLL
Query ----------------SLIDFHVHLD---------------lyPDPVAVARACEE--RQL   27
ident                    |   |                          |         
Sbjct lvrklsgtapnpafprGAVDTQMHMYlpgypalpggpglppgaLPGPEDYRRLMQwlGID   60
DSSP  llllllllllllllllLLEELLLLLLlllllllllllllllllLLLHHHHHHHHHhhLLL


DSSP  EEEELLL--LHHHHHHHHHHHLL-LLLEEELLLllhhhllllhhhLHHHH-HHHHH----
Query TVLSVTT--TPAAWRGTLALAAG-RPHVWTALGfhpevvseraadLPWFD-RYLPE----   79
ident  |              |||  |                                      
Sbjct RVIITQGnaHQRDNGNTLACVAEmGEAAHAVVI----------idATTTEkDMEKLtaag  110
DSSP  EEEEELLhhHLLLLHHHHHHHHHhHHHEEEEEL----------llLLLLHhHHHHHhhll


DSSP  LLEEEeEELLLlhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL-LLHHHHHHHHHHL
Query TRFVGeVGLDGspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR-RAESEVLNCLEAN  138
ident |                              |                     |  |   
Sbjct TVGAR-IMDLP------ggavNLSELDAVDERAHAA-DWMVAVQFDgNGLLDHLPRLQKI  162
DSSP  EEEEE-EELLL------llllLHHHHHHHHHHHHHL-LLEEEEELLhHHHHHHHHHHHLL


DSSP  hhHEEEEEEL-LLLL------hHHHHHHHHLL----LEEEELHH------hhLLHHHHHH
Query prSGTPILHW-YSGS------vTELRRAISLG----CWFSVGPT------mvRTQKGAAL  181
ident                        |      |      ||                  || 
Sbjct --RSRWVFDHhGKFFkgirtdgPEMAALLKLIdrgnLWFKFAGVyessrkswPYADVAAF  220
DSSP  --LLEEEELHhHHLLlllllllHHHHHHHHHHhhllEEEEELLHhhllllllLLHHHHHH


DSSP  HHHL---LHHHEEELLLLLLLEE---LLEEllhhHHHHHhHHHHHHHLLlhHHHHHHH-H
Query IRSM---PRDRVLTETDGPFLEL---DGQAalpwDVKSVvEGLSKIWQIpaSEVERIV-K  234
ident  |        |    |  |               |     |                   
Sbjct SRVIaahAPERIVWGTNWPHNSVretAAYP---dDARLA-ELTLGWLPD--EAARHRAlV  274
DSSP  HHHHhhhLHHHEEELLLLLLLLLllhHHLL---lHHHHH-HHHHLLLLL--HHHHHHHhL


DSSP  HHHHHHHH---l
Query ENVSRLLG---t  243
ident ||   |      
Sbjct ENPEALFKlspv  286
DSSP  HHHHHHHLllll


No 30: Query=3gg7A Sbjct=2ogjA Z-score=14.2

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------SLID    4
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  EEELHH---HLLLHhhHHHH-HHHLLL-EEEELL-LLHHHHHHHHH-HHLLL-LLEEELL
Query FHVHLD---LYPDPvaVARA-CEERQL-TVLSVT-TTPAAWRGTLA-LAAGR-PHVWTAL   56
ident  |||                   ||   |         |   |                |
Sbjct LHVHIWhggTDISI--RPSEcGAERGVtTLVDAGsAGEANFHGFREyIIEPSrERIKAFL  118
DSSP  EEELLLlllLLLLL--LHHHlLHHHLEeEEEEELlLLLLLHHHHHHhLLLLLlLEEEEEE


DSSP  LLL---------hHHLLLlHHHLH--HHHHHHHH----LLEEEeEELLLLhhhhhHHHHh
Query GFH---------pEVVSErAADLP--WFDRYLPE----TRFVGeVGLDGSpslrgTWTQq  101
ident                      |           |          |               
Sbjct NLGsiglvacnrvPELRD-IKDIDldRILECYAEnsehIVGLX-VRASHV---itGSWG-  172
DSSP  ELLllllllllllLLLLL-HHHLLhhHHHHHHHLllllEEEEE-EEELHH---hhLLLL-


DSSP  HHHHHHHHHHHHHLlLEEEEEELLL---LHHHHHHHHHhlhhheEEEEELL------LLL
Query FAVFQHILRRCEDHgGRILSIHSRR---AESEVLNCLEanprsgTPILHWY------SGS  152
ident                      |         |||  |                    |  
Sbjct VTPVKLGKKIAKIL-KVPXXVHVGEppaLYDEVLEILG-----pGDVVTHCfngksgSSI  226
DSSP  LHHHHHHHHHHHHH-LLLEEEEELLlllLHHHHHHHLL-----lLLEEELLllllllLLL


DSSP  H---HHHHHHHHL-LLEEEELH---HHHLlHHHHHHH-HHLLhhHEEELLLLL-LLEEll
Query V---TELRRAISL-GCWFSVGP---TMVRtQKGAALI-RSMPrdRVLTETDGP-FLELdg  203
ident          |    |     |             | | |          ||         
Sbjct XedeDLFNLAERCeGIRLDIGHggaSFSF-KVAEAAIaRGLL--PFSISTDLHgHSXN--  281
DSSP  LllhHHHHHHHHLlLLEEELLLlllLLLH-HHHHHHHhLLLL--LLLLLLLLLlLLLL--


DSSP  EELLhhHHHHHHHHHHHHHlLLHHHHHHHHHHHHHHHHH---------------------
Query QAALpwDVKSVVEGLSKIWqIPASEVERIVKENVSRLLG---------------------  242
ident       |       |      |   |   |  |                           
Sbjct FPVW--DLATTXSKLLSVD-XPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlv  338
DSSP  LLLL--LHHHHHHHHHHLL-LLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeee


DSSP  ----------------------------------------l
Query ----------------------------------------t  243
ident                                          
Sbjct dadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 31: Query=3gg7A Sbjct=3qy6A Z-score=14.1

back to top
DSSP  lLEEEEELHH-----HLLL---HHHHHHHHHHLLL-EEEELLL--------LHHH-HHHH
Query sLIDFHVHLD-----LYPD---PVAVARACEERQL-TVLSVTT--------TPAA-WRGT   42
ident   || | |          |       |||       |               |||     
Sbjct -MIDIHCHILpamddGAGDsadSIEMARAAVRQGIrTIIATPHhnngvyknEPAAvREAA   59
DSSP  -LEELLLLLLlllllLLLLhhhHHHHHHHHHHLLLlEEELLLEelllllllLHHHhHHHH


DSSP  HHHHL------LLLLEEELllllhhhllllhhhlhhhhhhhhhlleeEEEELlllhhhhh
Query LALAA------GRPHVWTAlgfhpevvseraadlpwfdrylpetrfvGEVGLdgspslrg   96
ident   |           ||                                |           
Sbjct DQLNKrlikedIPLHVLPG----------------------------QEIRI--------   83
DSSP  HHHHHhhhhllLLLEEELL----------------------------LEEEL--------


DSSP  hhhhhhhhHHHHHHHHHHL------llEEEEEELL-LLHH-HHHHHHHHLH-HHEEEEEE
Query twtqqfavFQHILRRCEDH------ggRILSIHSR-RAES-EVLNCLEANP-RSGTPILH  147
ident                                |                        |   
Sbjct --------YGEVEQDLAKRqllslndtKYILIEFPfDHVPrYAEQLFYDLQlKGYIPVIA  135
DSSP  --------LLLHHHHHHLLllllhhhlLEEEEELLlLLLLlLHHHHHHHHHhLLLEEEEE


DSSP  LLL------lLHHHHHHHHHLLLEEEELHHHH-------LLHHHHHHHHHLLhhHEEELL
Query WYS------gSVTELRRAISLGCWFSVGPTMV-------RTQKGAALIRSMPrdRVLTET  194
ident               |      |                        |             
Sbjct HPErnreireNPSLLYHLVEKGAASQITSGSLagifgkqLKAFSLRLVEANL--IHFVAS  193
DSSP  LHHhlhhhhhLLHHHHHHHHLLLEEEEEHHHHlllllhhHHHHHHHHHHLLL--LLEEEL


DSSP  LLLlleellEELLHhHHHHHHHHHHHHHLLlhhHHHHHHHHHHHHHHHL-----------
Query DGPfleldgQAALPwDVKSVVEGLSKIWQIpasEVERIVKENVSRLLGT-----------  243
ident |                      | |       |      ||   ||             
Sbjct DAH----nvKTRNF-HTQEALYVLEKEFGS---ELPYMLTENAELLLRNqtifrqppqpv  245
DSSP  LLL----llLLLLL-LHHHHHHHHHHHHLL---HHHHHHHHHHHHHHLLlllllllllll


DSSP  --
Query --  243
ident   
Sbjct kr  247
DSSP  ll


No 32: Query=3gg7A Sbjct=4ofcA Z-score=14.1

back to top
DSSP  LLEEEEELHH-----------------------------------------hLLLHHHHH
Query SLIDFHVHLD-----------------------------------------lYPDPVAVA   19
ident   || | |                                              ||    
Sbjct MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
DSSP  LLEEEEEELLllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH


DSSP  HHHHHLLL-EEEELLL----------------lhHHHHHHHHHHLLL-LLEEELLLLlhh
Query RACEERQL-TVLSVTT----------------tpAAWRGTLALAAGR-PHVWTALGFhpe   61
ident |             |                                             
Sbjct REMDQKGVtVQALSTVpvmfsywakpedtlnlcqLLNNDLASTVVSYpRRFVGLGTL---  117
DSSP  HHHHHHLLlEEEEELLhhhhlllllhhhhhhhhhHHHHHHHHHHHHLlLLEEEEELL---


DSSP  HLLLlHHHL-HHHHHHHH--HLLEEEeEELLllhhhhHHHH-hHHHHhHHHHHHHHHLlL
Query VVSErAADL-PWFDRYLP--ETRFVGeVGLDgspslrGTWT-qQFAVfQHILRRCEDHgG  117
ident               |         |   |          |               |    
Sbjct PMQA-PELAvKEMERCVKelGFPGVQ-IGTH-----vNEWDlnAQEL-FPVYAAAERL-K  168
DSSP  LLLL-HHHHhHHHHHHHHllLLLEEE-EELE-----eLLEEllLHHH-HHHHHHHHHH-L


DSSP  EEEEEE------------------------LLLLHHHHH--HHHHHLHHhEEEEEE-LLL
Query RILSIH------------------------SRRAESEVL--NCLEANPRsGTPILH-WYS  150
ident   |  |                           |          |  |            
Sbjct CSLFVHpwdmqmdgrmakywlpwlvgmpaeTTIAICSMImgGVFEKFPK-LKVCFAhGGG  227
DSSP  LEEEEElllllllhhhhlllhhhhlhhhhhHHHHHHHHHllLHHHHLLL-LLEEELhHHL


DSSP  L-LHHH---------------------hHHHHHlLLEEEELhhHHLLHHHHHHHHHLLHH
Query G-SVTE---------------------lRRAISlGCWFSVGptMVRTQKGAALIRSMPRD  188
ident     |                                               |      |
Sbjct AfPFTVgrishgfsmrpdlcaqdnpmnpKKYLG-SFYTDAL--VHDPLSLKLLTDVIGKD  284
DSSP  LhHHHHhhhhhhhhhlhhhhlllllllhHHHLL-LLEEELL--LLLHHHHHHHHHHHLLL


DSSP  HEEELLLLLLLEelleellhHHHHHHHHHhHHHHLllhHHHHHHH-HHHHHHHHH-----
Query RVLTETDGPFLEldgqaalpWDVKSVVEGlSKIWQipaSEVERIV-KENVSRLLG-----  242
ident  |   || ||                 |           |        |    ||     
Sbjct KVILGTDYPFPL------geLEPGKLIES-MEEFD---EETKNKLkAGNALAFLGlerkq  334
DSSP  LEELLLLLLLLL------llLLLLHHHHH-LLLLL---HHHHHHHhLHHHHHHHLllhhh


DSSP  l
Query t  243
ident  
Sbjct f  335
DSSP  l


No 33: Query=3gg7A Sbjct=1onxA Z-score=13.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --LLEEEEELHHH----------LLLHhhHHHHHHHLLL-EEEELLL---lhhHHHHHHH
Query --SLIDFHVHLDL----------YPDPvaVARACEERQL-TVLSVTT---tpaAWRGTLA   44
ident     || ||||             |          |     |                ||
Sbjct cpGFIDQHVHLIGgggeagpttrTPEV--ALSRLTEAGVtSVVGLLGtdsisrHPESLLA  118
DSSP  eeLEEEEEELLLLllllllhhhlLLLL--LHHHHHHLLEeEEEELLLllllllLHHHHHH


DSSP  HHLLL----LLEEELLLLLHhhllllhhhlHHHHHHHHH---LLEEEeEELLLLhhhhhH
Query LAAGR----PHVWTALGFHPevvseraadlPWFDRYLPE---TRFVGeVGLDGSpslrgT   97
ident             |   |                            |              
Sbjct KTRALneegISAWMLTGAYH---vpsrtitGSVEKDVAIidrVIGVX-CAISDH---rsA  171
DSSP  HHHHHhhhlLEEEEEEELLL---lllllllLLHHHHHHHlllEEEEE-EEELLL---llL


DSSP  HHHhHHHHHHHHHHHHHLL-----lEEEEEELLL---LHHHHHHHHH-HLHHheEEEEEL
Query WTQqFAVFQHILRRCEDHG-----gRILSIHSRR---AESEVLNCLE-ANPRsgTPILHW  148
ident                   |           |      |       ||             
Sbjct APD-VYHLANMAAESRVGGllggkpGVTVFHMGDskkALQPIYDLLEnCDVPisKLLPTH  230
DSSP  LLL-HHHHHHHHHHHHHHHhhhlllLEEEEEELLlllLLHHHHHHHHlLLLLhhHEEEEL


DSSP  L-LLLH--HHHHHHHHLLLEEEELHHHhlLHHHH--HHHHHL-----LHHHEEELLLLLL
Query Y-SGSV--TELRRAISLGCWFSVGPTMvrTQKGA--ALIRSM-----PRDRVLTETDGPF  198
ident                  |               |    |        |  ||    ||  
Sbjct VnRNVPlfEQALEFARKGGTIDITSSI--DEPVApaEGIARAvqagiPLARVTLSSDGNG  288
DSSP  HhHLHHhhHHHHHHHHLLLLEEEELLL--LLLLLhhHHHHHHhhlllLHHHEEEELLLLL


DSSP  LE---------eLLEELLHHHHHHHHHHHHHHHLLLhHHHHHHH-HHHHHHHHH------
Query LE---------lDGQAALPWDVKSVVEGLSKIWQIPaSEVERIV-KENVSRLLG------  242
ident                 |        |  | |                 |   |       
Sbjct SQpffddegnltHIGVAGFETLLETVQVLVKDYDFS-ISDALRPlTSSVAGFLNltgkge  347
DSSP  EEeeellllleeEEEELLLHHHHHHHHHHHHHHLLL-HHHHHHHhLHHHHHHLLllllll


DSSP  ------------------------------------------l
Query ------------------------------------------t  243
ident                                            
Sbjct ilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  lllllllleeeellllleeeeeelleeeeelleelllllllll


No 34: Query=3gg7A Sbjct=2gwgA Z-score=13.8

back to top
DSSP  LLEEEEELhHHLL------------------------------------LHHH-HHHHHH
Query SLIDFHVHlDLYP------------------------------------DPVA-VARACE   23
ident   || | |                                                    
Sbjct XIIDIHGH-YTTApkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQ   59
DSSP  LLEEEEEE-LLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHH


DSSP  HLL-LEEEELLL----------lhHHHHHHHHHHLLL-LLEEELLLLlhhHLLLLH--HH
Query ERQ-LTVLSVTT----------tpAAWRGTLALAAGR-PHVWTALGFhpeVVSERA--AD   69
ident ||                                         |                
Sbjct ERGsDLTVFSPRagdfnvsstwaaICNELCYRVSQLFpDNFIGAAXL--pQSPGVDpkTC  117
DSSP  HHLlLEEEEELLlllhhhhhhhhhHHHHHHHHHHHHLlLLEEEEEEL--lLLLLLLhhHH


DSSP  LHHHHHHHH--HLLEEEeEELL-lLHHHhHHHHhhHHHHHHHHHHHHHLlLEEEEEE---
Query LPWFDRYLP--ETRFVGeVGLD-gSPSLrGTWTqqFAVFQHILRRCEDHgGRILSIH---  123
ident  |                   |                   |             ||   
Sbjct IPELEKCVKeyGFVAIN-LNPDpsGGHW-TSPPltDRIWYPIYEKXVEL-EIPAXIHvst  174
DSSP  HHHHHHHHHllLLLEEE-ELLLllLLLL-LLLLllLHHHHHHHHHHHHH-LLLEEELlll


DSSP  -------LLLLHHHHH--HHHHHLHHhEEEEEE-LLLL-LHHH---------------hH
Query -------SRRAESEVL--NCLEANPRsGTPILH-WYSG-SVTE---------------lR  157
ident           |             |                                   
Sbjct gahylnaDTTAFXQCVagDLFKDFPE-LKFVIPhGGGAvPYHWgrfrglaqexkkplleD  233
DSSP  llhhhhhHHHHHHHHHhlLHHHHLLL-LLEEELhHHLLlHHHHhhhhhhhhhlllllhhH


DSSP  HHHhLLLEEEELHHhhLLHHHHHHHHHLLHHHEEELLLLLLLEELL---eellhhHHHHH
Query RAIsLGCWFSVGPTmvRTQKGAALIRSMPRDRVLTETDGPFLELDG---qaalpwDVKSV  214
ident         |              |    | | ||                     | |  
Sbjct HVL-NNIFFDTCVY--HQPGIDLLNTVIPVDNVLFASEXIGAVRGIdprtgfyydDTKRY  290
DSSP  HLL-LLEEEELLLL--LHHHHHHHHHHLLHHHEELLLLLLLLLLLEelllleellLLHHH


DSSP  HHHhHHHHLllhHHHHHHH-HHHHHHHHH-------------l
Query VEGlSKIWQipaSEVERIV-KENVSRLLG-------------t  243
ident  |  | |      |        |  |                 
Sbjct IEA-STILT---PEEKQQIyEGNARRVYPrldaalkakgkleh  329
DSSP  HHH-LLLLL---HHHHHHHhLHHHHHHLHhhhhhhhhhhhhll


No 35: Query=3gg7A Sbjct=2dvtA Z-score=13.8

back to top
DSSP  --LLEEEEELHH----------------------HLLLHHH-HHHHHHHLLL-EEEELL-
Query --SLIDFHVHLD----------------------LYPDPVA-VARACEERQL-TVLSVT-   33
ident          |                           |               |      
Sbjct mqGKVALEEHFAipetlqdsagfvpgdywkelqhRLLDIQDtRLKLMDAHGIeTMILSLn   60
DSSP  llLEEEEEEEELlhhhhhhhlllllllhhhhhhhHHHLLLLhHHHHHHHLLEeEEEEEEl


DSSP  ---------------lLHHHHHHHHHHHLLL-LLEEELLLLlhhHLLLlHHHL-HHHHHH
Query ---------------tTPAAWRGTLALAAGR-PHVWTALGFhpeVVSErAADL-PWFDRY   76
ident                    |        | |                           | 
Sbjct apavqaipdrrkaieiARRANDVLAEECAKRpDRFLAFAAL---PLQD-PDAAtEELQRC  116
DSSP  llhhhhlllhhhhhhhHHHHHHHHHHHHHHLlLLEEEEELL---LLLL-HHHHhHHHHHH


DSSP  HH--HLLEEEeEELL-llhHHHHHhhHHHH--hhHHHHHHHHHLlLEEEEEE--------
Query LP--ETRFVGeVGLD-gspSLRGTwtQQFA--vfQHILRRCEDHgGRILSIH--------  123
ident            |                             |         |        
Sbjct VNdlGFVGAL-VNGFsqegDGQTP--LYYDlpqyRPFWGEVEKL-DVPFYLHprnplpqd  172
DSSP  HHllLLLEEE-EELLllllLLLLL--LLLLlhhhHHHHHHHHHH-LLLEEEElllllhhh


DSSP  ----------------LLLL-HHHHHHH-----HHHLHHhEEEEEEL-LLLLHHH-----
Query ----------------SRRA-ESEVLNC-----LEANPRsGTPILHW-YSGSVTE-----  155
ident                          |           ||    ||     |         
Sbjct sriydghpwllgptwaFAQEtAVHALRLmasglFDEHPR-LNIILGHmGEGLPYMmwrid  231
DSSP  lhhhlllhhhlhhhlhHHHHhHHHHHHHhhllhHHHLLL-LLEEELHhHLLHHHHhhhhh


DSSP  -----------------hHHHHHLLLEEEELHHHHllhhhHHHHHHL----LHHHEEELL
Query -----------------lRRAISLGCWFSVGPTMVrtqkgAALIRSM----PRDRVLTET  194
ident                                                      || |  |
Sbjct hrnawvklpprypakrrfMDYFNENFHITTSGNFR-----TQTLIDAileiGADRILFST  286
DSSP  hllllllllllllllllhHHHHHHHEEEELLLLLL-----HHHHHHHhlllLHHHEELLL


DSSP  LLLLleelleeLLHHHHHHHHHHHhhHHLLlhhHHHHHH-HHHHHHHHH-l
Query DGPFleldgqaALPWDVKSVVEGLskIWQIpasEVERIV-KENVSRLLG-t  243
ident | ||                                      |  ||    
Sbjct DWPF-------ENIDHASDWFNAT--SIAE---ADRVKIgRTNARRLFKld  325
DSSP  LLLL-------LLHHHHHHHHHHL--LLLH---HHHHHHhLHHHHHHLLll


No 36: Query=3gg7A Sbjct=1yrrB Z-score=13.6

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------SLIDFHVH    8
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  -----HHHLL---lHHHHHHHHHHLL-----LEEEELLLLHH--HHHHHHHHHL-----L
Query -----LDLYP---dPVAVARACEERQ-----LTVLSVTTTPA--AWRGTLALAA-----G   48
ident                |                  |    |                    
Sbjct gcggvQFNDTaeavSVETLEIMQKANeksgcTNYLPTLITTSdeLMKQGVRVMReylakH  120
DSSP  eelleELLLLllllLHHHHHHHHHHHhllleEEEEEEELLLLhhHHHHHHHHHHhhhhhL


DSSP  LLLE-EELLLLLHHhllllhhhLHHHHHHHHHL--LEEEEEEllllhhhhhhhhhhHHHH
Query RPHV-WTALGFHPEvvseraadLPWFDRYLPET--RFVGEVGldgspslrgtwtqqFAVF  105
ident         |                 |                               | 
Sbjct PNQAlGLHLEGPWL-------nAALVDFLCENAdvITKVTLA-------------pEMVP  160
DSSP  LLLLlLEEEELLLL-------lLHHHHHHHHLHhhEEEEEEL-------------hHHLL


DSSP  HHHHHHHHHLlLEEEEEELLLLHHHHHHHHHHLhhHEEEeEELLL---LLHH-----HHH
Query QHILRRCEDHgGRILSIHSRRAESEVLNCLEANprSGTPiLHWYS---GSVT-----ELR  157
ident            |   |     |               |             |        
Sbjct AEVISKLANA-GIVVSAGHSNATLKEAKAGFRA--GITF-ATHLYnamPYITgrepgLAG  216
DSSP  HHHHHHHHHH-LLEEEELLLLLLHHHHHHHHHH--LEEE-ELLLLlllLLLLllllhHHH


DSSP  HHHHL-LLEEEELHHhhLLHHHHHHHHHL---LHHHEEELLLLL-LLEElleellhhHHH
Query RAISL-GCWFSVGPTmvRTQKGAALIRSM---PRDRVLTETDGP-FLELdgqaalpwDVK  212
ident                        | ||       |     ||      |           
Sbjct AILDEaDIYCGIIAD--GLHVDYANIRNAkrlKGDKLCLVTDATsGSSL--------TMI  266
DSSP  HHHHLlLLEEEEELL--LLLLLHHHHHHHhhhHHHHEEEELLLLlLLLL--------LHH


DSSP  HHHHHHHHHHLLLHHHHHHHHHHHHHHHHH------------------------------
Query SVVEGLSKIWQIPASEVERIVKENVSRLLG------------------------------  242
ident   |  |     |   || |       |  |                              
Sbjct EGVRNLVEHCGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
DSSP  HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee


DSSP  -------l
Query -------t  243
ident         
Sbjct ngnevvtq  334
DSSP  lleeeeel


No 37: Query=3gg7A Sbjct=3griA Z-score=13.5

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------SLIDFHVH    8
ident                                                        | |||
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  HHH-----LLLHHHHHHHHHHLLL-EEEELL----LLHH--HHHHHHHHHLL--LLLEEE
Query LDL-----YPDPVAVARACEERQL-TVLSVT----TTPA--AWRGTLALAAG--RPHVWT   54
ident |                |       ||                     |        |  
Sbjct LREpggeyKETIETGTKAAARGGFtTVCPXPntrpVPDSveHFEALQKLIDDnaQVRVLP  120
DSSP  LLLlllllLLLHHHHHHHHHHLLEeEEEELLllllLLLLhhHHHHHHHHHHHhlLLEELL


DSSP  LLLL-lhHHLLllhhhLHHHHHHHH-HLLEEEEEellllhhhhhhhhHHHHHHHHHHHHH
Query ALGF-hpEVVSeraadLPWFDRYLP-ETRFVGEVgldgspslrgtwtQQFAVFQHILRRC  112
ident                 |  |                           |            
Sbjct YASIttrQLGK----eLVDFPALVKeGAFAFTDD---------gvgvQTASXXYEGXIEA  167
DSSP  LEELlhhHLLL----lLLLHHHHHLlLLLLEEEL---------llllLLHHHHHHHHHHH


DSSP  HHLlLEEEEEELL---------------------------LLHHHHHHHHH--HLHHHeE
Query EDHgGRILSIHSR---------------------------RAESEVLNCLE--ANPRSgT  143
ident           |                                                 
Sbjct AKV-NKAIVAHCEdnsliyggaxhegkrskelgipgipniCESVQIARDVLlaEAAGC-H  225
DSSP  HHH-LLLEEELLLlhhhllllleellhhhhhhllleellhHHHHHHHHHHHhhHHHLL-L


DSSP  EEEELLLLlHHHHHHHHHLL-----LEEEELHHHHLLH---------------------H
Query PILHWYSGsVTELRRAISLG-----CWFSVGPTMVRTQ---------------------K  177
ident       |      |               | |                            
Sbjct YHVCHVST-KESVRVIRDAKragihVTAEVTPHHLLLTeddipgnnaiykxnpplrsteD  284
DSSP  EEELLLLL-HHHHHHHHHHHhllllEEEEELHHHHHLLhhhlllllhhhllllllllhhH


DSSP  HHHHHHHLLHH-HEEELLLLLL---------leeLLEELL-HHHHHHHHH-HHHHhhLLL
Query GAALIRSMPRD-RVLTETDGPF---------lelDGQAAL-PWDVKSVVE-GLSKiwQIP  225
ident   ||             ||                                   |     
Sbjct REALLEGLLDGtIDCIATDHAPhardekaqpxekAPFGIVgSETAFPLLYtHFVKngDWT  344
DSSP  HHHHHHHHHLLlLLEELLLLLLllhhhhllllllLLLLLLlLLLHHHHHHhHHLLllLLL


DSSP  HHHHHHHHHHHHHHHHH-------------------------------------------
Query ASEVERIVKENVSRLLG-------------------------------------------  242
ident                                                             
Sbjct LQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigyk  404
DSSP  HHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllllllle


DSSP  -----------------l
Query -----------------t  243
ident                   
Sbjct vygnpiltxvegevkfeg  422
DSSP  elleeeeeeelleeeeel


No 38: Query=3gg7A Sbjct=1a4mA Z-score=13.5

back to top
DSSP  ------LLEEEEELHHHLL-----------------------------------------
Query ------SLIDFHVHLDLYP-----------------------------------------   13
ident            |||||                                            
Sbjct tpafnkPKVELHVHLDGAIkpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
DSSP  llllllLEEEEEEEHHHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl


DSSP  ------------------LHHHHHHHHHHLLL-EEEELLLL-------------------
Query ------------------DPVAVARACEERQL-TVLSVTTT-------------------   35
ident                                   |                         
Sbjct kfdyympviagcreaikrIAYEFVEMKAKEGVvYVEVRYSPhllanskvdpmpwnqtegd  120
DSSP  lhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEeEEEEEELLhhhllllllllhhhlllll


DSSP  ---hhHHHHHHHHHLLL-----LLEEELLLLLHHHLlllhHHLHHHHHH-HHHL----LE
Query ---paAWRGTLALAAGR-----PHVWTALGFHPEVVseraADLPWFDRY-LPET----RF   82
ident                         |   |                               
Sbjct vtpddVVDLVNQGLQEGeqafgIKVRSILCCMRHQP----SWSLEVLELcKKYNqktvVA  176
DSSP  llhhhHHHHHHHHHHHHhhhhlLEEEEEEEEELLLH----HHHHHHHHHhHHLLllleEE


DSSP  EEeEELLLLhhhhhHHHHHHH-HHHHHHHHHHHLLLEeEEEEL--LLLHHHHHHHHHHLH
Query VGeVGLDGSpslrgTWTQQFA-VFQHILRRCEDHGGRiLSIHS--RRAESEVLNCLEANP  139
ident       |                           |      |         |        
Sbjct MD-LAGDET-----IEGSSLFpGHVEAYEGAVKNGIH-RTVHAgeVGSPEVVREAVDILK  229
DSSP  EE-EELLLL-----LLLHHHLhHHHHHHHHHHHHLLE-EEEEEllLLLHHHHHHHHHLLL


DSSP  hheEEEEELLLLLHH---HHHHHHHLLLEEEEL-HHHH------lLHHHhhHHHHL--LH
Query rsgTPILHWYSGSVT---ELRRAISLGCWFSVG-PTMV------rTQKGaaLIRSM--PR  187
ident    |                 |       | |                            
Sbjct ---TERVGHGYHTIEdeaLYNRLLKENMHFEVCpWSSYltgawdpKTTH--AVVRFknDK  284
DSSP  ---LLEEEELHHHHHlhhHHHHHHHLLLEEEELhHHHHhllllllLLLL--HHHHHhhLL


DSSP  HHEEELLLLLLLEElleellhhHHHHHHHHHHHHHLLLhHHHHHHHHHHHHHHH------
Query DRVLTETDGPFLELdgqaalpwDVKSVVEGLSKIWQIPaSEVERIVKENVSRLL------  241
ident       || |                      |       |       |           
Sbjct ANYSLNTDDPLIFK-------sTLDTDYQMTKKDMGFT-EEEFKRLNINAAKSSflpeee  336
DSSP  LLEEELLLLLLLLL-------lLHHHHHHHHHHLLLLL-HHHHHHHHHHHHHLLlllhhh


DSSP  -----------hl
Query -----------gt  243
ident              
Sbjct kkellerlyreyq  349
DSSP  hhhhhhhhhhhll


No 39: Query=3gg7A Sbjct=2qpxA Z-score=13.2

back to top
DSSP  ------------LLEEEEELhhHLLL----------------------------------
Query ------------SLIDFHVHldLYPD----------------------------------   14
ident              | | | |     |                                  
Sbjct gxddlsefvdqvPLLDHHCH--FLIDgkvpnrddrlaqvsteadkdypladtknrlayhg   58
DSSP  lllllhhhhhhlLEEEEEEL--LLLLlllllhhhhhhhhlllllllllhhhhlllhhhhh


DSSP  ------------------------hhhhhHHHHHLLL-EEEELLL-lhhhhhHHHH-HHL
Query ------------------------pvavaRACEERQL-TVLSVTT-tpaawrGTLA-LAA   47
ident                              |          |  |          |   | 
Sbjct flalakefaldannplaaxndpgyatynhRIFGHFHFkELLIDTGfvpddpiLDLDqTAE  118
DSSP  hhhhhhhhllllllllllllhhhhhhhhhHHHHHLLEeEEEEELLlllllllLLHHhHHH


DSSP  L-LLLEEELLLLlHHHLlLLHH------------HLHHHHHHHH-HLLEEEeEELLLL--
Query G-RPHVWTALGFhPEVVsERAA------------DLPWFDRYLP-ETRFVGeVGLDGS--   91
ident      |            |                                         
Sbjct LvGIPVKAIYRL-ETHA-EDFXlehdnfaawwqaFSNDVKQAKAhGFVGFX-SIAAYRvg  175
DSSP  HhLLLEEEEEEH-HHHH-HHHHlllllhhhhhhhHHHHHHLLLLlLLLLEE-ELHHHHll


DSSP  ----------------------hhhhHHHHHHHHHHHHHHHHHHHLlLEEEEEELL----
Query ----------------------pslrGTWTQQFAVFQHILRRCEDHgGRILSIHSR----  125
ident                                      |            |  |      
Sbjct lhlepvnvieaaagfdtwkhsgekrlTSKPLIDYXLYHVAPFIIAQ-DXPLQFHVGygda  234
DSSP  lllllllhhhhhhhhhhhhhhlllllLLHHHHHHHHHHHHHHHHHH-LLLEEEEELllll


DSSP  ------LLHHHHHHHHHHLH-HHEEEEEELLLLL-HHHHHHHHHLL-LEEEELHHH----
Query ------RAESEVLNCLEANP-RSGTPILHWYSGS-VTELRRAISLG-CWFSVGPTM----  172
ident                | |         |             |       |          
Sbjct dtdxylGNPLLXRDYLKAFTkKGLKVVLLHCYPYhREAGYLASVFPnLYFDISLLDnlgp  294
DSSP  lllhhhLLHHHHHHHHHHHHhHLLLEEEEELLLLhHHHHHHHHHLLlEEEELLLHHhhlh


DSSP  -hLLHHHHHHHHHLLHHHEEELLLLLlleelleeLLHHH-HHHHHHHHHHHHL-------
Query -vRTQKGAALIRSMPRDRVLTETDGPfleldgqaALPWD-VKSVVEGLSKIWQ-------  223
ident               |  | |   |                       |            
Sbjct sgASRVFNEAVELAPYTRILFASDAS-----typEXYGLaARQFKQALVAHFNqlpfvdl  349
DSSP  hhHHHHHHHHLLLLLHHHEELLLLLL-----llhHHHHHhHHHHHHHHHHHHHllllllh


DSSP  lLHHHHHHHH-HHHHHHHHH------l
Query iPASEVERIV-KENVSRLLG------t  243
ident                  |         
Sbjct aQKKAWINAIcWQTSAKLYHqerelrv  376
DSSP  hHHHHHHHHHhLHHHHHHLLlhhhhll


No 40: Query=3gg7A Sbjct=3giqA Z-score=13.1

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------SLID    4
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  EEELHHHL-LLHHHHhHHHHHLLL-EEEEL---LLLHH---------------------h
Query FHVHLDLY-PDPVAVaRACEERQL-TVLSV---TTTPA---------------------a   38
ident  | | ||         |        ||                                 
Sbjct VHGHDDLMfVEKPDL-RWKTSQGItTVVVGncgVSAAPaplpgntaaalallgetplfad  119
DSSP  LLLLLLLHhHHLLLL-HHHHLLLEeEEEELlllLLLLLllllllllhhhhhhllllllll


DSSP  hHHHHH---hhLLLLLEEELLLLLhhHLLLLHH--------------hLHHHHHHHH-HL
Query wRGTLA---laAGRPHVWTALGFHpeVVSERAA--------------dLPWFDRYLP-ET   80
ident      |          |    |         |                       |    
Sbjct vPAYFAaldaqRPMINVAALVGHA--NLRLAAMrdpqaaptaaeqqamQDMLQAALEaGA  177
DSSP  hHHHHHhhhhlLLLLEEEEEEEHH--HHHHHHLllllllllhhhhhhhHHHHHHHHHhLL


DSSP  LEEEeEELLllhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELLL-------LHHHHHH
Query RFVGeVGLDgspslrgtWTQQFAVFQHILRRCEDHgGRILSIHSRR-------AESEVLN  133
ident       ||            | |      |       |    | |        |  ||| 
Sbjct VGFS-TGLA----yqpgAVAQAAELEGLARVAAER-RRLHTSHIRNeadgveaAVEEVLA  231
DSSP  LEEE-EELL----lllhHHLLHHHHHHHHHHHHHL-LLEEEEELLLllllhhhHHHHHHH


DSSP  HHHHLHhhEEEEEELLLL--------LHHHHHHHHHLL-----LEEEELHH---------
Query CLEANPrsGTPILHWYSG--------SVTELRRAISLG-----CWFSVGPT---------  171
ident                           |   |                  |          
Sbjct IGRGTG--CATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDIYPYpgsstilip  289
DSSP  HHHHHL--LEEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEELLLleeeeellh


DSSP  ---------------------------------------------------hhlLHHHHH
Query ---------------------------------------------------mvrTQKGAA  180
ident                                                             
Sbjct eraetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdEDEVKR  349
DSSP  hhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHHH


DSSP  HHHHLlhhHEEELLLLLlleeLLEE-LLHHHHHHHHHHHH---HHHLllhHHHHHHH-HH
Query LIRSMprdRVLTETDGPflelDGQA-ALPWDVKSVVEGLS---KIWQipaSEVERIV-KE  235
ident               ||           |      |                |        
Sbjct IFQHP---CCMVGSDGL-pndARPHpRLWGSFTRVLGRYVreaRLMT---LEQAVARmTA  402
DSSP  HHHLL---LEEELLLLL-lllLLLLlHHHHHHHHHHHHHHhhlLLLL---HHHHHHHhLH


DSSP  HHHHHHH-----------------------------------------------------
Query NVSRLLG-----------------------------------------------------  242
ident    |  |                                                     
Sbjct LPARVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqp  462
DSSP  HHHHHHLlllllllllllllleeeelllllllllllllllllllleeeeeelleeeelll


DSSP  ------------l
Query ------------t  243
ident              
Sbjct padgrpgqvlrax  475
DSSP  lllllllllllll


No 41: Query=3gg7A Sbjct=4rdvB Z-score=12.9

back to top
DSSP  -------------------------------------------------LLEEEEELHHH
Query -------------------------------------------------SLIDFHVHLDL   11
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFQ   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHH


DSSP  LL------------------------------------LHHHHHHHHHHLLL-EEEELLL
Query YP------------------------------------DPVAVARACEERQL-TVLSVTT   34
ident                                                       |     
Sbjct RAmaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYtAVAEFHY  120
DSSP  HHhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEeEEEEEEL


DSSP  LH------------hHHHHHHHHHLL-LLLEEELLLLlhhHLLL-------------lHH
Query TP------------aAWRGTLALAAG-RPHVWTALGFhpeVVSE-------------rAA   68
ident                        |                                    
Sbjct VHhdldgrsyadpaeLSLRISRAASAaGIGLTLLPVL---YSHAgfggqpasegqrrfIN  177
DSSP  LLllllllllllllhHHHHHHHHHHHhLLEEEEEELL---LLEEellleellhhhlllLL


DSSP  HLHHHHHHHHHL----------LEEEEEELLllhhhhhhhhhHHHHHHHHHHHhhHLLLE
Query DLPWFDRYLPET----------RFVGEVGLDgspslrgtwtqQFAVFQHILRRceDHGGR  118
ident         |                    |                    |     |   
Sbjct GSEAYLELLQRLrapleaaghsLGLCFHSLR---------avTPQQIATVLAA--GHDDL  226
DSSP  LHHHHHHHHHHHhhhhhhhlleELEEELLLL---------llLHHHHHHHHLL--LLLLL


DSSP  EEEEELL---------------LLHHHHHHHHHhlhhheEEEEELLL-LLHHHHHHHHHL
Query ILSIHSR---------------RAESEVLNCLEanprsgTPILHWYS-GSVTELRRAISL  162
ident    ||                 |                   |         |       
Sbjct PVHIHIAeqqkevddcqawsgrRPLQWLYENVA---vdqRWCLVHAThADPAEVAAMARS  283
DSSP  LEEEEELllhhhhhhhhhhhllLHHHHHHHHLL---lllLEEEEELLlLLHHHHHHHHHH


DSSP  LLEEEEL-HHHH--LLHHHhhHHHHLL--hhHEEELLLLllleelleELLHhHHHHHHHH
Query GCWFSVG-PTMV--RTQKGaaLIRSMP--rdRVLTETDGpfleldgqAALPwDVKSVVEG  217
ident |        |                     |     |               |      
Sbjct GAVAGLClSTEAnlGDGIF--PATDFLaqggRLGIGSDS--------HVSL-SVVEELRW  332
DSSP  LLEEEELhHHHHhlLLLLL--LHHHHHhlllEEEELLLL--------LLLL-LHHHHHHH


DSSP  HHHHHL---------------LLHHHHHHHHHHHHHH-HHHL------------------
Query LSKIWQ---------------IPASEVERIVKENVSR-LLGT------------------  243
ident |                                     |                     
Sbjct LEYGQRlrdrkrnrlyrddqpMIGRTLYDAALAGGAQaLGQPigslavgrradllvldgn  392
DSSP  HHHHHHhhhllllllllllllLHHHHHHHHHHHHHHHhHLLLllllllllllleeeelll


DSSP  -----------------------------------------------------------
Query -----------------------------------------------------------  243
ident                                                            
Sbjct dpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  lhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 42: Query=3gg7A Sbjct=4qrnA Z-score=12.8

back to top
DSSP  --------------LLEEEEELHH------------------------------------
Query --------------SLIDFHVHLD------------------------------------   10
ident                 |                                           
Sbjct smtqdlktggeqgyLRIATEEAFAtreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllllLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  -----HLLLHH-HHHHHHHH-LLLEEEELLL----------------lhHHHHHHHHHHL
Query -----LYPDPV-AVARACEE-RQLTVLSVTT----------------tpAAWRGTLALAA   47
ident         |                     |                   |         
Sbjct tqileRLLDLGeRRIADMDAtGIDKAILALTspgvqplhdldeartlatRANDTLADACQ  120
DSSP  hhhhhHHHLLLhHHHHHHHHlLLLEEEEEELlllllllllhhhhhhhhhHHHHHHHHHHH


DSSP  LL-LLEEELLLLlhhhllllhHHLHHHHHH-HHHL-----LEEEeEELLllhhhhhHHHH
Query GR-PHVWTALGFhpevvseraADLPWFDRY-LPET-----RFVGeVGLDgspslrgTWTQ  100
ident                       |  |  |                               
Sbjct KYpDRFIGMGTV-------apQDPEWSAREiHRGArelgfKGIQ-INSH------tQGRY  166
DSSP  HLlLLEEELLLL-------llLLHHHHHHHhHHHHhllllLLEE-ELLL------lLLLL


DSSP  HHH-hhHHHHHHHHHLlLEEEEEE---------------------------LLLLHHHHH
Query QFA-vfQHILRRCEDHgGRILSIH---------------------------SRRAESEVL  132
ident         | |         | ||                                    
Sbjct LDEeffDPIFRALVEV-DQPLYIHpatspdsmidpmleagldgaifgfgveTGMHLLRLI  225
DSSP  LLLhhhHHHHHHHHHH-LLLEEELlllllllllhhhhhhlllllllhhhhhHHHHHHHHH


DSSP  --HHHHHLHHhEEEEEEL--LLLLHHH-------------------------hHHHHHLL
Query --NCLEANPRsGTPILHW--YSGSVTE-------------------------lRRAISLG  163
ident         |                                                   
Sbjct tiGIFDKYPS-LQIMVGHmgEALPYWLyrldymhqagvrsqryermkplkktiEGYLKSN  284
DSSP  hhLHHHHLLL-LLEEELHhhHLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHHHL


DSSP  LEEEELHHhHLLHHHHHHHHHLLHHHEEELLLLLLLEElleellhhHHHHHHHhhHHHHl
Query CWFSVGPTmVRTQKGAALIRSMPRDRVLTETDGPFLELdgqaalpwDVKSVVEglSKIWq  223
ident                      |  |||    | |             |            
Sbjct VLVTNSGV-AWEPAIKFCQQVMGEDRVMYAMDYPYQYV------adEVRAMDA--MDMS-  334
DSSP  EEEELLLL-LLHHHHHHHHHHHLHHHEELLLLLLLLLL------hhHHHHHHL--LLLL-


DSSP  llhHHHHHHH-HHHHHHHHHl
Query ipaSEVERIV-KENVSRLLGt  243
ident              |       
Sbjct ---AQTKKKFfQTNAEKWFKl  352
DSSP  ---HHHHHHHhLHHHHHHLLl


No 43: Query=3gg7A Sbjct=1itqA Z-score=12.6

back to top
DSSP  --------------LLEEEEELHHHLLL------------------hhhHHHH-HHHLLL
Query --------------SLIDFHVHLDLYPD------------------pvaVARA-CEERQL   27
ident                 || |  |                                     
Sbjct dffrdeaerimrdsPVIDGHNDLPWQLLdmfnnrlqderanlttlagthTNIPkLRAGFV   60
DSSP  lhhhhhhhhhhlllLEEEEEELHHHHHHhhhllllllhhhlllllllllLLHHhHHHLLE


DSSP  -EEEELLLL-------------hhHHHHHHHHH----LLLL-----------------LE
Query -TVLSVTTT-------------paAWRGTLALA----AGRP-----------------HV   52
ident         |                                                   
Sbjct gGQFWSVYTpcdtqnkdavrrtleQMDVVHRMCrmypETFLyvtssagirqafregkvAS  120
DSSP  eEEEEEELLlhhhllllhhhhhhhHHHHHHHHHhhllLLEEelllhhhhhhhhhllleEE


DSSP  EELLLlLHHHllllHHHLHHHHHHHHHLLEEEEEE--------lLLLH---HHHHHHHhh
Query WTALGfHPEVvserAADLPWFDRYLPETRFVGEVG--------lDGSP---SLRGTWTqq  101
ident                  |                                          
Sbjct LIGVE-GGHS---iDSSLGVLRALYQLGMRYLTLThscntpwadNWLVdtgDSEPQSQgl  176
DSSP  EEEEE-LHHH---lLLLHHHHHHHHHLLEEEEELLlllllllllLHHHlllLLLLLLLll


DSSP  HHHHHHHHHHHHHLlLEEEEEELLlLHHHHHHHHHHLHhhEEEEE-ELLL---------L
Query FAVFQHILRRCEDHgGRILSIHSRrAESEVLNCLEANPrsGTPIL-HWYS---------G  151
ident     |          |                 |         |  |             
Sbjct SPFGQRVVKELNRL-GVLIDLAHV-SVATMKATLQLSR--APVIFsHSSAysvcasrrnV  232
DSSP  LHHHHHHHHHHHHH-LLEEELLLL-LHHHHHHHHHHLL--LLLEElLLLLlllllllllL


DSSP  LHHHHHHHHHLLLEEEELHH--------------HHLLhhHHHHHHHLLHHHEEELLLLL
Query SVTELRRAISLGCWFSVGPT--------------MVRTqkGAALIRSMPRDRVLTETDGP  197
ident     ||          |                                   |    |  
Sbjct PDDVLRLVKQTDSLVMVNFYnnyisctnkanlsqVADH--LDHIKEVAGARAVGFGGDFD  290
DSSP  LHHHHHHHHHHLLEEEELLLhhhhlllllllhhhHHHH--HHHHHHHLLHHHEEELLLLL


DSSP  LL--EELLeeLLHHHHHHHHHHHHHhHLLLhHHHHHHH-HHHHHHHHHL-----------
Query FL--ELDGqaALPWDVKSVVEGLSKiWQIPaSEVERIV-KENVSRLLGT-----------  243
ident        |              |                  |  |               
Sbjct GVprVPEG-lEDVSKYPDLIAELLR-RNWT-EAEVKGAlADNLLRVFEAveqasnltqap  347
DSSP  LLllLLLL-lLLLLLHHHHHHHHHH-LLLL-HHHHHHHhLHHHHHHHHHhhhllllllll


DSSP  ----------------------
Query ----------------------  243
ident                       
Sbjct eeepipldqlggscrthygyss  369
DSSP  llllllhhhlllllllllllll


No 44: Query=3gg7A Sbjct=1a5kC Z-score=12.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------LLEEEEELHHhlllHHHHHHHHHHLLL-EEEEL------------LLLHH-HH
Query -------SLIDFHVHLDlypdPVAVARACEERQL-TVLSV------------TTTPA-AW   39
ident          || | |          |         |                 |      
Sbjct egkivtaGGIDTHIHWI----CPQQAEEALVSGVtTMVGGgtgpaagthattCTPGPwYI  176
DSSP  llleeeeLEEEEEEELL----LLLHHHHHHHHLEeEEEEElllllhhhhhllLLLHHhHH


DSSP  HHHHHHHLLL-LLEEELLLLLhhhllllhhhLHHHHHHHH-HLLEEEeEELLllhhhhhh
Query RGTLALAAGR-PHVWTALGFHpevvseraadLPWFDRYLP-ETRFVGeVGLDgspslrgt   97
ident    |  |                                            |        
Sbjct SRMLQAADSLpVNIGLLGKGN-------vsqPDALREQVAaGVIGLE-IHED--------  220
DSSP  HHHHHHHLLLlLEEEEEEELL-------lllHHHHHHHHHhLLLEEE-EEHH--------


DSSP  hhhHHHHHHHHHHHHHHLlLEEEEEELLL-----LHHHHHHHHHHLhhheEEEEELLLL-
Query wtqQFAVFQHILRRCEDHgGRILSIHSRR-----AESEVLNCLEANprsgTPILHWYSG-  151
ident      |     |             ||            |          |       | 
Sbjct wgaTPAAIDCALTVADEM-DIQVALHSDTlnesgFVEDTLAAIGGR----TIHTFHTEGa  275
DSSP  hllLHHHHHHHHHHHHHH-LLEEEEELLLlllllLHHHHHHHHLLL----LEEELLLLLl


DSSP  ----LHHHHHhHHHL-LLEEEELHHHHLL-------------------------------
Query ----SVTELRrAISL-GCWFSVGPTMVRT-------------------------------  175
ident            |        |                                       
Sbjct ggghAPDIIT-ACAHpNILPSSTNPTLPYtlntidehldmlmvchhldpdiaedvafaes  334
DSSP  llllLLLHHH-HHHLlLEEEEEEHHHLLLlllhhhhhhhhhhhhhllllllhhhhhllll


DSSP  ----HHHHHHHHHL-LHHHEEELLLLLLLeelleeLLHHHHHHHHHHHHHHHL-------
Query ----QKGAALIRSM-PRDRVLTETDGPFLeldgqaALPWDVKSVVEGLSKIWQ-------  223
ident        ||           ||  |               |                   
Sbjct rirrETIAAEDVLHdLGAFSLTSSDSQAM------GRVGEVILRTWQVAHRMKvqrgala  388
DSSP  lllhHHHHHHHHHHhLLLLLEEELLLLLL------LLLLLHHHHHHHHHHHHHhhhllll


DSSP  -------lLHHHHHHHH-HHHHHHHHH---------------------------------
Query -------iPASEVERIV-KENVSRLLG---------------------------------  242
ident                     |     |                                 
Sbjct eetgdndnFRVKRYIAKyTINPALTHGiahevgsievgkladlvvwspaffgvkpatvik  448
DSSP  lllllllhHHHHHHHHLlLHHHHHHLLllllllllllllllleeeelhhhlllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct ggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrs  508
DSSP  lleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhlllll


DSSP  ---------------------------------------------------------l
Query ---------------------------------------------------------t  243
ident                                                           
Sbjct aiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  eeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 45: Query=3gg7A Sbjct=3e74A Z-score=12.4

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------SLIDFHVH    8
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  HhhllLHHHHHHHHHHLLL-EEEELL-----LLHH--HHHHHHH--hhLLLLLEEELLLL
Query LdlypDPVAVARACEERQL-TVLSVT-----TTPA--AWRGTLA--laAGRPHVWTALGF   58
ident            ||       |           |                         | 
Sbjct I----GYETGTRAAAKGGItTXIEXPlnqlpATVDraSIELKFDaakgKLTIDAAQLGGL  116
DSSP  L----LHHHHHHHHHHLLEeEEEELLlllllLLLLhhHHHHHHHhhllLLLLEEEELEEL


DSSP  lhhhllllHHHLHHHHHHHH-HLLEEeEEELlllhhhhhhhhhHHHHHHHHHHHHHHLlL
Query hpevvserAADLPWFDRYLP-ETRFVgEVGLdgspslrgtwtqQFAVFQHILRRCEDHgG  117
ident                                                |           |
Sbjct -------vSYNIDRLHELDEvGVVGF-XCFV---------rdvNDWQFFKGAQKLGEL-G  158
DSSP  -------lLLLLLLHHHHHHhLLLLE-EEEL---------lllLHHHHHHHHHHHHHH-L


DSSP  EEEEEELLL---------------------------------LHHHHHHHHHHlHHHEeE
Query RILSIHSRR---------------------------------AESEVLNCLEAnPRSGtP  144
ident      |                                    |   ||            
Sbjct QPVLVHCENalicdelgeeakregrvtahdyvasrpvfteveAIRRVLYLAKV-AGCR-L  216
DSSP  LLEEEELLLhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHHHHHHHH-HLLL-E


DSSP  EEELLLlLHHHHHHHHHLL-----LEEEELHHHHLLH---------------------HH
Query ILHWYSgSVTELRRAISLG-----CWFSVGPTMVRTQ---------------------KG  178
ident      | |                      |                             
Sbjct HVCHVS-SPEGVEEVTRARqegqdITCESCPHYFVLDtdqfeeigtlakcsppirdleNQ  275
DSSP  EELLLL-LHHHHHHHHHHHhllllEEEEELLHHHHLLhhhhhhhlhhhllllllllhhHH


DSSP  HHHHHHL-LHHHEEELLLLLL---------leeLLEE-LLHHHHH-HHHHHHHHhHLLLh
Query AALIRSM-PRDRVLTETDGPF---------lelDGQA-ALPWDVK-SVVEGLSKiWQIPa  226
ident                  |                    |                     
Sbjct KGXWEKLfNGEIDCLVSDHSPcppexkagnixkAWGGiAGLQSCXdVXFDEAVQkRGXS-  334
DSSP  HHHHHHHhLLLLLEELLLLLLllllllllllllLLLLlLLHHHHHhHHHHHHLLlLLLL-


DSSP  HHHHHHH-HHHHHHHHH-------------------------------------------
Query SEVERIV-KENVSRLLG-------------------------------------------  242
ident           |     |                                           
Sbjct LPXFGKLxATNAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgr  394
DSSP  HHHHHHHhLHHHHHHLLlllllllllllllleeeeelllleellhhhlllllllllllll


DSSP  ----------------------------------l
Query ----------------------------------t  243
ident                                    
Sbjct tigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  eelleeeeeeelleeeeelllllllllllleelll


No 46: Query=3gg7A Sbjct=4dziC Z-score=12.3

back to top
DSSP  ----LLEEEEELHHH---------------------------------------------
Query ----SLIDFHVHLDL---------------------------------------------   11
ident       ||   |                                                
Sbjct alnyRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  llllLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  ------------------------------------LLLHHHHHHHHHHLLL-EEEELL-
Query ------------------------------------YPDPVAVARACEERQL-TVLSVT-   33
ident                                     |    |      |    |      
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIeTAFMLPt  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEeEEEEELl


DSSP  ------------------lLHHHHHHHHHHH---LLLLLEEELLLLLhhhlllLHHHL-H
Query ------------------tTPAAWRGTLALA---AGRPHVWTALGFHpevvseRAADL-P   71
ident                      |                    |                 
Sbjct fgcgveealkhdieatmasVHAFNLWLDEDWgfdRPDHRIIAAPIVS----laDPTRAvE  176
DSSP  hhhhhhhhllllhhhhhhhHHHHHHHHHHHLlllLLLLLEEELLLLL----llLHHHHhH


DSSP  HHHHHHH-HLLEEEeEELLllhhhhHHHH-hHHHHhHHHHHHHHHLlLEEEEEE------
Query WFDRYLP-ETRFVGeVGLDgspslrGTWT-qQFAVfQHILRRCEDHgGRILSIH------  123
ident   |  |      |  |                         |     |     |      
Sbjct EVDFVLArGAKLVL-VRPApvpglvKPRSlgDRSH-DPVWARLAEA-GVPVGFHlsdsgy  233
DSSP  HHHHHHHlLLLLEE-LLLLllllllLLLLllLHHH-HHHHHHHHHH-LLLEEEEllllll


DSSP  -----------------------LLLLHHHHH--HHHHHLHHHeEEEEELL--LLLHHH-
Query -----------------------SRRAESEVL--NCLEANPRSgTPILHWY--SGSVTE-  155
ident                                         |                   
Sbjct lhiaaawggakdpldqvllddraIHDTMASMIvhGVFTRHPKL-KAVSIENgsYFVHRLi  292
DSSP  hhhhhhllllllhhhhhhhllhhHHHHHHHHHhlLHHHHLLLL-LEEEELLllLHHHHHh


DSSP  ------------------hHHHHhLLLEEEELHHHhllhHHHHHHHHLLHHHEEELLLLL
Query ------------------lRRAIsLGCWFSVGPTMvrtqKGAALIRSMPRDRVLTETDGP  197
ident                            |               | |    |  |   | |
Sbjct krlkkaantqpqyfpedpvEQLR-NNVWIAPYYED----DLPELARVIGVDKILFGSDWP  347
DSSP  hhhhhhhhhlhhhllllhhHHHH-HHEEELLLLLL----LHHHHHHHHLHHHLLLLLLLL


DSSP  LleellEELLhhHHHHHHHHHhHHHLLlhhHHHHHH-HHHHHHHHHL----
Query FleldgQAALpwDVKSVVEGLsKIWQIpasEVERIV-KENVSRLLGT----  243
ident          |     |    | |          |     |   |||     
Sbjct H-----GEGL-aSPVSFTAEL-KGFSE---SDIRKImRDNALDLLGVqvgs  388
DSSP  L-----LLLL-lLHHHHHHHH-LLLLH---HHHHHHhLHHHHHHHLLllll


No 47: Query=3gg7A Sbjct=3iacA Z-score=12.1

back to top
DSSP  --------------------------LLEEEEELHHhlLLHH------------------
Query --------------------------SLIDFHVHLDlyPDPV------------------   16
ident                              ||| ||                         
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLS-pQEIAddrrfdnlgqiwlegdhy   59
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL-hHHHHhllllllhhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   16
ident                                                             
Sbjct kwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlf  119
DSSP  hhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllllllllll


DSSP  ---------------------HHHHHHHHLLL-EEEELLlLHHHhhhhHHHHL-------
Query ---------------------AVARACEERQL-TVLSVTtTPAAwrgtLALAA-------   47
ident                                   |      |      |           
Sbjct gpdtaesiwtqcneklatpafSARGIXQQXNVrXVGTTD-DPID---sLEYHRqiaadds  175
DSSP  lhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEeEEELLL-LLLL---lLHHHHhhhhlll


DSSP  LLLLEEELLLLLhHHLLL----------------------lhHHLHHHHHHHHH-----L
Query GRPHVWTALGFHpEVVSE----------------------raADLPWFDRYLPE-----T   80
ident     |         |                                  | |        
Sbjct IDIEVAPSWRPD-KVFKIeldgfvdylrkleaaadvsitrfdDLRQALTRRLDHfaacgC  234
DSSP  LLLEEELLLLLH-HHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHhhhllL


DSSP  LEEEeEELLLL-----------------------hhhHHHHHHHHHHHHHHHHHHHHLlL
Query RFVGeVGLDGS-----------------------pslRGTWTQQFAVFQHILRRCEDHgG  117
ident |     |                                      ||     |      |
Sbjct RASD-HGIETLrfapvpddaqldailgkrlagetlseLEIAQFTTAVLVWLGRQYAAR-G  292
DSSP  LEEE-EEELLLlllllllhhhhhhhhhhhhllllllhHHHHHHHHHHHHHHHHHHHHH-L


DSSP  EEEEEELLL-------------------------LHHHHHHHHHHLH---HHEEEEEElL
Query RILSIHSRR-------------------------AESEVLNCLEANP---RSGTPILHwY  149
ident      |                                    |            ||   
Sbjct WVXQLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXDvtnELPKTILY-C  351
DSSP  LEEEEEELEellllhhhhhhhllllllleellllLHHHHHHHHHHHHlllLLLEEEEE-E


DSSP  LLL--HHHH-HHHHHLL-------LEEEE--lhHHHLLhHHHHHHHHL-----LHHHEEE
Query SGS--VTEL-RRAISLG-------CWFSV--gpTMVRTqKGAALIRSM-----PRDRVLT  192
ident         |                 |                              |  
Sbjct LNPrdNEVLaTXIGNFQgpgiagkVQFGSgwwfNDQKD-GXLRQLEQLsqxglLSQFVGX  410
DSSP  LLHhhHHHHhHHHHHLLlllllllEEELLllhhHLLHH-HHHHHHHHHhhhllHHHLLLL


DSSP  LLLLLlleelleELLHH-HHHHHHHHHHHHHL-------------lLHHHHHHHHHHHHH
Query ETDGPfleldgqAALPW-DVKSVVEGLSKIWQ-------------iPASEVERIVKENVS  238
ident  ||           |           |                       |  |   |  
Sbjct LTDSR-------SFLSYtRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQ  463
DSSP  LLLLL-------LLLLLhHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHH


DSSP  HHHHL-
Query RLLGT-  243
ident |     
Sbjct RYFTIk  469
DSSP  HHLLLl


No 48: Query=3gg7A Sbjct=1j5sA Z-score=12.1

back to top
DSSP  -------------------------LLEEEEELHHhlllHHHH-----------------
Query -------------------------SLIDFHVHLDlypdPVAV-----------------   18
ident                             | | |||                         
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLD----AKDIvenkpwndiwevegatd   56
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL----HHHHhhllllllhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   18
ident                                                             
Sbjct hyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvi  116
DSSP  hhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhlllllll


DSSP  ---------------------hhHHHHLLL-EEEELLLlhhHHHHhHHHHLLL------L
Query ---------------------arACEERQL-TVLSVTTtpaAWRGtLALAAGR------P   50
ident                                               |             
Sbjct seetaeeiweetkkklpemtpqkLLRDMKVeILCTTDD---PVST-LEHHRKAkeavegV  172
DSSP  lhhhhhhhhhhhhhhlllllhhhHHHHLLEeEEELLLL---LLLL-LHHHHHHhhhlllL


DSSP  LEEELLLLLhhHLLLL---------------------hhHLHHHHHHHHH-----LLEEE
Query HVWTALGFHpeVVSER---------------------aaDLPWFDRYLPE-----TRFVG   84
ident                                         |                   
Sbjct TILPTWRPDraMNVDKegwreyvekmgerygedtstldgFLNALWKSHEHfkehgCVASD  232
DSSP  EEELLLLLHhhHLLLLllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHhhlllLLEEE


DSSP  eEELLLL----------------------hhhHHHHHHHHHHHHHHHHHHHHLlLEEEEE
Query eVGLDGS----------------------pslRGTWTQQFAVFQHILRRCEDHgGRILSI  122
ident    |                                                        
Sbjct -HALLEPsvyyvdenraravhekafsgekltqDEINDYKAFMMVQFGKMNQET-NWVTQL  290
DSSP  -EEELLLllllllhhhhhhhhhhhlllllllhHHHHHHHHHHHHHHHHHHHHH-LLEEEE


DSSP  ELL-------------------------LLHH-HHHHHHHHLHHHEEEEEeLLLL--LHH
Query HSR-------------------------RAES-EVLNCLEANPRSGTPILhWYSG--SVT  154
ident |                                     |          |          
Sbjct HIGalrdyrdslfktlgpdsggdistnfLRIAeGLRYFLNEFDGKLKIVL-YVLDptHLP  349
DSSP  EELeellllhhhhhhlllllllleelllLLHHhHHHHHHHHLLLLLLEEE-EELLhhHHH


DSSP  H-HHHHHHLL-LEEEEL--hHHHLLhHHHHHHHHL----LHHHE-EELLLLLlleellee
Query E-LRRAISLG-CWFSVG--pTMVRTqKGAALIRSM----PRDRV-LTETDGPfleldgqa  205
ident      |                                          ||          
Sbjct TiSTIARAFPnVYVGAPwwfNDSPF-GMEMHLKYLasvdLLYNLaGMVTDSR------kl  402
DSSP  HhHHHHHHLLlEEELLLlllLLLHH-HHHHHHHHHhlllLHHHLlLLLLLLL------ll


DSSP  LLHH-HHHHHHHHHHHHHL-----------lLHHHHHHHHHHHHHHHHHl
Query ALPW-DVKSVVEGLSKIWQ-----------iPASEVERIVKENVSRLLGt  243
ident              ||                    |          |   
Sbjct LSFGsRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF-  451
DSSP  LHHHhHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-


No 49: Query=3gg7A Sbjct=1v77A Z-score=11.5

back to top
DSSP  -LLEEEEELHHhlllhhHHHHHHHHLLLEEEELLL-----LHHHHHHHHHHHllllleEE
Query -SLIDFHVHLDlypdpvAVARACEERQLTVLSVTT-----TPAAWRGTLALAagrphvWT   54
ident    |                    |    |               |              
Sbjct vKFIEMDIRDK------EAYELAKEWFDEVVVSIKfneevDKEKLREARKEY-----gKV   49
DSSP  lLLEEEEELLH------HHHHHHHHHLLEEEEEEEellllLHHHHHHHHHHH-----lLE


DSSP  LLlllhhhllllhhhlhhhhhhhhhlleeeEEELLllhhhhhhhhhHHHHHHHHHHHHHh
Query ALgfhpevvseraadlpwfdrylpetrfvgEVGLDgspslrgtwtqQFAVFQHILRRCEd  114
ident |                                                           
Sbjct AI----------------------------LLSNP-----------KPSLVRDTVQKFK-   69
DSSP  EE----------------------------EEELL-----------LHHHHHHHHHHLL-


DSSP  llLEEEEEELLlLHHHHHHHHHHlhhheEEEEELLL------LLHH-HHHHHHHLLLEEE
Query hgGRILSIHSRrAESEVLNCLEAnprsgTPILHWYS------GSVT-ELRRAISLGCWFS  167
ident          |           |                    |                 
Sbjct --SYLIYVESN-DLRVIRYSIEK----gVDAIISPWvnrkdpGIDHvLAKLMVKKNVALG  122
DSSP  --LLEEEEELL-LHHHHHHHHHL----lLLEEELLLllllllLLLHhHHHHHHHHLLEEE


DSSP  ELH----------hhhLLHHHHHHHHHLL--hhHEEELLLLLlleellEELLhHHHHHHH
Query VGP----------tmvRTQKGAALIRSMP--rdRVLTETDGPfleldgQAALpWDVKSVV  215
ident                                  |                          
Sbjct FSLrpllysnpyeranLLRFMMKAWKLVEkykvRRFLTSSAQ-----eKWDV-RYPRDLI  176
DSSP  EELhhhhhllhhhhhhHHHHHHHHHHHHHhhllLEEEELLLL-----lHHHL-LLHHHHH


DSSP  HHHHHHHllLHHHHHHHHHHHHHHHHHl
Query EGLSKIWqiPASEVERIVKENVSRLLGt  243
ident      |                   |  
Sbjct SLGVVIG-mEIPQAKASISMYPEIILK-  202
DSSP  HHHHHLL-lLHHHHHHLLLHHHHHHHL-


No 50: Query=3gg7A Sbjct=2a3lA Z-score=11.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------LLEEEEELHHH-------
Query ------------------------------------------SLIDFHVHLDL-------   11
ident                                              | |||          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSAcmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLLlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   11
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  ----------------------------lLLHHHHHHHHHHLL-LEEEELLLLHH-----
Query ----------------------------yPDPVAVARACEERQ-LTVLSVTTTPA-----   37
ident                                   |    |                    
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgEITKQVFSDLEASKyQMAEYRISIYGrkmse  300
DSSP  hhhhllllllhhhhhhlllllllllllhhHHHHHHHHHHLLLLlEEEEEEEELLLllllh


DSSP  --hHHHHHH-hhLLLLLEEELLLLLHhHLLLL---------hHHLHHHHHHH--------
Query --aWRGTLA-laAGRPHVWTALGFHPeVVSER---------aADLPWFDRYL--------   77
ident                  |                          |      |        
Sbjct wdqLASWIVnndLYSENVVWLIQLPR-LYNIYkdmgivtsfqNILDNIFIPLfeatvdpd  359
DSSP  hhhHHHHHHlllLLLLLEEEEEEEEL-LHHHHlllllllllhHHHHHHLLHHhhhhhlhh


DSSP  ---------hhLLEEeEEEL-LLLHH--------------hhHHHHhHHHHHHHHHHHHH
Query ---------peTRFVgEVGL-DGSPS--------------lrGTWTqQFAVFQHILRRCE  113
ident                         |                                   
Sbjct shpqlhvflkqVVGF-DLVDdESKPErrptkhmptpaqwtnaFNPA-FSYYVYYCYANLY  417
DSSP  hllllhhhhllEEEE-EEELlLLLLLllllllllllllllllLLLL-HHHHHHHHHHHHH


DSSP  HLL---------LEEEEEEL-LLLHHHHHHHHHHLhhheEEEEELLLLLHH---HHHHHH
Query DHG---------GRILSIHS-RRAESEVLNCLEANprsgTPILHWYSGSVT---ELRRAI  160
ident                |  ||        |                               
Sbjct VLNklreskgmtTITLRPHSgEAGDIDHLAATFLT----CHSIAHGINLRKspvLQYLYY  473
DSSP  HHHhhhllllllLLEELLLLlLLLLLHHHHHHHHH----LLLLLLLHHHHHlhhHHHHHH


DSSP  HLLLEEEEL-HHHH----lLHHHhhHHHHLL--HHHEEELLLLLLLEELleellhHHHHH
Query SLGCWFSVG-PTMV----rTQKGaaLIRSMP--RDRVLTETDGPFLELDgqaalpWDVKS  213
ident                                     |   || |                
Sbjct LAQIGLAMSpLSNNslfldYHRN--PFPVFFlrGLNVSLSTDDPLQIHL----tkEPLVE  527
DSSP  HHLLLEEELhHHHLlllllLLLL--LHHHHHhlLLLEEELLLLHHHHLL----llLHHHH


DSSP  HHHHHHHHHLLLhHHHHHHHHHHHHHHH--------------------------------
Query VVEGLSKIWQIPaSEVERIVKENVSRLL--------------------------------  241
ident         |             |                                     
Sbjct EYSIAASVWKLS-ACDLCEIARNSVYQSgfshalkshwigkdyykrgpdgndihktnvph  586
DSSP  HHHHHHHHHLLL-HHHHHHHHHHHHHHLlllhhhhhhhlllllllllhhhllhhhhlllh


DSSP  ----------------------------hl
Query ----------------------------gt  243
ident                               
Sbjct irvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhhhhlllllllllllll


No 51: Query=3gg7A Sbjct=3ooqA Z-score=11.1

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------SLIDFHVH    8
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL


DSSP  HHHLLL----------------------------hHHHHHHHHHLLL-EEEELLL-----
Query LDLYPD----------------------------pVAVARACEERQL-TVLSVTT-----   34
ident   |                                              |  |       
Sbjct IGLFEEgvgyyysdgneatdpvtphvkaldgfnpqDPAIERALAGGVtSVXIVPGsanpv  120
DSSP  LLLLLLlllhhhlllllllllllllllhhhhllllLHHHHHHHLLLEeEEEELLLlllle


DSSP  --lhhhhhhhhhhHLLLLleeelllllhhhllllhhhlhhhhhhhhHLLEEEeEELLLL-
Query --tpaawrgtlalAAGRPhvwtalgfhpevvseraadlpwfdrylpETRFVGeVGLDGS-   91
ident                                                             
Sbjct ggqgsvikfrsiiVEECI--------------------------vkDPAGLK-XAFGENp  153
DSSP  eeeeeeeelllllHHHHE--------------------------eeEEEEEE-EELLHHh


DSSP  -HHHH------HHHHHHHHHHHHHH-----------------------------HHHHHL
Query -PSLR------GTWTQQFAVFQHIL-----------------------------RRCEDH  115
ident             |      |                                        
Sbjct kRVYGerkqtpSTRXGTAGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevGEXVLR  213
DSSP  hHHHHhlllllLLHHHHHHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHL


DSSP  LLEEEEEELLL--LHHHHHHHHHHLHHheEEEEELLLLLHHHHHHHHHLLLEEEELHH--
Query GGRILSIHSRR--AESEVLNCLEANPRsgTPILHWYSGSVTELRRAISLGCWFSVGPT--  171
ident        |  |           |                               |||   
Sbjct KKIPARXHAHRadDILTAIRIAEEFGF--NLVIEHGTEAYKISKVLAEKKIPVVVGPLlt  271
DSSP  LLLLEEEEELLhhHHHHHHHHHHHHLL--LEEEEELLLHHHHHHHHHHHLLLEEELLLll


DSSP  ----hhllHHHHHHHHHLL--hhHEEELLLLLLleelleeLLHHHHHHHHHHHHHHHlLL
Query ----mvrtQKGAALIRSMP--rdRVLTETDGPFleldgqaALPWDVKSVVEGLSKIWqIP  225
ident               |              | |                            
Sbjct frtklelkDLTXETIAKLLkdgvLIALXCDHPV-------IPLEFATVQAATAXRYG-AK  323
DSSP  llllhhhlLLLLLHHHHHHhlllLEEELLLLLL-------LLHHHHHHHHHHHHHHL-LL


DSSP  HHHHHHHHHHHHHHHHH-------------------------------------------
Query ASEVERIVKENVSRLLG-------------------------------------------  242
ident       |   |    ||                                           
Sbjct EEDLLKILTVNPAKILGledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrr  383
DSSP  HHHHHHLLLHHHHHHLLllllllllllllllleeeelllllllllleeeeeelleeeeel


DSSP  l
Query t  243
ident  
Sbjct e  384
DSSP  l


No 52: Query=3gg7A Sbjct=3au2A Z-score=10.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------LLEEEEELHH---HLLLHHHHHHH
Query ------------------------------------SLIDFHVHLD---LYPDPVAVARA   21
ident                                        |  ||               |
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTysdGQNTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLlllLLLLHHHHHHH


DSSP  HHHLLL-EEEELLL--------------LHHHHHHHHHHHL-LLLL-EEELllllhhhll
Query CEERQL-TVLSVTT--------------TPAAWRGTLALAA-GRPH-VWTAlgfhpevvs   64
ident                                             |               
Sbjct AKTMGYrYLAVTDHspavrvaggpspeeALKRVGEIRRFNEtHGPPyLLAG---------  411
DSSP  HHHHLLlEEEEEEElhhhhllllllhhhHHHHHHHHHHHHHhHLLLeEEEE---------


DSSP  llhhhlhhhhhhhhhlleeEEEELLLLhhhhhhhhhhhhhhhhHHHHHhhllleEEEEEL
Query eraadlpwfdrylpetrfvGEVGLDGSpslrgtwtqqfavfqhILRRCedhggrILSIHS  124
ident                     ||                                      
Sbjct -------------------AEVDIHPD------------gtldYPDWV-lreldLVLVSV  439
DSSP  -------------------EEEELLLL------------llllLLHHH-hllllEEEEEL


DSSP  L-----------lLHHHHHHHHhhlhhhEEEEEELLL------------lLHHHHHHHHH
Query R-----------rAESEVLNCLeanprsGTPILHWYS------------gSVTELRRAIS  161
ident                   |             |                        |  
Sbjct HsrfnlpkadqtkRLLKALENP------FVHVLAHPTarllgrrapieadWEAVFQKAKE  493
DSSP  LllllllhhhhhhHHHHHHLLL------LLLEELLLLlllllllllllllHHHHHHHHHH


DSSP  LLLEEEELH----HHHLlhhhHHHHHHLL--hhHEEELLLLLlleelleELLHHHHHHHH
Query LGCWFSVGP----TMVRtqkgAALIRSMP--rdRVLTETDGPfleldgqAALPWDVKSVV  215
ident  |                     | |            ||                   |
Sbjct KGVAVEIDGyydrMDLP----DDLARMAYgmglWISLSTDAH------qTDHLRFMELAV  543
DSSP  HLLEEEEELllllLLLL----HHHHHHHHhlllLEEEELLLL------lHHHHHHHHHHH


DSSP  HHHHHHHlllhhhHHHH-HHHH----HHHHHHL----
Query EGLSKIWqipaseVERI-VKEN----VSRLLGT----  243
ident       |                       |      
Sbjct GTAQRAW-----iGPERvLNTLdyedLLSWLKArrgv  575
DSSP  HHHHHLL-----lLLLLlHHHLlhhhHHHHHHLllll


No 53: Query=3gg7A Sbjct=3dcpA Z-score=10.0

back to top
DSSP  LLEEEEELHHH-----LLLHHHHHHHHHHLLL-EEEELLL--------------------
Query SLIDFHVHLDL-----YPDPVAVARACEERQL-TVLSVTT--------------------   34
ident    | | |          |         |        |                      
Sbjct XKRDGHTHTEFcphgtHDDVEEXVLKAIELDFdEYSIVEHaplssefxkntagdkeavtt   60
DSSP  LLEEEEELLLLlllllLLLHHHHHHHHHHLLLlEEEEEEEllllhhhhhllllllhhhhl


DSSP  ------lHHHH-HHHHHHHLLL---LLEEELllllhhhllllhhhlhhhhhhhhhlleeE
Query ------tPAAW-RGTLALAAGR---PHVWTAlgfhpevvseraadlpwfdrylpetrfvG   84
ident                                                             
Sbjct asxaxsdLPYYfKKXNHIKKKYasdLLIHIG----------------------------F   92
DSSP  llllhhhHHHHhHHHHHHHHHLlllLEEEEE----------------------------E


DSSP  EEELLLlhhhhhhhhHHHHHHHHHHHHHhhllleEEEEELLL------------------
Query EVGLDGspslrgtwtQQFAVFQHILRRCedhggrILSIHSRR------------------  126
ident ||                      |                                   
Sbjct EVDYLI---------GYEDFTRDFLNEY-gpqtdDGVLSLHFlegqggfrsidfsaedyn  142
DSSP  EEELLL---------LLHHHHHHHHHHH-hhhllEEEEELLEeeelleeeellllhhhhh


DSSP  -------------------LHHHHHHHhhHLHHHEEEEEELLL-----------------
Query -------------------AESEVLNCleANPRSGTPILHWYS-----------------  150
ident                                           |                 
Sbjct egivqfyggfeqaqlayleGVKQSIEA--DLGLFKPRRXGHISlcqkfqqffgedtsdfs  200
DSSP  hhlhhhhllhhhhhhhhhhHHHHHHHL--LLLLLLLLEELLLLhhhllhhhhlllhhhll


DSSP  -----lLHHHHHHHHHLLLEEEELH----------HHHLlhhhHHHHHHLL--HHHEEEL
Query -----gSVTELRRAISLGCWFSVGP----------TMVRtqkgAALIRSMP--RDRVLTE  193
ident           |                        |                        
Sbjct eevxekFRVILALVKKRDYELDFNTaglfkplcgeTYPP----KKIVTLASelQIPFVYG  256
DSSP  hhhhhhHHHHHHHHHHHLLEEEEELhhhhllllllLLLL----HHHHHHHHhlLLLEEEE


DSSP  LLLLlleelleelLHHH-HHHHHHHHHhhhlllhhhhhhhhhhhhhhhhhl
Query TDGPfleldgqaaLPWD-VKSVVEGLSkiwqipaseverivkenvsrllgt  243
ident  |                       |                         
Sbjct SDSH------gvqDIGRgYSTYCQKLE------------------------  277
DSSP  LLLL------lhhHLLLlHHHHHHHLL------------------------


No 54: Query=3gg7A Sbjct=1m65A Z-score=9.5

back to top
DSSP  LLEEEEEL----hhHLLLHHHHHHHHHHLLL-EEEELLL--------lHHHHHHH-hHHH
Query SLIDFHVH----ldLYPDPVAVARACEERQL-TVLSVTT--------tPAAWRGT-lALA   46
ident    | | |       |                                            
Sbjct YPVDLHMHtvasthAYSTLSDYIAQAKQKGIkLFAITDHgpdmedaphHWHFINMriWPR   60
DSSP  LLEELLLLllllllLLLLHHHHHHHHHHHLLlEEEEEEElllllllllLHHHHHHhhLLL


DSSP  LL-LLLEEELllllhhhllllhhhlhhhhhhhhhlleeEEEELLLlhhhhhhhhhhhhhh
Query AG-RPHVWTAlgfhpevvseraadlpwfdrylpetrfvGEVGLDGspslrgtwtqqfavf  105
ident                                        |                    
Sbjct VVdGVGILRG----------------------------IEANIKN------------vdg   80
DSSP  EElLEEEEEE----------------------------EEEELLL------------lll


DSSP  hhHHHHhhhllleeEEEELL----------lLHHHHHHHHHHlhhHEEEEEELLL-----
Query qhILRRcedhggriLSIHSR----------rAESEVLNCLEAnprSGTPILHWYS-----  150
ident                                                  |          
Sbjct eiDCSGkmfdsldlIIAGFHepvfaphdkatNTQAMIATIAS---GNVHIISHPGnpkye  137
DSSP  llLLLHhhhhhlleEEEELLllllllllhhhHHHHHHHHHHL---LLLLEELLLLlllll


DSSP  -LLHHHHHHHHHLLLEEEELHHHhllhHHHHHHHHLL--hhHEEELLLLLlleelleelL
Query -GSVTELRRAISLGCWFSVGPTMvrtqKGAALIRSMP--rdRVLTETDGPfleldgqaaL  207
ident          |                                |    |            
Sbjct iDVKAVAEAAAKHQVALEINNSS----NCREVAAAVRdaggWVALGSDSH------tafT  187
DSSP  lLHHHHHHHHHHHLLEEEEELLL----LHHHHHHHHHhhllLEEEELLLL------lhhH


DSSP  HHHHHHHHHHHHHHHlllhhhhhhHHHH---HHHHHHHL------------
Query PWDVKSVVEGLSKIWqipaseverIVKE---NVSRLLGT------------  243
ident           |             |           |              
Sbjct MGEFEECLKILDAVD----fpperILNVsprRLLNFLESrgmapiaefadl  234
DSSP  LLLLHHHHHHHHHLL----llhhhLHHHlhhHHHHHHHHllllllhhhlll


No 55: Query=3gg7A Sbjct=3f2bA Z-score=8.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEEEEELHH--
Query ------------------------------------------------SLIDFHVHLD--   10
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLll


DSSP  ---HLLLHHHHHHHHHHLLL-EEEELLL-LHHHHHHHHHHHL-LLLLEEELllllhhhll
Query ---LYPDPVAVARACEERQL-TVLSVTT-TPAAWRGTLALAA-GRPHVWTAlgfhpevvs   64
ident                                         |      |            
Sbjct qmdAVTSVTKLIEQAKKWGHpAIAVTDHaVVQSFPEAYSAAKkHGMKVIYG---------  171
DSSP  lllLLLLHHHHHHHHHHLLLlLEEELLLlLLLLHHHHHHHHHhHLLLEEEE---------


DSSP  llhhhlhhhhhhhhhlleeEEEELL--------------------llhhhhhHHHH---H
Query eraadlpwfdrylpetrfvGEVGLD--------------------gspslrgTWTQ---Q  101
ident                     |                                       
Sbjct -------------------LEANIVddpfhvtllaqnetglknlfklvslshIQYFhrvP  212
DSSP  -------------------EEEEEEllleeeeeeellhhhhhhhhhhhhhhhLLLLlllL


DSSP  HHHHHHHHHHHHhllLEEEeeellllhhhhhhhhhhlhhheeeEEEL----LLLLhhhHH
Query FAVFQHILRRCEdhgGRILsihsrraesevlncleanprsgtpILHW----YSGSvteLR  157
ident                |                                            
Sbjct RIPRSVLVKHRD---GLLV------------------------GSGCdkgeLFDN---VE  242
DSSP  LEEHHHHHHLLL---LEEE------------------------ELLLllllLLLL---LL


DSSP  HHhHLLL-EEEELHH-------hhlLHHHHHHHHHLL------hHHEEELLLLL------
Query RAiSLGC-WFSVGPT-------mvrTQKGAALIRSMP------rDRVLTETDGP------  197
ident            | |                  |||           |             
Sbjct DI-ARFYdFLEVHPPdvykplyvkdEEMIKNIIRSIValgekldIPVVATGNVHylnped  301
DSSP  LL-HHHLlLEEELLHhhhlllllllHHHHHHHHHHHHhhhhhllLLEEELLLLLlllhhh


DSSP  ----------------lleeLLEELLHHHhHHHHHHHHHhHLLLhhHHHHHHHHHHHHHH
Query ----------------flelDGQAALPWDvKSVVEGLSKiWQIPasEVERIVKENVSRLL  241
ident                                      |            ||  |     
Sbjct kiyrkilihsqgganplnrhELPDVYFRTtNEMLDCFSF-LGPE--KAKEIVVDNTQKIA  358
DSSP  hhhhhhhhhllhhhllllllLLLLLLLLLhHHHHHHHHH-HHHH--HHHHHHLHHHHHHH


DSSP  HL----------------------------------------------------------
Query GT----------------------------------------------------------  243
ident                                                             
Sbjct SLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighg  418
DSSP  HLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct faviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseff  478
DSSP  lhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct ndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahn  538
DSSP  lllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct ytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttg  598
DSSP  hhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct qhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvi  658
DSSP  eeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct rmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmle  718
DSSP  hhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct etrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrgleps  778
DSSP  hhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct lafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriay  838
DSSP  hhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct fkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlev  898
DSSP  hhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  243
ident                                                             
Sbjct alemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefls  958
DSSP  hhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllll


DSSP  ------------------------------------
Query ------------------------------------  243
ident                                     
Sbjct kedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=3gg7A Sbjct=2yb1A Z-score=7.3

back to top
DSSP  LLEEEEELHH---HLLLHHHHHHHHHHLLL-EEEELLLLHhhHHHHHHHHLLL----LLE
Query SLIDFHVHLD---LYPDPVAVARACEERQL-TVLSVTTTPaaWRGTLALAAGR----PHV   52
ident   || | |         |  |      |                |    ||         
Sbjct ANIDLHFHSRtsdGALTPTEVIDRAAARAPaLLALTDHDC--TGGLAEAAAAAarrgIPF   58
DSSP  LLEELLLLLLlllLLLLHHHHHHHHHLLLLlEEEELLLLL--LLLHHHHHHHHhhllLLE


DSSP  EELllllhhhllllhhhlhhhhhhhhhlleeEEEELL-----------------------
Query WTAlgfhpevvseraadlpwfdrylpetrfvGEVGLD-----------------------   89
ident                                 ||                          
Sbjct LNG----------------------------VEVSVSwgrhtvhivglgidpaepalaag   90
DSSP  EEE----------------------------EEEEEEelleeeeeeeellllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   89
ident                                                             
Sbjct lksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmr  150
DSSP  hhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhh


DSSP  --------llHHHHHHHhhhhHHHH--HHHHHhhhlLLEEeeeellllhhhhhhhhhhlh
Query --------gsPSLRGTWtqqfAVFQ--HILRRcedhGGRIlsihsrraesevlncleanp  139
ident                                     |                       
Sbjct tvfrkyltpgKPGYVSH----QWASleDAVGW--ivGAGG--------------------  184
DSSP  hhhhhlllllLLLLLLL----LLLLhhHHHHH--hhHLLL--------------------


DSSP  hheEEEEELLL---LLHHHHHHHHHLL-----LEEE-ELHHHhLLHHHHHHHHHL--LHH
Query rsgTPILHWYS---GSVTELRRAISLG-----CWFS-VGPTMvRTQKGAALIRSM--PRD  188
ident                  |   | |                                    
Sbjct ---MAVIAHPGrydMGRTLIERLILDFqaaggQGIEvASGSH-SLDDMHKFALHAdrHGL  240
DSSP  ---EEEELLHHhllLLHHHHHHHHHHHhhlllLEEEeEELLL-LHHHHHHHHHHHhhHLL


DSSP  HEEELLLLLlleelLEELlHHHHhhhHHHHHhhhlllhhhhhhhhhhHHHHHHH------
Query RVLTETDGPfleldGQAAlPWDVksvVEGLSkiwqipaseverivkeNVSRLLG------  242
ident       |                                            |        
Sbjct YASSGSDFH----aPGED-VGHT---EDLPP------------icrpIWRELEArilrpa  280
DSSP  EEEEELLLL----lLLLL-LLLL---LLLLL------------llllHHHHLHHhlllll


DSSP  ---l
Query ---t  243
ident     
Sbjct daen  284
DSSP  hhhl


No 57: Query=3gg7A Sbjct=2anuA Z-score=6.5

back to top
DSSP  ---LLEEEEELHH---HLLLHHHHHHHHHHLLL-EEEELLL-------------------
Query ---SLIDFHVHLD---LYPDPVAVARACEERQL-TVLSVTT-------------------   34
ident     | |||||            |           |                        
Sbjct tewLLCDFHVHTNxsdGHLPLGEVVDLFGKHGVdVVSITDHivdrrtleqrkrngeplga   60
DSSP  leeEEEEEEELLLlllLLLLHHHHHHHHHHLLLlEEEEEEEeelhhhhhhhhhlllllll


DSSP  -----LHHHHHHHHHHHLLL-----LLEEELllllhhhllllhhhlhhhhhhhhhlleee
Query -----TPAAWRGTLALAAGR-----PHVWTAlgfhpevvseraadlpwfdrylpetrfvg   84
ident                                                             
Sbjct itedkFQDYLKRLWREQKRAweeygXILIPG----------------------------v   92
DSSP  lllllHHHHHHHHHHHHHHHhhhhlLEEEEE----------------------------e


DSSP  EEELLLL-hhhhhhhhhhhhHHHHhhhhhhhllleeeeeellllhhhhhhHHHHL-HHHE
Query EVGLDGS-pslrgtwtqqfaVFQHilrrcedhggrilsihsrraesevlnCLEAN-PRSG  142
ident |                                                   |       
Sbjct EITNNTDlyhivavdvkeyvDPSL--------------------------PVEEIvEKLK  126
DSSP  EEEELLLleeeeeellllllLLLL--------------------------LHHHHhHHHH


DSSP  ----EEEEELL------lllhHHHHHHhHLLL-EEEE-LHHHHllhhHHHHHHHLLhhHE
Query ----TPILHWY------sgsvTELRRAiSLGC-WFSV-GPTMVrtqkGAALIRSMPrdRV  190
ident       |                  |                                | 
Sbjct eqnaLVIAAHPdrkklswylwANXERF-KDTFdAWEIaNRDDL----FNSVGVKKY--RY  179
DSSP  hlllEEEELLLlllllllhhhHLLLLL-LLLLlEEEEeELLEE----LHHHHHLLL--LE


DSSP  EELLLLLlleellEELLhHHHHhhhhhhhhhhlllhhhhhhhHHHH-------HHHHHH-
Query LTETDGPfleldgQAALpWDVKsvveglskiwqipaseveriVKEN-------VSRLLG-  242
ident     |                                                       
Sbjct VANSDFH------ELWH-VYSW------------------ktLVKSeknieaiKEAIRKn  214
DSSP  EEELLLL------LHHH-HLLE------------------eeEEEElllhhhhHHHHHHl


DSSP  ---------l
Query ---------t  243
ident           
Sbjct tdvaiylxrk  224
DSSP  lleeeeelll


No 58: Query=3gg7A Sbjct=1bksA Z-score=6.1

back to top
DSSP  --------------LLEEeeelhhhlllhhhhhhhhhhllleEEELLlLHHH-----HHH
Query --------------SLIDfhvhldlypdpvavaraceerqltVLSVTtTPAA-----WRG   41
ident                                                 |           
Sbjct meryenlfaqlndrREGA------------------------FVPFV-TLGDpgieqSLK   35
DSSP  lhhhhhhhhhhhhlLLLE------------------------EEEEE-ELLLllhhhHHH


DSSP  HH-HHHLlLLLEEELLLLlhhHLLL-----------------lhHHLHHHHHHHHHL---
Query TL-ALAAgRPHVWTALGFhpeVVSE-----------------raADLPWFDRYLPET---   80
ident     |          ||      |                             |      
Sbjct IIdTLID-AGADALELGV---PFSDpladgptiqnanlrafaagVTPAQCFEMLALIrek   91
DSSP  HHhHHHH-LLLLLEEEEL---LLLLlllllhhhhhhhhhhhhhlLLHHHHHHHHHHHhhh


DSSP  ----LEEEEEellllhhhhhhhhhHHHHHH-----hHHHHHHHLLLEEEEEELllLHHHH
Query ----RFVGEVgldgspslrgtwtqQFAVFQ-----hILRRCEDHGGRILSIHSrrAESEV  131
ident                                        |||  |             | 
Sbjct hptiPIGLLM--------------YANLVFnngidaFYARCEQVGVDSVLVAD-vPVEES  136
DSSP  llllLEEEEE--------------LHHHHHlllhhhHHHHHHHHLLLEEEELL-lLHHHL


DSSP  HHHHHHLH-HHEEEEEELLL-lLHHHHHHHHHLLL-EEEELhhhhLLHHHHHHHHHLLhh
Query LNCLEANP-RSGTPILHWYS-gSVTELRRAISLGC-WFSVGptmvRTQKGAALIRSMPrd  188
ident      |       ||           ||   | |                          
Sbjct APFRQAALrHNIAPIFICPPnaDDDLLRQVASYGRgYTYLL--alPLHHLIEKLKEYHaa  194
DSSP  HHHHHHHHhLLLEEEEEELLllLHHHHHHHHHHLLlLEEEL--llLHHHHHHHHHHHLll


DSSP  HEEELLLlllleelleeLLHH-HHHHHHHHH---------------hhhhlllhhhhhhh
Query RVLTETDgpfleldgqaALPW-DVKSVVEGL---------------skiwqipaseveri  232
ident   |                    |   |                                
Sbjct PALQGFG----------ISSPeQVSAAVRAGaagaisgsaivkiieknlaspkqmlaelr  244
DSSP  LEEELLL----------LLLHhHHHHHHHHLlleeeellhhhhhhhhllllhhhhhhhhh


DSSP  hhhhhhhhhhl
Query vkenvsrllgt  243
ident            
Sbjct sfvsamkaasr  255
DSSP  hhhhhhhhlll


No 59: Query=3gg7A Sbjct=3e38A Z-score=6.1

back to top
DSSP  -----------------LLEEEEELHH---HLLLHHHHHHHHHHLLL-EEEELLLL----
Query -----------------SLIDFHVHLD---LYPDPVAVARACEERQL-TVLSVTTT----   35
ident                     ||| |         |           |             
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVfsdGLVWPTVRVDEAYRDGLdAISLTEHIeyrp   60
DSSP  llllllllllllllleeEEEELLLLLLlllLLLLHHHHHHHHHHLLLlEELLEEELllll


DSSP  ------hHHHHHHHHHHLLL----LLEEELLLLLHHhllllhhhlhhhhhhHHHLleeee
Query ------pAAWRGTLALAAGR----PHVWTALGFHPEvvseraadlpwfdryLPETrfvge   85
ident           |                                        |        
Sbjct hkqdvvsDHNRSFDLCREQAeklgILLIKGSEITRA-----xapghfnaifLSDS-----  110
DSSP  lllllllLLLHHHHHHHHHHhhhlLEELLEEEEELL-----lllleeeeelLLLL-----


DSSP  eellllhhhhhhhhhhhHHHHHHHHHHHHLlLEEEEEE----------llLLHHHHHHHH
Query vgldgspslrgtwtqqfAVFQHILRRCEDHgGRILSIH----------srRAESEVLNCL  135
ident                         |      |                      |     
Sbjct ------------npleqKDYKDAFREAKKQ-GAFXFWNhpgwdsqqpdttKWWPEHTALY  157
DSSP  ------------hhhllLLHHHHHHHHHHL-LLEEEELllllllllllllLLLHHHHHHH


DSSP  HHLhhhEEEEEElllllhhhhhhhhhllleeeELHHHHllhhHHHHHHHLL--hhHEEEL
Query EANprsGTPILHwysgsvtelrraislgcwfsVGPTMVrtqkGAALIRSMP--rdRVLTE  193
ident                                               |             
Sbjct QEG---CXHGIE-------------------vANGHLY----XPEAIQWCLdknlTXIGT  191
DSSP  HLL---LLLEEE-------------------eEELLEE----LLHHHHHHHhhllEEEEE


DSSP  LLLL---llEELLeellhHHHHhhhhhhhhhhlllhhhhhhhHHHH--------HHHHHH
Query TDGP---flELDGqaalpWDVKsvveglskiwqipaseveriVKEN--------VSRLLG  242
ident  |         |                                             |  
Sbjct SDIHqpiqtDYDF-ekgeHRTX-------------------tFVFAkerslqgiREALDN  231
DSSP  LLLLllhhhHLLH-hhllLLLE-------------------eEEEEllllhhhhHHHHHL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  242
ident                                                             
Sbjct rrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtl  291
DSSP  lleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeellllll


DSSP  --------------------------------------------------l
Query --------------------------------------------------t  243
ident                                                    
Sbjct lvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel