Results: dupa

Query: 3f2bA

MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3f2b-A 66.6  0.0  994   994  100 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
   2:  2yb1-A 15.3  3.2  185   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   3:  3e38-A 12.4  3.1  167   342   16 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
   4:  2anu-A 11.7  2.8  157   224   19 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
   5:  1v77-A 11.4  3.3  161   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
   6:  1yrr-B 10.6  6.8  178   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
   7:  3qy6-A 10.5  3.4  167   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   8:  3au2-A 10.2  8.5  186   575   17 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   9:  1m65-A  9.7  3.4  160   234   21 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  10:  3ls9-A  9.5  6.3  180   453    8 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  11:  2oof-A  9.4  7.3  180   403    9 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  12:  1gkp-A  9.4  5.7  198   458    9 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  2paj-A  9.4  6.9  183   421   10 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  14:  1k6w-A  9.3  7.0  185   423    9 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  15:  3icj-A  9.1  8.3  181   468    8 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  16:  4mup-B  8.9  3.9  186   286    7 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  17:  1j6p-A  8.9  3.3  175   407    9 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  18:  2imr-A  8.9  7.3  170   380    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  19:  3dcp-A  8.8  3.5  155   277   15 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  20:  3mtw-A  8.8  6.8  175   404    9 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  21:  1bf6-A  8.7  4.0  181   291    6 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  22:  1a4m-A  8.7  3.5  172   349   15 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  23:  4cqb-A  8.5  7.2  172   402    6 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  24:  4c5y-A  8.5  8.5  193   436    8 PDB  MOLECULE: OCHRATOXINASE;                                             
  25:  2vun-A  8.5  6.0  166   385   13 PDB  MOLECULE: ENAMIDASE;                                                 
  26:  2ffi-A  8.5  3.7  169   273   10 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  27:  4b3z-D  8.5  9.4  200   477   11 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  28:  3k2g-B  8.4  3.8  179   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  4dlf-A  8.4  4.2  172   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  30:  3gg7-A  8.3  3.5  165   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  31:  2uz9-A  8.2  7.5  171   444    9 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  32:  2y1h-B  8.2  3.4  167   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  33:  3gri-A  8.1  6.5  197   422    7 PDB  MOLECULE: DIHYDROOROTASE;                                            
  34:  4hk5-D  8.0  3.6  159   380    9 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  35:  3nqb-A  8.0  8.3  191   587    9 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  36:  3mkv-A  8.0  9.9  183   414    5 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  37:  2dvt-A  7.8  3.5  161   325    7 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  38:  4qrn-A  7.7  3.8  167   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  39:  1onx-A  7.7  7.7  183   390   11 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  40:  2ob3-A  7.6  4.2  178   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  41:  3cjp-A  7.6  3.5  154   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  42:  3e74-A  7.5  6.3  186   429   11 PDB  MOLECULE: ALLANTOINASE;                                              
  43:  4ofc-A  7.4  3.5  158   335    8 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  44:  2vc5-A  7.2  4.0  175   314    9 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  45:  4rdv-B  7.2  3.8  176   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  46:  3irs-A  7.2  3.9  163   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  47:  3pnu-A  7.2  4.0  178   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  48:  4dzi-C  7.1  3.5  160   388    6 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  1a5k-C  6.8 12.2  191   566    7 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  50:  3ooq-A  6.6  7.1  161   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  51:  2ogj-A  6.4  7.9  168   379   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  52:  1itq-A  6.2  4.3  181   369   10 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  53:  3giq-A  6.2  6.1  175   475    8 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  54:  2a3l-A  6.1  3.4  158   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  55:  2gwg-A  6.0  4.2  163   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  56:  2qpx-A  5.5  3.7  153   376    7 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  57:  3iac-A  5.5  3.7  162   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  58:  1j5s-A  5.1  3.8  151   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  59:  1bks-A  4.1  3.9  135   255    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3f2bA Sbjct=3f2bA Z-score=66.6

back to top
DSSP  LLLHHHLLLLEEEEEEEEEEEEEEEEELLLLLEEEEEEEELLLLEEEEEEELLLHHHHHH
Query VRRLETIVEEERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAEL   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VRRLETIVEEERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAEL   60
DSSP  LLLHHHLLLLEEEEEEEEEEEEEEEEELLLLLEEEEEEEELLLLEEEEEEELLLHHHHHH


DSSP  HHLLLLLLEEEEEEEEEEELLLLEEEEEEEEEEEELLLLLLLLLLLLLLLLLLLLLLLLL
Query MSGVKKGMWVKVRGSVQNDTFVRDLVIIANDLNEIAANERQDTAPEGEKRVELHLHTPMS  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MSGVKKGMWVKVRGSVQNDTFVRDLVIIANDLNEIAANERQDTAPEGEKRVELHLHTPMS  120
DSSP  HHLLLLLLEEEEEEEEEEELLLLEEEEEEEEEEEELLLLLLLLLLLLLLLLLLLLLLLLL


DSSP  LLLLLLLHHHHHHHHHHLLLLLEEELLLLLLLLHHHHHHHHHHHLLLEEEEEEEEEELLL
Query QMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYGLEANIVDDP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYGLEANIVDDP  180
DSSP  LLLLLLLHHHHHHHHHHLLLLLEEELLLLLLLLHHHHHHHHHHHLLLEEEEEEEEEELLL


DSSP  EEEEEEELLHHHHHHHHHHHHHHHLLLLLLLLLEEHHHHHHLLLLEEEELLLLLLLLLLL
Query FHVTLLAQNETGLKNLFKLVSLSHIQYFHRVPRIPRSVLVKHRDGLLVGSGCDKGELFDN  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FHVTLLAQNETGLKNLFKLVSLSHIQYFHRVPRIPRSVLVKHRDGLLVGSGCDKGELFDN  240
DSSP  EEEEEEELLHHHHHHHHHHHHHHHLLLLLLLLLEEHHHHHHLLLLEEEELLLLLLLLLLL


DSSP  LLLLHHHLLLEEELLHHHHLLLLLLLHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLHH
Query VEDIARFYDFLEVHPPDVYKPLYVKDEEMIKNIIRSIVALGEKLDIPVVATGNVHYLNPE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VEDIARFYDFLEVHPPDVYKPLYVKDEEMIKNIIRSIVALGEKLDIPVVATGNVHYLNPE  300
DSSP  LLLLHHHLLLEEELLHHHHLLLLLLLHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLHH


DSSP  HHHHHHHHHHLLHHHLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHLHHHHHHHHL
Query DKIYRKILIHSQGGANPLNRHELPDVYFRTTNEMLDCFSFLGPEKAKEIVVDNTQKIASL  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DKIYRKILIHSQGGANPLNRHELPDVYFRTTNEMLDCFSFLGPEKAKEIVVDNTQKIASL  360
DSSP  HHHHHHHHHHLLHHHLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHLHHHHHHHHL


DSSP  LLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLHHHHHHHHHHHHHHHHLLLH
Query IGDVKPIKDELYTPRIEGADEEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFA  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IGDVKPIKDELYTPRIEGADEEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFA  420
DSSP  LLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLHHHHHHHHHHHHHHHHLLLH


DSSP  HHHHHHHHHHHHHHHLLLLLEELHHHHHLHHHHHLLLLLLLLLLLEEELLLLLLEEELLL
Query VIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFND  480
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFND  480
DSSP  HHHHHHHHHHHHHHHLLLLLEELHHHHHLHHHHHLLLLLLLLLLLEEELLLLLLEEELLL


DSSP  LLLLLHHHLLLLLLLLLLLLLEEELLLLLLHHHHLLLLLLLLLEEEEEELLLHHHHHHHH
Query GSVGSGFDLPDKNCPRCGTKYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYT  540
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GSVGSGFDLPDKNCPRCGTKYKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYT  540
DSSP  LLLLLHHHLLLLLLLLLLLLLEEELLLLLLHHHHLLLLLLLLLEEEEEELLLHHHHHHHH


DSSP  HHHHLLLLEEEEEEEEELLHHHHHHHHHHHHHHLLLLLLHHHHHHHHHHHLLLEEEEEEE
Query KVLFGEDNVYRAGTIGTVADKTAYGFVKAYASDHNLELRGAEIDRLAAGCTGVKRTTGQH  600
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KVLFGEDNVYRAGTIGTVADKTAYGFVKAYASDHNLELRGAEIDRLAAGCTGVKRTTGQH  600
DSSP  HHHHLLLLEEEEEEEEELLHHHHHHHHHHHHHHLLLLLLHHHHHHHHHHHLLLEEEEEEE


DSSP  EEEEEELLLLLLHHHLLLEELHHHLLLLLLLEEEEEHHHHLLLLLEEEEEEEHHHHHHHH
Query PGGIIVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRM  660
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PGGIIVVPDYMEIYDFTPIQYPADDTSSEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRM  660
DSSP  EEEEEELLLLLLHHHLLLEELHHHLLLLLLLEEEEEHHHHLLLLLEEEEEEEHHHHHHHH


DSSP  HHHHHLLLHHHLLLLLHHHHHLLLLLHHHLLLHHHHLLLLLLLLLLLLLLHHHHHHHHHH
Query LQDLSGIDPKTIPTDDPDVMGIFSSTEPLGVTPEQIMCNVGTIGIPEFGTRFVRQMLEET  720
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LQDLSGIDPKTIPTDDPDVMGIFSSTEPLGVTPEQIMCNVGTIGIPEFGTRFVRQMLEET  720
DSSP  HHHHHLLLHHHLLLLLHHHHHLLLLLHHHLLLHHHHLLLLLLLLLLLLLLHHHHHHHHHH


DSSP  LLLLHHHHHHHHHHLLLLLLLLLLHHHHHHLLLLLHHHLLLLHHHHHHHHHHLLLLHHHH
Query RPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRDDIMVYLIYRGLEPSLA  780
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RPKTFSELVQISGLSHGTDVWLGNAQELIQNGTCTLSEVIGCRDDIMVYLIYRGLEPSLA  780
DSSP  LLLLHHHHHHHHHHLLLLLLLLLLHHHHHHLLLLLHHHLLLLHHHHHHHHHHLLLLHHHH


DSSP  HHHHHHHLLLLLLLHHHHHHHHHLLLLHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHH
Query FKIMESVRKGKGLTPEFEAEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFK  840
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FKIMESVRKGKGLTPEFEAEMRKHDVPEWYIDSCKKIKYMFPKAHAAAYVLMAVRIAYFK  840
DSSP  HHHHHHHLLLLLLLHHHHHHHHHLLLLHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHH


DSSP  HHLHHHHHHHHHHHLLLLLLHHHHHHLHHHHHHHHHHHHHLHHHLLHHHHHHHHHHHHHH
Query VHHPLLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATAKEKSLLTVLEVAL  900
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VHHPLLYYASYFTVRAEDFDLDAMIKGSAAIRKRIEEINAKGIQATAKEKSLLTVLEVAL  900
DSSP  HHLHHHHHHHHHHHLLLLLLHHHHHHLHHHHHHHHHHHHHLHHHLLHHHHHHHHHHHHHH


DSSP  HHHHLLLEELLLLLLLLLLLLLEEELLEEELLHHHLLLLLHHHHHHHHHHHHLLLLLLHH
Query EMCERGFSFKNIDLYRSQATEFVIDGNSLIPPFNAIPGLGTNVAQAIVRAREEGEFLSKE  960
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EMCERGFSFKNIDLYRSQATEFVIDGNSLIPPFNAIPGLGTNVAQAIVRAREEGEFLSKE  960
DSSP  HHHHLLLEELLLLLLLLLLLLLEEELLEEELLHHHLLLLLHHHHHHHHHHHHLLLLLLHH


DSSP  HHHHHHLLLHHHHHHHHHLLLLLLLLLLLLLLLL
Query DLQQRGKLSKTLLEYLESRGCLDSLPDHNQLSLF  994
ident ||||||||||||||||||||||||||||||||||
Sbjct DLQQRGKLSKTLLEYLESRGCLDSLPDHNQLSLF  994
DSSP  HHHHHHLLLHHHHHHHHHLLLLLLLLLLLLLLLL


No 2: Query=3f2bA Sbjct=2yb1A Z-score=15.3

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
ident                                                     || |   |
Sbjct ------------------------------------------------ANIDLHFHSRTS   12
DSSP  ------------------------------------------------LLEELLLLLLLL


DSSP  llLLLLLHHHHHHHHHHLLLLLEEELLLLLLLLHHHHHHHHHHHLLLEEEEEEEEEELL-
Query qmDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYGLEANIVDD-  179
ident   |     |  |  |        | |||       ||  ||   |     | |       
Sbjct --DGALTPTEVIDRAAARAPALLALTDHDCTGGLAEAAAAAARRGIPFLNGVEVSVSWGr   70
DSSP  --LLLLLHHHHHHHHHLLLLLEEEELLLLLLLLHHHHHHHHHHLLLLEEEEEEEEEEELl


DSSP  -LEEEEEEELlhhHHHH--HHHHHHHHHllLLLL--------------------------
Query -PFHVTLLAQnetGLKN--LFKLVSLSHiqYFHR--------------------------  210
ident    |   |           |                                        
Sbjct hTVHIVGLGI---DPAEpaLAAGLKSIR--EGRLerarqmgasleaagiagcfdgamrwc  125
DSSP  eEEEEEEELL---LLLLhhHHHHHHHHH--LLHHhhhhhhhhhhhhlllllhhhhhhlll


DSSP  -----------------------------------------llLEEHHHHHHL--LLLEE
Query -----------------------------------------vpRIPRSVLVKH--RDGLL  227
ident                                                   |      |  
Sbjct dnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqWASLEDAVGWivGAGGM  185
DSSP  llhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllLLLHHHHHHHhhHLLLE


DSSP  EELLLllllLLLL------LLLLHH-----HLLLEE-ELLHhhhlllllllhhhHHHHHH
Query VGSGCdkgeLFDN------VEDIAR-----FYDFLE-VHPPdvykplyvkdeemIKNIIR  275
ident                     |              |                        
Sbjct AVIAH----PGRYdmgrtlIERLILdfqaaGGQGIEvASGS------------hSLDDMH  229
DSSP  EEELL----HHHLlllhhhHHHHHHhhhhlLLLEEEeEELL------------lLHHHHH


DSSP  HHHHHHHHLLLLEEELLLLLLLLHhhhhhhhhhhhllhhhlllllllllllLLLLhhhhh
Query SIVALGEKLDIPVVATGNVHYLNPedkiyrkilihsqgganplnrhelpdvYFRTtneml  335
ident                    |                                        
Sbjct KFALHADRHGLYASSGSDFHAPGE---------------------------DVGH-----  257
DSSP  HHHHHHHHHLLEEEEELLLLLLLL---------------------------LLLL-----


DSSP  hhhhhhhhhHHHHHhlhHHHHHHHLLLLlllllllllllllllhhhhhhhhhhhhhhhhh
Query dcfsflgpeKAKEIvvdNTQKIASLIGDvkpikdelytpriegadeeiremsyrrakeiy  395
ident                                                             
Sbjct -----tedlPPICR---PIWRELEARIL--------------------------------  277
DSSP  -----llllLLLLL---LHHHHLHHHLL--------------------------------


DSSP  lllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhl
Query gdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmt  455
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhl
Query eitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflg  515
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhll
Query fkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhn  575
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeee
Query lelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthf  635
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  ehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhh
Query dfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeq  695
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  hllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllll
Query imcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtct  755
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  hhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhh
Query lsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsck  815
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  hllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhh
Query kikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkri  875
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  hhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhh
Query eeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfna  935
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query ipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                            
Sbjct ----------------------------------------------------rpadaen  284
DSSP  ----------------------------------------------------lllhhhl


No 3: Query=3f2bA Sbjct=3e38A Z-score=12.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllLLLLLLL----LLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaaneRQDTAPE----GEKRVELHLH  116
ident                                             |            | |
Sbjct -----------------------------------aqrrNEIQVPDldgyTTLKCDFHXH   25
DSSP  -----------------------------------llllLLLLLLLllllEEEEEELLLL


DSSP  LLLLllLLLLLHHHHHHHHHHLLLLLEEELLLL------------LLLLHHHHHHHHHHH
Query TPMSqmDAVTSVTKLIEQAKKWGHPAIAVTDHA------------VVQSFPEAYSAAKKH  164
ident    |  |     |     |   |  ||  | |                ||      | | 
Sbjct SVFS--DGLVWPTVRVDEAYRDGLDAISLTEHIeyrphkqdvvsdHNRSFDLCREQAEKL   83
DSSP  LLLL--LLLLLHHHHHHHHHHLLLLEELLEEELllllllllllllLLHHHHHHHHHHHHH


DSSP  LLLEEEEEEEEEEllLEEEEEEELLhhhhhHHHHHHhhhhllllllllleEHHHHHHLL-
Query GMKVIYGLEANIVddPFHVTLLAQNetglkNLFKLVslshiqyfhrvpriPRSVLVKHR-  223
ident |   | | |      | |                |                         
Sbjct GILLIKGSEITRAxaPGHFNAIFLS-----DSNPLE------------qkDYKDAFREAk  126
DSSP  LLEELLEEEEELLllLLEEEEELLL-----LLHHHL------------llLHHHHHHHHh


DSSP  -LLEEEELLLL----lllllLLLL---LLHH---HLLLEE-ELLHHhhlllllllhhhhh
Query -DGLLVGSGCD----kgelfDNVE---DIAR---FYDFLE-VHPPDvykplyvkdeemik  271
ident   |                                    |                    
Sbjct kQGAFXFWNHPgwdsqqpdtTKWWpehTALYqegCXHGIEvANGHL--------------  172
DSSP  hLLLEEEELLLlllllllllLLLLhhhHHHHhllLLLEEEeEELLE--------------


DSSP  hhHHHHHHHHHHLLLLEEELLLLLL-LLHH---hhhhhhhhhhllhhhllllllllllll
Query niIRSIVALGEKLDIPVVATGNVHY-LNPE---dkiyrkilihsqgganplnrhelpdvy  327
ident                    |   |                                    
Sbjct -yXPEAIQWCLDKNLTXIGTSDIHQpIQTDydfekgehrtxtfvfakerslqgirealdn  231
DSSP  -eLLHHHHHHHHHLLEEEEELLLLLlHHHHllhhhllllleeeeeellllhhhhhhhhhl


DSSP  lllhhhHHHHHhhHHHHHhhhhhlhhhhhhhhlllllllllllllllllllhhhhhhhhh
Query frttneMLDCFsfLGPEKakeivvdntqkiasligdvkpikdelytpriegadeeirems  387
ident                                                             
Sbjct rrtaayFHELLigREDLL------------------------------------------  249
DSSP  lleeeeELLEEelLHHHH------------------------------------------


DSSP  hhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhh
Query yrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvg  447
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  hlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelll
Query ssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghd  507
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  lllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhh
Query ipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfv  567
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlll
Query kayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddts  627
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  lllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllh
Query sewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsste  687
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  hhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhh
Query plgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqe  747
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  hhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllll
Query liqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvp  807
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhl
Query ewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikg  867
ident                                                             
Sbjct ------------------------------------------------------------  249
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeell
Query saairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgn  927
ident                                                             
Sbjct ----------------------------------rpffekcvkieevsrneqgvtlsitn  275
DSSP  ----------------------------------hhhhhhheeeeeeeeelleeeeeeee


DSSP  eeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllll
Query slippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpd  987
ident                                                             
Sbjct vtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkg  335
DSSP  llllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeellee


DSSP  lllllll
Query hnqlslf  994
ident        
Sbjct lkytisl  342
DSSP  eeeeeel


No 4: Query=3f2bA Sbjct=2anuA Z-score=11.7

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPMS  120
ident                                                      | ||  |
Sbjct ---------------------------------------------tEWLLCDFHVHTNXS   15
DSSP  ---------------------------------------------lEEEEEEEEELLLLL


DSSP  llLLLLLHHHHHHHHHHLLLLLEEELLLL-----------------------llLLHHHH
Query qmDAVTSVTKLIEQAKKWGHPAIAVTDHA-----------------------vvQSFPEA  157
ident   |             | |      |||                                
Sbjct --DGHLPLGEVVDLFGKHGVDVVSITDHIvdrrtleqrkrngeplgaitedkfqDYLKRL   73
DSSP  --LLLLLHHHHHHHHHHLLLLEEEEEEEEelhhhhhhhhhllllllllllllhhHHHHHH


DSSP  HHHHHHHL----LLEEEEEEEEEELlLEEEEEEEllhhhhhhHHHHhhhhhlllllllLL
Query YSAAKKHG----MKVIYGLEANIVDdPFHVTLLAqnetglknLFKLvslshiqyfhrvPR  213
ident     |          | | |        |                               
Sbjct WREQKRAWeeygXILIPGVEITNNTdLYHIVAVD-------vKEYV------------DP  114
DSSP  HHHHHHHHhhhlLEEEEEEEEEELLlLEEEEEEL-------lLLLL------------LL


DSSP  EEH-HHHHHLLL--LEEEELLLL-----llLLLLLLLLLHHHLLLEE-ELLHHhhlllll
Query IPR-SVLVKHRD--GLLVGSGCD-----kgELFDNVEDIARFYDFLE-VHPPDvykplyv  264
ident        |        ||             |  | |      |  |     |       
Sbjct SLPvEEIVEKLKeqNALVIAAHPdrkklswYLWANXERFKDTFDAWEiANRDD-------  167
DSSP  LLLhHHHHHHHHhlLLEEEELLLlllllllHHHHLLLLLLLLLLEEEeEELLE-------


DSSP  llhhhhhhhHHHHHHHHhhllLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllll
Query kdeemikniIRSIVALGekldIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelp  324
ident            |            ||    | |                           
Sbjct --------lFNSVGVKK----YRYVANSDFHELW--------------------------  189
DSSP  --------eLHHHHHLL----LLEEEELLLLLHH--------------------------


DSSP  llLLLLhhhhhhhhhhhhhhhhhhHHLHhhhhhhHLLLllllllllllllllllhhhhhh
Query dvYFRTtnemldcfsflgpekakeIVVDntqkiaSLIGdvkpikdelytpriegadeeir  384
ident                                     |                       
Sbjct --HVYS-----------------wKTLV---kseKNIE----------------------  205
DSSP  --HHLL-----------------eEEEE---eelLLHH----------------------


DSSP  hhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelh
Query emsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrg  444
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  hhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleee
Query svgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkd  504
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhh
Query ghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktay  564
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhh
Query gfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypad  624
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  llllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlll
Query dtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifs  684
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  llhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllll
Query steplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgn  744
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhl
Query aqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkh  804
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhh
Query dvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldam  864
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  hhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllllllllllee
Query ikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvi  924
ident                                                             
Sbjct ------------------------------------------------------------  205
DSSP  ------------------------------------------------------------


DSSP  elleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllll
Query dgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgclds  984
ident                                                             
Sbjct ---------------------------------------------------aikeairkn  214
DSSP  ---------------------------------------------------hhhhhhhhl


DSSP  llllllllll
Query lpdhnqlslf  994
ident           
Sbjct tdvaiylxrk  224
DSSP  lleeeeelll


No 5: Query=3f2bA Sbjct=1v77A Z-score=11.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLlll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTpms  120
ident                                                 |  |        
Sbjct -----------------------------------------------VKFIEMDIRD---   10
DSSP  -----------------------------------------------LLLEEEEELL---


DSSP  lllllllhHHHHHHHHHLlLLLEEELLLL-------LLLLH-HHHHhhhhhhllleEEEE
Query qmdavtsvTKLIEQAKKWgHPAIAVTDHA-------VVQSF-PEAYsaakkhgmkvIYGL  172
ident             | || |      |                  |                
Sbjct --------KEAYELAKEW-FDEVVVSIKFneevdkeKLREArKEYG----------KVAI   51
DSSP  --------HHHHHHHHHH-LLEEEEEEEElllllhhHHHHHhHHHL----------LEEE


DSSP  EEE-EELLleeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHLLLLE-----
Query EAN-IVDDpfhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKHRDGL-----  226
ident                                                 |           
Sbjct LLSnPKPS-----------------------------------LVRDTVQKFKSYliyve   76
DSSP  EEElLLHH-----------------------------------HHHHHHHHLLLLeeeee


DSSP  --------------EEELLLllllLLLL------LLLLHHHL----LLEEELLhhHHLLL
Query --------------LVGSGCdkgeLFDN------VEDIARFY----DFLEVHPpdVYKPL  262
ident                            |          |         |           
Sbjct sndlrvirysiekgVDAIIS----PWVNrkdpgiDHVLAKLMvkknVALGFSL-rPLLYS  131
DSSP  lllhhhhhhhhhllLLEEEL----LLLLllllllLHHHHHHHhhhlLEEEEEL-hHHHHL


DSSP  LLLLHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllll
Query YVKDEEMIKNIIRSIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhe  322
ident                  | ||       |                               
Sbjct NPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKW------------------------  167
DSSP  LHHHHHHHHHHHHHHHHHHHHHLLLEEEELLLLLHH------------------------


DSSP  llllLLLLHHHHHHHHHH--HHHHHHHHHHLHHHHHHHHlllllllllllllllllllhh
Query lpdvYFRTTNEMLDCFSF--LGPEKAKEIVVDNTQKIASligdvkpikdelytpriegad  380
ident       |                  ||         |                       
Sbjct ----DVRYPRDLISLGVVigMEIPQAKASISMYPEIILK---------------------  202
DSSP  ----HLLLHHHHHHHHHHllLLHHHHHHLLLHHHHHHHL---------------------


DSSP  hhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhlllll
Query eeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylv  440
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  eelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllll
Query gsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtk  500
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  leeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellh
Query ykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvad  560
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhlllee
Query ktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiq  620
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  lhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhh
Query ypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvm  680
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  hlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllll
Query gifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdv  740
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhh
Query wlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeae  800
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  hhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllll
Query mrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfd  860
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllllllll
Query ldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqat  920
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  lleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhll
Query efvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrg  980
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  llllllllllllll
Query cldslpdhnqlslf  994
ident               
Sbjct --------------  202
DSSP  --------------


No 6: Query=3f2bA Sbjct=1yrrB Z-score=10.6

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -----------------------------------------------------yaltqgr    7
DSSP  -----------------------------------------------------leeelle


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELllllllllLLLLLLLLLLLLL---
Query msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtaPEGEKRVELHLHT---  117
ident                                  |                    |     
Sbjct iftgheflddhavviadgliksvcpvaelpPEIEQR---slngaILSPGFIDVQLNGcgg   64
DSSP  eelllleelleeeeeelleeeeeeehhhllLLLLEE---ellllEEEELEEEEEELEell


DSSP  -LLLLL---llllLHHHHHHHHHHLLLLLEEELLLL-----llLLHHHHHHHHHHHLLLE
Query -PMSQM---davtSVTKLIEQAKKWGHPAIAVTDHA-----vvQSFPEAYSAAKKHGMKV  168
ident                        | |      |          |          ||    
Sbjct vQFNDTaeavsveTLEIMQKANEKSGCTNYLPTLITtsdelmkQGVRVMREYLAKHPNQA  124
DSSP  eELLLLlllllhhHHHHHHHHHHLLLEEEEEEEELLllhhhhhHHHHHHHHHHHHLLLLL


DSSP  E-EEEEEEEellleeeeeeellHHHHhhhhhhhhhhhllllllllLEEHHHHHHLL-LLE
Query I-YGLEANIvddpfhvtllaqnETGLknlfklvslshiqyfhrvpRIPRSVLVKHR-DGL  226
ident     ||                |                        |  |  |    | 
Sbjct LgLHLEGPW---lnaalvdflcENAD---------vitkvtlapeMVPAEVISKLAnAGI  172
DSSP  LlEEEELLL---lllhhhhhhhHLHH---------heeeeeelhhHLLHHHHHHHHhHLL


DSSP  EE---------------------ELLL--LLLL-------llLLLL-LLHHhlLLEEELL
Query LV---------------------GSGC--DKGE-------lfDNVE-DIARfyDFLEVHP  255
ident  |                                             | |          
Sbjct VVsaghsnatlkeakagfragitFATHlyNAMPyitgrepglAGAIlDEAD--IYCGIIA  230
DSSP  EEeellllllhhhhhhhhhhleeEELLllLLLLlllllllhhHHHHhHLLL--LEEEEEL


DSSP  -HHHHlllllllhhhHHHHHHHHHHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhh
Query -PDVYkplyvkdeemIKNIIRSIVALGEkldIPVVATGNVHylnpedkiyrkilihsqgg  314
ident                    ||    |                                  
Sbjct dGLHV----------DYANIRNAKRLKG---DKLCLVTDAT-------------------  258
DSSP  lLLLL----------LHHHHHHHHHHHH---HHEEEELLLL-------------------


DSSP  hllllllllLLLLLLLHhHHHHHHH---HHHHHHHHHHHLHHHHHHHHLlllllllllll
Query anplnrhelPDVYFRTTnEMLDCFS---FLGPEKAKEIVVDNTQKIASLigdvkpikdel  371
ident                   |                                         
Sbjct ---------SGSSLTMI-EGVRNLVehcGIALDEVLRMATLYPARAIGV-----------  297
DSSP  ---------LLLLLLHH-HHHHHHHhhhLLLHHHHHHHHLHHHHHHLLL-----------


DSSP  lllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhh
Query ytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvk  431
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  hhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlll
Query kslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpd  491
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  lllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleee
Query kncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyr  551
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  eeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeelllll
Query agtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdym  611
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  lhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhh
Query eiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpkt  671
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhh
Query iptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqi  731
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhllll
Query sglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgk  791
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhh
Query gltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasy  851
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  hhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleell
Query ftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfkn  911
ident                                                             
Sbjct ------------------------------------------------------------  297
DSSP  ------------------------------------------------------------


DSSP  llllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhh
Query idlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklskt  971
ident                                                             
Sbjct ----------------------------------------------ekrlgtlaagkvan  311
DSSP  ----------------------------------------------llllllllllllll


DSSP  hhhhhhhllllllllllllllll
Query lleylesrgcldslpdhnqlslf  994
ident                        
Sbjct ltaftpdfkitktivngnevvtq  334
DSSP  eeeellllleeeeeelleeeeel


No 7: Query=3f2bA Sbjct=3qy6A Z-score=10.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllllLLLLLLL-LLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegekRVELHLH-TPM  119
ident                                                      | |  | 
Sbjct -------------------------------------------------MIDIHCHiLPA   11
DSSP  -------------------------------------------------LEELLLLlLLL


DSSP  LLlLLLL---LHHHHHHHHHHLLLLLEEELLLL-----------LLLLHHHHHHHHH--H
Query SQmDAVT---SVTKLIEQAKKWGHPAIAVTDHA-----------VVQSFPEAYSAAK--K  163
ident    |              |   |   |  | |            |               
Sbjct MD-DGAGdsaDSIEMARAAVRQGIRTIIATPHHnngvyknepaaVREAADQLNKRLIkeD   70
DSSP  LL-LLLLlhhHHHHHHHHHHHLLLLEEELLLEEllllllllhhhHHHHHHHHHHHHHhlL


DSSP  HLLLEEEEEEEEEELLleeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHL-
Query HGMKVIYGLEANIVDDpfhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKH-  222
ident     |  | |  |                                          | |  
Sbjct IPLHVLPGQEIRIYGE-----------------------------------VEQDLAKRq   95
DSSP  LLLEEELLLEEELLLL-----------------------------------HHHHHHLLl


DSSP  ----llLEEE---------------------------ELLLLllllLLLL-------LLL
Query ----rdGLLV---------------------------GSGCDkgelFDNV-------EDI  244
ident                                                             
Sbjct llslndTKYIliefpfdhvpryaeqlfydlqlkgyipVIAHP--erNREIrenpsllYHL  153
DSSP  lllhhhLLEEeeelllllllllhhhhhhhhhhllleeEEELH--hhLHHHhhllhhhHHH


DSSP  H-HHLLlEEEL--LHHH-HLLLllllHHHHHHHHHHHHhhhhhllllEEELLLLLLLLHh
Query A-RFYDfLEVH--PPDV-YKPLyvkdEEMIKNIIRSIValgekldipVVATGNVHYLNPe  300
ident                                                       |     
Sbjct VeKGAA-SQITsgSLAGiFGKQ---lKAFSLRLVEANL--------iHFVASDAHNVKT-  200
DSSP  HhLLLE-EEEEhhHHLLlLLHH---hHHHHHHHHHLLL--------lLEEELLLLLLLL-


DSSP  hhhhhhhhhhllhhhllllllllllLLLLLHhHHHHHHH-HHHHHHHHHHhLHHHHHHHH
Query dkiyrkilihsqgganplnrhelpdVYFRTTnEMLDCFS-FLGPEKAKEIvVDNTQKIAS  359
ident                            | |  | |       | |        |      
Sbjct -------------------------RNFHTQ-EALYVLEkEFGSELPYML-TENAELLLR  233
DSSP  -------------------------LLLLHH-HHHHHHHhHHLLHHHHHH-HHHHHHHHL


DSSP  Lllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlll
Query Ligdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgf  419
ident                                                             
Sbjct N-----------------------------------------------------------  234
DSSP  L-----------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeell
Query aviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffn  479
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  llllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhh
Query dgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahny  539
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeee
Query tkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgq  599
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  eeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhh
Query hpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvir  659
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhh
Query mlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmlee  719
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhh
Query trpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepsl  779
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhh
Query afkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayf  839
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhh
Query kvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvleva  899
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllh
Query lemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflsk  959
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllhhhhhhhhhllllllllllllllll
Query edlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                    
Sbjct ----------------------qtifrqppqpvkr  247
DSSP  ----------------------lllllllllllll


No 8: Query=3f2bA Sbjct=3au2A Z-score=10.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  --------------------------------------------------lLLHHHLLL-
Query --------------------------------------------------vRRLETIVE-    9
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarsllEAIRALPGv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhHHHHLLLLl


DSSP  -----------------------------LEEEeeeeeeeeeeeeeellllleeeeeeee
Query -----------------------------EERRvvvqgyvfdaevselksgrtlltmkit   40
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeRAVE---------------------------  213
DSSP  leeeelhhhhlllleelleeeeeelllhhHHHH---------------------------


DSSP  lllleEEEEeelllhhhhhhhhlllllleeeeeeeeeeelllleeeeEEEE---------
Query dytnsILVKmfsrdkedaelmsgvkkgmwvkvrgsvqndtfvrdlviIAND---------   91
ident        ||                                                   
Sbjct gfvrlPQVK--------------------------------------EVYAkgkeratvf  235
DSSP  hhhllLLEE--------------------------------------EEEEellleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   91
ident                                                             
Sbjct lknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriage  295
DSSP  elllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeell


DSSP  ------------------------eeeelllllllllllLLLLLLLLLLLLLLllLLLLL
Query ------------------------lneiaanerqdtapeGEKRVELHLHTPMSqmDAVTS  127
ident                                              |  |   |  |    
Sbjct teeevyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYS--DGQNT  353
DSSP  lhhhhhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLL--LLLLL


DSSP  HHHHHHHHHHLLLLLEEELLLL-------------LLLLHHHHHHHHHHHLL-LEEEEEE
Query VTKLIEQAKKWGHPAIAVTDHA-------------VVQSFPEAYSAAKKHGM-KVIYGLE  173
ident    | | ||  |    |||||                    |       ||      | |
Sbjct LEELWEAAKTMGYRYLAVTDHSpavrvaggpspeeALKRVGEIRRFNETHGPpYLLAGAE  413
DSSP  HHHHHHHHHHHLLLEEEEEEELhhhhllllllhhhHHHHHHHHHHHHHHHLLlEEEEEEE


DSSP  EEEELLleeeeeeellhhhHHHHH------hhhhhhhllllllllleehHHHHhlLLLEe
Query ANIVDDpfhvtllaqnetgLKNLF------klvslshiqyfhrvpriprSVLVkhRDGLl  227
ident   |  |                |                            |        
Sbjct VDIHPD-------gtldypDWVLReldlvlvsvhsrfnlpkadqtkrllKALE--NPFV-  463
DSSP  EELLLL-------llllllHHHHLllleeeeellllllllhhhhhhhhhHHHL--LLLL-


DSSP  EELLLLLL------lllLLLL-LLHHHL----LLEEELL-HHHHlllllllhhhhhhhHH
Query VGSGCDKG------elfDNVE-DIARFY----DFLEVHP-PDVYkplyvkdeemikniIR  275
ident                                    |     |                  
Sbjct HVLAHPTArllgrrapiEADWeAVFQKAkekgVAVEIDGyYDRM------------dlPD  511
DSSP  LEELLLLLlllllllllLLLHhHHHHHHhhhlLEEEEELlLLLL------------llLH


DSSP  HHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllllllLLLLhHHHH
Query SIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelpdvYFRTtNEML  335
ident                    |                                 |      
Sbjct DLARMAYGMGLWISLSTDAHQTD----------------------------HLRFmELAV  543
DSSP  HHHHHHHHLLLLEEEELLLLLHH----------------------------HHHHhHHHH


DSSP  HHHHHHHhhHHHHhhlHHHHH-hhHLLLllllllllllllllllhhhhhhhhhhhhhhhh
Query DCFSFLGpeKAKEivvDNTQK-iaSLIGdvkpikdelytpriegadeeiremsyrrakei  394
ident             |            |                                  
Sbjct GTAQRAW--IGPE--rVLNTLdyeDLLS--------------------------------  567
DSSP  HHHHHLL--LLLL--lLHHHLlhhHHHH--------------------------------


DSSP  hlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhh
Query ygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatm  454
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  llllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhh
Query teitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetfl  514
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  llllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhl
Query gfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdh  574
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleee
Query nlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtth  634
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  eehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhh
Query fdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpe  694
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  hhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhllll
Query qimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtc  754
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  lhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhh
Query tlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsc  814
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  hhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhh
Query kkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkr  874
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhh
Query ieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfn  934
ident                                                             
Sbjct ------------------------------------------------------------  567
DSSP  ------------------------------------------------------------


DSSP  hlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query aipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                             
Sbjct ----------------------------------------------------wlkarrgv  575
DSSP  ----------------------------------------------------hhhlllll


No 9: Query=3f2bA Sbjct=1m65A Z-score=9.7

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
ident                                                   | || ||  |
Sbjct ------------------------------------------------YPVDLHMHTVAS   12
DSSP  ------------------------------------------------LLEELLLLLLLL


DSSP  lLLLLLLHHHHHHHHHHLLLLLEEELLLLL----------lllHHHHHhhHHHHLLLEEE
Query qMDAVTSVTKLIEQAKKWGHPAIAVTDHAV----------vqsFPEAYsaAKKHGMKVIY  170
ident    |       | |||  |    | |||                          |     
Sbjct -THAYSTLSDYIAQAKQKGIKLFAITDHGPdmedaphhwhfinMRIWP--RVVDGVGILR   69
DSSP  -LLLLLLHHHHHHHHHHHLLLEEEEEEELLllllllllhhhhhHHHLL--LEELLEEEEE


DSSP  EEEEEEELLleeeeeeellhhhhHHHHhhhhhhhllllllLLLE-----------ehhhh
Query GLEANIVDDpfhvtllaqnetglKNLFklvslshiqyfhrVPRI-----------prsvl  219
ident | ||||                 |                 |                  
Sbjct GIEANIKNV------dgeidcsgKMFD---sldliiagfhEPVFaphdkatntqamiati  120
DSSP  EEEEELLLL------lllllllhHHHH---hlleeeeellLLLLllllhhhhhhhhhhhh


DSSP  HHLLlleEEELLLllllLLLL-----LLLLHHHL----LLEEELLhhhhlllllllhhhh
Query VKHRdglLVGSGCdkgeLFDN-----VEDIARFY----DFLEVHPpdvykplyvkdeemi  270
ident                           |   |         ||                  
Sbjct ASGN---VHIISH----PGNPkyeidVKAVAEAAakhqVALEINN---------------  158
DSSP  HLLL---LLEELL----LLLLlllllHHHHHHHHhhhlLEEEEEL---------------


DSSP  hhHHHHHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllllllLLLL
Query knIIRSIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelpdvYFRT  330
ident     |   |        |      |                                   
Sbjct ssNCREVAAAVRDAGGWVALGSDSHTAF----------------------------TMGE  190
DSSP  llLHHHHHHHHHHHLLLEEEELLLLLHH----------------------------HLLL


DSSP  hhhHHHHHH-hHHHHHHHHhhlHHHH---HHHHLL------LLLLlllllllllllllhh
Query tneMLDCFS-fLGPEKAKEivvDNTQ---KIASLI------GDVKpikdelytpriegad  380
ident       |           |                                         
Sbjct ---FEECLKilDAVDFPPE--rILNVsprRLLNFLesrgmaPIAE---------------  230
DSSP  ---LHHHHHhhHHLLLLHH--hLHHHlhhHHHHHHhhllllLLHH---------------


DSSP  hhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhlllll
Query eeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylv  440
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  eelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllll
Query gsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtk  500
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  leeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellh
Query ykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvad  560
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhlllee
Query ktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiq  620
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  lhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhh
Query ypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvm  680
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  hlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllll
Query gifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdv  740
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhh
Query wlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeae  800
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  hhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllll
Query mrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfd  860
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllllllll
Query ldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqat  920
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  lleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhll
Query efvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrg  980
ident                                                             
Sbjct ------------------------------------------------------------  230
DSSP  ------------------------------------------------------------


DSSP  llllllllllllll
Query cldslpdhnqlslf  994
ident               
Sbjct ----------fadl  234
DSSP  ----------hlll


No 10: Query=3f2bA Sbjct=3ls9A Z-score=9.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -------------------------------------------------milirgltrvi   11
DSSP  -------------------------------------------------leeeeeeeeee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEElllllllllLLLLLLLLLLLLLL--
Query msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIaanerqdtaPEGEKRVELHLHTP--  118
ident                                                      | |    
Sbjct tfddqereledadilidgpkivavgkdlsdrSVSR--tidgrgmIALPGLINSHQHLYeg   69
DSSP  llllllleeeeeeeeeelleeeeeellllllLLLE--eeellleEEEELEEEEEELHHhh


DSSP  --------------------------------llllllllLHHHHHHHHHHLLLLLEEEL
Query --------------------------------msqmdavtSVTKLIEQAKKWGHPAIAVT  146
ident                                                     |    |  
Sbjct amraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLESLLGGITTVADQ  129
DSSP  hhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHHHHLLEEEEEEE


DSSP  LLLL-----lLLHHHHHHHHHHHLLLEEEEEEEEEEllleeeeeeellhhhhhhhhHHHH
Query DHAV-----vQSFPEAYSAAKKHGMKVIYGLEANIVddpfhvtllaqnetglknlfKLVS  201
ident                   ||   |                                  | 
Sbjct HLFFpgatadSYIDATIEAATDLGIRFHAARSSMTL---gkseggfcddlfvepvdRVVQ  186
DSSP  ELLLllllllLHHHHHHHHHHHHLLEEEEEELLLLL---lhhhlllllhhhlllhhHHHH


DSSP  -----------------hhhllllllllLEEHHHHHHLL------LLEEEE---------
Query -----------------lshiqyfhrvpRIPRSVLVKHR------DGLLVG---------  229
ident                                              |  |           
Sbjct hclglidqyhepepfgmvrialgpcgvpYDKPELFEAFAqmaadyDVRLHThfyepldag  246
DSSP  hhhhhhhhhlllllllleeeeellllllLLLHHHHHHHHhhhhhhLLEEEEeellllhhh


DSSP  -------------------------LLLLllllLLLL--LLLHH-HLLLEEELL--HHHH
Query -------------------------SGCDkgelFDNV--EDIAR-FYDFLEVHP--PDVY  259
ident                                                             
Sbjct msdhlygmtpwrflekhgwasdrvwLAHA---vVPPReeIPEFAdAGVAIAHLIapDLRM  303
DSSP  hhhhhhlllhhhhhhhllllllleeEEEL---lLLLHhhHHHHHhHLLEEEELHhhHHHL


DSSP  LllllllhhhHHHHhhhHHHHHHHLLLLEEELLLLLLllhhhhhhhhhhhhllhhhllll
Query KplyvkdeemIKNIirsIVALGEKLDIPVVATGNVHYlnpedkiyrkilihsqgganpln  319
ident                           | |                               
Sbjct G---------WGLA---PIREYLDAGITVGFGTTGSA-----------------------  328
DSSP  L---------LLLL---LHHHHHHLLLEEEELLLLLL-----------------------


DSSP  lllllLLLLLLHHHHHHHHHH-------------HHHHHHHHHHLHHHHHHHHLllllll
Query rhelpDVYFRTTNEMLDCFSF-------------LGPEKAKEIVVDNTQKIASLigdvkp  366
ident                |                  |                         
Sbjct -----SNDGGNLLGDLRLAALahrpadpnepekwLSARELLRMATRGSAECLGR------  377
DSSP  -----LLLLLLHHHHHHHHHHhlhhhllllhhhlLLHHHHHHHLLHHHHHHLLL------


DSSP  llllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhh
Query ikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylis  426
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllh
Query hklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsg  486
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  hhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhll
Query fdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfge  546
ident                                                             
Sbjct -----------------------------pdlgvleegraadiacwrldgvdrvgvhdpa  408
DSSP  -----------------------------llllllllllllleeeeelllhhhlllllhh


DSSP  lleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhHHHLlleeeeeeeeeeeee
Query dnvyragtigtvadktaygfvkayasdhnlelrgaeidrlaAGCTgvkrttgqhpggiiv  606
ident                                          |                  
Sbjct iglimtglsdraslvvvngqvlvenerpvladlerivanttALIP---------------  453
DSSP  hhhhhlllllllleeeelleeeeelleellllhhhhhhhhhHHLL---------------


DSSP  llllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhl
Query vpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsg  666
ident                                                             
Sbjct ------------------------------------------------------------  453
DSSP  ------------------------------------------------------------


DSSP  llhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhh
Query idpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfs  726
ident                                                             
Sbjct ------------------------------------------------------------  453
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhh
Query elvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimes  786
ident                                                             
Sbjct ------------------------------------------------------------  453
DSSP  ------------------------------------------------------------


DSSP  hlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhh
Query vrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpll  846
ident                                                             
Sbjct ------------------------------------------------------------  453
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhll
Query yyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcerg  906
ident                                                             
Sbjct ------------------------------------------------------------  453
DSSP  ------------------------------------------------------------


DSSP  leellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhh
Query fsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrg  966
ident                                                             
Sbjct ------------------------------------------------------------  453
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhllllllllllllllll
Query klsktlleylesrgcldslpdhnqlslf  994
ident                             
Sbjct ----------------------------  453
DSSP  ----------------------------


No 11: Query=3f2bA Sbjct=2oofA Z-score=9.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhH
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaeL   60
ident                                                             
Sbjct ------------lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkY   48
DSSP  ------------lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllL


DSSP  HHLLLllleeeeeeeeeeelllleeeeeeeeeeeelllllllllLLLLLLLLLLLLLLL-
Query MSGVKkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtaPEGEKRVELHLHTPM-  119
ident                                                             
Sbjct PAHWQ---------------------------------dxkgklVTPGLIDCHTHLIFAg   75
DSSP  LLLLE---------------------------------elllleEEELEEEEEELLLLLl


DSSP  ----------------------------LLLL-------lllLHHHHHHHHHHLLLLLEE
Query ----------------------------SQMD-------avtSVTKLIEQAKKWGHPAIA  144
ident                                                       |     
Sbjct sraeefelrqkgvpyaeiarkgggiistVRATraasedqlfeLALPRVKSLIREGVTTVE  135
DSSP  llhhhhhhhhhlllhhhhhhllllhhhhHHHHhhllhhhhhhHHHHHHHHHHHHLEEEEE


DSSP  ELLL------lLLLLHHHHHHHHHHHLLLEEEEEEEEeellleeeeeeellhhhhhhhhh
Query VTDH------aVVQSFPEAYSAAKKHGMKVIYGLEANivddpfhvtllaqnetglknlfk  198
ident                   |          |   | |                        
Sbjct IKSGygltledELKXLRVARRLGEALPIRVKTTLLAA-------------------havp  176
DSSP  EELLllllhhhHHHHHHHHHHHHHHLLLEEEEEEEEE-------------------llll


DSSP  hhhhhhLLLLlllLLEE----------------------------hhHHHHLLL---LEE
Query lvslshIQYFhrvPRIP----------------------------rsVLVKHRD---GLL  227
ident                                                      |      
Sbjct peyrddPDSW-veTICQeiipaaaeagladavdvfcehigfslaqteQVYLAADqygLAV  235
DSSP  hhhlllHHHH-hhHHHHlhhhhhhhllllleeeeeellllllhhhhhHHHHHHHhllLEE


DSSP  EELlllllLLLLLLLLLHHHL--------------------------LLEEELL--HHHH
Query VGSgcdkgELFDNVEDIARFY--------------------------DFLEVHP--PDVY  259
ident  |                                                   |      
Sbjct KGH-----XDQLSNLGGSTLAanfgalsvdhleyldpegiqalahrgVVATLLPtaFYFL  290
DSSP  EEE-----ELLLLLLLHHHHHhhlllleeeelllllhhhhhhhhhhlLEEEELHhhHHHL


DSSP  LllllllhhhHHHHHHhhHHHHHHLLLLEEELLLLLLllhhhhhhhhhhhhllhhhllll
Query KplyvkdeemIKNIIRsiVALGEKLDIPVVATGNVHYlnpedkiyrkilihsqgganpln  319
ident |                 |    |   |                                
Sbjct K---------ETKLPP--VVALRKAGVPXAVSSDINP-----------------------  316
DSSP  L---------LLLLLL--HHHHHHLLLLEEELLLLLL-----------------------


DSSP  llllLLLL-LLLHhHHHHHHH---HHHHHHHHHHHLHHHHHHHHLlllllllllllllll
Query rhelPDVY-FRTTnEMLDCFS---FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpr  375
ident                          | |  |   |                         
Sbjct ----GTAPiVSLR-XAXNXACtlfGLTPVEAXAGVTRHAARALGE---------------  356
DSSP  ----LLLLlLLHH-HHHHHHHhhhLLLHHHHHHHLLHHHHHHLLL---------------


DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh
Query iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll
Query dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee
Query rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh
Query gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll
Query ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl
Query dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh
Query hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl
Query efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll
Query aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh
Query rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
ident                                                             
Sbjct --------------------------------qeqlgqlrvgxladflvwncghpaelsy  384
DSSP  --------------------------------lllllllllllllleeeellllllhhhh


DSSP  hhhllllllllllllllll
Query lesrgcldslpdhnqlslf  994
ident                    
Sbjct ligvdqlvsrvvngeetlh  403
DSSP  lllllleeeeeelleelll


No 12: Query=3f2bA Sbjct=1gkpA Z-score=9.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------pllikn    6
DSSP  ------------------------------------------------------leeeel


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEELllllllllLLLLLLLLLLLLLlLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIAanerqdtaPEGEKRVELHLHTpMS  120
ident                                                      | |    
Sbjct geiitadsrykadiyaegetitrigqnleapPGTEV--idatgkYVFPGFIDPHVHI-YL   63
DSSP  leeeelleeeeleeeelllllleeellllllLLLEE--eellllEEEELEEEEEELL-LL


DSSP  LL---LLLLLHHHHHHHHHHLLLLLEEELLLL---------llLLHHHHHHHHhhhLLLE
Query QM---DAVTSVTKLIEQAKKWGHPAIAVTDHA---------vvQSFPEAYSAAkkhGMKV  168
ident       |          |   |                          |           
Sbjct PFmatFAKDTHETGSKAALMGGTTTYIEMCCPsrnddalegyqLWKSKAEGNS---YCDY  120
DSSP  EElleELLLLHHHHHHHHHHLLEEEEEEEELLlllllhhhhhhHHHHHHLLLL---LLEE


DSSP  EEEE------------------------EEEEellleeeeeeellhhhhhhhhhhhhhhh
Query IYGL------------------------EANIvddpfhvtllaqnetglknlfklvslsh  204
ident                                                             
Sbjct TFHMavskfdektegqlreivadgissfXIFL----------------------------  152
DSSP  EEEEelllllllhhhhhhhhhhlllleeEEEE----------------------------


DSSP  lllLLLLLLE---EHHHHHHLL--LLEEEE------------------------------
Query iqyFHRVPRI---PRSVLVKHR--DGLLVG------------------------------  229
ident                          |  |                               
Sbjct --sYKNFFGVddgEMYQTLRLAkeLGVIVTahcenaelvgrlqqkllsegktgpewheps  210
DSSP  --lLLLLLLLlhhHHHHHHHHHhhHLLEEEeeellhhhhhhhhhhhhhlllllhhhllll


DSSP  -------------------------LLLL-lllLLLL-LLLL--hHHLLlEEELL-HHHH
Query -------------------------SGCD-kgeLFDN-VEDI--aRFYDfLEVHP-PDVY  259
ident                                    |               |        
Sbjct rpeaveaegtarfatflettgatgyVVHLsckpALDAaMAAKargVPIY-IESVIpHFLL  269
DSSP  llhhhhhhhhhhhhhhhhhhlleeeELLLllhhHHHHhHHHHhllLLEE-EEEEHhHHHL


DSSP  LLL----------------llLLHHhHHHHHHHHHHHHHhllllEEELLLLLLllhhhhh
Query KPL----------------yvKDEEmIKNIIRSIVALGEkldipVVATGNVHYlnpedki  303
ident                       |            | |                      
Sbjct DKTyaerggveamkyimspplRDKR-NQKVLWDALAQGF----iDTVGTDHCP-------  317
DSSP  LHHhhhllhhhhhllllllllLLLH-HHHHHHHHHHLLL----lLEEELLLLL-------


DSSP  HHHHHHHLLHHHLLLLllllllLLLL--LHHHHHHHHH---HHHHHHHHHHHLHHHHHHH
Query YRKILIHSQGGANPLNrhelpdVYFR--TTNEMLDCFS---FLGPEKAKEIVVDNTQKIA  358
ident            |                  |           |              |  
Sbjct FDTEQKLLGKEAFTAI---pngIPAIedRVNLLYTYGVsrgRLDIHRFVDAASTKAAKLF  374
DSSP  LLHHHHHHHLLLHHHL---lllLLLLllHHHHHHHHHLlllLLLHHHHHHHHLHHHHHHL


DSSP  HLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhll
Query SLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighg  418
ident  |                                                          
Sbjct GL----------------------------------------------------------  376
DSSP  LL----------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeel
Query faviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseff  478
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhh
Query ndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahn  538
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeee
Query ytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttg  598
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhh
Query qhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvi  658
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhh
Query rmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmle  718
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhh
Query etrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrgleps  778
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhh
Query lafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriay  838
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhh
Query fkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlev  898
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllll
Query alemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefls  958
ident                                                             
Sbjct --------------fprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeid  422
DSSP  --------------lllllllllllllleeeeelllleellhhhllllllllllllleel


DSSP  hhhhhhhhlllhhhhhhhhhllllllllllllllll
Query kedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                     
Sbjct grpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  leeeeeeelleeeeelleelllllllllllllllll


No 13: Query=3f2bA Sbjct=2pajA Z-score=9.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct --------------------------------------------pstlirnaaaimtggr   16
DSSP  --------------------------------------------leeeeellleelllll


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELllllllllLLLLLLLLLLLLLL--
Query msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtaPEGEKRVELHLHTP--  118
ident                                   |               |  | |    
Sbjct gtaddpsrvpgpdirivgdtidaigalaprPGETIV---datdcVIYPAWVNTHHHLFqs   73
DSSP  llllllllllllleeeelleeeeellllllLLLEEE---ellllEEEELEELLLLLHHhh


DSSP  ----------llllllllLHHHHHHHHHHLLLLLEEELLLLL-----lLLHHHHHHHHHH
Query ----------msqmdavtSVTKLIEQAKKWGHPAIAVTDHAV-----vQSFPEAYSAAKK  163
ident                               |    |             |       | |
Sbjct llkgepfralfderrfrlAARIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEK  133
DSSP  hllllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHH


DSSP  HLLLEEEEEE--------------------------------------------------
Query HGMKVIYGLE--------------------------------------------------  173
ident  |                                                          
Sbjct LGLRFVLLRGgatqtrqleadlptalrpetldayvadierlaaryhdaspramrrvvmap  193
DSSP  LLLEEEEEELlllllllllllllhhhllllhhhhhhhhhhhhhhllllllllleeeeell


DSSP  EEEEllleeeeeeellhhhhhhhhhhhhhhhlllllllLLEE---HHHHHHLLL---LEE
Query ANIVddpfhvtllaqnetglknlfklvslshiqyfhrvPRIP---RSVLVKHRD---GLL  227
ident                                         |                   
Sbjct TTVL----------------------------------YSISpreMRETAAVARrlgLRM  219
DSSP  LLLL----------------------------------LLLLhhhHHHHHHHHHhllLEE


DSSP  E----------------------ELLLLllllLLLL---LLLH-HHLLLEEELLHHHHLL
Query V----------------------GSGCDkgelFDNV---EDIA-RFYDFLEVHPPDVYKP  261
ident                                                      |      
Sbjct HshlsgkspvafcgehdwlgsdvWYAHL----VKVDadeIALLaQTGTGVAHCPQSNGRL  275
DSSP  EeelllllhhhhhhhllllllleEEELL----LLLLhhhHHHHhHHLLEEEELHHHHHLL


DSSP  lllllhhhhhhHHHHHHHHHhhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllll
Query lyvkdeemiknIIRSIVALGekldIPVVATGNVHylnpedkiyrkilihsqgganplnrh  321
ident              |     |     ||                                 
Sbjct -----------PVREMADAG----VPVSIGVDGA--------------------------  294
DSSP  -----------LLLLHHHHL----LLEEELLLHH--------------------------


DSSP  llLLLL-LLLHhHHHHHHHH------HHHHHHHHHHLHHHHHHHHLllllllllllllll
Query elPDVY-FRTTnEMLDCFSF------LGPEKAKEIVVDNTQKIASLigdvkpikdelytp  374
ident                                              |              
Sbjct --ASNEaADMI-SEVHMTWLaqrarlASIAEVIHWGTAGGARVMGL--------------  337
DSSP  --HHLLlLLHH-HHHHHHHHhhhhllLLHHHHHHHHLHHHHHHHLL--------------


DSSP  llllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhh
Query riegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksl  434
ident                                                             
Sbjct ------------------------------------------------------------  337
DSSP  ------------------------------------------------------------


DSSP  hllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllll
Query ddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdknc  494
ident                                                             
Sbjct ---------------------------------------------------devgkvavg  346
DSSP  ---------------------------------------------------lllllllll


DSSP  llllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeee
Query prcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragt  554
ident                                                             
Sbjct yaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelgg  406
DSSP  lllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeellllllllhhhhhh


DSSP  eeeLLHHHHHHHHHHhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhh
Query igtVADKTAYGFVKAyasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiy  614
ident             |                                               
Sbjct earRVVRELLREVVV---------------------------------------------  421
DSSP  hhhHHHHHHHHHHHL---------------------------------------------


DSSP  hllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlll
Query dftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktipt  674
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  llhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhh
Query ddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgl  734
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllll
Query shgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkglt  794
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhh
Query pefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftv  854
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllll
Query raedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidl  914
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  lllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhh
Query yrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlle  974
ident                                                             
Sbjct ------------------------------------------------------------  421
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllllllllllll
Query ylesrgcldslpdhnqlslf  994
ident                     
Sbjct --------------------  421
DSSP  --------------------


No 14: Query=3f2bA Sbjct=1k6wA Z-score=9.3

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------alqtii    6
DSSP  ------------------------------------------------------llleee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeEEEEEElllllllllLLLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiaNDLNEIaanerqdtaPEGEKRVELHLHTPms  120
ident                                  |                || | |    
Sbjct narlpgeeglwqihlqdgkisaidaqsgvMPITEN--sldaeqgLVIPPFVEPHIHLD--   62
DSSP  eellllllleeeeeeelleeeeeeeelllLLLLLL--eeellllEEELLEEEEEELLL--


DSSP  llLLLL---------------------------------LHHHHHHHHHHLLLLLEEELL
Query qmDAVT---------------------------------SVTKLIEQAKKWGHPAIAVTD  147
ident      |                                             |        
Sbjct --TTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRTHV  120
DSSP  --LLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEEEE


DSSP  LL-------LLLLHHHHHHHHHhhLLLEEEEEEE-EEELlleeeeeeellhhhhHHHHH-
Query HA-------VVQSFPEAYSAAKkhGMKVIYGLEA-NIVDdpfhvtllaqnetglKNLFK-  198
ident                     |                                       
Sbjct DVsdatltaLKAMLEVKQEVAP--WIDLQIVAFPqEGIL------sypngeallEEALRl  172
DSSP  ELlllllhhHHHHHHHHHHHLL--LLEEEEEEELlLLLL------llllhhhhhHHHHHl


DSSP  ----hhhhhhllllllllleEHHHHHHLL--LLEEEELllllLLLLL-----LLLLLHH-
Query ----lvslshiqyfhrvpriPRSVLVKHR--DGLLVGSgcdkGELFD-----NVEDIAR-  246
ident                                   |                         
Sbjct gadvvgaiphfeftreygveSLHKTFALAqkYDRLIDV----HCDEIddeqsRFVETVAa  228
DSSP  llleeeelhhhlllhhhhhhHHHHHHHHHhhHLLEEEE----EELLLlllllLHHHHHHh


DSSP  ------------------------------------hlLLEEELL--HHHHLLLLL--LL
Query ------------------------------------fyDFLEVHP--PDVYKPLYV--KD  266
ident                                             |               
Sbjct lahhegmgarvtashttamhsyngaytsrlfrllkmsgINFVANPlvNIHLQGRFDtyPK  288
DSSP  hhhhhllhhheeeeelhhhhhllhhhhhhhhhhhhhhlLEEEELHhhHHHHLLLLLllLL


DSSP  HHhhhHHHHhhHHHHHHLLLLEEELLLLLLllhhhhhhhhhhhhllhhhlllllllllll
Query EEmikNIIRsiVALGEKLDIPVVATGNVHYlnpedkiyrkilihsqgganplnrhelpdv  326
ident       | |  |       | |                                      
Sbjct RR---GITR--VKEMLESGINVCFGHDDVF------------------------dpwypl  319
DSSP  LL---LLLL--HHHHHHLLLLEEELLLLLL------------------------llllll


DSSP  LLLLHHHHHHHHHH-------hHHHHHHHHHLHHHHHHHHLLLllllllllllllllllh
Query YFRTTNEMLDCFSF-------lGPEKAKEIVVDNTQKIASLIGdvkpikdelytpriega  379
ident         |                               |                   
Sbjct GTANMLQVLHMGLHvcqlmgygQINDGLNLITHHSARTLNLQD-----------------  362
DSSP  LLLLHHHHHHHHHHhlllllhhHHHHHHHHHLHHHHHHLLLLL-----------------


DSSP  hhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllll
Query deeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgyl  439
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  leelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllll
Query vgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgt  499
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  lleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeell
Query kykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtva  559
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllle
Query dktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpi  619
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  elhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhh
Query qypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdv  679
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllll
Query mgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtd  739
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhh
Query vwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefea  799
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhlllll
Query emrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedf  859
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllll
Query dldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqa  919
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  llleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhl
Query tefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesr  979
ident                                                             
Sbjct --------------ygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaq  408
DSSP  --------------lllllllllleeeellllhhhhhhhllllleeeelleeeeelllll


DSSP  lllllllllllllll
Query gcldslpdhnqlslf  994
ident                
Sbjct ttvyleqpeaidykr  423
DSSP  eeeellleeeellll


No 15: Query=3f2bA Sbjct=3icjA Z-score=9.1

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ---------------------------------------------cmkalingtiytsfs   15
DSSP  ---------------------------------------------leeeeelleeeeeel


DSSP  hhlllllleeeeeeeeeeelllleeeeeeEEEEEELlllllllllLLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiaNDLNEIAanerqdtapEGEKRVELHLHTPms  120
ident                                  ||                  |||    
Sbjct pvkkvsglvisnervlyagdsstalriaeLAGGEII---dlkgkfVMPAFFDSHLHLD--   70
DSSP  leeeeleeeeelleeeeeelhhhhhhhhhHHLLEEE---elllleEEELEEEEEELHH--


DSSP  lllLLLL-----------------------------------------------------
Query qmdAVTS-----------------------------------------------------  127
ident                                                             
Sbjct ---ELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptredldvidrp  127
DSSP  ---HHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  127
ident                                                             
Sbjct vflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekiltvkdykh  187
DSSP  eeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhllllhhhhhh


DSSP  -HHHHHHHHHHLLLLLEEELLllLLLLHHHHHHHH--HHHLLLEEEEE------------
Query -VTKLIEQAKKWGHPAIAVTDhaVVQSFPEAYSAA--KKHGMKVIYGL------------  172
ident       |     |                            | |   |            
Sbjct yIESAQEHLLSLGVHSVGFMS-vGEKALKALFELEreGRLKMNVFAYLspelldkleeln  246
DSSP  hHHHHHHHHHHLLEEEEEEEE-eLHHHHHHHHHHHhlLLLLLEEEEEElhhhhhhhhhhl


DSSP  --------------EEEEellleeeeeeellhhhhhhhhhhhhhhhlllllLLLL--eEH
Query --------------EANIvddpfhvtllaqnetglknlfklvslshiqyfhRVPR--iPR  216
ident                                                             
Sbjct lgkfegrrlriwgvXLFV----------dgslgartallsepytdnpttsgELVMnkdEI  296
DSSP  llleellleeeeeeEEEL----------lllllllllllllllllllllllLLLLlhhHH


DSSP  HHHHHLLL---LEEE-----------------------ELLLllllLLLL---LLLLH-H
Query SVLVKHRD---GLLV-----------------------GSGCdkgeLFDN---VEDIA-R  246
ident                                                             
Sbjct VEVIERAKplgLDVAvhaigdkavdvaldafeeaefsgRIEH----ASLVrddQLERIkE  352
DSSP  HHHHHHHLlllLEEEeeellhhhhhhhhhhhhhhllllEEEE----LLLLlhhHHHHHhH


DSSP  HLLLEEELL--HHHHLL--LLLL--LHHHHHhHHHHHHHHHhhlllLEEELLLLLlllhh
Query FYDFLEVHP--PDVYKP--LYVK--DEEMIKnIIRSIVALGekldiPVVATGNVHylnpe  300
ident         |            |                                      
Sbjct LKVRISAQPhfIVSDWWivNRVGeeRAKWAY-RLKTLSSIT-----KLGFSTDSP-----  401
DSSP  HLLEEEELLlhHHHLLLhhHHHHhhHHHHLL-LHHHHHHHL-----LEEELLLLL-----


DSSP  hhhhhhhhhhllhhhllllllllllLLLLLHHHHHHHHH---------HHHHHHHHHHHL
Query dkiyrkilihsqgganplnrhelpdVYFRTTNEMLDCFS---------FLGPEKAKEIVV  351
ident                                    |                | |     
Sbjct -------------------------IEPADPWVSIDAAVnryvvdpgeRVSREEALHLYT  436
DSSP  -------------------------LLLLLHHHHHHHHHhlllllhhhLLLHHHHHHHLL


DSSP  HHHHH-HHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhh
Query DNTQK-IASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerleke  410
ident                                                             
Sbjct HGSAQvTLAE--------------------------------------------------  446
DSSP  HHHHHhLLLL--------------------------------------------------


DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeell
Query lksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcp  470
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  lllleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeel
Query nckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsg  530
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhh
Query eyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagc  590
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  llleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeee
Query tgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldil  650
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  eehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllll
Query ghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgt  710
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhh
Query rfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyl  770
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhh
Query iyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayv  830
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhh
Query lmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakek  890
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhh
Query slltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivra  950
ident                                                             
Sbjct ------------------------------------------------------------  446
DSSP  ------------------------------------------------------------


DSSP  hhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query reegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                             
Sbjct ----------------------dlgklergfraeyiildrdplk  468
DSSP  ----------------------lllllllllllleeeellllll


No 16: Query=3f2bA Sbjct=4mupB Z-score=8.9

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllLLLLLLLL-LLLLLLLLLLLL-
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanERQDTAPE-GEKRVELHLHTP-  118
ident                                             |      |    |   
Sbjct ---------------------------------lvrklSGTAPNPAfPRGAVDTQMHMYl   27
DSSP  ---------------------------------lllllLLLLLLLLlLLLLEELLLLLLl


DSSP  -------llLLLL---LLLHHHHHHHHHHLLLLLEEELLLL-----LLLLHHHHHHHHhh
Query -------msQMDA---VTSVTKLIEQAKKWGHPAIAVTDHA-----VVQSFPEAYSAAkk  163
ident                               |      |                      
Sbjct pgypalpggPGLPpgaLPGPEDYRRLMQWLGIDRVIITQGNahqrdNGNTLACVAEMG--   85
DSSP  lllllllllLLLLlllLLLHHHHHHHHHHHLLLEEEEELLHhhlllLHHHHHHHHHHH--


DSSP  hlLLEEEEE----------------------EEEEellleeeeeeellhhhhhhhhhhhh
Query hgMKVIYGL----------------------EANIvddpfhvtllaqnetglknlfklvs  201
ident                                                             
Sbjct --EAAHAVViidatttekdmekltaagtvgaRIMD-------------------------  118
DSSP  --HHEEEEElllllllhhhhhhhhhlleeeeEEEL-------------------------


DSSP  hhhllllllLLLE--EHHHHHHLL--LLEE-----------------------EELLLll
Query lshiqyfhrVPRI--PRSVLVKHR--DGLL-----------------------VGSGCdk  234
ident                                                             
Sbjct ------lpgGAVNlsELDAVDERAhaADWMvavqfdgnglldhlprlqkirsrWVFDH--  170
DSSP  ------lllLLLLhhHHHHHHHHHhhLLLEeeeellhhhhhhhhhhhhlllleEEELH--


DSSP  llLLLL------------LLLLHHH-LLLEEELLHHHHLLLllllHHHHHHHHHHHHHHH
Query geLFDN------------VEDIARF-YDFLEVHPPDVYKPLyvkdEEMIKNIIRSIVALG  281
ident                                                      | | |  
Sbjct -hGKFFkgirtdgpemaaLLKLIDRgNLWFKFAGVYESSRK-swpYADVAAFSRVIAAHA  228
DSSP  -hHHLLlllllllhhhhhHHHHHHHlLEEEEELLHHHLLLL-lllLHHHHHHHHHHHHHL


DSSP  HhllLLEEELLLLLLllhhHHHHhhhhhhllhhhllllllLLLLlllllHHHHHHHHHHH
Query EkldIPVVATGNVHYlnpeDKIYrkilihsqgganplnrhELPDvyfrtTNEMLDCFSFL  341
ident        |   |                                               |
Sbjct P---ERIVWGTNWPH---nSVRE----------------tAAYP---ddARLAELTLGWL  263
DSSP  H---HHEEELLLLLL---lLLLL----------------hHHLL---lhHHHHHHHHLLL


DSSP  -HHHHHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhhhhhhhhhhhhlllll
Query -GPEKAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeiremsyrrakeiygdplp  400
ident           | |                                               
Sbjct pDEAARHRALVENPEAL-FKLS--------------------------------------  284
DSSP  lLHHHHHHHHLHHHHHH-HLLL--------------------------------------


DSSP  hhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllll
Query klveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitev  460
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  llllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhllllll
Query nplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdk  520
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  llleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllh
Query vpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrg  580
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhh
Query aeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsi  640
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  llllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllll
Query hdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnv  700
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  llllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhll
Query gtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevi  760
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllll
Query gcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikym  820
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhh
Query fpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeina  880
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  lhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllll
Query kgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglg  940
ident                                                             
Sbjct ------------------------------------------------------------  284
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query tnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                       
Sbjct ----------------------------------------------------pv  286
DSSP  ----------------------------------------------------ll


No 17: Query=3f2bA Sbjct=1j6pA Z-score=8.9

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ---------------------------------------------------------hhx    3
DSSP  ---------------------------------------------------------lee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllLLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapEGEKRVELHLHTPms  120
ident                                                      | | |  
Sbjct iignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklVXPALFNTHTHAP--   61
DSSP  eeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeEEELEEEEEELHH--


DSSP  llLLLL-------------------------------LHHHHHHHHHHLLLLLEEELLll
Query qmDAVT-------------------------------SVTKLIEQAKKWGHPAIAVTDha  149
ident                                                  |          
Sbjct --XTLLrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY--  117
DSSP  --HHHHllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE--


DSSP  llLLHHHHHHHHHHHLLLEEEEEE-----------------------------------E
Query vvQSFPEAYSAAKKHGMKVIYGLE-----------------------------------A  174
ident           |    |                                            
Sbjct --FHEEWIAKAVRDFGXRALLTRGlvdsngddggrleenlklynewngfegrifvgfgpH  175
DSSP  --LLHHHHHHHHHHHLLEEEEEEEelllllllllhhhhhhhhhhhhllhhhleeeeeeeL


DSSP  EEEllleeeeeeellhhhhhhhhhhhhhhhlllllllLLEE--HHHHHHLLL--LEEE--
Query NIVddpfhvtllaqnetglknlfklvslshiqyfhrvPRIP--RSVLVKHRD--GLLV--  228
ident                                                          |  
Sbjct SPY----------------------------------LCSEeyLKRVFDTAKslNAPVti  201
DSSP  LLL----------------------------------LLLHhhHHHHHHHHHhhLLLEee


DSSP  -------------------------ELLLLllllLLLL---LLLHHHLLLEEELLHHHHL
Query -------------------------GSGCDkgelFDNV---EDIARFYDFLEVHPPDVYK  260
ident                                                  |    |    |
Sbjct hlyetskeeydledilniglkevktIAAHC---vHLPEryfGVLKDIPFFVSHNPASNLK  258
DSSP  eellllllllllhhhhlllllllleEEEEL---lLLLHhhhHHHLLLLEEEEELHHHHHH


DSSP  LLllllhhhHHHHHHHHHHHHhhllLLEEELLLLLLllhhhhhhhhhhhhllhhhlllll
Query PLyvkdeemIKNIIRSIVALGekldIPVVATGNVHYlnpedkiyrkilihsqgganplnr  320
ident                     |      |                                
Sbjct LG------nGIAPVQRXIEHG----XKVTLGTDGAA------------------------  284
DSSP  LL------lLLLLHHHHHHLL----LEEEELLLLLL------------------------


DSSP  lllLLLLLLLHhHHHHHHHH---------HHHHHHHHHHLHHHHHHHHLlllllllllll
Query helPDVYFRTTnEMLDCFSF---------LGPEKAKEIVVDNTQKIASLigdvkpikdel  371
ident                   |          |        |                     
Sbjct ---SNNSLNLF-FEXRLASLlqkaqnprnLDVNTCLKXVTYDGAQAXGF-----------  329
DSSP  ---LLLLLLHH-HHHHHHHHhhhllllllLLHHHHHHHHLHHHHHHHLL-----------


DSSP  lllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhh
Query ytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvk  431
ident                                                             
Sbjct ------------------------------------------------------------  329
DSSP  ------------------------------------------------------------


DSSP  hhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlll
Query kslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpd  491
ident                                                             
Sbjct ------------------------------------------------------------  329
DSSP  ------------------------------------------------------------


DSSP  lllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleee
Query kncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyr  551
ident                                                             
Sbjct --------------------------ksgkieegwnadlvvidldlpexfpvqniknhlv  363
DSSP  --------------------------lllllllllllleeeeelllhhhllhhhhhhhhh


DSSP  eeeeeellhhhhhhhhhhhhhhllllllhhhhhhhHHHHLlleeeeeeeeeeeeelllll
Query agtigtvadktaygfvkayasdhnlelrgaeidrlAAGCTgvkrttgqhpggiivvpdym  611
ident                                    |                        
Sbjct hafsgevfatxvagkwiyfdgeyptidseevkrelARIEK--------------------  403
DSSP  hllllllleeeelleeeeellllllllhhhhhhhhHHHHH--------------------


DSSP  lhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhh
Query eiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpkt  671
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhh
Query iptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqi  731
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhllll
Query sglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgk  791
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhh
Query gltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasy  851
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  hhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleell
Query ftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfkn  911
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  llllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhh
Query idlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklskt  971
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllllllllllll
Query lleylesrgcldslpdhnqlslf  994
ident                        
Sbjct -------------------elys  407
DSSP  -------------------hhhl


No 18: Query=3f2bA Sbjct=2imrA Z-score=8.9

back to top
DSSP  -----------------------------lllhhhlllleeEEEEeeeeeeeeeeellll
Query -----------------------------vrrletiveeerRVVVqgyvfdaevselksg   31
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyPHAA---------------   45
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlLLLE---------------


DSSP  leeeeeeeelllleeeeeeelllhhhhhhhhlllllleeeeeeeeeeelllleeeeeeee
Query rtlltmkitdytnsilvkmfsrdkedaelmsgvkkgmwvkvrgsvqndtfvrdlviiand   91
ident                                                             
Sbjct ------------------------------------------------------------   45
DSSP  ------------------------------------------------------------


DSSP  eeeelllllllllllLLLLLLLLLLLlLLLL-------------------LLLL---LHH
Query lneiaanerqdtapeGEKRVELHLHTpMSQM-------------------DAVT---SVT  129
ident                    |  | |                                   
Sbjct -------eeragaviAPPPVNAHTHL-DMSAyefqalpyfqwipevvirgRHLRgvaAAQ   97
DSSP  -------eeellleeLLLLLEEEEEL-LLLHhhhhhlhhhhllhhhhhhhLLLLhhhHHH


DSSP  HHHHHHHHLLLLLEEELLLlLLLLHHHHHHHhhhHLLLEEEEEE----------------
Query KLIEQAKKWGHPAIAVTDHaVVQSFPEAYSAakkHGMKVIYGLE----------------  173
ident          |                                 |                
Sbjct AGADTLTRLGAGGVGDIVW-APEVMDALLAR---EDLSGTLYFEvlnpfpdkadevfaaa  153
DSSP  HHHHHHHHLLLLLEEEEEL-LHHHHHHHHLL---LLLLEEEEEEellllhhhhhhhhhhh


DSSP  ---------------------EEEEllleeeeeeellhhhhhhhhhhhhhhhllllllll
Query ---------------------ANIVddpfhvtllaqnetglknlfklvslshiqyfhrvp  212
ident                                                             
Sbjct rthlerwrrlerpglrlglspHTPF-----------------------------------  178
DSSP  hhhhhhhhlllllleeeeeeeLLLL-----------------------------------


DSSP  LEEHHHHHHLLL------LEEE--------------------------------------
Query RIPRSVLVKHRD------GLLV--------------------------------------  228
ident            |        |                                       
Sbjct TVSHRLMRLLSDyaagegLPLQihvaehptelemfrtgggplwdnrmpalyphtlaevig  238
DSSP  LLLHHHHHHHHHhhhhhlLLLEeeelllhhhhhhhhhlllllhhhllhhhllllhhhhhl


DSSP  -----------------------ELLLllllLLLL---LLLLHH-HLLLEEELL--HHHH
Query -----------------------GSGCdkgeLFDN---VEDIAR-FYDFLEVHP--PDVY  259
ident                                                      |      
Sbjct repgpdltpvryldelgvlaarpTLVH----MVNVtpdDIARVArAGCAVVTCPrsNHHL  294
DSSP  llllllllhhhhhhhhllhhhllEEEE----LLLLlhhHHHHHHhHLLLEEELHhhHHHL


DSSP  LLlllllhhhhhhHHHHHHHHHhhllLLEEELLLLLLllhhhhhhhhhhhhllhhhllll
Query KPlyvkdeemiknIIRSIVALGekldIPVVATGNVHYlnpedkiyrkilihsqgganpln  319
ident                    | |      |                               
Sbjct EC--------gtfDWPAFAAAG----VEVALGTDSVA-----------------------  319
DSSP  LL--------lllLHHHHHHLL----LLEEELLLLHH-----------------------


DSSP  lllllLLLLLLHHHHHHHHHH----HHHHHHHHHHLHHHHHHHHllllllllllllllll
Query rhelpDVYFRTTNEMLDCFSF----LGPEKAKEIVVDNTQKIASligdvkpikdelytpr  375
ident              |           | |       |   |                    
Sbjct -----SGETLNVREEVTFARQlypgLDPRVLVRAAVKGGQRVVG----------------  358
DSSP  -----HHLLLLLHHHHHHHHHhlllLLHHHHHHHHHHHHHHHHL----------------


DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh
Query iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll
Query dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee
Query rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh
Query gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll
Query ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl
Query dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh
Query hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl
Query efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll
Query aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh
Query rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
ident                                                             
Sbjct ---------------------------------------------------------tpf  361
DSSP  ---------------------------------------------------------lll


DSSP  hhhllllllllllllllll
Query lesrgcldslpdhnqlslf  994
ident                    
Sbjct lrrgetwqegfrwelsrdl  380
DSSP  llllllllhhhlhhhllll


No 19: Query=3f2bA Sbjct=3dcpA Z-score=8.8

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
ident                                                      | ||   
Sbjct ------------------------------------------------XKRDGHTHTEFC   12
DSSP  ------------------------------------------------LLEEEEELLLLL


DSSP  lLLLL-LLHHHHHHHHHHLLLLLEEELLLLL--------------------------llL
Query qMDAV-TSVTKLIEQAKKWGHPAIAVTDHAV--------------------------vqS  153
ident         |      |            ||                              
Sbjct -PHGThDDVEEXVLKAIELDFDEYSIVEHAPlssefxkntagdkeavttasxaxsdlpyY   71
DSSP  -LLLLlLLHHHHHHHHHHLLLLEEEEEEELLllhhhhhllllllhhhhlllllhhhhhhH


DSSP  HHHHHHHHHHHL--LLEEEEEEEEEELLleeeeeeellHHHHHHH---hhhhhhhhlllL
Query FPEAYSAAKKHG--MKVIYGLEANIVDDpfhvtllaqnETGLKNL---fklvslshiqyF  208
ident |       ||         | |                                      
Sbjct FKKXNHIKKKYAsdLLIHIGFEVDYLIG-yedftrdflNEYGPQTddgvlslhflegqgG  130
DSSP  HHHHHHHHHHLLllLEEEEEEEEELLLL-lhhhhhhhhHHHHHHLleeeeelleeeellE


DSSP  LLL---------------------------lleehhhhHHLLLLEEEELLLllllLLLL-
Query HRV---------------------------priprsvlVKHRDGLLVGSGCdkgeLFDN-  240
ident  |                                               |          
Sbjct FRSidfsaedynegivqfyggfeqaqlaylegvkqsieADLGLFKPRRXGH----ISLCq  186
DSSP  EEEllllhhhhhhhlhhhhllhhhhhhhhhhhhhhhhhLLLLLLLLLEELL----LLHHh


DSSP  --------------------LLLLHHHL----LLEEELL-HHHHLLLllllhhhhhhhHH
Query --------------------VEDIARFY----DFLEVHP-PDVYKPLyvkdeemikniIR  275
ident                        |          |                         
Sbjct kfqqffgedtsdfseevxekFRVILALVkkrdYELDFNTaGLFKPLC------getypPK  240
DSSP  llhhhhlllhhhllhhhhhhHHHHHHHHhhhlLEEEEELhHHHLLLL------lllllLH


DSSP  HHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllllllLLLLhhHHH
Query SIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelpdvYFRTtnEML  335
ident  || |   | || |     |                                        
Sbjct KIVTLASELQIPFVYGSDSHGVQ----------------------------DIGR--GYS  270
DSSP  HHHHHHHHLLLLEEEELLLLLHH----------------------------HLLL--LHH


DSSP  HhhhhhhhhhHHHHhlhhhhhhhhlllllllllllllllllllhhhhhhhhhhhhhhhhh
Query DcfsflgpekAKEIvvdntqkiasligdvkpikdelytpriegadeeiremsyrrakeiy  395
ident                                                             
Sbjct T--------yCQKL----------------------------------------------  276
DSSP  H--------hHHHL----------------------------------------------


DSSP  lllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhl
Query gdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmt  455
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  lllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhl
Query eitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflg  515
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  lllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhll
Query fkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhn  575
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeee
Query lelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthf  635
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  ehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhh
Query dfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeq  695
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  hllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllll
Query imcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtct  755
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  hhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhh
Query lsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsck  815
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  hllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhh
Query kikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkri  875
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  hhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhh
Query eeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfna  935
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query ipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                            
Sbjct ----------------------------------------------------------e  277
DSSP  ----------------------------------------------------------l


No 20: Query=3f2bA Sbjct=3mtwA Z-score=8.8

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -----------------------------------------------aeikavsaarlld   13
DSSP  -----------------------------------------------lleeeeeeeeeee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELlllllllllLLLLLLLLLLLLL--
Query msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtapEGEKRVELHLHTP--  118
ident                                                      | |    
Sbjct vasgkyvdnplvivtdgritsigkkgdavpAGATAV---dlpgvtLLPGLIDMHVHLDsl   70
DSSP  lllleeeeleeeeeelleeeeeeellllllLLLEEE---eeeeeeEEELEEEEEELLLll


DSSP  ----------llllllllLHHHHHHHHHHLLLLLEEELLllLLLLHHHHHHHHH--HHLL
Query ----------msqmdavtSVTKLIEQAKKWGHPAIAVTDhaVVQSFPEAYSAAK--KHGM  166
ident                     |         |                    |        
Sbjct aevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-aADYDDVGLREAIDagYVPG  129
DSSP  llllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-lLLLHHHHHHHHHHllLLLL


DSSP  -LEEEE------------------------------------------------EEEE--
Query -KVIYG------------------------------------------------LEAN--  175
ident                                                             
Sbjct pRIVTAaisfgatgghcdstffppsmdqknpfnsdspdearkavrtlkkygaqvIXICat  189
DSSP  lEEEELllleellllllllllllhhhllllllllllhhhhhhhhhhhhhlllleEEEEll


DSSP  --------------EELLleeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHH
Query --------------IVDDpfhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVK  221
ident                                                           | 
Sbjct ggvfsrgnepgqqqLTYE-----------------------------------EMKAVVD  214
DSSP  llllllllllllllLLHH-----------------------------------HHHHHHH


DSSP  LLL--LEEEE-------------------LLLLllllLLLL--LLLHHHLLLEEELLhHH
Query HRD--GLLVG-------------------SGCDkgelFDNV--EDIARFYDFLEVHPpDV  258
ident      |  |                             |                     
Sbjct EAHmaGIKVAahahgasgireavragvdtIEHA--slVDDEgiKLAVQKGAYFSMDI-YN  271
DSSP  HHHhlLLEEEeeellhhhhhhhhhlllleEEEL--llLLHHhhHHHHHHLLEEELLL-LL


DSSP  HL------------------LLLLllHHHHHHHHHHHHHHHhhllLLEEELLLLLlllhh
Query YK------------------PLYVkdEEMIKNIIRSIVALGekldIPVVATGNVHylnpe  300
ident                            |      |     |       |           
Sbjct TDytqaegkkngvlednlrkDRDI--GELQRENFRKALKAG----VKMVYGTDAG-----  320
DSSP  HHhhhhhhhhhlllhhhhhhHHHH--HHHHHHHHHHHHHHL----LEEELLLLLL-----


DSSP  hhhhhhhhhhllhhhlllllllllLLLL-LLHHhHHHHHHH--HHHHHHHHHHLHHHHHH
Query dkiyrkilihsqgganplnrhelpDVYF-RTTNeMLDCFSF--LGPEKAKEIVVDNTQKI  357
ident                                              |  |           
Sbjct ------------------------IYPHgDNAK-QFAVMVRygATPLQAIQSATLTAAEA  355
DSSP  ------------------------LLLLlLHHH-HHHHHHHllLLHHHHHHHLLHHHHHH


DSSP  HHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhl
Query ASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiigh  417
ident                                                             
Sbjct LGR---------------------------------------------------------  358
DSSP  HLL---------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleee
Query gfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhsef  477
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  llllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhh
Query fndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprah  537
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeee
Query nytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrtt  597
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhh
Query gqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptv  657
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhh
Query irmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqml  717
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllh
Query eetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglep  777
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhh
Query slafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavria  837
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhh
Query yfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvle  897
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhlllll
Query valemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefl  957
ident                                                             
Sbjct ---------------------------------------------------skdvgqvav  367
DSSP  ---------------------------------------------------lllllllll


DSSP  lhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query skedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                      
Sbjct grygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  llllleeeelllllllhhhhhllleeeelleeeelll


No 21: Query=3f2bA Sbjct=1bf6A Z-score=8.7

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTPMS  120
ident                                                      | |    
Sbjct -------------------------------------------sfdpTGYTLAHEHLHID   17
DSSP  -------------------------------------------llllLLEEEEEELLLEE


DSSP  LL-------LLLLLHHHHHHHHHHLL---LLLEEELLL-lLLLLHHHHHHHHHHHLLLEE
Query QM-------DAVTSVTKLIEQAKKWG---HPAIAVTDH-aVVQSFPEAYSAAKKHGMKVI  169
ident                                                        |  | 
Sbjct LSgfknnvdCRLDQYAFICQEMNDLMtrgVRNVIEMTNryMGRNAQFMLDVMRETGINVV   77
DSSP  LHhhhllhhHEELLHHHHHHHHHHHHhllEEEEEELLLhhHLLLHHHHHHHHHHHLLEEE


DSSP  EE-------------------------------------------EEEEEEllleeeeee
Query YG-------------------------------------------LEANIVddpfhvtll  186
ident                                               |             
Sbjct ACtgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkagiiAEIGTS---------  128
DSSP  EEellllhhhlllhhhhllhhhhhhhhhhhhhllllllllleeeeEEEELL---------


DSSP  ellhhhhhhhhhhhhhhhlLLLLllLLEE-HHHHHHLL--LLEEEE--------------
Query aqnetglknlfklvslshiQYFHrvPRIP-RSVLVKHR--DGLLVG--------------  229
ident                                          |                  
Sbjct -----------------egKITP--LEEKvFIAAALAHnqTGRPISthtsfstmgleqla  169
DSSP  -----------------llLLLH--HHHHhHHHHHHHHhhHLLLEEeelhhhllhhhhhh


DSSP  -------------LLLLlllllLLLL--LLHHHlLLEEELlhhHHLLLllllHHHHHHHH
Query -------------SGCDkgelfDNVE--DIARFyDFLEVHppdVYKPLyvkdEEMIKNII  274
ident               |                                      |      
Sbjct llqahgvdlsrvtVGHC-dlkdNLDNilKMIDLgAYVQFD-tiGKNSY--ypDEKRIAML  225
DSSP  hhhhllllhhheeELLL-llllLHHHhhHHHHLlLEEEEL-llLLLLL--llHHHHHHHH


DSSP  HHHHHHHHhllLLEEELLLLLL--LLHHHHhhhhhhhhllhhhlllllllllllLLLL-H
Query RSIVALGEkldIPVVATGNVHY--LNPEDKiyrkilihsqgganplnrhelpdvYFRT-T  331
ident       |      |                                              
Sbjct HALRDRGL--lNRVMLSMDITRrsHLKANG----------------------gyGYDYlL  261
DSSP  HHHHHLLL--hHHEEELLLLLLhhHLHHHL----------------------llLLLHhH


DSSP  HHHHHHHH--HHHHHHHHHHHLHHHHHHHHlllllllllllllllllllhhhhhhhhhhh
Query NEMLDCFS--FLGPEKAKEIVVDNTQKIASligdvkpikdelytpriegadeeiremsyr  389
ident                        |                                    
Sbjct TTFIPQLRqsGFSQADVDVMLRENPSQFFQ------------------------------  291
DSSP  HLHHHHHHhlLLLHHHHHHHHLHHHHHHLL------------------------------


DSSP  hhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhl
Query rakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgss  449
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelllll
Query fvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdip  509
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhh
Query fetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvka  569
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllll
Query yasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtsse  629
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  lleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhh
Query wrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsstepl  689
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  lllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhh
Query gvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeli  749
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhh
Query qngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpew  809
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhh
Query yidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsa  869
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeellee
Query airkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnsl  929
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  ellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllll
Query ippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhn  989
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  lllll
Query qlslf  994
ident      
Sbjct -----  291
DSSP  -----


No 22: Query=3f2bA Sbjct=1a4mA Z-score=8.7

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllLLLLllLLLLLLLLLLlll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqDTAPegEKRVELHLHTpms  120
ident                                                   |||| |    
Sbjct ----------------------------------------tPAFN--KPKVELHVHL---   15
DSSP  ----------------------------------------lLLLL--LLEEEEEEEH---


DSSP  llLLLL------------------------------------------------------
Query qmDAVT------------------------------------------------------  126
ident   |                                                         
Sbjct --DGAIkpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcr   73
DSSP  --HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllh


DSSP  -----LHHHHHHHHHHLLLLLEEELLLL-------------------------LLLLHHH
Query -----SVTKLIEQAKKWGHPAIAVTDHA-------------------------VVQSFPE  156
ident            |   | |     |                             |      
Sbjct eaikrIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqtegdvtpddvVDLVNQG  133
DSSP  hhhhhHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlllllllhhhhHHHHHHH


DSSP  HHHHHHHHLLLEEEEEEEE------------------------------------EELLl
Query AYSAAKKHGMKVIYGLEAN------------------------------------IVDDp  180
ident         | ||   |                                            
Sbjct LQEGEQAFGIKVRSILCCMrhqpswslevlelckkynqktvvamdlagdetiegsSLFP-  192
DSSP  HHHHHHHHLLEEEEEEEEElllhhhhhhhhhhhhhllllleeeeeeelllllllhHHLH-


DSSP  eeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHLL--LLEEE----------
Query fhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKHR--DGLLV----------  228
ident                                                             
Sbjct ---------------------------------gHVEAYEGAVknGIHRTvhagevgspe  219
DSSP  ---------------------------------hHHHHHHHHHhhLLEEEeeelllllhh


DSSP  ------------ELLLllllLLLL------LLLLHhhlLLEEELLHhHHLLLlllLHHHH
Query ------------GSGCdkgeLFDN------VEDIArfyDFLEVHPPdVYKPLyvkDEEMI  270
ident               |                          || |   |      |    
Sbjct vvreavdilkteRVGH----GYHTiedealYNRLLkenMHFEVCPWsSYLTG-awDPKTT  274
DSSP  hhhhhhhlllllEEEE----LHHHhhlhhhHHHHHhllLEEEELHHhHHHLL-llLLLLL


DSSP  HhHHHHHHHHHHhlllLEEELLLLLLllhhhhhhhhhhhhllhhhlllllllllLLLLLL
Query KnIIRSIVALGEkldiPVVATGNVHYlnpedkiyrkilihsqgganplnrhelpDVYFRT  330
ident                                                             
Sbjct H-AVVRFKNDKA----NYSLNTDDPL----------------------------IFKSTL  301
DSSP  L-HHHHHHHLLL----LEEELLLLLL----------------------------LLLLLH


DSSP  HhHHHHHHH---HHHHHHHHHHhLHHHHHHhHLLLllllllllllllllllhhhhhhhhh
Query TnEMLDCFS---FLGPEKAKEIvVDNTQKIaSLIGdvkpikdelytpriegadeeirems  387
ident                 |  |     |  |  |                            
Sbjct D-TDYQMTKkdmGFTEEEFKRL-NINAAKS-SFLP-------------------------  333
DSSP  H-HHHHHHHhllLLLHHHHHHH-HHHHHHL-LLLL-------------------------


DSSP  hhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhh
Query yrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvg  447
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  hlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelll
Query ssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghd  507
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  lllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhh
Query ipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfv  567
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlll
Query kayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddts  627
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  lllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllh
Query sewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsste  687
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  hhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhh
Query plgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqe  747
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  hhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllll
Query liqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvp  807
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhl
Query ewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikg  867
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeell
Query saairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgn  927
ident                                                             
Sbjct ------------------------------------------------------------  333
DSSP  ------------------------------------------------------------


DSSP  eeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllll
Query slippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpd  987
ident                                                             
Sbjct ---------------------------------------------------eeekkelle  342
DSSP  ---------------------------------------------------hhhhhhhhh


DSSP  lllllll
Query hnqlslf  994
ident        
Sbjct rlyreyq  349
DSSP  hhhhhll


No 23: Query=3f2bA Sbjct=4cqbA Z-score=8.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  HHLL--------lllleeeeeeeeeeelllleeeeeeeeeEEELllllllllLLLLLLLL
Query MSGV--------kkgmwvkvrgsvqndtfvrdlviiandlNEIAanerqdtaPEGEKRVE  112
ident                                                           | 
Sbjct SKDFdliirnaylsekdsvydigivgdriikieakiegtvKDEI---dakgnLVSPGFVD   57
DSSP  LLLEeeeeeeeeelllleeeeeeeelleeeeeelllllleEEEE---ellllLEEELEEE


DSSP  -LLLLLlllllLLLL-------------------------------------LHHHHHHH
Query -LHLHTpmsqmDAVT-------------------------------------SVTKLIEQ  134
ident               |                                      |      
Sbjct aHTHMD-----KSFTstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHM  112
DSSP  eEELHH-----HLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHH


DSSP  HHHLLLLLEEELLLL-------LLLL-HHHHHHHHhhHLLLEEEEEEE-EEELlleeeee
Query AKKWGHPAIAVTDHA-------VVQS-FPEAYSAAkkHGMKVIYGLEA-NIVDdpfhvtl  185
ident     |                  |                       |            
Sbjct QVLHGTLYTRTHVDVdsvaktkAVEAvLEAKEELK--DLIDIQVVAFAqSGFF--vdles  168
DSSP  HHHLLEEEEEEEEELllllllhHHHHhHHHHHHLL--LLLEEEEEEELlLLLL--llllh


DSSP  eellhhhhhhhhhhhhhhhllllllllleEHHHHHHLL---LLEEEELlllllLLLLL--
Query laqnetglknlfklvslshiqyfhrvpriPRSVLVKHR---DGLLVGSgcdkgELFDN--  240
ident                                    |     |                  
Sbjct eslirksldmgcdlvggvdpatrennvegSLDLCFKLAkeyDVDIDYH-----IHDIGtv  223
DSSP  hhhhhhhhhhllleeellllllllllhhhHHHHHHHHHhhlLLEEEEE-----ELLLHhh


DSSP  LLLLHH----------------------------------------hlLLEEELLHHhhl
Query VEDIAR----------------------------------------fyDFLEVHPPDvyk  260
ident                                                             
Sbjct GVYSINrlaqktiengykgrvttshawcfadapsewldeaiplykdsgMKFVTCFSS---  280
DSSP  HHHHHHhhhhhhhhlllllleeeeellhhhhllhhhhhhhhhhhhhhlLEEEEELLL---


DSSP  llllllhhhHHHHhhHHHHHHHHlLLLEEELLLLLLllhhhhhhhhhhhhllhhhlllll
Query plyvkdeemIKNIirSIVALGEKlDIPVVATGNVHYlnpedkiyrkilihsqgganplnr  320
ident                    | |   |                                  
Sbjct --------tPPTM--PVIKLLEA-GINLGCASDNIR------------------------  305
DSSP  --------lLLLL--LHHHHHHL-LLEEEEELLLLL------------------------


DSSP  llLLLLLLLLHHHHHHHHHH-------hHHHHHHHHHLHHHHHHHHLlllllllllllll
Query heLPDVYFRTTNEMLDCFSF-------lGPEKAKEIVVDNTQKIASLigdvkpikdelyt  373
ident                                                             
Sbjct dfWVPFGNGDMVQGALIETQrlelktnrDLGLIWKMITSEGARVLGI-------------  352
DSSP  llLLLLLLLLHHHHHHHHHHhhllllhhHHHHHHHHHLHHHHHHHLL-------------


DSSP  lllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhh
Query priegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkks  433
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllll
Query lddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkn  493
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  lllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeee
Query cprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyrag  553
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  eeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllh
Query tigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymei  613
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhll
Query ydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktip  673
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhh
Query tddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisg  733
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhllllll
Query lshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgl  793
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhh
Query tpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyft  853
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellll
Query vraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknid  913
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  llllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhh
Query lyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktll  973
ident                                                             
Sbjct -------------------------------eknygievgkkadlvvlnslspqwaiidq  381
DSSP  -------------------------------hhhlllllllllleeeellllhhhhhhhl


DSSP  hhhhhllllllllllllllll
Query eylesrgcldslpdhnqlslf  994
ident                      
Sbjct akrlcvikngriivkdeviva  402
DSSP  lleeeeeelleeeeelleell


No 24: Query=3f2bA Sbjct=4c5yA Z-score=8.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhHH
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaEL   60
ident                                                             
Sbjct --------------deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkKY   46
DSSP  --------------lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhHH


DSSP  HHLllllleeeeeeeeeeelllleeeeeeeeEEEEllllllllllLLLLLLLLLL-LLLL
Query MSGvkkgmwvkvrgsvqndtfvrdlviiandLNEIaanerqdtapEGEKRVELHL-HTPM  119
ident                                                      |      
Sbjct LRS---------------------------tQSTH------rvpvLMPGLWDCHMhFGGD   73
DSSP  HHH---------------------------lLLEE------eeeeEEELEEEEEElLLLL


DSSP  ---------LLLL----lllLHHHHHHHHHHLLLLLEEELLlllLLLHHHHHHHH-HHHL
Query ---------SQMD----avtSVTKLIEQAKKWGHPAIAVTDhavVQSFPEAYSAA-KKHG  165
ident                             |   |                 |         
Sbjct ddyyndytsGLAThpassgaRLARGCWEALQNGYTSYRDLA---GYGCEVAKAINdGTIV  130
DSSP  lllllllhhHHHLlhhhhhhHHHHHHHHHHHLLEEEEEELL---LLHHHHHHHHHlLLLL


DSSP  L-LEEEE-EEEEEelLLEEeeeeellhhhhhhhhhhhhhHHLL------lllllLLEE--
Query M-KVIYG-LEANIvdDPFHvtllaqnetglknlfklvslSHIQ------yfhrvPRIP--  215
ident    |                                                        
Sbjct GpNVYSSgAALSQ-tAGHG------difalpagevlgsyGVMNprpgywgagplCIADgv  183
DSSP  LlEEEELlLEEEL-lLLLL------llllllhhhhhhhhLLLLlllllllllleEELLlh


DSSP  ------------------------------------------HHHHHHLL--LLEEEELL
Query ------------------------------------------RSVLVKHR--DGLLVGSG  231
ident                                             | |         |   
Sbjct eevrravrlqirrgakvixvmasggvmsrddnpnfaqfspeeLKVIVEEAarQNRIVSAH  243
DSSP  hhhhhhhhhhhhhlllleeeellllllllllllllllllhhhHHHHHHHHhhLLLLEEEE


DSSP  lllllLLLLL-lLLHH--HLLL---------------------EEELLhHHHL-------
Query cdkgeLFDNV-eDIAR--FYDF---------------------LEVHPpDVYK-------  260
ident               |                                   |         
Sbjct -----VHGKAgiMAAIkaGCKSlehvsyadeevwelmkekgilYVATR-SVIEiflasng  297
DSSP  -----ELLHHhhHHHHhhLLLEeeelllllhhhhhhhhhhlleEELLH-HHHHhhhhhll


DSSP  --------LLLLLLHHHHHHHHHHHHHHHHhlllLEEELLLLLLLlhhhhhhhhhhhhll
Query --------PLYVKDEEMIKNIIRSIVALGEkldiPVVATGNVHYLnpedkiyrkilihsq  312
ident                             |                               
Sbjct eglvkeswAKLQALADSHLKAYQGAIKAGV----TIALGTDTAPG---------------  338
DSSP  llllllhhHLLLHHHHHHHHHHHHHHHLLL----LEELLLLLLLL---------------


DSSP  hhhlllllllllllLLLLhhHHHHHHH---HHHHHHHHHHHLHHHHHHHHLLLLLlllll
Query gganplnrhelpdvYFRTtnEMLDCFS---FLGPEKAKEIVVDNTQKIASLIGDVkpikd  369
ident                       |          |  |      |                
Sbjct --------------GPTA--LELQFAVergGMTPLEAIKAATANAPLSVGPQAPL-----  377
DSSP  --------------LLLH--HHHHHHHhllLLLHHHHHHHHLLLHHHHHHHHLLL-----


DSSP  lllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhh
Query elytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishkl  429
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhl
Query vkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdl  489
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  lllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllle
Query pdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednv  549
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeelll
Query yragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpd  609
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  lllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllh
Query ymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidp  669
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  hhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhh
Query ktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselv  729
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhll
Query qisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrk  789
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhh
Query gkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyya  849
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhlllee
Query syftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsf  909
ident                                                             
Sbjct ------------------------------------------------------------  377
DSSP  ------------------------------------------------------------


DSSP  llllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlll
Query knidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgkls  969
ident                                                             
Sbjct --------------------------tgqlregyeadvialeenpledikvfqepkavth  411
DSSP  --------------------------llllllllllleeeelllllllhhhhhlhhheee


DSSP  hhhhhhhhhllllllllllllllll
Query ktlleylesrgcldslpdhnqlslf  994
ident                          
Sbjct vwkggklfkgpgigpwgedarnpfl  436
DSSP  eeelleeeellllllllllllllll


No 25: Query=3f2bA Sbjct=2vunA Z-score=8.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -----------------------------------------------sktiiknigkivs   13
DSSP  -----------------------------------------------leeeeellleeel


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeEEELllllllllLLLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlNEIAanerqdtaPEGEKRVELHLHTPms  120
ident                                                      | |    
Sbjct gdikspvlqadtivvedgliaaiggeelmkdaGDAT-iidaagsTVTPGLLDTHVHVS--   70
DSSP  lllllleellleeeeelleeeeeelhhhhlllLLLE-eeellllEEEELEEEEEELLL--


DSSP  llllllLHHH--------HHHHHHHLLLLLEEELLLL---------------llLLHHHH
Query qmdavtSVTK--------LIEQAKKWGHPAIAVTDHA---------------vvQSFPEA  157
ident                    |  |   |                                 
Sbjct ------GGDYaprqktmdFISSALHGGVTTMISAGSPhfpgrpkdaagtkalaiTLSKSY  124
DSSP  ------LLLEehhhleelHHHHHHLLLEEEEEELLLLllllllllhhhhhhhhhHHHHHH


DSSP  HHHHhhHLLLEEE------------------------eEEEE----EELLleeeeeeell
Query YSAAkkHGMKVIY------------------------gLEAN----IVDDpfhvtllaqn  189
ident | |    | ||                            |                    
Sbjct YNAR-pAGVKVHGgavilekglteedfiemkkegvwivGEVGlgtiKNPE----------  173
DSSP  HHLL-hHHLEEELleelllllllhhhhhhhhhlllleeEEELllllLLHH----------


DSSP  hhhhhhhhhhhhhhhllllllllleEHHHHHHLL-LLEE---------------------
Query etglknlfklvslshiqyfhrvpriPRSVLVKHR-DGLL---------------------  227
ident                                     |                       
Sbjct ------------------------dAAPMVEWAHkHGFKvqmhtggtsipgsstvtaddv  209
DSSP  ------------------------hHHHHHHHHHhLLLEeeeelllllllllllllhhhh


DSSP  -----EELLLL-llllLLLL---LLLHH-HLLLEEELLhhhhlllllllhhhHHHHHHHH
Query -----VGSGCD-kgelFDNV---EDIAR-FYDFLEVHPpdvykplyvkdeemIKNIIRSI  277
ident                    |     |        |                    |    
Sbjct iktkpDVVSHInggptAISVqevDRIMDeTDFAMEIVQ------------cgNPKIADYV  257
DSSP  hhhllLEEELLlllllLLLHhhhHHHHHhLLLEEEEEL------------llLHHHHHHH


DSSP  HHHHHHLLL--LEEELLLLLlllhhhhhhhhhhhhllhhhllllllllLLLLLLL-hHHH
Query VALGEKLDI--PVVATGNVHylnpedkiyrkilihsqgganplnrhelPDVYFRT-tNEM  334
ident             |                                               
Sbjct ARRAAEKGQlgRVIFGNDAP---------------------------sGTGLIPLgiLRN  290
DSSP  HHHHHHHLLhhHEEEELLLL---------------------------lLLLLLLLhhHHH


DSSP  HHHHHHH---HHHHHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhhhhhhhh
Query LDCFSFL---GPEKAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeiremsyrra  391
ident            || |      |                                      
Sbjct MCQIASMsdiDPEVAVCMATGNSTAV-YGLN-----------------------------  320
DSSP  HHHHHHHlllLHHHHHHHHLHHHHHH-HLLL-----------------------------


DSSP  hhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhh
Query keiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfv  451
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellllllh
Query atmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfe  511
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhh
Query tflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkaya  571
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllllll
Query sdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewr  631
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  eeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhll
Query tthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgv  691
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhl
Query tpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqn  751
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  llllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhh
Query gtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyi  811
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhh
Query dsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaai  871
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeel
Query rkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslip  931
ident                                                             
Sbjct ----------------------------------------------------------tg  322
DSSP  ----------------------------------------------------------ll


DSSP  lhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllllll
Query pfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnql  991
ident                                                             
Sbjct viapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraa  382
DSSP  llllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllllll


DSSP  lll
Query slf  994
ident    
Sbjct kil  385
DSSP  eel


No 26: Query=3f2bA Sbjct=2ffiA Z-score=8.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPMS  120
ident                                                      | |    
Sbjct ---------------------------------------------lHLTAIDSHAHVFSR   15
DSSP  ---------------------------------------------lLLLLEELLLLLLLH


DSSP  ----------LLLLLLLHHHHHHHHHHLLLLLEEELLLL----lLLLHHHHHHHHHhhll
Query ----------QMDAVTSVTKLIEQAKKWGHPAIAVTDHA----vVQSFPEAYSAAKkhgm  166
ident                        |    |                     |         
Sbjct glnlasqrryAPNYDAPLGDYLGQLRAHGFSHGVLVQPSflgtdNRYLLSALQTVP---g   72
DSSP  hhhhhlllllLLLLLLLHHHHHHHHHHLLLLEELLLLLHhhlllLHHHHHHHHHLL---l


DSSP  LEEEEE----------------------EEEE----ELLLeeeeeeellhhhhhhhhhhh
Query KVIYGL----------------------EANI----VDDPfhvtllaqnetglknlfklv  200
ident                               |       |                     
Sbjct QLRGVVxlerdveqatlaexarlgvrgvRLNLxgqdXPDL--------------------  112
DSSP  LLLLLLlllllllhhhhhhhhllllleeELLLllllLLLL--------------------


DSSP  hhhhllllllllleeHHHHHHLL--LLEE-----------------------EELLLlll
Query slshiqyfhrvpripRSVLVKHR--DGLL-----------------------VGSGCdkg  235
ident                   |       |                                 
Sbjct -----------tgaqWRPLLERIgeQGWHvelhrqvadipvlvralqpygldIVIDH---  158
DSSP  -----------llllLHHHHHHHhhHLLEeeellllllhhhhhhhhllllllEEELH---


DSSP  lLLLL---------LLLL----hhhlLLEEELLHHhHLLLlllLHHHHHHHHHHHHHHHH
Query eLFDN---------VEDI----arfyDFLEVHPPDvYKPLyvkDEEMIKNIIRSIVALGE  282
ident                               |              |      |      |
Sbjct fGRPDarrglgqpgFAELltlsgrgkVWVKVSGIY-RLQG---SPEENLAFARQALCALE  214
DSSP  hHLLLlllllllllHHHHllllllllEEEEEELHH-HLLL---LHHHHHHHHHHHHHHHH


DSSP  HLLL--LEEELLLLLlllhhhhhhhhhhhhllhhhlllllllLLLLLLLlhhhhhHHHH-
Query KLDI--PVVATGNVHylnpedkiyrkilihsqgganplnrheLPDVYFRttnemlDCFS-  339
ident                                              | |         |  
Sbjct AHYGaeRLXWGSDWP-----------------------htqhESEVSFG---savEQFEa  248
DSSP  HHLLhhHEEEELLLL-----------------------llllLLLLLHH---hhhHHHHh


DSSP  -HHHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlll
Query -FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdp  398
ident              |                                              
Sbjct lGCSAQLRQALLLDTARALFGF--------------------------------------  270
DSSP  hLLLHHHHHHHHLHHHHHHLLL--------------------------------------


DSSP  llhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllll
Query lpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteit  458
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  llllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhllll
Query evnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkg  518
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  llllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhlllll
Query dkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlel  578
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehh
Query rgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfh  638
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  hhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhll
Query sihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimc  698
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  llllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhh
Query nvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlse  758
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhll
Query vigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkik  818
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhh
Query ymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieei  878
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  hhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlll
Query nakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipg  938
ident                                                             
Sbjct ------------------------------------------------------------  270
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query lgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                         
Sbjct -----------------------------------------------------ele  273
DSSP  -----------------------------------------------------lll


No 27: Query=3f2bA Sbjct=4b3zD Z-score=8.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ----------------------------------------------------drllikgg    8
DSSP  ----------------------------------------------------leeeeeee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEElllllllllLLLLLLLLLLLLLLLl
Query msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIaanerqdtaPEGEKRVELHLHTPMs  120
ident                                                             
Sbjct riinddqslyadvyledglikqigenlivpGGVKT---ieangrMVIPGGIDVNTYLQK-   64
DSSP  eeelllleeeeeeeeelleeeeeellllllLLLEE---eellllEEEELEEEEEELLLL-


DSSP  lllllLLHHHHHHHHHHLLLLLEEELLL---------lllLLHHHHHHHHhhhLLLEEEE
Query qmdavTSVTKLIEQAKKWGHPAIAVTDH---------avvQSFPEAYSAAkkhGMKVIYG  171
ident               |   |   |                      |              
Sbjct --taaDDFFQGTRAALVGGTTMIIDHVVpepgsslltsfeKWHEAADTKS---CCDYSLH  119
DSSP  --lllLLHHHHHHHHHHLLEEEEEEEELllllllhhhhhhHHHHHHHLLL---LLEEEEE


DSSP  E-------------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhll
Query L-------------------------EANIvddpfhvtllaqnetglknlfklvslshiq  206
ident                                                             
Sbjct VditswydgvreelevlvqdkgvnsfQVYM------------------------------  149
DSSP  EelllllllhhhhhhhhhhllllleeEEEL------------------------------


DSSP  lLLLLLLE---EHHHHHHLL--LLEE----------------------------------
Query yFHRVPRI---PRSVLVKHR--DGLL----------------------------------  227
ident     |                  |                                    
Sbjct aYKDVYQMsdsQLYEAFTFLkgLGAVilvhaengdliaqeqkrilemgitgpeghalsrp  209
DSSP  lLLLLLLLlhhHHHHHHHHHhhHLLEeeeelllhhhhhhhhhhhhhllllllhhhhhhll


DSSP  ---------------------EELLLL-lllLLLL--LLLL-HHHLlLEEEL--LHHH--
Query ---------------------VGSGCD-kgeLFDN--VEDI-ARFYdFLEVH--PPDV--  258
ident                      |           |             | |          
Sbjct eeleaeavfraitiagrincpVYITKVmsksAADIiaLARKkGPLV-FGEPIaaSLGTdg  268
DSSP  hhhhhhhhhhhhhhhhhhlllEEEEEEllhhHHHHhhHHHHhLLLE-EEEELhhHHHLll


DSSP  ------------------HLLLllllHHHHHHHHHHH-HHHHhhllllEEELLLLLLllh
Query ------------------YKPLyvkdEEMIKNIIRSI-VALGekldipVVATGNVHYlnp  299
ident                                    |             |          
Sbjct thywsknwakaaafvtspPLSP----DPTTPDYLTSLlACGD-----lQVTGSGHCP---  316
DSSP  hhhhlllhhhhhhlllllLLLL----LLLHHHHHHHHhHHLL-----lLLLLLLLLL---


DSSP  hhhhHHHHHHHLLHHHLLLLlllllLLLL--LLHHHHHHHHH---HHHHHHHHHHHLHHH
Query edkiYRKILIHSQGGANPLNrhelpDVYF--RTTNEMLDCFS---FLGPEKAKEIVVDNT  354
ident     |             |       |           |                   | 
Sbjct ----YSTAQKAVGKDNFTLI---peGVNGieERMTVVWDKAVatgKMDENQFVAVTSTNA  369
DSSP  ----LLHHHHHHHLLLHHHL---llLLLLllLHHHHHHHHHLlllLLLHHHHHHHHLHHH


DSSP  HHHHHL------------------------------------------------------
Query QKIASL------------------------------------------------------  360
ident  ||  |                                                      
Sbjct AKIFNLyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvis  429
DSSP  HHHHLLlllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeee


DSSP  --------------------LLLL-----------lllllllllLLLLlhhhhhhhhhhh
Query --------------------IGDV-----------kpikdelytPRIEgadeeiremsyr  389
ident                     |                                       
Sbjct qgkivfedgninvnkgmgrfIPRKafpehlyqrvkirnkvfglqGVSR------------  477
DSSP  lleeeeelleelllllllllLLLLlllhhhhhhhhhhhhhllllLLLL------------


DSSP  hhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhl
Query rakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgss  449
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelllll
Query fvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdip  509
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhh
Query fetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvka  569
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllll
Query yasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtsse  629
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  lleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhh
Query wrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsstepl  689
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  lllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhh
Query gvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeli  749
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  hlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhh
Query qngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpew  809
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhh
Query yidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsa  869
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeellee
Query airkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnsl  929
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  ellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllll
Query ippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhn  989
ident                                                             
Sbjct ------------------------------------------------------------  477
DSSP  ------------------------------------------------------------


DSSP  lllll
Query qlslf  994
ident      
Sbjct -----  477
DSSP  -----


No 28: Query=3f2bA Sbjct=3k2gB Z-score=8.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
ident                                                      | |    
Sbjct ---------------------slselspchvrsgrixtvdgpipssalGHTLXHEHLQND   39
DSSP  ---------------------llllllllllllleeeelleeeehhhlLLEELLLLLLEE


DSSP  LL--------------------------------------LLLLL--HHHHHHHHHHLLL
Query QM--------------------------------------DAVTS--VTKLIEQAKKWGH  140
ident                                                      |    | 
Sbjct CRcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDLdlAIAEVKQFAAVGG   99
DSSP  LHhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLHhhHHHHHHHHHHLLL


DSSP  LLEEELLLL-LLLLHHHHHHHHHHHLLLEEEE----------------------------
Query PAIAVTDHA-VVQSFPEAYSAAKKHGMKVIYG----------------------------  171
ident   |                      |  |  |                            
Sbjct RSIVDPTCRgIGRDPVKLRRISAETGVQVVXGagyylassxpetaarlsaddiadeivae  159
DSSP  LEEEELLLLlLLLLHHHHHHHHHHHLLEEEELlllllhhhllhhhhlllhhhhhhhhhhh


DSSP  ---------------EEEEEEllleeeeeeellhhhhhhhhhhhhhhhLLLLllllleEH
Query ---------------LEANIVddpfhvtllaqnetglknlfklvslshIQYFhrvpriPR  216
ident                 |                                           
Sbjct alegtdgtdarigliGEIGVS------------------------sdfTAEE----ekSL  191
DSSP  hhlllllllllllleEEELLL------------------------lllLHHH----hhHH


DSSP  HHHHHLL--LLEEE----------------------------ELLLLllllLLLL----L
Query SVLVKHR--DGLLV----------------------------GSGCDkgelFDNV----E  242
ident           ||                                                
Sbjct RGAARAQvrTGLPLxvhlpgwfrlahrvldlveeegadlrhtVLCHX--npSHXDpvyqA  249
DSSP  HHHHHHHhhHLLLEeellllllllhhhhhhhhhhllllhhheEELLL--hhHLLLhhhhH


DSSP  LLHHHLLLEEELlhhHHLL------lllllhHHHHHHHHHHHHHHHhllLLEEELLLLL-
Query DIARFYDFLEVHppdVYKP------lyvkdeEMIKNIIRSIVALGEkldIPVVATGNVH-  295
ident   |    |||                           |      |            |  
Sbjct TLAQRGAFLEFD-xiGXDFfyadqgvqcpsdDEVARAILGLADHGY--lDRILLSHDVFv  306
DSSP  HHHHHLLEEEEL-llLLLLeelllleelllhHHHHHHHHHHHHLLL--hHHEEELLLLLl


DSSP  --LLLHHHHhhhhhhhhllhhhlllllllllllLLLL-HHHHHHHHH--HHHHHHHHHHH
Query --YLNPEDKiyrkilihsqgganplnrhelpdvYFRT-TNEMLDCFS--FLGPEKAKEIV  350
ident    |                                  |   |       |         
Sbjct kxXLTRYGG-----------------------nGYAFvTKHFLPRLRrhGLDDAALETLX  343
DSSP  hhHLHHHLL-----------------------lLLLHhHHLHHHHHHhlLLLHHHHHHHH


DSSP  LHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhh
Query VDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerleke  410
ident | |                                                         
Sbjct VTNPRRVFDA--------------------------------------------------  353
DSSP  LHHHHHHHLL--------------------------------------------------


DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeell
Query lksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcp  470
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  lllleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeel
Query nckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsg  530
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhh
Query eyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagc  590
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  llleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeee
Query tgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldil  650
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  eehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllll
Query ghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgt  710
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhh
Query rfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyl  770
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhh
Query iyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayv  830
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhh
Query lmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakek  890
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhh
Query slltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivra  950
ident                                                             
Sbjct ------------------------------------------------------------  353
DSSP  ------------------------------------------------------------


DSSP  hhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query reegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                             
Sbjct ---------------------------------------siegh  358
DSSP  ---------------------------------------lllll


No 29: Query=3f2bA Sbjct=4dlfA Z-score=8.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLL--
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTP--  118
ident                                                  |   | |    
Sbjct -----------------------------------------------ALRIDSHQHFWry   13
DSSP  -----------------------------------------------LLLEEEEELLLll


DSSP  -----------llllllLLLHHHHHHHHHHLLLLLEEELLLL----LLLL-HHHHHHHHh
Query -----------msqmdaVTSVTKLIEQAKKWGHPAIAVTDHA----VVQS-FPEAYSAAk  162
ident                        |          |                   |   | 
Sbjct raadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQARagrdETAFlLELACDEA-   72
DSSP  lhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELLLllhhHHHHhHHHHLLLL-


DSSP  hhlLLEEEEE------------------------EEEEellleeeeeeellhhhhhhhhh
Query khgMKVIYGL------------------------EANIvddpfhvtllaqnetglknlfk  198
ident                                                             
Sbjct ---RIAAVVGwedlrapqlaervaewrgtklrgfRHQL----------------------  107
DSSP  ---LEEEEEEllllllllhhhhhhlllllleeeeEELH----------------------


DSSP  hhhhhhlllLLLL----lleEHHHHHHLLL--LEEE------------------------
Query lvslshiqyFHRV----priPRSVLVKHRD--GLLV------------------------  228
ident             |            |                                  
Sbjct -------qdEADVrafvddaDFARGVAWLQanDYVYdvlvferqlpdvqafcarhdahwl  160
DSSP  -------hhLLLHhhhhhlhHHHHHHHHHHhlLLEEeelllhhhhhhhhhhhhhllllle


DSSP  ELLLllllLLLL-----------------LLLLHHH-LLLEEELLHHHHLL----LLLLL
Query GSGCdkgeLFDN-----------------VEDIARF-YDFLEVHPPDVYKP----LYVKD  266
ident                                  |                     |   |
Sbjct VLDH---aGKPAlaefdrddtalarwraaLRELAALpHVVCKLSGLVTEADwrrgLRASD  217
DSSP  EEHH---hHLLLhhhllllllhhhhhhhhHHHHHLLlLEEEEELLLLLLLLllllLLHHH


DSSP  HHHHHHHHHHHHHHHHhlllLEEELLLLLlllhhhhhhhhhhhhllhhhlllllllLLLL
Query EEMIKNIIRSIVALGEkldiPVVATGNVHylnpedkiyrkilihsqgganplnrheLPDV  326
ident    |                                                    |   
Sbjct LRHIEQCLDAALDAFG--pqRLMFGSDWP------------------------vclLAAS  251
DSSP  HHHHHHHHHHHHHHHL--hhHEEELLLLL------------------------hhhHLLL


DSSP  LlllHHHHHHHHHHHHHH-HHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhh
Query YfrtTNEMLDCFSFLGPE-KAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeire  385
ident |                                                           
Sbjct YdevASLVERWAESRLSAaERSALWGGTAARC-YALP-----------------------  287
DSSP  HhhhHHHHHHHHHHHLLHhHHHHHLLHHHHHH-LLLL-----------------------


DSSP  hhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhh
Query msyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgs  445
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  hhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeel
Query vgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdg  505
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhh
Query hdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktayg  565
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhl
Query fvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypadd  625
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  lllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhllll
Query tssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifss  685
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  lhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllh
Query teplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgna  745
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhll
Query qeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhd  805
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhh
Query vpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldami  865
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  hlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleee
Query kgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvid  925
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  lleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllll
Query gnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldsl  985
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  lllllllll
Query pdhnqlslf  994
ident          
Sbjct ---------  287
DSSP  ---------


No 30: Query=3f2bA Sbjct=3gg7A Z-score=8.3

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPms  120
ident                                                      | |    
Sbjct ------------------------------------------------SLIDFHVHLD--   10
DSSP  ------------------------------------------------LLEEEEELHH--


DSSP  lllLLLLHHHHHHHHHHLLLlLEEELLLlLLLLHHHHHHHHHhHLLLEEEE---------
Query qmdAVTSVTKLIEQAKKWGHpAIAVTDHaVVQSFPEAYSAAKkHGMKVIYG---------  171
ident                                         |      |            
Sbjct ---LYPDPVAVARACEERQL-TVLSVTT-TPAAWRGTLALAA-GRPHVWTAlgfhpevvs   64
DSSP  ---HLLLHHHHHHHHHHLLL-EEEELLL-LHHHHHHHHHHHL-LLLLEEELllllhhhll


DSSP  -------------------EEEEEEllleeeeeeellhhhhhhhhhhhhhhhLLLLlllL
Query -------------------LEANIVddpfhvtllaqnetglknlfklvslshIQYFhrvP  212
ident                     |                                       
Sbjct eraadlpwfdrylpetrfvGEVGLD--------------------gspslrgTWTQ---Q  101
DSSP  llhhhlhhhhhhhhhlleeEEEELL--------------------llhhhhhHHHH---H


DSSP  LEEHHHHHHLLL---LEEE------------------------ELLLllllLLLL---LL
Query RIPRSVLVKHRD---GLLV------------------------GSGCdkgeLFDN---VE  242
ident                |                                            
Sbjct FAVFQHILRRCEdhgGRILsihsrraesevlncleanprsgtpILHW----YSGSvteLR  157
DSSP  HHHHHHHHHHHHhllLEEEeeellllhhhhhhhhhhlhhheeeEEEL----LLLLhhhHH


DSSP  LL-HHHLlLEEELLHhhhlllllllHHHHHHHHHHHHhhhhhllLLEEELLLLLlllhhh
Query DI-ARFYdFLEVHPPdvykplyvkdEEMIKNIIRSIValgekldIPVVATGNVHylnped  301
ident            | |                  |||           |             
Sbjct RAiSLGC-WFSVGPT-------mvrTQKGAALIRSMP------rDRVLTETDGP------  197
DSSP  HHhHLLL-EEEELHH-------hhlLHHHHHHHHHLL------hHHEEELLLLL------


DSSP  hhhhhhhhhllhhhllllllLLLLLLLLLhHHHHHHHHH-HHHH--HHHHHHLHHHHHHH
Query kiyrkilihsqgganplnrhELPDVYFRTtNEMLDCFSF-LGPE--KAKEIVVDNTQKIA  358
ident                                      |            ||  |     
Sbjct ----------------flelDGQAALPWDvKSVVEGLSKiWQIPasEVERIVKENVSRLL  241
DSSP  ----------------lleeLLEELLHHHhHHHHHHHHHhHLLLhhHHHHHHHHHHHHHH


DSSP  HLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhll
Query SLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighg  418
ident                                                             
Sbjct GT----------------------------------------------------------  243
DSSP  HL----------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeel
Query faviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseff  478
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhh
Query ndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahn  538
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeee
Query ytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttg  598
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhh
Query qhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvi  658
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhh
Query rmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmle  718
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhh
Query etrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrgleps  778
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhh
Query lafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriay  838
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhh
Query fkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlev  898
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllll
Query alemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefls  958
ident                                                             
Sbjct ------------------------------------------------------------  243
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlllhhhhhhhhhllllllllllllllll
Query kedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                     
Sbjct ------------------------------------  243
DSSP  ------------------------------------


No 31: Query=3f2bA Sbjct=2uz9A Z-score=8.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhHH
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaEL   60
ident                                                             
Sbjct ------plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcFK   54
DSSP  ------llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlLL


DSSP  HHLllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllLLLLLLLLL-LLLL-
Query MSGvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapEGEKRVELH-LHTP-  118
ident                                                   |  |      
Sbjct PCE---------------------------------irelshhefFMPGLVDTHiHASQy   81
DSSP  HHH---------------------------------eeellllleEEELEEEEEeEHHHh


DSSP  -----------------lLLLLL---------llLHHHHHHHHHHLLLLLEEELLlLLLL
Query -----------------mSQMDA---------vtSVTKLIEQAKKWGHPAIAVTDhAVVQ  152
ident                                     |       | |             
Sbjct sfagssidlpllewltkyTFPAEhrfqnidfaeeVYTRVVRRTLKNGTTTACYFA-TIHT  140
DSSP  hhllllllllhhhhhhhlHHHHHhhhhlhhhhhhHHHHHHHHHHHLLEEEEEEEL-LLLH


DSSP  -LHHHHHHHHHHHLLLEEEEEE--------------------------------------
Query -SFPEAYSAAKKHGMKVIYGLE--------------------------------------  173
ident  |         | |     |                                        
Sbjct dSSLLLADITDKFGQRAFVGKVcmdlndtfpeyketteesiketerfvsemlqknysrvk  200
DSSP  hHHHHHHHHHHHHLLEEEEELEelllllllllllllhhhhhhhhhhhhhhhhhhllllee


DSSP  -----EEEEllleeeeeeellhhhhhhhhhhhhhhhlllllllLLEE--HHHHHHLL---
Query -----ANIVddpfhvtllaqnetglknlfklvslshiqyfhrvPRIP--RSVLVKHR---  223
ident                                                     |       
Sbjct pivtpRFSL----------------------------------SCSEtlMGELGNIAktr  226
DSSP  eeeeeLLHH----------------------------------HLLHhhHHHHHHHHhhh


DSSP  LLEE-------------------------------------EELLLllllllllLLLLHH
Query DGLL-------------------------------------VGSGCdkgelfdnVEDIAR  246
ident |                                                           
Sbjct DLHIqshisenrdeveavknlypsyknytsvydknnlltnkTVMAH----gcylSAEELN  282
DSSP  LLEEeeeelllhhhhhhhhhhllllllhhhhhhhlllllllEEEEE----llllLHHHHH


DSSP  HL----LLEEELL--HHHHLLlllllhhhhhhHHHHhHHHHHHLLLLEEELLLLLlllhh
Query FY----DFLEVHP--PDVYKPlyvkdeemiknIIRSiVALGEKLDIPVVATGNVHylnpe  300
ident             |                        |    |          |      
Sbjct VFhergASIAHCPnsNLSLSS-----------GFLN-VLEVLKHEVKIGLGTDVA-----  325
DSSP  HHhhhlLEEEELHhhHHHLLL-----------LLLL-HHHHHHLLLEEEELLLLL-----


DSSP  hhhhhhhhhhllhhhllllllllllLLLLLHhHHHHHHHH--------------HHHHHH
Query dkiyrkilihsqgganplnrhelpdVYFRTTnEMLDCFSF--------------LGPEKA  346
ident                                                       |     
Sbjct -----------------------ggYSYSML-DAIRRAVMvsnillinkvneksLTLKEV  361
DSSP  -----------------------llLLLLHH-HHHHHHHHhhhhhhhlllllllLLHHHH


DSSP  HHHHLHHHHH-HHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhh
Query KEIVVDNTQK-IASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklvee  405
ident                                                             
Sbjct FRLATLGGSQaLGLD---------------------------------------------  376
DSSP  HHHHLHHHHHhLLLL---------------------------------------------


DSSP  hhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlllllllllll
Query rlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpp  465
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  eeelllllleeellllllllhhhllllllllllllleeellllllhhhhlllllllllee
Query hyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdid  525
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  eeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhh
Query lnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidr  585
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhlllll
Query laagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnll  645
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  eeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhlllllllll
Query kldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigi  705
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhh
Query pefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrdd  765
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhh
Query imvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkah  825
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhl
Query aaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqa  885
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhh
Query takekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaq  945
ident                                                             
Sbjct -----------------------------------------geignfevgkefdailinp  395
DSSP  -----------------------------------------llllllllllllleeeell


DSSP  hhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query aivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                  
Sbjct kasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  lllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 32: Query=3f2bA Sbjct=2y1hB Z-score=8.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPms  120
ident                                               |   |  | |    
Sbjct ----------------------------------------------GVGLVDCHCHLS--   12
DSSP  ----------------------------------------------LLLEEEEEELLL--


DSSP  llLLLL--LHHHHHHHHHHLLLLLEEELLLL--LLLLHHHHHHHHHhhlLLEEEE-----
Query qmDAVT--SVTKLIEQAKKWGHPAIAVTDHA--VVQSFPEAYSAAKkhgMKVIYG-----  171
ident               | |||    |                           |        
Sbjct --APDFdrDLDDVLEKAKKANVVALVAVAEHsgEFEKIMQLSERYN---GFVLPClgvhp   67
DSSP  --LHHHllLHHHHHHHHHHLLEEEEEELLLLhhHHHHHHHHHHHLL---LLEEEEellll


DSSP  -------------------------------EEEEE---------------ELLLeeeee
Query -------------------------------LEANI---------------VDDPfhvtl  185
ident                                 |                           
Sbjct vqgldqrsvtlkdldvalpiienykdrllaiGEVGLdfsprfagtgeqkeeQRQV-----  122
DSSP  eelllleellhhhhhhhhhhhhhhllllleeEEEEEellllllllhhhhhhHHHH-----


DSSP  eellhhhhhhhhhhhhhhhllllllllleeHHHHHHLL---LLEE---------------
Query laqnetglknlfklvslshiqyfhrvpripRSVLVKHR---DGLL---------------  227
ident                                                             
Sbjct ------------------------------LIRQIQLAkrlNLPVnvhsrsagrptinll  152
DSSP  ------------------------------HHHHHHHHhhhLLLEeeeeellhhhhhhhh


DSSP  -------EELLLllllLLLL---LLLLHHHLLLEEELLHhhhlllllllhhhHHHHHHHH
Query -------VGSGCdkgeLFDN---VEDIARFYDFLEVHPPdvykplyvkdeemIKNIIRSI  277
ident        |                    |   |    |                      
Sbjct qeqgaekVLLHA----FDGRpsvAMEGVRAGYFFSIPPS-----------iiRSGQKQKL  197
DSSP  hhlllllEEEEL----LLLLhhhHHHHHHLLLEEEELHH-----------hhLLHHHHHH


DSSP  HHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllllLLLLLL-LLLHhHHHH
Query VALGEkldIPVVATGNVHylnpedkiyrkilihsqgganplnrhELPDVY-FRTTnEMLD  336
ident |                                                           
Sbjct VKQLP--lTSICLETDSP---------------------algpeKQVRNEpWNIS-ISAE  233
DSSP  HHHLL--hHHEEELLLLL---------------------lllllLLLLLLhHHHH-HHHH


DSSP  HH-HHHHHHhHHHHhLHHHHHHHHL----LLLLllllllllllllllhhhhhhhhhhhhh
Query CF-SFLGPEkAKEIvVDNTQKIASL----IGDVkpikdelytpriegadeeiremsyrra  391
ident       |     |     |   |                                     
Sbjct YIaQVKGIS-VEEV-IEVTTQNALKlfpkLRHL---------------------------  264
DSSP  HHhHHHLLL-HHHH-HHHHHHHHHHhlllHHHH---------------------------


DSSP  hhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhh
Query keiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfv  451
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellllllh
Query atmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfe  511
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhh
Query tflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkaya  571
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  hhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllllll
Query sdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewr  631
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  eeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhll
Query tthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgv  691
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhl
Query tpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqn  751
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  llllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhh
Query gtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyi  811
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhh
Query dsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaai  871
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeel
Query rkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslip  931
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  lhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllllll
Query pfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnql  991
ident                                                             
Sbjct ------------------------------------------------------------  264
DSSP  ------------------------------------------------------------


DSSP  lll
Query slf  994
ident    
Sbjct --l  265
DSSP  --l


No 33: Query=3f2bA Sbjct=3griA Z-score=8.1

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------xklikn    6
DSSP  ------------------------------------------------------leeeel


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELLlllllllLLLLLLLLLLLL-LLL
Query msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAAnerqdtaPEGEKRVELHLH-TPM  119
ident                                                   |  | |    
Sbjct gkvlqngelqqadilidgkvikqiapaiepSNGVDII--dakghFVSPGFVDVHVHlREP   64
DSSP  leeeelleeeeleeeeelleeeeeelllllLLLLEEE--ellllEEEELEEEEEELlLLL


DSSP  LLlllLLLHHHHHHHHHHLLLLLEEELLL---------llllLHHHHHHHHhhhLLLEEE
Query SQmdaVTSVTKLIEQAKKWGHPAIAVTDH---------avvqSFPEAYSAAkkhGMKVIY  170
ident                |   |                              |      |  
Sbjct GG-eyKETIETGTKAAARGGFTTVCPXPNtrpvpdsvehfeaLQKLIDDNA---QVRVLP  120
DSSP  LL-llLLLHHHHHHHHHHLLEEEEEELLLlllllllhhhhhhHHHHHHHHL---LLEELL


DSSP  EEeeeeellleeeeeeellhhhhhhhhhHHHHHHLLL---------------lllLLLE-
Query GLeanivddpfhvtllaqnetglknlfkLVSLSHIQY---------------fhrVPRI-  214
ident                                                             
Sbjct YA-------------------------sITTRQLGKElvdfpalvkegafaftddGVGVq  155
DSSP  LE-------------------------eLLHHHLLLLlllhhhhhlllllleeelLLLLl


DSSP  ---EHHHHHHLL--LLEEE-----------------------------------------
Query ---PRSVLVKHR--DGLLV-----------------------------------------  228
ident                                                             
Sbjct tasXXYEGXIEAakVNKAIvahcednsliyggaxhegkrskelgipgipnicesvqiard  215
DSSP  lhhHHHHHHHHHhhHLLLEeellllhhhllllleellhhhhhhllleellhhhhhhhhhh


DSSP  -----------ELLLL-lllLLLL-LLLL--hHHLLlEEELLHH----------------
Query -----------GSGCD-kgeLFDN-VEDI--aRFYDfLEVHPPD----------------  257
ident                                       || |                  
Sbjct vllaeaagchyHVCHVstkeSVRViRDAKragIHVT-AEVTPHHlllteddipgnnaiyk  274
DSSP  hhhhhhhllleEELLLllhhHHHHhHHHHhllLLEE-EEELHHHhhllhhhlllllhhhl


DSSP  -hHLLLllllHHHHHHHHHHHHHHHhhllLLEEELLLLLLllhhhhhhHHHHHHLlHHHL
Query -vYKPLyvkdEEMIKNIIRSIVALGekldIPVVATGNVHYlnpedkiyRKILIHSqGGAN  316
ident                         |                                   
Sbjct xnPPLR----STEDREALLEGLLDG----TIDCIATDHAP-------hARDEKAQ-PXEK  318
DSSP  llLLLL----LHHHHHHHHHHHHLL----LLLEELLLLLL-------lLHHHHLL-LLLL


DSSP  LLllllLLLLLL-LLHHHHHHHHH---HHHHHHHHHHHLHHHHHHHHLllllllllllll
Query PLnrheLPDVYF-RTTNEMLDCFS---FLGPEKAKEIVVDNTQKIASLigdvkpikdely  372
ident          |            |                        |            
Sbjct AP----FGIVGSeTAFPLLYTHFVkngDWTLQQLVDYLTIKPCETFNL------------  362
DSSP  LL----LLLLLLlLHHHHHHHHHLlllLLLHHHHHHHHLHHHHHHLLL------------


DSSP  llllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhh
Query tpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkk  432
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllll
Query slddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdk  492
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  llllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeee
Query ncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyra  552
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  eeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllll
Query gtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdyme  612
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhl
Query iydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpkti  672
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhh
Query ptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqis  732
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllll
Query glshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkg  792
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhh
Query ltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyf  852
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  hhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelll
Query tvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfkni  912
ident                                                             
Sbjct ------------------------------------------------------------  362
DSSP  ------------------------------------------------------------


DSSP  lllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhh
Query dlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktl  972
ident                                                             
Sbjct ----------------------eygtlkengyadltiidldseqeikgedflskadntpf  400
DSSP  ----------------------lllllllllllleeeeelllleellhhhllllllllll


DSSP  hhhhhhllllllllllllllll
Query leylesrgcldslpdhnqlslf  994
ident                       
Sbjct igykvygnpiltxvegevkfeg  422
DSSP  llleelleeeeeeelleeeeel


No 34: Query=3f2bA Sbjct=4hk5D Z-score=8.0

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLL-
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPM-  119
ident                                                   |  | |    
Sbjct ----------------------------------------------TPVVVDIHTHMYPp   14
DSSP  ----------------------------------------------LLLLEEEEEEELLh


DSSP  --------------------------------------------------lllllLLLHH
Query --------------------------------------------------sqmdaVTSVT  129
ident                                                          |  
Sbjct syiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrplsthFASLA   74
DSSP  hhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleellhhHLLHH


DSSP  HHHHHHHHLLLLLEEELLLL------------------LLLLHHHHHHHHhhhlLLEEEE
Query KLIEQAKKWGHPAIAVTDHA------------------VVQSFPEAYSAAkkhgMKVIYG  171
ident          |                                                  
Sbjct QKMHFMDTNGIRVSVISLANpwfdflapdeapgiadavNAEFSDMCAQHV----GRLFFF  130
DSSP  HHHHHHHHLLLLEEEEEELLllllllllllhhhhhhhhHHHHHHHHHLLL----LLEEEE


DSSP  E---------------------------EEEEEllleeeeeeellhhhhhhhhhhhhhhh
Query L---------------------------EANIVddpfhvtllaqnetglknlfklvslsh  204
ident                                                             
Sbjct AalplsapvdavkasiervknlkycrgiILGTS---------------------------  163
DSSP  EellllllhhhhhhhhhhhhlllleeeeEELLL---------------------------


DSSP  llLLLLllleehHHHHHLL--LLEEE----------------------------------
Query iqYFHRvpriprSVLVKHR--DGLLV----------------------------------  228
ident                        |||                                  
Sbjct -gLGKGlddphlLPVFEAVadAKLLVflhphyglpnevygprseeyghvlplalgfpmet  222
DSSP  -lLLLLlllhhhHHHHHHHhhLLLEEeelllllllhhhhlllhhhlllhhhhhlhhhhhh


DSSP  ---------------------ELLLllllLLLL---------------------------
Query ---------------------GSGCdkgeLFDN---------------------------  240
ident                                                             
Sbjct tiavarmymagvfdhvrnlqmLLAH---sGGTLpflagriescivhdghlvktgkvpkdr  279
DSSP  hhhhhhhhhllhhhhllllleEEHH---hHLLHhhhhhhhhhhhhllhhhhhllllllll


DSSP  --LLLL-HHHLlLEEELLHhhhlllllllhhhHHHHHHHHHHHHHhlllLEEELLLLLLL
Query --VEDI-ARFYdFLEVHPPdvykplyvkdeemIKNIIRSIVALGEkldiPVVATGNVHYL  297
ident              |                           |                  
Sbjct rtIWTVlKEQI-YLDAVIY-------------SEVGLQAAIASSG--adRLMFGTDHPFF  323
DSSP  llHHHHhHHLE-EEELLLL-------------LHHHHHHHHHHHL--hhHEELLLLLLLL


DSSP  LHHhhhhhhhhhhllhhhlllllllllllllllhHHHHHHHH-HHHH--HHHHHHHLHHH
Query NPEdkiyrkilihsqgganplnrhelpdvyfrttNEMLDCFS-FLGP--EKAKEIVVDNT  354
ident  |                                           |     |      | 
Sbjct PPI--------------------eedvqgpwdssRLNAQAVIkAVGEgsSDAAAVMGLNA  363
DSSP  LLL--------------------llllllllhhhHHHHHHHHhHHLLllHHHHHHHLHHH


DSSP  HHHHhLLLLlllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhh
Query QKIAsLIGDvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksi  414
ident                                                             
Sbjct VRVL-SLKA---------------------------------------------------  371
DSSP  HHHL-LLHH---------------------------------------------------


DSSP  hhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeellllll
Query ighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckh  474
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  eeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhh
Query seffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqp  534
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllle
Query rahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvk  594
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehh
Query rttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghdd  654
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhh
Query ptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvr  714
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhll
Query qmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrg  774
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhh
Query lepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmav  834
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhh
Query riayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakeksllt  894
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhll
Query vlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareeg  954
ident                                                             
Sbjct ------------------------------------------------------------  371
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query eflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                         
Sbjct -------------------------------elehhhhhh  380
DSSP  -------------------------------hhhhhhhhl


No 35: Query=3f2bA Sbjct=3nqbA Z-score=8.0

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------epadlnddtlraravaaargdqrfdvlitg   30
DSSP  ------------------------------llhhhllhhhhhhhhhhhhlllleeeeeel


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllLLLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtaPEGEKRVELHLHTPms  120
ident                                                      | |    
Sbjct gtlvdvvtgelrpadigivgaliasvhepasrrdaaqvidaggaYVSPGLIDTHXHIE--   88
DSSP  leeelllllleeeleeeeelleeeeeellllllleeeeeellllEEEELEEEEEELHH--


DSSP  lllLLLLHHHHHHHHHHLLLLLEEELLL---------lLLLLHHHHHHHhhhhLLLEEEE
Query qmdAVTSVTKLIEQAKKWGHPAIAVTDH---------aVVQSFPEAYSAakkhGMKVIYG  171
ident                   |   |    |          |                  |  
Sbjct --sSXITPAAYAAAVVARGVTTIVWDPHefgnvhgvdgVRWAAKAIENL----PLRAILL  142
DSSP  --hHLLLHHHHHHHHHLLLEEEEEELLHhhhhhhlhhhHHHHHHHHLLL----LLEEEEE


DSSP  EEEEeellleeeeeeellhhhhhhhhhhhhhhhllllLLLLLE-----------------
Query LEANivddpfhvtllaqnetglknlfklvslshiqyfHRVPRI-----------------  214
ident                                                             
Sbjct APSC------------------------vpsapglerGGADFDaailadllswpeiggia  178
DSSP  ELLL------------------------lllllllllLLLLLLhhhhhhhhlllleeeee


DSSP  -------------EHHHHHHLL--LLEEEELLlllllLLLL----LLLLHH-HLLLEEEl
Query -------------PRSVLVKHR--DGLLVGSGcdkgeLFDN----VEDIAR-FYDFLEVh  254
ident                |  |        ||                               
Sbjct eixnxrgvierdpRXSGIVQAGlaAEKLVCGH-----ARGLknadLNAFXAaGVSSDHE-  232
DSSP  eellhhhhhlllhHHHHHHHHHhhHLLEEEEL-----LLLLlhhhHHHHHHlLLLEELL-


DSSP  lhhhhlllllllhhhHHHHHHHHHHHHhhllLLEEE------------------------
Query ppdvykplyvkdeemIKNIIRSIVALGekldIPVVA------------------------  290
ident                           |                                 
Sbjct -------------lvSGEDLXAKLRAG----LTIELrgshdhllpefvaalntlghlpqt  275
DSSP  -------------llLHHHHHHHHHLL----LEEEEelllhhhhhhhhhhhhhhllllll


DSSP  ---LLLLLLLLHhhhhhhhhhhhllhhhllllllllllllLLLHhHHHHHHH--HHHHHH
Query ---TGNVHYLNPedkiyrkilihsqgganplnrhelpdvyFRTTnEMLDCFS--FLGPEK  345
ident                                                        | || 
Sbjct vtlCTDDVFPDD------------------------llqgGGLD-DVVRRLVryGLKPEW  310
DSSP  eeeELLLLLHHH------------------------hhhlLLHH-HHHHHHHhlLLLHHH


DSSP  HHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhh
Query AKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklvee  405
ident |      |                                                    
Sbjct ALRAATLNAAQRLGR---------------------------------------------  325
DSSP  HHHHHLHHHHHHHLL---------------------------------------------


DSSP  hhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlllllllllll
Query rlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpp  465
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  eeelllllleeellllllllhhhllllllllllllleeellllllhhhhlllllllllee
Query hyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdid  525
ident                                                             
Sbjct ---------------------------------------sdlgliaagrradivvfedln  346
DSSP  ---------------------------------------llllllllllllleeeellll


DSSP  eeeelllhhhhhhhhhhhhlllleeeeeeEEELL--------------------------
Query lnfsgeyqprahnytkvlfgednvyragtIGTVA--------------------------  559
ident                                                             
Sbjct gfsarhvlasgravaeggrxlvdiptcdtTVLKGsxklplrxandflvksqgakvrlati  406
DSSP  llleeeeeelleeeeelleelllllllllHHHLLllllllllhhhhllllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  559
ident                                                             
Sbjct drprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafatt  466
DSSP  ellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeel


DSSP  --------------------hhhhHHHH-hhhhhhlLLLLLhhhHHHHhhhHLLL-----
Query --------------------dktaYGFV-kayasdhNLELRgaeIDRLaagCTGV-----  593
ident                                                             
Sbjct vshdshnltvfggnagdxalaanaVIGTgggxavasEGKVT---AILP---LPLSglvsd  520
DSSP  llllllleeeeellhhhhhhhhhhHHHLlleeeeeeLLEEE---EEEE---LLLLlllll


DSSP  ---------------eeeeeeeeeeeeellllllhhhllleelhhhLLLLLLleeeeehh
Query ---------------krttgqhpggiivvpdymeiydftpiqypadDTSSEWrtthfdfh  638
ident                                                             
Sbjct apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqTDXGIA--------  572
DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleeLLLLEE--------


DSSP  hhllllleeeeEEEHhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhll
Query sihdnllkldiLGHDdptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimc  698
ident                                                             
Sbjct dvltgkvxespVIEV---------------------------------------------  587
DSSP  elllleeelllEEEL---------------------------------------------


DSSP  llllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhh
Query nvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlse  758
ident                                                             
Sbjct ------------------------------------------------------------  587
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhll
Query vigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkik  818
ident                                                             
Sbjct ------------------------------------------------------------  587
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhh
Query ymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieei  878
ident                                                             
Sbjct ------------------------------------------------------------  587
DSSP  ------------------------------------------------------------


DSSP  hhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlll
Query nakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipg  938
ident                                                             
Sbjct ------------------------------------------------------------  587
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query lgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                         
Sbjct --------------------------------------------------------  587
DSSP  --------------------------------------------------------


No 36: Query=3f2bA Sbjct=3mkvA Z-score=8.0

back to top
DSSP  -------------------------lllhhhlllleeEEEEeeeeeeeeeeellllleee
Query -------------------------vrrletiveeerRVVVqgyvfdaevselksgrtll   35
ident                                                             
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdKPIK-------------------   41
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeelLLLL-------------------


DSSP  eeeeelllleeeeeeelllhhhhhhhhlllllleeeeeeeeeeelllleeeeeeeEEEEE
Query tmkitdytnsilvkmfsrdkedaelmsgvkkgmwvkvrgsvqndtfvrdlviianDLNEI   95
ident                                                             
Sbjct ------------------------------------------------------sSNAHV   47
DSSP  ------------------------------------------------------lLLLEE


DSSP  LllllllllllLLLLLLLLLLLlllllLLLL----------------LHHHHHHHHHHLL
Query AanerqdtapeGEKRVELHLHTpmsqmDAVT----------------SVTKLIEQAKKWG  139
ident                  || |       |                              |
Sbjct I---dvkgktiMPGLIDLHVHV-----VAIEfnlprvatlpnvlvtlRAVPIMRAMLRRG   99
DSSP  E---elllleeEELEEEEEELL-----LLLLllhhhhllllhhhhhhHHHHHHHHHHHLL


DSSP  LLLEEELLlllllLHHHHHHHHH--HHLL-LEEEE-------------------------
Query HPAIAVTDhavvqSFPEAYSAAK--KHGM-KVIYG-------------------------  171
ident                     |                                       
Sbjct FTTVRDAG----gAGYPFKQAVEsgLVEGpRLFVSgralsqtgghadprarsdymppdsp  155
DSSP  EEEEEELL----lLLHHHHHHHHllLLLLlEEEELlleeellllllllllllllllllll


DSSP  ----------------------------------EEEE---------------EELLlee
Query ----------------------------------LEAN---------------IVDDpfh  182
ident                                                             
Sbjct cgccvrvgalgrvadgvdevrravreelqmgadqIXIMasggvasptdpvgvfGYSE---  212
DSSP  lllllllllleeelllhhhhhhhhhhhhhhllllEEEElllllllllllllllLLLH---


DSSP  eeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHLLL---LEEE-----------
Query vtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKHRD---GLLV-----------  228
ident                                      |                      
Sbjct -------------------------------dEIRAIVAEAQgrgTYVLahaytpaaiar  241
DSSP  -------------------------------hHHHHHHHHHHlllLLEEeeellhhhhhh


DSSP  -------ELLLllllLLLL---LLLLHH-HLLLEEELL--HHHHL-----------LLLL
Query -------GSGCdkgeLFDN---VEDIAR-FYDFLEVHP--PDVYK-----------PLYV  264
ident                                          |                  
Sbjct avrcgvrTIEH----GNLIddeTARLVAeHGAYVVPTLvtYDALAsegekyglppeSIAK  297
DSSP  hhhllllEEEE----LLLLlhhHHHHHHhHLLEEELLHhhHHHHHhhlllllllhhHHLL


DSSP  llHHHHHhHHHHHHHHHHHLLLLEEELLLLLLLlhhhhhhhhhhhhllhhhlllllllll
Query kdEEMIKnIIRSIVALGEKLDIPVVATGNVHYLnpedkiyrkilihsqgganplnrhelp  324
ident                                                             
Sbjct -iADVHG-AGLHSIEIMKRAGVKMGFGTDLLGE---------------------------  328
DSSP  -hHHHHL-LHHHHHHHHHHHLLLLLLLLLLLHH---------------------------


DSSP  lLLLLLHhHHHHHHHH-HHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhh
Query dVYFRTTnEMLDCFSF-LGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeei  383
ident                  | |                                        
Sbjct -AQRLQS-DEFRILAEvLSPAEVIASATIVSAEVLGM-----------------------  363
DSSP  -HHHHLL-HHHHHHHLlLLHHHHHHHLLHHHHHHLLL-----------------------


DSSP  hhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleel
Query remsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsr  443
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  hhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllllllee
Query gsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykk  503
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  ellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhh
Query dghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadkta  563
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhh
Query ygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypa  623
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  hllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhll
Query ddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgif  683
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  lllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllllllll
Query ssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlg  743
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhh
Query naqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrk  803
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhh
Query hdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdlda  863
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  hhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllle
Query mikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefv  923
ident                                                             
Sbjct ------------------------------------------------------------  363
DSSP  ------------------------------------------------------------


DSSP  eelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllll
Query idgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcld  983
ident                                                             
Sbjct --------------------qdklgrivpgahadvlvvdgnplksvdcllgqgehiplvm  403
DSSP  --------------------lllllllllllllleeeellllllllllllllllllleee


DSSP  lllllllllll
Query slpdhnqlslf  994
ident            
Sbjct kdgrlfvnele  414
DSSP  elleeeeelll


No 37: Query=3f2bA Sbjct=2dvtA Z-score=7.8

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLlLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTpMS  120
ident                                                   | |  |    
Sbjct ----------------------------------------------mQGKVALEEHF-AI   13
DSSP  ----------------------------------------------lLLEEEEEEEE-LL


DSSP  LLL------------------LLLLHHH-HHHHHHHLLLLLEEELLLL------------
Query QMD------------------AVTSVTK-LIEQAKKWGHPAIAVTDHA------------  149
ident                                      |         |            
Sbjct PETlqdsagfvpgdywkelqhRLLDIQDtRLKLMDAHGIETMILSLNApavqaipdrrka   73
DSSP  HHHhhhhlllllllhhhhhhhHHHLLLLhHHHHHHHLLEEEEEEEELLlhhhhlllhhhh


DSSP  ------LLLLHHHHHHHHHhhlLLEEEEE--------------------------EEEEE
Query ------VVQSFPEAYSAAKkhgMKVIYGL--------------------------EANIV  177
ident             |                                            |  
Sbjct ieiarrANDVLAEECAKRP---DRFLAFAalplqdpdaateelqrcvndlgfvgaLVNGF  130
DSSP  hhhhhhHHHHHHHHHHHLL---LLEEEEEllllllhhhhhhhhhhhhhllllleeEEELL


DSSP  llleeeeeeellhhhhhhhhhhhhhhhllLLLL-------llleehHHHHHLL--LLEE-
Query ddpfhvtllaqnetglknlfklvslshiqYFHR-------vpriprSVLVKHR--DGLL-  227
ident                                                             
Sbjct -----------------------------SQEGdgqtplyydlpqyRPFWGEVekLDVPf  161
DSSP  -----------------------------LLLLllllllllllhhhHHHHHHHhhHLLLe


DSSP  ----------------------------------------------------EELLLlll
Query ----------------------------------------------------VGSGCdkg  235
ident                                                        |    
Sbjct ylhprnplpqdsriydghpwllgptwafaqetavhalrlmasglfdehprlnIILGH---  218
DSSP  eeelllllhhhlhhhlllhhhlhhhlhhhhhhhhhhhhhhhllhhhhlllllEEELH---


DSSP  lLLLL--------------------------LLLLHHHLlLEEE-LLHHhhlllllllhh
Query eLFDN--------------------------VEDIARFYdFLEV-HPPDvykplyvkdee  268
ident                                                             
Sbjct mGEGLpymmwridhrnawvklpprypakrrfMDYFNENF-HITTsGNFR-----------  266
DSSP  hHLLHhhhhhhhhhllllllllllllllllhHHHHHHHE-EEELlLLLL-----------


DSSP  hhHHHHHHHHHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllllllllLLL
Query miKNIIRSIVALGEkldIPVVATGNVHylnpedkiyrkilihsqgganplnrhelpdVYF  328
ident                                                             
Sbjct --TQTLIDAILEIG--aDRILFSTDWP-----------------------------fENI  293
DSSP  --HHHHHHHHLLLL--hHHEELLLLLL-----------------------------lLLH


DSSP  L-LHHHHHHHhhHHHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhh
Query R-TTNEMLDCfsFLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeirems  387
ident                      |   |      |                           
Sbjct DhASDWFNAT--SIAEADRVKIGRTNARRLFKL---------------------------  324
DSSP  HhHHHHHHHL--LLLHHHHHHHHLHHHHHHLLL---------------------------


DSSP  hhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhh
Query yrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvg  447
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  hlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelll
Query ssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghd  507
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  lllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhh
Query ipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfv  567
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlll
Query kayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddts  627
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  lllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllh
Query sewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsste  687
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  hhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhh
Query plgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqe  747
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  hhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllll
Query liqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvp  807
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhl
Query ewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikg  867
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeell
Query saairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgn  927
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  eeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllll
Query slippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpd  987
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  lllllll
Query hnqlslf  994
ident        
Sbjct ------d  325
DSSP  ------l


No 38: Query=3f2bA Sbjct=4qrnA Z-score=7.7

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllLLLL--LLLLLLLLLLLLLLl
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaaneRQDT--APEGEKRVELHLHTp  118
ident                                                 |  |        
Sbjct ------------------------------------smtQDLKtgGEQGYLRIATEEAF-   23
DSSP  ------------------------------------lllLLLLllLLLLLLLEEEEEEE-


DSSP  LLLL-----------------------------------LLLL--LHHH-HHHHHHHLLL
Query MSQM-----------------------------------DAVT--SVTK-LIEQAKKWGH  140
ident                                                    |      | 
Sbjct ATREiidvylrmirdgtadkgmvslwgfyaqspseratqILERllDLGErRIADMDATGI   83
DSSP  LLHHhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhHHHHhhLLLHhHHHHHHHLLL


DSSP  LLEEELLLL------------------LLLLH-HHHHHHHhhhlLLEEEEE---------
Query PAIAVTDHA------------------VVQSF-PEAYSAAkkhgMKVIYGL---------  172
ident                                                |            
Sbjct DKAILALTSpgvqplhdldeartlatrANDTLaDACQKYP----DRFIGMGtvapqdpew  139
DSSP  LEEEEEELLllllllllhhhhhhhhhhHHHHHhHHHHHLL----LLEEELLllllllhhh


DSSP  -----------------EEEEEllleeeeeeellhhhhhhhhhhhhhhhllLLLL-llle
Query -----------------EANIVddpfhvtllaqnetglknlfklvslshiqYFHR-vpri  214
ident                    |                                  |     
Sbjct sareihrgarelgfkgiQINSH-----------------------------TQGRyldee  170
DSSP  hhhhhhhhhhlllllleEELLL-----------------------------LLLLllllh


DSSP  ehHHHHHLL--LLEEE--------------------------------------------
Query prSVLVKHR--DGLLV--------------------------------------------  228
ident                                                             
Sbjct ffDPIFRALveVDQPLyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigif  230
DSSP  hhHHHHHHHhhHLLLEeellllllllllhhhhhhlllllllhhhhhhhhhhhhhhhhlhh


DSSP  --------ELLLllllLLLL----------------------------LLLL-HHHLlLE
Query --------GSGCdkgeLFDN----------------------------VEDI-ARFYdFL  251
ident           |                                      |          
Sbjct dkypslqiMVGH--mgEALPywlyrldymhqagvrsqryermkplkktIEGYlKSNV-LV  287
DSSP  hhllllleEELH--hhHLHHhhhhhhhhhhhhhhhlllllllllllllHHHHhHHLE-EE


DSSP  EE-LLHHhhlllllllhhhhHHHHHHHHHHHHhlllLEEELLLLLlllhhhhhhhhhhhh
Query EV-HPPDvykplyvkdeemiKNIIRSIVALGEkldiPVVATGNVHylnpedkiyrkilih  310
ident                        |             |                      
Sbjct TNsGVAW-------------EPAIKFCQQVMG--edRVMYAMDYP---------------  317
DSSP  ELlLLLL-------------HHHHHHHHHHHL--hhHEELLLLLL---------------


DSSP  llhhhllllllllllLLLLL--HHHHHHhhHHHHHHHHHHHHLHHHHHHHHLllllllll
Query sqgganplnrhelpdVYFRT--TNEMLDcfSFLGPEKAKEIVVDNTQKIASLigdvkpik  368
ident                          |            |     |  |   |        
Sbjct ---------------YQYVAdeVRAMDA--MDMSAQTKKKFFQTNAEKWFKL--------  352
DSSP  ---------------LLLLHhhHHHHHL--LLLLHHHHHHHHLHHHHHHLLL--------


DSSP  llllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhh
Query delytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishk  428
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhh
Query lvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfd  488
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  llllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhllll
Query lpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgedn  548
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeell
Query vyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvp  608
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  llllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlll
Query dymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgid  668
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhh
Query pktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfsel  728
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhl
Query vqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvr  788
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhh
Query kgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyy  848
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllle
Query asyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfs  908
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  ellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhll
Query fknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgkl  968
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhllllllllllllllll
Query sktlleylesrgcldslpdhnqlslf  994
ident                           
Sbjct --------------------------  352
DSSP  --------------------------


No 39: Query=3f2bA Sbjct=1onxA Z-score=7.7

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -----------------------------------------------------------m    1
DSSP  -----------------------------------------------------------l


DSSP  HHLLL----------------llleeeeeeeeeeelllleeeeeeeeeEEELllllllll
Query MSGVK----------------kgmwvkvrgsvqndtfvrdlviiandlNEIAanerqdta  104
ident                                                             
Sbjct IDYTAagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnCTVV---dlsgq   58
DSSP  LLLHHhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllLEEE---ellll


DSSP  llLLLLLLLLLL-LLLLL-----LLLLLLhhhHHHHHHHLLLLLEEELLLL-----LLLL
Query peGEKRVELHLH-TPMSQ-----MDAVTSvtkLIEQAKKWGHPAIAVTDHA-----VVQS  153
ident          | |                            |                  |
Sbjct ilCPGFIDQHVHlIGGGGeagptTRTPEV---ALSRLTEAGVTSVVGLLGTdsisrHPES  115
DSSP  eeEELEEEEEELlLLLLLlllhhHLLLLL---LHHHHHHLLEEEEEELLLLlllllLHHH


DSSP  -HHHHHHHHHhHLLLEEEEE-EEEEEllleeeeeeellhhhhhhhhhhhhhhhlllllLL
Query -FPEAYSAAKkHGMKVIYGL-EANIVddpfhvtllaqnetglknlfklvslshiqyfhRV  211
ident             |                                               
Sbjct lLAKTRALNE-EGISAWMLTgAYHVP-----srtitgsvekdvaiidrvigvxcaisdHR  169
DSSP  hHHHHHHHHH-HLLEEEEEEeLLLLL-----lllllllhhhhhhhllleeeeeeeellLL


DSSP  LL----eEHHHHHHLLL---------LEEE---------------------------ELL
Query PR----iPRSVLVKHRD---------GLLV---------------------------GSG  231
ident                           |  |                              
Sbjct SAapdvyHLANMAAESRvggllggkpGVTVfhmgdskkalqpiydllencdvpisklLPT  229
DSSP  LLlllhhHHHHHHHHHHhhhhhhlllLEEEeeelllllllhhhhhhhhlllllhhheEEE


DSSP  LL--lllLLLL----lLLLHhhllLEEELLhhHHLLlllllhhhhHHHHHHHH-HHHHhl
Query CD--kgeLFDN----vEDIArfydFLEVHPpdVYKPlyvkdeemiKNIIRSIV-ALGEkl  284
ident        ||                          |            |   | |     
Sbjct HVnrnvpLFEQalefaRKGG----TIDITS-sIDEP------vapAEGIARAVqAGIP--  276
DSSP  LHhhlhhHHHHhhhhhHLLL----LEEEEL-lLLLL------llhHHHHHHHHhLLLL--


DSSP  llLEEELLLLLlllhhhhhhhhhhhhllHHHLLlLLLLLllLLLLLHHHHHHHHH---HH
Query diPVVATGNVHylnpedkiyrkilihsqGGANPlNRHELpdVYFRTTNEMLDCFS---FL  341
ident    |                                |      | |  |           
Sbjct laRVTLSSDGN-----------gsqpffDDEGN-LTHIG-vAGFETLLETVQVLVkdyDF  323
DSSP  hhHEEEELLLL-----------leeeeeLLLLL-EEEEE-eLLLHHHHHHHHHHHhhhLL


DSSP  HHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllh
Query GPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpk  401
ident     |             |                                         
Sbjct SISDALRPLTSSVAGFLNL-----------------------------------------  342
DSSP  LHHHHHHHHLHHHHHHLLL-----------------------------------------


DSSP  hhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlllllll
Query lveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevn  461
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  lllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhlllllll
Query plpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkv  521
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  lleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhh
Query pdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrga  581
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhl
Query eidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsih  641
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhlllll
Query dnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvg  701
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhlll
Query tigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevig  761
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhlllll
Query crddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymf  821
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhl
Query pkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinak  881
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  hhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllh
Query giqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgt  941
ident                                                             
Sbjct ------------------------------------------------------------  342
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query nvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                      
Sbjct -----tgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  -----llllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 40: Query=3f2bA Sbjct=2ob3A Z-score=7.6

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
ident                                                      | |   |
Sbjct ---------------------------------drintvrgpitiseaGFTLTHEHICGS   27
DSSP  ---------------------------------lleeelleeelhhhhLLEEEEELLEEL


DSSP  L--------------llllllhHHHHHHHHHLLLLLEEELLL-LLLLLHHHHHHHHHHHL
Query Q--------------mdavtsvTKLIEQAKKWGHPAIAVTDH-AVVQSFPEAYSAAKKHG  165
ident                             |   |   |                       
Sbjct SagflrawpeffgsrkalaekaVRGLRRARAAGVRTIVDVSTfDIGRDVSLLAEVSRAAD   87
DSSP  LllhhhhlhhhhllhhhhhhhhHHHHHHHHHLLLLEEEELLLhHHLLLHHHHHHHHHHHL


DSSP  LLEEEEE----------------------------------------EEEEEllleeeee
Query MKVIYGL----------------------------------------EANIVddpfhvtl  185
ident                                                             
Sbjct VHIVAATglwfdpplsmrlrsveeltqfflreiqygiedtgiragiiXVATT--------  139
DSSP  LEEELEEellllllhhhhlllhhhhhhhhhhhhhllllllllllleeEEELL--------


DSSP  eellhhhhhhhhhhhhhhhLLLLllllleEHHHHHHLL--LLEEE---------------
Query laqnetglknlfklvslshIQYFhrvpriPRSVLVKHR--DGLLV---------------  228
ident                                          |  |               
Sbjct ----------------gkaTPFQ----elVLKAAARASlaTGVPVtthtaasqrdgeqqa  179
DSSP  ----------------lllLHHH----hhHHHHHHHHHhhHLLLEeeellhhhlhhhhhh


DSSP  -------------ELLLLllllLLLL---LLLHHHLLLEEELlhhHHLL-----------
Query -------------GSGCDkgelFDNV---EDIARFYDFLEVHppdVYKP-----------  261
ident                |       |        |             |             
Sbjct aifeseglspsrvCIGHS--ddTDDLsylTALAARGYLIGLD-hiPYSAiglednasasa  236
DSSP  hhhhhllllhhheEELLH--hhLLLHhhhHHHHHLLLEEEEL-llLLLLllllllhhhhh


DSSP  --LLLLlhHHHHHHHHHHHHHHHhllLLEEELLLLLL-llhhhhHHHHhhhhllhhhlll
Query --LYVKdeEMIKNIIRSIVALGEkldIPVVATGNVHY-lnpedkIYRKilihsqgganpl  318
ident               |      |                                      
Sbjct llGIRS-wQTRALLIKALIDQGY--mKQILVSNDWTFgfssyvtNIMD------------  281
DSSP  hhLLLL-hHHHHHHHHHHHHLLL--hHHEEELLLLLLeelllllLHHH------------


DSSP  lllLLLLlLLLL-HHHHHHHHH--HHHHHHHHHHHLHHHHHHHHLlllllllllllllll
Query nrhELPDvYFRT-TNEMLDCFS--FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpr  375
ident                             |    | | |     |                
Sbjct vmdRVNPdGMAFiPLRVIPFLRekGVPQETLAGITVTNPARFLSP---------------  326
DSSP  hhhHHLLlHHHHhHHLHHHHHHhlLLLHHHHHHHHLHHHHHHHLL---------------


DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh
Query iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll
Query dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee
Query rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh
Query gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll
Query ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl
Query dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh
Query hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl
Query efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll
Query aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh
Query rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllllllll
Query lesrgcldslpdhnqlslf  994
ident                    
Sbjct ----------------tlr  329
DSSP  ----------------lll


No 41: Query=3f2bA Sbjct=3cjpA Z-score=7.6

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPms  120
ident                                                      | |    
Sbjct ------------------------------------------------LIIDGHTHVI--   10
DSSP  ------------------------------------------------LLEEEEEELL--


DSSP  lllllLLHHHHHHHHHHLLLLLEEELLL--------------------------------
Query qmdavTSVTKLIEQAKKWGHPAIAVTDH--------------------------------  148
ident        | | |      |                                         
Sbjct -----LPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngktnsmi   65
DSSP  -----LLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllllllh


DSSP  ----lLLLLHHHHHHHHHhhlLLEEEE----------------------------EEEEE
Query ----aVVQSFPEAYSAAKkhgMKVIYG----------------------------LEANI  176
ident                |                                        |   
Sbjct dvrrnSIKELTNVIQAYP---SRYVGFgnvpvglsendtnsyieenivnnklvgiGELTP  122
DSSP  hhhhhHHHHHHHHHHHLL---LLEEEEelllllllhhhhhhhhhhhllllllleeEEELL


DSSP  ----ELLLeeeeeeellhhhhhhhhhhhhhhhllllllllleeHHHHHHLL--LLEE---
Query ----VDDPfhvtllaqnetglknlfklvslshiqyfhrvpripRSVLVKHR--DGLL---  227
ident                                                        |    
Sbjct asgqIKSL-----------------------------------KPIFKYSMdsGSLPiwi  147
DSSP  llllHHHH-----------------------------------HHHHHHHHhlLLLLeee


DSSP  -------------------------EELLLllllLLLL---lLLLH--HHLLLEEELLHH
Query -------------------------VGSGCdkgeLFDN---vEDIA--RFYDFLEVHPPD  257
ident                          |  |        |       |       |      
Sbjct hafnplvlqdikeiaelckafpkvpVILGH---mGGSNwmtaVELAkeIQNLYLDTSAYF  204
DSSP  lllllllhhhhhhhhhhhhhlllllEEEHH---hHHHHhhhhHHHHhhLLLEEEELLLLL


DSSP  hhlllllllhhhHHHHHHHHHHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhll
Query vykplyvkdeemIKNIIRSIVALGEkldIPVVATGNVHylnpedkiyrkilihsqgganp  317
ident                                                             
Sbjct ------------STFVLKIVINELP---LKCIFGTDMP----------------------  227
DSSP  ------------LHHHHHHHHHHLL---LLEELLLLLL----------------------


DSSP  llllllllLLLLL--HHHHHHHHhhHHHHHHHHHHLHHHHHHHHLlllllllllllllll
Query lnrhelpdVYFRT--TNEMLDCFsfLGPEKAKEIVVDNTQKIASLigdvkpikdelytpr  375
ident                               |     ||                      
Sbjct --------FGDLQlsIEAIKKMS--NDSYVANAVLGDNISRLLNI---------------  262
DSSP  --------LLLHHhhHHHHHHHL--LLHHHHHHHHLHHHHHHHLL---------------


DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh
Query iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll
Query dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee
Query rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh
Query gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll
Query ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl
Query dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh
Query hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl
Query efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll
Query aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh
Query rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllllllll
Query lesrgcldslpdhnqlslf  994
ident                    
Sbjct -------------------  262
DSSP  -------------------


No 42: Query=3f2bA Sbjct=3e74A Z-score=7.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------sfdlii    6
DSSP  ------------------------------------------------------leeeee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEElllllllllLLLLLLLLLLLLLlll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIaanerqdtaPEGEKRVELHLHTpms  120
ident                                                   |  | |    
Sbjct kngtvilenearvvdiavkggkiaaigqdlgDAKE--vxdasglVVSPGXVDAHTHI---   61
DSSP  elleeelllleeeleeeeelleeeeeellllLEEE--eeellllEEEELEEEEEELL---


DSSP  llllllLHHHHHHHHHHLLLLLEEELLL----LLLL------lhhHHHHHHhhhLLLEEE
Query qmdavtSVTKLIEQAKKWGHPAIAVTDH----AVVQ------sfpEAYSAAkkhGMKVIY  170
ident               | | |             | |           |             
Sbjct ------GYETGTRAAAKGGITTXIEXPLnqlpATVDrasielkfdAAKGKL---TIDAAQ  112
DSSP  ------LHHHHHHHHHHLLEEEEEELLLllllLLLLhhhhhhhhhHHLLLL---LLEEEE


DSSP  EE---------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhlllll
Query GL---------------------EANIvddpfhvtllaqnetglknlfklvslshiqyfh  209
ident                                                             
Sbjct LGglvsynidrlheldevgvvgfXCFV---------------------------------  139
DSSP  LEellllllllhhhhhhhlllleEEEL---------------------------------


DSSP  llLLEE---HHHHHHLL--LLEE-------------------------------------
Query rvPRIP---RSVLVKHR--DGLL-------------------------------------  227
ident                     |                                       
Sbjct --RDVNdwqFFKGAQKLgeLGQPvlvhcenalicdelgeeakregrvtahdyvasrpvft  197
DSSP  --LLLLhhhHHHHHHHHhhHLLLeeeelllhhhhhhhhhhhhhhllllhhhhhhlllhhh


DSSP  ------------------EELLLL-lllLLLL-LLLL--hHHLLlEEELLHH--------
Query ------------------VGSGCD-kgeLFDN-VEDI--aRFYDfLEVHPPD--------  257
ident                                               |  |          
Sbjct eveairrvlylakvagcrLHVCHVsspeGVEEvTRARqegQDIT-CESCPHYfvldtdqf  256
DSSP  hhhhhhhhhhhhhhhlllEEELLLllhhHHHHhHHHHhllLLEE-EEELLHHhhllhhhh


DSSP  ---------hHLLLlllLHHHHHHHHHHHHHHHhhllllEEELLLLLLllhhhhhHHHHH
Query ---------vYKPLyvkDEEMIKNIIRSIVALGekldipVVATGNVHYlnpedkiYRKIL  308
ident                  | |  |                                     
Sbjct eeigtlakcsPPIR---DLENQKGXWEKLFNGE-----iDCLVSDHSP-------CPPEX  301
DSSP  hhhlhhhlllLLLL---LHHHHHHHHHHHHLLL-----lLEELLLLLL-------LLLLL


DSSP  HHllhhhlLLLLLLLLLLLL-LLHHHHHHHHH---HHHHHHHHHHHLHHHHHHHHL----
Query IHsqgganPLNRHELPDVYF-RTTNEMLDCFS---FLGPEKAKEIVVDNTQKIASL----  360
ident                             |                   |   |  |    
Sbjct KA-----gNIXKAWGGIAGLqSCXDVXFDEAVqkrGXSLPXFGKLXATNAADIFGLqqkg  356
DSSP  LL-----lLLLLLLLLLLLHhHHHHHHHHHHLlllLLLHHHHHHHHLHHHHHHLLLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  360
ident                                                             
Sbjct riapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqg  416
DSSP  llllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellll


DSSP  ---------LLLLllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhh
Query ---------IGDVkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekel  411
ident          |                                                  
Sbjct fpvapkgqfILKH-----------------------------------------------  429
DSSP  lllllllleELLL-----------------------------------------------


DSSP  hhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelll
Query ksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpn  471
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  llleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeell
Query ckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsge  531
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhl
Query yqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagct  591
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  lleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeee
Query gvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilg  651
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  ehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllh
Query hddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtr  711
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhh
Query fvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyli  771
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  hllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhh
Query yrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvl  831
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhh
Query mavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakeks  891
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhh
Query lltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrar  951
ident                                                             
Sbjct ------------------------------------------------------------  429
DSSP  ------------------------------------------------------------


DSSP  hllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query eegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                            
Sbjct -------------------------------------------  429
DSSP  -------------------------------------------


No 43: Query=3f2bA Sbjct=4ofcA Z-score=7.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLL-
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPM-  119
ident                                                      | |    
Sbjct ------------------------------------------------MKIDIHSHILPk   12
DSSP  ------------------------------------------------LLEEEEEELLLl


DSSP  -----------------------------------lllllLLLHHHHHHHHHHLLLLLEE
Query -----------------------------------sqmdaVTSVTKLIEQAKKWGHPAIA  144
ident                                                |      |    |
Sbjct ewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRIREMDQKGVTVQA   72
DSSP  llllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHHHHHHHHLLLEEE


DSSP  ELLLL------------------LLLLH-HHHHHHHhhhlLLEEEE--------------
Query VTDHA------------------VVQSF-PEAYSAAkkhgMKVIYG--------------  171
ident                                  |                          
Sbjct LSTVPvmfsywakpedtlnlcqlLNNDLaSTVVSYP----RRFVGLgtlpmqapelavke  128
DSSP  EELLHhhhlllllhhhhhhhhhhHHHHHhHHHHHLL----LLEEEEellllllhhhhhhh


DSSP  ------------EEEE------EELLleeeeeeellhhhhhhhhhhhhhhhlllllllll
Query ------------LEAN------IVDDpfhvtllaqnetglknlfklvslshiqyfhrvpr  213
ident                                                             
Sbjct mercvkelgfpgVQIGthvnewDLNA----------------------------------  154
DSSP  hhhhhhllllleEEEEleelleELLL----------------------------------


DSSP  eeHHHHHHLL--LLEE--------------------------------------------
Query ipRSVLVKHR--DGLL--------------------------------------------  227
ident                                                             
Sbjct qeLFPVYAAAerLKCSlfvhpwdmqmdgrmakywlpwlvgmpaettiaicsmimggvfek  214
DSSP  hhHHHHHHHHhhHLLEeeeelllllllhhhhlllhhhhlhhhhhhhhhhhhhhlllhhhh


DSSP  -----EELLLllllLLLL-------------------------LLLLHHHLlLEEELLHH
Query -----VGSGCdkgeLFDN-------------------------VEDIARFYdFLEVHPPD  257
ident      |                                                     |
Sbjct fpklkVCFAH---gGGAFpftvgrishgfsmrpdlcaqdnpmnPKKYLGSF-YTDALVHD  270
DSSP  lllllEEELH---hHLLHhhhhhhhhhhhhhlhhhhlllllllHHHHLLLL-EEELLLLL


DSSP  hhlllllllhhhhHHHHHHHHHHHHhllLLEEELLLLLLllhhhhhhhhhhhhllhhhll
Query vykplyvkdeemiKNIIRSIVALGEkldIPVVATGNVHYlnpedkiyrkilihsqgganp  317
ident                               |                             
Sbjct -------------PLSLKLLTDVIG--kDKVILGTDYPF---------------------  294
DSSP  -------------HHHHHHHHHHHL--lLLEELLLLLLL---------------------


DSSP  llllllLLLLLLLHhHHHHHHHHHHHHHHHHHHLHHHHHHHHLlllllllllllllllll
Query lnrhelPDVYFRTTnEMLDCFSFLGPEKAKEIVVDNTQKIASLigdvkpikdelytprie  377
ident       |                   |        |      |                 
Sbjct ------PLGELEPG-KLIESMEEFDEETKNKLKAGNALAFLGL-----------------  330
DSSP  ------LLLLLLLL-HHHHHLLLLLHHHHHHHHLHHHHHHHLL-----------------


DSSP  lhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhll
Query gadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddg  437
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  llleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllll
Query ylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprc  497
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  lllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeee
Query gtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigt  557
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhll
Query vadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydft  617
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  leelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllh
Query piqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddp  677
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlll
Query dvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshg  737
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhh
Query tdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpef  797
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhlll
Query eaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvrae  857
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllll
Query dfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrs  917
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  llllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhh
Query qatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleyle  977
ident                                                             
Sbjct ------------------------------------------------------------  330
DSSP  ------------------------------------------------------------


DSSP  hllllllllllllllll
Query srgcldslpdhnqlslf  994
ident                  
Sbjct ------------erkqf  335
DSSP  ------------lhhhl


No 44: Query=3f2bA Sbjct=2vc5A Z-score=7.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLlLL
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTpMS  120
ident                                                      | |    
Sbjct --------------------------------mriplvgkdsieskdiGFTLIHEHL-RV   27
DSSP  --------------------------------llllllllllllhhhlLLEELLLLL-LL


DSSP  LL--------------llllLHHHHHHHHHHLLLLLEEELLL--LLLLlHHHHHHHHHHH
Query QM--------------davtSVTKLIEQAKKWGHPAIAVTDH--AVVQsFPEAYSAAKKH  164
ident                             |   |   |                    |  
Sbjct FSeavrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTVmgLGRD-IRFMEKVVKAT   86
DSSP  LLhhhhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLLllLLLL-HHHHHHHHHLL


DSSP  LLLEEEE------------------------------------------eEEEEelllee
Query GMKVIYG------------------------------------------lEANIvddpfh  182
ident |     |                                                     
Sbjct GINLVAGtgiyiyidlpfyflnrsideiadlfihdikegiqgtlnkagfvXIAA------  140
DSSP  LLEEEELeellllllllhhhllllhhhhhhhhhhhhhlllllllllllleEEEL------


DSSP  eeeeellhhhhhhhhhhhhhhhLLLLllllleEHHHHHHLL---LLEEE-----------
Query vtllaqnetglknlfklvslshIQYFhrvpriPRSVLVKHR---DGLLV-----------  228
ident                                                             
Sbjct -----------------depgiTKDV----ekVIRAAAIANketKVPIIthsnahnntgl  179
DSSP  -----------------lllllLHHH----hhHHHHHHHHHhhhLLLEEeellllllhhh


DSSP  ----------------ELLLLllllLLLL--LLLHHHLLLEEELlhhHHLLlllllhHHH
Query ----------------GSGCDkgelFDNV--EDIARFYDFLEVHppdVYKPlyvkdeEMI  270
ident                   |              ||    |                    
Sbjct eqqrilteegvdpgkiLIGHL-gdtDNIDyiKKIADKGSFIGLDrygLDLF---lpvDKR  235
DSSP  hhhhhhhhllllhhheEELLH-hhlLLHHhhHHHHHLLLEEEELlllLLLL---llhHHH


DSSP  HHHHHHHHHHHHhllLLEEELLLLLLllhhhhHHHHHhhhllhhhlllllLLLL-LLLLL
Query KNIIRSIVALGEkldIPVVATGNVHYlnpedkIYRKIlihsqgganplnrHELP-DVYFR  329
ident           |                                         |       
Sbjct NETTLRLIKDGY--sDKIMISHDYCCtidwgtAKPEY------------kPKLApRWSIT  281
DSSP  HHHHHHHHHLLL--lLLEEELLLLLLllllllLLHHH------------hHHHLlLLLLL


DSSP  -LHHHHHHHHHHHHHHhhHHHHLHHHHHHHHLLlllllllllllllllllhhhhhhhhhh
Query -TTNEMLDCFSFLGPEkaKEIVVDNTQKIASLIgdvkpikdelytpriegadeeiremsy  388
ident              |     |                                        
Sbjct lIFEDTIPFLKRNGVN--EEVIATIFKENPKKF---------------------------  312
DSSP  hHHHLHHHHHHLLLLL--HHHHHHHHLHHHHHH---------------------------


DSSP  hhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhh
Query rrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgs  448
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  lhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellll
Query sfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdi  508
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  llhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhh
Query pfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvk  568
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllll
Query ayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtss  628
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  llleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhh
Query ewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsstep  688
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  hlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhh
Query lgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqel  748
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  hhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllh
Query iqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpe  808
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlh
Query wyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgs  868
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelle
Query aairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgns  928
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  eellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllll
Query lippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdh  988
ident                                                             
Sbjct ------------------------------------------------------------  312
DSSP  ------------------------------------------------------------


DSSP  llllll
Query nqlslf  994
ident       
Sbjct ----fs  314
DSSP  ----ll


No 45: Query=3f2bA Sbjct=4rdvB Z-score=7.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -----------------------------------------------------------s    1
DSSP  -----------------------------------------------------------l


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllLLLLLLLLLLLLL--
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapEGEKRVELHLHTP--  118
ident                                                     || |    
Sbjct aifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggaVLPGMPNLHSHAFqr   61
DSSP  eeeeeeeeelleeeeeeeeeellllleeeeelllllllleellllEEELEEEEEELHHhh


DSSP  -----------------------------llllllllLHHHHHHHHHHLLLLLEEELLLL
Query -----------------------------msqmdavtSVTKLIEQAKKWGHPAIAVTDHA  149
ident                                          |     | |  | |     
Sbjct amaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYTAVAEFHYV  121
DSSP  hhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEEEEEEEELL


DSSP  L-----------llLHHHHHHHHHHHLLLEEEEEEEEeellleeeeeeellhhhhhhhhh
Query V-----------vqSFPEAYSAAKKHGMKVIYGLEANivddpfhvtllaqnetglknlfk  198
ident                      ||   |                                 
Sbjct HhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLY-----------------------  158
DSSP  LllllllllllllhHHHHHHHHHHHHLLEEEEEELLL-----------------------


DSSP  hhhHHHL-LLLLLL--------------------------------------lLEEHHHH
Query lvsLSHI-QYFHRV--------------------------------------pRIPRSVL  219
ident                                                             
Sbjct ---SHAGfGGQPASegqrrfingseaylellqrlrapleaaghslglcfhslrAVTPQQI  215
DSSP  ---LEEElLLEELLhhhllllllhhhhhhhhhhhhhhhhhhlleeleeellllLLLHHHH


DSSP  HHLL----LLEEE------------------------------------ELLLLllllLL
Query VKHR----DGLLV------------------------------------GSGCDkgelFD  239
ident         | | |                                               
Sbjct ATVLaaghDDLPVhihiaeqqkevddcqawsgrrplqwlyenvavdqrwCLVHA---tHA  272
DSSP  HHHHllllLLLLEeeeelllhhhhhhhhhhhlllhhhhhhhhlllllleEEEEL---lLL


DSSP  LL--LLLH-HHLLLEEELL--HHHHLLlllllhhhHHHHHHHHHHHHhhllLLEEELLLL
Query NV--EDIA-RFYDFLEVHP--PDVYKPlyvkdeemIKNIIRSIVALGekldIPVVATGNV  294
ident          |                                  | |             
Sbjct DPaeVAAMaRSGAVAGLCLstEANLGD--------GIFPATDFLAQG----GRLGIGSDS  320
DSSP  LHhhHHHHhHHLLEEEELHhhHHHLLL--------LLLLHHHHHHLL----LEEEELLLL


DSSP  llllhhhhhhhhhhhhllhhhllllllllllLLLLLHHHHHHHHHH--------------
Query hylnpedkiyrkilihsqgganplnrhelpdVYFRTTNEMLDCFSF--------------  340
ident                                       | |                   
Sbjct -------------------------------HVSLSVVEELRWLEYgqrlrdrkrnrlyr  349
DSSP  -------------------------------LLLLLHHHHHHHHHHhhhhhhllllllll


DSSP  ----hHHHHHHHHHLHHHHHHHHLLlllllllllllllllllhhhhhhhhhhhhhhhhhl
Query ----lGPEKAKEIVVDNTQKIASLIgdvkpikdelytpriegadeeiremsyrrakeiyg  396
ident                                                             
Sbjct ddqpmIGRTLYDAALAGGAQALGQP-----------------------------------  374
DSSP  lllllHHHHHHHHHHHHHHHHHLLL-----------------------------------


DSSP  llllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhll
Query dplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmte  456
ident                                                             
Sbjct ------------------------------------------------------------  374
DSSP  ------------------------------------------------------------


DSSP  llllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhll
Query itevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgf  516
ident                                                             
Sbjct ---------------------------------------------------------igs  377
DSSP  ---------------------------------------------------------lll


DSSP  llllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhlll
Query kgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnl  576
ident                                                             
Sbjct lavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhagee  437
DSSP  lllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhh


DSSP  lllhhhhhhHHHHHllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeee
Query elrgaeidrLAAGCtgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfd  636
ident          |                                                  
Sbjct rsarafvqvLGELL----------------------------------------------  451
DSSP  hhhhhhhhhHHHHL----------------------------------------------


DSSP  hhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhh
Query fhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqi  696
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  llllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllh
Query mcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctl  756
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhh
Query sevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckk  816
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhh
Query ikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrie  876
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhl
Query einakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnai  936
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query pglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                           
Sbjct ----------------------------------------------------------  451
DSSP  ----------------------------------------------------------


No 46: Query=3f2bA Sbjct=3irsA Z-score=7.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLL--
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTP--  118
ident                                                 |     |  |  
Sbjct -----------------------------------------------LKIIDFRLRPPam   13
DSSP  -----------------------------------------------LLLEELLLLLLlh


DSSP  LLLLL------------------------llLLHHHHHHHHHHLLLLLEEELLLL-----
Query MSQMD------------------------avTSVTKLIEQAKKWGHPAIAVTDHA-----  149
ident                                 |     |     |               
Sbjct GFLNAriytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGRNssvlg   73
DSSP  HHHHLhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELLEellle


DSSP  ---LLLLHHHHHhhhhhhllLEEEEE-------------------------EEEEEllle
Query ---VVQSFPEAYsaakkhgmKVIYGL-------------------------EANIVddpf  181
ident           |         |                                       
Sbjct svsNADVAAVAK----aypdKFHPVGsieaatrkeamaqmqeildlgirivNLEPG----  125
DSSP  ellHHHHHHHHH----hlllLEEEEEelllllhhhhhhhhhhhhhllllleEELHH----


DSSP  eeeeeellhhhhhhhhhhhhhhhlllLLLL---lleEHHHHHHLL-LLEEE---------
Query hvtllaqnetglknlfklvslshiqyFHRV---priPRSVLVKHR-DGLLV---------  228
ident                                                |  |         
Sbjct ------------------------vwATPMhvddrrLYPLYAFCEdNGIPVimmtggnag  161
DSSP  ------------------------hlLLLLllllhhHHHHHHHHHhLLLLEeeellllll


DSSP  -----------------------ELLLllllLLLL---LLLLH--HHLLLEEEL-LHHHH
Query -----------------------GSGCdkgeLFDN---VEDIA--RFYDFLEVH-PPDVY  259
ident                         |                 |  |    |         
Sbjct pditytnpehidrvlgdfpdltvVSSH---gNWPWvqeIIHVAfrRPNLYLSPDmYLYNL  218
DSSP  llhhhhlhhhhhhhhhhllllleEEEH---hHLLLhhhHHHHHhhLLLEEEELHhHHLLL


DSSP  lllllllhhHHHHHHHHHH-HHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhlll
Query kplyvkdeeMIKNIIRSIV-ALGEkldIPVVATGNVHylnpedkiyrkilihsqgganpl  318
ident                                                             
Sbjct ---------PGHADFIQAAnSFLA---DRMLFGTAYP-----------------------  243
DSSP  ---------LLHHHHHHHHlLHHH---HLLLLLLLLL-----------------------


DSSP  lllllllLLLL--LHHHHHHhhHHHHHHHHHHHHLHHHHHHHHLLlllllllllllllll
Query nrhelpdVYFR--TTNEMLDcfSFLGPEKAKEIVVDNTQKIASLIgdvkpikdelytpri  376
ident               |   |       |     |   |                       
Sbjct -------MCPLkeYTEWFLT--LPIKPDAMEKILHGNAERLLAQA---------------  279
DSSP  -------LLLHhhHHHHHHL--LLLLHHHHHHHHLHHHHHHHHHL---------------


DSSP  llhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhl
Query egadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksldd  436
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  lllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllll
Query gylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncpr  496
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  llllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeee
Query cgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtig  556
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  ellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhl
Query tvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydf  616
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  lleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllll
Query tpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptdd  676
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhll
Query pdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglsh  736
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  llllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhh
Query gtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpe  796
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhll
Query feaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvra  856
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllll
Query edfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyr  916
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  lllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhh
Query sqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleyl  976
ident                                                             
Sbjct ------------------------------------------------------------  279
DSSP  ------------------------------------------------------------


DSSP  hhllllllllllllllll
Query esrgcldslpdhnqlslf  994
ident                   
Sbjct ----------------gr  281
DSSP  ----------------ll


No 47: Query=3f2bA Sbjct=3pnuA Z-score=7.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllLLLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtaPEGEKRVELHLHTPms  120
ident                                                      |||    
Sbjct -----------------------------------enlyfqsnaMKLKNPLDMHLHLR--   23
DSSP  -----------------------------------lllllllllEEEELLEEEEELLL--


DSSP  llllllLHHHHHHHHHHLlLLLEEELLL---------lllLLHHHHHHHHHHHLLLEEEE
Query qmdavtSVTKLIEQAKKWgHPAIAVTDH---------avvQSFPEAYSAAKKHGMKVIYG  171
ident                      |                          | |         
Sbjct ---dnqMLELIAPLSARD-FCAAVIMPNlipplcnledlkAYKMRILKACKDENFTPLMT   79
DSSP  ---lhhHHHHHHHHHHLL-LLEEEELLLlllllllhhhhhHHHHHHHHHHLLLLLEEEEE


DSSP  E--------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhllllllL
Query L--------------------EANIvddpfhvtllaqnetglknlfklvslshiqyfhrV  211
ident |                                                           
Sbjct LffknydekflysakdeifgiXLYP---------------------------agittnsN  112
DSSP  EelllllhhhhhhhllllleeEELL---------------------------lllllllL


DSSP  LLEE------hHHHHHLL--LLEEE---------------------------------EL
Query PRIP------rSVLVKHR--DGLLV---------------------------------GS  230
ident                                                             
Sbjct GGVSsfdieylKPTLEAMsdLNIPLlvhgetndfvmdresnfakiyeklakhfprlkiVM  172
DSSP  LLLLlllhhhhHHHHHHHhhLLLLEeelllllllhhhllhhhhhhhhhhhhhllllleEE


DSSP  LLL-lllLLLLLLLlHHHLlLEEELLHHhHLLLL---------------llLHHHHHHHH
Query GCD-kgeLFDNVEDiARFYdFLEVHPPDvYKPLY---------------vkDEEMIKNII  274
ident        |     |                  |                       |   
Sbjct EHIttktLCELLKD-YENL-YATITLHHlIITLDdviggkmnphlfckpiaKRYEDKEAL  230
DSSP  LLLllhhHHHHHHH-LLLE-EEEELLHHhLLLHHhhhlllllhhhllllllLLHHHHHHH


DSSP  HHHHhhhhhllLLEEELLLLLLllhhhHHHHHhhhhllhhhlllllllLLLLLL--LLHH
Query RSIValgekldIPVVATGNVHYlnpedKIYRKilihsqgganplnrheLPDVYF--RTTN  332
ident              |                                     |        
Sbjct CELA---fsgyEKVMFGSDSAP-----HPKGC----------------AAGVFSapVILP  266
DSSP  HHHH---hlllLLEEELLLLLL-----LLLLL----------------LLLLLLhhHHHH


DSSP  HHHHHHH-HHHHHHHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhhhhhhhh
Query EMLDCFS-FLGPEKAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeiremsyrra  391
ident      |      |       ||| ||                                  
Sbjct VLAELFKqNSSEENLQKFLSDNTCKI-YDLK-----------------------------  296
DSSP  HHHHHHHhHLLHHHHHHHHLHHHHHH-HLLL-----------------------------


DSSP  hhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhh
Query keiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfv  451
ident                                                             
Sbjct ------------------------------------------------------------  296
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellllllh
Query atmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfe  511
ident                                                             
Sbjct ------------------------------------------------------------  296
DSSP  ------------------------------------------------------------


DSSP  hhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhh
Query tflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkaya  571
ident                                                             
Sbjct -----------------------------------------------------fkedkil  303
DSSP  -----------------------------------------------------lllllee


DSSP  hhllllllhhhhhhhHHHHllleeeeeeeeeeeeellllllhhhllleelhhhlllllll
Query sdhnlelrgaeidrlAAGCtgvkrttgqhpggiivvpdymeiydftpiqypaddtssewr  631
ident                                                             
Sbjct tleekewqvpnvyedKYNQ-----------------------------------------  322
DSSP  eeellleelllleelLLLE-----------------------------------------


DSSP  eeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhll
Query tthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgv  691
ident                                                             
Sbjct ------------------------------------------------------------  322
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhl
Query tpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqn  751
ident                                                             
Sbjct ------------------------------------------------------------  322
DSSP  ------------------------------------------------------------


DSSP  llllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhh
Query gtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyi  811
ident                                                             
Sbjct ------------------------------------------------------------  322
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhh
Query dsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaai  871
ident                                                             
Sbjct ------------------------------------------------------------  322
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeel
Query rkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslip  931
ident                                                             
Sbjct ------------------------------------------------------------  322
DSSP  ------------------------------------------------------------


DSSP  lhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllllll
Query pfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnql  991
ident                                                             
Sbjct -----------------------------------------------vvpymageilkfq  335
DSSP  -----------------------------------------------ellllllleelle


DSSP  lll
Query slf  994
ident    
Sbjct lkh  338
DSSP  ell


No 48: Query=3f2bA Sbjct=4dziC Z-score=7.1

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllLLLLllLLLLLLLLLLL-
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdTAPEgeKRVELHLHTPM-  119
ident                                                        |    
Sbjct ------------------------------------------ALNY--RVIDVDNHYYEp   16
DSSP  ------------------------------------------LLLL--LEEEEEEELLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  119
ident                                                             
Sbjct ldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgei   76
DSSP  lllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhhhhlll


DSSP  --------------llllllLLHH-HHHHHHHHLLLLLEEELLLLL--------------
Query --------------sqmdavTSVT-KLIEQAKKWGHPAIAVTDHAV--------------  150
ident                            |                                
Sbjct pdgvdpaslmkverladhpeYQNRdARIAVMDEQDIETAFMLPTFGcgveealkhdieat  136
DSSP  lllllhhhllleelhhhlhhHLLHhHHHHHHHHHLEEEEEEELLHHhhhhhhllllhhhh


DSSP  --------lLLHHHHHhhhhhHLLLEEEE-------------------------EEEEEE
Query --------vQSFPEAYsaakkHGMKVIYG-------------------------LEANIV  177
ident                           |                                 
Sbjct masvhafnlWLDEDWG--fdrPDHRIIAApivsladptraveevdfvlargaklVLVRPA  194
DSSP  hhhhhhhhhHHHHHLL--lllLLLLEEELlllllllhhhhhhhhhhhhhlllllEELLLL


DSSP  LlleeeeeeellhhhhhhhhhhhhhhhllLLLLllleEHHH-----hHHLL--LLEE---
Query DdpfhvtllaqnetglknlfklvslshiqYFHRvpriPRSV-----lVKHR--DGLL---  227
ident                                                       |     
Sbjct P----------------------------VPGLvkprSLGDrshdpvWARLaeAGVPvgf  226
DSSP  L----------------------------LLLLllllLLLLhhhhhhHHHHhhHLLLeee


DSSP  ---------------------------------------------------EELLLLlll
Query ---------------------------------------------------VGSGCDkge  236
ident                                                      |      
Sbjct hlsdsgylhiaaawggakdpldqvllddraihdtmasmivhgvftrhpklkAVSIENgsy  286
DSSP  ellllllhhhhhhllllllhhhhhhhllhhhhhhhhhhhhllhhhhlllllEEEELLlll


DSSP  LLLLL-------------------LLLHHHLLLEEELLHhhhlllllllhhhhhhHHHHH
Query LFDNV-------------------EDIARFYDFLEVHPPdvykplyvkdeemiknIIRSI  277
ident                             |                               
Sbjct FVHRLikrlkkaantqpqyfpedpVEQLRNNVWIAPYYE---------------dDLPEL  331
DSSP  HHHHHhhhhhhhhhhlhhhllllhHHHHHHHEEELLLLL---------------lLHHHH


DSSP  HHHHHhllLLEEELLLLLLllhhhhhhhhhhhhllhhhlllllllllLLLLLLHhHHHHH
Query VALGEkldIPVVATGNVHYlnpedkiyrkilihsqgganplnrhelpDVYFRTTnEMLDC  337
ident                                                             
Sbjct ARVIG--vDKILFGSDWPH---------------------------gEGLASPV-SFTAE  361
DSSP  HHHHL--hHHLLLLLLLLL---------------------------lLLLLLHH-HHHHH


DSSP  HHHHHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhll
Query FSFLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygd  397
ident            |  ||                                            
Sbjct LKGFSESDIRKIMRDNALDLLGV-------------------------------------  384
DSSP  HLLLLHHHHHHHHLHHHHHHHLL-------------------------------------


DSSP  lllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlll
Query plpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmtei  457
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  lllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhlll
Query tevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfk  517
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  lllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllll
Query gdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnle  577
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeeh
Query lrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdf  637
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  hhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhl
Query hsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqim  697
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhh
Query cnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctls  757
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  hllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhl
Query evigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckki  817
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhh
Query kymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkriee  877
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  hhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhll
Query inakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaip  937
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query glgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                          
Sbjct -----------------------------------------------------qvgs  388
DSSP  -----------------------------------------------------llll


No 49: Query=3f2bA Sbjct=1a5kC Z-score=6.8

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelLLHHHHHH
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsRDKEDAEL   60
ident                                                          |  
Sbjct ---------------------------------------------------sNISRQAYA    9
DSSP  ---------------------------------------------------lEEEHHHHH


DSSP  HHlllllleeeeeeeeeeelllleeeEEEE-EEEEE------------------------
Query MSgvkkgmwvkvrgsvqndtfvrdlvIIAN-DLNEI------------------------   95
ident                                                             
Sbjct DM-fgptvgdkvrladtelwieveddLTTYgEEVKFgggkvirdgmgqgqmlaadcvdlv   68
DSSP  HH-hlllllleeelllllleeelleeLLLLlLLLLLllllllllllllllllhhhlllee


DSSP  ----------------------------------------------llllllllllLLLL
Query ----------------------------------------------aanerqdtapEGEK  109
ident                                                             
Sbjct ltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaaegkiVTAG  128
DSSP  eeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeelllleEEEL


DSSP  LLLLLLLLllllllllLLHHhHHHHHHHLLLLLEEEL-----------LLLL-----lLL
Query RVELHLHTpmsqmdavTSVTkLIEQAKKWGHPAIAVT-----------DHAV-----vQS  153
ident     | |                | |   |                              
Sbjct GIDTHIHW--------ICPQ-QAEEALVSGVTTMVGGgtgpaagthatTCTPgpwyisRM  179
DSSP  EEEEEEEL--------LLLL-HHHHHHHHLEEEEEEElllllhhhhhlLLLLhhhhhhHH


DSSP  HHHhHHHHhhhLLLEEEE---------------------EEEE----EELLleeeeeeel
Query FPEaYSAAkkhGMKVIYG---------------------LEAN----IVDDpfhvtllaq  188
ident                                        ||                   
Sbjct LQA-ADSL---PVNIGLLgkgnvsqpdalreqvaagvigLEIHedwgATPA---------  226
DSSP  HHH-HLLL---LLEEEEEeelllllhhhhhhhhhhllleEEEEhhhlLLHH---------


DSSP  lhhhhhhhhhhhhhhhllllllllLEEHhhHHHLL--LLEE-------------------
Query netglknlfklvslshiqyfhrvpRIPRsvLVKHR--DGLL-------------------  227
ident                          |                                  
Sbjct ------------------------AIDC--ALTVAdeMDIQvalhsdtlnesgfvedtla  260
DSSP  ------------------------HHHH--HHHHHhhHLLEeeeelllllllllhhhhhh


DSSP  ------EELLL----LLLL---LLLLlllLHHHLlLEEELLHH-----------------
Query ------VGSGC----DKGE---LFDNvedIARFYdFLEVHPPD-----------------  257
ident                  |                       |                  
Sbjct aiggrtIHTFHtegaGGGHapdIITA--cAHPNI-LPSSTNPTlpytlntidehldmlmv  317
DSSP  hhllllEEELLllllLLLLlllHHHH--hHLLLE-EEEEEHHHllllllhhhhhhhhhhh


DSSP  --------------hhlLLLLllhhHHHHHHHHHHHHHHhllllEEELLLLLlllhhhhh
Query --------------vykPLYVkdeeMIKNIIRSIVALGEkldipVVATGNVHylnpedki  303
ident                                     ||                      
Sbjct chhldpdiaedvafaesRIRR----ETIAAEDVLHDLGA----fSLTSSDSQ--------  361
DSSP  hhllllllhhhhhllllLLLH----HHHHHHHHHHHLLL----lLEEELLLL--------


DSSP  hhhhhhhllhhhlllllllllLLLL-LLHHHHHHHHHH-----------------hHHHH
Query yrkilihsqgganplnrhelpDVYF-RTTNEMLDCFSF-----------------lGPEK  345
ident                                                             
Sbjct --------------------aMGRVgEVILRTWQVAHRmkvqrgalaeetgdndnfRVKR  401
DSSP  --------------------lLLLLlLHHHHHHHHHHHhhhhhlllllllllllhhHHHH


DSSP  HHHHHLHHHHHHHHL---------------------------------------------
Query AKEIVVDNTQKIASL---------------------------------------------  360
ident        |                                                    
Sbjct YIAKYTINPALTHGIahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdin  461
DSSP  HHHLLLHHHHHHLLLlllllllllllllleeeelhhhlllllleeeelleeeeeeellll


DSSP  -------------------------lLLLLlllllllllllllhhhhhhhhhhhhhhhhh
Query -------------------------iGDVKpikdelytpriegadeeiremsyrrakeiy  395
ident                                                             
Sbjct asiptpqpvhyrpmfgalgsarhhcrLTFL------------------------------  491
DSSP  llllllllleeeelhhhlhhhhhhhlEEEE------------------------------


DSSP  lllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhl
Query gdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmt  455
ident                                                             
Sbjct ------------------------------------------------------------  491
DSSP  ------------------------------------------------------------


DSSP  lllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhl
Query eitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflg  515
ident                                                             
Sbjct ------------------------------------------------------------  491
DSSP  ------------------------------------------------------------


DSSP  lllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhll
Query fkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhn  575
ident                                                             
Sbjct ------------------------------------------------------------  491
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhllleeeeeeeeeeeeellllllHHHLlleelhhhllllllleeee
Query lelrgaeidrlaagctgvkrttgqhpggiivvpdymeIYDFtpiqypaddtssewrtthf  635
ident                                                             
Sbjct --------------------------------sqaaaANGV-------------------  500
DSSP  --------------------------------lhhhhHHLH-------------------


DSSP  eHHHHllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhh
Query dFHSIhdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeq  695
ident                                                             
Sbjct aERLN-------------------------------------------------------  505
DSSP  hHHLL-------------------------------------------------------


DSSP  hllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllll
Query imcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtct  755
ident                                                             
Sbjct ------------------------------------------------------------  505
DSSP  ------------------------------------------------------------


DSSP  hhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhh
Query lsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsck  815
ident                                                             
Sbjct ------------------------------------------------------------  505
DSSP  ------------------------------------------------------------


DSSP  hllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhh
Query kikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkri  875
ident                                                             
Sbjct ------------------------------------------------------------  505
DSSP  ------------------------------------------------------------


DSSP  hhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhh
Query eeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfna  935
ident                                                             
Sbjct ----------------------------------------------------------lr  507
DSSP  ----------------------------------------------------------ll


DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query ipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                            
Sbjct saiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  leeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 50: Query=3f2bA Sbjct=3ooqA Z-score=6.6

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct -----------------------------------------------------kilfkna    7
DSSP  -----------------------------------------------------leeeeee


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELllllllllllLLLLLLLLLL----
Query msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtapeGEKRVELHLH----  116
ident                                  ||               |  | |    
Sbjct tvfpitsrpfkgdvlvsngkvekvgeniedPDAEIV---dltgkflFPGFVDAHSHiglf   64
DSSP  eellllllleeeeeeeelleeeeeelllllLLLEEE---elllleeEELEEEEEELllll


DSSP  --------lLLLLL--------llllLHHH---hhhhhhhllLLLEEELLL----LLLL-
Query --------tPMSQM--------davtSVTK---lieqakkwgHPAIAVTDH----AVVQ-  152
ident                                                           | 
Sbjct eegvgyyysDGNEAtdpvtphvkaldGFNPqdpaieralaggVTSVXIVPGsanpVGGQg  124
DSSP  lllllhhhlLLLLLlllllllllhhhHLLLllhhhhhhhlllEEEEEELLLllllEEEEe


DSSP  --lhhhhhHHHHhhLLLE--EEEEEEEEellleeeeeeellhhhhhhhhhhhhhhhlLLL
Query --sfpeaySAAKkhGMKV--IYGLEANIvddpfhvtllaqnetglknlfklvslshiQYF  208
ident                          |                                  
Sbjct svikfrsiIVEE--CIVKdpAGLKXAFG-----------------enpkrvygerkqTPS  165
DSSP  eeeellllLHHH--HEEEeeEEEEEELL-----------------hhhhhhhhhlllLLL


DSSP  L-LLLL------------------------------------------------------
Query H-RVPR------------------------------------------------------  213
ident                                                             
Sbjct TrXGTAgvirdyftkvknyxkkkelaqkegkeftetdlkxevgexvlrkkiparxhahra  225
DSSP  LhHHHHhhhhhhhhhhhhhhhhhhhhhhlllllllllhhhhhhhhhhllllleeeeellh


DSSP  ----eeHHHHHHLLLLeeEELLLllLLLLLLLLLLH-HHLLLEEELLHHHHLLLLlllhh
Query ----ipRSVLVKHRDGllVGSGCdkGELFDNVEDIA-RFYDFLEVHPPDVYKPLYvkdee  268
ident                          |                  | |             
Sbjct ddiltaIRIAEEFGFN--LVIEH--GTEAYKISKVLaEKKIPVVVGPLLTFRTKL-elkd  280
DSSP  hhhhhhHHHHHHHLLL--EEEEE--LLLHHHHHHHHhHHLLLEEELLLLLLLLLH-hhll


DSSP  hHHHHHHHHHHHHhhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllllllllLLL
Query mIKNIIRSIVALGekldIPVVATGNVHylnpedkiyrkilihsqgganplnrhelpdVYF  328
ident      |      |                                            |  
Sbjct lTXETIAKLLKDG----VLIALXCDHP------------------------------VIP  306
DSSP  lLLLHHHHHHHLL----LLEEELLLLL------------------------------LLL


DSSP  LLhhHHHHHHHH-----HHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhh
Query RTtnEMLDCFSF-----LGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeei  383
ident                     |    |   |  ||  |                       
Sbjct LE--FATVQAATaxrygAKEEDLLKILTVNPAKILGL-----------------------  341
DSSP  HH--HHHHHHHHhhhhlLLHHHHHHLLLHHHHHHLLL-----------------------


DSSP  hhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleel
Query remsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsr  443
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  hhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllllllee
Query gsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykk  503
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  ellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhh
Query dghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadkta  563
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhh
Query ygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypa  623
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  hllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhll
Query ddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgif  683
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  lllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllllllll
Query ssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlg  743
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhh
Query naqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrk  803
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhh
Query hdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdlda  863
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  hhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllle
Query mikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefv  923
ident                                                             
Sbjct ------------------------------------------------------------  341
DSSP  ------------------------------------------------------------


DSSP  eelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllll
Query idgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcld  983
ident                                                             
Sbjct ----------------------------edrigsiepgkdadlvvwsghpfdxksvverv  373
DSSP  ----------------------------lllllllllllllleeeelllllllllleeee


DSSP  lllllllllll
Query slpdhnqlslf  994
ident            
Sbjct yidgvevfrre  384
DSSP  eelleeeeell


No 51: Query=3f2bA Sbjct=2ogjA Z-score=6.4

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhllllLLEE----------------eeeeeeeeelllleeeeeeEEEEEELllllllll
Query msgvkkGMWV----------------kvrgsvqndtfvrdlviiaNDLNEIAanerqdta  104
ident                                                             
Sbjct ------QAPIlltnvkpvgfgkgasqsstdiliggdgkiaavgsaLQAPADT--qridaa   52
DSSP  ------LLLEeeeeeeellllllllllleeeeellllleeeeellLLLLLLE--eellll


DSSP  LLLLLLLLLLLL--LLLLlLLLLllhhhHHHH-HHHLLLLLEEELLLLL----lLLHHHH
Query PEGEKRVELHLH--TPMSqMDAVtsvtkLIEQ-AKKWGHPAIAVTDHAV----vQSFPEA  157
ident       | || |                         |         |            
Sbjct FISPGWVDLHVHiwHGGT-DISI-----RPSEcGAERGVTTLVDAGSAGeanfhGFREYI  106
DSSP  EEEELEEEEEELllLLLL-LLLL-----LHHHlLHHHLEEEEEEELLLLlllhhHHHHHL


DSSP  HHHHhhhLLLEEEEE-----------------------------------------EEEE
Query YSAAkkhGMKVIYGL-----------------------------------------EANI  176
ident               |                                             
Sbjct IEPS---RERIKAFLnlgsiglvacnrvpelrdikdidldrilecyaensehivglXVRA  163
DSSP  LLLL---LLEEEEEEelllllllllllllllllhhhllhhhhhhhhhllllleeeeEEEE


DSSP  ellleeeeeeellhhhhhhhhhhhhhhhllllllllleeHHHHHHLLLLEE---------
Query vddpfhvtllaqnetglknlfklvslshiqyfhrvpripRSVLVKHRDGLL---------  227
ident                                             |               
Sbjct ------------------------shvitgswgvtpvklGKKIAKILKVPXxvhvgeppa  199
DSSP  ------------------------lhhhhlllllhhhhhHHHHHHHHLLLEeeeelllll


DSSP  ------------EELLLL---------lllllLLLL-lLHHHLlLEEELL-hHHHLllll
Query ------------VGSGCD---------kgelfDNVE-dIARFYdFLEVHP-pDVYKplyv  264
ident                                              |              
Sbjct lydevleilgpgDVVTHCfngksgssixededLFNLaeRCEGI-RLDIGHggASFS----  254
DSSP  lhhhhhhhllllLEEELLllllllllllllhhHHHHhhHLLLL-EEELLLllLLLL----


DSSP  llHHHHHHHH-HHHHhhhhhllllEEELLLLL--LLLHhhhhhhhhhhhllhhhllllll
Query kdEEMIKNII-RSIValgekldipVVATGNVH--YLNPedkiyrkilihsqgganplnrh  321
ident          | |                   |    |                       
Sbjct --FKVAEAAIaRGLL--------pFSISTDLHghSXNF----------------------  282
DSSP  --HHHHHHHHhLLLL--------lLLLLLLLLllLLLL----------------------


DSSP  llllLLLLLHhHHHHHHH--HHHHHHHHHHHLHHHHHHHHLllllllllllllllllllh
Query elpdVYFRTTnEMLDCFS--FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriega  379
ident                         |   | |  |      |                   
Sbjct ----PVWDLA-TTXSKLLsvDXPFENVVEAVTRNPASVIRL-------------------  318
DSSP  ----LLLLHH-HHHHHHHhlLLLHHHHHHLLLHHHHHHLLL-------------------


DSSP  hhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllll
Query deeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgyl  439
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  leelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllll
Query vgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgt  499
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  lleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeell
Query kykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtva  559
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllle
Query dktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpi  619
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  elhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhh
Query qypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdv  679
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  hhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllll
Query mgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtd  739
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhh
Query vwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefea  799
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  hhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhlllll
Query emrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedf  859
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllll
Query dldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqa  919
ident                                                             
Sbjct ------------------------------------------------------------  318
DSSP  ------------------------------------------------------------


DSSP  llleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhl
Query tefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesr  979
ident                                                             
Sbjct --------------dxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryav  364
DSSP  --------------lllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeee


DSSP  lllllllllllllll
Query gcldslpdhnqlslf  994
ident                
Sbjct igaeaiaasryipra  379
DSSP  elleeeellllllll


No 52: Query=3f2bA Sbjct=1itqA Z-score=6.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllLLLLLLLLLLLLLLLL--L
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqDTAPEGEKRVELHLHT--P  118
ident                                                      |      
Sbjct ----------------------------------dffrdeaERIMRDSPVIDGHNDLpwQ   26
DSSP  ----------------------------------lhhhhhhHHHHLLLLEEEEEELHhhH


DSSP  LLL------------llllllhhhHHHHHHHlLLLLEEELLLL------------LLLLH
Query MSQ------------mdavtsvtkLIEQAKKwGHPAIAVTDHA------------VVQSF  154
ident                          |                                  
Sbjct LLDmfnnrlqderanlttlagthtNIPKLRAgFVGGQFWSVYTpcdtqnkdavrrTLEQM   86
DSSP  HHHhhllllllhhhllllllllllLHHHHHHlLEEEEEEEELLlhhhllllhhhhHHHHH


DSSP  HHHHHHH--HHHLL------------------LEEEEEEEeeellleeeeeeellhhhhh
Query PEAYSAA--KKHGM------------------KVIYGLEAnivddpfhvtllaqnetglk  194
ident                                     | |                     
Sbjct DVVHRMCrmYPETFlyvtssagirqafregkvASLIGVEG--------------------  126
DSSP  HHHHHHHhhLLLLEeelllhhhhhhhhhllleEEEEEEEL--------------------


DSSP  hhhHHHHHHH----------------llllllllLEEH-------------------hhH
Query nlfKLVSLSH----------------iqyfhrvpRIPR-------------------svL  219
ident         |                                                   
Sbjct ---GHSIDSSlgvlralyqlgmryltlthscntpWADNwlvdtgdsepqsqglspfgqrV  183
DSSP  ---HHHLLLLhhhhhhhhhlleeeeellllllllLLLLhhhlllllllllllllhhhhhH


DSSP  HHLL--LLEEE---------------------ELLL--------lLLLLlllLLLLHHHL
Query VKHR--DGLLV---------------------GSGC--------dKGELfdnVEDIARFY  248
ident ||     | |                                            |  |  
Sbjct VKELnrLGVLIdlahvsvatmkatlqlsrapvIFSHssaysvcasRRNV---PDDVLRLV  240
DSSP  HHHHhhHLLEEelllllhhhhhhhhhhlllllEELLlllllllllLLLL---LHHHHHHH


DSSP  ----LLEEELL-hhhHLLLLlllhHHHHHHHHHHHHHHHhlllLEEELLLLLlllhhhhh
Query ----DFLEVHP-pdvYKPLYvkdeEMIKNIIRSIVALGEkldiPVVATGNVHylnpedki  303
ident         |                        |          |   |           
Sbjct kqtdSLVMVNFynnyISCTNkanlSQVADHLDHIKEVAG--arAVGFGGDFD--------  290
DSSP  hhhlLEEEELLlhhhHLLLLlllhHHHHHHHHHHHHHLL--hhHEEELLLLL--------


DSSP  hhhhhhhllhhhlllllllLLLL---LLLLHHHHHHHHH--HHHHHHHHHHHLHHHHHHH
Query yrkilihsqgganplnrheLPDV---YFRTTNEMLDCFS--FLGPEKAKEIVVDNTQKIA  358
ident                                                 |    ||     
Sbjct ----------------gvpRVPEgleDVSKYPDLIAELLrrNWTEAEVKGALADNLLRVF  334
DSSP  ----------------lllLLLLlllLLLLHHHHHHHHHhlLLLHHHHHHHHLHHHHHHH


DSSP  HLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhll
Query SLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighg  418
ident                                                             
Sbjct EA----------------------------------------------------------  336
DSSP  HH----------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeel
Query faviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseff  478
ident                                                             
Sbjct ------------------------------------------------------------  336
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhh
Query ndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahn  538
ident                                                             
Sbjct ------------------------------------------------------------  336
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeee
Query ytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttg  598
ident                                                             
Sbjct ------------------------------------------------------------  336
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeellllllhhhllleelhhhLLLLLLLeeeeehhhhllllleeeeeeehhhhhh
Query qhpggiivvpdymeiydftpiqypadDTSSEWRtthfdfhsihdnllkldilghddptvi  658
ident                             |                               
Sbjct -----veqasnltqapeeepipldqlGGSCRTH---------------------------  364
DSSP  -----hhhllllllllllllllhhhlLLLLLLL---------------------------


DSSP  hhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhh
Query rmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmle  718
ident                                                             
Sbjct ------------------------------------------------------------  364
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhh
Query etrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrgleps  778
ident                                                             
Sbjct ------------------------------------------------------------  364
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhh
Query lafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriay  838
ident                                                             
Sbjct ------------------------------------------------------------  364
DSSP  ------------------------------------------------------------


DSSP  hhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhh
Query fkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlev  898
ident                                                             
Sbjct ------------------------------------------------------------  364
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllll
Query alemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefls  958
ident                                                             
Sbjct ------------------------------------------------------------  364
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhlllhhhhhhhhhllllllllllllllll
Query kedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                     
Sbjct -------------------------------ygyss  369
DSSP  -------------------------------lllll


No 53: Query=3f2bA Sbjct=3giqA Z-score=6.2

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ---------------------------------------------------ekldfkitg    9
DSSP  ---------------------------------------------------lleeeeeel


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEELllllllllLLLLLLLLLLLLLlll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIAanerqdtaPEGEKRVELHLHTpms  120
ident                                                      | |    
Sbjct gwiidgtgaprrradlgvrdgriaaigelgaHPARH-awdasgkIVAPGFIDVHGHD---   65
DSSP  leelllllllleeleeeeelleeeeeellllLLEEE-eeellllEEEELEEELLLLL---


DSSP  llllllLHHHhhHHHH---hllLLLEEELLLLLLLL------------------------
Query qmdavtSVTKliEQAK---kwgHPAIAVTDHAVVQS------------------------  153
ident                            |    |                           
Sbjct -----dLMFVekPDLRwktsqgITTVVVGNCGVSAApaplpgntaaalallgetplfadv  120
DSSP  -----lLHHHhlLLLHhhhlllEEEEEELLLLLLLLlllllllllhhhhhhllllllllh


DSSP  hHHHHHHhHHHL-LLEEEEE----------------------------------------
Query fPEAYSAaKKHG-MKVIYGL----------------------------------------  172
ident                |                                            
Sbjct pAYFAALdAQRPmINVAALVghanlrlaamrdpqaaptaaeqqamqdmlqaaleagavgf  180
DSSP  hHHHHHHhHLLLlLEEEEEEehhhhhhhhlllllllllhhhhhhhhhhhhhhhhhlllee


DSSP  EEEEellleeeeeeellhhhhhhhhhhhhhhhllllllLLLE--EHHHHHHLL-----LL
Query EANIvddpfhvtllaqnetglknlfklvslshiqyfhrVPRI--PRSVLVKHR-----DG  225
ident                                        |        |           
Sbjct STGL--------------------------------ayQPGAvaQAAELEGLArvaaeRR  208
DSSP  EEEL--------------------------------llLLHHhlLHHHHHHHHhhhhhLL


DSSP  EE-----------------------------EELLLllllLLLL----------LLLLHH
Query LL-----------------------------VGSGCdkgeLFDN----------VEDIAR  246
ident  |                                                          
Sbjct RLhtshirneadgveaaveevlaigrgtgcaTVVSH----HKCMmpqnwgrsraTLANID  264
DSSP  LEeeeelllllllhhhhhhhhhhhhhhhlleEEELL----LLLLlhhhlllhhhHHHHHH


DSSP  ------hlLLEEELLHHHH-----------------------------------------
Query ------fyDFLEVHPPDVY-----------------------------------------  259
ident           |   |                                             
Sbjct rareqgveVALDIYPYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcd  324
DSSP  hhhhllllEEEEELLLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlll


DSSP  -------------LLLLlllhhhHHHHHHHHHHHHhhlllLEEELLLLLLllhhHHHHhh
Query -------------KPLYvkdeemIKNIIRSIVALGekldiPVVATGNVHYlnpeDKIYrk  306
ident                               |                             
Sbjct kttaarrlapagaIYFA-----mDEDEVKRIFQHP-----CCMVGSDGLP----NDAR--  368
DSSP  hhhhhhhhlleeeEEEL-----lLHHHHHHHHHLL-----LEEELLLLLL----LLLL--


DSSP  hhhhllhhhlllllllLLLLLLLlHHHHHHHHH----HHHHHHHHHHHLHHHHHHHHL--
Query ilihsqgganplnrheLPDVYFRtTNEMLDCFS----FLGPEKAKEIVVDNTQKIASL--  360
ident                             |            | |                
Sbjct ----------------PHPRLWGsFTRVLGRYVrearLMTLEQAVARMTALPARVFGFae  412
DSSP  ----------------LLLHHHHhHHHHHHHHHhhllLLLHHHHHHHHLHHHHHHHLLll


DSSP  ---------------------------------------------------------lLL
Query ---------------------------------------------------------iGD  363
ident                                                             
Sbjct rgvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqVL  472
DSSP  llllllllllleeeelllllllllllllllllllleeeeeelleeeelllllllllllLL


DSSP  LLlllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhh
Query VKpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviy  423
ident                                                             
Sbjct RA----------------------------------------------------------  474
DSSP  LL----------------------------------------------------------


DSSP  hhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllll
Query lishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsv  483
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  llhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhh
Query gsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvl  543
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  hlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeee
Query fgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpgg  603
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  eeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhh
Query iivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqd  663
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  hhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhlll
Query lsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpk  723
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhh
Query tfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafki  783
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhl
Query mesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhh  843
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhh
Query pllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemc  903
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  hllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhh
Query ergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlq  963
ident                                                             
Sbjct ------------------------------------------------------------  474
DSSP  ------------------------------------------------------------


DSSP  hhhlllhhhhhhhhhllllllllllllllll
Query qrgklsktlleylesrgcldslpdhnqlslf  994
ident                                
Sbjct ------------------------------x  475
DSSP  ------------------------------l


No 54: Query=3f2bA Sbjct=2a3lA Z-score=6.1

back to top
DSSP  -------------------------------------------------------lllhh
Query -------------------------------------------------------vrrle    5
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  hlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhhhhlll
Query tiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaelmsgvk   65
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  llleeeeeeeeeeelllleeeeeeeeeeeelllllllLLLLlLLLLLL-LLLL-------
Query kgmwvkvrgsvqndtfvrdlviiandlneiaanerqdTAPEgEKRVEL-HLHT-------  117
ident                                              |     |        
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrDFYN-VRKVDThVHHSacmnqkh  179
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllLLLL-LLEEEEeEELLllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  117
ident                                                             
Sbjct llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll


DSSP  ----------------------lllllllllLHHHHHHHHHHLLLLLEEELLLL------
Query ----------------------pmsqmdavtSVTKLIEQAKKWGHPAIAVTDHA------  149
ident                                                             
Sbjct fnlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRISIygrkms  299
DSSP  lhhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEELllllll


DSSP  ----llllhhhhHHHHhhhlLLEEEEEEEEEellleeeeeeellhhhhhhhhhhhHHHH-
Query ----vvqsfpeaYSAAkkhgMKVIYGLEANIvddpfhvtllaqnetglknlfklvSLSH-  204
ident                       |                                 |   
Sbjct ewdqlaswivnnDLYS----ENVVWLIQLPR--------lyniykdmgivtsfqnILDNi  347
DSSP  hhhhhhhhhhllLLLL----LLEEEEEEEEL--------lhhhhlllllllllhhHHHHh


DSSP  --------------------------------------------------llllllllle
Query --------------------------------------------------iqyfhrvpri  214
ident                                                             
Sbjct fiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtnafnpafsy  407
DSSP  llhhhhhhhlhhhllllhhhhlleeeeeeelllllllllllllllllllllllllllhhh


DSSP  EHHHHHHLL-------------LLEEE--------------------ELLLllllLLLL-
Query PRSVLVKHR-------------DGLLV--------------------GSGCdkgeLFDN-  240
ident                          |                                  
Sbjct YVYYCYANLyvlnklreskgmtTITLRphsgeagdidhlaatfltchSIAH----GINLr  463
DSSP  HHHHHHHHHhhhhhhhllllllLLEELlllllllllhhhhhhhhhllLLLL----LHHHh


DSSP  ----LLLL-hhhlLLEEELLHHHHLLLlllLHHHHhhHHHHHHHHHhhllLLEEELLLLL
Query ----VEDI-arfyDFLEVHPPDVYKPLyvkDEEMIknIIRSIVALGekldIPVVATGNVH  295
ident                |   |          |              |      |       
Sbjct kspvLQYLyylaqIGLAMSPLSNNSLF--lDYHRN--PFPVFFLRG----LNVSLSTDDP  515
DSSP  hlhhHHHHhhhhlLLEEELHHHHLLLL--lLLLLL--LHHHHHHLL----LLEEELLLLH


DSSP  LllhhhhhhhhhhhhllhhhllllllllLLLL--LLLHhHHHHHHH---HHHHHHHHHHh
Query YlnpedkiyrkilihsqgganplnrhelPDVY--FRTTnEMLDCFS---FLGPEKAKEIv  350
ident                                        |          |      || 
Sbjct L---------------------------QIHLtkEPLV-EEYSIAAsvwKLSACDLCEI-  546
DSSP  H---------------------------HHLLllLHHH-HHHHHHHhhhLLLHHHHHHH-


DSSP  LHHHHHHHhLLLLlllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhh
Query VDNTQKIAsLIGDvkpikdelytpriegadeeiremsyrrakeiygdplpklveerleke  410
ident   |                                                         
Sbjct ARNSVYQS-GFSH-----------------------------------------------  558
DSSP  HHHHHHHL-LLLH-----------------------------------------------


DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeell
Query lksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcp  470
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  lllleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeel
Query nckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsg  530
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhh
Query eyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagc  590
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  llleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeee
Query tgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldil  650
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  eehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllll
Query ghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgt  710
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhh
Query rfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyl  770
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  hhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhh
Query iyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayv  830
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhh
Query lmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakek  890
ident                                                             
Sbjct ------------------------------------------------------------  558
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhh
Query slltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivra  950
ident                                                             
Sbjct ----------------------------------------------alkshwigkdyykr  572
DSSP  ----------------------------------------------hhhhhhllllllll


DSSP  hhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query reegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                             
Sbjct gpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 55: Query=3f2bA Sbjct=2gwgA Z-score=6.0

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLL-
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPM-  119
ident                                                      | |    
Sbjct ------------------------------------------------XIIDIHGHYTTa   12
DSSP  ------------------------------------------------LLEEEEEELLLl


DSSP  -----------------------------lllllllLHHH-HHHHHHHLLLLLEEELLLL
Query -----------------------------sqmdavtSVTK-LIEQAKKWGHPAIAVTDHA  149
ident                                     |            |         |
Sbjct pkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVFSPRA   72
DSSP  lhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEELLL


DSSP  ------------LLLLHHHHHHHHHhhlLLEEEEE-------------------------
Query ------------VVQSFPEAYSAAKkhgMKVIYGL-------------------------  172
ident                                |                            
Sbjct gdfnvsstwaaiCNELCYRVSQLFP---DNFIGAAxlpqspgvdpktcipelekcvkeyg  129
DSSP  llhhhhhhhhhhHHHHHHHHHHHLL---LLEEEEEellllllllhhhhhhhhhhhhhlll


DSSP  ----EEEEEllleeeeeeellhhhhhhhhhhhhhhhlllLLLL-------lleeHHHHHH
Query ----EANIVddpfhvtllaqnetglknlfklvslshiqyFHRV-------pripRSVLVK  221
ident       |                                                     
Sbjct fvaiNLNPD------------------------------PSGGhwtsppltdriWYPIYE  159
DSSP  lleeEELLL------------------------------LLLLlllllllllhhHHHHHH


DSSP  LL--LLEE-----------------------------------EELLLllllLLLL----
Query HR--DGLL-----------------------------------VGSGCdkgeLFDN----  240
ident                                                             
Sbjct KXveLEIPaxihvstgahylnadttafxqcvagdlfkdfpelkFVIPH---gGGAVpyhw  216
DSSP  HHhhHLLLeeellllllhhhhhhhhhhhhhhhllhhhhlllllEEELH---hHLLLhhhh


DSSP  ---------------LLLLHHHLlLEEELLHHhhlllllllhhhhHHHHHHHHHHHHhll
Query ---------------VEDIARFYdFLEVHPPDvykplyvkdeemiKNIIRSIVALGEkld  285
ident                         |                       |           
Sbjct grfrglaqexkkpllEDHVLNNI-FFDTCVYH-------------QPGIDLLNTVIP--v  260
DSSP  hhhhhhhhhlllllhHHHLLLLE-EEELLLLL-------------HHHHHHHHHHLL--h


DSSP  LLEEELLLLLL-lLHHHhhhhhhhhhllhhhllllllllLLLLlllhhHHHHHHHHHHHH
Query IPVVATGNVHY-lNPEDkiyrkilihsqgganplnrhelPDVYfrttnEMLDCFSFLGPE  344
ident   |             |                                       | ||
Sbjct DNVLFASEXIGavRGID-----------------prtgfYYDD---tkRYIEASTILTPE  300
DSSP  HHEELLLLLLLllLLEE-----------------lllleELLL---lhHHHHHLLLLLHH


DSSP  HHHHHHLHHHHHHHHLLLLLllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhh
Query KAKEIVVDNTQKIASLIGDVkpikdelytpriegadeeiremsyrrakeiygdplpklve  404
ident     |   |                                                   
Sbjct EKQQIYEGNARRVYPRLDAA----------------------------------------  320
DSSP  HHHHHHLHHHHHHLHHHHHH----------------------------------------


DSSP  hhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllll
Query erlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplp  464
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  leeelllllleeellllllllhhhllllllllllllleeellllllhhhhllllllllle
Query phyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdi  524
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  eeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhh
Query dlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeid  584
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllll
Query rlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnl  644
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  leeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllll
Query lkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtig  704
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  llllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhh
Query ipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrd  764
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhh
Query dimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpka  824
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhh
Query haaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiq  884
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhh
Query atakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnva  944
ident                                                             
Sbjct ------------------------------------------------------------  320
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll
Query qaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
ident                                                   
Sbjct -----------------------------------------lkakgkleh  329
DSSP  -----------------------------------------hhhhhhhll


No 56: Query=3f2bA Sbjct=2qpxA Z-score=5.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllLLLLlLLLLLLLLL---
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtAPEGeKRVELHLHT---  117
ident                                                      | |    
Sbjct -----------------------------------gxddlsefVDQV-PLLDHHCHFlid   24
DSSP  -----------------------------------lllllhhhHHHL-LEEEEEELLlll


DSSP  ------------------------------------------------llllllllllhh
Query ------------------------------------------------pmsqmdavtsvt  129
ident                                                             
Sbjct gkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaaxndpgyat   84
DSSP  lllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhh


DSSP  hhhHHHHHLLLLLEEELLL-lllllhHHHHHHHHHHLLLEEEEEEEEeellleeeeeeel
Query kliEQAKKWGHPAIAVTDH-avvqsfPEAYSAAKKHGMKVIYGLEANivddpfhvtllaq  188
ident                                 |   |  |                    
Sbjct ynhRIFGHFHFKELLIDTGfvpddpiLDLDQTAELVGIPVKAIYRLE-------------  131
DSSP  hhhHHHHHLLEEEEEEELLlllllllLLHHHHHHHHLLLEEEEEEHH-------------


DSSP  lhhhhhhhhhhHHHHHLL------------------------------------------
Query netglknlfklVSLSHIQ------------------------------------------  206
ident                                                             
Sbjct ----------tHAEDFXLehdnfaawwqafsndvkqakahgfvgfxsiaayrvglhlepv  181
DSSP  ----------hHHHHHHLllllhhhhhhhhhhhhhllllllllleeelhhhhllllllll


DSSP  --------------llLLLL------leEHHHHHHLL--LLEEEELLLL--------llL
Query --------------yfHRVP------riPRSVLVKHR--DGLLVGSGCD--------kgE  236
ident                                                             
Sbjct nvieaaagfdtwkhsgEKRLtskplidyXLYHVAPFIiaQDXPLQFHVGygdadtdxylG  241
DSSP  lhhhhhhhhhhhhhhlLLLLllhhhhhhHHHHHHHHHhhHLLLEEEEELlllllllhhhL


DSSP  LLLLLLLLH------hHLLLEEEllhhhhlllllllhhhhhhHHHHHHHHHHHLL-LLEE
Query LFDNVEDIA------rFYDFLEVhppdvykplyvkdeemiknIIRSIVALGEKLD-IPVV  289
ident       |             |                       |    |          
Sbjct NPLLXRDYLkaftkkgLKVVLLH----------------cypYHREAGYLASVFPnLYFD  285
DSSP  LHHHHHHHHhhhhhhlLLEEEEE----------------lllLHHHHHHHHHHLLlEEEE


DSSP  E-----------------------------LLLLLLLLhhhhhhhhhhhhllhhhlllll
Query A-----------------------------TGNVHYLNpedkiyrkilihsqgganplnr  320
ident                                                             
Sbjct IslldnlgpsgasrvfneavelapytrilfASDASTYP----------------------  323
DSSP  LllhhhhlhhhhhhhhhhhlllllhhheelLLLLLLLH----------------------


DSSP  llllllLLLL-HHHHHHHHHHHH----------hhhhhHHHLhhHHHHHH--LLLLllll
Query helpdvYFRT-TNEMLDCFSFLG----------pekakEIVVdnTQKIAS--LIGDvkpi  367
ident                                              |  |           
Sbjct -----eXYGLaARQFKQALVAHFnqlpfvdlaqkkawiNAIC--WQTSAKlyHQER----  372
DSSP  -----hHHHHhHHHHHHHHHHHHhllllllhhhhhhhhHHHH--LHHHHHhlLLHH----


DSSP  lllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhh
Query kdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylish  427
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhh
Query klvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgf  487
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  hllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlll
Query dlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfged  547
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  leeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeel
Query nvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivv  607
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  lllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhll
Query pdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgi  667
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  lhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhh
Query dpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfse  727
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhh
Query lvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesv  787
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhh
Query rkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhplly  847
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhlll
Query yasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergf  907
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  eellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhl
Query sfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgk  967
ident                                                             
Sbjct ------------------------------------------------------------  372
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhllllllllllllllll
Query lsktlleylesrgcldslpdhnqlslf  994
ident                            
Sbjct -----------------------elrv  376
DSSP  -----------------------hhll


No 57: Query=3f2bA Sbjct=3iacA Z-score=5.5

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPms  120
ident                                                      | |    
Sbjct ----------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCHLS--   36
DSSP  ----------------------llllllllllllhhhhhhhhhlllLLLEEELLLLLL--


DSSP  lllllLLHH---------------------------------------------------
Query qmdavTSVT---------------------------------------------------  129
ident                                                             
Sbjct ----pQEIAddrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantv   92
DSSP  ----hHHHHhllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhh


DSSP  ------------------------------------------------hHHHHHHHLLLL
Query ------------------------------------------------kLIEQAKKWGHP  141
ident                                                             
Sbjct pktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVR  152
DSSP  hhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEE


DSSP  LEEELLLL--lLLLHHHHHHHhHHHLLLEEEEE---------------------------
Query AIAVTDHA--vVQSFPEAYSAaKKHGMKVIYGL---------------------------  172
ident     ||                      |                               
Sbjct XVGTTDDPidsLEYHRQIAAD-DSIDIEVAPSWrpdkvfkieldgfvdylrkleaaadvs  211
DSSP  EEELLLLLlllLHHHHHHHHL-LLLLLEEELLLllhhhhllllllhhhhhhhhhhhhlll


DSSP  --------------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhll
Query --------------------------EANIvddpfhvtllaqnetglknlfklvslshiq  206
ident                              |                              
Sbjct itrfddlrqaltrrldhfaacgcrasDHGIetlrfapvpddaqldailgkrlagetlsel  271
DSSP  lllhhhhhhhhhhhhhhhhhlllleeEEEEllllllllllhhhhhhhhhhhhllllllhh


DSSP  llllllleEHHHHHHLL--LLEEEE-----------------------------------
Query yfhrvpriPRSVLVKHR--DGLLVG-----------------------------------  229
ident             |       |                                       
Sbjct eiaqfttaVLVWLGRQYaaRGWVXQlhigairnnntrxfrllgpdtgfdsigdnniswal  331
DSSP  hhhhhhhhHHHHHHHHHhhHLLEEEeeeleellllhhhhhhhllllllleelllllhhhh


DSSP  ----------------LLLLL-llLLLL----LLLLHH----hLLLEEEllhHHHLllll
Query ----------------SGCDK-geLFDN----VEDIAR----fYDFLEVhppDVYKplyv  264
ident                                                             
Sbjct srlldsxdvtnelpktILYCLnprDNEVlatxIGNFQGpgiagKVQFGS--gWWFN----  385
DSSP  hhhhhhhhlllllleeEEEELlhhHHHHhhhhHHHLLLlllllLEEELL--lLHHH----


DSSP  llHHHHHHHHHHHHHHHHhlllLEEE-LLLLLLLLhhhhhhhhhhhhllhhhllllllll
Query kdEEMIKNIIRSIVALGEkldiPVVA-TGNVHYLNpedkiyrkilihsqgganplnrhel  323
ident                 |       |                                   
Sbjct dqKDGXLRQLEQLSQXGL--lsQFVGxLTDSRSFL-------------------------  418
DSSP  llHHHHHHHHHHHHHHLL--hhHLLLlLLLLLLLL-------------------------


DSSP  lllLLLLHHHHHHHHHHHH----------------HHHHHHHHLHHHHHHHHLlllllll
Query pdvYFRTTNEMLDCFSFLG----------------PEKAKEIVVDNTQKIASLigdvkpi  367
ident                  |                       |   | |            
Sbjct ---SYTRHEYFRRILCNLLgqwaqdgeipddeaxlSRXVQDICFNNAQRYFTI-------  468
DSSP  ---LLHHHHHHHHHHHHHHhhhhhlllllllhhhhHHHHHHHHLHHHHHHLLL-------


DSSP  lllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhh
Query kdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylish  427
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhh
Query klvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgf  487
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  hllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlll
Query dlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfged  547
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  leeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeel
Query nvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivv  607
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  lllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhll
Query pdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgi  667
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  lhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhh
Query dpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfse  727
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhh
Query lvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesv  787
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhh
Query rkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhplly  847
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhlll
Query yasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergf  907
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  eellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhl
Query sfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgk  967
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhllllllllllllllll
Query lsktlleylesrgcldslpdhnqlslf  994
ident                            
Sbjct --------------------------k  469
DSSP  --------------------------l


No 58: Query=3f2bA Sbjct=1j5sA Z-score=5.1

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllLLLLllLLLLLLLLLLll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdTAPEgeKRVELHLHTPms  120
ident                                                   |  | |    
Sbjct ---------------------hmflgedylltnraavrlfneVKDL--PIVDPHNHLD--   35
DSSP  ---------------------llllllllllllhhhhhhhhhHLLL--LEEELLLLLL--


DSSP  lllllllHHHH-------------------------------------------------
Query qmdavtsVTKL-------------------------------------------------  131
ident                                                             
Sbjct -------AKDIvenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalak   88
DSSP  -------HHHHhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhh


DSSP  -------------------------------------------------hhHHHHLLLLL
Query -------------------------------------------------ieQAKKWGHPA  142
ident                                                             
Sbjct vfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpqkLLRDMKVEI  148
DSSP  hhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhhhHHHHLLEEE


DSSP  EEELLLLLLLlHHHHHHHHHHHL-LLEEEEEEEE--EELL----------------leee
Query IAVTDHAVVQsFPEAYSAAKKHG-MKVIYGLEAN--IVDD----------------pfhv  183
ident    ||  |         |                     |                    
Sbjct LCTTDDPVST-LEHHRKAKEAVEgVTILPTWRPDraMNVDkegwreyvekmgerygedts  207
DSSP  EELLLLLLLL-LHHHHHHHHHLLlLEEELLLLLHhhHLLLlllhhhhhhhhhhhhlllll


DSSP  eeeellhhhhHHHHH----------------------------------hhhhhhlllll
Query tllaqnetglKNLFK----------------------------------lvslshiqyfh  209
ident           |                                                 
Sbjct tldgflnalwKSHEHfkehgcvasdhallepsvyyvdenraravhekafsgekltqdein  267
DSSP  lhhhhhhhhhHHHHHhhllllleeeeeelllllllllhhhhhhhhhhhlllllllhhhhh


DSSP  lllleEHHHHHHLL--LLEEEELLlllllLLLL-------------------------LL
Query rvpriPRSVLVKHR--DGLLVGSGcdkgeLFDN-------------------------VE  242
ident            |                                                
Sbjct dykafMMVQFGKMNqeTNWVTQLH-----IGALrdyrdslfktlgpdsggdistnflrIA  322
DSSP  hhhhhHHHHHHHHHhhHLLEEEEE-----ELEEllllhhhhhhlllllllleelllllHH


DSSP  LLH---------hhlLLEEellhhhhlllllllhhhhhhHHHHHhHHHHHLL------LL
Query DIA---------rfyDFLEvhppdvykplyvkdeemiknIIRSIvALGEKLD------IP  287
ident                  |                                          
Sbjct EGLryflnefdgklkIVLY------------------vlDPTHL-PTISTIArafpnvYV  363
DSSP  HHHhhhhhhllllllEEEE------------------elLHHHH-HHHHHHHhhllleEE


DSSP  EE-----------------------------ELLLLLLLLhhhhhhhhhhhhllhhhlll
Query VV-----------------------------ATGNVHYLNpedkiyrkilihsqgganpl  318
ident                                       |                     
Sbjct GApwwfndspfgmemhlkylasvdllynlagMVTDSRKLL--------------------  403
DSSP  LLlllllllhhhhhhhhhhhhllllhhhlllLLLLLLLLL--------------------


DSSP  llllllllLLLL-HHHHHHHHHHHH--------------hhhhhHHHLHHHHHHHHllll
Query nrhelpdvYFRT-TNEMLDCFSFLG--------------pekakEIVVDNTQKIASligd  363
ident          |   |       |                          |           
Sbjct --------SFGSrTEMFRRVLSNVVgemvekgqipikearelvkHVSYDGPKALFF----  451
DSSP  --------HHHHhHHHHHHHHHHHHhhhhhlllllhhhhhhhhhHHHLHHHHHHHL----


DSSP  lllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhh
Query vkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviy  423
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllll
Query lishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsv  483
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  llhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhh
Query gsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvl  543
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeee
Query fgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpgg  603
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  eeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhh
Query iivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqd  663
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhlll
Query lsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpk  723
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhh
Query tfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafki  783
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhl
Query mesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhh  843
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhh
Query pllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemc  903
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhh
Query ergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlq  963
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  hhhlllhhhhhhhhhllllllllllllllll
Query qrgklsktlleylesrgcldslpdhnqlslf  994
ident                                
Sbjct -------------------------------  451
DSSP  -------------------------------


No 59: Query=3f2bA Sbjct=1bksA Z-score=4.1

back to top
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh
Query vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllllLLLLLLLLlll
Query msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegekRVELHLHTpms  120
ident                                                             
Sbjct --------------------------------meryenlfaqlndrregAFVPFVTL---   25
DSSP  --------------------------------lhhhhhhhhhhhhllllEEEEEEEL---


DSSP  llLLLL--LHHHHHHHHHHLLLlLEEELLL---------------------------llL
Query qmDAVT--SVTKLIEQAKKWGHpAIAVTDH---------------------------avV  151
ident            | |      |                                       
Sbjct --GDPGieQSLKIIDTLIDAGA-DALELGVpfsdpladgptiqnanlrafaagvtpaqcF   82
DSSP  --LLLLhhHHHHHHHHHHHLLL-LLEEEELlllllllllhhhhhhhhhhhhhlllhhhhH


DSSP  LLHHHHHHHHHhhllLEEEEEEEEEellleeeeeeellhhhhhhhhhhhHHHHLLL----
Query QSFPEAYSAAKkhgmKVIYGLEANIvddpfhvtllaqnetglknlfklvSLSHIQY----  207
ident                    ||                                       
Sbjct EMLALIREKHP----TIPIGLLMYA-----------------------nLVFNNGIdafy  115
DSSP  HHHHHHHHHLL----LLLEEEEELH-----------------------hHHHLLLHhhhh


DSSP  ------------lllllleeHHHHHHLL--LLEEEELLlllllLLLL----LLLLH-HHL
Query ------------fhrvpripRSVLVKHR--DGLLVGSGcdkgeLFDN----VEDIA-RFY  248
ident                                               |             
Sbjct arceqvgvdsvlvadvpveeSAPFRQAAlrHNIAPIFI-----CPPNadddLLRQVaSYG  170
DSSP  hhhhhhllleeeellllhhhLHHHHHHHhhLLLEEEEE-----ELLLllhhHHHHHhHHL


DSSP  L-LEEELlhhhhlllllllhhhhhHHHHHHHHHHHHLLL-LEEELlllllllhhhhhhhh
Query D-FLEVHppdvykplyvkdeemikNIIRSIVALGEKLDI-PVVATgnvhylnpedkiyrk  306
ident                                         |                   
Sbjct RgYTYLL----------------aLPLHHLIEKLKEYHAaPALQG---------------  199
DSSP  LlLEEEL----------------lLLHHHHHHHHHHHLLlLEEEL---------------


DSSP  hhhhllhhhlllllllllllllllhHHHHHHHhhhhhhHHHHHHLhhhhhhhhlllllll
Query ilihsqgganplnrhelpdvyfrttNEMLDCFsflgpeKAKEIVVdntqkiasligdvkp  366
ident                           |                                 
Sbjct --------------------fgissPEQVSAA------VRAGAAG---------------  218
DSSP  --------------------lllllHHHHHHH------HHHLLLE---------------


DSSP  llllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhh
Query ikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylis  426
ident                                                             
Sbjct ------------------------------------------------------------  218
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllh
Query hklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsg  486
ident                                                             
Sbjct ------------------------------------------------------------  218
DSSP  ------------------------------------------------------------


DSSP  hhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhll
Query fdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfge  546
ident                                                             
Sbjct ------------------------------------------------------------  218
DSSP  ------------------------------------------------------------


DSSP  lleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhHHHHLlleeeeeeeeeeeee
Query dnvyragtigtvadktaygfvkayasdhnlelrgaeidrlAAGCTgvkrttgqhpggiiv  606
ident                                                             
Sbjct ----------------------------aisgsaivkiieKNLAS---------------  235
DSSP  ----------------------------eeellhhhhhhhHLLLL---------------


DSSP  llllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhl
Query vpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsg  666
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  llhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhh
Query idpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfs  726
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhh
Query elvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimes  786
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  hlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhh
Query vrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpll  846
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhll
Query yyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcerg  906
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  leellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhh
Query fsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrg  966
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhllllllllllllllll
Query klsktlleylesrgcldslpdhnqlslf  994
ident                             
Sbjct --------pkqmlaelrsfvsamkaasr  255
DSSP  --------hhhhhhhhhhhhhhhhhlll