Results: dupa

Query: 3e74A

MOLECULE: ALLANTOINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3e74-A 75.2  0.0  429   429  100 PDB  MOLECULE: ALLANTOINASE;                                              
   2:  1gkp-A 50.8  2.0  420   458   30 PDB  MOLECULE: HYDANTOINASE;                                              
   3:  3gri-A 47.8  2.1  394   422   27 PDB  MOLECULE: DIHYDROOROTASE;                                            
   4:  4b3z-D 46.5  2.3  421   477   26 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   5:  3giq-A 34.0  2.5  345   475   24 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   6:  3pnu-A 31.5  2.6  307   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
   7:  3nqb-A 28.9  2.9  307   587   22 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   8:  1onx-A 28.1  2.7  314   390   20 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   9:  2vun-A 27.1  2.9  314   385   19 PDB  MOLECULE: ENAMIDASE;                                                 
  10:  1yrr-B 26.5  2.9  294   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  11:  4cqb-A 24.5  3.5  308   402   19 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  12:  2ogj-A 24.0  3.4  301   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  13:  2paj-A 24.0  3.6  305   421   15 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  14:  1a5k-C 23.6  2.7  338   566   20 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  15:  3mtw-A 23.3  3.9  306   404   14 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  16:  3ooq-A 22.8  3.0  273   384   23 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  17:  3icj-A 22.6  3.3  282   468   18 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  18:  3mkv-A 22.6  3.4  301   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  19:  2oof-A 22.3  3.7  298   403   19 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  20:  1j6p-A 22.2  3.6  303   407   18 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  21:  3ls9-A 22.0  3.6  311   453   18 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  22:  4c5y-A 21.0  3.8  310   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  23:  1k6w-A 21.0  4.0  299   423   18 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  24:  2uz9-A 19.6  4.1  301   444   18 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  25:  4rdv-B 19.5  3.5  299   451   18 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  26:  2ob3-A 16.2  3.4  232   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  27:  3irs-A 15.8  2.8  214   281   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  28:  2imr-A 15.6  5.0  270   380   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  29:  2vc5-A 15.4  3.0  224   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  30:  1bf6-A 15.3  2.9  215   291   14 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  31:  3cjp-A 15.2  2.7  207   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  32:  3k2g-B 15.1  2.9  217   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  33:  2qpx-A 15.0  3.2  222   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  34:  1a4m-A 14.7  3.4  230   349   14 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  35:  2ffi-A 14.5  3.2  220   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  36:  2dvt-A 14.4  3.3  227   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  37:  4dlf-A 14.1  3.6  221   287   13 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  38:  4hk5-D 14.1  3.4  236   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  39:  4qrn-A 14.1  3.2  226   352   12 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  40:  2y1h-B 14.0  3.1  213   265   14 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  41:  4mup-B 13.9  3.5  222   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  42:  4ofc-A 13.7  3.3  222   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  43:  4dzi-C 13.7  3.7  230   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  44:  1itq-A 13.0  3.4  219   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  45:  3gg7-A 12.4  3.4  206   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  46:  3qy6-A 12.1  3.2  193   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  2gwg-A 11.9  3.7  208   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  48:  1v77-A 10.4  3.9  183   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  49:  1j5s-A 10.2  4.0  223   451    9 PDB  MOLECULE: URONATE ISOMERASE;                                         
  50:  3iac-A  9.7  3.6  224   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  2a3l-A  8.1  4.1  221   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3dcp-A  7.7  4.2  186   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3f2b-A  7.5  6.3  186   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  1m65-A  7.1  3.5  167   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3au2-A  6.6  7.6  179   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  56:  1bks-A  6.5  4.4  171   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.0  3.3  134   284   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  4.9  4.2  165   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  3.7  4.1  134   224    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3e74A Sbjct=3e74A Z-score=75.2

back to top
DSSP  LEEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLLEEEEEELLLLEEEELEEEEEEL
Query SFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVXDASGLVVSPGXVDAHTH   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVXDASGLVVSPGXVDAHTH   60
DSSP  LEEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLLEEEEEELLLLEEEELEEEEEEL


DSSP  LLHHHHHHHHHHLLEEEEEELLLLLLLLLLLHHHHHHHHHHHLLLLLLEEEELEELLLLL
Query IGYETGTRAAAKGGITTXIEXPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVSYN  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IGYETGTRAAAKGGITTXIEXPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVSYN  120
DSSP  LLHHHHHHHHHHLLEEEEEELLLLLLLLLLLHHHHHHHHHHHLLLLLLEEEELEELLLLL


DSSP  LLLHHHHHHHLLLLEEEELLLLLHHHHHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHH
Query IDRLHELDEVGVVGFXCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEAKR  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IDRLHELDEVGVVGFXCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEAKR  180
DSSP  LLLHHHHHHHLLLLEEEELLLLLHHHHHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHH


DSSP  HLLLLHHHHHHLLLHHHHHHHHHHHHHHHHHHLLLEEELLLLLHHHHHHHHHHHHLLLLE
Query EGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEGQDI  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSSPEGVEEVTRARQEGQDI  240
DSSP  HLLLLHHHHHHLLLHHHHHHHHHHHHHHHHHHLLLEEELLLLLHHHHHHHHHHHHLLLLE


DSSP  EEEELLHHHHLLHHHHHHHLHHHLLLLLLLLHHHHHHHHHHHHLLLLLEELLLLLLLLLL
Query TCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGXWEKLFNGEIDCLVSDHSPCPPE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGXWEKLFNGEIDCLVSDHSPCPPE  300
DSSP  EEEELLHHHHLLHHHHHHHLHHHLLLLLLLLHHHHHHHHHHHHLLLLLEELLLLLLLLLL


DSSP  LLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLL
Query XKAGNIXKAWGGIAGLQSCXDVXFDEAVQKRGXSLPXFGKLXATNAADIFGLQQKGRIAP  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct XKAGNIXKAWGGIAGLQSCXDVXFDEAVQKRGXSLPXFGKLXATNAADIFGLQQKGRIAP  360
DSSP  LLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLL


DSSP  LLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLLEELLEEEEEEELLEEEEELLLLLLLL
Query GKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQGFPVA  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQGFPVA  420
DSSP  LLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLLEELLEEEEEEELLEEEEELLLLLLLL


DSSP  LLLLEELLL
Query PKGQFILKH  429
ident |||||||||
Sbjct PKGQFILKH  429
DSSP  LLLLEELLL


No 2: Query=3e74A Sbjct=1gkpA Z-score=50.8

back to top
DSSP  leEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLLE--EEEEELLLLEEEELEEEEE
Query sfDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDA--KEVXDASGLVVSPGXVDAH   58
ident    | ||||  |        ||   |  |  ||| |      || || |  | ||  | |
Sbjct --PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPpgTEVIDATGKYVFPGFIDPH   58
DSSP  --LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLLLllLEEEELLLLEEEELEEEEE


DSSP  ELL-----------LHHHHHHHHHHLLEEEEEELLLLllllllLHHHHHHHHHHHLLLLL
Query THI-----------GYETGTRAAAKGGITTXIEXPLNqlpatvDRASIELKFDAAKGKLT  107
ident  ||             |||  ||  || || ||                |    | |   
Sbjct VHIylpfmatfakdTHETGSKAALMGGTTTYIEMCCP-srnddALEGYQLWKSKAEGNSY  117
DSSP  ELLlleelleelllLHHHHHHHHHHLLEEEEEEEELL-lllllHHHHHHHHHHHHLLLLL


DSSP  LEEEELEELLLL---LLLLHHHHHHHLLLLEEEEL-----LLLLHHHHHHHHHHHHHHLL
Query IDAAQLGGLVSY---NIDRLHELDEVGVVGFXCFV-----RDVNDWQFFKGAQKLGELGQ  159
ident  |                 | |    |   || |        | |           ||| 
Sbjct CDYTFHMAVSKFdekTEGQLREIVADGISSFXIFLsyknfFGVDDGEMYQTLRLAKELGV  177
DSSP  LEEEEEEELLLLlllHHHHHHHHHHLLLLEEEEEElllllLLLLHHHHHHHHHHHHHHLL


DSSP  LEEEELLLHHHHHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHHHHHHHHHHHHLLLEEEL
Query PVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVC  219
ident  |  |||||     |      ||         |||   | |   |        |    | 
Sbjct IVTAHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVV  237
DSSP  EEEEEELLHHHHHHHHHHHHHLLLLLHHHLLLLLLHHHHHHHHHHHHHHHHHHLLEEEEL


DSSP  LLLLHHHHHHHHHHHHLLLLEEEEELLHHHHLLHHHHHH---HLHHHLLLLLLLLHHHHH
Query HVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEE---IGTLAKCSPPIRDLENQK  276
ident | |          |   |  |  ||    | ||    |           ||| ||  |||
Sbjct HLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERggvEAMKYIMSPPLRDKRNQK  297
DSSP  LLLLHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHHLlhhHHHLLLLLLLLLLLHHHH


DSSP  HHHHHHHLLLLLEELLLLLLLLLLLLLLL---LLLLLLLLLLHHHHHHHHHHHHLLLLLL
Query GXWEKLFNGEIDCLVSDHSPCPPEXKAGN---IXKAWGGIAGLQSCXDVXFDEAVQKRGX  333
ident   |  |  | ||    || |   | |            ||              |     
Sbjct VLWDALAQGFIDTVGTDHCPFDTEQKLLGkeaFTAIPNGIPAIEDRVNLLYTYGVSRGRL  357
DSSP  HHHHHHHLLLLLEEELLLLLLLHHHHHHHlllHHHLLLLLLLLLLHHHHHHHHHLLLLLL


DSSP  LHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLL
Query SLPXFGKLXATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYV  392
ident     |     | ||  |||   || || | ||| |   |                     
Sbjct DIHRFVDAASTKAAKLFGLFpRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFE  417
DSSP  LHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLL


DSSP  LLEELLEEEEEEELLEEEEELLlLLLLLL-LLLEELLL----
Query GRTIGARITKTILRGDVIYDIEqGFPVAP-KGQFILKH----  429
ident |  |  |      || |       |      |          
Sbjct GFEIDGRPSVVTVRGKVAVRDG-QFVGEKgWGKLLRREpmyf  458
DSSP  LLEELLEEEEEEELLEEEEELL-EELLLLlLLLLLLLLllll


No 3: Query=3e74A Sbjct=3griA Z-score=47.8

back to top
DSSP  leEEEEELLEEeLLLL-EEELEEEEELLEEEEEELLLLL--eEEEEELLLLEEEELEEEE
Query sfDLIIKNGTViLENE-ARVVDIAVKGGKIAAIGQDLGD--aKEVXDASGLVVSPGXVDA   57
ident      |||| | | |      ||   |  |  |             || |  |||| || 
Sbjct --XKLIKNGKV-LQNGeLQQADILIDGKVIKQIAPAIEPsngVDIIDAKGHFVSPGFVDV   57
DSSP  --LEEEELLEE-EELLeEEELEEEEELLEEEEEELLLLLlllLEEEELLLLEEEELEEEE


DSSP  EELL---------LHHHHHHHHHHLLEEEEEELLLlLLLLLLLHHHHHHHHHHHLLLLLL
Query HTHI---------GYETGTRAAAKGGITTXIEXPLnQLPATVDRASIELKFDAAKGKLTI  108
ident | |            |||| ||| || ||   ||    |        |            
Sbjct HVHLrepggeykeTIETGTKAAARGGFTTVCPXPN-TRPVPDSVEHFEALQKLIDDNAQV  116
DSSP  EELLlllllllllLHHHHHHHHHHLLEEEEEELLL-LLLLLLLHHHHHHHHHHHHHHLLL


DSSP  EEEELEELL----LLLLLLHHHHHHHLLLLEEEELLLL-LHHHHHHHHHHHHHHLLLEEE
Query DAAQLGGLV----SYNIDRLHELDEVGVVGFXCFVRDV-NDWQFFKGAQKLGELGQPVLV  163
ident                       |   |   |      |        |             
Sbjct RVLPYASITtrqlGKELVDFPALVKEGAFAFTDDGVGVqTASXXYEGXIEAAKVNKAIVA  176
DSSP  EELLLEELLhhhlLLLLLLHHHHHLLLLLLEEELLLLLlLHHHHHHHHHHHHHHLLLEEE


DSSP  ELLLHHHHHHHhhhhhhhllllhhHHHH----------LLLHHHHHHHHHHHHHHHHHHL
Query HCENALICDELgeeakregrvtahDYVA----------SRPVFTEVEAIRRVLYLAKVAG  213
ident |||                                     |   |   | |   ||  ||
Sbjct HCEDNSLIYGG-------------AXHEgkrskelgipGIPNICESVQIARDVLLAEAAG  223
DSSP  LLLLHHHLLLL-------------LEELlhhhhhhlllEELLHHHHHHHHHHHHHHHHHL


DSSP  LLEEELLLLLHHHHHHHHHHHHLLLLEEEEELLHHHHLLHHHHHHHLHHHLLLLLLLLHH
Query CRLHVCHVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLE  273
ident |  ||||||  | |     |   |   | |  ||   |  |         |  || |  |
Sbjct CHYHVCHVSTKESVRVIRDAKRAGIHVTAEVTPHHLLLTEDDIPGNNAIYKXNPPLRSTE  283
DSSP  LLEEELLLLLHHHHHHHHHHHHLLLLEEEEELHHHHHLLHHHLLLLLHHHLLLLLLLLHH


DSSP  HHHHHHHHHHLLLLLEELLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLL
Query NQKGXWEKLFNGEIDCLVSDHSPCPPEXKAGNIXKAWGGIAGLQSCXDVXFDEAVQKRGX  333
ident       | |  | |||   || |     ||    ||  || |            |     
Sbjct DREALLEGLLDGTIDCIATDHAPHARDEKAQPXEKAPFGIVGSETAFPLLYTHFVKNGDW  343
DSSP  HHHHHHHHHHLLLLLEELLLLLLLLHHHHLLLLLLLLLLLLLLLLHHHHHHHHHLLLLLL


DSSP  LHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLL
Query SLPXFGKLXATNAADIFGLQqKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVG  393
ident  |              | |   |       ||   |   |       |        |  |
Sbjct TLQQLVDYLTIKPCETFNLE-YGTLKENGYADLTIIDLDSEQEIKGEDFLSKADNTPFIG  402
DSSP  LHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLL


DSSP  LEELLEEEEEEELLEEEEELllllllllllleelll
Query RTIGARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
ident          |   | |                    
Sbjct YKVYGNPILTXVEGEVKFEG----------------  422
DSSP  LEELLEEEEEEELLEEEEEL----------------


No 4: Query=3e74A Sbjct=4b3zD Z-score=46.5

back to top
DSSP  leEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLLE--EEEEELLLLEEEELEEEEE
Query sfDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDA--KEVXDASGLVVSPGXVDAH   58
ident    | || |  |        |     | |  ||  |          | |  | ||  |  
Sbjct -dRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPggVKTIEANGRMVIPGGIDVN   59
DSSP  -lEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLLLLllLEEEELLLLEEEELEEEEE


DSSP  ELL------LHHHHHHHHHHLLEEEEEELLLLLlllllLHHHHHHHHHHHLLLLLLEEEE
Query THI------GYETGTRAAAKGGITTXIEXPLNQlpatvDRASIELKFDAAKGKLTIDAAQ  112
ident |            |||||  || |  |              | |    ||  |   |   
Sbjct TYLqktaadDFFQGTRAALVGGTTMIIDHVVPE-pgssLLTSFEKWHEAADTKSCCDYSL  118
DSSP  ELLllllllLHHHHHHHHHHLLEEEEEEEELLL-llllHHHHHHHHHHHHHLLLLLEEEE


DSSP  LEELLLL---LLLLHHHHHH-HLLLLEEEEL-----LLLLHHHHHHHHHHHHHHLLLEEE
Query LGGLVSY---NIDRLHELDE-VGVVGFXCFV-----RDVNDWQFFKGAQKLGELGQPVLV  163
ident      |        |  |    ||  |             | |       |  ||   ||
Sbjct HVDITSWydgVREELEVLVQdKGVNSFQVYMaykdvYQMSDSQLYEAFTFLKGLGAVILV  178
DSSP  EEELLLLlllHHHHHHHHHHlLLLLEEEEELlllllLLLLHHHHHHHHHHHHHHLLEEEE


DSSP  ELLLHHHHHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHHHHHHHHHHHHLLLEEELLLLL
Query HCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHVSS  223
ident | ||              |         |||   | ||  |    |    |      | |
Sbjct HAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMS  238
DSSP  ELLLHHHHHHHHHHHHHLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHHLLLEEEEEELL


DSSP  HHHHHHHHHHHHLLLLEEEEELLHHHHLLHHHHHH----HLHHHLLLLLLL-LHHHHHHH
Query PEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEE----IGTLAKCSPPIR-DLENQKGX  278
ident          ||  |     |        |                 |||   |       
Sbjct KSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSknwaKAAAFVTSPPLSpDPTTPDYL  298
DSSP  HHHHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLllhhHHHHLLLLLLLLlLLLHHHHH


DSSP  HHHHHLLLLLEELLLLLLLLLLLLLLL---LLLLLLLLLLHHHHHHHHHHHHLLLLLLLH
Query WEKLFNGEIDCLVSDHSPCPPEXKAGN---IXKAWGGIAGLQSCXDVXFDEAVQKRGXSL  335
ident    |  |      | | |     ||           |  |      |  | ||       
Sbjct TSLLACGDLQVTGSGHCPYSTAQKAVGkdnFTLIPEGVNGIEERMTVVWDKAVATGKMDE  358
DSSP  HHHHHHLLLLLLLLLLLLLLHHHHHHHlllHHHLLLLLLLLLLHHHHHHHHHLLLLLLLH


DSSP  HHHHHHHLHHHHHHLLLL-LLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLL
Query PXFGKLXATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGR  394
ident   |     |||| || |   ||||| | ||| |   |      |              | 
Sbjct NQFVAVTSTNAAKIFNLYpRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGM  418
DSSP  HHHHHHHLHHHHHHHLLLlLLLLLLLLLLLLEEEEEEEEEEELLLLLLLLLLLLLLLLLL


DSSP  EELLEEEEEEELLEEEEELLlLLLLLL-LLLEELLL------------------------
Query TIGARITKTILRGDVIYDIEqGFPVAP-KGQFILKH------------------------  429
ident          |  |           |    | ||                           
Sbjct ECHGSPLVVISQGKIVFEDG-NINVNKgMGRFIPRKafpehlyqrvkirnkvfglqgvsr  477
DSSP  EEEEEEEEEEELLEEEEELL-EELLLLlLLLLLLLLlllhhhhhhhhhhhhhllllllll


No 5: Query=3e74A Sbjct=3giqA Z-score=34.0

back to top
DSSP  -LEEEEEELLEEEL--LLLEEELEEEEELLEEEEEEL-LLLLEEEEEELLLLEEEELEEE
Query -SFDLIIKNGTVIL--ENEARVVDIAVKGGKIAAIGQ-DLGDAKEVXDASGLVVSPGXVD   56
ident    |  |  |  |       |  |  |  | |||||      |    ||||  | ||  |
Sbjct eKLDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGElGAHPARHAWDASGKIVAPGFID   60
DSSP  lLEEEEEELLEELLllLLLLEELEEEEELLEEEEEELlLLLLEEEEEELLLLEEEELEEE


DSSP  EEELL--LHHH--hHHHHHHLLEEEEEELL--LLLLLL---------------lllhHHH
Query AHTHI--GYET--gTRAAAKGGITTXIEXP--LNQLPA---------------tvdrASI   95
ident  | |           |     ||||           ||                   |  
Sbjct VHGHDdlMFVEkpdLRWKTSQGITTVVVGNcgVSAAPAplpgntaaalallgetplfADV  120
DSSP  LLLLLllHHHHlllLHHHHLLLEEEEEELLllLLLLLLlllllllhhhhhhllllllLLH


DSSP  HHHHHHH-LLLLLLEEEELEELL-------------------lLLLLLHHHHHHHLLLLE
Query ELKFDAA-KGKLTIDAAQLGGLV-------------------sYNIDRLHELDEVGVVGF  135
ident    | |       |  | | |                         | |    | | |||
Sbjct PAYFAALdAQRPMINVAALVGHAnlrlaamrdpqaaptaaeqqAMQDMLQAALEAGAVGF  180
DSSP  HHHHHHHhHLLLLLEEEEEEEHHhhhhhhlllllllllhhhhhHHHHHHHHHHHHLLLEE


DSSP  EEEL---LLLL--HHHHHHHHHHHHHHLLLEEEELLLhhhhhhhhhhhhhhllllhhhhh
Query XCFV---RDVN--DWQFFKGAQKLGELGQPVLVHCENalicdelgeeakregrvtahdyv  190
ident                     |    |       |  |                       
Sbjct STGLayqPGAVaqAAELEGLARVAAERRRLHTSHIRN-----------------------  217
DSSP  EEELlllLHHHllHHHHHHHHHHHHHLLLEEEEELLL-----------------------


DSSP  hlllHHHHHHHHHHHHHHHHHHLLLEEELLLLL---------HHHHHHHHHHHHLLLLEE
Query asrpVFTEVEAIRRVLYLAKVAGCRLHVCHVSS---------PEGVEEVTRARQEGQDIT  241
ident           |   ||      ||   | |                    |||  |    
Sbjct ---eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDRAREQGVEVA  274
DSSP  ---lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHHHHHLLLLEE


DSSP  EEELLHH-------hhllhhhhHHHL----------------------------------
Query CESCPHY-------fvldtdqfEEIG----------------------------------  260
ident     |                                                       
Sbjct LDIYPYPgsstiliperaetidDIRItwstphpecsgeyladiaarwgcdkttaarrlap  334
DSSP  EEELLLLeeeeellhhhlllllLLEEeeelllhhhllllhhhhhhhhlllhhhhhhhhll


DSSP  -HHHLllllLLLHhhHHHHHHHHHlLLLLEELLLLLLLLLllllllllllllLLLLHHHH
Query -TLAKcsppIRDLenQKGXWEKLFnGEIDCLVSDHSPCPPexkagnixkawgGIAGLQSC  319
ident                                 ||  |                   |   
Sbjct aGAIY----FAMD--EDEVKRIFQ-HPCCMVGSDGLPNDA-----------rPHPRLWGS  376
DSSP  eEEEE----ELLL--HHHHHHHHH-LLLEEELLLLLLLLL-----------lLLLHHHHH


DSSP  HHHHHHHHLLLLL-LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLleell
Query XDVXFDEAVQKRG-XSLPXFGKLXATNAADIFGLQQKGRIAPGKDADFVFIQPNSsyvlt  378
ident         |       |           |  ||    |   ||  || |   |       
Sbjct FTRVLGRYVREARlMTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVFDPDT-----  431
DSSP  HHHHHHHHHHHLLlLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLLL-----


DSSP  hhhllllllllLLLLL--eelLEEEEEEELLEEEEelllLLLL--LLLLLEELLl
Query nddleyrhkvsPYVGR--tigARITKTILRGDVIYdieqGFPV--APKGQFILKh  429
ident                        |      |          |      ||     
Sbjct -------vadrATWDEptlasVGIAGVLVNGAEVF----PQPPadGRPGQVLRAx  475
DSSP  -------llllLLLLLlllllLLEEEEEELLEEEE----LLLLllLLLLLLLLLl


No 6: Query=3e74A Sbjct=3pnuA Z-score=31.5

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeELLL-LEEEELEEEEEE
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxDASG-LVVSPGXVDAHT   59
ident                                                         | | 
Sbjct ----------------------------------------enlYFQSnAMKLKNPLDMHL   20
DSSP  ----------------------------------------lllLLLLlLEEEELLEEEEE


DSSP  LL----LHHHHHHHHHHlLEEEEEELLLlLLLLLLLHHHHHHHHHHHLLLL---LLEEEE
Query HI----GYETGTRAAAKgGITTXIEXPLnQLPATVDRASIELKFDAAKGKL---TIDAAQ  112
ident |       |      |          |    |                            
Sbjct HLrdnqMLELIAPLSAR-DFCAAVIMPN-LIPPLCNLEDLKAYKMRILKACkdeNFTPLM   78
DSSP  LLllhhHHHHHHHHHHL-LLLEEEELLL-LLLLLLLHHHHHHHHHHHHHHHlllLLEEEE


DSSP  LEELLlLLLL-LHHHHHHhLLLLEEEEL--------LLLLH---HHHHHHHHHHHHHLLL
Query LGGLVsYNID-RLHELDEvGVVGFXCFV--------RDVND---WQFFKGAQKLGELGQP  160
ident             |         | |             |                 |  |
Sbjct TLFFK-NYDEkFLYSAKD-EIFGIXLYPagittnsnGGVSSfdiEYLKPTLEAMSDLNIP  136
DSSP  EEELL-LLLHhHHHHHLL-LLLEEEELLllllllllLLLLLllhHHHHHHHHHHHHLLLL


DSSP  EEEELLLHHhhhhhhhhhhhhllllhhhhhhLLLHhHHHHHHHHHHHHHHHH-LLLEEEL
Query VLVHCENALicdelgeeakregrvtahdyvaSRPVfTEVEAIRRVLYLAKVA-GCRLHVC  219
ident  ||| |                               |         |||          
Sbjct LLVHGETND----------------------FVMD-RESNFAKIYEKLAKHFpRLKIVME  173
DSSP  EEELLLLLL----------------------LHHH-LLHHHHHHHHHHHHHLlLLLEEEL


DSSP  LLLLHHHHHHHHHHhhllLLEEEEELLHHHHLLHHHHH--HHLHHHLLLLLLLLHHHHHH
Query HVSSPEGVEEVTRArqegQDITCESCPHYFVLDTDQFE--EIGTLAKCSPPIRDLENQKG  277
ident |       |                  |      |            | |     |    
Sbjct HITTKTLCELLKDY----ENLYATITLHHLIITLDDVIggKMNPHLFCKPIAKRYEDKEA  229
DSSP  LLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHHllLLLHHHLLLLLLLLHHHHHH


DSSP  HHHHHHLLL-LLEELLLLLLLLLllllllllLLLLLLLLHHHHHHHHHHHHLllLLLLHH
Query XWEKLFNGE-IDCLVSDHSPCPPexkagnixKAWGGIAGLQSCXDVXFDEAVqkRGXSLP  336
ident   |  | |       ||  | |             |         |           |  
Sbjct LCELAFSGYeKVMFGSDSAPHPK--------GCAAGVFSAPVILPVLAELFK--QNSSEE  279
DSSP  HHHHHHLLLlLEEELLLLLLLLL--------LLLLLLLLHHHHHHHHHHHHH--HHLLHH


DSSP  HHHHHHLHHHHHHLLLLLlllllllLLLLEEEEELlLLEELLHHH-lllLLLLLLLLLLE
Query XFGKLXATNAADIFGLQQkgriapgKDADFVFIQPnSSYVLTNDD-leyRHKVSPYVGRT  395
ident    |    |   |  |         |                |         |    |  
Sbjct NLQKFLSDNTCKIYDLKF-------KEDKILTLEE-KEWQVPNVYedkyNQVVPYMAGEI  331
DSSP  HHHHHHLHHHHHHHLLLL-------LLLLEEEEEL-LLEELLLLEelllLEELLLLLLLE


DSSP  ELLEEEEeeelleeeeelllllllllllleelll
Query IGARITKtilrgdviydieqgfpvapkgqfilkh  429
ident                                   
Sbjct LKFQLKH---------------------------  338
DSSP  ELLEELL---------------------------


No 7: Query=3e74A Sbjct=3nqbA Z-score=28.9

back to top
DSSP  ----------------------LEEEEEELLEEELL--LLEEELEEEEELLEEEEEEL--
Query ----------------------SFDLIIKNGTVILE--NEARVVDIAVKGGKIAAIGQ--   34
ident                        ||  |  ||       | |  ||   |  ||      
Sbjct epadlnddtlraravaaargdqRFDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpa   60
DSSP  llhhhllhhhhhhhhhhhhlllLEEEEEELLEEELLllLLEEELEEEEELLEEEEEELll


DSSP  LLLLEEEEEELLLLEEEELEEEEEELL-----LHHHHHHHHHHLLEEEEEELLLL--LLL
Query DLGDAKEVXDASGLVVSPGXVDAHTHI-----GYETGTRAAAKGGITTXIEXPLN--QLP   87
ident    ||  | || |  ||||  | | ||            |    | ||    |       
Sbjct SRRDAAQVIDAGGAYVSPGLIDTHXHIessxiTPAAYAAAVVARGVTTIVWDPHEfgNVH  120
DSSP  LLLLEEEEEELLLLEEEELEEEEEELHhhhllLHHHHHHHHHLLLEEEEEELLHHhhHHH


DSSP  LlllHHHHHHHHHHHLLlLLLEEEELEELL------------lLLLLLHHHHHHHL-LLL
Query AtvdRASIELKFDAAKGkLTIDAAQLGGLV------------sYNIDRLHELDEVG-VVG  134
ident              |    |   |  |                      |  |       |
Sbjct G---VDGVRWAAKAIEN-LPLRAILLAPSCvpsapglerggadFDAAILADLLSWPeIGG  176
DSSP  L---HHHHHHHHHHHLL-LLLEEEEEELLLlllllllllllllLLHHHHHHHHLLLlEEE


DSSP  E-EEELlLLLH----HHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhh
Query F-XCFVrDVND----WQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdy  189
ident                       |        |  |                         
Sbjct IaEIXN-XRGVierdPRXSGIVQAGLAAEKLVCGHAR-----------------------  212
DSSP  EeEELL-HHHHhlllHHHHHHHHHHHHHLLEEEELLL-----------------------


DSSP  hhlllhhHHHH-HHHHHHHHHhhhllLEEELLLLLHHHHHHHHHHHhllllEEEEELLHH
Query vasrpvfTEVE-AIRRVLYLAkvagcRLHVCHVSSPEGVEEVTRARqegqdITCESCPHY  248
ident                                   | |      ||       | |     
Sbjct -------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-----LTIELRGSH  255
DSSP  -------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-----LEEEEELLL


DSSP  HHLlhhhhhhhlhhhllllllllhhhHHHHHHHH---HLLL-LLEELLLLLLLLllllll
Query FVLdtdqfeeigtlakcsppirdlenQKGXWEKL---FNGE-IDCLVSDHSPCPpexkag  304
ident   |                              |           |  |           
Sbjct DHL-----------------------LPEFVAALntlGHLPqTVTLCTDDVFPD------  286
DSSP  HHH-----------------------HHHHHHHHhhhLLLLlLEEEELLLLLHH------


DSSP  lllllllllllhHHHHhHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLL
Query nixkawggiaglQSCXdVXFDEAVqKRGXSLPXFGKLXATNAADIFGLQQKGRIAPGKDA  364
ident                        |   |            |||   |    | || |  |
Sbjct -------dllqgGGLD-DVVRRLV-RYGLKPEWALRAATLNAAQRLGRSDLGLIAAGRRA  337
DSSP  -------hhhhlLLHH-HHHHHHH-HLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLL


DSSP  LEEEEELllleellhhhllllllllllllleELLEEEEEEELLEEEEELLlLLLLLL---
Query DFVFIQPnssyvltnddleyrhkvspyvgrtIGARITKTILRGDVIYDIEqGFPVAP---  421
ident | |                             |         |           |     
Sbjct DIVVFED-----------------------lNGFSARHVLASGRAVAEGG-RXLVDIptc  373
DSSP  LEEEELL-----------------------lLLLLEEEEEELLEEEEELL-EELLLLlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct dttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegat  433
DSSP  llhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleelllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct xisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavig  493
DSSP  eeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct tgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkac  553
DSSP  llleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhh


DSSP  --------------------------llleelll
Query --------------------------kgqfilkh  429
ident                                   
Sbjct fgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hlllllllllleelllleeelllleeellleeel


No 8: Query=3e74A Sbjct=1onxA Z-score=28.1

back to top
DSSP  ------LEEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLL----eEEEEELLLLEE
Query ------SFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGD----aKEVXDASGLVV   50
ident                           |  |  ||| |              | | ||   
Sbjct midytaAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSdivpnCTVVDLSGQIL   60
DSSP  llllhhHLLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLlllllLEEEELLLLEE


DSSP  EELEEEEEELL-------------LHHHhHHHHHHLLEEEEEELLLLL--LLLLllhhhh
Query SPGXVDAHTHI-------------GYETgTRAAAKGGITTXIEXPLNQ--LPATvdrasi   95
ident  ||  | | |                          | |                     
Sbjct CPGFIDQHVHLiggggeagpttrtPEVA-LSRLTEAGVTSVVGLLGTDsiSRHP------  113
DSSP  EELEEEEEELLllllllllhhhllLLLL-HHHHHHLLEEEEEELLLLLllLLLH------


DSSP  HHHHHHHLL--LLLLEEEELEE-lLLLL---lLLHHHH-HHHL-LLLEEEEL-----LLL
Query ELKFDAAKG--KLTIDAAQLGG-lVSYN---iDRLHEL-DEVG-VVGFXCFV-----RDV  142
ident |             | |  | |                      | | ||          
Sbjct ESLLAKTRAlnEEGISAWMLTGayHVPSrtitGSVEKDvAIIDrVIGVXCAIsdhrsAAP  173
DSSP  HHHHHHHHHhhHHLLEEEEEEEllLLLLllllLLHHHHhHHLLlEEEEEEEElllllLLL


DSSP  LHHHHHHHHHHHHHHL------LLEEEELLLHHhhhhhhhhhhhhllllhhhhhhlllhh
Query NDWQFFKGAQKLGELG------QPVLVHCENALicdelgeeakregrvtahdyvasrpvf  196
ident         |      |           |                                
Sbjct DVYHLANMAAESRVGGllggkpGVTVFHMGDSK---------------------------  206
DSSP  LHHHHHHHHHHHHHHHhhhlllLEEEEEELLLL---------------------------


DSSP  hhhHHHHHHHHHHHHHLL---LEEELLLL----LHHHHHHHHHHHhllllEEEEELLH--
Query tevEAIRRVLYLAKVAGC---RLHVCHVS----SPEGVEEVTRARqegqdITCESCPH--  247
ident     |      |          |   ||       |   |  |        |        
Sbjct ---KALQPIYDLLENCDVpisKLLPTHVNrnvpLFEQALEFARKG-----GTIDITSSid  258
DSSP  ---LLLHHHHHHHHLLLLlhhHEEEELHHhlhhHHHHHHHHHHLL-----LLEEEELLll


DSSP  ---HHHLlhhhhhhhlhhhllllllllhhhhhhHHHHHH-LLLL--LEELLLLLLLllll
Query ---YFVLdtdqfeeigtlakcsppirdlenqkgXWEKLF-NGEI--DCLVSDHSPCppex  301
ident                                                 | ||        
Sbjct epvAPAE-------------------------gIARAVQaGIPLarVTLSSDGNGSqpff  293
DSSP  lllLHHH-------------------------hHHHHHHlLLLHhhEEEELLLLLEeeee


DSSP  llllLLLLLLLlLLHHHHHhHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLL
Query kagnIXKAWGGiAGLQSCXdVXFDEAVQKRGXSLPXFGKLXATNAADIFGLQQKGRIAPG  361
ident          |  ||            |     |            |    |  || | ||
Sbjct ddegNLTHIGV-AGFETLL-ETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPG  351
DSSP  llllLEEEEEE-LLLHHHH-HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLL


DSSP  LLLLEEEEELLlleellhhhllllllllllllleelLEEEEEEELLEEEEELLlLLLLLL
Query KDADFVFIQPNssyvltnddleyrhkvspyvgrtigARITKTILRGDVIYDIEqGFPVAP  421
ident  |||     |                           ||     ||           |  
Sbjct NDADLLVMTPE-------------------------LRIEQVYARGKLMVKDG-KACVKG  385
DSSP  LLLLEEEELLL-------------------------LLEEEEEELLEEEEELL-EELLLL


DSSP  llleelll
Query kgqfilkh  429
ident         
Sbjct ---tfetd  390
DSSP  ---lllll


No 9: Query=3e74A Sbjct=2vunA Z-score=27.1

back to top
DSSP  lEEEEEELL-EEEL---LLLEEEL-EEEEELLEEEEEEL-LLLL---eEEEEELLLLEEE
Query sFDLIIKNG-TVIL---ENEARVV-DIAVKGGKIAAIGQ-DLGD---aKEVXDASGLVVS   51
ident     ||||                  | |  | |||||   |          || |  | 
Sbjct -SKTIIKNIgKIVSgdiKSPVLQAdTIVVEDGLIAAIGGeELMKdagdATIIDAAGSTVT   59
DSSP  -LEEEEELLlEEELlllLLLEELLlEEEEELLEEEEEELhHHHLllllLEEEELLLLEEE


DSSP  ELEEEEEEL-LLHH--------HHHHHHHHLLEEEEEELLLL-LLLL-----LLLHhHHH
Query PGXVDAHTH-IGYE--------TGTRAAAKGGITTXIEXPLN-QLPA-----TVDRaSIE   96
ident ||  | | |  |               |  || || |                       
Sbjct PGLLDTHVHvSGGDyaprqktmDFISSALHGGVTTMISAGSPhFPGRpkdaaGTKA-LAI  118
DSSP  ELEEEEEELlLLLLeehhhleeLHHHHHHLLLEEEEEELLLLlLLLLlllhhHHHH-HHH


DSSP  HHHHHH-LLLLL-LEEEE-LEELLLLLLL-LHHHHHHHLLLLEE-EELLLL-LHHHHHHH
Query LKFDAA-KGKLT-IDAAQ-LGGLVSYNID-RLHELDEVGVVGFX-CFVRDV-NDWQFFKG  150
ident                       |          |    ||            |       
Sbjct TLSKSYyNARPAgVKVHGgAVILEKGLTEeDFIEMKKEGVWIVGeVGLGTIkNPEDAAPM  178
DSSP  HHHHHHhHLLHHhLEEELlEELLLLLLLHhHHHHHHHLLLLEEEeELLLLLlLHHHHHHH


DSSP  HHHHHHHLLLEEEEL-LLHHHHHhhhhhhhhhllllhhhhhhlllhHHHHhhHHHHHHHH
Query AQKLGELGQPVLVHC-ENALICDelgeeakregrvtahdyvasrpvFTEVeaIRRVLYLA  209
ident        |  |  |                                 |       |    
Sbjct VEWAHKHGFKVQMHTgGTSIPGS-----------------------STVT--ADDVIKTK  213
DSSP  HHHHHHLLLEEEEELlLLLLLLL-----------------------LLLL--HHHHHHHL


DSSP  hhhllLEEELLLL------LHHHHHHHHHHHhlllLEEEEELLHHHhllhhhhhhhlhhh
Query kvagcRLHVCHVS------SPEGVEEVTRARqegqDITCESCPHYFvldtdqfeeigtla  263
ident         | |        |   |           |   |                    
Sbjct -----PDVVSHINggptaiSVQEVDRIMDET----DFAMEIVQCGN--------------  250
DSSP  -----LLEEELLLllllllLHHHHHHHHHHL----LLEEEEELLLL--------------


DSSP  llllllllhhhHHHHHHHHHLL------lLLEELLLLLLllllllllllllllLLLLLhH
Query kcsppirdlenQKGXWEKLFNG------eIDCLVSDHSPcppexkagnixkawGGIAGlQ  317
ident             |                      |                 |      
Sbjct -----------PKIADYVARRAaekgqlgRVIFGNDAPS--------------GTGLI-P  284
DSSP  -----------HHHHHHHHHHHhhhllhhHEEEELLLLL--------------LLLLL-L


DSSP  HHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEEELlLLEEl
Query SCXDVXFDEAVQKRGXSLPXFGKLXATNAADIFGLqQKGRIAPGKDADFVFIQPnSSYVl  377
ident                            |     ||   | ||||| ||            
Sbjct LGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL-NTGVIAPGKEADLIIMDT-PLGS-  341
DSSP  LHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEEL-LLLL-


DSSP  lhhhllllllllllllleELLEEEEEEELLEEEEELllllllllllleelll
Query tnddleyrhkvspyvgrtIGARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
ident                       |      |                      
Sbjct ------vaedamgaiaagDIPGISVVLIDGEAVVTK--srntppakraakil  385
DSSP  ------llllhhhhhhhlLLLEEEEEEELLEEEELL--llllllllllleel


No 10: Query=3e74A Sbjct=1yrrB Z-score=26.5

back to top
DSSP  leeEEEELLEEELLLLEEE-LEEEEELLEEEEEEL--LLLLEEEEEELLLLEEEELEEEE
Query sfdLIIKNGTVILENEARV-VDIAVKGGKIAAIGQ--DLGDAKEVXDASGLVVSPGXVDA   57
ident         |      |           | |        |    |     |   |||  | 
Sbjct ---YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPvaELPPEIEQRSLNGAILSPGFIDV   57
DSSP  ---LEEELLEEELLLLEELlEEEEEELLEEEEEEEhhHLLLLLLEEELLLLEEEELEEEE


DSSP  EELL----------------LHHHHHHHHHHLLEEEEEELLLL-lLLLLllHHHHHHHHH
Query HTHI----------------GYETGTRAAAKGGITTXIEXPLN-qLPATvdRASIELKFD  100
ident                       |    |  | | |                         
Sbjct QLNGcggvqfndtaeavsveTLEIMQKANEKSGCTNYLPTLITtsDELM--KQGVRVMRE  115
DSSP  EELEelleelllllllllhhHHHHHHHHHHLLLEEEEEEEELLllHHHH--HHHHHHHHH


DSSP  HHLLLLlLEEE-ELEELL---LLLLLLHHHHHhHLLLLEEEELlllLHHHhHHHHHHHHH
Query AAKGKLtIDAA-QLGGLV---SYNIDRLHELDeVGVVGFXCFVrdvNDWQfFKGAQKLGE  156
ident          |               | | |                          ||  
Sbjct YLAKHP-NQALgLHLEGPwlnAALVDFLCENA-DVITKVTLAP---EMVP-AEVISKLAN  169
DSSP  HHHHLL-LLLLlEEEELLlllLHHHHHHHHLH-HHEEEEEELH---HHLL-HHHHHHHHH


DSSP  HLLLEEEELLLhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHHHHHHHHHlLLE
Query LGQPVLVHCENalicdelgeeakregrvtahdyvasrpvfteveAIRRVLYLAKVAgCRL  216
ident  |  |     |                                 |          |    
Sbjct AGIVVSAGHSN---------------------------------ATLKEAKAGFRA-GIT  195
DSSP  HLLEEEELLLL---------------------------------LLHHHHHHHHHH-LEE


DSSP  EELLLLL---------hhHHHHHHHHHhlllLEEEEELLhhHHLLhhhhhhhlhhhllll
Query HVCHVSS---------peGVEEVTRARqegqDITCESCPhyFVLDtdqfeeigtlakcsp  267
ident    |                           || |        |                
Sbjct FATHLYNampyitgrepgLAGAILDEA----DIYCGIIA--DGLH---------------  234
DSSP  EELLLLLllllllllllhHHHHHHHLL----LLEEEEEL--LLLL---------------


DSSP  llllhhhHHHHHHHHHLLL--LLEELLLLLlllllllllllllllLLLLLhhHHHHhHHH
Query pirdlenQKGXWEKLFNGE--IDCLVSDHSpcppexkagnixkawGGIAGlqSCXDvXFD  325
ident                        ||| |                  |             
Sbjct ------vDYANIRNAKRLKgdKLCLVTDAT---------------SGSSL--TMIE-GVR  270
DSSP  ------lLHHHHHHHHHHHhhHEEEELLLL---------------LLLLL--LHHH-HHH


DSSP  HHLLLLLLLHHHHHHHHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELLlleellhhhlll
Query EAVQKRGXSLPXFGKLXATNAADIFGL-QQKGRIAPGKDADFVFIQPNssyvltnddley  384
ident   |   |  |           |   |     |  | || |      |             
Sbjct NLVEHCGIALDEVLRMATLYPARAIGVeKRLGTLAAGKVANLTAFTPD------------  318
DSSP  HHHHHHLLLHHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLLEEEELLL------------


DSSP  lllllllllleelLEEEEEEELLEEEEELllllllllllleelll
Query rhkvspyvgrtigARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
ident                |||||  |                      
Sbjct -------------FKITKTIVNGNEVVTQ----------------  334
DSSP  -------------LLEEEEEELLEEEEEL----------------


No 11: Query=3e74A Sbjct=4cqbA Z-score=24.5

back to top
DSSP  --LEEEEEELLEEELllLEEELEEEEELLEEEEEELLLLL-EEEEEELLLLEEEELEEEE
Query --SFDLIIKNGTVILenEARVVDIAVKGGKIAAIGQDLGD-AKEVXDASGLVVSPGXVDA   57
ident    ||||| |          | ||   |  |  |        |   || |  |||| |||
Sbjct skDFDLIIRNAYLSE--KDSVYDIGIVGDRIIKIEAKIEGtVKDEIDAKGNLVSPGFVDA   58
DSSP  llLEEEEEEEEEELL--LLEEEEEEEELLEEEEEELLLLLlEEEEEELLLLLEEELEEEE


DSSP  EELL------------------------------------------LHHHHHHHHHHLLE
Query HTHI------------------------------------------GYETGTRAAAKGGI   75
ident |||                                                       | 
Sbjct HTHMdksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGT  118
DSSP  EELHhhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLE


DSSP  EEEEELLLlllllllLHHHHHHHHHHHLLLL-LLEEEELEELL------LLLLLLHHHHH
Query TTXIEXPLnqlpatvDRASIELKFDAAKGKL-TIDAAQLGGLV------SYNIDRLHELD  128
ident                     |    |       ||                         
Sbjct LYTRTHVD--vdsvaKTKAVEAVLEAKEELKdLIDIQVVAFAQsgffvdLESESLIRKSL  176
DSSP  EEEEEEEE--lllllLLHHHHHHHHHHHHLLlLLEEEEEEELLllllllLLHHHHHHHHH


DSSP  HHLLLLEEEEL----lllLHHHHHHHHHHHHHHLLLEEEELLLhhhhhhhhhhhhhhlll
Query EVGVVGFXCFV----rdvNDWQFFKGAQKLGELGQPVLVHCENalicdelgeeakregrv  184
ident   |                            |       |                    
Sbjct DMGCDLVGGVDpatrennVEGSLDLCFKLAKEYDVDIDYHIHD-----------------  219
DSSP  HHLLLEEELLLlllllllHHHHHHHHHHHHHHLLLEEEEEELL-----------------


DSSP  lhhhhhhlllHHHHHHHHHHHHHHHHHHLL--LEEELLLL-LHHH----hhhHHHHHHlL
Query tahdyvasrpVFTEVEAIRRVLYLAKVAGC--RLHVCHVS-SPEG----veeVTRARQeG  237
ident               |  | |        |   |    |                      
Sbjct ---------iGTVGVYSINRLAQKTIENGYkgRVTTSHAWcFADApsewldeAIPLYK-D  269
DSSP  ---------lHHHHHHHHHHHHHHHHHLLLllLEEEEELLhHHHLlhhhhhhHHHHHH-H


DSSP  LLEEEEELLHHHhllhhhhhhhlhhhllllllllhhhHHHHhhHHHLL----LLLEELLL
Query QDITCESCPHYFvldtdqfeeigtlakcsppirdlenQKGXweKLFNG----EIDCLVSD  293
ident        |                                                  ||
Sbjct SGMKFVTCFSST-------------------------PPTM--PVIKLleagINLGCASD  302
DSSP  HLLEEEEELLLL-------------------------LLLL--LHHHHhhllLEEEEELL


DSSP  LLLLllllllllllllLLLL-LLHHhHHHHHHHHH---llLLLLLHHHHHHHHLHHHHHH
Query HSPCppexkagnixkaWGGI-AGLQsCXDVXFDEA---vqKRGXSLPXFGKLXATNAADI  349
ident                                  |      |    |    |      |  
Sbjct NIRD------------FWVPfGNGD-MVQGALIETqrlelKTNRDLGLIWKMITSEGARV  349
DSSP  LLLL------------LLLLlLLLL-HHHHHHHHHhhhllLLHHHHHHHHHHHLHHHHHH


DSSP  LL-LLLLlLLLLLLLLLEEEEELllleellhhhllllllllllllleELLE-EEEEEELL
Query FG-LQQKgRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrtIGAR-ITKTILRG  407
ident  |       |  || || |                            |        |  |
Sbjct LGiEKNY-GIEVGKKADLVVLNS-----------------lspqwaiIDQAkRLCVIKNG  391
DSSP  HLlHHHL-LLLLLLLLLEEEELL-----------------llhhhhhHHLLlEEEEEELL


DSSP  EEEEELLlLLLLllllleelll
Query DVIYDIEqGFPVapkgqfilkh  429
ident   |   |               
Sbjct RIIVKDE-VIVA----------  402
DSSP  EEEEELL-EELL----------


No 12: Query=3e74A Sbjct=2ogjA Z-score=24.0

back to top
DSSP  leEEEEELLEEE-LLLL--EEELEEEEE-LLEEEEEELLLLLE-EEEEELLlLEEEELEE
Query sfDLIIKNGTVI-LENE--ARVVDIAVK-GGKIAAIGQDLGDA-KEVXDASgLVVSPGXV   55
ident        |               ||     ||||| |  |               ||| |
Sbjct qaPILLTNVKPVgFGKGasQSSTDILIGgDGKIAAVGSALQAPaDTQRIDA-AFISPGWV   59
DSSP  llLEEEEEEEELlLLLLllLLLEEEEELlLLLEEEEELLLLLLlLEEELLL-LEEEELEE


DSSP  EEEELLLH-----hhHHHH-HHHLLEEEEEELLLlllllLLLHhHHHHHHHHHLLLLLLE
Query DAHTHIGY-----etGTRA-AAKGGITTXIEXPLnqlpaTVDRaSIELKFDAAKGKLTID  109
ident | | ||               |  | ||                                
Sbjct DLHVHIWHggtdisiRPSEcGAERGVTTLVDAGS-----AGEA-NFHGFREYIIEPSRER  113
DSSP  EEEELLLLlllllllLHHHlLHHHLEEEEEEELL-----LLLL-LHHHHHHHLLLLLLLE


DSSP  EEELEELL-----------------LLLLLLHH-HHHHHL--LLLEEEEL-----lllLH
Query AAQLGGLV-----------------SYNIDRLH-ELDEVG--VVGFXCFV-----rdvND  144
ident       |                      ||      |     || |             
Sbjct IKAFLNLGsiglvacnrvpelrdikDIDLDRILeCYAENSehIVGLXVRAshvitgswGV  173
DSSP  EEEEEELLlllllllllllllllhhHLLHHHHHhHHHLLLllEEEEEEEElhhhhlllLL


DSSP  HHHHHHHHHHHHHLLLEEEELLLHHhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHH
Query WQFFKGAQKLGELGQPVLVHCENALicdelgeeakregrvtahdyvasrpvfteveAIRR  204
ident      |      |  |  ||                                        
Sbjct TPVKLGKKIAKILKVPXXVHVGEPP------------------------------aLYDE  203
DSSP  HHHHHHHHHHHHHLLLEEEEELLLL------------------------------lLHHH


DSSP  HHHHHHhhllLEEELLL-------LLHH---HHHHHHHHHhlllLEEEEELLhhhhllhh
Query VLYLAKvagcRLHVCHV-------SSPE---GVEEVTRARqegqDITCESCPhyfvldtd  254
ident ||           | |        |  |         |       |              
Sbjct VLEILG---pGDVVTHCfngksgsSIXEdedLFNLAERCE----GIRLDIGH--------  248
DSSP  HHHHLL---lLLEEELLlllllllLLLLlhhHHHHHHHLL----LLEEELLL--------


DSSP  hhhhhlhhhlLLLLLllhhhHHHHHHHHH-LLLLLEELLLLLLlllllllllllllllLL
Query qfeeigtlakCSPPIrdlenQKGXWEKLF-NGEIDCLVSDHSPcppexkagnixkawgGI  313
ident                      |                 |                    
Sbjct ---------gGASFS-----FKVAEAAIArGLLPFSISTDLHG---------------HS  279
DSSP  ---------lLLLLL-----HHHHHHHHHlLLLLLLLLLLLLL---------------LL


DSSP  LL--hHHHHhHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLLLLllLLLLLLLLLEEEEEL
Query AG--lQSCXdVXFDEAVqKRGXSLPXFGKLXATNAADIFGLQQkgRIAPGKDADFVFIQP  371
ident                      |           | |    |    |   |  |||     
Sbjct XNfpvWDLA-TTXSKLL-SVDXPFENVVEAVTRNPASVIRLDXenRLDVGQRADFTVFDL  337
DSSP  LLlllLLHH-HHHHHHH-HLLLLHHHHHHLLLHHHHHHLLLLLllLLLLLLLLEEEEEEE


DSSP  lLLEELlhhhlllllllllllLLEELLEEEEEEELLEEEEELllllllllllleelll
Query nSSYVLtnddleyrhkvspyvGRTIGARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
ident      |                                |                   
Sbjct -VDADL-----eatdsngdvsRLKRLFEPRYAVIGAEAIAAS----------ryipra  379
DSSP  -EEEEE-----eeellllleeEEEEEEEEEEEEELLEEEELL----------llllll


No 13: Query=3e74A Sbjct=2pajA Z-score=24.0

back to top
DSSP  lEEEEEELL-EEELL-------LLEEE-LEEEEELLEEEEEELlLLLE--EEEEELLLLE
Query sFDLIIKNG-TVILE-------NEARV-VDIAVKGGKIAAIGQdLGDA--KEVXDASGLV   49
ident      | |                     ||   |  | |||  |         ||   |
Sbjct -PSTLIRNAaAIMTGgrgtaddPSRVPgPDIRIVGDTIDAIGA-LAPRpgETIVDATDCV   58
DSSP  -LEEEEELLlEELLLlllllllLLLLLlLLEEEELLEEEEELL-LLLLllLEEEELLLLE


DSSP  EEELEEEEEELL---------------------LHHHHHHHHHHLLEEEEEELLLLLLll
Query VSPGXVDAHTHI---------------------GYETGTRAAAKGGITTXIEXPLNQLpa   88
ident   |  |  | |                          |    |  |  |           
Sbjct IYPAWVNTHHHLfqsllkgepfralfderrfrlAARIGLIELARSGCATVADHNYVYY--  116
DSSP  EEELEELLLLLHhhhhllllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLLLLL--


DSSP  lllhhhhHHHHHHHLLLL---LLEEEELEELLL-------------------LLLLLHHH
Query tvdrasiELKFDAAKGKL---TIDAAQLGGLVS-------------------YNIDRLHE  126
ident                            | |                              
Sbjct ---pgmpFDSSAILFEEAeklGLRFVLLRGGATqtrqleadlptalrpetldAYVADIER  173
DSSP  ---llllLLHHHHHHHHHhhlLLEEEEEELLLLllllllllllhhhllllhhHHHHHHHH


DSSP  HHHHL---------LLLEEE--ELLLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhh
Query LDEVG---------VVGFXC--FVRDVNDWQFFKGAQKLGELGQPVLVHCEnalicdelg  175
ident |              |                   |     ||     |           
Sbjct LAARYhdaspramrRVVMAPttVLYSISPREMRETAAVARRLGLRMHSHLS---------  224
DSSP  HHHHLlllllllleEEEELLllLLLLLLHHHHHHHHHHHHHLLLEEEEELL---------


DSSP  hhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHhhllLEEELLLLLHH--HHHHHHHH
Query eeakregrvtahdyvasrpvftevEAIRRVLYLAKvagcRLHVCHVSSPE--GVEEVTRA  233
ident                                             |               
Sbjct ----------------------gkSPVAFCGEHDW-lgsDVWYAHLVKVDadEIALLAQT  261
DSSP  ----------------------llLHHHHHHHLLL-lllLEEEELLLLLLhhHHHHHHHH


DSSP  HhllllEEEEELLHhhhllhhhhhhhlhhhlllLLLLlhhhhhHHHHHHHLLLLLEELLL
Query RqegqdITCESCPHyfvldtdqfeeigtlakcsPPIRdlenqkGXWEKLFNGEIDCLVSD  293
ident            ||                                 |    |       |
Sbjct G-----TGVAHCPQ------------------sNGRL------PVREMADAGVPVSIGVD  292
DSSP  L-----LEEEELHH------------------hHHLL------LLLLHHHHLLLEEELLL


DSSP  LLLlllllllllllllllLLLLHHhHHHHHHhHHLLLLL---LLHHHHHHHHLHHHHHHL
Query HSPcppexkagnixkawgGIAGLQsCXDVXFdEAVQKRG---XSLPXFGKLXATNAADIF  350
ident                                            |            |   
Sbjct GAA---------------SNEAAD-MISEVH-MTWLAQRarlASIAEVIHWGTAGGARVM  335
DSSP  HHH---------------HLLLLL-HHHHHH-HHHHHHHhllLLHHHHHHHHLHHHHHHH


DSSP  LLLLLLLLLLLLLLLEEEEELlLLEEllhhhlllllllllllllEELLE-EEEEEELLEE
Query GLQQKGRIAPGKDADFVFIQPnSSYVltnddleyrhkvspyvgrTIGAR-ITKTILRGDV  409
ident ||   |  | |  ||                               |          |  
Sbjct GLDEVGKVAVGYAADIAVYRL-DDPR-----yfglhdpaigpvaSGGRPsVMALFSAGKR  389
DSSP  LLLLLLLLLLLLLLLEEEEEL-LLHH-----hlllllhhhhhhhLLLLLeEEEEEELLEE


DSSP  EEELLlLLLLL-------------lllleelll
Query IYDIEqGFPVA-------------pkgqfilkh  429
ident                                  
Sbjct VVVDD-LIEGVdikelggearrvvrellrevvv  421
DSSP  EEELL-LLLLLlhhhhhhhhhhhhhhhhhhhhl


No 14: Query=3e74A Sbjct=1a5kC Z-score=23.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---LEEEEEELLEEELLLLEEELEEEEELLEEEEEEL----------LLLL--eEEEEEL
Query ---SFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQ----------DLGD--aKEVXDA   45
ident      ||   |            || || | | |||                   ||  |
Sbjct aadCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKagnpdiqpnvTIPIgaaTEVIAA  120
DSSP  hhhLLLEEEEEEEEEELLEEEEEEEEEELLEEEEEELeellllllllLEELlllLEEEEL


DSSP  LLLEEEELEEEEEE-LLLHhHHHHHHHHLLEEEEEELL----LLLL--llLLLHHHHHHH
Query SGLVVSPGXVDAHT-HIGYeTGTRAAAKGGITTXIEXP----LNQL--paTVDRASIELK   98
ident  |  |  |  | |   |        |   | ||                 |     |   
Sbjct EGKIVTAGGIDTHIhWICP-QQAEEALVSGVTTMVGGGtgpaAGTHattcTPGPWYISRM  179
DSSP  LLLEEEELEEEEEEeLLLL-LHHHHHHHHLEEEEEEELllllHHHHhlllLLHHHHHHHH


DSSP  HHHHLlLLLLEEEELEELLLLLLLLHHHHHHHLLLLEEEEL-LLLLHHHHHHHHHHHHHH
Query FDAAKgKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFXCFV-RDVNDWQFFKGAQKLGEL  157
ident   ||   |      ||       | | |    || |                      | 
Sbjct LQAAD-SLPVNIGLLGKGNVSQPDALREQVAAGVIGLEIHEdWGATPAAIDCALTVADEM  238
DSSP  HHHHL-LLLLEEEEEEELLLLLHHHHHHHHHHLLLEEEEEHhHLLLHHHHHHHHHHHHHH


DSSP  LLLEEEELLLHHHhhhhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHHhlLLEE
Query GQPVLVHCENALIcdelgeeakregrvtahdyvasrpvftevEAIRRVLYLAKVagCRLH  217
ident    |  |                                         |          |
Sbjct DIQVALHSDTLNE----------------------------sGFVEDTLAAIGG--RTIH  268
DSSP  LLEEEEELLLLLL----------------------------lLLHHHHHHHHLL--LLEE


DSSP  ELLLLL------hHHHHhHHHHHhlllLEEEEELLHHHHL---LHHHHhhhlHHHL----
Query VCHVSS------pEGVEeVTRARqegqDITCESCPHYFVL---DTDQFeeigTLAK----  264
ident   |                         |   |            |              
Sbjct TFHTEGaggghapDIIT-ACAHP----NILPSSTNPTLPYtlnTIDEH----LDMLmvch  319
DSSP  ELLLLLlllllllLHHH-HHHLL----LEEEEEEHHHLLLlllHHHHH----HHHHhhhh


DSSP  ------------lllLLLLhHHHHHHHHHHHLLLLLEELLLLLllllllllllllllllL
Query ------------cspPIRDlENQKGXWEKLFNGEIDCLVSDHSpcppexkagnixkawgG  312
ident                 ||  |           |      ||                   
Sbjct hldpdiaedvafaesRIRR-ETIAAEDVLHDLGAFSLTSSDSQ----------------A  362
DSSP  llllllhhhhhllllLLLH-HHHHHHHHHHHLLLLLEEELLLL----------------L


DSSP  LLLHHHHHHHHHhHHLLLLL---------------LLHHHHHHHHLHHHHHHLLL-LLLL
Query IAGLQSCXDVXFdEAVQKRG---------------XSLPXFGKLXATNAADIFGL-QQKG  356
ident                                                | |   |     |
Sbjct MGRVGEVILRTW-QVAHRMKvqrgalaeetgdndnFRVKRYIAKYTINPALTHGIaHEVG  421
DSSP  LLLLLLHHHHHH-HHHHHHHhhhlllllllllllhHHHHHHHHLLLHHHHHHLLLlLLLL


DSSP  LLLLLLLLLEEEEELLLleellhhhllllllllllllleelLEEEEEEELLEEEEELL--
Query RIAPGKDADFVFIQPNSsyvltnddleyrhkvspyvgrtigARITKTILRGDVIYDIE--  414
ident  |  || || |   |                                |  |         
Sbjct SIEVGKLADLVVWSPAF----------------------fgVKPATVIKGGMIAIAPMgd  459
DSSP  LLLLLLLLLEEEELHHH----------------------llLLLLEEEELLEEEEEEEll


DSSP  ------------LLLLLLL-------LLLEELLL--------------------------
Query ------------QGFPVAP-------KGQFILKH--------------------------  429
ident                                |                            
Sbjct inasiptpqpvhYRPMFGAlgsarhhCRLTFLSQaaaangvaerlnlrsaiavvkgcrtv  519
DSSP  llllllllllleEEELHHHlhhhhhhHLEEEELHhhhhhlhhhhllllleeeelllllll


DSSP  -----------------------------------------------
Query -----------------------------------------------  429
ident                                                
Sbjct qkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lhhhllllllllleeelllllleeelleellllllllllllllllll


No 15: Query=3e74A Sbjct=3mtwA Z-score=23.3

back to top
DSSP  LEEEEEELLEEELL--LLEEE-LEEEEELLEEEEEEL-LLLLE--EEEEELLLLEEEELE
Query SFDLIIKNGTVILE--NEARV-VDIAVKGGKIAAIGQ-DLGDA--KEVXDASGLVVSPGX   54
ident                           |  | |  ||             |  |    || 
Sbjct AEIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKkGDAVPagATAVDLPGVTLLPGL   60
DSSP  LLEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEElLLLLLllLEEEEEEEEEEEELE


DSSP  EEEEELL---------------------LHHHHHHHHHHLLEEEEEELLlLLLLllllhh
Query VDAHTHI---------------------GYETGTRAAAKGGITTXIEXPlNQLPatvdra   93
ident  | | |                                  | ||                
Sbjct IDMHVHLdslaevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-AADY----dd  115
DSSP  EEEEELLlllllllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-LLLL----hh


DSSP  hhhhhhhhhLLLLLLEEEELE-ELLL--------------------------LLLLLHHH
Query sielkfdaaKGKLTIDAAQLG-GLVS--------------------------YNIDRLHE  126
ident                                                             
Sbjct vglreaidaGYVPGPRIVTAAiSFGAtgghcdstffppsmdqknpfnsdspdEARKAVRT  175
DSSP  hhhhhhhhlLLLLLLEEEELLlLEELlllllllllllhhhllllllllllhhHHHHHHHH


DSSP  HHHHLLLLEEEEL-------------lLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhh
Query LDEVGVVGFXCFV-------------rDVNDWQFFKGAQKLGELGQPVLVHCEnalicde  173
ident |   |    |                                  |  |  |         
Sbjct LKKYGAQVIXICAtggvfsrgnepgqqQLTYEEMKAVVDEAHMAGIKVAAHAH-------  228
DSSP  HHHLLLLEEEEELllllllllllllllLLLHHHHHHHHHHHHHLLLEEEEEEL-------


DSSP  hhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHhhhllLEEELLLLLhhHHHHHHHH
Query lgeeakregrvtahdyvasrpvftEVEAIRRVLYLAkvagcRLHVCHVSSpeGVEEVTRA  233
ident                             ||                | |      |    
Sbjct ------------------------GASGIREAVRAG-----VDTIEHASL--VDDEGIKL  257
DSSP  ------------------------LHHHHHHHHHLL-----LLEEEELLL--LLHHHHHH


DSSP  HHlLLLEEEEE-LLHHhHLLHHHHHHHLHhhllllLLLLhhHHHHHHHHHHLLL----LL
Query RQeGQDITCES-CPHYfVLDTDQFEEIGTlakcspPIRDleNQKGXWEKLFNGE----ID  288
ident                            |         ||        |            
Sbjct AV-QKGAYFSMdIYNT-DYTQAEGKKNGVlednlrKDRD--IGELQRENFRKALkagvKM  313
DSSP  HH-HHLLEEELlLLLH-HHHHHHHHHHLLlhhhhhHHHH--HHHHHHHHHHHHHhhllEE


DSSP  EELLLLLlllllllllllllllllLLLHHHHHhHHHHHHLlLLLLLHHHHHHHHLHHHHH
Query CLVSDHSpcppexkagnixkawggIAGLQSCXdVXFDEAVqKRGXSLPXFGKLXATNAAD  348
ident     |                   |          |   |   |             || 
Sbjct VYGTDAG-----------------IYPHGDNA-KQFAVMV-RYGATPLQAIQSATLTAAE  354
DSSP  ELLLLLL-----------------LLLLLLHH-HHHHHHH-HLLLLHHHHHHHLLHHHHH


DSSP  HLLLL-LLLLLLLLLLLLEEEEELllleellhhhlllllllllllllEELL--EEEEEEE
Query IFGLQ-QKGRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrTIGA--RITKTIL  405
ident   |     |  | |   |                                          
Sbjct ALGRSkDVGQVAVGRYGDMIAVAG-------------------dplaDVTTleKPVFVMK  395
DSSP  HHLLLlLLLLLLLLLLLLEEEELL-------------------llllLHHHhhLLLEEEE


DSSP  LLEEEEELllllllllllleelll
Query RGDVIYDIeqgfpvapkgqfilkh  429
ident  | |                    
Sbjct GGAVVKAP---------------x  404
DSSP  LLEEEELL---------------l


No 16: Query=3e74A Sbjct=3ooqA Z-score=22.8

back to top
DSSP  leEEEEELLEEEL-LLLEEELEEEEELLEEEEEELLLLL-EEEEEELLLLEEEELEEEEE
Query sfDLIIKNGTVIL-ENEARVVDIAVKGGKIAAIGQDLGD-AKEVXDASGLVVSPGXVDAH   58
ident       || ||          |  |  ||    |    |   |  |  |    || ||||
Sbjct --KILFKNATVFPiTSRPFKGDVLVSNGKVEKVGENIEDpDAEIVDLTGKFLFPGFVDAH   58
DSSP  --LEEEEEEEELLlLLLLEEEEEEEELLEEEEEELLLLLlLLEEEELLLLEEEELEEEEE


DSSP  EL-------------------------------LLHH-HHHHHHHHLLEEEEEELLLlll
Query TH-------------------------------IGYE-TGTRAAAKGGITTXIEXPLnql   86
ident  |                                         |  || |     |    
Sbjct SHiglfeegvgyyysdgneatdpvtphvkaldgFNPQdPAIERALAGGVTSVXIVPG---  115
DSSP  ELlllllllllhhhlllllllllllllllhhhhLLLLlHHHHHHHLLLEEEEEELLL---


DSSP  lllllhhhhhhhhhhHLLLlllEEEEleellllllllhhhhhhhLLLLEEEEL-------
Query patvdrasielkfdaAKGKltiDAAQlgglvsynidrlheldevGVVGFXCFV-------  139
ident                                                |            
Sbjct sanpvggqgsvikfrSIIV-eeCIVK------------------DPAGLKXAFgenpkrv  156
DSSP  lllleeeeeeeeellLLLH-hhHEEE------------------EEEEEEEELlhhhhhh


DSSP  ----------lllLHHHHHHH------------------------------hhHHHHHLL
Query ----------rdvNDWQFFKG------------------------------aqKLGELGQ  159
ident                                                             
Sbjct ygerkqtpstrxgTAGVIRDYftkvknyxkkkelaqkegkeftetdlkxevgeXVLRKKI  216
DSSP  hhhlllllllhhhHHHHHHHHhhhhhhhhhhhhhhhhlllllllllhhhhhhhHHHLLLL


DSSP  LEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHHHHLLLEEEL
Query PVLVHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAKVAGCRLHVC  219
ident |   |                                     |      |   |  |   
Sbjct PARXHAH-------------------------------RADDILTAIRIAEEFGFNLVIE  245
DSSP  LEEEEEL-------------------------------LHHHHHHHHHHHHHHLLLEEEE


DSSP  LLLL-HHHHHHHHHHHhllllEEEEELLHhhHLLHhhhhhhlhhhLLLLLLLlhhhHHHH
Query HVSS-PEGVEEVTRARqegqdITCESCPHyfVLDTdqfeeigtlaKCSPPIRdlenQKGX  278
ident |                    |     |                                
Sbjct HGTEaYKISKVLAEKK-----IPVVVGPL--LTFR----------TKLELKD---lTXET  285
DSSP  ELLLhHHHHHHHHHHL-----LLEEELLL--LLLL----------LLHHHLL---lLLLH


DSSP  HHHHHL-LLLLEELLLLLlllllllllllllllllLLLHHHHHhHHHHHHLlLLLLLHHH
Query WEKLFN-GEIDCLVSDHSpcppexkagnixkawggIAGLQSCXdVXFDEAVqKRGXSLPX  337
ident   ||   |    |  ||                     |     |    |    |     
Sbjct IAKLLKdGVLIALXCDHP-----------------VIPLEFAT-VQAATAX-RYGAKEED  326
DSSP  HHHHHHlLLLEEELLLLL-----------------LLLHHHHH-HHHHHHH-HHLLLHHH


DSSP  HHHHHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELllleellhhhllllllllllllleE
Query FGKLXATNAADIFGL-QQKGRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrtI  396
ident   |    | | | ||    | | |||||| |                             
Sbjct LLKILTVNPAKILGLeDRIGSIEPGKDADLVVWSG--------------------hpfdX  366
DSSP  HHHLLLHHHHHHLLLlLLLLLLLLLLLLLEEEELL--------------------llllL


DSSP  LLEEEEEEELLEEEEELLlllllllllleelll
Query GARITKTILRGDVIYDIEqgfpvapkgqfilkh  429
ident           |      |               
Sbjct KSVVERVYIDGVEVFRRE---------------  384
DSSP  LLLEEEEEELLEEEEELL---------------


No 17: Query=3e74A Sbjct=3icjA Z-score=22.6

back to top
DSSP  lEEEEEELLEEELL--LLEEELEEEEELLEEEEEEL--LLLLE-----EEEEELLLLEEE
Query sFDLIIKNGTVILE--NEARVVDIAVKGGKIAAIGQ--DLGDA-----KEVXDASGLVVS   51
ident        |||          |             |              |  |  |  | 
Sbjct -CMKALINGTIYTSfsPVKKVSGLVISNERVLYAGDssTALRIaelagGEIIDLKGKFVM   59
DSSP  -LEEEEELLEEEEEelLEEEELEEEEELLEEEEEELhhHHHHHhhhhlLEEEELLLLEEE


DSSP  ELEEEEEELL--------------------------------------------------
Query PGXVDAHTHI--------------------------------------------------   61
ident |   | | |                                                   
Sbjct PAFFDSHLHLdelgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHhhhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   61
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll


DSSP  --------LHHHHHHHHHHLLEEEEEELLllllllLLLHhHHHHHHHHHL-LLLLLEEEE
Query --------GYETGTRAAAKGGITTXIEXPlnqlpaTVDRaSIELKFDAAK-GKLTIDAAQ  112
ident           |         |                        |     | |      
Sbjct ltvkdykhYIESAQEHLLSLGVHSVGFMS------VGEK-ALKALFELEReGRLKMNVFA  232
DSSP  llhhhhhhHHHHHHHHHHHLLEEEEEEEE------ELHH-HHHHHHHHHHlLLLLLEEEE


DSSP  LEELLlllllLHHH-----hHHHL-----LLLEEEEL-----------------------
Query LGGLVsynidRLHE-----lDEVG-----VVGFXCFV-----------------------  139
ident            |                   | | ||                       
Sbjct YLSPE-----LLDKleelnlGKFEgrrlrIWGVXLFVdgslgartallsepytdnpttsg  287
DSSP  EELHH-----HHHHhhhhllLLEEllleeEEEEEEELlllllllllllllllllllllll


DSSP  -lLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhH
Query -rDVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvftE  198
ident     |             ||  | ||                                  
Sbjct elVMNKDEIVEVIERAKPLGLDVAVHAI-------------------------------G  316
DSSP  llLLLHHHHHHHHHHHLLLLLEEEEEEL-------------------------------L


DSSP  HHHHHHHHHHHHHHLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEELLHHHHLLHHhhhh
Query VEAIRRVLYLAKVAGCRLHVCHVSSpeGVEEVTRARQeGQDITCESCPHYFVLDTDqfee  258
ident   |    |     |       | |                       ||  | |      
Sbjct DKAVDVALDAFEEAEFSGRIEHASL--VRDDQLERIK-ELKVRISAQPHFIVSDWW----  369
DSSP  HHHHHHHHHHHHHHLLLLEEEELLL--LLHHHHHHHH-HHLLEEEELLLHHHHLLL----


DSSP  hlhhhllllllLLHH----hhHHHHhHHHLLL---lLEELLLLLllllllllllllllll
Query igtlakcsppiRDLE----nqKGXWeKLFNGE---iDCLVSDHSpcppexkagnixkawg  311
ident                      |     |             |                  
Sbjct -----------IVNRvgeeraKWAY-RLKTLSsitkLGFSTDSP----------------  401
DSSP  -----------HHHHhhhhhhHHLL-LHHHHHhhllEEELLLLL----------------


DSSP  lLLLHhhHHHHHHHHHLL-------lLLLLHhHHHHHHLHHHHHHLLLLLLLLLLLLLLL
Query gIAGLqsCXDVXFDEAVQ-------kRGXSLpXFGKLXATNAADIFGLQQKGRIAPGKDA  364
ident  |        |  | ||         |         |     |        |    |  |
Sbjct -IEPA--DPWVSIDAAVNryvvdpgeRVSRE-EALHLYTHGSAQVTLAEDLGKLERGFRA  457
DSSP  -LLLL--LHHHHHHHHHHlllllhhhLLLHH-HHHHHLLHHHHHHLLLLLLLLLLLLLLL


DSSP  LEEEEELllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll
Query DFVFIQPnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
ident                                                             
Sbjct EYIILDR-----------------------------------------------------  464
DSSP  LEEEELL-----------------------------------------------------


DSSP  eelll
Query filkh  429
ident      
Sbjct -dplk  468
DSSP  -llll


No 18: Query=3e74A Sbjct=3mkvA Z-score=22.6

back to top
DSSP  LEEEEEELLEEELLL--LEEE-LEEEEELLEEEEEEL-LLLL-EEEEEELLLLEEEELEE
Query SFDLIIKNGTVILEN--EARV-VDIAVKGGKIAAIGQ-DLGD-AKEVXDASGLVVSPGXV   55
ident        ||               |    | |              | |  |    ||  
Sbjct LTTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSDkPIKSsNAHVIDVKGKTIMPGLI   60
DSSP  LLEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEELlLLLLlLLEEEELLLLEEEELEE


DSSP  EEEELL--------------------LHHHHHHHHHHLLEEEEEELLLllllllllhhhH
Query DAHTHI--------------------GYETGTRAAAKGGITTXIEXPLnqlpatvdrasI   95
ident | | |                           ||    | ||                  
Sbjct DLHVHVvaiefnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG----------aG  110
DSSP  EEEELLllllllhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELLL----------lL


DSSP  HHHHHHH--LLLLLLEEEELE-ELLL----------------------------------
Query ELKFDAA--KGKLTIDAAQLG-GLVS----------------------------------  118
ident      |              |  |                                    
Sbjct YPFKQAVesGLVEGPRLFVSGrALSQtgghadprarsdymppdspcgccvrvgalgrvad  170
DSSP  HHHHHHHhlLLLLLLEEEELLlEEELllllllllllllllllllllllllllllleeell


DSSP  ---LLLLLHHHHHHHLLLLEEEEL-------------lLLLHHHHHHHHHHHHHHLLLEE
Query ---YNIDRLHELDEVGVVGFXCFV-------------rDVNDWQFFKGAQKLGELGQPVL  162
ident           |    |    |                                  |  ||
Sbjct gvdEVRRAVREELQMGADQIXIMAsggvasptdpvgvfGYSEDEIRAIVAEAQGRGTYVL  230
DSSP  lhhHHHHHHHHHHHHLLLLEEEELllllllllllllllLLLHHHHHHHHHHHHLLLLLEE


DSSP  EELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHhhhllLEEELLLL
Query VHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAkvagcRLHVCHVS  222
ident  |                                    || |               |  
Sbjct AHAY-------------------------------TPAAIARAVRCG-----VRTIEHGN  254
DSSP  EEEL-------------------------------LHHHHHHHHHLL-----LLEEEELL


DSSP  LHH--HHHHHHHHHhllllEEEEELLHhhhllhhhhhhHLHH---------hllllLLLL
Query SPE--GVEEVTRARqegqdITCESCPHyfvldtdqfeeIGTL---------akcspPIRD  271
ident          |                                                  
Sbjct LIDdeTARLVAEHG-----AYVVPTLV------tydalASEGekyglppesiakiaDVHG  303
DSSP  LLLhhHHHHHHHHL-----LEEELLHH------hhhhhHHHLllllllhhhhllhhHHHL


DSSP  hhHHHHHHHHHHL-LLLLEELLLLLLLllllllllllllllLLLLHHhhhhHHHHHHLlL
Query leNQKGXWEKLFN-GEIDCLVSDHSPCppexkagnixkawgGIAGLQscxdVXFDEAVqK  330
ident         |     |       |                              |      
Sbjct --AGLHSIEIMKRaGVKMGFGTDLLGE--------------AQRLQS----DEFRILA-E  342
DSSP  --LHHHHHHHHHHhLLLLLLLLLLLHH--------------HHHHLL----HHHHHHH-L


DSSP  LLLLhHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllleellhhhllllllll
Query RGXSlPXFGKLXATNAADIFGLQ-QKGRIAPGKDADFVFIQPnssyvltnddleyrhkvs  389
ident                 |   | |   ||| ||  ||                        
Sbjct VLSP-AEVIASATIVSAEVLGMQdKLGRIVPGAHADVLVVDG------------------  383
DSSP  LLLH-HHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL------------------


DSSP  lllllEELL------EEEEEEELLEEEEELLLllllllllleelll
Query pyvgrTIGA------RITKTILRGDVIYDIEQgfpvapkgqfilkh  429
ident                 |      |                      
Sbjct -nplkSVDCllgqgeHIPLVMKDGRLFVNELE--------------  414
DSSP  -llllLLLLllllllLLLEEEELLEEEEELLL--------------


No 19: Query=3e74A Sbjct=2oofA Z-score=22.3

back to top
DSSP  -LEEEEEELLEEELL------LLEE-ELEEEEELLEEEEEEL--LLLLeeEEEELLLLEE
Query -SFDLIIKNGTVILE------NEAR-VVDIAVKGGKIAAIGQ--DLGDakEVXDASGLVV   50
ident         | |                    |  | | |     ||       |  |  |
Sbjct lNCERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVPxqDLKYpaHWQDXKGKLV   60
DSSP  lLLLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEEhhHLLLllLLEELLLLEE


DSSP  EELEEEEEELL----------------------------------------------LHH
Query SPGXVDAHTHI----------------------------------------------GYE   64
ident  ||  | |||                                                  
Sbjct TPGLIDCHTHLifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  EELEEEEEELLllllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHLLEEEEEELLLLL---LLLLllhhHHHHHHHHHLLLLLLEEEELEELL----
Query TGTRAAAKGGITTXIEXPLNQ---LPATvdraSIELKFDAAKGKLTIDAAQLGGLV----  117
ident          | ||                               | |             
Sbjct PRVKSLIREGVTTVEIKSGYGltlEDEL----KXLRVARRLGEALPIRVKTTLLAAhavp  176
DSSP  HHHHHHHHHLEEEEEEELLLLllhHHHH----HHHHHHHHHHHHLLLEEEEEEEEEllll


DSSP  -----------lLLLL-LHHHHHH-HLLLLEEEEL--lLLLHHHHHHHHHHHHHHLLLEE
Query -----------sYNID-RLHELDE-VGVVGFXCFV--rDVNDWQFFKGAQKLGELGQPVL  162
ident                        |         |         |           |  | 
Sbjct peyrddpdswveTICQeIIPAAAEaGLADAVDVFCehiGFSLAQTEQVYLAADQYGLAVK  236
DSSP  hhhlllhhhhhhHHHHlHHHHHHHlLLLLEEEEEElllLLLHHHHHHHHHHHHHLLLEEE


DSSP  EELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHhhHHHHHHhhhLLLE-EELLL
Query VHCEnalicdelgeeakregrvtahdyvasrpvftEVEAirRVLYLAkvaGCRL-HVCHV  221
ident  |                                           ||         | | 
Sbjct GHXD------------------------------qLSNL--GGSTLA--aNFGAlSVDHL  262
DSSP  EEEL------------------------------lLLLL--LHHHHH--hHLLLlEEEEL


DSSP  LLhhHHHHHHHHHhlLLLEEEEELLHHHHLlhhhhhhhlhhhllllLLLLHhhhhhHHHH
Query SSpeGVEEVTRARqeGQDITCESCPHYFVLdtdqfeeigtlakcspPIRDLenqkgXWEK  281
ident        |   |            |  |                                
Sbjct EY--LDPEGIQAL-aHRGVVATLLPTAFYF----------------LKETK---lpPVVA  300
DSSP  LL--LLHHHHHHH-hHHLLEEEELHHHHHH----------------LLLLL---llLHHH


DSSP  HHL-LLLLEELLLLLLllllllllllllllLLLLLHhHHHHHHHhhhlllLLLLhHHHHH
Query LFN-GEIDCLVSDHSPcppexkagnixkawGGIAGLqSCXDVXFdeavqkRGXSlPXFGK  340
ident |   |      ||  |              |      |    |                 
Sbjct LRKaGVPXAVSSDINP--------------GTAPIV-SLRXAXNxactlfGLTP-VEAXA  344
DSSP  HHHlLLLEEELLLLLL--------------LLLLLL-LHHHHHHhhhhhhLLLH-HHHHH


DSSP  HHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELllleellhhhlllllllllllllEELL-
Query LXATNAADIFGL-QQKGRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrTIGA-  398
ident      ||   |   | |    |  |||                             ||  
Sbjct GVTRHAARALGEqEQLGQLRVGXLADFLVWNC---------------ghpaelsyLIGVd  389
DSSP  HLLHHHHHHLLLlLLLLLLLLLLLLLEEEELL---------------llllhhhhLLLLl


DSSP  EEEEEEELLEEEEElllllllllllleelll
Query RITKTILRGDVIYDieqgfpvapkgqfilkh  429
ident         |                      
Sbjct QLVSRVVNGEETLH-----------------  403
DSSP  LEEEEEELLEELLL-----------------


No 20: Query=3e74A Sbjct=1j6pA Z-score=22.2

back to top
DSSP  lEEEEEELLEEELL--LLEEELEEEEELLEEEEEE-LLLLleeeEEELLLLEEEELEEEE
Query sFDLIIKNGTVILE--NEARVVDIAVKGGKIAAIG-QDLGdakeVXDASGLVVSPGXVDA   57
ident     || |         |          | |               | ||  | |     
Sbjct -HHXIIGNCLILKDfsSEPFWGAVEIENGTIKRVLqGEVK---vDLDLSGKLVXPALFNT   56
DSSP  -LEEEEEEEEELLLllLLLEEEEEEEELLEEEEEEeLLLL---lLEELLLEEEEELEEEE


DSSP  EELL------------------------------------LHHHHHHHHHHLLEEEEEEL
Query HTHI------------------------------------GYETGTRAAAKGGITTXIEX   81
ident |||                                     |        |  ||     |
Sbjct HTHApxtllrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDX  116
DSSP  EELHhhhhhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEE


DSSP  LLllllllllhhHHHHHHHhhllLLLLEEEELEELLL------LLLLLHHHHHHHL----
Query PLnqlpatvdraSIELKFDaakgKLTIDAAQLGGLVS------YNIDRLHELDEVG----  131
ident               |             |    |||               |        
Sbjct YF----------HEEWIAK-avrDFGXRALLTRGLVDsngddgGRLEENLKLYNEWngfe  165
DSSP  EL----------LHHHHHH-hhhHHLLEEEEEEEELLllllllLHHHHHHHHHHHHllhh


DSSP  ---LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhh
Query ---VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtah  187
ident     |||                      |  ||  |                       
Sbjct griFVGFGPhSPYLCSEEYLKRVFDTAKSLNAPVTIHLY---------------------  204
DSSP  hleEEEEEElLLLLLLHHHHHHHHHHHHHHLLLEEEEEL---------------------


DSSP  hhhhlLLHHhhhHHHHHHHHHHHhhLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEELLH
Query dyvasRPVFtevEAIRRVLYLAKvaGCRLHVCHVSSpeGVEEVTRARQeGQDITCESCPH  247
ident                   |             |       |                 | 
Sbjct ---etSKEE---YDLEDILNIGL-kEVKTIAAHCVH--LPERYFGVLK-DIPFFVSHNPA  254
DSSP  ---llLLLL---LLLHHHHLLLL-lLLLEEEEELLL--LLHHHHHHHL-LLLEEEEELHH


DSSP  hhhllhhhhhhhlhhhLLLLLLLlhhhhhHHHHHHHLLLLLEELLLLLLlllllllllll
Query yfvldtdqfeeigtlaKCSPPIRdlenqkGXWEKLFNGEIDCLVSDHSPcppexkagnix  307
ident                                      |    |  |              
Sbjct --------------snLKLGNGI-----aPVQRXIEHGXKVTLGTDGAA-----------  284
DSSP  --------------hhHHLLLLL-----lLHHHHHHLLLEEEELLLLLL-----------


DSSP  llllLLLLHhHHHHHHHHHH------lllLLLLhHHHHHHHLHHHHHHLLLlLLLLLLLL
Query kawgGIAGLqSCXDVXFDEA------vqkRGXSlPXFGKLXATNAADIFGLqQKGRIAPG  361
ident         |      |                      |      |   |    | |  |
Sbjct ----SNNSL-NLFFEXRLASllqkaqnprNLDV-NTCLKXVTYDGAQAXGF-KSGKIEEG  337
DSSP  ----LLLLL-LHHHHHHHHHhhhhlllllLLLH-HHHHHHHLHHHHHHHLL-LLLLLLLL


DSSP  LLLLEEEEELLLLEellhhhllllllllllllleELLE--EEEEEELLEEEEELLlLLLL
Query KDADFVFIQPNSSYvltnddleyrhkvspyvgrtIGAR--ITKTILRGDVIYDIEqGFPV  419
ident   || | |                                   |   |  ||      | 
Sbjct WNADLVVIDLDLPE--------xfpvqniknhlvHAFSgeVFATXVAGKWIYFDG-EYPT  388
DSSP  LLLLEEEEELLLHH--------hllhhhhhhhhhHLLLllLLEEEELLEEEEELL-LLLL


DSSP  L---------lllleelll
Query A---------pkgqfilkh  429
ident                    
Sbjct Idseevkrelariekelys  407
DSSP  Llhhhhhhhhhhhhhhhhl


No 21: Query=3e74A Sbjct=3ls9A Z-score=22.0

back to top
DSSP  leEEEEELL-EEELL---LLEEE-LEEEEELLEEEEEELLLLL--EEEEEELLLLEEEEL
Query sfDLIIKNG-TVILE---NEARV-VDIAVKGGKIAAIGQDLGD--AKEVXDASGLVVSPG   53
ident      |     ||            ||   | || | | || |       |  |    ||
Sbjct --MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDrsVSRTIDGRGMIALPG   58
DSSP  --LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLllLLEEEELLLEEEEEL


DSSP  EEEEEELL-------------------------------------------LHHHHHHHH
Query XVDAHTHI-------------------------------------------GYETGTRAA   70
ident     | |                                                     
Sbjct LINSHQHLyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLES  118
DSSP  EEEEEELHhhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHH


DSSP  HHLLEEEEEELLLLLLllllLHHHHHHHHhHHLLLLLLEEEELEELLL------------
Query AKGGITTXIEXPLNQLpatvDRASIELKFdAAKGKLTIDAAQLGGLVS------------  118
ident   |||||     |           |      |   | |                      
Sbjct LLGGITTVADQHLFFP-gatADSYIDATI-EAATDLGIRFHAARSSMTlgkseggfcddl  176
DSSP  HHLLEEEEEEEELLLL-lllLLLHHHHHH-HHHHHHLLEEEEEELLLLllhhhlllllhh


DSSP  ------LLLLLHHHHHHHL---------LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEE
Query ------YNIDRLHELDEVG---------VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVL  162
ident               |                     |       |   ||          
Sbjct fvepvdRVVQHCLGLIDQYhepepfgmvRIALGPcGVPYDKPELFEAFAQMAADYDVRLH  236
DSSP  hlllhhHHHHHHHHHHHHHlllllllleEEEELLlLLLLLLHHHHHHHHHHHHHHLLEEE


DSSP  EEL----LLHHHHHhhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHhhllLEEE
Query VHC----ENALICDelgeeakregrvtahdyvasrpvftevEAIRRVLYLAKvagcRLHV  218
ident  |                                          |           |   
Sbjct THFyeplDAGMSDH-----------------------lygmTPWRFLEKHGW-asdRVWL  272
DSSP  EEEllllHHHHHHH-----------------------hhllLHHHHHHHLLL-lllLEEE


DSSP  LLLLLHHhhHHHHHHHHllLLEEEEELLHHhhllhhhhhhhlhhhllllLLLLhhhhhhH
Query CHVSSPEgvEEVTRARQegQDITCESCPHYfvldtdqfeeigtlakcspPIRDlenqkgX  278
ident  |   |   ||                                                 
Sbjct AHAVVPP-rEEIPEFAD--AGVAIAHLIAP----------------dlrMGWG----laP  309
DSSP  EELLLLL-hHHHHHHHH--HLLEEEELHHH----------------hhhLLLL----llL


DSSP  HHHHHL-LLLLEELLLLLLlllllllllllllllLLLLHhHHHHHHhHHHL---------
Query WEKLFN-GEIDCLVSDHSPcppexkagnixkawgGIAGLqSCXDVXfDEAV---------  328
ident        |         |                   |           |          
Sbjct IREYLDaGITVGFGTTGSA---------------SNDGG-NLLGDL-RLAAlahrpadpn  352
DSSP  HHHHHHlLLEEEELLLLLL---------------LLLLL-LHHHHH-HHHHhhlhhhlll


DSSP  --llLLLLHhHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEELLL-------------
Query --qkRGXSLpXFGKLXATNAADIFGLQQKGRIAPGKDADFVFIQPNS-------------  373
ident                     |   |    |    |  ||                     
Sbjct epekWLSAR-ELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLDGvdrvgvhdpaigl  411
DSSP  lhhhLLLHH-HHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLhhhlllllhhhhh


DSSP  --LEELlhhhllllllllllllleellEEEEEEELLEEEEELLlLLLLL-----llllee
Query --SYVLtnddleyrhkvspyvgrtigaRITKTILRGDVIYDIEqGFPVA-----pkgqfi  426
ident                            |       | |    |     |           
Sbjct imTGLS--------------------dRASLVVVNGQVLVENE-RPVLAdlerivantta  450
DSSP  hhLLLL--------------------lLLLEEEELLEEEEELL-EELLLlhhhhhhhhhh


DSSP  lll
Query lkh  429
ident    
Sbjct lip  453
DSSP  hll


No 22: Query=3e74A Sbjct=4c5yA Z-score=21.0

back to top
DSSP  --LEEEEEELLEEEL-LLLEEE-LEEEEELLEEEEEE--LLLL-----LEEEEEELllLE
Query --SFDLIIKNGTVIL-ENEARV-VDIAVKGGKIAAIG--QDLG-----DAKEVXDAsgLV   49
ident       ||  |  |    |             ||  |   |                  |
Sbjct deAKVTIIYAGLLIPgDGEPLRnAALVISDKIIAFVGseADIPkkylrSTQSTHRV--PV   58
DSSP  llLLEEEEEEEEELLlLLLLEEeEEEEEELLEEEEEEehHHLLhhhhhHLLLEEEE--EE


DSSP  EEELEEEEEELL-----------------------LHHHHHHHHHHLLEEEEEELLLlll
Query VSPGXVDAHTHI-----------------------GYETGTRAAAKGGITTXIEXPLnql   86
ident   ||  | | |                            |   |   | |          
Sbjct LMPGLWDCHMHFggdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAG---  115
DSSP  EEELEEEEEELLllllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLL---


DSSP  lllllhhhhhHHHHHHL--LLLLLEEEEL-EELLL-------------------------
Query patvdrasieLKFDAAK--GKLTIDAAQL-GGLVS-------------------------  118
ident               |                 |                           
Sbjct -------ygcEVAKAINdgTIVGPNVYSSgAALSQtaghgdifalpagevlgsygvmnpr  168
DSSP  -------lhhHHHHHHHllLLLLLEEEELlLEEELlllllllllllhhhhhhhhllllll


DSSP  ----------------LLLLLHHHHHHHLLLLEEEEL-------------lLLLHHHHHH
Query ----------------YNIDRLHELDEVGVVGFXCFV-------------rDVNDWQFFK  149
ident                             |    |                          
Sbjct pgywgagplciadgveEVRRAVRLQIRRGAKVIXVMAsggvmsrddnpnfaQFSPEELKV  228
DSSP  lllllllleeelllhhHHHHHHHHHHHHLLLLEEEELllllllllllllllLLLHHHHHH


DSSP  HHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHH
Query GAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLA  209
ident            |  |                                     |       
Sbjct IVEEAARQNRIVSAHVH-------------------------------GKAGIMAAIKAG  257
DSSP  HHHHHHHLLLLEEEEEL-------------------------------LHHHHHHHHHHL


DSSP  hhhllLEEELLLLLhhHHHHHHHHHHlLLLEEEEELLHHHHLLhHHHHhHLHHhllllll
Query kvagcRLHVCHVSSpeGVEEVTRARQeGQDITCESCPHYFVLDtDQFEeIGTLakcsppi  269
ident           |||     |||         |                     |       
Sbjct -----CKSLEHVSY--ADEEVWELMK-EKGILYVATRSVIEIF-LASN-GEGL-vkeswa  306
DSSP  -----LLEEEELLL--LLHHHHHHHH-HHLLEEELLHHHHHHH-HHHL-LLLL-lllhhh


DSSP  LLHHHHHHHH---HHHHL-LLLLEELLLLLllllllllllllllllllllHHHHHhHHHH
Query RDLENQKGXW---EKLFN-GEIDCLVSDHSpcppexkagnixkawggiagLQSCXdVXFD  325
ident                    |    |  |                                
Sbjct KLQALADSHLkayQGAIKaGVTIALGTDTA-------------------pGGPTA-LELQ  346
DSSP  LLLHHHHHHHhhhHHHHHlLLLEELLLLLL-------------------lLLLLH-HHHH


DSSP  HHLLllLLLHHHHHHHHLHHHHHHL--LLLLLLLLLLLLLLLEEEEELllleellhhhll
Query EAVQkrGXSLPXFGKLXATNAADIF--GLQQKGRIAPGKDADFVFIQPnssyvltnddle  383
ident  ||   |       |    ||           |    |  ||                  
Sbjct FAVErgGMTPLEAIKAATANAPLSVgpQAPLTGQLREGYEADVIALEE------------  394
DSSP  HHHHllLLLHHHHHHHHLLLHHHHHhhHLLLLLLLLLLLLLLEEEELL------------


DSSP  lllllllllllEELL-----EEEEEEELLEEEEELLL-LLLLLlllleelll
Query yrhkvspyvgrTIGA-----RITKTILRGDVIYDIEQ-GFPVApkgqfilkh  429
ident             |         |     |                       
Sbjct -------npleDIKVfqepkAVTHVWKGGKLFKGPGIgPWGED---arnpfl  436
DSSP  -------llllLHHHhhlhhHEEEEEELLEEEELLLLlLLLLL---llllll


No 23: Query=3e74A Sbjct=1k6wA Z-score=21.0

back to top
DSSP  leEEEEELLEEEllLLEEELEEEEELLEEEEEELL---llleEEEEELLLLEEEELEEEE
Query sfDLIIKNGTVIleNEARVVDIAVKGGKIAAIGQD---lgdaKEVXDASGLVVSPGXVDA   57
ident      | |       |     |    ||| ||              ||    | |  |  
Sbjct -aLQTIINARLP--GEEGLWQIHLQDGKISAIDAQsgvmpitENSLDAEQGLVIPPFVEP   57
DSSP  -lLLEEEEELLL--LLLLEEEEEEELLEEEEEEEElllllllLLEEELLLLEEELLEEEE


DSSP  EELL--------------------------------------LHHHHHHHHHHLLEEEEE
Query HTHI--------------------------------------GYETGTRAAAKGGITTXI   79
ident | |                                                   ||    
Sbjct HIHLdttqtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVR  117
DSSP  EELLllllllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEE


DSSP  ELLlllllLLLL--HHHHHHHHHHHLLLL-LLEEEELEEL---LLLL---LLLHHHHHHH
Query EXPlnqlpATVD--RASIELKFDAAKGKL-TIDAAQLGGL---VSYN---IDRLHELDEV  130
ident            |                   ||                    | |    
Sbjct THV-----DVSDatLTALKAMLEVKQEVApWIDLQIVAFPqegILSYpngEALLEEALRL  172
DSSP  EEE-----ELLLllLHHHHHHHHHHHHHLlLLEEEEEEELlllLLLLllhHHHHHHHHHL


DSSP  LLLLEEEEL-----llLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllll
Query GVVGFXCFV-----rdVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvt  185
ident |                      |             |||                    
Sbjct GADVVGAIPhfeftreYGVESLHKTFALAQKYDRLIDVHCD-------------------  213
DSSP  LLLEEEELHhhlllhhHHHHHHHHHHHHHHHHLLEEEEEEL-------------------


DSSP  hhhhhhlLLHHHhhHHHHHHHHHHHHHLL--LEEELLLL-LHHH----hhhhHHHHHlLL
Query ahdyvasRPVFTevEAIRRVLYLAKVAGC--RLHVCHVS-SPEG----veevTRARQeGQ  238
ident                    |  ||   |   |    |                |      
Sbjct -----eiDDEQS--RFVETVAALAHHEGMgaRVTASHTTaMHSYngaytsrlFRLLK-MS  265
DSSP  -----llLLLLL--LHHHHHHHHHHHHLLhhHEEEEELHhHHHLlhhhhhhhHHHHH-HH


DSSP  LEEEEELLHHhhllhhhhhhhlhhhllllLLLL------HHHHhhhhhHHHLLL----LL
Query DITCESCPHYfvldtdqfeeigtlakcspPIRD------LENQkgxweKLFNGE----ID  288
ident  |     |                                                    
Sbjct GINFVANPLV-----------------niHLQGrfdtypKRRG---itRVKEMLesgiNV  305
DSSP  LLEEEELHHH-----------------hhHHLLllllllLLLL---llLHHHHHhlllLE


DSSP  EELLLLLLLLllllllllllllLLLLLHhHHHHHHH----hhhllLLLLLHhHHHHHHLH
Query CLVSDHSPCPpexkagnixkawGGIAGLqSCXDVXF----deavqKRGXSLpXFGKLXAT  344
ident |   |    |                       |             |        |   
Sbjct CFGHDDVFDP-----------wYPLGTA-NMLQVLHmglhvcqlmGYGQIN-DGLNLITH  352
DSSP  EELLLLLLLL-----------lLLLLLL-LHHHHHHhhhhhllllLHHHHH-HHHHHHLH


DSSP  HHHHHLLLLLLlLLLLLLLLLEEEEELllleellhhhlllllllllllllEELLEEEEEE
Query NAADIFGLQQKgRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrTIGARITKTI  404
ident   |    ||    || |  |                                        
Sbjct HSARTLNLQDY-GIAAGNSANLIILPA----------------engfdalRRQVPVRYSV  395
DSSP  HHHHHLLLLLL-LLLLLLLLLEEEELL----------------llhhhhhHHLLLLLEEE


DSSP  ELLEEEEELL---lllllllllleelll
Query LRGDVIYDIE---qgfpvapkgqfilkh  429
ident   | ||                      
Sbjct RGGKVIASTQpaqttvyleqpeaidykr  423
DSSP  ELLEEEEELLllleeeellleeeellll


No 24: Query=3e74A Sbjct=2uz9A Z-score=19.6

back to top
DSSP  LEEEEEELlEEELL-----LLEEE-LEEEEE-LLEEEEEELL--------lLLEE--EEE
Query SFDLIIKNgTVILE-----NEARV-VDIAVK-GGKIAAIGQD--------lGDAK--EVX   43
ident     |    |          |        |   |||                  |  |  
Sbjct PLAHIFRG-TFVHStwtcpMEVLRdHLLGVSdSGKIVFLEEAsqqeklakeWCFKpcEIR   59
DSSP  LLLEEEEE-EEEELlllllLEEEEeEEEEELlLLLEEEEEEHhhhhhhhhhHLLLhhHEE


DSSP  ELL-LLEEEELEEEEEELL-------------------------------------LHHH
Query DAS-GLVVSPGXVDAHTHI-------------------------------------GYET   65
ident   |      || || | |                                       |  
Sbjct ELShHEFFMPGLVDTHIHAsqysfagssidlpllewltkytfpaehrfqnidfaeeVYTR  119
DSSP  ELLlLLEEEELEEEEEEEHhhhhhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHHHH


DSSP  HHHHHHHLLEEEEEELLllllllLLLHHHHHhHHHHHllLLLLEEEELEELLL-------
Query GTRAAAKGGITTXIEXPlnqlpaTVDRASIElKFDAAkgKLTIDAAQLGGLVS-------  118
ident   |   | | ||           |    |          |    |               
Sbjct VVRRTLKNGTTTACYFA------TIHTDSSL-LLADItdKFGQRAFVGKVCMDlndtfpe  172
DSSP  HHHHHHHLLEEEEEEEL------LLLHHHHH-HHHHHhhHHLLEEEEELEELLlllllll


DSSP  ------LLLLLHHHHHHHL--------LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEEE
Query ------YNIDRLHELDEVG--------VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVLV  163
ident         |                         |                         
Sbjct yketteESIKETERFVSEMlqknysrvKPIVTPrFSLSCSETLMGELGNIAKTRDLHIQS  232
DSSP  llllhhHHHHHHHHHHHHHhhhlllleEEEEEElLHHHLLHHHHHHHHHHHHHHLLEEEE


DSSP  ELL----LHHHHHHhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHhhhllLEEEL
Query HCE----NALICDElgeeakregrvtahdyvasrpvftevEAIRRVLYLAkvagcRLHVC  219
ident |                                                           
Sbjct HISenrdEVEAVKN--------------------lypsykNYTSVYDKNN-lltnKTVMA  271
DSSP  EELllhhHHHHHHH--------------------hlllllLHHHHHHHLL-llllLEEEE


DSSP  LLLLHHhhHHHHHHHHllLLEEEEELLHhhhllhhhhhhhlhhHLLLLLLllhhhhhhHH
Query HVSSPEgvEEVTRARQegQDITCESCPHyfvldtdqfeeigtlAKCSPPIrdlenqkgXW  279
ident |       ||               ||                   |             
Sbjct HGCYLS-aEELNVFHE--RGASIAHCPN-------------snLSLSSGF-------lNV  308
DSSP  ELLLLL-hHHHHHHHH--HLLEEEELHH-------------hhHHLLLLL-------lLH


DSSP  HHHHL-LLLLEELLLLLllllllllllllllllLLLLHhHHHHHHH-----------hhh
Query EKLFN-GEIDCLVSDHSpcppexkagnixkawgGIAGLqSCXDVXF-----------dea  327
ident            |  |                  |     |  |                 
Sbjct LEVLKhEVKIGLGTDVA----------------GGYSY-SMLDAIRravmvsnillinkv  351
DSSP  HHHHHlLLEEEELLLLL----------------LLLLL-LHHHHHHhhhhhhhhhhhlll


DSSP  lllLLLLHhHHHHHHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELL---LLEE-llhhhl
Query vqkRGXSLpXFGKLXATNAADIFGL-QQKGRIAPGKDADFVFIQPN---SSYV-ltnddl  382
ident              |         ||    |    ||  |   | |    |          
Sbjct nekSLTLK-EVFRLATLGGSQALGLdGEIGNFEVGKEFDAILINPKasdSPIDlfygdff  410
DSSP  lllLLLHH-HHHHHHLHHHHHHLLLlLLLLLLLLLLLLLEEEELLLlllLLLLlllhhhh


DSSP  llllllllllllEELL--EEEEEEELLEEEEElllllllllllleelll
Query eyrhkvspyvgrTIGA--RITKTILRGDVIYDieqgfpvapkgqfilkh  429
ident               |    |      |                      
Sbjct gdiseaviqkflYLGDdrNIEEVYVGGKQVVP---------------fs  444
DSSP  lllllhhhhhhhHHLLhhHEEEEEELLEEEEL---------------ll


No 25: Query=3e74A Sbjct=4rdvB Z-score=19.5

back to top
DSSP  leeEEEELLEEELLLLEEE-LEEEEE-LLEEEEEE--LLLLLeeeEEELlLLEEEELEEE
Query sfdLIIKNGTVILENEARV-VDIAVK-GGKIAAIG--QDLGDakeVXDAsGLVVSPGXVD   56
ident      |      |       |       |  | |                |  | ||   
Sbjct ---SAIFAERALLPEGWARnVRFEISaDGVLAEIRpdANADG---AERL-GGAVLPGMPN   53
DSSP  ---LEEEEEEEEELLEEEEeEEEEELlLLLEEEEEllLLLLL---LEEL-LLLEEELEEE


DSSP  EEELL----------------------------------------LHHHHHHHHHHLLEE
Query AHTHI----------------------------------------GYETGTRAAAKGGIT   76
ident  | |                                                   | | |
Sbjct LHSHAfqramaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYT  113
DSSP  EEELHhhhhhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEE


DSSP  EEEELLLLLLL--llllhHHHHHHHhHHLLLL---LLEEEELEELLL-------------
Query TXIEXPLNQLP--atvdrASIELKFdAAKGKL---TIDAAQLGGLVS-------------  118
ident    |                 ||             |    |  | |             
Sbjct AVAEFHYVHHDldgrsyaDPAELSL-RISRAAsaaGIGLTLLPVLYShagfggqpasegq  172
DSSP  EEEEEELLLLLlllllllLLLHHHH-HHHHHHhhhLLEEEEEELLLLeeellleellhhh


DSSP  ----LLLLL-HHHHHHHL--------lLLEEE-ELLLLLHHHHHHHHHhhHHHL-LLEEE
Query ----YNIDR-LHELDEVG--------vVGFXC-FVRDVNDWQFFKGAQklGELG-QPVLV  163
ident           |  |              |      | |   |              ||  
Sbjct rrfiNGSEAyLELLQRLRapleaaghsLGLCFhSLRAVTPQQIATVLA--AGHDdLPVHI  230
DSSP  llllLLHHHhHHHHHHHHhhhhhhlleELEEElLLLLLLHHHHHHHHL--LLLLlLLEEE


DSSP  ELL----LHHHHHHhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHhhllLEEEL
Query HCE----NALICDElgeeakregrvtahdyvasrpvftevEAIRRVLYLAKvagcRLHVC  219
ident |          |                                           |    
Sbjct HIAeqqkEVDDCQA----------------------wsgrRPLQWLYENVA-vdqRWCLV  267
DSSP  EELllhhHHHHHHH----------------------hhllLHHHHHHHHLL-lllLEEEE


DSSP  LLLLHH--HHHHHHHHHhllllEEEEELLHhhhllhhhhhhhlhhHLLLLLLllhhhhhH
Query HVSSPE--GVEEVTRARqegqdITCESCPHyfvldtdqfeeigtlAKCSPPIrdlenqkG  277
ident |        |    |            |                 |     |        
Sbjct HATHADpaEVAAMARSG-----AVAGLCLS-------------teANLGDGI------fP  303
DSSP  ELLLLLhhHHHHHHHHL-----LEEEELHH-------------hhHHLLLLL------lL


DSSP  HHHHHHLLLLLEELLLLLllllllllllllllllllLLHHhhHHHHHHH-----------
Query XWEKLFNGEIDCLVSDHSpcppexkagnixkawggiAGLQscXDVXFDE-----------  326
ident     |  |      ||                      |                     
Sbjct ATDFLAQGGRLGIGSDSH------------------VSLS--VVEELRWleygqrlrdrk  343
DSSP  HHHHHHLLLEEEELLLLL------------------LLLL--HHHHHHHhhhhhhhhhll


DSSP  -----hlllLLLLHhHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEEELLLleellhhh
Query -----avqkRGXSLpXFGKLXATNAADIFGLqQKGRIAPGKDADFVFIQPNSsyvltndd  381
ident                          |   |    |  | |  ||      |         
Sbjct rnrlyrddqPMIGR-TLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDGND----pyla  397
DSSP  lllllllllLLHHH-HHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELLLL----hhhh


DSSP  llllllllllllLEEL-lEEEEEEELLEEEEELLlLLLLL------lllleelll
Query leyrhkvspyvgRTIG-aRITKTILRGDVIYDIEqGFPVA------pkgqfilkh  429
ident                |          |                            
Sbjct saegdallnrwlFAGGdrQVRDVMVAGRWVVRDG-RHAGEersarafvqvlgell  451
DSSP  llllhhhhhhhhHHLLhhHEEEEEELLEEEELLL-LLLLHhhhhhhhhhhhhhhl


No 26: Query=3e74A Sbjct=2ob3A Z-score=16.2

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                     |    | |
Sbjct -------------------------------------drintvrgpitiseaGFTLTHEH   23
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL


DSSP  L-----------------------LHHHHHHHHHHLLEEEEEELL---LLLLlllllhhh
Query I-----------------------GYETGTRAAAKGGITTXIEXP---LNQLpatvdras   94
ident |                           | | |   |  |                    
Sbjct IcgssagflrawpeffgsrkalaeKAVRGLRRARAAGVRTIVDVStfdIGRD--------   75
DSSP  LeellllhhhhlhhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLlhhHLLL--------


DSSP  hHHHHHHHLLLLLLEEEELEELLL------------LLLLLHHHHHH-------HLLLLE
Query iELKFDAAKGKLTIDAAQLGGLVS------------YNIDRLHELDE-------VGVVGF  135
ident                     ||                                      
Sbjct -VSLLAEVSRAADVHIVAATGLWFdpplsmrlrsveELTQFFLREIQygiedtgIRAGII  134
DSSP  -HHHHHHHHHHHLLEEELEEELLLlllhhhhlllhhHHHHHHHHHHHlllllllLLLLEE


DSSP  EEEL----lllLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhh
Query XCFV----rdvNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyva  191
ident |                  |      | ||  |                           
Sbjct XVATtgkatpfQELVLKAAARASLATGVPVTTHTA-------------------------  169
DSSP  EEELlllllhhHHHHHHHHHHHHHHHLLLEEEELL-------------------------


DSSP  lllhhhHHHHHHHHHHHHHHHLL---LEEELLL-LLHHhHHHHHHHHHllLLEEEEE-LL
Query srpvftEVEAIRRVLYLAKVAGC---RLHVCHV-SSPEgVEEVTRARQegQDITCES-CP  246
ident                      |    |    |           |                
Sbjct -----aSQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLdHI  221
DSSP  -----hHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEElLL


DSSP  HHhhLLHHHhHHHLHHHLLllLLLLHhhHHHHHHHHHLL------lLLEELLLLLLLlll
Query HYfvLDTDQfEEIGTLAKCspPIRDLenQKGXWEKLFNG------eIDCLVSDHSPCppe  300
ident  |        |                                         |       
Sbjct PY--SAIGL-EDNASASAL--LGIRS--WQTRALLIKALidqgymkQILVSNDWTFG---  271
DSSP  LL--LLLLL-LLLHHHHHH--HLLLL--HHHHHHHHHHHhhlllhhHEEELLLLLLE---


DSSP  llllllLLLLL------lllLHHHHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlll
Query xkagniXKAWG------giaGLQSCXDVXFDEAVqKRGXSLPXFGKLXATNAADIFGlqq  354
ident                     |                |           || |       
Sbjct --fssyVTNIMdvmdrvnpdGMAFIPLRVIPFLR-EKGVPQETLAGITVTNPARFLS---  325
DSSP  --elllLLLHHhhhhhhlllHHHHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL---


DSSP  llllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeell
Query kgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydie  414
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  lllllllllleelll
Query qgfpvapkgqfilkh  429
ident                
Sbjct -----------ptlr  329
DSSP  -----------llll


No 27: Query=3e74A Sbjct=3irsA Z-score=15.8

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
ident                                                        |    
Sbjct ---------------------------------------------------LKIIDFRLR    9
DSSP  ---------------------------------------------------LLLEELLLL


DSSP  LL-----------------------------------HHHHHHHHHHLLEEEEEELLLL-
Query IG-----------------------------------YETGTRAAAKGGITTXIEXPLN-   84
ident                                       |      |  ||        | 
Sbjct PPamgflnariytrpdirnrftrqlgfepapsaeeksLELMFEEMAAAGIEQGVCVGRNs   69
DSSP  LLlhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllHHHHHHHHHHLLLLEEEEELLEe


DSSP  --lLLLLLlhHHHHHHHHHHlllllLEEEELEELLL----LLLLLHHHHHHHLLLLEEEE
Query --qLPATVdrASIELKFDAAkgkltIDAAQLGGLVS----YNIDRLHELDEVGVVGFXCF  138
ident           |       |            |               |    |       
Sbjct svlGSVSN--ADVAAVAKAY----pDKFHPVGSIEAatrkEAMAQMQEILDLGIRIVNLE  123
DSSP  lllEELLH--HHHHHHHHHL----lLLEEEEEELLLllhhHHHHHHHHHHHLLLLLEEEL


DSSP  LLL-------lLHHHhHHHHHHHHHHLLLEEEEL--llHHHHhhhhhhhhhhllllhhhh
Query VRD-------vNDWQfFKGAQKLGELGQPVLVHC--enALICdelgeeakregrvtahdy  189
ident                           | ||                              
Sbjct PGVwatpmhvdDRRL-YPLYAFCEDNGIPVIMMTggnaGPDI------------------  164
DSSP  HHHllllllllLHHH-HHHHHHHHHLLLLEEEELllllLLLH------------------


DSSP  hhlllhhHHHHHHHHHHHHHHhhLLLEEELLLL---LHHHHHHHHHHHhlllLEEEEELl
Query vasrpvfTEVEAIRRVLYLAKvaGCRLHVCHVS---SPEGVEEVTRARqegqDITCESCp  246
ident        |  | | |||             |       |      |              
Sbjct -----tyTNPEHIDRVLGDFP--DLTVVSSHGNwpwVQEIIHVAFRRP----NLYLSPD-  212
DSSP  -----hhHLHHHHHHHHHHLL--LLLEEEEHHHlllHHHHHHHHHHLL----LEEEELH-


DSSP  HHHHLLhhhhhhhlhhhllllllllhHHHHHHHHHHHLLL--LLEELLLLLlllllllll
Query HYFVLDtdqfeeigtlakcsppirdlENQKGXWEKLFNGE--IDCLVSDHSpcppexkag  304
ident  |                                                          
Sbjct MYLYNL--------------------PGHADFIQAANSFLadRMLFGTAYP---------  243
DSSP  HHHLLL--------------------LLHHHHHHHHLLHHhhLLLLLLLLL---------


DSSP  llllllllLLLHHHHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLlllllllllllll
Query nixkawggIAGLQSCXDVXFDEAvqkrgXSLPXFGKLXATNAADIFGlqqkgriapgkda  364
ident            |                       |    ||                  
Sbjct --------MCPLKEYTEWFLTLP-----IKPDAMEKILHGNAERLLA-------------  277
DSSP  --------LLLHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHH-------------


DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll
Query dfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  eelll
Query filkh  429
ident      
Sbjct -qagr  281
DSSP  -hlll


No 28: Query=3e74A Sbjct=2imrA Z-score=15.6

back to top
DSSP  leeeEEELLE-EELLLLEEElEEEEellEEEEEE--LLLLLE---eeeEELLlLEEEELE
Query sfdlIIKNGT-VILENEARVvDIAVkggKIAAIG--QDLGDA---kevXDASgLVVSPGX   54
ident                         |     || |    |           |   |  |  
Sbjct -htpRLLTCDvLYTGAQSPG-GVVVvgeTVAAAGhpDELRRQyphaaeERAG-AVIAPPP   57
DSSP  -lleEEEEELeEELLEELLE-EEEEellEEEEEElhHHHHHHlllleeEELL-LEELLLL


DSSP  EEEEELL------------------------------LHHHHHHHHHHLLEEEEEELLLl
Query VDAHTHI------------------------------GYETGTRAAAKGGITTXIEXPLn   84
ident | ||||                                   |       |          
Sbjct VNAHTHLdmsayefqalpyfqwipevvirgrhlrgvaAAQAGADTLTRLGAGGVGDIVW-  116
DSSP  LEEEEELlllhhhhhhlhhhhllhhhhhhhllllhhhHHHHHHHHHHHLLLLLEEEEEL-


DSSP  lllllllHHHHHHHHHhhlllLLLEEEELEELLL-------lLLLLHH-HHHHHL-----
Query qlpatvdRASIELKFDaakgkLTIDAAQLGGLVS-------yNIDRLH-ELDEVG-----  131
ident                                                   |         
Sbjct ------aPEVMDALLA----rEDLSGTLYFEVLNpfpdkadeVFAAARtHLERWRrlerp  166
DSSP  ------lHHHHHHHHL----lLLLLEEEEEEELLllhhhhhhHHHHHHhHHHHHHlllll


DSSP  --LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEEEELL----LHHH-------HHHHHHh
Query --VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVLVHCE----NALI-------CDELGEe  177
ident     |        |               | |   |                        
Sbjct glRLGLSPhTPFTVSHRLMRLLSDYAAGEGLPLQIHVAehptELEMfrtgggpLWDNRM-  225
DSSP  leEEEEEElLLLLLLHHHHHHHHHHHHHHLLLLEEEELllhhHHHHhhhllllLHHHLL-


DSSP  hhhhllllhhhhhhlllhhhhhHHHHHHH-HHHHhhLLLEEELLLLLHH--HHHHHHHHH
Query akregrvtahdyvasrpvftevEAIRRVL-YLAKvaGCRLHVCHVSSPE--GVEEVTRAR  234
ident                          |            |    |           | || 
Sbjct --palyphtlaevigrepgpdlTPVRYLDeLGVL--AARPTLVHMVNVTpdDIARVARAG  281
DSSP  --hhhllllhhhhhllllllllLHHHHHHhHLLH--HHLLEEEELLLLLhhHHHHHHHHL


DSSP  hllllEEEEELLHHHHLlhhhhhhhlhhhlllLLLLlhhhhhhhhhHHHLL----LLLEE
Query qegqdITCESCPHYFVLdtdqfeeigtlakcsPPIRdlenqkgxweKLFNG----EIDCL  290
ident           ||                                               |
Sbjct -----CAVVTCPRSNHH---------------LECG--------tfDWPAFaaagVEVAL  313
DSSP  -----LLEEELHHHHHH---------------LLLL--------llLHHHHhhllLLEEE


DSSP  LLLLLLlllllllllllllllLLLLHhHHHHHHHhHHLLLLL-LLHHHHHHHHLHHHHHH
Query VSDHSPcppexkagnixkawgGIAGLqSCXDVXFdEAVQKRG-XSLPXFGKLXATNAADI  349
ident   |                      |          | |                     
Sbjct GTDSVA---------------SGETL-NVREEVT-FARQLYPgLDPRVLVRAAVKGGQRV  356
DSSP  LLLLHH---------------HHLLL-LLHHHHH-HHHHHLLlLLHHHHHHHHHHHHHHH


DSSP  LLllllLLLLL-LLLL-lEEEEelllleellhhhllllllllllllleelleEEEEeell
Query FGlqqkGRIAP-GKDA-dFVFIqpnssyvltnddleyrhkvspyvgrtigarITKTilrg  407
ident  |          |                                               
Sbjct VG----TPFLRrGETWqeGFRW------------------------------ELSR----  378
DSSP  HL----LLLLLlLLLLlhHHLH------------------------------HHLL----


DSSP  eeeeelllllllllllleelll
Query dviydieqgfpvapkgqfilkh  429
ident                       
Sbjct --------------------dl  380
DSSP  --------------------ll


No 29: Query=3e74A Sbjct=2vc5A Z-score=15.4

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                     |    | |
Sbjct ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL


DSSP  L----------------------LHHHHHHHHHHLLEEEEEELLL--LLLLllllhhhhH
Query I----------------------GYETGTRAAAKGGITTXIEXPL--NQLPatvdrasiE   96
ident                                |   |  |                     
Sbjct LrvfseavrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTVmgLGRD--------I   76
DSSP  LllllhhhhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLLllLLLL--------H


DSSP  HHHHHHlLLLLLEEEELEELL--------------lLLLLLHHHHHH-------HLLLLE
Query LKFDAAkGKLTIDAAQLGGLV--------------sYNIDRLHELDE-------VGVVGF  135
ident            |      |                    |                    
Sbjct RFMEKVvKATGINLVAGTGIYiyidlpfyflnrsidEIADLFIHDIKegiqgtlNKAGFV  136
DSSP  HHHHHHhHLLLLEEEELEELLllllllhhhllllhhHHHHHHHHHHHlllllllLLLLLE


DSSP  EEEL-----llLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhh
Query XCFV-----rdVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyv  190
ident |                   |    |   |   |                          
Sbjct XIAAdepgitkDVEKVIRAAAIANKETKVPIITHSN------------------------  172
DSSP  EEELllllllhHHHHHHHHHHHHHHHHLLLEEEELL------------------------


DSSP  hlllhhHHHHHHHHHHHHHHHHLL---LEEELLL-LLHH--HHHHHHHHHhllllEEEEE
Query asrpvfTEVEAIRRVLYLAKVAGC---RLHVCHV-SSPE--GVEEVTRARqegqdITCES  244
ident                       |         |                           
Sbjct ------AHNNTGLEQQRILTEEGVdpgKILIGHLgDTDNidYIKKIADKG-----SFIGL  221
DSSP  ------LLLLHHHHHHHHHHHLLLlhhHEEELLHhHLLLhhHHHHHHHLL-----LEEEE


DSSP  LlhhhhllhhhhhhhlhhhLLLLLLllHHHHHHHHHHHHLLL--LLEELLLLLL------
Query CphyfvldtdqfeeigtlaKCSPPIrdLENQKGXWEKLFNGE--IDCLVSDHSP------  296
ident                                         |         |         
Sbjct D---------------rygLDLFLP-vDKRNETTLRLIKDGYsdKIMISHDYCCtidwgt  265
DSSP  L---------------lllLLLLLL-hHHHHHHHHHHHHLLLllLEEELLLLLLllllll


DSSP  LLLLLLlllllLLLLllLLHHHHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlllll
Query CPPEXKagnixKAWGgiAGLQSCXDVXFDEAVqKRGXSLPXFGKLXATNAADIFGlqqkg  356
ident   || |                             |            |    |      
Sbjct AKPEYK-----PKLAprWSITLIFEDTIPFLK-RNGVNEEVIATIFKENPKKFFS-----  314
DSSP  LLHHHH-----HHHLllLLLLHHHHLHHHHHH-LLLLLHHHHHHHHLHHHHHHLL-----


DSSP  llllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellll
Query riapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqg  416
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  lllllllleelll
Query fpvapkgqfilkh  429
ident              
Sbjct -------------  314
DSSP  -------------


No 30: Query=3e74A Sbjct=1bf6A Z-score=15.3

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
ident                                                     |   || |
Sbjct -----------------------------------------------sfdpTGYTLAHEH   13
DSSP  -----------------------------------------------llllLLEEEEEEL


DSSP  L-------------------LHHHHHHHHHHLLEEEEEELLL--LLLLllllhhhhHHHH
Query I-------------------GYETGTRAAAKGGITTXIEXPL--NQLPatvdrasiELKF   99
ident                                 |    ||                     
Sbjct LhidlsgfknnvdcrldqyaFICQEMNDLMTRGVRNVIEMTNryMGRN--------AQFM   65
DSSP  LleelhhhhllhhheellhhHHHHHHHHHHHLLEEEEEELLLhhHLLL--------HHHH


DSSP  HHHLLLLLLEEEELEEL--------------llLLLLLHHHHHHH-------LLLLE-EE
Query DAAKGKLTIDAAQLGGL--------------vsYNIDRLHELDEV-------GVVGF-XC  137
ident         |      |                           |                
Sbjct LDVMRETGINVVACTGYyqdaffpehvatrsvqELAQEMVDEIEQgidgtelKAGIIaEI  125
DSSP  HHHHHHHLLEEEEEELLllhhhlllhhhhllhhHHHHHHHHHHHLlllllllLEEEEeEE


DSSP  EL-----lllLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhl
Query FV-----rdvNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvas  192
ident               |   |      | |   |                            
Sbjct GTsegkitplEEKVFIAAALAHNQTGRPISTHTS--------------------------  159
DSSP  ELllllllhhHHHHHHHHHHHHHHHLLLEEEELH--------------------------


DSSP  llhhhHHHHHHHHHHHHHHHLL---LEEELLLL---LHHHHHHHHHHHhllllEEEEE-L
Query rpvftEVEAIRRVLYLAKVAGC---RLHVCHVS---SPEGVEEVTRARqegqdITCES-C  245
ident              | |    |    |  | |                             
Sbjct -----FSTMGLEQLALLQAHGVdlsRVTVGHCDlkdNLDNILKMIDLG-----AYVQFdT  209
DSSP  -----HHLLHHHHHHHHHHLLLlhhHEEELLLLlllLHHHHHHHHHLL-----LEEEElL


DSSP  LHHhhllhhhhhhhlhhhllllLLLLHhHHHHHHHHHHL---LLLLEELLLLLLLLllll
Query PHYfvldtdqfeeigtlakcspPIRDLeNQKGXWEKLFN---GEIDCLVSDHSPCPpexk  302
ident                          |          |          |  |         
Sbjct IGK-----------------nsYYPDE-KRIAMLHALRDrglLNRVMLSMDITRRS----  247
DSSP  LLL-----------------llLLLHH-HHHHHHHHHHHlllHHHEEELLLLLLHH----


DSSP  lllllllllllLLHHHHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlllllllllll
Query agnixkawggiAGLQSCXDVXFDEAVqKRGXSLPXFGKLXATNAADIFGlqqkgriapgk  362
ident             |                | |          |    |            
Sbjct ----hlkanggYGYDYLLTTFIPQLR-QSGFSQADVDVMLRENPSQFFQ-----------  291
DSSP  ----hlhhhllLLLLHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHLL-----------


DSSP  llleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllll
Query dadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapk  422
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  lleelll
Query gqfilkh  429
ident        
Sbjct -------  291
DSSP  -------


No 31: Query=3e74A Sbjct=3cjpA Z-score=15.2

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                        | |||
Sbjct ----------------------------------------------------LIIDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  L--LHHHHHHHHHHLLEEEEEELLLLLL--------------------------------
Query I--GYETGTRAAAKGGITTXIEXPLNQL--------------------------------   86
ident      |         |    |                                       
Sbjct VilPVEKHIKIMDEAGVDKTILFSTSIHpetavnlrdvkkemkklndvvngktnsmidvr   68
DSSP  LllLHHHHHHHHHHHLLLEEEEELLLLLhhhlllhhhhhhhhhhhhhhhlllllllhhhh


DSSP  LLLLlhHHHHHHHHHHllllllEEEELEELLL-----LLLLLHH-HHHHHLLLLE-EEEL
Query PATVdrASIELKFDAAkgkltiDAAQLGGLVS-----YNIDRLH-ELDEVGVVGF-XCFV  139
ident               |            |                        ||      
Sbjct RNSI--KELTNVIQAY----psRYVGFGNVPVglsenDTNSYIEeNIVNNKLVGIgELTP  122
DSSP  HHHH--HHHHHHHHHL----llLEEEEELLLLlllhhHHHHHHHhHLLLLLLLEEeEELL


DSSP  lllLHHHHHHHHHHHHHH-LLLEEEELLLHhhhhhhhhhhhhhllllhhhhhhlllhhhH
Query rdvNDWQFFKGAQKLGEL-GQPVLVHCENAlicdelgeeakregrvtahdyvasrpvftE  198
ident                      |   |  |                               
Sbjct asgQIKSLKPIFKYSMDSgSLPIWIHAFNP----------------------------lV  154
DSSP  lllLHHHHHHHHHHHHHLlLLLEEELLLLL----------------------------lL


DSSP  HHHHHHHHHHHHHHL-LLEEELLLL---LHHHHHHHHHHHhlllLEEEEELlHHHHllhh
Query VEAIRRVLYLAKVAG-CRLHVCHVS---SPEGVEEVTRARqegqDITCESCpHYFVldtd  254
ident    |     | |          |         ||                          
Sbjct LQDIKEIAELCKAFPkVPVILGHMGgsnWMTAVELAKEIQ----NLYLDTSaYFST----  206
DSSP  HHHHHHHHHHHHHLLlLLEEEHHHHhhhHHHHHHHHHHLL----LEEEELLlLLLH----


DSSP  hhhhhlhhhllllllllhhhhHHHHHHHHLL-lLLEELLLLLlllllllllllllllllL
Query qfeeigtlakcsppirdlenqKGXWEKLFNG-eIDCLVSDHSpcppexkagnixkawggI  313
ident                                        |                    
Sbjct ---------------------FVLKIVINELplKCIFGTDMP-----------------F  228
DSSP  ---------------------HHHHHHHHHLllLEELLLLLL-----------------L


DSSP  LLHHHHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLllllllllllllleeeeelll
Query AGLQSCXDVXFDEAvqkrgXSLPXFGKLXATNAADIFGLqqkgriapgkdadfvfiqpns  373
ident   ||                           |                            
Sbjct GDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI---------------------  262
DSSP  LLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL---------------------


DSSP  leellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query syvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                         
Sbjct --------------------------------------------------------  262
DSSP  --------------------------------------------------------


No 32: Query=3e74A Sbjct=3k2gB Z-score=15.1

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                     |    | |
Sbjct -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL


DSSP  L-------------------------------------------------LHHHHHHHHH
Query I-------------------------------------------------GYETGTRAAA   71
ident                                                            |
Sbjct LqndcrcwwnppqeperqylaeapisieilselrqdpfvnkhnialddldLAIAEVKQFA   95
DSSP  LleelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleellhhHHHHHHHHHH


DSSP  HLLEEEEEELLL--LLLLllllhhhHHHHHHhHLLLLLLEEEElEELL------------
Query KGGITTXIEXPL--NQLPatvdrasIELKFDaAKGKLTIDAAQlGGLV------------  117
ident   |                                         |               
Sbjct AVGGRSIVDPTCrgIGRD-------PVKLRR-ISAETGVQVVX-GAGYylassxpetaar  146
DSSP  HLLLLEEEELLLllLLLL-------HHHHHH-HHHHHLLEEEE-LLLLllhhhllhhhhl


DSSP  ---lLLLLLHHHHHH-------HLLLLE-EEEL----llLLHHHHHHHHHHHHHHLLLEE
Query ---sYNIDRLHELDE-------VGVVGF-XCFV----rdVNDWQFFKGAQKLGELGQPVL  162
ident        |                        |               |      | |  
Sbjct lsadDIADEIVAEALegtdgtdARIGLIgEIGVssdftaEEEKSLRGAARAQVRTGLPLX  206
DSSP  llhhHHHHHHHHHHHlllllllLLLLLEeEELLlllllhHHHHHHHHHHHHHHHHLLLEE


DSSP  EELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHHHHLLL---EEEL
Query VHCEnalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAKVAGCR---LHVC  219
ident ||                                       ||| |    |        |
Sbjct VHLP------------------------------gWFRLAHRVLDLVEEEGADlrhTVLC  236
DSSP  ELLL------------------------------lLLLLHHHHHHHHHHLLLLhhhEEEL


DSSP  LL-LLHH---HHHHHHHHHhllllEEEEE-LLHHhhllhhhhhhhlhHHLL---llLLLL
Query HV-SSPE---GVEEVTRARqegqdITCES-CPHYfvldtdqfeeigtLAKC---spPIRD  271
ident |   |                      |                                
Sbjct HXnPSHXdpvYQATLAQRG-----AFLEFdXIGX-------------DFFYadqgvQCPS  278
DSSP  LLhHHLLlhhHHHHHHHHL-----LEEEElLLLL-------------LLEElllleELLL


DSSP  hhhHHHHHHHHHLLL------LLEELLLLLLLLlllllllllllllllLLHHHHHHHHHH
Query lenQKGXWEKLFNGE------IDCLVSDHSPCPpexkagnixkawggiAGLQSCXDVXFD  325
ident                         |  |                     |          
Sbjct ---DDEVARAILGLAdhgyldRILLSHDVFVKX--------xltryggNGYAFVTKHFLP  327
DSSP  ---HHHHHHHHHHHHhlllhhHEEELLLLLLHH--------hlhhhllLLLLHHHHLHHH


DSSP  HHLlLLLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeeelllleellhhhllll
Query EAVqKRGXSLPXFGKLXATNAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyr  385
ident       |        || ||    |                                   
Sbjct RLR-RHGLDDAALETLXVTNPRRVFD----------------------------------  352
DSSP  HHH-HLLLLHHHHHHHHLHHHHHHHL----------------------------------


DSSP  llllllllleelleeeeeeelleeeeelllllllllllleelll
Query hkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                             
Sbjct --------------------------------------asiegh  358
DSSP  --------------------------------------llllll


No 33: Query=3e74A Sbjct=2qpxA Z-score=15.0

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllLEEE-ELEEEEEE
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasgLVVS-PGXVDAHT   59
ident                                                  |      | | 
Sbjct -----------------------------------------gxddlsEFVDqVPLLDHHC   19
DSSP  -----------------------------------------lllllhHHHHhLLEEEEEE


DSSP  LLL---------------------------------------------------------
Query HIG---------------------------------------------------------   62
ident |                                                           
Sbjct HFLidgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaaxnd   79
DSSP  LLLlllllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllh


DSSP  ---hHHHHHHHHHLLEEEEEELLLLLLlllllhhhhhhHHHHHlLLLLLEEEELEELLLL
Query ---yETGTRAAAKGGITTXIEXPLNQLpatvdrasielKFDAAkGKLTIDAAQLGGLVSY  119
ident         |                               |       |       |   
Sbjct pgyaTYNHRIFGHFHFKELLIDTGFVP------ddpilDLDQTaELVGIPVKAIYRLETH  133
DSSP  hhhhHHHHHHHHHLLEEEEEEELLLLL------lllllLHHHHhHHHLLLEEEEEEHHHH


DSSP  -----------------LLLLHHHHHHHLLLLEEEEL-----------------------
Query -----------------NIDRLHELDEVGVVGFXCFV-----------------------  139
ident                             | ||||                          
Sbjct aedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIAayrvglhlepvnvieaaagfdtw  193
DSSP  hhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELHhhhlllllllllhhhhhhhhhhh


DSSP  ----------lllLHHHHHHHHHHHHHHLLLEEEELL----lHHHHhhhhhhhhhhllll
Query ----------rdvNDWQFFKGAQKLGELGQPVLVHCE----nALICdelgeeakregrvt  185
ident               |      |        |   |                         
Sbjct khsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGygdadTDXY--------------  239
DSSP  hhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELlllllLLHH--------------


DSSP  hhhhhhlllhhHHHHHhHHHHHHHHHHLLLEEELLLL--LHHHHHHHHHHhhllLLEEEE
Query ahdyvasrpvfTEVEAiRRVLYLAKVAGCRLHVCHVS--SPEGVEEVTRArqegQDITCE  243
ident                  |  |      |      |      |                  
Sbjct ---------lgNPLLX-RDYLKAFTKKGLKVVLLHCYpyHREAGYLASVF----PNLYFD  285
DSSP  ---------hlLHHHH-HHHHHHHHHHLLLEEEEELLllHHHHHHHHHHL----LLEEEE


DSSP  EL--LHHHHLLhhhhhhhlhhhllllllllhhhhHHHHHHhHLLL---LLEELLLLLLll
Query SC--PHYFVLDtdqfeeigtlakcsppirdlenqKGXWEKlFNGE---IDCLVSDHSPcp  298
ident                                       |              || |   
Sbjct ISllDNLGPSG---------------------asRVFNEA-VELApytRILFASDAST--  321
DSSP  LLlhHHHLHHH---------------------hhHHHHHH-LLLLlhhHEELLLLLLL--


DSSP  lllllllllllllllLLHHHHHHHHHHHHLlLLLL---------LHHHHHHHHLHHHHHH
Query pexkagnixkawggiAGLQSCXDVXFDEAVqKRGX---------SLPXFGKLXATNAADI  349
ident                              |                           |  
Sbjct -------------ypEXYGLAARQFKQALV-AHFNqlpfvdlaqKKAWINAICWQTSAKL  367
DSSP  -------------lhHHHHHHHHHHHHHHH-HHHHllllllhhhHHHHHHHHHLHHHHHH


DSSP  LLLLLLLLLllllllleeeeelllleellhhhllllllllllllleelleeeeeeellee
Query FGLQQKGRIapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdv  409
ident        |                                                    
Sbjct YHQERELRV---------------------------------------------------  376
DSSP  LLLHHHHLL---------------------------------------------------


DSSP  eeelllllllllllleelll
Query iydieqgfpvapkgqfilkh  429
ident                     
Sbjct --------------------  376
DSSP  --------------------


No 34: Query=3e74A Sbjct=1a4mA Z-score=14.7

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
ident                                                       |  | |
Sbjct ----------------------------------------------tpafNKPKVELHVH   14
DSSP  ----------------------------------------------llllLLLEEEEEEE


DSSP  L-----------------------------------------------------------
Query I-----------------------------------------------------------   61
ident                                                             
Sbjct Ldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcre   74
DSSP  Hhhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllhh


DSSP  ----lHHHHHHHHHHLLEEEEEELLL-LLLL--------------lllLHHHHHHHHHHH
Query ----gYETGTRAAAKGGITTXIEXPL-NQLP--------------atvDRASIELKFDAA  102
ident              || |            |                        |     
Sbjct aikriAYEFVEMKAKEGVVYVEVRYSpHLLAnskvdpmpwnqtegdvtPDDVVDLVNQGL  134
DSSP  hhhhhHHHHHHHHHHLLEEEEEEEELlHHHLlllllllhhhlllllllHHHHHHHHHHHH


DSSP  LLLL---LLEEEELEELL---LLLLLL-HHHHHHHL---LLLEEEE-----llLLLHHHH
Query KGKL---TIDAAQLGGLV---SYNIDR-LHELDEVG---VVGFXCF-----vrDVNDWQF  147
ident         |                   |          ||                   
Sbjct QEGEqafGIKVRSILCCMrhqPSWSLEvLELCKKYNqktVVAMDLAgdetiegSSLFPGH  194
DSSP  HHHHhhhLLEEEEEEEEElllHHHHHHhHHHHHHLLlllEEEEEEElllllllHHHLHHH


DSSP  HHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhHHHHHHHHHHH
Query FKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvfTEVEAIRRVLY  207
ident           |    ||                                   |  |    
Sbjct VEAYEGAVKNGIHRTVHAG----------------------------evGSPEVVREAVD  226
DSSP  HHHHHHHHHHLLEEEEEEL----------------------------llLLHHHHHHHHH


DSSP  HHhhhlLLEEELLLLlhHHHH---HHHHHHHllLLEEEEELLHhhhllhhhhhhhlhhHL
Query LAkvagCRLHVCHVSspEGVE---EVTRARQegQDITCESCPHyfvldtdqfeeigtlAK  264
ident           | |       |      |          | ||                  
Sbjct IL----KTERVGHGY--HTIEdeaLYNRLLK--ENMHFEVCPW-------------ssYL  265
DSSP  LL----LLLEEEELH--HHHHlhhHHHHHHH--LLLEEEELHH-------------hhHH


DSSP  LLlLLLLHHHHhHHHHHHHLLLLLEELLLLLLlllllllllllllllLLLLhhHHHHHHH
Query CSpPIRDLENQkGXWEKLFNGEIDCLVSDHSPcppexkagnixkawgGIAGlqSCXDVXF  324
ident                          |  |                               
Sbjct TG-AWDPKTTH-AVVRFKNDKANYSLNTDDPL---------------IFKS--TLDTDYQ  306
DSSP  LL-LLLLLLLL-HHHHHHHLLLLEEELLLLLL---------------LLLL--LHHHHHH


DSSP  hHHLLLLLLLHHHHHHHhLHHHHHHLLL-----LLLL--LLLLllllleeeeelllleel
Query dEAVQKRGXSLPXFGKLxATNAADIFGL-----QQKG--RIAPgkdadfvfiqpnssyvl  377
ident        |     |  |   |||    |                                
Sbjct -MTKKDMGFTEEEFKRL-NINAAKSSFLpeeekKELLerLYRE-----------------  347
DSSP  -HHHHLLLLLHHHHHHH-HHHHHHLLLLlhhhhHHHHhhHHHH-----------------


DSSP  lhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query tnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                     
Sbjct --------------------------------------------------yq  349
DSSP  --------------------------------------------------ll


No 35: Query=3e74A Sbjct=2ffiA Z-score=14.5

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
ident                                                        | | |
Sbjct -------------------------------------------------lhLTAIDSHAH   11
DSSP  -------------------------------------------------llLLLEELLLL


DSSP  L-------------------LHHHHHHHHHHLLEEEEEELLLL-LLLLLllhHHHHHHHH
Query I-------------------GYETGTRAAAKGGITTXIEXPLN-QLPATvdrASIELKFD  100
ident                                 |                           
Sbjct VfsrglnlasqrryapnydaPLGDYLGQLRAHGFSHGVLVQPSfLGTDN---RYLLSALQ   68
DSSP  LllhhhhhhlllllllllllLHHHHHHHHHHLLLLEELLLLLHhHLLLL---HHHHHHHH


DSSP  HHllllllEEEELEELLLLLLL-LHHHHHHHLLLLEEEEL---llLLHH--hHHHHHHHH
Query AAkgkltiDAAQLGGLVSYNID-RLHELDEVGVVGFXCFV---rdVNDW--qFFKGAQKL  154
ident                |        | |    || |                         
Sbjct TV----pgQLRGVVXLERDVEQaTLAEXARLGVRGVRLNLxgqdxPDLTgaqWRPLLERI  124
DSSP  HL----llLLLLLLLLLLLLLHhHHHHHHLLLLLEEELLLlllllLLLLlllLHHHHHHH


DSSP  HHHLLLEEEELllhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHHHHLL
Query GELGQPVLVHCenalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAKVAGC  214
ident || |  |  |                                  |  |          | 
Sbjct GEQGWHVELHR--------------------------------QVADIPVLVRALQPYGL  152
DSSP  HHHLLEEEELL--------------------------------LLLLHHHHHHHHLLLLL


DSSP  LEEELL-LLLH-------HHHHHHHHHhHLLLLEEEEELLHHhhllhhhhhhhlhhhlll
Query RLHVCH-VSSP-------EGVEEVTRArQEGQDITCESCPHYfvldtdqfeeigtlakcs  266
ident      |             |  |                  |                  
Sbjct DIVIDHfGRPDarrglgqPGFAELLTL-SGRGKVWVKVSGIY------------------  193
DSSP  LEEELHhHLLLlllllllLLHHHHLLL-LLLLLEEEEEELHH------------------


DSSP  LLLLL-HHHHHHHHHHHHLLL------lLEELLLLLLllllllllllllllLLLL---LH
Query PPIRD-LENQKGXWEKLFNGE------iDCLVSDHSPcppexkagnixkawGGIA---GL  316
ident        ||       |   |           ||                          
Sbjct RLQGSpEENLAFARQALCALEahygaerLXWGSDWPH--------------TQHEsevSF  239
DSSP  HLLLLhHHHHHHHHHHHHHHHhhllhhhEEEELLLLL--------------LLLLlllLH


DSSP  HHHHHHHhHHHLllllLLHHHHHHHHLHHHHHHLLLLLllllllllllleeeeellllee
Query QSCXDVXfDEAVqkrgXSLPXFGKLXATNAADIFGLQQkgriapgkdadfvfiqpnssyv  376
ident  |               |      |    |   ||                         
Sbjct GSAVEQF-EALG----CSAQLRQALLLDTARALFGFEL----------------------  272
DSSP  HHHHHHH-HHHL----LLHHHHHHHHLHHHHHHLLLLL----------------------


DSSP  llhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query ltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                      
Sbjct ----------------------------------------------------e  273
DSSP  ----------------------------------------------------l


No 36: Query=3e74A Sbjct=2dvtA Z-score=14.4

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
ident                                                     | |    |
Sbjct --------------------------------------------------MQGKVALEEH   10
DSSP  --------------------------------------------------LLLEEEEEEE


DSSP  L---------------------------LHHHHHHHHHHLLEEEEEELLLL---------
Query I---------------------------GYETGTRAAAKGGITTXIEXPLN---------   84
ident                                |        || | |              
Sbjct FaipetlqdsagfvpgdywkelqhrlldIQDTRLKLMDAHGIETMILSLNApavqaipdr   70
DSSP  EllhhhhhhhlllllllhhhhhhhhhhlLLLHHHHHHHHLLEEEEEEEELLlhhhhlllh


DSSP  llllllLHHHHHHHHHHHLLLllLEEEELEELLL----LLLLLHHHHHH-HLLLLEEEEL
Query qlpatvDRASIELKFDAAKGKltIDAAQLGGLVS----YNIDRLHELDE-VGVVGFXCFV  139
ident        |                       |           |       | ||     
Sbjct rkaieiARRANDVLAEECAKR-pDRFLAFAALPLqdpdAATEELQRCVNdLGFVGALVNG  129
DSSP  hhhhhhHHHHHHHHHHHHHHL-lLLEEEEELLLLllhhHHHHHHHHHHHlLLLLEEEEEL


DSSP  LL-----------lLHHHhHHHHHHHHHHLLLEEEELllHHHHHHHHHHHHhhllllhHH
Query RD-----------vNDWQfFKGAQKLGELGQPVLVHCenALICDELGEEAKregrvtaHD  188
ident                             |  |   |                      | 
Sbjct FSqegdgqtplyydLPQY-RPFWGEVEKLDVPFYLHP-rNPLPQDSRIYDG-------HP  180
DSSP  LLllllllllllllLHHH-HHHHHHHHHHLLLEEEEL-lLLLHHHLHHHLL-------LH


DSSP  HHH---lllHHHHHHHHHHHH--HHHHHHL-LLEEEL-LLLLhhHHHH------------
Query YVA---srpVFTEVEAIRRVL--YLAKVAG-CRLHVC-HVSSpeGVEE------------  229
ident                   |     |                                   
Sbjct WLLgptwafAQETAVHALRLMasGLFDEHPrLNIILGhMGEG--LPYMmwridhrnawvk  238
DSSP  HHLhhhlhhHHHHHHHHHHHHhlLHHHHLLlLLEEELhHHLL--HHHHhhhhhhllllll


DSSP  ----------hHHHHHllLLEEEEELlHHHHllhhhhhhhlhhhllllllllhhhhhHHH
Query ----------vTRARQegQDITCESCpHYFVldtdqfeeigtlakcsppirdlenqkGXW  279
ident                              |                              
Sbjct lpprypakrrfMDYFN--ENFHITTS-GNFR-------------------------tQTL  270
DSSP  llllllllllhHHHHH--HHEEEELL-LLLL-------------------------hHHH


DSSP  HHHHLLL---LLEELLLLLlllllllllllllllllLLLHHHHHHHHHHHHlllllLLHH
Query EKLFNGE---IDCLVSDHSpcppexkagnixkawggIAGLQSCXDVXFDEAvqkrgXSLP  336
ident                 |                           |               
Sbjct IDAILEIgadRILFSTDWP-----------------FENIDHASDWFNATS-----IAEA  308
DSSP  HHHHLLLlhhHEELLLLLL-----------------LLLHHHHHHHHHHLL-----LLHH


DSSP  HHHHHHLHHHHHHLLLLlllllllllllleeeeelllleellhhhlllllllllllllee
Query XFGKLXATNAADIFGLQqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrti  396
ident    |   |||   | |                                            
Sbjct DRVKIGRTNARRLFKLD-------------------------------------------  325
DSSP  HHHHHHLHHHHHHLLLL-------------------------------------------


DSSP  lleeeeeeelleeeeelllllllllllleelll
Query garitktilrgdviydieqgfpvapkgqfilkh  429
ident                                  
Sbjct ---------------------------------  325
DSSP  ---------------------------------


No 37: Query=3e74A Sbjct=4dlfA Z-score=14.1

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
ident                                                        | | |
Sbjct ---------------------------------------------------ALRIDSHQH    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  L----------------------LHHHHHHHHHHLLEEEEEELLLLlllLLLLhhHHHHH
Query I----------------------GYETGTRAAAKGGITTXIEXPLNqlpATVDraSIELK   98
ident                                         |                   
Sbjct FwryraadypwigagmgvlardyLPDALHPLMHAQALGASIAVQARagrDETA--FLLEL   67
DSSP  LllllhhhllllllllhhhllllLHHHHHHHHHHLLLLEEEEELLLllhHHHH--HHHHH


DSSP  HhhhlllllLEEE-ELEELL--LLLLL-LHHHhHHHL-LLLEEEEL-------lllLHHH
Query FdaakgkltIDAA-QLGGLV--SYNID-RLHElDEVG-VVGFXCFV-------rdvNDWQ  146
ident             |   |           |  |        ||               |  
Sbjct A-----cdeARIAaVVGWEDlrAPQLAeRVAE-WRGTkLRGFRHQLqdeadvrafvDDAD  121
DSSP  H-----lllLLEEeEEELLLllLLLHHhHHHL-LLLLlEEEEEELHhhlllhhhhhHLHH


DSSP  HHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllHHHHHHHhHHHH
Query FFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpVFTEVEAiRRVL  206
ident |  |   |        |                                           
Sbjct FARGVAWLQANDYVYDVLVF----------------------------ERQLPDV-QAFC  152
DSSP  HHHHHHHHHHLLLEEEELLL----------------------------HHHHHHH-HHHH


DSSP  HHHHhhLLLEEELLLL----------------LHHHHHHHHHHHhlllLEEEEELlHHHH
Query YLAKvaGCRLHVCHVS----------------SPEGVEEVTRARqegqDITCESCpHYFV  250
ident          |   |                        |            |        
Sbjct ARHD--AHWLVLDHAGkpalaefdrddtalarWRAALRELAALP----HVVCKLS-GLVT  205
DSSP  HHLL--LLLEEEHHHHlllhhhllllllhhhhHHHHHHHHHLLL----LEEEEEL-LLLL


DSSP  LLHhhHHHHLHHhlllllllLHHHHHHHHHHHHLLL---LLEELLLLLllllllllllll
Query LDTdqFEEIGTLakcsppirDLENQKGXWEKLFNGE---IDCLVSDHSpcppexkagnix  307
ident                     ||                      ||              
Sbjct EAD--WRRGLRA-------sDLRHIEQCLDAALDAFgpqRLMFGSDWP------------  244
DSSP  LLL--LLLLLLH-------hHHHHHHHHHHHHHHHHlhhHEEELLLLL------------


DSSP  llllLLLL---HHHHHHHHHHHHLllLLLLHHHHHHHHLHHHHHHLLLLlllllllllll
Query kawgGIAG---LQSCXDVXFDEAVqkRGXSLPXFGKLXATNAADIFGLQqkgriapgkda  364
ident                       |      |      |    ||    |            
Sbjct ----VCLLaasYDEVASLVERWAE--SRLSAAERSALWGGTAARCYALP-----------  287
DSSP  ----HHHHlllHHHHHHHHHHHHH--HHLLHHHHHHHLLHHHHHHLLLL-----------


DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll
Query dfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  eelll
Query filkh  429
ident      
Sbjct -----  287
DSSP  -----


No 38: Query=3e74A Sbjct=4hk5D Z-score=14.1

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
ident                                                    |  || |||
Sbjct --------------------------------------------------TPVVVDIHTH   10
DSSP  --------------------------------------------------LLLLEEEEEE


DSSP  L-----------------------------------------------------------
Query I-----------------------------------------------------------   61
ident                                                             
Sbjct Myppsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrplsthf   70
DSSP  Ellhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleellhhh


DSSP  -LHHHHHHHHHHLLEEEEEELLLL--------llllllLHHHHHHHHHhhLLLLllEEEE
Query -GYETGTRAAAKGGITTXIEXPLN--------qlpatvDRASIELKFDaaKGKLtiDAAQ  112
ident              ||        |                |      |            
Sbjct aSLAQKMHFMDTNGIRVSVISLANpwfdflapdeapgiADAVNAEFSDmcAQHV-gRLFF  129
DSSP  lLHHHHHHHHHHLLLLEEEEEELLllllllllllhhhhHHHHHHHHHHhhHLLL-lLEEE


DSSP  LEELLLL-----LLLLHHHHHHHL-LLLEEEELlLLLH-----HHHHHHHHHHHHHLLLE
Query LGGLVSY-----NIDRLHELDEVG-VVGFXCFVrDVND-----WQFFKGAQKLGELGQPV  161
ident    |                       |                               |
Sbjct FAALPLSapvdaVKASIERVKNLKyCRGIILGT-SGLGkglddPHLLPVFEAVADAKLLV  188
DSSP  EEELLLLllhhhHHHHHHHHHLLLlEEEEEELL-LLLLlllllHHHHHHHHHHHHLLLEE


DSSP  EEELLLHhhHHHHHHHhhHHLLLLHhhHHHLL---lHHHHHHHHHHHH--HHHHHH-LLL
Query LVHCENAliCDELGEEakREGRVTAhdYVASR---pVFTEVEAIRRVL--YLAKVA-GCR  215
ident   |                         |             |  |              
Sbjct FLHPHYG--LPNEVYG--PRSEEYG--HVLPLalgfPMETTIAVARMYmaGVFDHVrNLQ  242
DSSP  EELLLLL--LLHHHHL--LLHHHLL--LHHHHhlhhHHHHHHHHHHHHhlLHHHHLlLLL


DSSP  EEELLLLLhHHHH--------------------------hhHHHHhllLLEEEEELlHHH
Query LHVCHVSSpEGVE--------------------------evTRARqegQDITCESCpHYF  249
ident     |                                             |       | 
Sbjct MLLAHSGG-TLPFlagriescivhdghlvktgkvpkdrrtiWTVL--kEQIYLDAV-IYS  298
DSSP  EEEHHHHL-LHHHhhhhhhhhhhllhhhhhllllllllllhHHHH--hHLEEEELL-LLL


DSSP  HllhhhhhhhlhhhllllllllhhhhhHHHHHHHLLL---LLEELLLLLlllllllllll
Query VldtdqfeeigtlakcsppirdlenqkGXWEKLFNGE---IDCLVSDHSpcppexkagni  306
ident                                               ||            
Sbjct E--------------------------VGLQAAIASSgadRLMFGTDHP-----------  321
DSSP  H--------------------------HHHHHHHHHHlhhHEELLLLLL-----------


DSSP  lllllLLLL--------hhHHHHHHH--HHHLlllLLLHHHHHHHHLHHHHHHLLLLLll
Query xkawgGIAG--------lqSCXDVXF--DEAVqkrGXSLPXFGKLXATNAADIFGLQQkg  356
ident                    |          ||   |            ||     |    
Sbjct -----FFPPieedvqgpwdSSRLNAQavIKAV---GEGSSDAAAVMGLNAVRVLSLKA--  371
DSSP  -----LLLLlllllllllhHHHHHHHhhHHHH---LLLLHHHHHHHLHHHHHHLLLHH--


DSSP  llllLLLLleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellll
Query riapGKDAdfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqg  416
ident                                                             
Sbjct --elEHHH----------------------------------------------------  377
DSSP  --hhHHHH----------------------------------------------------


DSSP  lllllllleelll
Query fpvapkgqfilkh  429
ident              
Sbjct ----------hhh  380
DSSP  ----------hhl


No 39: Query=3e74A Sbjct=4qrnA Z-score=14.1

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSPGXVDAHTH   60
ident                                                             
Sbjct --------------------------------------smtqdlktggEQGYLRIATEEA   22
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE


DSSP  L----------------------------------------------LHHHHHHHHHHLL
Query I----------------------------------------------GYETGTRAAAKGG   74
ident                                                  |         |
Sbjct FatreiidvylrmirdgtadkgmvslwgfyaqspseratqilerlldLGERRIADMDATG   82
DSSP  EllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhhlLLHHHHHHHHHLL


DSSP  EEEEEELLLL---------------lLLLLllhHHHHHHHHHHlllllLEEEELEELLL-
Query ITTXIEXPLN---------------qLPATvdrASIELKFDAAkgkltIDAAQLGGLVS-  118
ident |   |                       |                         |     
Sbjct IDKAILALTSpgvqplhdldeartlaTRAN---DTLADACQKY----pDRFIGMGTVAPq  135
DSSP  LLEEEEEELLllllllllhhhhhhhhHHHH---HHHHHHHHHL----lLLEEELLLLLLl


DSSP  ---LLLLLHHHHHH-HLLLLEEEEL-----lllLHHHhHHHHHHHHHHLLLEEEELLLHH
Query ---YNIDRLHELDE-VGVVGFXCFV-----rdvNDWQfFKGAQKLGELGQPVLVHCENAL  169
ident          |      |  |                        | |  ||   |     
Sbjct dpeWSAREIHRGAReLGFKGIQINShtqgryldEEFF-DPIFRALVEVDQPLYIHPATSP  194
DSSP  lhhHHHHHHHHHHHlLLLLLEEELLllllllllLHHH-HHHHHHHHHHLLLEEELLLLLL


DSSP  H-HHHHHHHHhhhllllhhhhHHLL----lHHHHHHHHHHHH--HHHHHH-LLLEEELLL
Query I-CDELGEEAkregrvtahdyVASR----pVFTEVEAIRRVL--YLAKVA-GCRLHVCHV  221
ident         ||                             |                | | 
Sbjct DsMIDPMLEA-----------GLDGaifgfGVETGMHLLRLItiGIFDKYpSLQIMVGHM  243
DSSP  LlLLHHHHHH-----------LLLLlllhhHHHHHHHHHHHHhhLHHHHLlLLLEEELHH


DSSP  LLhHHHH--------------------------hhHHHHHllLLEEEEELlHHHHllhhh
Query SSpEGVE--------------------------evTRARQegQDITCESCpHYFVldtdq  255
ident                                                             
Sbjct GE-ALPYwlyrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW-----  294
DSSP  HH-LHHHhhhhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL-----


DSSP  hhhhlhhhllllllllhhhhHHHHHHHHLLL--LLEELLLLLllllllllllllllllLL
Query feeigtlakcsppirdlenqKGXWEKLFNGE--IDCLVSDHSpcppexkagnixkawgGI  313
ident                                        |                    
Sbjct -------------------ePAIKFCQQVMGedRVMYAMDYP----------------YQ  319
DSSP  -------------------hHHHHHHHHHHLhhHEELLLLLL----------------LL


DSSP  LLhHHHHHHHHHHhllllLLLHHHHHHHHLHHHHHHLLLllllllllllllleeeeelll
Query AGlQSCXDVXFDEavqkrGXSLPXFGKLXATNAADIFGLqqkgriapgkdadfvfiqpns  373
ident                     |     |   |||   | |                     
Sbjct YV-ADEVRAMDAM-----DMSAQTKKKFFQTNAEKWFKL---------------------  352
DSSP  LL-HHHHHHHHLL-----LLLHHHHHHHHLHHHHHHLLL---------------------


DSSP  leellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query syvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                         
Sbjct --------------------------------------------------------  352
DSSP  --------------------------------------------------------


No 40: Query=3e74A Sbjct=2y1hB Z-score=14.0

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
ident                                                     | || | |
Sbjct --------------------------------------------------GVGLVDCHCH   10
DSSP  --------------------------------------------------LLLEEEEEEL


DSSP  L-------LHHHHHHHHHHLLEEEEEELLLLlLLLLllhhHHHHHHHHHllllllEEEEL
Query I-------GYETGTRAAAKGGITTXIEXPLNqLPATvdraSIELKFDAAkgkltiDAAQL  113
ident                 | |                      |                  
Sbjct LsapdfdrDLDDVLEKAKKANVVALVAVAEHsGEFE----KIMQLSERY----ngFVLPC   62
DSSP  LllhhhllLHHHHHHHHHHLLEEEEEELLLLhHHHH----HHHHHHHHL----llLEEEE


DSSP  EEL---------------LLLLLLLHHHHHhHLLLLE-EEEL------------lllLHH
Query GGL---------------VSYNIDRLHELDeVGVVGF-XCFV------------rdvNDW  145
ident  |                                                          
Sbjct LGVhpvqgldqrsvtlkdLDVALPIIENYK-DRLLAIgEVGLdfsprfagtgeqkeeQRQ  121
DSSP  ELLlleelllleellhhhHHHHHHHHHHHL-LLLLEEeEEEEellllllllhhhhhhHHH


DSSP  HHHHHHHHHHHHLLLEEEELLLhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHH
Query QFFKGAQKLGELGQPVLVHCENalicdelgeeakregrvtahdyvasrpvfteveAIRRV  205
ident       |    |  || ||                                    | |  
Sbjct VLIRQIQLAKRLNLPVNVHSRS---------------------------------AGRPT  148
DSSP  HHHHHHHHHHHHLLLEEEEEEL---------------------------------LHHHH


DSSP  HHHHHHHLLL-EEELLLLLHHhhHHHHHHHHllLLEEEEELLhHHHLlhhhhhhhlhhhl
Query LYLAKVAGCR-LHVCHVSSPEgvEEVTRARQegQDITCESCPhYFVLdtdqfeeigtlak  264
ident   |    |                                 |                  
Sbjct INLLQEQGAEkVLLHAFDGRP--SVAMEGVR--AGYFFSIPP-SIIR-------------  190
DSSP  HHHHHHLLLLlEEEELLLLLH--HHHHHHHH--LLLEEEELH-HHHL-------------


DSSP  lllllllhhhHHHHHHHHHLLL--LLEELLLLLllllllllllllllLLLLLLHHHHHhH
Query csppirdlenQKGXWEKLFNGE--IDCLVSDHSpcppexkagnixkaWGGIAGLQSCXdV  322
ident                           ||  |                             
Sbjct ----------SGQKQKLVKQLPltSICLETDSP---------algpeKQVRNEPWNIS-I  230
DSSP  ----------LHHHHHHHHHLLhhHEEELLLLL---------lllllLLLLLLHHHHH-H


DSSP  HHHHHLLLLLLL-HHHHHHHhLHHHHHHLL-LLLLlllllllllleeeeelllleellhh
Query XFDEAVQKRGXS-LPXFGKLxATNAADIFG-LQQKgriapgkdadfvfiqpnssyvltnd  380
ident       |  | |           ||   |  |                            
Sbjct SAEYIAQVKGISvEEVIEVT-TQNALKLFPkLRHL-------------------------  264
DSSP  HHHHHHHHHLLLhHHHHHHH-HHHHHHHLLlHHHH-------------------------


DSSP  hllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query dleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                  
Sbjct ------------------------------------------------l  265
DSSP  ------------------------------------------------l


No 41: Query=3e74A Sbjct=4mupB Z-score=13.9

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEE-LEEEEEE
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSP-GXVDAHT   59
ident                                                    | | ||   
Sbjct -------------------------------------lvrklsgtapnPAFPrGAVDTQM   23
DSSP  -------------------------------------lllllllllllLLLLlLLEELLL


DSSP  LL--------------------LHHHHHHHHHHLLEEEEEELLLLlLLLLllhhHHHHHH
Query HI--------------------GYETGTRAAAKGGITTXIEXPLNqLPATvdraSIELKF   99
ident |                     | |   |     ||   |    |               
Sbjct HMylpgypalpggpglppgalpGPEDYRRLMQWLGIDRVIITQGN-AHQR----DNGNTL   78
DSSP  LLllllllllllllllllllllLHHHHHHHHHHHLLLEEEEELLH-HHLL----LLHHHH


DSSP  hhhllllllEEEELEELLLLLLL-LHHHHHHHLLLLEEEEL-----LLLLhhHHHHHHHH
Query daakgkltiDAAQLGGLVSYNID-RLHELDEVGVVGFXCFV-----RDVNdwQFFKGAQK  153
ident           |                 |   | ||                        
Sbjct -acvaemgeAAHAVVIIDATTTEkDMEKLTAAGTVGARIMDlpggaVNLS--ELDAVDER  135
DSSP  -hhhhhhhhHEEEEELLLLLLLHhHHHHHHHLLEEEEEEELlllllLLHH--HHHHHHHH


DSSP  HHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhHHHHHHhHHHHHHHhhhL
Query LGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvFTEVEAiRRVLYLAkvaG  213
ident        | |                                          |       
Sbjct AHAADWMVAVQFD----------------------------gNGLLDH-LPRLQKI---R  163
DSSP  HHHLLLEEEEELL----------------------------hHHHHHH-HHHHHLL---L


DSSP  LLEEELLLL--------lhHHHHHHHHHHHlLLLEEEEELLHHhhlLHHHHhhhlhhhll
Query CRLHVCHVS--------spEGVEEVTRARQeGQDITCESCPHYfvlDTDQFeeigtlakc  265
ident  |    |                                   |                 
Sbjct SRWVFDHHGkffkgirtdgPEMAALLKLID-RGNLWFKFAGVY-esSRKSW---------  212
DSSP  LEEEELHHHhlllllllllHHHHHHHHHHH-HLLEEEEELLHH-hlLLLLL---------


DSSP  llllllHHHHHHHHHHHHLLL-LLEELLLLLL-LLLLLLlllllllllLLLLhHHHHHHH
Query sppirdLENQKGXWEKLFNGE-IDCLVSDHSP-CPPEXKagnixkawgGIAGlQSCXDVX  323
ident                                     |                       
Sbjct ----pyADVAAFSRVIAAHAPeRIVWGTNWPHnSVRETA--------aYPDD-ARLAELT  259
DSSP  ----llHHHHHHHHHHHHHLHhHEEELLLLLLlLLLLHH--------hLLLH-HHHHHHH


DSSP  HHHHlllllLLHHHHHHHHLHHHHHHLLLLLLlllllllllleeeeelllleellhhhll
Query FDEAvqkrgXSLPXFGKLXATNAADIFGLQQKgriapgkdadfvfiqpnssyvltnddle  383
ident                      |    | |                               
Sbjct LGWL-----PDEAARHRALVENPEALFKLSPV----------------------------  286
DSSP  HLLL-----LLHHHHHHHHLHHHHHHHLLLLL----------------------------


DSSP  llllllllllleelleeeeeeelleeeeelllllllllllleelll
Query yrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                               
Sbjct ----------------------------------------------  286
DSSP  ----------------------------------------------


No 42: Query=3e74A Sbjct=4ofcA Z-score=13.7

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                        | | |
Sbjct ----------------------------------------------------MKIDIHSH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  L---------------------------------------------LHHHHHHHHHHLLE
Query I---------------------------------------------GYETGTRAAAKGGI   75
ident |                                               |   |     | 
Sbjct IlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwDPEVRIREMDQKGV   68
DSSP  LlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhhlLHHHHHHHHHHHLL


DSSP  EEEEELLLLLL---------llllLHHHHHHHHHhhlllllLEEEELEELLL----LLLL
Query TTXIEXPLNQL---------patvDRASIELKFDaakgkltIDAAQLGGLVS----YNID  122
ident |                                             || |          
Sbjct TVQALSTVPVMfsywakpedtlnlCQLLNNDLAS-tvvsypRRFVGLGTLPMqapeLAVK  127
DSSP  LEEEEELLHHHhlllllhhhhhhhHHHHHHHHHH-hhhhllLLEEEEELLLLllhhHHHH


DSSP  LHHHHHH-HLLLLEEEEL-----lllLHHHhHHHHHHHHHHLLLEEEELllhhhHHHHhH
Query RLHELDE-VGVVGFXCFV-----rdvNDWQfFKGAQKLGELGQPVLVHCenaliCDELgE  176
ident          |  |                  |        |     ||            
Sbjct EMERCVKeLGFPGVQIGThvnewdlnAQEL-FPVYAAAERLKCSLFVHP---wdMQMD-G  182
DSSP  HHHHHHHlLLLLEEEEELeelleellLHHH-HHHHHHHHHHLLEEEEEL---llLLLL-H


DSSP  HHHhhllllhHHHHH--lLLHHHHHHHHHHHH-HHHHHHL--LLEEELLLLLhHHHH---
Query EAKregrvtaHDYVA--sRPVFTEVEAIRRVL-YLAKVAG--CRLHVCHVSSpEGVE---  228
ident                           ||                    |           
Sbjct RMA-------KYWLPwlvGMPAETTIAICSMImGGVFEKFpkLKVCFAHGGG-AFPFtvg  234
DSSP  HHH-------LLLHHhhlHHHHHHHHHHHHHHlLLHHHHLllLLEEELHHHL-LHHHhhh


DSSP  -------------------hhHHHHhlllLEEEEELlHHHHllhhhhhhhlhhhllllll
Query -------------------evTRARqegqDITCESCpHYFVldtdqfeeigtlakcsppi  269
ident                                                             
Sbjct rishgfsmrpdlcaqdnpmnpKKYL---gSFYTDAL-VHDP-------------------  271
DSSP  hhhhhhhhlhhhhlllllllhHHHL---lLLEEELL-LLLH-------------------


DSSP  llhhhhhHHHHHHHLLL---LLEELLLLLLlllllllllllllllLLLLHhHHHHHHHhH
Query rdlenqkGXWEKLFNGE---IDCLVSDHSPcppexkagnixkawgGIAGLqSCXDVXFdE  326
ident             |          |  |                      |          
Sbjct -------LSLKLLTDVIgkdKVILGTDYPF---------------PLGEL-EPGKLIE-S  307
DSSP  -------HHHHHHHHHHlllLEELLLLLLL---------------LLLLL-LLLHHHH-H


DSSP  HLLlllLLHHHHHHHHLHHHHHHLLLLllllllllLLLLeeeeelllleellhhhlllll
Query AVQkrgXSLPXFGKLXATNAADIFGLQqkgriapgKDADfvfiqpnssyvltnddleyrh  386
ident              || | ||    ||                                  
Sbjct MEE---FDEETKNKLKAGNALAFLGLE--------RKQF---------------------  335
DSSP  LLL---LLHHHHHHHHLHHHHHHHLLL--------HHHL---------------------


DSSP  lllllllleelleeeeeeelleeeeelllllllllllleelll
Query kvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                            
Sbjct -------------------------------------------  335
DSSP  -------------------------------------------


No 43: Query=3e74A Sbjct=4dziC Z-score=13.7

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSPGXVDAHTH   60
ident                                                        |   |
Sbjct ------------------------------------------------ALNYRVIDVDNH   12
DSSP  ------------------------------------------------LLLLLEEEEEEE


DSSP  L-----------------------------------------------------------
Query I-----------------------------------------------------------   61
ident                                                             
Sbjct Yyepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllf   72
DSSP  Lllllllllllllhhhlllleeeeelllleeeeelleellllllllllleelllllhhhh


DSSP  --------------------------LHHHHHHHHHHLLEEEEEELLLLL----------
Query --------------------------GYETGTRAAAKGGITTXIEXPLNQ----------   85
ident                                        | |    |             
Sbjct rgeipdgvdpaslmkverladhpeyqNRDARIAVMDEQDIETAFMLPTFGcgveealkhd  132
DSSP  hllllllllhhhllleelhhhlhhhlLHHHHHHHHHHHLEEEEEEELLHHhhhhhhllll


DSSP  --lllllLHHHHHHHHHHH-llllllEEEELEELLLL----LLLLHHHHHHHLLLLEEEE
Query --lpatvDRASIELKFDAA-kgkltiDAAQLGGLVSY----NIDRLHELDEVGVVGFXCF  138
ident          |                                          |       
Sbjct ieatmasVHAFNLWLDEDWgfdrpdhRIIAAPIVSLAdptrAVEEVDFVLARGAKLVLVR  192
DSSP  hhhhhhhHHHHHHHHHHHLlllllllLEEELLLLLLLlhhhHHHHHHHHHHLLLLLEELL


DSSP  L----------lllLHHHhHHHHHHHHHHLLLEEEELLLHHHhHHHHHHHHHhlllLHHH
Query V----------rdvNDWQfFKGAQKLGELGQPVLVHCENALIcDELGEEAKRegrvTAHD  188
ident                          | | | ||  |                        
Sbjct PapvpglvkprslgDRSH-DPVWARLAEAGVPVGFHLSDSGY-LHIAAAWGG---aKDPL  247
DSSP  LlllllllllllllLHHH-HHHHHHHHHHLLLEEEELLLLLL-HHHHHHLLL---lLLHH


DSSP  HHHLLLHHHHHHHHHHHHH-HHHHHL--LLEEELLLLLHhHHHHHH--------------
Query YVASRPVFTEVEAIRRVLY-LAKVAG--CRLHVCHVSSPeGVEEVT--------------  231
ident                                      |   |                  
Sbjct DQVLLDDRAIHDTMASMIVhGVFTRHpkLKAVSIENGSY-FVHRLIkrlkkaantqpqyf  306
DSSP  HHHHHLLHHHHHHHHHHHHlLHHHHLllLLEEEELLLLL-HHHHHHhhhhhhhhhlhhhl


DSSP  hhhHLLL---LEEEEELLHHhhllhhhhhhhlhhhllllllllhhhhhhHHHHHHLLL--
Query rarQEGQ---DITCESCPHYfvldtdqfeeigtlakcsppirdlenqkgXWEKLFNGE--  286
ident       |                                              |      
Sbjct pedPVEQlrnNVWIAPYYED-----------------------------DLPELARVIgv  337
DSSP  lllHHHHhhhHEEELLLLLL-----------------------------LHHHHHHHHlh


DSSP  -LLEELLLLLLlllllllllllllllLLLLhHHHHhHHHHHHLlllLLLHHHHHHHHLHH
Query -IDCLVSDHSPcppexkagnixkawgGIAGlQSCXdVXFDEAVqkrGXSLPXFGKLXATN  345
ident       ||                  |     |       |     | |     |    |
Sbjct dKILFGSDWPH---------------GEGL-ASPV-SFTAELK---GFSESDIRKIMRDN  377
DSSP  hHLLLLLLLLL---------------LLLL-LLHH-HHHHHHL---LLLHHHHHHHHLHH


DSSP  HHHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeee
Query AADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktil  405
ident | |  |                                                      
Sbjct ALDLLG------------------------------------------------------  383
DSSP  HHHHHL------------------------------------------------------


DSSP  lleeeeelllllllllllleelll
Query rgdviydieqgfpvapkgqfilkh  429
ident                         
Sbjct -------------------vqvgs  388
DSSP  -------------------lllll


No 44: Query=3e74A Sbjct=1itqA Z-score=13.0

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllLEEE--ELEEEEE
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasgLVVS--PGXVDAH   58
ident                                                          | |
Sbjct ----------------------------------------dffrdeaERIMrdSPVIDGH   20
DSSP  ----------------------------------------lhhhhhhHHHHllLLEEEEE


DSSP  ELL-----------------------lhhhHHHHHHHLLEEEEEELLLLL---------L
Query THI-----------------------gyetGTRAAAKGGITTXIEXPLNQ---------L   86
ident                                      |                      
Sbjct NDLpwqlldmfnnrlqderanlttlagthtNIPKLRAGFVGGQFWSVYTPcdtqnkdavR   80
DSSP  ELHhhhhhhhhllllllhhhllllllllllLHHHHHHLLEEEEEEEELLLhhhllllhhH


DSSP  LLLllhHHHHHHHHHHL--LLLL-----------------LEEEELEELL---LLLLLLH
Query PATvdrASIELKFDAAK--GKLT-----------------IDAAQLGGLV---SYNIDRL  124
ident                                                            |
Sbjct RTL---EQMDVVHRMCRmyPETFlyvtssagirqafregkVASLIGVEGGhsiDSSLGVL  137
DSSP  HHH---HHHHHHHHHHHhlLLLEeelllhhhhhhhhhlllEEEEEEEELHhhlLLLHHHH


DSSP  HHHHHHLLLLEEEE---lLLLL-----------------HHHHHHHHHHHHHHLLLEEEE
Query HELDEVGVVGFXCF---vRDVN-----------------DWQFFKGAQKLGELGQPVLVH  164
ident   |   |                                          |  ||      
Sbjct RALYQLGMRYLTLThscnTPWAdnwlvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLA  197
DSSP  HHHHHLLEEEEELLllllLLLLllhhhllllllllllllLHHHHHHHHHHHHHLLEEELL


DSSP  LLlhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHHHHHHHHHLLLEEEL-LLLL
Query CEnalicdelgeeakregrvtahdyvasrpvfteveAIRRVLYLAKVAGCRLHVC-HVSS  223
ident                                                             
Sbjct HV----------------------------------SVATMKATLQLSRAPVIFShSSAY  223
DSSP  LL----------------------------------LHHHHHHHHHHLLLLLEELlLLLL


DSSP  H------hHHHHHHHHHhlLLLEEEEELLH-hhhLLHHHHhhhlhhhllllllllhhhhh
Query P------eGVEEVTRARqeGQDITCESCPH-yfvLDTDQFeeigtlakcsppirdlenqk  276
ident             | |      |              |                       
Sbjct SvcasrrnVPDDVLRLV-kQTDSLVMVNFYnnyiSCTNKA--------------nlsqva  268
DSSP  LlllllllLLHHHHHHH-hHHLLEEEELLLhhhhLLLLLL--------------lhhhhh


DSSP  HHHHHHHL---LLLLEELLLLLlllllllllllllllLLLL----LHHHhHHHHHHHHLL
Query GXWEKLFN---GEIDCLVSDHSpcppexkagnixkawGGIA----GLQScXDVXFDEAVQ  329
ident                    |                                    |   
Sbjct DHLDHIKEvagARAVGFGGDFD-------------gvPRVPegleDVSK-YPDLIAELLR  314
DSSP  HHHHHHHHhllHHHEEELLLLL-------------llLLLLllllLLLL-HHHHHHHHHH


DSSP  lLLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeeelllleellhhhllllllll
Query kRGXSLPXFGKLXATNAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvs  389
ident  |           | |    |                                       
Sbjct -RNWTEAEVKGALADNLLRVFE--------------------------------------  335
DSSP  -LLLLHHHHHHHHLHHHHHHHH--------------------------------------


DSSP  llllleelleeeeeeelleeeeelllllllllllleelll
Query pyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                         
Sbjct ------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  ------hhhhllllllllllllllhhhlllllllllllll


No 45: Query=3e74A Sbjct=3gg7A Z-score=12.4

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                        | | |
Sbjct ----------------------------------------------------SLIDFHVH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  L----LHHHHHHHHHHLLEeEEEELLlllllLLLLhhHHHHHHHhhllLLLLEEEELEEL
Query I----GYETGTRAAAKGGItTXIEXPlnqlpATVDraSIELKFDaakgKLTIDAAQLGGL  116
ident            ||       |           |                         | 
Sbjct LdlypDPVAVARACEERQL-TVLSVT-----TTPA--AWRGTLA--laAGRPHVWTALGF   58
DSSP  HhhllLHHHHHHHHHHLLL-EEEELL-----LLHH--HHHHHHH--hhLLLLLEEELLLL


DSSP  -------lLLLLLLHHHHHHhLLLLE-EEEL---------lllLHHHHHHHHHHHHHH-L
Query -------vSYNIDRLHELDEvGVVGF-XCFV---------rdvNDWQFFKGAQKLGEL-G  158
ident                                                |           |
Sbjct hpevvserAADLPWFDRYLP-ETRFVgEVGLdgspslrgtwtqQFAVFQHILRRCEDHgG  117
DSSP  lhhhllllHHHLHHHHHHHH-HLLEEeEEELlllhhhhhhhhhHHHHHHHHHHHHHHLlL


DSSP  LLEEEELLLhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHHHHHHHH-HLLL-E
Query QPVLVHCENalicdelgeeakregrvtahdyvasrpvfteveAIRRVLYLAKV-AGCR-L  216
ident      |                                    |   ||            
Sbjct RILSIHSRR---------------------------------AESEVLNCLEAnPRSGtP  144
DSSP  EEEEEELLL---------------------------------LHHHHHHHHHHlHHHEeE


DSSP  EELLLL-LHHHHHHHHHHHhllllEEEEELLHHHHLLhhhhhhhlhhhllllllllhhHH
Query HVCHVS-SPEGVEEVTRARqegqdITCESCPHYFVLDtdqfeeigtlakcsppirdleNQ  275
ident      | |                      |                             
Sbjct ILHWYSgSVTELRRAISLG-----CWFSVGPTMVRTQ---------------------KG  178
DSSP  EEELLLlLHHHHHHHHHLL-----LEEEELHHHHLLH---------------------HH


DSSP  HHHHHHHhLLLLLEELLLLLLllllllllllllLLLLlLLHHHHHhHHHHHHLLlLLLL-
Query KGXWEKLfNGEIDCLVSDHSPcppexkagnixkAWGGiAGLQSCXdVXFDEAVQkRGXS-  334
ident                  |                    |                     
Sbjct AALIRSM-PRDRVLTETDGPF---------lelDGQA-ALPWDVK-SVVEGLSKiWQIPa  226
DSSP  HHHHHHL-LHHHEEELLLLLL---------leeLLEE-LLHHHHH-HHHHHHHHhHLLLh


DSSP  HHHHHHHhLHHHHHHLLlllllllllllllleeeeelllleellhhhlllllllllllll
Query LPXFGKLxATNAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgr  394
ident           |     |                                           
Sbjct SEVERIV-KENVSRLLG-------------------------------------------  242
DSSP  HHHHHHH-HHHHHHHHH-------------------------------------------


DSSP  eelleeeeeeelleeeeelllllllllllleelll
Query tigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                    
Sbjct ----------------------------------t  243
DSSP  ----------------------------------l


No 46: Query=3e74A Sbjct=3qy6A Z-score=12.1

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeelEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgXVDAHTH   60
ident                                                        | | |
Sbjct -----------------------------------------------------MIDIHCH    7
DSSP  -----------------------------------------------------LEELLLL


DSSP  L------------LHHHHHHHHHHLLEEEEEELLL--llllLLLLHhHHHHHHHH-HLLL
Query I------------GYETGTRAAAKGGITTXIEXPL--nqlpATVDRaSIELKFDA-AKGK  105
ident |                  |||   || | |  |                   |   |  
Sbjct IlpamddgagdsaDSIEMARAAVRQGIRTIIATPHhnngvyKNEPA-AVREAADQlNKRL   66
DSSP  LllllllllllhhHHHHHHHHHHHLLLLEEELLLEelllllLLLHH-HHHHHHHHhHHHH


DSSP  ----LLLEEEELEellllllllhhhhhhhlllleEEELllllHHHHHHHHHHH----hhh
Query ----LTIDAAQLGglvsynidrlheldevgvvgfXCFVrdvnDWQFFKGAQKL----gel  157
ident                                                    |        
Sbjct ikedIPLHVLPGQ---------------------EIRI----YGEVEQDLAKRqllslnd  101
DSSP  hhllLLLEEELLL---------------------EEEL----LLLHHHHHHLLllllhhh


DSSP  lLLEEEELLLHhhhhhhhhhhhhhllllhhhhhhlllhhHHHHHHHHHHHHHHHHLLLEE
Query gQPVLVHCENAlicdelgeeakregrvtahdyvasrpvfTEVEAIRRVLYLAKVAGCRLH  217
ident     |                                            |     |    
Sbjct tKYILIEFPFD----------------------------HVPRYAEQLFYDLQLKGYIPV  133
DSSP  lLEEEEELLLL----------------------------LLLLLHHHHHHHHHHLLLEEE


DSSP  ELLLL-------lHHHHHHHHHHHhllllEEEEELLHHH-HLLHhhhhhhlhhhllllll
Query VCHVS-------sPEGVEEVTRARqegqdITCESCPHYF-VLDTdqfeeigtlakcsppi  269
ident   |          |                                              
Sbjct IAHPErnreirenPSLLYHLVEKG-----AASQITSGSLaGIFG----------------  172
DSSP  EELHHhlhhhhhlLHHHHHHHHLL-----LEEEEEHHHHlLLLL----------------


DSSP  llHHHHHHHHHHHHLLLLLEELLLLLLllllllllllllllllLLLHhHHHHhHHHHHLl
Query rdLENQKGXWEKLFNGEIDCLVSDHSPcppexkagnixkawggIAGLqSCXDvXFDEAVq  329
ident                  |    ||                                    
Sbjct --KQLKAFSLRLVEANLIHFVASDAHN--------------vkTRNF-HTQE-ALYVLE-  213
DSSP  --HHHHHHHHHHHHLLLLLEEELLLLL--------------llLLLL-LHHH-HHHHHH-


DSSP  lLLLLHHHHHHHhLHHHHHHLLLLlllllllllllleeeeelllleellhhhllllllll
Query kRGXSLPXFGKLxATNAADIFGLQqkgriapgkdadfvfiqpnssyvltnddleyrhkvs  389
ident            |   ||      |                                    
Sbjct -KEFGSELPYML-TENAELLLRNQ------------------------------------  235
DSSP  -HHHLLHHHHHH-HHHHHHHHLLL------------------------------------


DSSP  llllleelleeeeeeelleeeeelllllllllllleelll
Query pyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                         
Sbjct ----------------------------tifrqppqpvkr  247
DSSP  ----------------------------llllllllllll


No 47: Query=3e74A Sbjct=2gwgA Z-score=11.9

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                        | | |
Sbjct ----------------------------------------------------XIIDIHGH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  L---------------------------------------LHHH-HHHHHHHLLEEEEEE
Query I---------------------------------------GYET-GTRAAAKGGITTXIE   80
ident                                                      |      
Sbjct YttapkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVF   68
DSSP  LllllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEE


DSSP  LLLL---------llLLLLlhhHHHHHHHHHllllllEEEELEELLL-------LLLLLH
Query XPLN---------qlPATVdraSIELKFDAAkgkltiDAAQLGGLVS-------YNIDRL  124
ident  |                                          |           |  |
Sbjct SPRAgdfnvsstwaaICNE---LCYRVSQLF----pdNFIGAAXLPQspgvdpkTCIPEL  121
DSSP  ELLLllhhhhhhhhhHHHH---HHHHHHHHL----llLEEEEEELLLlllllhhHHHHHH


DSSP  HHHHH-HLLLLEEEELLL----------lLHHHhHHHHHHHHHHLLLEEEElllhhhhhh
Query HELDE-VGVVGFXCFVRD----------vNDWQfFKGAQKLGELGQPVLVHcenalicde  173
ident        | |                             |  ||  |   |         
Sbjct EKCVKeYGFVAINLNPDPsgghwtsppltDRIW-YPIYEKXVELEIPAXIH---------  171
DSSP  HHHHHlLLLLEEEELLLLlllllllllllLHHH-HHHHHHHHHHLLLEEEL---------


DSSP  hhhhhhhhllllhhhhhhlllhHHHHHHHHHH--hHHHHHH-LLLEEELLLLLhHHHH--
Query lgeeakregrvtahdyvasrpvFTEVEAIRRV--lYLAKVA-GCRLHVCHVSSpEGVE--  228
ident                            |        | |          |          
Sbjct --------------vstgahylNADTTAFXQCvagDLFKDFpELKFVIPHGGG-AVPYhw  216
DSSP  --------------lllllhhhHHHHHHHHHHhhlLHHHHLlLLLEEELHHHL-LLHHhh


DSSP  ---------hhhhhHHLLL--LEEEEELlHHHHllhhhhhhhlhhhllllllllhhhhHH
Query ---------evtraRQEGQ--DITCESCpHYFVldtdqfeeigtlakcsppirdlenqKG  277
ident                       |    |  |                            |
Sbjct grfrglaqexkkplLEDHVlnNIFFDTC-VYHQ-------------------------PG  250
DSSP  hhhhhhhhhlllllHHHHLllLEEEELL-LLLH-------------------------HH


DSSP  HHHHHHLLL--LLEELLLLLlllllllllllllllLLLL--------lhhHHHHHHHHHh
Query XWEKLFNGE--IDCLVSDHSpcppexkagnixkawGGIA--------glqSCXDVXFDEa  327
ident                 |                  |                        
Sbjct IDLLNTVIPvdNVLFASEXI---------------GAVRgidprtgfyydDTKRYIEAS-  294
DSSP  HHHHHHHLLhhHEELLLLLL---------------LLLLleelllleellLLHHHHHHL-


DSSP  lllLLLLHHHHHHHHLHHHHHHLL--LLLLlllLLLLllleeeeelllleellhhhllll
Query vqkRGXSLPXFGKLXATNAADIFG--LQQKgriAPGKdadfvfiqpnssyvltnddleyr  385
ident                  ||                                         
Sbjct ---TILTPEEKQQIYEGNARRVYPrlDAALkakGKLE-----------------------  328
DSSP  ---LLLLHHHHHHHHLHHHHHHLHhhHHHHhhhHHHL-----------------------


DSSP  llllllllleelleeeeeeelleeeeelllllllllllleelll
Query hkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                             
Sbjct -------------------------------------------h  329
DSSP  -------------------------------------------l


No 48: Query=3e74A Sbjct=1v77A Z-score=10.4

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
ident                                                             
Sbjct ---------------------------------------------------VKFIEMDIR    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LLHhhHHHHHHHlLEEEEEELLlllllllllhhhhhhhhhhhlllllleeeeleELLLLL
Query IGYetGTRAAAKgGITTXIEXPlnqlpatvdrasielkfdaakgkltidaaqlgGLVSYN  120
ident          |                                                  
Sbjct DKE--AYELAKE-WFDEVVVSI--------------------------------KFNEEV   34
DSSP  LHH--HHHHHHH-HLLEEEEEE--------------------------------EELLLL


DSSP  lllHHHHHHHLL-----LLEEEELllLLHHHHHHHHHHHHhhLLLEEEELLlhhhhhhhh
Query idrLHELDEVGV-----VGFXCFVrdVNDWQFFKGAQKLGelGQPVLVHCEnalicdelg  175
ident      |           |                  ||         |            
Sbjct ---DKEKLREARkeygkVAILLSN--PKPSLVRDTVQKFK--SYLIYVESN---------   78
DSSP  ---LHHHHHHHHhhhllEEEEEEL--LLHHHHHHHHHHLL--LLEEEEELL---------


DSSP  hhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHhhhllLEEELLLLL---HHHHH-hHH
Query eeakregrvtahdyvasrpvftEVEAIRRVLYLAkvagcRLHVCHVSS---PEGVE-eVT  231
ident                           ||                         |      
Sbjct ----------------------DLRVIRYSIEKG-----VDAIISPWVnrkDPGIDhvLA  111
DSSP  ----------------------LHHHHHHHHHLL-----LLEEELLLLlllLLLLLhhHH


DSSP  HHHHlLLLEEEEELLHHHHLLHHHhhhhlhhhlllllllLHHHHHHHHHHHHLLL-----
Query RARQeGQDITCESCPHYFVLDTDQfeeigtlakcsppirDLENQKGXWEKLFNGE-----  286
ident                                           |      |          
Sbjct KLMV-KKNVALGFSLRPLLYSNPY---------------ERANLLRFMMKAWKLVekykv  155
DSSP  HHHH-HHLLEEEEELHHHHHLLHH---------------HHHHHHHHHHHHHHHHhhhll


DSSP  lLEELLLLLLlllllllllllllllllLLHHHhHHHHHHHHLlllLLLHHHHHHHHLHHH
Query iDCLVSDHSPcppexkagnixkawggiAGLQScXDVXFDEAVqkrGXSLPXFGKLXATNA  346
ident    | |                                   |   |   |          
Sbjct rRFLTSSAQE----------------kWDVRY-PRDLISLGV-viGMEIPQAKASISMYP  197
DSSP  lEEEELLLLL----------------hHHLLL-HHHHHHHHH-hlLLLHHHHHHLLLHHH


DSSP  HHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeel
Query ADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilr  406
ident   |                                                         
Sbjct EIILK-------------------------------------------------------  202
DSSP  HHHHL-------------------------------------------------------


DSSP  leeeeelllllllllllleelll
Query gdviydieqgfpvapkgqfilkh  429
ident                        
Sbjct -----------------------  202
DSSP  -----------------------


No 49: Query=3e74A Sbjct=1j5sA Z-score=10.2

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEE--LEEEEE
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSP--GXVDAH   58
ident                                                         || |
Sbjct -----------------------------hmflgedylltnraavrlfNEVKdlPIVDPH   31
DSSP  -----------------------------llllllllllllhhhhhhhHHHLllLEEELL


DSSP  ELL---------------------------------------------------------
Query THI---------------------------------------------------------   61
ident  |                                                          
Sbjct NHLdakdivenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfp   91
DSSP  LLLlhhhhhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhh


DSSP  --------------------------------------------lhHHHHHHHHhllEEE
Query --------------------------------------------gyETGTRAAAkggITT   77
ident                                                   |         
Sbjct rfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLLRDMK---VEI  148
DSSP  hhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHHHHLL---EEE


DSSP  EEELLllllllLLLHHhHHHHHHHHLLLLLLEEEELEELLLL------------------
Query XIEXPlnqlpaTVDRAsIELKFDAAKGKLTIDAAQLGGLVSY------------------  119
ident                   |    |                                    
Sbjct LCTTD------DPVST-LEHHRKAKEAVEGVTILPTWRPDRAmnvdkegwreyvekmger  201
DSSP  EELLL------LLLLL-LHHHHHHHHHLLLLEEELLLLLHHHhllllllhhhhhhhhhhh


DSSP  --------------LLLLHHHHHHHLLLLEEEEL--------------------------
Query --------------NIDRLHELDEVGVVGFXCFV--------------------------  139
ident                        | | |                                
Sbjct ygedtstldgflnaLWKSHEHFKEHGCVASDHALlepsvyyvdenraravhekafsgekl  261
DSSP  hllllllhhhhhhhHHHHHHHHHLLLLLEEEEEElllllllllhhhhhhhhhhhllllll


DSSP  -----lllLHHHHHHHHHHHHHHLLLEEEELLLhhhHHHHhHHHHHHLlllhhhhhhLLL
Query -----rdvNDWQFFKGAQKLGELGQPVLVHCENaliCDELgEEAKREGrvtahdyvaSRP  194
ident                      |       |                              
Sbjct tqdeindyKAFMMVQFGKMNQETNWVTQLHIGA---LRDY-RDSLFKT-lgpdsggdIST  316
DSSP  lhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELE---ELLL-LHHHHHH-llllllllEEL


DSSP  HHhhHHHHHHHHHHHHHH--LLLEEEL---llLLHHHHHHHHHHHhlllLEEEEEL--lH
Query VFteVEAIRRVLYLAKVA--GCRLHVC---hvSSPEGVEEVTRARqegqDITCESC--pH  247
ident  |          |                     |                         
Sbjct NF--LRIAEGLRYFLNEFdgKLKIVLYvldptHLPTISTIARAFP----NVYVGAPwwfN  370
DSSP  LL--LLHHHHHHHHHHHLllLLLEEEEellhhHHHHHHHHHHHLL----LEEELLLlllL


DSSP  HHHLlhhhhhhhlhhhllllllllhhhhhHHHHHHHL----LLLLEELLLLLLlllllll
Query YFVLdtdqfeeigtlakcsppirdlenqkGXWEKLFN----GEIDCLVSDHSPcppexka  303
ident                                   |            | |          
Sbjct DSPF----------------------gmeMHLKYLASvdllYNLAGMVTDSRK-------  401
DSSP  LLHH----------------------hhhHHHHHHHLlllhHHLLLLLLLLLL-------


DSSP  llllllllllLLHHHHHHHHHHHHLLLLL-----------lLHHHHHHHHLHHHHHHLLl
Query gnixkawggiAGLQSCXDVXFDEAVQKRG-----------xSLPXFGKLXATNAADIFGl  352
ident               |             |                            |  
Sbjct ---------lLSFGSRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF-  451
DSSP  ---------lLHHHHHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-


DSSP  llllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeee
Query qqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviyd  412
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  lllllllllllleelll
Query ieqgfpvapkgqfilkh  429
ident                  
Sbjct -----------------  451
DSSP  -----------------


No 50: Query=3e74A Sbjct=3iacA Z-score=9.7

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllLEEE--ELEEEEE
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasgLVVS--PGXVDAH   58
ident                                                          | |
Sbjct ----------------------------atfxtedfllkndiartlyHKYAapXPIYDFH   32
DSSP  ----------------------------llllllllllllhhhhhhhHHLLllLLEEELL


DSSP  ELL----LHHH-------------------------------------------------
Query THI----GYET-------------------------------------------------   65
ident  |                                                          
Sbjct CHLspqeIADDrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantv   92
DSSP  LLLlhhhHHHLlllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhh


DSSP  -------------------------------------------------HHHHHHHLLEE
Query -------------------------------------------------GTRAAAKGGIT   76
ident                                                             
Sbjct pktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVR  152
DSSP  hhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEE


DSSP  EEEELLllllllLLLHHhHHHHHHHH-LLLLLLEEEELEELLLL----------------
Query TXIEXPlnqlpaTVDRAsIELKFDAA-KGKLTIDAAQLGGLVSY----------------  119
ident                    |     |      |  |                        
Sbjct XVGTTD------DPIDS-LEYHRQIAaDDSIDIEVAPSWRPDKVfkieldgfvdylrkle  205
DSSP  EEELLL------LLLLL-LHHHHHHHhLLLLLLEEELLLLLHHHhllllllhhhhhhhhh


DSSP  ----------------LLLLHHHHHHHLLLLEEEEL------------------------
Query ----------------NIDRLHELDEVGVVGFXCFV------------------------  139
ident                    ||      |                                
Sbjct aaadvsitrfddlrqaLTRRLDHFAACGCRASDHGIetlrfapvpddaqldailgkrlag  265
DSSP  hhhllllllhhhhhhhHHHHHHHHHHLLLLEEEEEEllllllllllhhhhhhhhhhhhll


DSSP  --------lllLHHHHHHHHHHHHHHLLLEEEELLLhhHHHHhhhhhhhhllllhhhhhh
Query --------rdvNDWQFFKGAQKLGELGQPVLVHCENalICDElgeeakregrvtahdyva  191
ident                           |     |     |                     
Sbjct etlseleiaqfTTAVLVWLGRQYAARGWVXQLHIGA--IRNN--ntrxfrllgpdtgfds  321
DSSP  llllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELE--ELLL--lhhhhhhhllllllle


DSSP  lLLHHhHHHHHHHHHHHHHH-hLLLEEELLL----LLHHHHHHHHHHH--hlllLEEEEE
Query sRPVFtEVEAIRRVLYLAKV-aGCRLHVCHV----SSPEGVEEVTRAR--qegqDITCES  244
ident          |  | |    |                                       |
Sbjct iGDNN-ISWALSRLLDSXDVtnELPKTILYClnprDNEVLATXIGNFQgpgiagKVQFGS  380
DSSP  eLLLL-LHHHHHHHHHHHHLllLLLEEEEEEllhhHHHHHHHHHHHLLllllllLEEELL


DSSP  L--lHHHHLlhhhhhhhlhhhllllllllhhhhHHHHHHHHLLL----LLEELLLLLLll
Query C--pHYFVLdtdqfeeigtlakcsppirdlenqKGXWEKLFNGE----IDCLVSDHSPcp  298
ident                                      | |              |     
Sbjct GwwfNDQKD----------------------gxLRQLEQLSQXGllsqFVGXLTDSRS--  416
DSSP  LlhhHLLHH----------------------hhHHHHHHHHHHLlhhhLLLLLLLLLL--


DSSP  lllllllllllllllLLHHHHHHHHHHHHLLLLL-------------lLHHHHHHHHLHH
Query pexkagnixkawggiAGLQSCXDVXFDEAVQKRG-------------xSLPXFGKLXATN  345
ident                                  |                 |       |
Sbjct ---------------FLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNN  461
DSSP  ---------------LLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHH


DSSP  HHHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeee
Query AADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktil  405
ident |   |                                                       
Sbjct AQRYFT------------------------------------------------------  467
DSSP  HHHHLL------------------------------------------------------


DSSP  lleeeeelllllllllllleelll
Query rgdviydieqgfpvapkgqfilkh  429
ident                         
Sbjct ----------------------ik  469
DSSP  ----------------------ll


No 51: Query=3e74A Sbjct=2a3lA Z-score=8.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------leeeeeelleeellllEEELeeeeelleeeeeellllleeeeeellL
Query -------------sfdliikngtvileneARVVdiavkggkiaaigqdlgdakevxdasG   47
ident                              |                              
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS-------------------------aP  155
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH-------------------------lL


DSSP  LEEE--ELEEEEEELL--------------------------------------------
Query LVVS--PGXVDAHTHI--------------------------------------------   61
ident          || | |                                             
Sbjct HRDFynVRKVDTHVHHsacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldl  215
DSSP  LLLLllLLEEEEEEELlllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhhll


DSSP  -------------------------------------------------------LHHHH
Query -------------------------------------------------------GYETG   66
ident                                                             
Sbjct tgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeITKQV  275
DSSP  lllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHHHHH


DSSP  HHHHHHLLEEEEEELLL-lllllllLHHHHHHHHHHhLLLLlLEEEELEELLLL------
Query TRAAAKGGITTXIEXPL-nqlpatvDRASIELKFDAaKGKLtIDAAQLGGLVSY------  119
ident                                                |  |         
Sbjct FSDLEASKYQMAEYRISiygrkmseWDQLASWIVNN-DLYS-ENVVWLIQLPRLyniykd  333
DSSP  HHHHLLLLLEEEEEEEElllllllhHHHHHHHHHLL-LLLL-LLEEEEEEEELLhhhhll


DSSP  ---------LLLLHH----------------hhhHHLLLLEEEE----------------
Query ---------NIDRLH----------------eldEVGVVGFXCF----------------  138
ident            |                         ||||                   
Sbjct mgivtsfqnILDNIFiplfeatvdpdshpqlhvfLKQVVGFDLVddeskperrptkhmpt  393
DSSP  lllllllhhHHHHHLlhhhhhhhlhhhllllhhhHLLEEEEEEEllllllllllllllll


DSSP  -------llllLHHHHHHHHHHHHHHL----------LLEEEELLlhhhhhhhhhhhhhh
Query -------vrdvNDWQFFKGAQKLGELG----------QPVLVHCEnalicdelgeeakre  181
ident                       |  |                |                 
Sbjct paqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSG---------------  438
DSSP  lllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLL---------------


DSSP  llllhhhhhhlllHHHHhHHHHHHHHHHhhhlllEEELLLLlhHHHH---HHHHHHHllL
Query grvtahdyvasrpVFTEvEAIRRVLYLAkvagcrLHVCHVSspEGVE---EVTRARQegQ  238
ident                                       |                     
Sbjct ------------eAGDI-DHLAATFLTC------HSIAHGI--NLRKspvLQYLYYL--A  475
DSSP  ------------lLLLL-HHHHHHHHHL------LLLLLLH--HHHHlhhHHHHHHH--H


DSSP  LEEEEEL-LHHHhllhhhhhhhlhhhllllLLLLhhhHHHHhhHHHLL----LLLEELLL
Query DITCESC-PHYFvldtdqfeeigtlakcspPIRDlenQKGXweKLFNG----EIDCLVSD  293
ident  |                               |                      |  |
Sbjct QIGLAMSpLSNN-----------------sLFLD---YHRN--PFPVFflrgLNVSLSTD  513
DSSP  LLLEEELhHHHL-----------------lLLLL---LLLL--LHHHHhhllLLEEELLL


DSSP  LLllllllllllllllllLLLL--hHHHHHHHHhHHLLLLLLLHHHHHHHhLHHHHHHLL
Query HSpcppexkagnixkawgGIAG--lQSCXDVXFdEAVQKRGXSLPXFGKLxATNAADIFG  351
ident                                    |      |        | |     |
Sbjct DP----------------LQIHltkEPLVEEYS-IAASVWKLSACDLCEI-ARNSVYQSG  555
DSSP  LH----------------HHHLlllLHHHHHHH-HHHHHHLLLHHHHHHH-HHHHHHHLL


DSSP  LLL---llLLLLLLllleeeeelllleellhhhllllllllllllleelleeeeeeelle
Query LQQ---kgRIAPGKdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgd  408
ident          |                                                  
Sbjct FSHalkshWIGKDY--------------------ykrgpdgndihktnvphirvefrdti  595
DSSP  LLHhhhhhHLLLLL--------------------llllhhhllhhhhlllhhhhhhhhhh


DSSP  eeeelllllllllllleelll
Query viydieqgfpvapkgqfilkh  429
ident                      
Sbjct wkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhlllllllllllll


No 52: Query=3e74A Sbjct=3dcpA Z-score=7.7

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
ident                                                        | |||
Sbjct ----------------------------------------------------XKRDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  L---------LHHHHHHHHHHLLEEEEEELLL-----------------llllLLLL--H
Query I---------GYETGTRAAAKGGITTXIEXPL-----------------nqlpATVD--R   92
ident             |     |                                         
Sbjct TefcphgthdDVEEXVLKAIELDFDEYSIVEHaplssefxkntagdkeavttaSXAXsdL   68
DSSP  LlllllllllLHHHHHHHHHHLLLLEEEEEEEllllhhhhhllllllhhhhllLLLHhhH


DSSP  HHHHHHHHHH-LLLL-LLEEEELeellllllllhhhhhhhllllEEEELlllLHHHHHHH
Query ASIELKFDAA-KGKL-TIDAAQLgglvsynidrlheldevgvvgFXCFVrdvNDWQFFKG  150
ident      |     |                                |               
Sbjct PYYFKKXNHIkKKYAsDLLIHIG---------------------FEVDYligYEDFTRDF  107
DSSP  HHHHHHHHHHhHHLLlLLEEEEE---------------------EEEELlllLHHHHHHH


DSSP  HHHHHHhllleEEELLLHHH--------------hhHHHHHHhhhllllhhHHHHLlLHH
Query AQKLGElgqpvLVHCENALI--------------cdELGEEAkregrvtahDYVASrPVF  196
ident     |                                                       
Sbjct LNEYGPqtddgVLSLHFLEGqggfrsidfsaedyneGIVQFY--------gGFEQA-QLA  158
DSSP  HHHHHHhlleeEEELLEEEElleeeellllhhhhhhHLHHHH--------lLHHHH-HHH


DSSP  HHhHHHHHHHHHhHHHLLL-EEELLLL-----------------------LHHHHHHHHH
Query TEvEAIRRVLYLaKVAGCR-LHVCHVS-----------------------SPEGVEEVTR  232
ident    |                    | |                              |  
Sbjct YL-EGVKQSIEA-DLGLFKpRRXGHISlcqkfqqffgedtsdfseevxekFRVILALVKK  216
DSSP  HH-HHHHHHHHL-LLLLLLlLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHHHH


DSSP  HHhllllEEEEELLHHhhllhhhhhhhlHHHLlllllllhhHHHHHHHHHHLLLLLEELL
Query ARqegqdITCESCPHYfvldtdqfeeigTLAKcsppirdleNQKGXWEKLFNGEIDCLVS  292
ident                              |             |               |
Sbjct RD-----YELDFNTAG---------lfkPLCG-----etypPKKIVTLASELQIPFVYGS  257
DSSP  HL-----LEEEEELHH---------hhlLLLL-----llllLHHHHHHHHHLLLLEEEEL


DSSP  LLLLlllllllllllllllllLLHHHHHHHHHHHHLllllllhhhhhhhhlhhhhhhlll
Query DHSPcppexkagnixkawggiAGLQSCXDVXFDEAVqkrgxslpxfgklxatnaadifgl  352
ident |                                                           
Sbjct DSHG----------------vQDIGRGYSTYCQKLE------------------------  277
DSSP  LLLL----------------hHHLLLLHHHHHHHLL------------------------


DSSP  llllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeee
Query qqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviyd  412
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllllllllleelll
Query ieqgfpvapkgqfilkh  429
ident                  
Sbjct -----------------  277
DSSP  -----------------


No 53: Query=3e74A Sbjct=3f2bA Z-score=7.5

back to top
DSSP  ------------------------------------------------------leeeee
Query ------------------------------------------------------sfdlii    6
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  elleeelllleeeleeeeelleeeeeellllLEEE--eeellllEEEELEEEEEELL---
Query kngtvilenearvvdiavkggkiaaigqdlgDAKE--vxdasglVVSPGXVDAHTHI---   61
ident                                                   |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIaanerqdtaPEGEKRVELHLHTpms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEElllllllllLLLLLLLLLLLLLlll


DSSP  ------LHHHHHHHHHHLLEEEEEELLLllllLLLLhhhhhhhhhHHLLLL---LLEEEE
Query ------GYETGTRAAAKGGITTXIEXPLnqlpATVDrasielkfdAAKGKL---TIDAAQ  112
ident               | | |             | |           |             
Sbjct qmdavtSVTKLIEQAKKWGHPAIAVTDH----AVVQ------sfpEAYSAAkkhGMKVIY  170
DSSP  llllllLHHHHHHHHHHLLLLLEEELLL----LLLL------lhhHHHHHHhhhLLLEEE


DSSP  LEellllllllhhhhhhhlllleEEEL---------------------------------
Query LGglvsynidrlheldevgvvgfXCFV---------------------------------  139
ident                                                             
Sbjct GL---------------------EANIvddpfhvtllaqnetglknlfklvslshiqyfh  209
DSSP  EE---------------------EEEEellleeeeeeellhhhhhhhhhhhhhhhlllll


DSSP  --LLLLhhhHHHHHHHHhhHLLLeeeelllhhhhhhhhhhhhhhllllhhhhhhlllhhh
Query --RDVNdwqFFKGAQKLgeLGQPvlvhcenalicdelgeeakregrvtahdyvasrpvft  197
ident                     |                                       
Sbjct rvPRIP---RSVLVKHR--DGLL-------------------------------------  227
DSSP  llLLEE---HHHHHHLL--LLEE-------------------------------------


DSSP  hhhhhhhhhhhhhhhlllEEELLLllhhHHHHhHHHHhllLLEE-EEELLHHhhllhhhh
Query eveairrvlylakvagcrLHVCHVsspeGVEEvTRARqegQDIT-CESCPHYfvldtdqf  256
ident                                               |  |          
Sbjct ------------------VGSGCD-kgeLFDN-VEDI--aRFYDfLEVHPPD--------  257
DSSP  ------------------EELLLL-lllLLLL-LLLL--hHHLLlEEELLHH--------


DSSP  hhhlhhhlllLLLL---LHHHHHHHHHHHHLLL-----lLEELLLLLL-------LLLLL
Query eeigtlakcsPPIR---DLENQKGXWEKLFNGE-----iDCLVSDHSP-------CPPEX  301
ident                  | |  |                                     
Sbjct ---------vYKPLyvkDEEMIKNIIRSIVALGekldipVVATGNVHYlnpedkiYRKIL  308
DSSP  ---------hHLLLlllLHHHHHHHHHHHHHHHhhllllEEELLLLLLllhhhhhHHHHH


DSSP  LL-----lLLLLLLLLLLLHhHHHHHHHHHHLlllLLLHHHHHHHHLHHHHHHLLLllll
Query KA-----gNIXKAWGGIAGLqSCXDVXFDEAVqkrGXSLPXFGKLXATNAADIFGLqqkg  356
ident                             |                   |   |  |    
Sbjct IHsqgganPLNRHELPDVYF-RTTNEMLDCFS---FLGPEKAKEIVVDNTQKIASL----  360
DSSP  HHllhhhlLLLLLLLLLLLL-LLHHHHHHHHH---HHHHHHHHHHHLHHHHHHHHL----


DSSP  llllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellll
Query riapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqg  416
ident                                                             
Sbjct ------------------------------------------------------------  360
DSSP  ------------------------------------------------------------


DSSP  lllllllleELLL-----------------------------------------------
Query fpvapkgqfILKH-----------------------------------------------  429
ident          |                                                  
Sbjct ---------IGDVkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekel  411
DSSP  ---------LLLLllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct ksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpn  471
DSSP  hhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct ckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsge  531
DSSP  llleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct yqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagct  591
DSSP  lhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct gvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilg  651
DSSP  lleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct hddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtr  711
DSSP  ehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct fvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyli  771
DSSP  hhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct yrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvl  831
DSSP  hllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct mavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakeks  891
DSSP  hhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  429
ident                                                             
Sbjct lltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrar  951
DSSP  hhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhh


DSSP  -------------------------------------------
Query -------------------------------------------  429
ident                                            
Sbjct eegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 54: Query=3e74A Sbjct=1m65A Z-score=7.1

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeelEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgXVDAHTH   60
ident                                                       || | |
Sbjct ----------------------------------------------------yPVDLHMH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  L--------LHHHHHHHHHHLLEEEEEELLL-----LLLLllllHHHHHHHHHHHllllL
Query I--------GYETGTRAAAKGGITTXIEXPL-----NQLPatvdRASIELKFDAAkgklT  107
ident                  |   ||                                     
Sbjct TvasthaysTLSDYIAQAKQKGIKLFAITDHgpdmeDAPH----HWHFINMRIWPrvvdG   64
DSSP  LllllllllLHHHHHHHHHHHLLLEEEEEEElllllLLLL----LHHHHHHHHLLleelL


DSSP  LEEEELE-ELLL--llLLLHHH-HHHHlLLLEEEELL---------llLHHHHHHHHHHH
Query IDAAQLG-GLVS--ynIDRLHE-LDEVgVVGFXCFVR---------dvNDWQFFKGAQKL  154
ident                                                 |           
Sbjct VGILRGIeANIKnvdgEIDCSGkMFDS-LDLIIAGFHepvfaphdkatNTQAMIATIASG  123
DSSP  EEEEEEEeEELLllllLLLLLHhHHHH-LLEEEEELLllllllllhhhHHHHHHHHHHLL


DSSP  hhhlLLEEEE-LLLHHhhhhhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHHhl
Query gelgQPVLVH-CENALicdelgeeakregrvtahdyvasrpvftevEAIRRVLYLAKVag  213
ident              |                                     |   |    
Sbjct ----NVHIIShPGNPK----------------------------yeIDVKAVAEAAAK--  149
DSSP  ----LLLEELlLLLLL----------------------------llLLHHHHHHHHHH--


DSSP  LLEEELL---llLHHHHHHHHHHHhllllEEEEE------------LLHHHHllhhhhhh
Query CRLHVCH---vsSPEGVEEVTRARqegqdITCES------------CPHYFVldtdqfee  258
ident               |    |  |                                     
Sbjct HQVALEInnssnCREVAAAVRDAG-----GWVALgsdshtaftmgeFEECLK--------  196
DSSP  HLLEEEEellllHHHHHHHHHHHL-----LLEEEelllllhhhlllLHHHHH--------


DSSP  hlhhhllllllllhhhhhhHHHHhhLLLLLEElllllllllllllllllllllllllhhh
Query igtlakcsppirdlenqkgXWEKlfNGEIDCLvsdhspcppexkagnixkawggiaglqs  318
ident                            |                                
Sbjct ------------------iLDAVdfPPERILN----------------------------  210
DSSP  ------------------hHHHLllLHHHLHH----------------------------


DSSP  hhhhhhhhhlllllllhhhhhhHHLHHHHHHLLllllllllllLLLLeeeeelllleell
Query cxdvxfdeavqkrgxslpxfgkLXATNAADIFGlqqkgriapgKDADfvfiqpnssyvlt  378
ident                                                             
Sbjct ----------------------VSPRRLLNFLE-srgmapiaeFADL-------------  234
DSSP  ----------------------HLHHHHHHHHH-hllllllhhHLLL-------------


DSSP  hhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query nddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                    
Sbjct ---------------------------------------------------  234
DSSP  ---------------------------------------------------


No 55: Query=3e74A Sbjct=3au2A Z-score=6.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  --------------------leeeeeelleeelllleeeleeeeelleeeeeeLLLLL--
Query --------------------sfdliikngtvilenearvvdiavkggkiaaigQDLGD--   38
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   38
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   38
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------eeeeeelllleeEELEEEEEELL-------LHHHHHHH
Query ----------------------akevxdasglvvSPGXVDAHTHI-------GYETGTRA   69
ident                                        |   |          |    |
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysdgqnTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLlllllllLHHHHHHH


DSSP  HHHLLEEEEEELLL---------llllLLLLhhhHHHHHHHH-LLLLLLEEEELeellll
Query AAKGGITTXIEXPL---------nqlpATVDrasIELKFDAA-KGKLTIDAAQLgglvsy  119
ident |   |                                                       
Sbjct AKTMGYRYLAVTDHspavrvaggpspeEALK---RVGEIRRFnETHGPPYLLAG------  411
DSSP  HHHHLLLEEEEEEElhhhhllllllhhHHHH---HHHHHHHHhHHHLLLEEEEE------


DSSP  llllhhhhhhhlllleEEELllllhhhhhhHHHHhhhhlllEEEELLlHHHHhhhhhhhh
Query nidrlheldevgvvgfXCFVrdvndwqffkGAQKlgelgqpVLVHCEnALICdelgeeak  179
ident                                          |||                
Sbjct ---------------aEVDI---hpdgtldYPDWvlreldlVLVSVH-SRFN--------  444
DSSP  ---------------eEEEL---lllllllLLHHhhlllleEEEELL-LLLL--------


DSSP  hhllllhhhhhhlLLHHHHHHHHHHHHHHhhhhlLLEE-ELLLL----------lhHHHH
Query regrvtahdyvasRPVFTEVEAIRRVLYLakvagCRLH-VCHVS----------spEGVE  228
ident               |           |          |   |                  
Sbjct -------------LPKADQTKRLLKALEN-----PFVHvLAHPTarllgrrapieaDWEA  486
DSSP  -------------LLHHHHHHHHHHHHLL-----LLLLeELLLLllllllllllllLHHH


DSSP  HHHHHHHllLLEEEEEL--LHHHhllhhhhhhhlhhhllllllllhhhhhhHHHHHHLLL
Query EVTRARQegQDITCESC--PHYFvldtdqfeeigtlakcsppirdlenqkgXWEKLFNGE  286
ident     |         |                                             
Sbjct VFQKAKE--KGVAVEIDgyYDRM--------------------------dlPDDLARMAY  518
DSSP  HHHHHHH--HLLEEEEEllLLLL--------------------------llLHHHHHHHH


DSSP  ----lLEELLLLLLllllllllllllllllLLLHhHHHHHHHHHHLlLLLLLHHHhhHHH
Query ----iDCLVSDHSPcppexkagnixkawggIAGLqSCXDVXFDEAVqKRGXSLPXfgKLX  342
ident        |  |                      |          |             | 
Sbjct gmglwISLSTDAHQ----------------TDHL-RFMELAVGTAQ-RAWIGPER--VLN  558
DSSP  hllllEEEELLLLL----------------HHHH-HHHHHHHHHHH-HLLLLLLL--LHH


DSSP  LH---hHHHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelle
Query AT---nAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigar  399
ident                                                             
Sbjct TLdyedLLSWLK------------------------------------------------  570
DSSP  HLlhhhHHHHHH------------------------------------------------


DSSP  eeeeeelleeeeelllllllllllleelll
Query itktilrgdviydieqgfpvapkgqfilkh  429
ident                               
Sbjct -------------------------arrgv  575
DSSP  -------------------------lllll


No 56: Query=3e74A Sbjct=1bksA Z-score=6.5

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeleEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgxVDAHTH   60
ident                                                             
Sbjct -------------------------------------meryenlfaqlndrregAFVPFV   23
DSSP  -------------------------------------lhhhhhhhhhhhhllllEEEEEE


DSSP  --------lLHHHHHHHHHHllEEEEEELLLL---------------------lLLLLll
Query --------iGYETGTRAAAKggITTXIEXPLN---------------------qLPATvd   91
ident                            |                                
Sbjct tlgdpgieqSLKIIDTLIDA--GADALELGVPfsdpladgptiqnanlrafaagVTPA--   79
DSSP  elllllhhhHHHHHHHHHHL--LLLLEEEELLllllllllhhhhhhhhhhhhhlLLHH--


DSSP  hHHHHHHHHHHLLllllEEEELEELLLLLLL------LHHHHHHHLLLLEEEEllLLLHH
Query rASIELKFDAAKGkltiDAAQLGGLVSYNID------RLHELDEVGVVGFXCFvrDVNDW  145
ident     |                                       |||        ||   
Sbjct -QCFEMLALIREK--hpTIPIGLLMYANLVFnngidaFYARCEQVGVDSVLVA--DVPVE  134
DSSP  -HHHHHHHHHHHH--llLLLEEEEELHHHHHlllhhhHHHHHHHHLLLEEEEL--LLLHH


DSSP  HHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhHHHH-HHHH
Query QFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvfTEVE-AIRR  204
ident       |            |                                      | 
Sbjct ESAPFRQAALRHNIAPIFICP-----------------------------pNADDdLLRQ  165
DSSP  HLHHHHHHHHHLLLEEEEEEL-----------------------------lLLLHhHHHH


DSSP  HHHHHhhhllLEEELLL--lLHHHHHHHHHHHhllllEEEEEL-------LHHHhllhhh
Query VLYLAkvagcRLHVCHV--sSPEGVEEVTRARqegqdITCESC-------PHYFvldtdq  255
ident |         |              |                                  
Sbjct VASYG-----RGYTYLLalpLHHLIEKLKEYH----aAPALQGfgisspeQVSA------  210
DSSP  HHHHL-----LLLEEELlllHHHHHHHHHHHL----lLLEEELlllllhhHHHH------


DSSP  hhhhlhhhllllllllhhhhhhhhhhhhLLLLLEELLL-LLLL--LLLLLLlllllllll
Query feeigtlakcsppirdlenqkgxweklfNGEIDCLVSD-HSPC--PPEXKAgnixkawgg  312
ident                                     |                       
Sbjct --------------------------avRAGAAGAISGsAIVKiiEKNLAS-pkqmlael  243
DSSP  --------------------------hhHHLLLEEEELlHHHHhhHHLLLL-hhhhhhhh


DSSP  llLHHHHHHHHHhhhlllllllhhhhhhhhlhhhhhhlllllllllllllllleeeeell
Query iaGLQSCXDVXFdeavqkrgxslpxfgklxatnaadifglqqkgriapgkdadfvfiqpn  372
ident                                                             
Sbjct rsFVSAMKAASR------------------------------------------------  255
DSSP  hhHHHHHHHLLL------------------------------------------------


DSSP  lleellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query ssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                          
Sbjct ---------------------------------------------------------  255
DSSP  ---------------------------------------------------------


No 57: Query=3e74A Sbjct=2yb1A Z-score=5.0

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeelEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgXVDAHTH   60
ident                                                        | | |
Sbjct ----------------------------------------------------aNIDLHFH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  L-------LHHHHHHHHHHLLEEEEEELLLlllllLLLHhhhhhhhhhhllLLLLEEEEL
Query I-------GYETGTRAAAKGGITTXIEXPLnqlpaTVDRasielkfdaakgKLTIDAAQL  113
ident                 ||                                    |     
Sbjct SrtsdgalTPTEVIDRAAARAPALLALTDH-----DCTG--glaeaaaaaaRRGIPFLNG   61
DSSP  LlllllllLHHHHHHHHHLLLLLEEEELLL-----LLLL--lhhhhhhhhhHLLLLEEEE


DSSP  EELlllllllhhhhhhhlllleeeellLLLH-----------------------------
Query GGLvsynidrlheldevgvvgfxcfvrDVND-----------------------------  144
ident                             |                               
Sbjct VEV------------------------SVSWgrhtvhivglgidpaepalaaglksireg   97
DSSP  EEE------------------------EEEElleeeeeeeellllllhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  144
ident                                                             
Sbjct rlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyl  157
DSSP  hhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhll


DSSP  ------------hHHHHHHHHHHHHLLLEEEE-LLLHHhhhhhhhhhhhhllllhhhhhh
Query ------------wQFFKGAQKLGELGQPVLVH-CENALicdelgeeakregrvtahdyva  191
ident                          |                                  
Sbjct tpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAhPGRYD----------------------  195
DSSP  lllllllllllllLHHHHHHHHHHLLLEEEELlHHHLL----------------------


DSSP  lllhhHHHHHHHHHHHHHHHHlLLEEELL-------lLLHHHHHHHHHHHhllllEEEEe
Query srpvfTEVEAIRRVLYLAKVAgCRLHVCH-------vSSPEGVEEVTRARqegqdITCEs  244
ident           | |       |                          |            
Sbjct -----MGRTLIERLILDFQAA-GGQGIEVasgshsldDMHKFALHADRHG-----LYAS-  243
DSSP  -----LLHHHHHHHHHHHHHL-LLLEEEEeellllhhHHHHHHHHHHHHL-----LEEE-


DSSP  llhhhhllhhhhhhhlhhhllllllllhhhhhhhhhhhhllllleELLLLLLLlllllll
Query cphyfvldtdqfeeigtlakcsppirdlenqkgxweklfngeidcLVSDHSPCppexkag  304
ident                                                ||           
Sbjct ---------------------------------------------SGSDFHAP-------  251
DSSP  ---------------------------------------------EELLLLLL-------


DSSP  llllllllLLLHhhhhhhhhhhhlllllllhhhhhhhhlhHHHHHLLLllllllllllll
Query nixkawggIAGLqscxdvxfdeavqkrgxslpxfgklxatNAADIFGLqqkgriapgkda  364
ident                                                             
Sbjct --------GEDV-----------------ghtedlppicrPIWRELEA------------  274
DSSP  --------LLLL-----------------lllllllllllLHHHHLHH------------


DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll
Query dfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
ident                                                             
Sbjct -------------------------------------------------------rilrp  279
DSSP  -------------------------------------------------------hllll


DSSP  eelll
Query filkh  429
ident      
Sbjct adaen  284
DSSP  lhhhl


No 58: Query=3e74A Sbjct=3e38A Z-score=4.9

back to top
DSSP  leeeeeelleEELLLleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL
Query sfdliikngtVILENearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
ident             |                                          | | |
Sbjct -aqrrneiqvPDLDG----------------------------------yTTLKCDFHXH   25
DSSP  -lllllllllLLLLL----------------------------------lEEEEEELLLL


DSSP  L-------LHHHHHHHHHHLLEEEEEELLL--LLLL-llllHHHHHHHHhHHLLLL---L
Query I-------GYETGTRAAAKGGITTXIEXPL--NQLP-atvdRASIELKFdAAKGKL---T  107
ident                 |   |                                       
Sbjct SvfsdglvWPTVRVDEAYRDGLDAISLTEHieYRPHkqdvvSDHNRSFD-LCREQAeklG   84
DSSP  LlllllllLHHHHHHHHHHLLLLEELLEEEllLLLLlllllLLLLHHHH-HHHHHHhhhL


DSSP  LEEEELEELLllllllhhhhhhhlllleeeellLLLH-----------------hHHHHH
Query IDAAQLGGLVsynidrlheldevgvvgfxcfvrDVND-----------------wQFFKG  150
ident |                                                           
Sbjct ILLIKGSEIT-----------------------RAXApghfnaiflsdsnpleqkDYKDA  121
DSSP  LEELLEEEEE-----------------------LLLLlleeeeelllllhhhlllLHHHH


DSSP  HHHHHHHLLLEEE-ELLL--HHHHhhhhhhhhhhllllhhhhhhlllhhHHHHhhHHHHH
Query AQKLGELGQPVLV-HCEN--ALICdelgeeakregrvtahdyvasrpvfTEVEaiRRVLY  207
ident        |      |                                  |          
Sbjct FREAKKQGAFXFWnHPGWdsQQPD-------------------------TTKW--WPEHT  154
DSSP  HHHHHHLLLEEEElLLLLllLLLL-------------------------LLLL--LHHHH


DSSP  HHHHHLLLEEELLL----LLHHHHHHHHHHHhllllEEEEellhhhhllhhhhhhhlhhh
Query LAKVAGCRLHVCHV----SSPEGVEEVTRARqegqdITCEscphyfvldtdqfeeigtla  263
ident      ||             ||               |                      
Sbjct ALYQEGCXHGIEVAnghlYXPEAIQWCLDKN-----LTXI--------------------  189
DSSP  HHHHLLLLLEEEEEelleELLHHHHHHHHHL-----LEEE--------------------


DSSP  llllllllhhhhhhhhhhhhllllleELLLLLLLllllllllllllllLLLLhhhhhhhh
Query kcsppirdlenqkgxweklfngeidcLVSDHSPCppexkagnixkawgGIAGlqscxdvx  323
ident                             ||                              
Sbjct --------------------------GTSDIHQP------------iqTDYD--------  203
DSSP  --------------------------EELLLLLL------------hhHHLL--------


DSSP  hhhhlllllllhhhhhhhHLHHhhhhllLLLL----------------------------
Query fdeavqkrgxslpxfgklXATNaadifgLQQK----------------------------  355
ident                             ||                              
Sbjct ---------fekgehrtxTFVF-akersLQGIrealdnrrtaayfhelligredllrpff  253
DSSP  ---------hhhllllleEEEE-ellllHHHHhhhhhllleeeeelleeellhhhhhhhh


DSSP  -----------lllllllllleeeEELL------------------LLEEllhhhlllll
Query -----------griapgkdadfvfIQPN------------------SSYVltnddleyrh  386
ident                                                             
Sbjct ekcvkieevsrneqgvtlsitnvtDLVLklkktahdtllvyfrdxtLKPH----------  303
DSSP  hhheeeeeeeeelleeeeeeeellLLLEeeeelllllleellleeeELLL----------


DSSP  lllllllleelleeeeeeelleeeeelllllllllllleelll
Query kvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                            
Sbjct ----trytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  ----eeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=3e74A Sbjct=2anuA Z-score=3.7

back to top
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleEEELEEEEEEL
Query sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvVSPGXVDAHTH   60
ident                                                        | | |
Sbjct -------------------------------------------------TEWLLCDFHVH   11
DSSP  -------------------------------------------------LEEEEEEEEEL


DSSP  L-------LHHHHHHHHHHLLEEEEEELLL--------------llLLLLlLHHHHHHHH
Query I-------GYETGTRAAAKGGITTXIEXPL--------------nqLPATvDRASIELKF   99
ident                   | |                         | |           
Sbjct TnxsdghlPLGEVVDLFGKHGVDVVSITDHivdrrtleqrkrngepLGAI-TEDKFQDYL   70
DSSP  LlllllllLHHHHHHHHHHLLLLEEEEEEEeelhhhhhhhhhllllLLLL-LLLLHHHHH


DSSP  HHHLLLL-------lLEEE-ELEELlllllllhhhhhhhlllleeeelLLLL--------
Query DAAKGKL-------tIDAA-QLGGLvsynidrlheldevgvvgfxcfvRDVN--------  143
ident                                                             
Sbjct KRLWREQkraweeygXILIpGVEIT-----------------------NNTDlyhivavd  107
DSSP  HHHHHHHhhhhhhhlLEEEeEEEEE-----------------------ELLLleeeeeel


DSSP  ---hhhhhHHHHHHHHHLL----lEEEElllhhhhhhhhhhhhhhllllhhhhhhlllhh
Query ---dwqffKGAQKLGELGQ----pVLVHcenalicdelgeeakregrvtahdyvasrpvf  196
ident                |        |                                   
Sbjct vkeyvdpsLPVEEIVEKLKeqnalVIAA---------------------------hpdrk  140
DSSP  llllllllLLHHHHHHHHHhllleEEEL---------------------------lllll


DSSP  hhHHHHHHHHHHHhhhllleeelllllhhhhhhhhhhhhllllEEEE-ELLHHHhllhhh
Query teVEAIRRVLYLAkvagcrlhvchvsspegveevtrarqegqdITCE-SCPHYFvldtdq  255
ident                                               |             
Sbjct klSWYLWANXERF--------------------------kdtfDAWEiANRDDL------  168
DSSP  llLLHHHHLLLLL--------------------------llllLEEEeEELLEE------


DSSP  hhhhlhhhllllllllhhhhhhHHHHHHLLLLLEELLLLLLllllllllllllllllLLL
Query feeigtlakcsppirdlenqkgXWEKLFNGEIDCLVSDHSPcppexkagnixkawggIAG  315
ident                                     ||                      
Sbjct ----------------------FNSVGVKKYRYVANSDFHE----------------LWH  190
DSSP  ----------------------LHHHHHLLLLEEEELLLLL----------------HHH


DSSP  HhhhhhhhhhhhlllllllhhhhhhHHLHhhhhhllllllllllllLLLLeeeeelllle
Query LqscxdvxfdeavqkrgxslpxfgkLXATnaadifglqqkgriapgKDADfvfiqpnssy  375
ident                                                             
Sbjct V---------------------yswKTLV----------------kSEKN----------  203
DSSP  H---------------------lleEEEE----------------eELLL----------


DSSP  ellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll
Query vltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
ident                                                       
Sbjct ---------------------------------ieaikeairkntdvaiylxrk  224
DSSP  ---------------------------------hhhhhhhhhhllleeeeelll