Results: dupa

Query: 3e38A

MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3e38-A 58.7  0.0  342   342  100 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
   2:  2anu-A 21.4  2.8  197   224   24 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
   3:  2yb1-A 16.6  2.5  173   284   22 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   4:  3f2b-A 12.4  3.1  167   994   16 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
   5:  3au2-A  9.8  3.4  163   575   18 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   6:  1m65-A  8.9  3.6  157   234   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   7:  3dcp-A  8.8  3.7  162   277   15 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
   8:  3nqb-A  7.6 12.5  169   587    9 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   9:  1a4m-A  6.9  3.6  163   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  10:  1v77-A  6.8  3.5  135   202    5 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  11:  3qy6-A  6.7  3.7  154   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  12:  4mup-B  6.6  3.8  160   286    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  13:  1k6w-A  6.4  3.9  167   423    8 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  14:  2ffi-A  6.3  3.5  149   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  15:  4cqb-A  6.2  3.8  161   402    9 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  16:  2vun-A  6.2  4.6  177   385   11 PDB  MOLECULE: ENAMIDASE;                                                 
  17:  3gg7-A  6.1  3.6  145   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  18:  2oof-A  6.1  3.6  161   403   14 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  19:  3ls9-A  6.0  3.8  167   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  20:  1onx-A  6.0  3.5  155   390   10 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  21:  1yrr-B  5.9  3.8  157   334    8 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  22:  4dlf-A  5.9  3.6  148   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  23:  3pnu-A  5.8  4.5  165   338    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  4hk5-D  5.7  3.8  151   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  25:  2vc5-A  5.7  3.7  153   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  26:  2paj-A  5.7  4.0  162   421   10 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  27:  3mtw-A  5.6  3.9  157   404   11 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  28:  2uz9-A  5.6  3.6  164   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  29:  1gkp-A  5.6  4.5  165   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  30:  1itq-A  5.6  3.8  156   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  31:  4qrn-A  5.5  3.9  157   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  32:  3k2g-B  5.4  3.8  157   358   11 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  33:  3gri-A  5.4  4.9  169   422   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  34:  2y1h-B  5.4  3.3  136   265   11 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  35:  2imr-A  5.3  3.7  153   380    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  36:  1j6p-A  5.2  4.0  164   407    9 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  37:  3cjp-A  5.2  4.0  141   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  38:  2ob3-A  5.2  3.4  144   329    8 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  39:  1bf6-A  5.1  3.6  151   291    9 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  40:  3e74-A  4.9  4.2  165   429   12 PDB  MOLECULE: ALLANTOINASE;                                              
  41:  4rdv-B  4.9  3.9  172   451    9 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  42:  3mkv-A  4.8  3.8  146   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  43:  3giq-A  4.7  3.7  161   475   11 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  44:  4ofc-A  4.7  3.9  140   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  45:  4c5y-A  4.7  3.4  139   436   14 PDB  MOLECULE: OCHRATOXINASE;                                             
  46:  2dvt-A  4.6  3.5  140   325   14 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  47:  4b3z-D  4.5  3.9  157   477   10 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  48:  2ogj-A  4.4  4.7  158   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  49:  3iac-A  4.3  3.8  156   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  2qpx-A  4.3  4.2  148   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  51:  1a5k-C  4.2  4.2  150   566   12 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  52:  3icj-A  4.2  3.9  144   468   10 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  53:  2gwg-A  4.0  4.0  148   329    6 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  54:  3irs-A  4.0  3.9  142   281    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  55:  1bks-A  3.7  4.4  133   255   12 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  56:  4dzi-C  3.7  3.7  135   388    9 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  57:  2a3l-A  3.2  4.1  135   616    8 PDB  MOLECULE: AMP DEAMINASE;                                             
  58:  3ooq-A  2.7  4.0  127   384    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  1j5s-A  2.3  5.3  128   451    6 PDB  MOLECULE: URONATE ISOMERASE;                                         


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3e38A Sbjct=3e38A Z-score=58.7

back to top
DSSP  LLLLLLLLLLLLLLLEEEEEELLLLLLLLLLLLLHHHHHHHHHHLLLLEELLEEELLLLL
Query AQRRNEIQVPDLDGYTTLKCDFHXHSVFSDGLVWPTVRVDEAYRDGLDAISLTEHIEYRP   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AQRRNEIQVPDLDGYTTLKCDFHXHSVFSDGLVWPTVRVDEAYRDGLDAISLTEHIEYRP   60
DSSP  LLLLLLLLLLLLLLLEEEEEELLLLLLLLLLLLLHHHHHHHHHHLLLLEELLEEELLLLL


DSSP  LLLLLLLLLLHHHHHHHHHHHHHLLEELLEEEEELLLLLLEEEEELLLLLHHHLLLLHHH
Query HKQDVVSDHNRSFDLCREQAEKLGILLIKGSEITRAXAPGHFNAIFLSDSNPLEQKDYKD  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HKQDVVSDHNRSFDLCREQAEKLGILLIKGSEITRAXAPGHFNAIFLSDSNPLEQKDYKD  120
DSSP  LLLLLLLLLLHHHHHHHHHHHHHLLEELLEEEEELLLLLLEEEEELLLLLHHHLLLLHHH


DSSP  HHHHHHHLLLEEEELLLLLLLLLLLLLLLLHHHHHHHHLLLLLEEEEEELLEELLHHHHH
Query AFREAKKQGAFXFWNHPGWDSQQPDTTKWWPEHTALYQEGCXHGIEVANGHLYXPEAIQW  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AFREAKKQGAFXFWNHPGWDSQQPDTTKWWPEHTALYQEGCXHGIEVANGHLYXPEAIQW  180
DSSP  HHHHHHHLLLEEEELLLLLLLLLLLLLLLLHHHHHHHHLLLLLEEEEEELLEELLHHHHH


DSSP  HHHHLLEEEEELLLLLLHHHHLLHHHLLLLLEEEEEELLLLHHHHHHHHHLLLEEEEELL
Query CLDKNLTXIGTSDIHQPIQTDYDFEKGEHRTXTFVFAKERSLQGIREALDNRRTAAYFHE  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CLDKNLTXIGTSDIHQPIQTDYDFEKGEHRTXTFVFAKERSLQGIREALDNRRTAAYFHE  240
DSSP  HHHHLLEEEEELLLLLLHHHHLLHHHLLLLLEEEEEELLLLHHHHHHHHHLLLEEEEELL


DSSP  EEELLHHHHHHHHHHHEEEEEEEEELLEEEEEEEELLLLLEEEEELLLLLLEELLLEEEE
Query LLIGREDLLRPFFEKCVKIEEVSRNEQGVTLSITNVTDLVLKLKKTAHDTLLVYFRDXTL  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LLIGREDLLRPFFEKCVKIEEVSRNEQGVTLSITNVTDLVLKLKKTAHDTLLVYFRDXTL  300
DSSP  EEELLHHHHHHHHHHHEEEEEEEEELLEEEEEEEELLLLLEEEEELLLLLLEELLLEEEE


DSSP  LLLEEEEEEEEELLLLLLLEEEEEEEEEEEELLEEEEEEEEL
Query KPHTRYTVRIGFKQGIKGGDVNFEVTNFIVAPDKGLKYTISL  342
ident ||||||||||||||||||||||||||||||||||||||||||
Sbjct KPHTRYTVRIGFKQGIKGGDVNFEVTNFIVAPDKGLKYTISL  342
DSSP  LLLEEEEEEEEELLLLLLLEEEEEEEEEEEELLEEEEEEEEL


No 2: Query=3e38A Sbjct=2anuA Z-score=21.4

back to top
DSSP  llllllllllllllLEEEEEELLLLLLLLLLLLLHHHHHHHHHHLLLLEELLEEELL---
Query aqrrneiqvpdldgYTTLKCDFHXHSVFSDGLVWPTVRVDEAYRDGLDAISLTEHIE---   57
ident                  | |||| |   |||       ||     | |  | | ||    
Sbjct --------------TEWLLCDFHVHTNXSDGHLPLGEVVDLFGKHGVDVVSITDHIVdrr   46
DSSP  --------------LEEEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEEEEEElhh


DSSP  -------------LLLLlllllLLLLHHHHHHHHHHHH-HLLEELLEEEEELLLLLLEEE
Query -------------YRPHkqdvvSDHNRSFDLCREQAEK-LGILLIKGSEITRAXAPGHFN  103
ident                        |           |    |  || | |||      |  
Sbjct tleqrkrngeplgAITE--dkfQDYLKRLWREQKRAWEeYGXILIPGVEITNNTDLYHIV  104
DSSP  hhhhhhhllllllLLLL--llhHHHHHHHHHHHHHHHHhHLLEEEEEEEEEELLLLEEEE


DSSP  EELLLLlHHHLLLLHHHHHHHHHHLLLEEEELLLLLLLLLlllllLLHHhHHHHhlLLLL
Query AIFLSDsNPLEQKDYKDAFREAKKQGAFXFWNHPGWDSQQpdttkWWPEhTALYqeGCXH  163
ident |                     | | |     ||           |              
Sbjct AVDVKE-YVDPSLPVEEIVEKLKEQNALVIAAHPDRKKLS--wylWANX-ERFK--DTFD  158
DSSP  EELLLL-LLLLLLLHHHHHHHHHHLLLEEEELLLLLLLLL--lhhHHLL-LLLL--LLLL


DSSP  EEEEEELLEELLHHHHHHhhhlLEEEEELLLLLLHhhhllhhhllLLLEEEEEElLLLHH
Query GIEVANGHLYXPEAIQWCldknLTXIGTSDIHQPIqtdydfekgeHRTXTFVFAkERSLQ  223
ident   | ||                      || |                 | |   |    
Sbjct AWEIANRDDLFNSVGVKK----YRYVANSDFHELW--------hvYSWKTLVKS-EKNIE  205
DSSP  EEEEEELLEELHHHHHLL----LLEEEELLLLLHH--------hhLLEEEEEEE-LLLHH


DSSP  HHHHHHHLL-LEEEEELLeeellhhhhhhhhhhheeeeeeeeelleeeeeeeelllllee
Query GIREALDNR-RTAAYFHElligredllrpffekcvkieevsrneqgvtlsitnvtdlvlk  282
ident  | ||       | |                                             
Sbjct AIKEAIRKNtDVAIYLXR------------------------------------------  223
DSSP  HHHHHHHHLlLEEEEELL------------------------------------------


DSSP  eeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query lkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                             
Sbjct -----------------------------------------------------------k  224
DSSP  -----------------------------------------------------------l


No 3: Query=3e38A Sbjct=2yb1A Z-score=16.6

back to top
DSSP  llllllllllllllleeEEEELLLLLLLLLLLLLHHHHHHHHHHLLLLEELLEEELllll
Query aqrrneiqvpdldgyttLKCDFHXHSVFSDGLVWPTVRVDEAYRDGLDAISLTEHIeyrp   60
ident                     | | ||  |||   ||   | |         || |     
Sbjct -----------------ANIDLHFHSRTSDGALTPTEVIDRAAARAPALLALTDHD----   39
DSSP  -----------------LLEELLLLLLLLLLLLLHHHHHHHHHLLLLLEEEELLLL----


DSSP  llllllllLLHHHHHHHHHHHHHLLEELLEEEEELLL--LLLEEEEELLLL----lHHHL
Query hkqdvvsdHNRSFDLCREQAEKLGILLIKGSEITRAX--APGHFNAIFLSD----sNPLE  114
ident                    |   ||    | |          |                 
Sbjct --------CTGGLAEAAAAAARRGIPFLNGVEVSVSWgrHTVHIVGLGIDPaepalAAGL   91
DSSP  --------LLLLHHHHHHHHHHLLLLEEEEEEEEEEEllEEEEEEEELLLLllhhhHHHH


DSSP  LL----------------------------------------------------------
Query QK----------------------------------------------------------  116
ident                                                             
Sbjct KSiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrt  151
DSSP  HHhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhh


DSSP  -------------------LHHHHHHHHHHLLLEEEELLLLLllLLLLLlLLLHHHHHHH
Query -------------------DYKDAFREAKKQGAFXFWNHPGWdsQQPDTtKWWPEHTALY  157
ident                       ||       |      |||                   
Sbjct vfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAHPGR--YDMGRtLIERLILDFQ  209
DSSP  hhhhlllllllllllllllLHHHHHHHHHHLLLEEEELLHHH--LLLLHhHHHHHHHHHH


DSSP  HLLLlLEEEEEELLEE---LLHHHHHHHHHLLEEEEELLLLllHHHHllhhhllllLEEE
Query QEGCxHGIEVANGHLY---XPEAIQWCLDKNLTXIGTSDIHqpIQTDydfekgehrTXTF  214
ident   |   ||||| |                  |     || |                   
Sbjct AAGG-QGIEVASGSHSlddMHKFALHADRHGLYASSGSDFH--APGE------dvgHTED  260
DSSP  HLLL-LEEEEEELLLLhhhHHHHHHHHHHHLLEEEEELLLL--LLLL------lllLLLL


DSSP  eeellllhhhhhhhhhllleeeeelleEELLhhhhhhhhhhheeeeeeeeelleeeeeee
Query vfakerslqgirealdnrrtaayfhelLIGRedllrpffekcvkieevsrneqgvtlsit  274
ident                            |                                
Sbjct ---------------------------LPPI-----------------------------  264
DSSP  ---------------------------LLLL-----------------------------


DSSP  ellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelle
Query nvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdk  334
ident                                                             
Sbjct ------------------------------------------------crpiwreleari  276
DSSP  ------------------------------------------------lllhhhhlhhhl


DSSP  eeeeeeel
Query glkytisl  342
ident         
Sbjct lrpadaen  284
DSSP  llllhhhl


No 4: Query=3e38A Sbjct=3f2bA Z-score=12.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -----------------------------------llllLLLLLLLllllEEEEEELLLL
Query -----------------------------------aqrrNEIQVPDldgyTTLKCDFHXH   25
ident                                             |            | |
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaaneRQDTAPE----GEKRVELHLH  116
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllLLLLLLL----LLLLLLLLLL


DSSP  LLLL--LLLLLHHHHHHHHHHLLLLEELLEEELllllllllllllLLHHHHHHHHHHHHH
Query SVFS--DGLVWPTVRVDEAYRDGLDAISLTEHIeyrphkqdvvsdHNRSFDLCREQAEKL   83
ident    |  |     |     |   |  ||  | |                ||      | | 
Sbjct TPMSqmDAVTSVTKLIEQAKKWGHPAIAVTDHA------------VVQSFPEAYSAAKKH  164
DSSP  LLLLllLLLLLHHHHHHHHHHLLLLLEEELLLL------------LLLLHHHHHHHHHHH


DSSP  LLEELLEEEEELLllLLEEEEELLL-----LLHHHL------------llLHHHHHHHHh
Query GILLIKGSEITRAxaPGHFNAIFLS-----DSNPLE------------qkDYKDAFREAk  126
ident |   | | |      | |                |                         
Sbjct GMKVIYGLEANIVddPFHVTLLAQNetglkNLFKLVslshiqyfhrvpriPRSVLVKHR-  223
DSSP  LLLEEEEEEEEEEllLEEEEEEELLhhhhhHHHHHHhhhhllllllllleEHHHHHHLL-


DSSP  hLLLEEEELLLlllllllllLLLLhhhHHHHhllLLLEEEeEELLE--------------
Query kQGAFXFWNHPgwdsqqpdtTKWWpehTALYqegCXHGIEvANGHL--------------  172
ident   |                                    |                    
Sbjct -DGLLVGSGCD----kgelfDNVE---DIAR---FYDFLE-VHPPDvykplyvkdeemik  271
DSSP  -LLEEEELLLL----lllllLLLL---LLHH---HLLLEE-ELLHHhhlllllllhhhhh


DSSP  -eLLHHHHHHHHHLLEEEEELLLLLlHHHHllhhhllllleeeeeellllhhhhhhhhhl
Query -yXPEAIQWCLDKNLTXIGTSDIHQpIQTDydfekgehrtxtfvfakerslqgirealdn  231
ident                    |   |                                    
Sbjct niIRSIVALGEKLDIPVVATGNVHY-LNPE---dkiyrkilihsqgganplnrhelpdvy  327
DSSP  hhHHHHHHHHHHLLLLEEELLLLLL-LLHH---hhhhhhhhhhllhhhllllllllllll


DSSP  lleeeeELLEEelLHHHH------------------------------------------
Query rrtaayFHELLigREDLL------------------------------------------  249
ident                                                             
Sbjct frttneMLDCFsfLGPEKakeivvdntqkiasligdvkpikdelytpriegadeeirems  387
DSSP  lllhhhHHHHHhhHHHHHhhhhhlhhhhhhhhlllllllllllllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct yrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvg  447
DSSP  hhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct ssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghd  507
DSSP  hlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct ipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfv  567
DSSP  lllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct kayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddts  627
DSSP  hhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct sewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsste  687
DSSP  lllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct plgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqe  747
DSSP  hhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct liqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvp  807
DSSP  hhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  249
ident                                                             
Sbjct ewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikg  867
DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhl


DSSP  ----------------------------------hhhhhhheeeeeeeeelleeeeeeee
Query ----------------------------------rpffekcvkieevsrneqgvtlsitn  275
ident                                                             
Sbjct saairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgn  927
DSSP  hhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeell


DSSP  llllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeellee
Query vtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkg  335
ident                                                             
Sbjct slippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpd  987
DSSP  eeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllll


DSSP  eeeeeel
Query lkytisl  342
ident        
Sbjct hnqlslf  994
DSSP  lllllll


No 5: Query=3e38A Sbjct=3au2A Z-score=9.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -------------------llllllllllllllleEEEEELLLLLLLLLLLLLHHHHHHH
Query -------------------aqrrneiqvpdldgytTLKCDFHXHSVFSDGLVWPTVRVDE   41
ident                                      | |   ||  |||          
Sbjct yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTYSDGQNTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLLLLLLLLHHHHHHH


DSSP  HHHLLLLEELLEEELL-LLLLLllllLLLLHHHHHHHHHHHHHL-LEELLEEEEELllll
Query AYRDGLDAISLTEHIE-YRPHKqdvvSDHNRSFDLCREQAEKLG-ILLIKGSEITRaxap   99
ident |   |      | |    |                 |   |  |   |  | |       
Sbjct AKTMGYRYLAVTDHSPaVRVAGgpspEEALKRVGEIRRFNETHGpPYLLAGAEVDI----  416
DSSP  HHHHLLLEEEEEEELHhHHLLLlllhHHHHHHHHHHHHHHHHHLlLEEEEEEEEEL----


DSSP  leeeeelllllhhhllLLHHHH--------------------------------hhhhHH
Query ghfnaiflsdsnpleqKDYKDA--------------------------------freaKK  127
ident                                                             
Sbjct ----------------HPDGTLdypdwvlreldlvlvsvhsrfnlpkadqtkrllkalEN  460
DSSP  ----------------LLLLLLlllhhhhlllleeeeellllllllhhhhhhhhhhhhLL


DSSP  LLLeEEELLLLLL----LLLLlllllLHHHHHHHHLL--llLEEEEEEL-LEEL--LHHH
Query QGAfXFWNHPGWD----SQQPdttkwWPEHTALYQEG--cxHGIEVANG-HLYX--PEAI  178
ident         ||                     |  |         |               
Sbjct PFV-HVLAHPTARllgrRAPI-----EADWEAVFQKAkekgVAVEIDGYyDRMDlpDDLA  514
DSSP  LLL-LEELLLLLLllllLLLL-----LLLHHHHHHHHhhhlLEEEEELLlLLLLllHHHH


DSSP  HHHHHHLLEEEEELLLLLLHhhhllhhhllLLLE------------------EEEEelll
Query QWCLDKNLTXIGTSDIHQPIqtdydfekgeHRTX------------------TFVFaker  220
ident        |      | ||             |                            
Sbjct RMAYGMGLWISLSTDAHQTD---------hLRFMelavgtaqrawigpervlNTLD----  561
DSSP  HHHHHLLLLEEEELLLLLHH---------hHHHHhhhhhhhhhllllllllhHHLL----


DSSP  lHHHHHHHHHllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeelllll
Query sLQGIREALDnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvtdlv  280
ident         |                                                   
Sbjct -YEDLLSWLK--------------------------------------------------  570
DSSP  -HHHHHHHHH--------------------------------------------------


DSSP  eeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeee
Query lklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkyti  340
ident                                                             
Sbjct ---------------------------------------------------------arr  573
DSSP  ---------------------------------------------------------lll


DSSP  el
Query sl  342
ident   
Sbjct gv  575
DSSP  ll


No 6: Query=3e38A Sbjct=1m65A Z-score=8.9

back to top
DSSP  llllllllllllllleeEEEELLLLLLLL-LLLLLHHHHHHHHHHLLLLEELLEEELL-L
Query aqrrneiqvpdldgyttLKCDFHXHSVFS-DGLVWPTVRVDEAYRDGLDAISLTEHIE-Y   58
ident                     | | | | |             |   |      | |    
Sbjct -----------------YPVDLHMHTVAStHAYSTLSDYIAQAKQKGIKLFAITDHGPdM   43
DSSP  -----------------LLEELLLLLLLLlLLLLLHHHHHHHHHHHLLLEEEEEEELLlL


DSSP  LLLLllllLLLLHhHHHHhHHHHhHLLEELLEEEEELLlllleeeeelllllhhHLLL--
Query RPHKqdvvSDHNRsFDLCrEQAEkLGILLIKGSEITRAxapghfnaiflsdsnpLEQK--  116
ident                          |     | |                          
Sbjct EDAP--hhWHFIN-MRIW-PRVV-DGVGILRGIEANIK----------nvdgeiDCSGkm   88
DSSP  LLLL--llHHHHH-HHHL-LLEE-LLEEEEEEEEEELL----------llllllLLLHhh


DSSP  ----------------------------lhhhhHHHHhhllleEEELLLLLLLLLlllLL
Query ----------------------------dykdaFREAkkqgafXFWNHPGWDSQQpdtTK  148
ident                                                |||          
Sbjct fdsldliiagfhepvfaphdkatntqamiatiaSGNV------HIISHPGNPKYE---ID  139
DSSP  hhhlleeeeellllllllllhhhhhhhhhhhhhLLLL------LEELLLLLLLLL---LL


DSSP  LLHhhHHHHHllLLLEEEeEELLEELLHHHHHHHHHLLEEEEELLLLLLHhhhllhhhll
Query WWPehTALYQegCXHGIEvANGHLYXPEAIQWCLDKNLTXIGTSDIHQPIqtdydfekge  208
ident       |          |  |      |      |        || |             
Sbjct VKAvaEAAAK--HQVALE-INNSSNCREVAAAVRDAGGWVALGSDSHTAF---------t  187
DSSP  HHHhhHHHHH--HLLEEE-EELLLLHHHHHHHHHHHLLLEEEELLLLLHH---------h


DSSP  lLLEE----------------EEEEllllHHHHHHHHHLlleeeeelleeellhhhhhhh
Query hRTXT----------------FVFAkersLQGIREALDNrrtaayfhelligredllrpf  252
ident                                     |                       
Sbjct mGEFEeclkildavdfpperiLNVS----PRRLLNFLES---------------------  222
DSSP  lLLLHhhhhhhhhllllhhhlHHHL----HHHHHHHHHH---------------------


DSSP  hhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeee
Query fekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigf  312
ident                                                             
Sbjct ------------------------------------------------------------  222
DSSP  ------------------------------------------------------------


DSSP  llllllleeeeeeeeeeeelleeeeeeeel
Query kqgikggdvnfevtnfivapdkglkytisl  342
ident                               
Sbjct ------------------rgmapiaefadl  234
DSSP  ------------------llllllhhhlll


No 7: Query=3e38A Sbjct=3dcpA Z-score=8.8

back to top
DSSP  llllllllllllllleeEEEELLLLLLLL--LLLLLHHHHHHHHHHLLLLEELLEEELL-
Query aqrrneiqvpdldgyttLKCDFHXHSVFS--DGLVWPTVRVDEAYRDGLDAISLTEHIE-   57
ident                   | | | |  |            |  |     |  |  ||   
Sbjct -----------------XKRDGHTHTEFCphGTHDDVEEXVLKAIELDFDEYSIVEHAPl   43
DSSP  -----------------LLEEEEELLLLLllLLLLLHHHHHHHHHHLLLLEEEEEEELLl


DSSP  -----------------LLLLLLlLLLLLLHHHHHHHHHHHhHLLEELLEEEEELLllll
Query -----------------YRPHKQdVVSDHNRSFDLCREQAEkLGILLIKGSEITRAxapg  100
ident                                              |   | |        
Sbjct ssefxkntagdkeavttASXAXS-DLPYYFKKXNHIKKKYA-SDLLIHIGFEVDYL----   97
DSSP  lhhhhhllllllhhhhlLLLLHH-HHHHHHHHHHHHHHHLL-LLLEEEEEEEEELL----


DSSP  eeeeelllllhhhlLLLHHHHH--------------------------------------
Query hfnaiflsdsnpleQKDYKDAF--------------------------------------  122
ident                    |                                        
Sbjct -----------igyEDFTRDFLneygpqtddgvlslhflegqggfrsidfsaedynegiv  146
DSSP  -----------lllHHHHHHHHhhhhhhlleeeeelleeeelleeeellllhhhhhhhlh


DSSP  -------------------------HHHHhlllEEEELLLLLLllLLLL-----------
Query -------------------------REAKkqgaFXFWNHPGWDsqQPDT-----------  146
ident                             |         |      |              
Sbjct qfyggfeqaqlaylegvkqsieadlGLFK----PRRXGHISLC--QKFQqffgedtsdfs  200
DSSP  hhhllhhhhhhhhhhhhhhhhhlllLLLL----LLEELLLLHH--HLLHhhhlllhhhll


DSSP  ----llLLHHHHHHHHLLllLEEEeEELLE---------ELLH-HHHHHHHHLLEEEEEL
Query ----tkWWPEHTALYQEGcxHGIEvANGHL---------YXPE-AIQWCLDKNLTXIGTS  192
ident                           |            | |                 |
Sbjct eevxekFRVILALVKKRD--YELD-FNTAGlfkplcgetYPPKkIVTLASELQIPFVYGS  257
DSSP  hhhhhhHHHHHHHHHHHL--LEEE-EELHHhhlllllllLLLHhHHHHHHHLLLLEEEEL


DSSP  LLLLLHhhhllhhhlllLLEEeeeellllhhhhhhhhhlllEEEEelleEELLhhhhhhh
Query DIHQPIqtdydfekgehRTXTfvfakerslqgirealdnrrTAAYfhelLIGRedllrpf  252
ident | |                                                         
Sbjct DSHGVQ---------diGRGY--------------------STYC----QKLE-------  277
DSSP  LLLLHH---------hlLLLH--------------------HHHH----HHLL-------


DSSP  hhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeee
Query fekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigf  312
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  llllllleeeeeeeeeeeelleeeeeeeel
Query kqgikggdvnfevtnfivapdkglkytisl  342
ident                               
Sbjct ------------------------------  277
DSSP  ------------------------------


No 8: Query=3e38A Sbjct=3nqbA Z-score=7.6

back to top
DSSP  -------------------------llllllllLLLLLL---------------------
Query -------------------------aqrrneiqVPDLDG---------------------   14
ident                                  |    |                     
Sbjct epadlnddtlraravaaargdqrfdvlitggtlVDVVTGelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeELLLLLleeeleeeeelleeeeeelll


DSSP  ---------------leEEEEE-LLLLLlllllLLLHHHHHHHHHHLLLLEELLEEEllL
Query ---------------ytTLKCD-FHXHSvfsdgLVWPTVRVDEAYRDGLDAISLTEHieY   58
ident                      |              |          |   |    |   
Sbjct srrdaaqvidaggayvsPGLIDtHXHIE---ssXITPAAYAAAVVARGVTTIVWDPHefG  117
DSSP  lllleeeeeelllleeeELEEEeEELHH---hhLLLHHHHHHHHHLLLEEEEEELLHhhH


DSSP  LLLlllllLLLLHHHHHHHHHhhhhLLEELLEEEEEL-llllleeeeelllllHHHL---
Query RPHkqdvvSDHNRSFDLCREQaeklGILLIKGSEITR-axapghfnaiflsdsNPLE---  114
ident   |                          |                              
Sbjct NVH---gvDGVRWAAKAIENL----PLRAILLAPSCVpsapglerggadfdaaILADlls  170
DSSP  HHH---lhHHHHHHHHHHLLL----LLEEEEEELLLLllllllllllllllhhHHHHhhl


DSSP  -------------------lLLHHHHHHHHHHLLLEEEELLLlllllllllLLLLHHHHH
Query -------------------qKDYKDAFREAKKQGAFXFWNHPgwdsqqpdtTKWWPEHTA  155
ident                                                            |
Sbjct wpeiggiaeixnxrgvierdPRXSGIVQAGLAAEKLVCGHAR---------GLKNADLNA  221
DSSP  llleeeeeeellhhhhhlllHHHHHHHHHHHHHLLEEEELLL---------LLLHHHHHH


DSSP  HHHLlLLLEEEEeelleELLH-HHHHHHHHLLEEE-------------------------
Query LYQEgCXHGIEVanghlYXPE-AIQWCLDKNLTXI-------------------------  189
ident                            |   ||                           
Sbjct FXAA-GVSSDHE-----LVSGeDLXAKLRAGLTIElrgshdhllpefvaalntlghlpqt  275
DSSP  HHHL-LLLEELL-----LLLHhHHHHHHHLLLEEEeelllhhhhhhhhhhhhhhllllll


DSSP  --EELLLLLlhHHHLLHhhlLLLL------------------eeEEEEllllhHHHHHHh
Query --GTSDIHQpiQTDYDFekgEHRT------------------xtFVFAkerslQGIREAl  229
ident      |       |                                              
Sbjct vtLCTDDVF--PDDLLQ---GGGLddvvrrlvryglkpewalraATLN----aAQRLGR-  325
DSSP  eeEELLLLL--HHHHHH---LLLHhhhhhhhhhllllhhhhhhhHLHH----hHHHHLL-


DSSP  hllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeeLLLLL---------
Query dnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnVTDLV---------  280
ident                                                             
Sbjct -----------------------------sdlgliaagrradivvfEDLNGfsarhvlas  356
DSSP  -----------------------------llllllllllllleeeeLLLLLlleeeeeel


DSSP  -------------------------------eeeeelllllleellleeeellleeeeee
Query -------------------------------lklkktahdtllvyfrdxtlkphtrytvr  309
ident                                                             
Sbjct gravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwge  416
DSSP  leeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeee


DSSP  eEELLL------------------------------------------------------
Query iGFKQG------------------------------------------------------  315
ident                                                             
Sbjct tEADVKdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltv  476
DSSP  eEEEEElleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  315
ident                                                             
Sbjct fggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlrea  536
DSSP  eellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhh


DSSP  ------------------------lllleeeeeeeeeeeelleeeeeeeel
Query ------------------------ikggdvnfevtnfivapdkglkytisl  342
ident                                                    
Sbjct vgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 9: Query=3e38A Sbjct=1a4mA Z-score=6.9

back to top
DSSP  lllllLLLLlllllleeEEEELLLLLlllLLLL---------------------------
Query aqrrnEIQVpdldgyttLKCDFHXHSvfsDGLV---------------------------   33
ident                   |   | |    ||                             
Sbjct ---tpAFNK--------PKVELHVHL---DGAIkpetilyfgkkrgialpadtveelrni   46
DSSP  ---llLLLL--------LEEEEEEEH---HHLLlhhhhhhhhhhhllllllllhhhhhhh


DSSP  --------------------------------LHHHHHHHHHHLLLLEELLEEELLLLLL
Query --------------------------------WPTVRVDEAYRDGLDAISLTEHIEYRPH   61
ident                                      |      |               
Sbjct igmdkplslpgflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPHLLAN  106
DSSP  hlllllllhhhhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLHHHLL


DSSP  -----------lLLLL--LLLLHHHHHHHHHHHHHLLEELLEEEEELLlllleeeeelll
Query -----------kQDVV--SDHNRSFDLCREQAEKLGILLIKGSEITRAxapghfnaifls  108
ident              ||              |     ||         |             
Sbjct skvdpmpwnqteGDVTpdDVVDLVNQGLQEGEQAFGIKVRSILCCMRH---------qps  157
DSSP  llllllhhhlllLLLLhhHHHHHHHHHHHHHHHHHLLEEEEEEEEELL---------lhh


DSSP  llhHHLL---------------------------lLHHHHHHHHHHLLLEEEELLLLLll
Query dsnPLEQ---------------------------kDYKDAFREAKKQGAFXFWNHPGWds  141
ident                                        |   | | |            
Sbjct wslEVLElckkynqktvvamdlagdetiegsslfpGHVEAYEGAVKNGIHRTVHAGEV--  215
DSSP  hhhHHHHhhhhllllleeeeeeelllllllhhhlhHHHHHHHHHHHHLLEEEEEELLL--


DSSP  lllllLLLLhhhHHHHHLLLLLEEEEeelleELLH----hHHHHHHHLLEEEE-------
Query qqpdtTKWWpehTALYQEGCXHGIEVanghlYXPE----aIQWCLDKNLTXIG-------  190
ident                                |            |  |            
Sbjct -----GSPE-vvREAVDILKTERVGH----gYHTIedealYNRLLKENMHFEVcpwssyl  265
DSSP  -----LLHH-hhHHHHHLLLLLEEEE----lHHHHhlhhhHHHHHHLLLEEEElhhhhhh


DSSP  ------------------------ELLLlllHHHHLlhhhlLLLL---------------
Query ------------------------TSDIhqpIQTDYdfekgEHRT---------------  211
ident                           |                                 
Sbjct tgawdpktthavvrfkndkanyslNTDD---PLIFK-----STLDtdyqmtkkdmgftee  317
DSSP  llllllllllhhhhhhhlllleeeLLLL---LLLLL-----LLHHhhhhhhhhlllllhh


DSSP  --eeEEEE-------lllLHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeeee
Query --xtFVFA-------kerSLQGIrealdnrrtaayfhelligredllrpffekcvkieev  262
ident                                                             
Sbjct efkrLNINaakssflpeeEKKEL-------------------------------------  340
DSSP  hhhhHHHHhhhlllllhhHHHHH-------------------------------------


DSSP  eeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleee
Query srneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvn  322
ident                                                             
Sbjct ------------------------------------------------------------  340
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeelleeeeeeeel
Query fevtnfivapdkglkytisl  342
ident                     
Sbjct -----------lerlyreyq  349
DSSP  -----------hhhhhhhll


No 10: Query=3e38A Sbjct=1v77A Z-score=6.8

back to top
DSSP  llllllllllllllleEEEEELLLLLllllllllhHHHHHHHHHLlLLEELLEEELLlll
Query aqrrneiqvpdldgytTLKCDFHXHSvfsdglvwpTVRVDEAYRDgLDAISLTEHIEyrp   60
ident                                          |     |            
Sbjct ----------------VKFIEMDIRD---------KEAYELAKEW-FDEVVVSIKFN---   31
DSSP  ----------------LLLEEEEELL---------HHHHHHHHHH-LLEEEEEEEEL---


DSSP  llllllLLLLHHHHHHHhhhhhhlleeLLEEEEELllllleeeeelllllhhhllllHHH
Query hkqdvvSDHNRSFDLCReqaeklgillIKGSEITRaxapghfnaiflsdsnpleqkdYKD  120
ident                                                             
Sbjct -eevdkEKLREARKEYG----------KVAILLSN---------------------pKPS   59
DSSP  -llllhHHHHHHHHHHL----------LEEEEEEL---------------------lLHH


DSSP  HHHHHHHLL---------------------lEEEELLLLllLLLLlLLLLL-HHHHHHHH
Query AFREAKKQG---------------------aFXFWNHPGwdSQQPdTTKWW-PEHTALYQ  158
ident   |                                  |                      
Sbjct LVRDTVQKFksyliyvesndlrvirysiekgVDAIISPW--VNRK-DPGIDhVLAKLMVK  116
DSSP  HHHHHHHHLllleeeeelllhhhhhhhhhllLLEEELLL--LLLL-LLLLLhHHHHHHHH


DSSP  LLllLEEEeEELLE--------------eLLHHHHHHHHHLLEEEEELLLLLLHhhhllh
Query EGcxHGIEvANGHL--------------yXPEAIQWCLDKNLTXIGTSDIHQPIqtdydf  204
ident                                 |             ||            
Sbjct KN--VALG-FSLRPllysnpyeranllrfMMKAWKLVEKYKVRRFLTSSAQEKW----dv  169
DSSP  HL--LEEE-EELHHhhhllhhhhhhhhhhHHHHHHHHHHHLLLEEEELLLLLHH----hl


DSSP  hhlLLLL---------------eEEEEellllhhhhhhHHHLlleeeeelleeellhhhh
Query ekgEHRT---------------xTFVFakerslqgireALDNrrtaayfhelligredll  249
ident                                                             
Sbjct rypRDLIslgvvigmeipqakasISMY---------peIILK------------------  202
DSSP  llhHHHHhhhhhllllhhhhhhlLLHH---------hhHHHL------------------


DSSP  hhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeee
Query rpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvr  309
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  eeellllllleeeeeeeeeeeelleeeeeeeel
Query igfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                  
Sbjct ---------------------------------  202
DSSP  ---------------------------------


No 11: Query=3e38A Sbjct=3qy6A Z-score=6.7

back to top
DSSP  llllllllllllllleeeEEELLLL--LLLLLLLLL---HHHHHHHHHHLLLLEELLEEE
Query aqrrneiqvpdldgyttlKCDFHXH--SVFSDGLVW---PTVRVDEAYRDGLDAISLTEH   55
ident                     | | |      ||             | | |   |  | |
Sbjct ------------------MIDIHCHilPAMDDGAGDsadSIEMARAAVRQGIRTIIATPH   42
DSSP  ------------------LEELLLLllLLLLLLLLLhhhHHHHHHHHHHLLLLEEELLLE


DSSP  LLllllllllllLLLHHHHHHHHHHH--HHLLEELLEEEEELLlllleeeeelllllhhh
Query IEyrphkqdvvsDHNRSFDLCREQAE--KLGILLIKGSEITRAxapghfnaiflsdsnpl  113
ident                   |                 | ||                    
Sbjct HN-ngvyknepaAVREAADQLNKRLIkeDIPLHVLPGQEIRIY-----------------   84
DSSP  EL-lllllllhhHHHHHHHHHHHHHHhlLLLLEEELLLEEELL-----------------


DSSP  lllLHHHHHH-HHHH--lLLEEEELlllLLLLLlllllLLHHHHHHHHLLLLLE------
Query eqkDYKDAFR-EAKK--qGAFXFWNhpgWDSQQpdttkWWPEHTALYQEGCXHG------  164
ident                                              |   |          
Sbjct --gEVEQDLAkRQLLslnDTKYILI-efPFDHV--pryAEQLFYDLQLKGYIPViahper  139
DSSP  --lLHHHHHHlLLLLlhhHLLEEEE-elLLLLL--lllHHHHHHHHHHLLLEEEeelhhh


DSSP  -------------------EEEEELLE----------------elLHHHhhhhhhlleEE
Query -------------------IEVANGHL----------------yxPEAIqwcldknltXI  189
ident                                                 |           
Sbjct nreirenpsllyhlvekgaASQITSGSlagifgkqlkafslrlveANLI---------HF  190
DSSP  lhhhhhllhhhhhhhhlllEEEEEHHHhlllllhhhhhhhhhhhhLLLL---------LE


DSSP  EELLLLlLHHHHllhhhLLLL---------------leEEEEellllhhhhhhHHHLLle
Query GTSDIHqPIQTDydfekGEHR---------------txTFVFakerslqgireALDNRrt  234
ident   || |    |       |                                         
Sbjct VASDAH-NVKTR-nfhtQEALyvlekefgselpymlteNAEL---------llRNQTI--  237
DSSP  EELLLL-LLLLL-lllhHHHHhhhhhhhllhhhhhhhhHHHH---------hhLLLLL--


DSSP  eeeelleeELLHhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleel
Query aayfhellIGREdllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvy  294
ident                                                             
Sbjct --------FRQP------------------------------------------------  241
DSSP  --------LLLL------------------------------------------------


DSSP  lleeeellleeeeeeeeellllllleeeeeeeeeeeELLEEeeeeeel
Query frdxtlkphtrytvrigfkqgikggdvnfevtnfivAPDKGlkytisl  342
ident                                                 
Sbjct ------------------------------------PQPVK------r  247
DSSP  ------------------------------------LLLLL------l


No 12: Query=3e38A Sbjct=4mupB Z-score=6.6

back to top
DSSP  ---lllllLLLLllllllEEEEEELLLLLL------------lllllLLHH-HHHHHHHH
Query ---aqrrnEIQVpdldgyTTLKCDFHXHSV------------fsdglVWPT-VRVDEAYR   44
ident                        |   |                                
Sbjct lvrklsgtAPNP----afPRGAVDTQMHMYlpgypalpggpglppgaLPGPeDYRRLMQW   56
DSSP  llllllllLLLL----llLLLLEELLLLLLlllllllllllllllllLLLHhHHHHHHHH


DSSP  LLLLEELLEEEllLLLLllllllLLLHHHHHHHHHHHhhllEELLEE-------------
Query DGLDAISLTEHieYRPHkqdvvsDHNRSFDLCREQAEklgiLLIKGS-------------   91
ident  | |    |                |     |                            
Sbjct LGIDRVIITQG--NAHQ------RDNGNTLACVAEMG---eAAHAVViidatttekdmek  105
DSSP  HLLLEEEEELL--HHHL------LLLHHHHHHHHHHH---hHEEEEElllllllhhhhhh


DSSP  ---------EEELLlllleeeeelllllhhhlLLLHHHHHHHHHHLLLE-----------
Query ---------EITRAxapghfnaiflsdsnpleQKDYKDAFREAKKQGAF-----------  131
ident           |                               |                 
Sbjct ltaagtvgaRIMDL------------pggavnLSELDAVDERAHAADWMvavqfdgngll  153
DSSP  hhhlleeeeEEELL------------llllllHHHHHHHHHHHHHLLLEeeeellhhhhh


DSSP  ------------EEELLLLLlllLLLLLL----LLHHHHHHHHLLlLLEEEeEELLE---
Query ------------XFWNHPGWdsqQPDTTK----WWPEHTALYQEGcXHGIEvANGHL---  172
ident                 | |                     |   |         |     
Sbjct dhlprlqkirsrWVFDHHGK---FFKGIRtdgpEMAALLKLIDRG-NLWFK-FAGVYess  208
DSSP  hhhhhhhlllleEEELHHHH---LLLLLLlllhHHHHHHHHHHHL-LEEEE-ELLHHhll


DSSP  --------eLLHHHHHHHHHLLEEEEELLLLL-----lhHHHLlhhhlLLLL--------
Query --------yXPEAIQWCLDKNLTXIGTSDIHQ-----piQTDYdfekgEHRT--------  211
ident                                                             
Sbjct rkswpyadvAAFSRVIAAHAPERIVWGTNWPHnsvretaAYPD----dARLAeltlgwlp  264
DSSP  llllllhhhHHHHHHHHHHLHHHEEELLLLLLlllllhhHLLL----hHHHHhhhhllll


DSSP  -------eEEEE-ellllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeeeee
Query -------xTFVF-akersLQGIrealdnrrtaayfhelligredllrpffekcvkieevs  263
ident                   |                                         
Sbjct deaarhraLVENpealfkLSPV--------------------------------------  286
DSSP  lhhhhhhhHLHHhhhhhlLLLL--------------------------------------


DSSP  eelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeee
Query rneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeelleeeeeeeel
Query evtnfivapdkglkytisl  342
ident                    
Sbjct -------------------  286
DSSP  -------------------


No 13: Query=3e38A Sbjct=1k6wA Z-score=6.4

back to top
DSSP  -----------------------------------llllllllllllllLEEEEEELLLL
Query -----------------------------------aqrrneiqvpdldgYTTLKCDFHXH   25
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEEEL


DSSP  LLllLLLL---------------------------------LHHHHHHHHHHLLLLEELL
Query SVfsDGLV---------------------------------WPTVRVDEAYRDGLDAISL   52
ident                                                      |      
Sbjct LD--TTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRT  118
DSSP  LL--LLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEE


DSSP  EEELLllllllllLLLLLHHHHHHHHHHHhHLLEELLEEE--------------------
Query TEHIEyrphkqdvVSDHNRSFDLCREQAEkLGILLIKGSE--------------------   92
ident                                 | |                         
Sbjct HVDVS------daTLTALKAMLEVKQEVA-PWIDLQIVAFpqegilsypngealleealr  171
DSSP  EEELL------llLLHHHHHHHHHHHHHL-LLLEEEEEEEllllllllllhhhhhhhhhh


DSSP  -------EELLLllleeeeelllllhhhllLLHHHHHHHHH-HLLL--------------
Query -------ITRAXapghfnaiflsdsnpleqKDYKDAFREAK-KQGA--------------  130
ident                                     |  |                    
Sbjct lgadvvgAIPHF----------eftreygvESLHKTFALAQkYDRLidvhcdeiddeqsr  221
DSSP  lllleeeELHHH----------lllhhhhhHHHHHHHHHHHhHLLEeeeeelllllllll


DSSP  ----------------EEEELLLLLlllllllLLLL----hhhhhhHHLLllLEEEEEEL
Query ----------------FXFWNHPGWdsqqpdtTKWW----pehtalYQEGcxHGIEVANG  170
ident                      |                                      
Sbjct fvetvaalahhegmgaRVTASHTTA------mHSYNgaytsrlfrlLKMS-gINFVANPL  274
DSSP  hhhhhhhhhhhhllhhHEEEEELHH------hHHLLhhhhhhhhhhHHHH-lLEEEELHH


DSSP  LE--------------ELLHhHHHHHHHLLEEEEELLLLLL--hHHHLlhhhlLLLL---
Query HL--------------YXPEaIQWCLDKNLTXIGTSDIHQP--iQTDYdfekgEHRT---  211
ident                          |          |                       
Sbjct VNihlqgrfdtypkrrGITR-VKEMLESGINVCFGHDDVFDpwyPLGT--anmLQVLhmg  331
DSSP  HHhhhlllllllllllLLLL-HHHHHHLLLLEEELLLLLLLlllLLLL--llhHHHHhhh


DSSP  -----------------eEEEE-ellllHHHHhhhhhllleeeeelleeellhhhhhhhH
Query -----------------xTFVF-akersLQGIrealdnrrtaayfhelligredllrpfF  253
ident                             ||                              
Sbjct lhvcqlmgygqindglnlITHHsartlnLQDY--------------giaagnsanliilP  377
DSSP  hhhlllllhhhhhhhhhhHLHHhhhhllLLLL--------------llllllllleeeeL


DSSP  HHHeeeeeeeeelleeeeeeeelLLLLE-----------eeeelllllleellleeeell
Query EKCvkieevsrneqgvtlsitnvTDLVL-----------klkktahdtllvyfrdxtlkp  302
ident                          |                                  
Sbjct AEN------------------gfDALRRqvpvrysvrggkviastqpaqttvyleqpeai  419
DSSP  LLL------------------hhHHHHHllllleeeelleeeeellllleeeellleeee


DSSP  LEEEeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query HTRYtvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                         
Sbjct DYKR------------------------------------  423
DSSP  LLLL------------------------------------


No 14: Query=3e38A Sbjct=2ffiA Z-score=6.3

back to top
DSSP  llllllllllllllleeEEEELLLLLL------------llllLLLHHHHHHHHHHLLLL
Query aqrrneiqvpdldgyttLKCDFHXHSV------------fsdgLVWPTVRVDEAYRDGLD   48
ident                     | | |                                |  
Sbjct --------------lhlTAIDSHAHVFsrglnlasqrryapnyDAPLGDYLGQLRAHGFS   46
DSSP  --------------lllLLEELLLLLLlhhhhhhlllllllllLLLHHHHHHHHHHLLLL


DSSP  EELLEEElLLLLlllllllLLLHHHHHHHHHHHhhlLEELLEE-----------------
Query AISLTEHiEYRPhkqdvvsDHNRSFDLCREQAEklgILLIKGS-----------------   91
ident    |                 ||               |                     
Sbjct HGVLVQP-SFLG-------TDNRYLLSALQTVP---GQLRGVVxlerdveqatlaexarl   95
DSSP  EELLLLL-HHHL-------LLLHHHHHHHHHLL---LLLLLLLlllllllhhhhhhhhll


DSSP  -----EEELLlllleeeeelllllhhhllLLHH-----hhHHHHHHLLLE----------
Query -----EITRAxapghfnaiflsdsnpleqKDYK-----daFREAKKQGAF----------  131
ident                               |               ||            
Sbjct gvrgvRLNLX---------------gqdxPDLTgaqwrplLERIGEQGWHvelhrqvadi  140
DSSP  llleeELLLL---------------llllLLLLllllhhhHHHHHHHLLEeeellllllh


DSSP  -------------EEELL-LLLLllLLLLL---LLLHhhhhhHHLLllLEEEeEELLE--
Query -------------XFWNH-PGWDsqQPDTT---KWWPehtalYQEGcxHGIEvANGHL--  172
ident                  |    |                                |    
Sbjct pvlvralqpygldIVIDHfGRPD--ARRGLgqpGFAElltlsGRGK--VWVK-VSGIYrl  195
DSSP  hhhhhhhllllllEEELHhHLLL--LLLLLlllLHHHhllllLLLL--EEEE-EELHHhl


DSSP  ----------ELLHHHHHHHHHLL-EEEEELLLLL--lhHHHLlhhhlLLLL--------
Query ----------YXPEAIQWCLDKNL-TXIGTSDIHQ--piQTDYdfekgEHRT--------  211
ident                               ||                            
Sbjct qgspeenlafARQALCALEAHYGAeRLXWGSDWPHtqheSEVS----fGSAVeqfealgc  251
DSSP  lllhhhhhhhHHHHHHHHHHHLLHhHEEEELLLLLllllLLLL----hHHHHhhhhhhll


DSSP  ------eEEEE--elllLHHHhhhhhhllleeeeelleeellhhhhhhhhhhheeeeeee
Query ------xTFVF--akerSLQGirealdnrrtaayfhelligredllrpffekcvkieevs  263
ident                                                             
Sbjct saqlrqaLLLDtaralfGFEL---------------------------------------  272
DSSP  lhhhhhhHHLHhhhhhlLLLL---------------------------------------


DSSP  eelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeee
Query rneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
ident                                                             
Sbjct ------------------------------------------------------------  272
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeelleeeeeeeel
Query evtnfivapdkglkytisl  342
ident                    
Sbjct ------------------e  273
DSSP  ------------------l


No 15: Query=3e38A Sbjct=4cqbA Z-score=6.2

back to top
DSSP  ---lllllllllLLLL---------------------------------llEEEEEELLL
Query ---aqrrneiqvPDLD---------------------------------gyTTLKCDFHX   24
ident                                                         | | 
Sbjct skdfdliirnayLSEKdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeELLLleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  LLLL-----------------------------------lllllLHHHHHHHHHHLLLLE
Query HSVF-----------------------------------sdglvWPTVRVDEAYRDGLDA   49
ident |                                                       |   
Sbjct HMDKsftstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTLY  120
DSSP  LHHHllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEEE


DSSP  ELLEEEllllllllllLLLL-LHHHHHHHHHHHhHLLEELLEEE----------------
Query ISLTEHieyrphkqdvVSDH-NRSFDLCREQAEkLGILLIKGSE----------------   92
ident                              |      |                       
Sbjct TRTHVD------vdsvAKTKaVEAVLEAKEELK-DLIDIQVVAFaqsgffvdleseslir  173
DSSP  EEEEEE------llllLLLHhHHHHHHHHHHLL-LLLEEEEEEEllllllllllhhhhhh


DSSP  ----------EELLLLlleeeeelllllhhhllLLHHHHHHHHH-HLLL-----------
Query ----------ITRAXApghfnaiflsdsnpleqKDYKDAFREAK-KQGA-----------  130
ident                |                       |  ||                
Sbjct ksldmgcdlvGGVDPA----------trennveGSLDLCFKLAKeYDVDidyhihdigtv  223
DSSP  hhhhhllleeELLLLL----------lllllhhHHHHHHHHHHHhLLLEeeeeelllhhh


DSSP  -------------------EEEELLLLLlllLLLL--lLLLHhhhhhhhlllLLEEEeEE
Query -------------------FXFWNHPGWdsqQPDT--tKWWPehtalyqegcXHGIEvAN  169
ident                         |                                   
Sbjct gvysinrlaqktiengykgRVTTSHAWC--fADAPsewLDEA---iplykdsGMKFV-TC  277
DSSP  hhhhhhhhhhhhhhlllllLEEEEELLH--hHHLLhhhHHHH---hhhhhhhLLEEE-EE


DSSP  LLEEL--LHHHHHHHHhLLEEEEELLLLLL-hHHHLlhhhlLLLL---------------
Query GHLYX--PEAIQWCLDkNLTXIGTSDIHQP-iQTDYdfekgEHRT---------------  211
ident           |             ||                                  
Sbjct FSSTPptMPVIKLLEA-GINLGCASDNIRDfwVPFG-ngdmVQGAlietqrlelktnrdl  335
DSSP  LLLLLllLLHHHHHHL-LLEEEEELLLLLLllLLLL-lllhHHHHhhhhhhhllllhhhh


DSSP  -----EEEEeellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeeeeeel
Query -----XTFVfakerslqgIREAldnrrtaayfhelligredllrpffekcvkieevsrne  266
ident                                                             
Sbjct gliwkMITS----egarvLGIE-----------------------------knygievgk  362
DSSP  hhhhhHHLH----hhhhhHLLH-----------------------------hhlllllll


DSSP  leeeeeeEELL---LLLEeeeelllllleellleeeellleeeeeeeeellllllleeee
Query qgvtlsiTNVT---DLVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
ident                                                             
Sbjct kadlvvlNSLSpqwAIID---------------------------------------qak  383
DSSP  llleeeeLLLLhhhHHHH---------------------------------------lll


DSSP  eeeeeeeelleeeeeeeel
Query evtnfivapdkglkytisl  342
ident                    
Sbjct rlcvikngriivkdeviva  402
DSSP  eeeeeelleeeeelleell


No 16: Query=3e38A Sbjct=2vunA Z-score=6.2

back to top
DSSP  llllllllllllLLLE--------------------------------------------
Query aqrrneiqvpdlDGYT--------------------------------------------   16
ident                                                             
Sbjct --sktiiknigkIVSGdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstv   58
DSSP  --leeeeellleEELLllllleellleeeeelleeeeeelhhhhlllllleeeellllee


DSSP  -EEEEELLLLLLllllllLHHH--------HHHHHHHLLLLEELLEEELlLLLLL----l
Query -TLKCDFHXHSVfsdglvWPTV--------RVDEAYRDGLDAISLTEHIeYRPHK----q   63
ident      | | |                        |   |             |       
Sbjct tPGLLDTHVHVS------GGDYaprqktmdFISSALHGGVTTMISAGSP-HFPGRpkdaa  111
DSSP  eELEEEEEELLL------LLLEehhhleelHHHHHHLLLEEEEEELLLL-LLLLLlllhh


DSSP  lllLLLLHHHHHHHHHHHhHLLEELL-EEEE-------------------------ELLL
Query dvvSDHNRSFDLCREQAEkLGILLIK-GSEI-------------------------TRAX   97
ident                     |                                       
Sbjct gtkALAITLSKSYYNARP-AGVKVHGgAVILekglteedfiemkkegvwivgevglGTIK  170
DSSP  hhhHHHHHHHHHHHHLLH-HHLEEELlEELLlllllhhhhhhhhhlllleeeeellLLLL


DSSP  LLleeeeelllllhhhlllLHHHHHHHHHHLLLEEEELLLLLLllLLLL-LLLLHHHHHH
Query APghfnaiflsdsnpleqkDYKDAFREAKKQGAFXFWNHPGWDsqQPDT-TKWWPEHTAL  156
ident  |                 |       | | |        |     |   |         
Sbjct NP----------------eDAAPMVEWAHKHGFKVQMHTGGTS--IPGSsTVTADDVIKT  212
DSSP  LH----------------hHHHHHHHHHHHLLLEEEEELLLLL--LLLLlLLLHHHHHHH


DSSP  HhlllLLEE-EEEELLEELL--HHHHHHHHHLLEEEE-----------------------
Query YqegcXHGI-EVANGHLYXP--EAIQWCLDKNLTXIG-----------------------  190
ident               |       |                                     
Sbjct K----PDVVsHINGGPTAISvqEVDRIMDETDFAMEIvqcgnpkiadyvarraaekgqlg  268
DSSP  L----LLEEeLLLLLLLLLLhhHHHHHHHHLLLEEEEellllhhhhhhhhhhhhhhllhh


DSSP  ----ELLLL---LLHH---------hhllhhhllllleeEEEEllllhhhHHHHHHllle
Query ----TSDIH---QPIQ---------tdydfekgehrtxtFVFAkerslqgIREALDnrrt  234
ident       |       |                                      |      
Sbjct rvifGNDAPsgtGLIPlgilrnmcqiasmsdidpevavcMATG-------NSTAVY----  317
DSSP  heeeELLLLlllLLLLlhhhhhhhhhhhhllllhhhhhhHHLH-------HHHHHH----


DSSP  eeeelleeellhhhhhhhhhHHEEEeeeeeelleeeeeEEELLL--LLEEeeelllllle
Query aayfhelligredllrpffeKCVKIeevsrneqgvtlsITNVTD--LVLKlkktahdtll  292
ident                                                             
Sbjct --glntgviapgkeadliimDTPLG------------sVAEDAMgaIAAG----------  353
DSSP  --lllllllllllllleeeeELLLL------------lLLLLHHhhHHHL----------


DSSP  ellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query vyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                   
Sbjct ------------------dipgisvvlidgeavvtksrntppakraakil  385
DSSP  ------------------llleeeeeeelleeeellllllllllllleel


No 17: Query=3e38A Sbjct=3gg7A Z-score=6.1

back to top
DSSP  llllllllllllllleeEEEELLLLLLlllLLLLHHHHHHHHHHLLLlEELLEEELllll
Query aqrrneiqvpdldgyttLKCDFHXHSVfsdGLVWPTVRVDEAYRDGLdAISLTEHIeyrp   60
ident                     ||| |         |           |             
Sbjct -----------------SLIDFHVHLD---LYPDPVAVARACEERQL-TVLSVTTT----   35
DSSP  -----------------LLEEEEELHH---HLLLHHHHHHHHHHLLL-EEEELLLL----


DSSP  lllllllLLLHHHHHHHHHHhhhlLEELLEEEEELL-----lllleeeeelLLLL-----
Query hkqdvvsDHNRSFDLCREQAeklgILLIKGSEITRA-----xapghfnaifLSDS-----  110
ident           |                                        |        
Sbjct ------pAAWRGTLALAAGR----PHVWTALGFHPEvvseraadlpwfdryLPETrfvge   85
DSSP  ------hHHHHHHHHHHLLL----LLEEELLLLLHHhllllhhhlhhhhhhHHHLleeee


DSSP  ------------hhhllLLHHHHHHHHHHL-LLEEEELllllllllllllLLLHHHHHHH
Query ------------npleqKDYKDAFREAKKQ-GAFXFWNhpgwdsqqpdttKWWPEHTALY  157
ident                         |      |                      |     
Sbjct vgldgspslrgtwtqqfAVFQHILRRCEDHgGRILSIH----------srRAESEVLNCL  135
DSSP  eellllhhhhhhhhhhhHHHHHHHHHHHHLlLEEEEEE----------llLLHHHHHHHH


DSSP  HLL---LLLEEE-------------------eEELLEE----LLHHHHHHHhhllEEEEE
Query QEG---CXHGIE-------------------vANGHLY----XPEAIQWCLdknlTXIGT  191
ident                                               |             
Sbjct EANprsGTPILHwysgsvtelrraislgcwfsVGPTMVrtqkGAALIRSMP--rdRVLTE  193
DSSP  HHLhhhEEEEEElllllhhhhhhhhhllleeeELHHHHllhhHHHHHHHLL--hhHEEEL


DSSP  LLLLllhhhHLLH-hhllLLLE-------------------eEEEEllllhhhhHHHHHL
Query SDIHqpiqtDYDF-ekgeHRTX-------------------tFVFAkerslqgiREALDN  231
ident  |         |                                             |  
Sbjct TDGP---flELDGqaalpWDVKsvveglskiwqipaseveriVKEN--------VSRLLG  242
DSSP  LLLL---llEELLeellhHHHHhhhhhhhhhhlllhhhhhhhHHHH--------HHHHHH


DSSP  lleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeellllll
Query rrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtl  291
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  eellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query lvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                    
Sbjct --------------------------------------------------t  243
DSSP  --------------------------------------------------l


No 18: Query=3e38A Sbjct=2oofA Z-score=6.1

back to top
DSSP  ---lllllllllLLLLL------------------------------------------l
Query ---aqrrneiqvPDLDG------------------------------------------y   15
ident               |                                             
Sbjct lncervwlnvtpATLRSdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeeLLLLLlllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  EEEEEELLL-LLLL--------------------------------------lllllLHH
Query TTLKCDFHX-HSVF--------------------------------------sdglvWPT   36
ident |    | |                                                    
Sbjct TPGLIDCHThLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  EELEEEEEElLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHLLLLEELLEEELLLllllllllLLLLHHHHHHHHHHHHHLLEELLEEE-EEL
Query VRVDEAYRDGLDAISLTEHIEYrphkqdvvSDHNRSFDLCREQAEKLGILLIKGSE-ITR   95
ident  ||    | |                     |        |   | | |           
Sbjct PRVKSLIREGVTTVEIKSGYGL------tlEDELKXLRVARRLGEALPIRVKTTLLaAHA  174
DSSP  HHHHHHHHHLEEEEEEELLLLL------lhHHHHHHHHHHHHHHHHLLLEEEEEEEeELL


DSSP  L---lllleeeeelllllHHHL---------------------llLHHHHHHHHHHLLLE
Query A---xapghfnaiflsdsNPLE---------------------qkDYKDAFREAKKQGAF  131
ident                                                      |   |  
Sbjct VppeyrddpdswveticqEIIPaaaeagladavdvfcehigfslaQTEQVYLAADQYGLA  234
DSSP  LlhhhlllhhhhhhhhhhLHHHhhhhllllleeeeeellllllhhHHHHHHHHHHHLLLE


DSSP  EEELlLLLLllllllLLLLhhHHHHHHlLLLLEEEEeelleELLH--hHHHHHHHLLEEE
Query XFWNhPGWDsqqpdtTKWWpeHTALYQeGCXHGIEVanghlYXPE--aIQWCLDKNLTXI  189
ident                       |                         ||          
Sbjct VKGH-XDQL------SNLG-gSTLAAN-FGALSVDH----lEYLDpegIQALAHRGVVAT  281
DSSP  EEEE-ELLL------LLLL-hHHHHHH-LLLLEEEE----lLLLLhhhHHHHHHHLLEEE


DSSP  ----------------------------EELLL----LLLHhhhllhhhlLLLL------
Query ----------------------------GTSDI----HQPIqtdydfekgEHRT------  211
ident                               |||                           
Sbjct llptafyflketklppvvalrkagvpxaVSSDInpgtAPIV-------slRXAXnxactl  334
DSSP  elhhhhhhllllllllhhhhhhlllleeELLLLllllLLLL-------lhHHHHhhhhhh


DSSP  ---------eEEEEellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeee
Query ---------xTFVFakerslqgIREAldnrrtaayfhelligredllrpffekcvkieev  262
ident                         |                                   
Sbjct fgltpveaxaGVTR---haaraLGEQ----------------------------eqlgql  363
DSSP  hlllhhhhhhHLLH---hhhhhLLLL----------------------------llllll


DSSP  eeelleeeeeeeELLLLLeeeeelllllleellleeeellleeeeeeeeellllllleee
Query srneqgvtlsitNVTDLVlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvn  322
ident                                                             
Sbjct rvgxladflvwnCGHPAE----------------------------------------ls  383
DSSP  llllllleeeelLLLLLH----------------------------------------hh


DSSP  eeeeeeeeelleeeeeeeel
Query fevtnfivapdkglkytisl  342
ident                     
Sbjct yligvdqlvsrvvngeetlh  403
DSSP  hlllllleeeeeelleelll


No 19: Query=3e38A Sbjct=3ls9A Z-score=6.0

back to top
DSSP  -lllllllllLLLL---------------------------------------llEEEEE
Query -aqrrneiqvPDLD---------------------------------------gyTTLKC   20
ident              |                                              
Sbjct milirgltrvITFDdqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeELLLlllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  ELLLLLllllLLLL----------------------------------------HHHHHH
Query DFHXHSvfsdGLVW----------------------------------------PTVRVD   40
ident   | |                                                       
Sbjct NSHQHL----YEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvirevARAVLL  116
DSSP  EEEELH----HHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhHHHHHH


DSSP  HHHHLLLLEELLEEellLLLLllLLLLLllHHHHHHHHHHHHHLLEELLEE---------
Query EAYRDGLDAISLTEhieYRPHkqDVVSDhnRSFDLCREQAEKLGILLIKGS---------   91
ident |    |                     |     |   | |  |||               
Sbjct ESLLGGITTVADQH---LFFP--GATAD--SYIDATIEAATDLGIRFHAARssmtlgkse  169
DSSP  HHHHLLEEEEEEEE---LLLL--LLLLL--LHHHHHHHHHHHHLLEEEEEEllllllhhh


DSSP  ---------------------------------------EEELLLllleeeeelllllhh
Query ---------------------------------------EITRAXapghfnaiflsdsnp  112
ident                                                             
Sbjct ggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCGVP---------------  214
DSSP  lllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLLLL---------------


DSSP  hLLLL-HHHHHHHHH-HLLL----------------------------------EEEELL
Query lEQKD-YKDAFREAK-KQGA----------------------------------FXFWNH  136
ident              |                                             |
Sbjct yDKPElFEAFAQMAAdYDVRlhthfyepldagmsdhlygmtpwrflekhgwasdRVWLAH  274
DSSP  lLLHHhHHHHHHHHHhHLLEeeeeellllhhhhhhhhhlllhhhhhhhllllllLEEEEE


DSSP  LLllllllllLLLLHhhhHHHHLLllLEEEEEELLE-----ELLHhHHHHHHHLLEEEEE
Query PGwdsqqpdtTKWWPehtALYQEGcxHGIEVANGHL-----YXPEaIQWCLDKNLTXIGT  191
ident                        |    |                 |   ||   |    
Sbjct AV--------VPPREeipEFADAG--VAIAHLIAPDlrmgwGLAP-IREYLDAGITVGFG  323
DSSP  LL--------LLLHHhhhHHHHHL--LEEEELHHHHhhlllLLLL-HHHHHHLLLEEEEL


DSSP  LLLLLlhhhhllhhhllLLLE-------------------------------EEEE----
Query SDIHQpiqtdydfekgeHRTX-------------------------------TFVF----  216
ident                                                             
Sbjct TTGSA---------sndGGNLlgdlrlaalahrpadpnepekwlsarellrmATRGsaec  374
DSSP  LLLLL---------lllLLLHhhhhhhhhhhlhhhllllhhhlllhhhhhhhLLHHhhhh


DSSP  -----------eLLLLhhhhhhhhhllleeeeelleeellhhhhhhhhhhheeeeeeeee
Query -----------aKERSlqgirealdnrrtaayfhelligredllrpffekcvkieevsrn  265
ident                                                             
Sbjct lgrpdlgvleegRAAD--------------------------------------iacwrl  396
DSSP  llllllllllllLLLL--------------------------------------eeeeel


DSSP  lleeeeEEEELL--LLLEEeeelllllleellleeeellleeeeeeeeellllllleeee
Query eqgvtlSITNVT--DLVLKlkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
ident                                                             
Sbjct dgvdrvGVHDPAigLIMTG----------------------lsdraslvvvngqvlvene  434
DSSP  llhhhlLLLLHHhhHHHLL----------------------lllllleeeelleeeeell


DSSP  eeeeeeeelleeeeeeeel
Query evtnfivapdkglkytisl  342
ident                    
Sbjct rpvladlerivanttalip  453
DSSP  eellllhhhhhhhhhhhll


No 20: Query=3e38A Sbjct=1onxA Z-score=6.0

back to top
DSSP  ---------lllllllllLLLLL------------------------------------l
Query ---------aqrrneiqvPDLDG------------------------------------y   15
ident                      |                                      
Sbjct midytaagftllqgahlyAPEDRgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeeLLLEEeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  EEEEEELLLL-LLLL------llLLLHHhhHHHHHHLLLLEELLEEEllLLLLLllllLL
Query TTLKCDFHXH-SVFS------dgLVWPTvrVDEAYRDGLDAISLTEHieYRPHKqdvvSD   68
ident      | | |                           |                      
Sbjct CPGFIDQHVHlIGGGgeagpttrTPEVA--LSRLTEAGVTSVVGLLG--TDSIS----RH  112
DSSP  EELEEEEEELlLLLLllllhhhlLLLLL--HHHHHHLLEEEEEELLL--LLLLL----LL


DSSP  LLHHHHHHHHHHHHHlLEELLEE---------------------------EEELLLllle
Query HNRSFDLCREQAEKLgILLIKGS---------------------------EITRAXapgh  101
ident         |   |   |                                           
Sbjct PESLLAKTRALNEEG-ISAWMLTgayhvpsrtitgsvekdvaiidrvigvXCAISD----  167
DSSP  HHHHHHHHHHHHHHL-LEEEEEEellllllllllllhhhhhhhllleeeeEEEELL----


DSSP  eeeelllllhhhllLLHHHHHHHHHHL------LLEE-----------------------
Query fnaiflsdsnpleqKDYKDAFREAKKQ------GAFX-----------------------  132
ident                       |                                     
Sbjct ------hrsaapdvYHLANMAAESRVGgllggkPGVTvfhmgdskkalqpiydllencdv  221
DSSP  ------lllllllhHHHHHHHHHHHHHhhhhllLLEEeeeelllllllhhhhhhhhllll


DSSP  -----EELLLLLLlllLLLLLLlhhhhhhhhllllLEEEeEELLE-----ELLHHHHHH-
Query -----FWNHPGWDsqqPDTTKWwpehtalyqegcxHGIEvANGHL-----YXPEAIQWC-  181
ident         |                            |                      
Sbjct pisklLPTHVNRN---VPLFEQ-----alefarkgGTID-ITSSIdepvaPAEGIARAVq  272
DSSP  lhhheEEELHHHL---HHHHHH-----hhhhhhllLLEE-EELLLlllllHHHHHHHHHh


DSSP  HHHL-lEEEEELLLL-----------------LLHH---------hhllhhhllllleEE
Query LDKN-lTXIGTSDIH-----------------QPIQ---------tdydfekgehrtxTF  214
ident            ||                                               
Sbjct AGIPlaRVTLSSDGNgsqpffddegnlthigvAGFEtlletvqvlvkdydfsisdalrPL  332
DSSP  LLLLhhHEEEELLLLleeeeellllleeeeeeLLLHhhhhhhhhhhhhhlllhhhhhhHH


DSSP  EE--ellllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeee
Query VF--akersLQGIrealdnrrtaayfhelligredllrpffekcvkieevsrneqgvtls  272
ident          | |                                                
Sbjct TSsvagflnLTGK-----------------------------------geilpgndadll  357
DSSP  LHhhhhhllLLLL-----------------------------------llllllllllee


DSSP  eeELLLLleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeel
Query itNVTDLvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivap  332
ident                                                             
Sbjct vmTPELR-------------------------------------ieqvyargklmvkdgk  380
DSSP  eeLLLLL-------------------------------------eeeeeelleeeeelle


DSSP  leeeeeeeel
Query dkglkytisl  342
ident           
Sbjct acvkgtfetd  390
DSSP  elllllllll


No 21: Query=3e38A Sbjct=1yrrB Z-score=5.9

back to top
DSSP  lllllllllLLLLL------------------------------------lEEEEEELLL
Query aqrrneiqvPDLDG------------------------------------yTTLKCDFHX   24
ident                                                         |   
Sbjct -yaltqgriFTGHEflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQL   59
DSSP  -leeelleeELLLLeelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEE


DSSP  L-----llllllLLLHH-HHHHHHHHLL---LLEELLEEELLLLLllllllLLLLHHHHH
Query H-----svfsdgLVWPT-VRVDEAYRDG---LDAISLTEHIEYRPhkqdvvSDHNRSFDL   75
ident                                      |                 |    
Sbjct NgcggvqfndtaEAVSVeTLEIMQKANEksgCTNYLPTLITTSDE----lmKQGVRVMRE  115
DSSP  LeelleelllllLLLLHhHHHHHHHHHHlllEEEEEEEELLLLHH----hhHHHHHHHHH


DSSP  HHHHHHhhLLEELLEEEEELLL-llleeeeelLLLL---hhhllllHHHHHHHHHHLLLE
Query CREQAEklGILLIKGSEITRAX-apghfnaifLSDS---npleqkdYKDAFREAKKQGAF  131
ident            |    |                                        |  
Sbjct YLAKHP--NQALGLHLEGPWLNaalvdflcenADVItkvtlapemvPAEVISKLANAGIV  173
DSSP  HHHHLL--LLLLLEEEELLLLLlhhhhhhhhlHHHEeeeeelhhhlLHHHHHHHHHHLLE


DSSP  EEELLLlllllllllLLLLHHHHHHHHLlLLLEEEEeelleELLH--------hHHHHHH
Query XFWNHPgwdsqqpdtTKWWPEHTALYQEgCXHGIEVanghlYXPE--------aIQWCLD  183
ident     |               |  |                                  ||
Sbjct VSAGHS---------NATLKEAKAGFRA-GITFATH---lyNAMPyitgrepglAGAILD  220
DSSP  EEELLL---------LLLHHHHHHHHHH-LEEEELL---llLLLLlllllllhhHHHHHH


DSSP  HL-LEEEE-------------------------ELLLLllhhhhllhhhlLLLL------
Query KN-LTXIG-------------------------TSDIHqpiqtdydfekgEHRT------  211
ident                                    |                        
Sbjct EAdIYCGIiadglhvdyanirnakrlkgdklclVTDAT---------sgsSLTMiegvrn  271
DSSP  LLlLEEEEelllllllhhhhhhhhhhhhhheeeELLLL---------lllLLLHhhhhhh


DSSP  -------------eeEEEEllllhhhhHHHHHllleeeeelleeellhhhhhhhhhhhee
Query -------------xtFVFAkerslqgiREALDnrrtaayfhelligredllrpffekcvk  258
ident                                                             
Sbjct lvehcgialdevlrmATLY--------PARAI-----------------------gvekr  300
DSSP  hhhhhlllhhhhhhhHLHH--------HHHHL-----------------------lllll


DSSP  eeeeeeelleeeeeeeELLLLleeeeelllllleellleeeellleeeeeeeeellllll
Query ieevsrneqgvtlsitNVTDLvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikg  318
ident                                                             
Sbjct lgtlaagkvanltaftPDFKI---------------------------------------  321
DSSP  llllllllllleeeelLLLLE---------------------------------------


DSSP  leeeeeeeeeeeelleeeeeeeel
Query gdvnfevtnfivapdkglkytisl  342
ident                         
Sbjct -----------tktivngnevvtq  334
DSSP  -----------eeeeelleeeeel


No 22: Query=3e38A Sbjct=4dlfA Z-score=5.9

back to top
DSSP  llllllllllllllleEEEEELLLLLL---------------llllLLLHHHHHHHHHHL
Query aqrrneiqvpdldgytTLKCDFHXHSV---------------fsdgLVWPTVRVDEAYRD   45
ident                  |  | | |                        |          
Sbjct ----------------ALRIDSHQHFWryraadypwigagmgvlarDYLPDALHPLMHAQ   44
DSSP  ----------------LLLEEEEELLLlllhhhllllllllhhhllLLLHHHHHHHHHHL


DSSP  LLLEELLEEElllllllllllLLLL-HHHHHHHHHhhhhLLEELLEE-------------
Query GLDAISLTEHieyrphkqdvvSDHN-RSFDLCREQaeklGILLIKGS-------------   91
ident  | |                  |       |                             
Sbjct ALGASIAVQA--------ragRDETaFLLELACDE----ARIAAVVGwedlrapqlaerv   92
DSSP  LLLEEEEELL--------lllHHHHhHHHHHHLLL----LLEEEEEEllllllllhhhhh


DSSP  -----------EEELLlllleeeeelllllhhhllLLHHHHHHHHHHLLLE---------
Query -----------EITRAxapghfnaiflsdsnpleqKDYKDAFREAKKQGAF---------  131
ident                                     |                       
Sbjct aewrgtklrgfRHQLQ--------deadvrafvddADFARGVAWLQANDYVydvlvferq  144
DSSP  hlllllleeeeEELHH--------hlllhhhhhhlHHHHHHHHHHHHLLLEeeelllhhh


DSSP  ---------------EEELL-LLLLL-------lLLLLL--LLLHhhHHHHhllllLEEE
Query ---------------XFWNH-PGWDS-------qQPDTT--KWWPehTALYqegcxHGIE  166
ident                    |                                        
Sbjct lpdvqafcarhdahwLVLDHaGKPALaefdrddtALARWraALRElaALPH-----VVCK  199
DSSP  hhhhhhhhhhlllllEEEHHhHLLLHhhllllllHHHHHhhHHHHhhLLLL-----EEEE


DSSP  eEELL-------------------eELLHHHHHHHhhlLEEEEELLLLLlhHHHLLhhhl
Query vANGH-------------------lYXPEAIQWCLdknLTXIGTSDIHQpiQTDYDfekg  207
ident    |                         |              ||              
Sbjct -LSGLvteadwrrglrasdlrhieqCLDAALDAFG--pQRLMFGSDWPV-cLLAAS---y  252
DSSP  -ELLLlllllllllllhhhhhhhhhHHHHHHHHHL--hHHEEELLLLLH-hHHLLL---h


DSSP  LLLLeeeeeellllhhhhhhhhhllleeeEELLEEellhhhhhhhhhhheeeeeeeeell
Query EHRTxtfvfakerslqgirealdnrrtaaYFHELLigredllrpffekcvkieevsrneq  267
ident                                                             
Sbjct DEVA------------------------sLVERWA-------------------------  263
DSSP  HHHH------------------------hHHHHHH-------------------------


DSSP  eeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeE
Query gvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtN  327
ident                                                             
Sbjct -----------------------------------------------------------E  264
DSSP  -----------------------------------------------------------H


DSSP  EEE--------elleeeeeeeel
Query FIV--------apdkglkytisl  342
ident                        
Sbjct SRLsaaersalwggtaarcyalp  287
DSSP  HHLlhhhhhhhllhhhhhhllll


No 23: Query=3e38A Sbjct=3pnuA Z-score=5.8

back to top
DSSP  -lllllllLLLLlllleEEEEELLLLLLllllllLHHHHHHHHHHlLLLEELLEEElllL
Query -aqrrneiQVPDldgytTLKCDFHXHSVfsdglvWPTVRVDEAYRdGLDAISLTEHieyR   59
ident                      | | |                  |    |          
Sbjct enlyfqsnAMKL-----KNPLDMHLHLR---dnqMLELIAPLSAR-DFCAAVIMPN---L   48
DSSP  llllllllLEEE-----ELLEEEEELLL---lhhHHHHHHHHHHL-LLLEEEELLL---L


DSSP  LLLllllLLLLHHHHHHHHHHHHHLLEELLEEEEE-------------------------
Query PHKqdvvSDHNRSFDLCREQAEKLGILLIKGSEIT-------------------------   94
ident         |                                                   
Sbjct IPPlcnlEDLKAYKMRILKACKDENFTPLMTLFFKnydekflysakdeifgixlypagit  108
DSSP  LLLlllhHHHHHHHHHHHHHHLLLLLEEEEEEELLlllhhhhhhhllllleeeellllll


DSSP  -----LLLLLleeeeelllllhhhlllLHHHHHHHHHHLLLEEEELlLLLLLllLLLL--
Query -----RAXAPghfnaiflsdsnpleqkDYKDAFREAKKQGAFXFWNhPGWDSqqPDTT--  147
ident                              |                              
Sbjct tnsngGVSSF--------------dieYLKPTLEAMSDLNIPLLVH-GETND-fVMDRes  152
DSSP  lllllLLLLL--------------lhhHHHHHHHHHHHLLLLEEEL-LLLLL-lHHHLlh


DSSP  -LLLHhHHHHHHLL--LLLEEEEEelleELLHHHHHHHHHL-LEEEE-------------
Query -KWWPeHTALYQEG--CXHGIEVAnghlYXPEAIQWCLDKN-LTXIG-------------  190
ident          |           |                |   |                 
Sbjct nFAKI-YEKLAKHFprLKIVMEHI----TTKTLCELLKDYEnLYATItlhhliitlddvi  207
DSSP  hHHHH-HHHHHHHLllLLEEELLL----LLHHHHHHHHHLLlEEEEEllhhhlllhhhhh


DSSP  ------------------------------------ELLLLLL-----------------
Query ------------------------------------TSDIHQP-----------------  197
ident                                      ||                     
Sbjct ggkmnphlfckpiakryedkealcelafsgyekvmfGSDSAPHpkgcaagvfsapvilpv  267
DSSP  lllllhhhllllllllhhhhhhhhhhhhllllleeeLLLLLLLllllllllllhhhhhhh


DSSP  -hhhhllhhhllllleeEEEEllllhhhhHHHHHLlleeeeelleeellhhhhhhhhhhh
Query -iqtdydfekgehrtxtFVFAkerslqgiREALDNrrtaayfhelligredllrpffekc  256
ident                                                             
Sbjct laelfkqnsseenlqkfLSDN--------TCKIYD-------------------------  294
DSSP  hhhhhhhhllhhhhhhhHLHH--------HHHHHL-------------------------


DSSP  eeeeeeeeelleeeeeeeelLLLL----eeeeelllllleellleEEELLleeeeeeeee
Query vkieevsrneqgvtlsitnvTDLV----lklkktahdtllvyfrdXTLKPhtrytvrigf  312
ident                                                ||           
Sbjct ----------lkfkedkiltLEEKewqvpnvyedkynqvvpymagEILKF----------  334
DSSP  ----------llllllleeeEELLleelllleelllleellllllLEELL----------


DSSP  llllllleeeeeeeeeeeelleeeeeeeel
Query kqgikggdvnfevtnfivapdkglkytisl  342
ident                               
Sbjct --------------------------qlkh  338
DSSP  --------------------------eell


No 24: Query=3e38A Sbjct=4hk5D Z-score=5.7

back to top
DSSP  lllllllllllllllEEEEEELLLLLLL--------------------------------
Query aqrrneiqvpdldgyTTLKCDFHXHSVF--------------------------------   28
ident                |    | | |                                   
Sbjct ---------------TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillss   45
DSSP  ---------------LLLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhh


DSSP  ---------------------lllLLLHHHHHHHHHHLLLLEELLEEElLLLL------l
Query ---------------------sdgLVWPTVRVDEAYRDGLDAISLTEHiEYRP------h   61
ident                                       |                     
Sbjct elaaldaaladpaaklpgrplsthFASLAQKMHFMDTNGIRVSVISLAnPWFDflapdea  105
DSSP  hhhhhhhhhhlllllllleellhhHLLHHHHHHHHHHLLLLEEEEEELlLLLLllllllh


DSSP  llllLLLLLHHHHHHHHHHhhhlLEELLE---------------------------EEEE
Query kqdvVSDHNRSFDLCREQAeklgILLIKG---------------------------SEIT   94
ident             | |          |                                  
Sbjct pgiaDAVNAEFSDMCAQHV----GRLFFFaalplsapvdavkasiervknlkycrgIILG  161
DSSP  hhhhHHHHHHHHHHHHLLL----LLEEEEeellllllhhhhhhhhhhhhlllleeeEEEL


DSSP  LLlllleeeeelllllhhhllLLHHHHHHHHHHLLLE-----------------------
Query RAxapghfnaiflsdsnpleqKDYKDAFREAKKQGAF-----------------------  131
ident                            |                                
Sbjct TS-----------glgkglddPHLLPVFEAVADAKLLvflhphyglpnevygprseeygh  210
DSSP  LL-----------llllllllHHHHHHHHHHHHLLLEeeelllllllhhhhlllhhhlll


DSSP  --------------------------------EEELL-LLLLllllllLLLL--------
Query --------------------------------XFWNH-PGWDsqqpdtTKWW--------  150
ident                                     |  |                    
Sbjct vlplalgfpmettiavarmymagvfdhvrnlqMLLAHsGGTL-----pFLAGriescivh  265
DSSP  hhhhhlhhhhhhhhhhhhhhhllhhhhlllllEEEHHhHLLH-----hHHHHhhhhhhhl


DSSP  ---------------HHHHHhhhlllLLEEEeEELL--eELLHHHHHHHhhlLEEEEELL
Query ---------------PEHTAlyqegcXHGIEvANGH--lYXPEAIQWCLdknLTXIGTSD  193
ident                   |             |          ||              |
Sbjct dghlvktgkvpkdrrTIWTV---lkeQIYLD-AVIYsevGLQAAIASSG--aDRLMFGTD  319
DSSP  lhhhhhlllllllllLHHHH---hhhLEEEE-LLLLlhhHHHHHHHHHL--hHHEELLLL


DSSP  LLLlhhhHLLHHH-----lLLLLeeeeeellllhhhhhhhhhllleeeeeLLEEEllhhh
Query IHQpiqtDYDFEK-----gEHRTxtfvfakerslqgirealdnrrtaayfHELLIgredl  248
ident            |                                          |     
Sbjct HPF----FPPIEEdvqgpwDSSR-------------------------lnAQAVI-----  345
DSSP  LLL----LLLLLLllllllHHHH-------------------------hhHHHHH-----


DSSP  hhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeee
Query lrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytv  308
ident                                                             
Sbjct ------------------------------------------------------------  345
DSSP  ------------------------------------------------------------


DSSP  eeeellllllleeeeeeeEEEE-------------------elleeeeeeeel
Query rigfkqgikggdvnfevtNFIV-------------------apdkglkytisl  342
ident                                                      
Sbjct ------------------KAVGegssdaaavmglnavrvlslkaelehhhhhh  380
DSSP  ------------------HHHLlllhhhhhhhlhhhhhhlllhhhhhhhhhhl


No 25: Query=3e38A Sbjct=2vc5A Z-score=5.7

back to top
DSSP  llllllllllllllleeEEEELLLLLLL---------------lllllLHHHHHHHHHHL
Query aqrrneiqvpdldgyttLKCDFHXHSVF---------------sdglvWPTVRVDEAYRD   45
ident                       | |                            |  |   
Sbjct -mriplvgkdsieskdiGFTLIHEHLRVfseavrqqwphlynedeefrNAVNEVKRAMQF   59
DSSP  -llllllllllllhhhlLLEELLLLLLLllhhhhhhlhhhllhhhhhhHHHHHHHHHHHL


DSSP  LLLEELLEEELLLLlllllllllLLHHHHHHHHHHHhhlLEELlEEEE-ELLL--lllee
Query GLDAISLTEHIEYRphkqdvvsdHNRSFDLCREQAEklgILLIkGSEI-TRAX--apghf  102
ident |   |                    |             | |                  
Sbjct GVKTIVDPTVMGLG--------rDIRFMEKVVKATG---INLV-AGTGiYIYIdlpfyfl  107
DSSP  LLLEEEELLLLLLL--------lLHHHHHHHHHLLL---LEEE-ELEElLLLLlllhhhl


DSSP  eeelllllhHHLL------------------------------lLHHHHHHHHHHLLLEE
Query naiflsdsnPLEQ------------------------------kDYKDAFREAKKQGAFX  132
ident                                                 |    |      
Sbjct nrsideiadLFIHdikegiqgtlnkagfvxiaadepgitkdvekVIRAAAIANKETKVPI  167
DSSP  lllhhhhhhHHHHhhhlllllllllllleeeelllllllhhhhhHHHHHHHHHHHHLLLE


DSSP  EELLLLlllllllLLLL-LHHHHHHHHLLL---lLEEEEEellEELL---HHHHHHhHHL
Query FWNHPGwdsqqpdTTKW-WPEHTALYQEGC---xHGIEVAnghLYXP---EAIQWClDKN  185
ident                         |  ||       |                    || 
Sbjct ITHSNA-------HNNTgLEQQRILTEEGVdpgkILIGHL---GDTDnidYIKKIA-DKG  216
DSSP  EEELLL-------LLLHhHHHHHHHHHLLLlhhhEEELLH---HHLLlhhHHHHHH-HLL


DSSP  LEE--------------------------------EEELLLLL--------------lhH
Query LTX--------------------------------IGTSDIHQ--------------piQ  199
ident                                        |                    
Sbjct SFIgldrygldlflpvdkrnettlrlikdgysdkiMISHDYCCtidwgtakpeykpklaP  276
DSSP  LEEeellllllllllhhhhhhhhhhhhhlllllleEELLLLLLllllllllhhhhhhhlL


DSSP  HHL--lhhHLLL------------lleEEEEellllhhhHHHHHHLlleeeeelleeell
Query TDY--dfeKGEH------------rtxTFVFakerslqgIREALDNrrtaayfhelligr  245
ident                             |                               
Sbjct RWSitlifEDTIpflkrngvneeviatIFKE--------NPKKFFS--------------  314
DSSP  LLLllhhhHLHHhhhhlllllhhhhhhHHLH--------HHHHHLL--------------


DSSP  hhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeelllee
Query edllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtr  305
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  eeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query ytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                      
Sbjct -------------------------------------  314
DSSP  -------------------------------------


No 26: Query=3e38A Sbjct=2pajA Z-score=5.7

back to top
DSSP  ---llllllllLLLLLL-----------------------------------------le
Query ---aqrrneiqVPDLDG-----------------------------------------yt   16
ident                 |                                           
Sbjct pstlirnaaaiMTGGRGtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleeLLLLLLlllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  EEEEELLLLLllllLLLL------------------HHHHHHHHHHLLLLEELLEEELll
Query TLKCDFHXHSvfsdGLVW------------------PTVRVDEAYRDGLDAISLTEHIey   58
ident       | |                                 |  | |            
Sbjct PAWVNTHHHL----FQSLlkgepfralfderrfrlaARIGLIELARSGCATVADHNYV--  114
DSSP  ELEELLLLLH----HHHHllllllhhhllhhhhhhhHHHHHHHHHLLLEEEEEELLLL--


DSSP  lllLLLLLLLLLhhhHHHHHHHHHHLLEELLEEEEE------------------------
Query rphKQDVVSDHNrsfDLCREQAEKLGILLIKGSEIT------------------------   94
ident          |         | |||||                                  
Sbjct --yYPGMPFDSS---AILFEEAEKLGLRFVLLRGGAtqtrqleadlptalrpetldayva  169
DSSP  --lLLLLLLLHH---HHHHHHHHHLLLEEEEEELLLlllllllllllhhhllllhhhhhh


DSSP  -----------------------------LLLLlleeeeelllllhhhlllLHHHHHHHH
Query -----------------------------RAXApghfnaiflsdsnpleqkDYKDAFREA  125
ident                                                            |
Sbjct dierlaaryhdaspramrrvvmapttvlySISP-----------------rEMRETAAVA  212
DSSP  hhhhhhhhllllllllleeeeelllllllLLLH-----------------hHHHHHHHHH


DSSP  HHLLLEEEELLLlllllllLLLLLLHHHHHHHhlllLLEEEeeelleELLH---hHHHHH
Query KKQGAFXFWNHPgwdsqqpDTTKWWPEHTALYqegcXHGIEvanghlYXPE---aIQWCL  182
ident    |                                                   |    
Sbjct RRLGLRMHSHLS-------GKSPVAFCGEHDW-lgsDVWYA-----hLVKVdadeIALLA  259
DSSP  HHLLLEEEEELL-------LLLHHHHHHHLLL-lllLEEEE-----lLLLLlhhhHHHHH


DSSP  HHLLEEEE----------------------ELLLLLLHHHhllhhhlLLLL---------
Query DKNLTXIG----------------------TSDIHQPIQTdydfekgEHRT---------  211
ident                                 |                           
Sbjct QTGTGVAHcpqsngrlpvremadagvpvsiGVDGAASNEA----admISEVhmtwlaqra  315
DSSP  HHLLEEEElhhhhhllllllhhhhllleeeLLLHHHHLLL----llhHHHHhhhhhhhhh


DSSP  ----------eEEEEellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeee
Query ----------xTFVFakerslqgIREAldnrrtaayfhelligredllrpffekcvkiee  261
ident                                                             
Sbjct rlasiaevihwGTAG----garvMGLD------------------evgkvavgyaadiav  353
DSSP  llllhhhhhhhHLHH----hhhhHLLL------------------lllllllllllleee


DSSP  eeeelleeeeeEEEL-LLLLeeeeelllllleellleeeellleeeeeeeeellllllle
Query vsrneqgvtlsITNV-TDLVlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggd  320
ident                                                             
Sbjct yrlddpryfglHDPAiGPVA--------------sggrpsvmalfsagkrvvvddliegv  399
DSSP  eelllhhhlllLLHHhHHHH--------------llllleeeeeeelleeeeelllllll


DSSP  eeeeeeeeeeelleeeeeeeel
Query vnfevtnfivapdkglkytisl  342
ident                       
Sbjct dikelggearrvvrellrevvv  421
DSSP  lhhhhhhhhhhhhhhhhhhhhl


No 27: Query=3e38A Sbjct=3mtwA Z-score=5.6

back to top
DSSP  --lllllllllLLLLL---------------------------------------lEEEE
Query --aqrrneiqvPDLDG---------------------------------------yTTLK   19
ident             |                                               
Sbjct aeikavsaarlLDVASgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeEELLLleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EELLLLLllLLLL----------------lLHHHHHHHHHHLLLLEELLEEellllllll
Query CDFHXHSvfSDGL----------------vWPTVRVDEAYRDGLDAISLTEhieyrphkq   63
ident  | | |                          |         |                 
Sbjct IDMHVHL--DSLAevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG---------  109
DSSP  EEEEELL--LLLLlllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL---------


DSSP  lllllLLHHHHHHHHHHH---HHLLEELLE------------------------------
Query dvvsdHNRSFDLCREQAE---KLGILLIKG------------------------------   90
ident              ||        |                                    
Sbjct ----aADYDDVGLREAIDagyVPGPRIVTAaisfgatgghcdstffppsmdqknpfnsds  165
DSSP  ----lLLLHHHHHHHHHHlllLLLLEEEELllleellllllllllllhhhllllllllll


DSSP  ------------------EEEELLLllleeeeelllllhhhllLLHHHHHHHHHHLLLE-
Query ------------------SEITRAXapghfnaiflsdsnpleqKDYKDAFREAKKQGAF-  131
ident                     |                         |    ||   |   
Sbjct pdearkavrtlkkygaqvIXICATG--gvfsrgnepgqqqltyEEMKAVVDEAHMAGIKv  223
DSSP  hhhhhhhhhhhhhlllleEEEELLL--lllllllllllllllhHHHHHHHHHHHHLLLEe


DSSP  ------------------EEELLLLLlllllllLLLL--hHHHHHHhllllLEEEeEELL
Query ------------------XFWNHPGWdsqqpdtTKWW--pEHTALYqegcxHGIEvANGH  171
ident                       |                                     
Sbjct aahahgasgireavragvDTIEHASL-------VDDEgikLAVQKG-----AYFS-MDIY  270
DSSP  eeeellhhhhhhhhhlllLEEEELLL-------LLHHhhhHHHHHL-----LEEE-LLLL


DSSP  ---------------------------eELLHHHHHHHHHlLEEEEELLLL-LLHHhhll
Query ---------------------------lYXPEAIQWCLDKnLTXIGTSDIH-QPIQtdyd  203
ident                                                 |    |      
Sbjct ntdytqaegkkngvlednlrkdrdigelQRENFRKALKAG-VKMVYGTDAGiYPHG----  325
DSSP  lhhhhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHL-LEEELLLLLLlLLLL----


DSSP  hhhllLLLE---------------EEEEellllhhhHHHHhhllleeeeelleeellhhh
Query fekgeHRTX---------------TFVFakerslqgIREAldnrrtaayfhelligredl  248
ident                                                             
Sbjct ---dnAKQFavmvrygatplqaiqSATL---taaeaLGRS--------------------  359
DSSP  ---lhHHHHhhhhhllllhhhhhhHLLH---hhhhhHLLL--------------------


DSSP  hhhhhhhheeeeeeeeelleeeeeeeELLLLLEeeeelllllleellleeeellleeeee
Query lrpffekcvkieevsrneqgvtlsitNVTDLVLklkktahdtllvyfrdxtlkphtrytv  308
ident                               |                             
Sbjct ---------kdvgqvavgrygdmiavAGDPLAD---------------------------  383
DSSP  ---------llllllllllllleeeeLLLLLLL---------------------------


DSSP  eeeellllllleeeeeeeeeeeelleeeeeeeel
Query rigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                   
Sbjct -------------vttlekpvfvmkggavvkapx  404
DSSP  -------------hhhhhllleeeelleeeelll


No 28: Query=3e38A Sbjct=2uz9A Z-score=5.6

back to top
DSSP  -lllllllllLLLL----------------------------------------------
Query -aqrrneiqvPDLD----------------------------------------------   13
ident                                                             
Sbjct plahifrgtfVHSTwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeEELLllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  -----llEEEEEELLLLLlllLLLL---------------------------------LH
Query -----gyTTLKCDFHXHSvfsDGLV---------------------------------WP   35
ident             | | |                                           
Sbjct lshheffMPGLVDTHIHA---SQYSfagssidlpllewltkytfpaehrfqnidfaeeVY  117
DSSP  llllleeEELEEEEEEEH---HHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHH


DSSP  HHHHHHHHHLLLLEELLEEellllllllllllLLLHHHHHHHHHHHHHLLEELLE-----
Query TVRVDEAYRDGLDAISLTEhieyrphkqdvvsDHNRSFDLCREQAEKLGILLIKG-----   90
ident |  |      |                      |  |  |      | |     |     
Sbjct TRVVRRTLKNGTTTACYFA------------tIHTDSSLLLADITDKFGQRAFVGkvcmd  165
DSSP  HHHHHHHHHLLEEEEEEEL------------lLLHHHHHHHHHHHHHHLLEEEEEleell


DSSP  -------------------------------------eEEELLLllleeeeelllllhhh
Query -------------------------------------sEITRAXapghfnaiflsdsnpl  113
ident                                                             
Sbjct lndtfpeyketteesiketerfvsemlqknysrvkpivTPRFSL--------------sc  211
DSSP  lllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLHH--------------hl


DSSP  lLLLHHHHHHHHH-HLLL-------------------------------------EEEEL
Query eQKDYKDAFREAK-KQGA-------------------------------------FXFWN  135
ident            ||                                               
Sbjct sETLMGELGNIAKtRDLHiqshisenrdeveavknlypsyknytsvydknnlltnKTVMA  271
DSSP  lHHHHHHHHHHHHhHLLEeeeeelllhhhhhhhhhhllllllhhhhhhhllllllLEEEE


DSSP  LLLllllllllLLLLHHHHHhHHLLllLEEEEEELLE-----ELLHhHHHHHHHLLEEEE
Query HPGwdsqqpdtTKWWPEHTAlYQEGcxHGIEVANGHL-----YXPEaIQWCLDKNLTXIG  190
ident |               |       |    |                     |        
Sbjct HGC--------YLSAEELNVfHERG--ASIAHCPNSNlslssGFLN-VLEVLKHEVKIGL  320
DSSP  ELL--------LLLHHHHHHhHHHL--LEEEELHHHHhhlllLLLL-HHHHHHLLLEEEE


DSSP  ELLLLllhhhhllhhhllLLLE----------------------------EEEE------
Query TSDIHqpiqtdydfekgeHRTX----------------------------TFVF------  216
ident   |                                                         
Sbjct GTDVA------ggysysmLDAIrravmvsnillinkvneksltlkevfrlATLGgsqalg  374
DSSP  LLLLL------llllllhHHHHhhhhhhhhhhhhlllllllllhhhhhhhHLHHhhhhll


DSSP  ----------eLLLLhhhhhhhhhllleeeeelleeellhhhhhhhhhhhEEEEeeeeel
Query ----------aKERSlqgirealdnrrtaayfhelligredllrpffekcVKIEevsrne  266
ident            ||                                               
Sbjct ldgeignfevgKEFD-----------------ailinpkasdspidlfygDFFG------  411
DSSP  lllllllllllLLLL-----------------eeeelllllllllllllhHHHL------


DSSP  leeeeEEEELL--LLLEeeeelllllleellleeeellleeeeeeeeellllllleeeee
Query qgvtlSITNVT--DLVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfe  324
ident          |    | |                                           
Sbjct ----dISEAVIqkFLYL-----------------------------------------gd  426
DSSP  ----lLLLHHHhhHHHH-----------------------------------------ll


DSSP  eeeeeeelleeeeeeeel
Query vtnfivapdkglkytisl  342
ident                   
Sbjct drnieevyvggkqvvpfs  444
DSSP  hhheeeeeelleeeelll


No 29: Query=3e38A Sbjct=1gkpA Z-score=5.6

back to top
DSSP  lllllllllLLLLL-----------------------------------leEEEEELLLL
Query aqrrneiqvPDLDG-----------------------------------ytTLKCDFHXH   25
ident             |                                          | | |
Sbjct pllikngeiITADSrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeEELLEeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  LLL----lLLLLLHHHHHHHHHHLLLLEELLEEELLlllllllllLLLLHHHHHHHHHHh
Query SVF----sDGLVWPTVRVDEAYRDGLDAISLTEHIEyrphkqdvvSDHNRSFDLCREQAe   81
ident                     |   |                                   
Sbjct IYLpfmatFAKDTHETGSKAALMGGTTTYIEMCCPS---rnddalEGYQLWKSKAEGNS-  116
DSSP  LLLeelleELLLLHHHHHHHHHHLLEEEEEEEELLL---llllhhHHHHHHHHHHLLLL-


DSSP  hhLLEELLEEEEE------------------------------LLLLlleeeeelllllh
Query klGILLIKGSEIT------------------------------RAXApghfnaiflsdsn  111
ident                                                             
Sbjct --YCDYTFHMAVSkfdektegqlreivadgissfxiflsyknfFGVD-------------  161
DSSP  --LLEEEEEEELLlllllhhhhhhhhhhlllleeeeeelllllLLLL-------------


DSSP  hhlllLHHHHHHHHHHLLLEEEeLLLLlllLLLL-------------------------L
Query pleqkDYKDAFREAKKQGAFXFwNHPGwdsQQPD-------------------------T  146
ident            | ||  |      |                                   
Sbjct ---dgEMYQTLRLAKELGVIVT-AHCE--nAELVgrlqqkllsegktgpewhepsrpeaV  215
DSSP  ---hhHHHHHHHHHHHHLLEEE-EEEL--lHHHHhhhhhhhhhlllllhhhllllllhhH


DSSP  LLL--LHHHHHHHHLLLLLEEEEEelleELLHHHHHHHHHL-----LEEE----------
Query TKW--WPEHTALYQEGCXHGIEVAnghlYXPEAIQWCLDKN-----LTXI----------  189
ident          | |   |                |                           
Sbjct EAEgtARFATFLETTGATGYVVHL----SCKPALDAAMAAKargvpIYIEsviphflldk  271
DSSP  HHHhhHHHHHHHHHHLLEEEELLL----LLHHHHHHHHHHHhllllEEEEeehhhhhllh


DSSP  ---------------------------------------EELLLLLL-------------
Query ---------------------------------------GTSDIHQP-------------  197
ident                                           |                 
Sbjct tyaerggveamkyimspplrdkrnqkvlwdalaqgfidtVGTDHCPFdteqkllgkeaft  331
DSSP  hhhhllhhhhhlllllllllllhhhhhhhhhhhllllleEELLLLLLlhhhhhhhlllhh


DSSP  ---------hhhhlLHHHLL----------llleEEEE-------ELLLlhhhhhhhhhl
Query ---------iqtdyDFEKGE----------hrtxTFVF-------AKERslqgirealdn  231
ident                                                             
Sbjct aipngipaiedrvnLLYTYGvsrgrldihrfvdaASTKaaklfglFPRK-----------  380
DSSP  hllllllllllhhhHHHHHHlllllllhhhhhhhHLHHhhhhlllLLLL-----------


DSSP  lleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeellLLLEeeeellllll
Query rrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvtDLVLklkktahdtl  291
ident                                                             
Sbjct ---------------------------------gtiavgsdadlvvYDPQyrgtisvktq  407
DSSP  ---------------------------------lllllllllleeeEELLlleellhhhl


DSSP  eellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query lvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                    
Sbjct hvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 30: Query=3e38A Sbjct=1itqA Z-score=5.6

back to top
DSSP  lllllllLLLLllllEEEEEELLLLLLlllLLLL-------------------hhHHHHH
Query aqrrneiQVPDldgyTTLKCDFHXHSVfsdGLVW-------------------ptVRVDE   41
ident                     | |                                     
Sbjct -dffrdeAERI--mrDSPVIDGHNDLP---WQLLdmfnnrlqderanlttlagthTNIPK   54
DSSP  -lhhhhhHHHH--hlLLLEEEEEELHH---HHHHhhhllllllhhhlllllllllLLHHH


DSSP  HHHLLLLEELLEEE------lllLLLLlllllLLLHHHHHHH----HHHH----------
Query AYRDGLDAISLTEH------ieyRPHKqdvvsDHNRSFDLCR----EQAE----------   81
ident                                               |             
Sbjct LRAGFVGGQFWSVYtpcdtqnkdAVRR---tlEQMDVVHRMCrmypETFLyvtssagirq  111
DSSP  HHHLLEEEEEEEELllhhhllllHHHH---hhHHHHHHHHHHhhllLLEEelllhhhhhh


DSSP  ---hHLLEELLEEEEELllllleeeeelllllHHHL------------------------
Query ---kLGILLIKGSEITRaxapghfnaiflsdsNPLE------------------------  114
ident            | |                                              
Sbjct afreGKVASLIGVEGGH--------sidsslgVLRAlyqlgmryltlthscntpwadnwl  163
DSSP  hhhlLLEEEEEEEELHH--------hllllhhHHHHhhhlleeeeellllllllllllhh


DSSP  -------------llLHHHHHHHHHHLLLEEEELLLlllllllllllLLHHHHHHHHLL-
Query -------------qkDYKDAFREAKKQGAFXFWNHPgwdsqqpdttkWWPEHTALYQEG-  160
ident                       |    |      |                  |  |   
Sbjct vdtgdsepqsqglspFGQRVVKELNRLGVLIDLAHV-----------SVATMKATLQLSr  212
DSSP  hlllllllllllllhHHHHHHHHHHHHLLEEELLLL-----------LHHHHHHHHHHLl


DSSP  lLLEEEeeelleELLH-------HHHHHHHHL----LEEE--------------------
Query cXHGIEvanghlYXPE-------AIQWCLDKN----LTXI--------------------  189
ident                             |                               
Sbjct aPVIFS----hsSAYSvcasrrnVPDDVLRLVkqtdSLVMvnfynnyisctnkanlsqva  268
DSSP  lLLEEL----llLLLLlllllllLLHHHHHHHhhhlLEEEelllhhhhlllllllhhhhh


DSSP  ----------------EELLLLLlhhHHLLHhhLLLL---------------------le
Query ----------------GTSDIHQpiqTDYDFekGEHR---------------------tx  212
ident                    |             |                          
Sbjct dhldhikevagaravgFGGDFDG--vPRVPE--GLEDvskypdliaellrrnwteaevkg  324
DSSP  hhhhhhhhhllhhheeELLLLLL--lLLLLL--LLLLlllhhhhhhhhhhllllhhhhhh


DSSP  EEEEellllhhhHHHHHHLlleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeee
Query TFVFakerslqgIREALDNrrtaayfhelligredllrpffekcvkieevsrneqgvtls  272
ident                                                             
Sbjct ALAD--------NLLRVFE-----------------------------------------  335
DSSP  HHLH--------HHHHHHH-----------------------------------------


DSSP  eeellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeel
Query itnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivap  332
ident                                                             
Sbjct ------------------------------------aveqasnltqapeeepipldqlgg  359
DSSP  ------------------------------------hhhhllllllllllllllhhhlll


DSSP  leeeeeeeel
Query dkglkytisl  342
ident           
Sbjct scrthygyss  369
DSSP  llllllllll


No 31: Query=3e38A Sbjct=4qrnA Z-score=5.5

back to top
DSSP  --llLLLL-LLLLllllleEEEEELLLLLLL-----------------------------
Query --aqRRNE-IQVPdldgytTLKCDFHXHSVF-----------------------------   28
ident                     |                                       
Sbjct smtqDLKTgGEQG------YLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaq   54
DSSP  llllLLLLlLLLL------LLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhh


DSSP  ---------lllLLLHH-HHHHHHHHLLLLEELLEEElLLLL------lLLLLlLLLL-H
Query ---------sdgLVWPT-VRVDEAYRDGLDAISLTEHiEYRP------hKQDVvSDHN-R   71
ident             |      |       | |   |                       |  
Sbjct spseratqilerLLDLGeRRIADMDATGIDKAILALTsPGVQplhdldeARTLaTRANdT  114
DSSP  lllhhhhhhhhhHHLLLhHHHHHHHHLLLLEEEEEELlLLLLllllhhhHHHHhHHHHhH


DSSP  HHHHHHHHHhhhlLEELLEE--------------------------EEELLlllleeeee
Query SFDLCREQAeklgILLIKGS--------------------------EITRAxapghfnai  105
ident   | |           |                              |            
Sbjct LADACQKYP----DRFIGMGtvapqdpewsareihrgarelgfkgiQINSH---------  161
DSSP  HHHHHHHLL----LLEEELLllllllhhhhhhhhhhhhhlllllleEELLL---------


DSSP  lllllhhhlllLHHHHHHHHHHLLLEEEEL------------------llllLLLLllll
Query flsdsnpleqkDYKDAFREAKKQGAFXFWN------------------hpgwDSQQpdtt  147
ident                 ||                                          
Sbjct --tqgryldeeFFDPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifGFGVetgm  219
DSSP  --llllllllhHHHHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllHHHHhhhh


DSSP  llLHHH-HHHH---HLLLL-----------------------------------------
Query kwWPEH-TALY---QEGCX-----------------------------------------  162
ident                                                             
Sbjct hlLRLItIGIFdkyPSLQImvghmgealpywlyrldymhqagvrsqryermkplkktieg  279
DSSP  hhHHHHhHLHHhhlLLLLEeelhhhhlhhhhhhhhhhhhhhhhhlllllllllllllhhh


DSSP  -----LEEEeEELLEE---LLHHHHHHHhhllEEEEELLLLLlhhhhllhhhLLLL----
Query -----HGIEvANGHLY---XPEAIQWCLdknlTXIGTSDIHQpiqtdydfekGEHR----  210
ident             |           |             |                     
Sbjct ylksnVLVT-NSGVAWepaIKFCQQVMG--edRVMYAMDYPY-------qyvADEVramd  329
DSSP  hhhhlEEEE-LLLLLLhhhHHHHHHHHL--hhHEELLLLLLL-------lllHHHHhhhh


DSSP  ---------leEEEEellllhhhHHHHHHllleeeeelleeellhhhhhhhhhhheeeee
Query ---------txTFVFakerslqgIREALDnrrtaayfhelligredllrpffekcvkiee  261
ident             |                                               
Sbjct amdmsaqtkkkFFQT-------nAEKWFK-------------------------------  351
DSSP  lllllhhhhhhHHLH-------hHHHHLL-------------------------------


DSSP  eeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeelllllllee
Query vsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdv  321
ident                                                             
Sbjct ------------------------------------------------------------  351
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeeelleeeeeeeel
Query nfevtnfivapdkglkytisl  342
ident                      
Sbjct --------------------l  352
DSSP  --------------------l


No 32: Query=3e38A Sbjct=3k2gB Z-score=5.4

back to top
DSSP  ----------llllllllllllllleeEEEELLLLlLLLL--------------------
Query ----------aqrrneiqvpdldgyttLKCDFHXHsVFSD--------------------   30
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDCrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEELhhhllllllhhhhhhhhlll


DSSP  -------------------LLLLhHHHHHHHHHLL---LLEELLEEELLLLlllllllll
Query -------------------GLVWpTVRVDEAYRDG---LDAISLTEHIEYRphkqdvvsd   68
ident                     |        |           |                  
Sbjct sieilselrqdpfvnkhniALDDlDLAIAEVKQFAavgGRSIVDPTCRGIG---------  111
DSSP  lhhhhhhhhllhhhlllllEELLhHHHHHHHHHHHhllLLEEEELLLLLLL---------


DSSP  llhHHHHHHHHHHHHLLEELLEEEEE----------------------------------
Query hnrSFDLCREQAEKLGILLIKGSEIT----------------------------------   94
ident         |      |     |                                      
Sbjct --rDPVKLRRISAETGVQVVXGAGYYlassxpetaarlsaddiadeivaealegtdgtda  169
DSSP  --lLHHHHHHHHHHHLLEEEELLLLLlhhhllhhhhlllhhhhhhhhhhhhhllllllll


DSSP  ---------lLLLLleeeeelllllhhhllLLHHHHHHHHHHLL----LEEEELLLLLll
Query ---------rAXAPghfnaiflsdsnpleqKDYKDAFREAKKQG----AFXFWNHPGWds  141
ident                                      | |               |||  
Sbjct rigligeigvSSDF---------------tAEEEKSLRGAARAQvrtgLPLXVHLPGW--  212
DSSP  lllleeeellLLLL---------------lHHHHHHHHHHHHHHhhhlLLEEELLLLL--


DSSP  lllllLLLL-HHHHHHHHLLL---lLEEEEEellEELL---hhHHHHHHHLLEEEEE---
Query qqpdtTKWW-PEHTALYQEGC---xHGIEVAnghLYXP---eaIQWCLDKNLTXIGT---  191
ident                   ||                                        
Sbjct -----FRLAhRVLDLVEEEGAdlrhTVLCHX---NPSHxdpvyQATLAQRGAFLEFDxig  264
DSSP  -----LLLHhHHHHHHHHLLLlhhhEEELLL---HHHLllhhhHHHHHHHLLEEEELlll


DSSP  -------------------------------------LLLLLL----hHHHL---lhhHL
Query -------------------------------------SDIHQP----iQTDY---dfeKG  207
ident                                       |                   | 
Sbjct xdffyadqgvqcpsddevarailgladhgyldrillsHDVFVKxxltrYGGNgyafvtKH  324
DSSP  llleelllleelllhhhhhhhhhhhhhlllhhheeelLLLLLHhhlhhHLLLlllhhhHL


DSSP  LL------------lleeEEEEllllhhhhhHHHHLlleeeeelleeellHHHHhhhhhh
Query EH------------rtxtFVFAkerslqgirEALDNrrtaayfhelligrEDLLrpffek  255
ident                    |                                        
Sbjct FLprlrrhglddaaletlXVTN--------pRRVFD------------asIEGH------  358
DSSP  HHhhhhhllllhhhhhhhHLHH--------hHHHHL------------llLLLL------


DSSP  heeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeelll
Query cvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqg  315
ident                                                             
Sbjct ------------------------------------------------------------  358
DSSP  ------------------------------------------------------------


DSSP  lllleeeeeeeeeeeelleeeeeeeel
Query ikggdvnfevtnfivapdkglkytisl  342
ident                            
Sbjct ---------------------------  358
DSSP  ---------------------------


No 33: Query=3e38A Sbjct=3griA Z-score=5.4

back to top
DSSP  llllllllllLLLL-------------------------------------leEEEEELL
Query aqrrneiqvpDLDG-------------------------------------ytTLKCDFH   23
ident            |                                             | |
Sbjct --xklikngkVLQNgelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVH   58
DSSP  --leeeelleEEELleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEE


DSSP  LL-LLLL-llLLLHHHHHHHHHHLLLLEELLEEellLLLLlllllLLLLHHHHHHHHHHH
Query XH-SVFS-dgLVWPTVRVDEAYRDGLDAISLTEhieYRPHkqdvvSDHNRSFDLCREQAE   81
ident  |                  | | |                            |    | 
Sbjct VHlREPGgeyKETIETGTKAAARGGFTTVCPXP---NTRPvpdsvEHFEALQKLIDDNAQ  115
DSSP  ELlLLLLlllLLLHHHHHHHHHHLLEEEEEELL---LLLLllllhHHHHHHHHHHHHHLL


DSSP  hhlLEELLEEEE----------------------------ELLLLlleeeeelllllhhh
Query klgILLIKGSEI----------------------------TRAXApghfnaiflsdsnpl  113
ident            |                                |               
Sbjct ---VRVLPYASIttrqlgkelvdfpalvkegafaftddgvGVQTA---------------  157
DSSP  ---LEELLLEELlhhhlllllllhhhhhlllllleeelllLLLLH---------------


DSSP  lllLHHHHHHHHHHLLLEEEElLLLLllLLLL----------------------LLLL--
Query eqkDYKDAFREAKKQGAFXFWnHPGWdsQQPD----------------------TTKW--  149
ident           || |        |                                     
Sbjct --sXXYEGXIEAAKVNKAIVA-HCED--NSLIyggaxhegkrskelgipgipniCESVqi  212
DSSP  --hHHHHHHHHHHHHLLLEEE-LLLL--HHHLlllleellhhhhhhllleellhHHHHhh


DSSP  LHHHHHHHH-LLLLlEEEEEelleELLHHHHHHHHHL-----LEEE--------------
Query WPEHTALYQ-EGCXhGIEVAnghlYXPEAIQWCLDKN-----LTXI--------------  189
ident                            |      |        |                
Sbjct ARDVLLAEAaGCHY-HVCHV----STKESVRVIRDAKragihVTAEvtphhlllteddip  267
DSSP  HHHHHHHHHhLLLE-EELLL----LLHHHHHHHHHHHhllllEEEEelhhhhhllhhhll


DSSP  --------------------------------EELLLLLL-------------------h
Query --------------------------------GTSDIHQP-------------------i  198
ident                                    |                        
Sbjct gnnaiykxnpplrstedrealleglldgtidcIATDHAPHardekaqpxekapfgivgse  327
DSSP  lllhhhllllllllhhhhhhhhhhhhllllleELLLLLLLlhhhhlllllllllllllll


DSSP  hhhlLHHHLL----------llleEEEEellllhhhhhHHHHLlleeeeelleeellhhh
Query qtdyDFEKGE----------hrtxTFVFakerslqgirEALDNrrtaayfhelligredl  248
ident                                           |                 
Sbjct tafpLLYTHFvkngdwtlqqlvdyLTIK---------pCETFN-----------------  361
DSSP  lhhhHHHHHHlllllllhhhhhhhHLHH---------hHHHLL-----------------


DSSP  hhhhhhhheeeeeeeeelleeeeeeeelLLLLeeeeelllllleellleeeelLLEEeee
Query lrpffekcvkieevsrneqgvtlsitnvTDLVlklkktahdtllvyfrdxtlkPHTRytv  308
ident                              ||                             
Sbjct ------------leygtlkengyadltiIDLD---------------------SEQEikg  388
DSSP  ------------llllllllllllleeeEELL---------------------LLEEllh


DSSP  eeeellllllleeeeeeeeeeeelleeeeeeeel
Query rigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                   
Sbjct edflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  hhllllllllllllleelleeeeeeelleeeeel


No 34: Query=3e38A Sbjct=2y1hB Z-score=5.4

back to top
DSSP  lllllllllllllllEEEEEELLLLLLllLLLLL--HHHHHHHHHHLLLLEELLEEELll
Query aqrrneiqvpdldgyTTLKCDFHXHSVfsDGLVW--PTVRVDEAYRDGLDAISLTEHIey   58
ident                     | | |                  |      |         
Sbjct ---------------GVGLVDCHCHLS--APDFDrdLDDVLEKAKKANVVALVAVAEH--   41
DSSP  ---------------LLLEEEEEELLL--LHHHLllHHHHHHHHHHLLEEEEEELLLL--


DSSP  llllllllLLLLHHHHHHHHHHHhhlLEELLE----------------------------
Query rphkqdvvSDHNRSFDLCREQAEklgILLIKG----------------------------   90
ident         |          |                                        
Sbjct --------SGEFEKIMQLSERYN---GFVLPClgvhpvqgldqrsvtlkdldvalpiien   90
DSSP  --------HHHHHHHHHHHHHLL---LLEEEEelllleelllleellhhhhhhhhhhhhh


DSSP  --------EEEELLLllleeeeelllllhhhllLLHHHHHHHHH-HLLL-----------
Query --------SEITRAXapghfnaiflsdsnpleqKDYKDAFREAK-KQGA-----------  130
ident          |                                ||                
Sbjct ykdrllaiGEVGLDF---sprfagtgeqkeeqrQVLIRQIQLAKrLNLPvnvhsrsagrp  147
DSSP  hllllleeEEEEEEL---lllllllhhhhhhhhHHHHHHHHHHHhHLLLeeeeeellhhh


DSSP  -----------EEEELLLLLllllllLLLLlhhhhhhhhllllLEEEeEELLE-----EL
Query -----------FXFWNHPGWdsqqpdTTKWwpehtalyqegcxHGIEvANGHL-----YX  174
ident                                                             
Sbjct tinllqeqgaeKVLLHAFDG------RPSV-----amegvragYFFS-IPPSIirsgqKQ  195
DSSP  hhhhhhhllllLEEEELLLL------LHHH-----hhhhhhllLEEE-ELHHHhllhhHH


DSSP  LHHHHHHHhhlLEEEEELLLL---llhHHHLlhhhllllleeeeeellllhhhhhhhhhl
Query PEAIQWCLdknLTXIGTSDIH---qpiQTDYdfekgehrtxtfvfakerslqgirealdn  231
ident     |  |          |        |                                
Sbjct KLVKQLPL---TSICLETDSPalgpekQVRN-----------------------------  223
DSSP  HHHHHLLH---HHEEELLLLLllllllLLLL-----------------------------


DSSP  lleeeeellEEELlhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeellllll
Query rrtaayfheLLIGredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtl  291
ident            |                                                
Sbjct epwnisisaEYIA-----------------------------------------------  236
DSSP  lhhhhhhhhHHHH-----------------------------------------------


DSSP  eellleeeellleeeeeeeeellllllleeeeeeeeEEEE--------------lleeee
Query lvyfrdxtlkphtrytvrigfkqgikggdvnfevtnFIVA--------------pdkglk  337
ident                                                             
Sbjct ------------------------------------QVKGisveevievttqnalklfpk  260
DSSP  ------------------------------------HHHLllhhhhhhhhhhhhhhhlll


DSSP  eeeel
Query ytisl  342
ident      
Sbjct lrhll  265
DSSP  hhhhl


No 35: Query=3e38A Sbjct=2imrA Z-score=5.3

back to top
DSSP  -------------------------------------------lllllllLLLLlllleE
Query -------------------------------------------aqrrneiQVPDldgytT   17
ident                                                    |        
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragAVIA-----P   55
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellLEEL-----L


DSSP  EEEELLLLLLLL---------------------lLLLL--HHHHHHHHHHLLLLEELLEE
Query LKCDFHXHSVFS---------------------dGLVW--PTVRVDEAYRDGLDAISLTE   54
ident      | |   |                                 |   | |        
Sbjct PPVNAHTHLDMSayefqalpyfqwipevvirgrhLRGVaaAQAGADTLTRLGAGGVGDIV  115
DSSP  LLLEEEEELLLLhhhhhhlhhhhllhhhhhhhllLLHHhhHHHHHHHHHHLLLLLEEEEE


DSSP  elllllllllllllLLHHHHHHHHHhhhHLLEELLEE-----------------------
Query hieyrphkqdvvsdHNRSFDLCREQaekLGILLIKGS-----------------------   91
ident                    |                                        
Sbjct -------------wAPEVMDALLAR---EDLSGTLYFevlnpfpdkadevfaaarthler  159
DSSP  -------------lLHHHHHHHHLL---LLLLEEEEEeellllhhhhhhhhhhhhhhhhh


DSSP  -------------EEELLLllleeeeelllllhhhlLLLHHHHHHHHHHLLLE-------
Query -------------EITRAXapghfnaiflsdsnpleQKDYKDAFREAKKQGAF-------  131
ident                                               |   |         
Sbjct wrrlerpglrlglSPHTPF--------------tvsHRLMRLLSDYAAGEGLPlqihvae  205
DSSP  hhlllllleeeeeEELLLL--------------lllHHHHHHHHHHHHHHLLLleeeell


DSSP  -------------------------------------------------------EEELL
Query -------------------------------------------------------XFWNH  136
ident                                                            |
Sbjct hptelemfrtgggplwdnrmpalyphtlaevigrepgpdltpvryldelgvlaarPTLVH  265
DSSP  lhhhhhhhhhlllllhhhllhhhllllhhhhhlllllllllhhhhhhhhllhhhlLEEEE


DSSP  LLllllllllLLLLHHHHHHHHLLllLEEEeEELLEE-----lLHHHHHHHHHLLEEEEE
Query PGwdsqqpdtTKWWPEHTALYQEGcxHGIEvANGHLY-----xPEAIQWCLDKNLTXIGT  191
ident                        |                                    
Sbjct MV--------NVTPDDIARVARAG--CAVV-TCPRSNhhlecgTFDWPAFAAAGVEVALG  314
DSSP  LL--------LLLHHHHHHHHHHL--LLEE-ELHHHHhhllllLLLHHHHHHLLLLEEEL


DSSP  LLLLLlhhhhllhhhllLLLE----------------------EEEE------ELLLlhh
Query SDIHQpiqtdydfekgeHRTX----------------------TFVF------AKERslq  223
ident  |                                                          
Sbjct TDSVA---------sgeTLNVreevtfarqlypgldprvlvraAVKGgqrvvgTPFL---  362
DSSP  LLLHH---------hhlLLLLhhhhhhhhhhlllllhhhhhhhHHHHhhhhhlLLLL---


DSSP  hhhhhhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeelLLLLeee
Query girealdnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvTDLVlkl  283
ident                                                             
Sbjct -------------------------------------------rrgetwqegfRWEL---  376
DSSP  -------------------------------------------lllllllhhhLHHH---


DSSP  eelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query kktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                            
Sbjct -------------------------------------------------------srdl  380
DSSP  -------------------------------------------------------llll


No 36: Query=3e38A Sbjct=1j6pA Z-score=5.2

back to top
DSSP  --lllllllllLLLLL--------------------------------lEEEEEELLLLL
Query --aqrrneiqvPDLDG--------------------------------yTTLKCDFHXHS   26
ident             |                                           | | 
Sbjct hhxiignclilKDFSSepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelLLLLLlleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  lllLLLL--------------------------------LHHHHHHHHHHLLLLEELLEE
Query vfsDGLV--------------------------------WPTVRVDEAYRDGLDAISLTE   54
ident                                               |  | |        
Sbjct ---PXTLlrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY  117
DSSP  ---HHHHhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE


DSSP  EllllllllllllLLLHHHHHHHHHHhhhlLEELLEEEEELLlllleeeeelllLLHH--
Query HieyrphkqdvvsDHNRSFDLCREQAeklgILLIKGSEITRAxapghfnaiflsDSNP--  112
ident                       |                                     
Sbjct F------------HEEWIAKAVRDFG----XRALLTRGLVDS---ngddggrleENLKly  158
DSSP  L------------LHHHHHHHHHHHL----LEEEEEEEELLL---llllllhhhHHHHhh


DSSP  ---------------------hllLLHHHHHHHHHHLLLEEEELlLLLLlllLLLLLLLH
Query ---------------------leqKDYKDAFREAKKQGAFXFWNhPGWDsqqPDTTKWWP  151
ident                            |  |  ||   |                     
Sbjct newngfegrifvgfgphspylcseEYLKRVFDTAKSLNAPVTIH-LYET---SKEEYDLE  214
DSSP  hhhllhhhleeeeeeelllllllhHHHHHHHHHHHHHLLLEEEE-ELLL---LLLLLLLH


DSSP  HHH-HHHHlLLLLEEEEeelleELLHhhHHHHHHL---LEEEE-----------------
Query EHT-ALYQeGCXHGIEVanghlYXPEaiQWCLDKN---LTXIG-----------------  190
ident                                                             
Sbjct DILnIGLK-EVKTIAAH----cVHLP-eRYFGVLKdipFFVSHnpasnlklgngiapvqr  268
DSSP  HHHlLLLL-LLLEEEEE----lLLLL-hHHHHHHLlllEEEEElhhhhhhlllllllhhh


DSSP  ----------ELLLLLlhHHHL-------------------lhhhllllleeEEEE-lll
Query ----------TSDIHQpiQTDY-------------------dfekgehrtxtFVFA-ker  220
ident             |                                               
Sbjct xiehgxkvtlGTDGAA--SNNSlnlffexrlasllqkaqnprnldvntclkxVTYDgaqa  326
DSSP  hhhllleeeeLLLLLL--LLLLllhhhhhhhhhhhhhllllllllhhhhhhhHLHHhhhh


DSSP  lHHHHhhhhhllleeeeelleeellhhhhhhhhhhHEEEeeeeeelleeeeeeEELL--L
Query sLQGIrealdnrrtaayfhelligredllrpffekCVKIeevsrneqgvtlsiTNVT--D  278
ident                                                       |     
Sbjct xGFKS----------gkieegwnadlvvidldlpeXFPV--------------QNIKnhL  362
DSSP  hLLLL----------lllllllllleeeeelllhhHLLH--------------HHHHhhH


DSSP  LLEeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeee
Query LVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglky  338
ident                                                             
Sbjct VHA-------------------fsgevfatxvagkwiyfdgeyptidseevkrelariek  403
DSSP  HHL-------------------lllllleeeelleeeeellllllllhhhhhhhhhhhhh


DSSP  eeel
Query tisl  342
ident     
Sbjct elys  407
DSSP  hhhl


No 37: Query=3e38A Sbjct=3cjpA Z-score=5.2

back to top
DSSP  llllllllllllllleeEEEELLLLLLlllllLLHHHHHHHHHHLLLLEELLEEE-----
Query aqrrneiqvpdldgyttLKCDFHXHSVfsdglVWPTVRVDEAYRDGLDAISLTEH-----   55
ident                  |  | | |                    | |   |        
Sbjct -----------------LIIDGHTHVI-----LPVEKHIKIMDEAGVDKTILFSTsihpe   38
DSSP  -----------------LLEEEEEELL-----LLHHHHHHHHHHHLLLEEEEELLlllhh


DSSP  --------------------lllllllllllLLLLHHHHHHHHHHHhhllEELLEEEEEL
Query --------------------ieyrphkqdvvSDHNRSFDLCREQAEklgiLLIKGSEITR   95
ident                                                             
Sbjct tavnlrdvkkemkklndvvngktnsmidvrrNSIKELTNVIQAYPS----RYVGFGNVPV   94
DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHLLL----LEEEEELLLL


DSSP  LlllleeeeelllllhHHLL--------------------llHHHHHHHHH-HLLLEEEE
Query AxapghfnaiflsdsnPLEQ--------------------kdYKDAFREAK-KQGAFXFW  134
ident                   |                        |  |             
Sbjct G-------lsendtnsYIEEnivnnklvgigeltpasgqiksLKPIFKYSMdSGSLPIWI  147
DSSP  L-------llhhhhhhHHHHhllllllleeeeellllllhhhHHHHHHHHHhLLLLLEEE


DSSP  LlLLLLllllllLLLL-HHHHHHHHLL--LLLEEEEeelleeLLHHhHHHHHHL-----L
Query NhPGWDsqqpdtTKWW-PEHTALYQEG--CXHGIEVanghlyXPEAiQWCLDKN-----L  186
ident                   |   |                                    |
Sbjct H-AFNP-----lVLQDiKEIAELCKAFpkVPVILGH----mgGSNW-MTAVELAkeiqnL  196
DSSP  L-LLLL-----lLHHHhHHHHHHHHHLllLLEEEHH----hhHHHH-HHHHHHHhhlllE


DSSP  EEEE----------------------ELLLLLlhhhhllhhhlLLLLeeeeeellllhhh
Query TXIG----------------------TSDIHQpiqtdydfekgEHRTxtfvfakerslqg  224
ident                             |                               
Sbjct YLDTsayfstfvlkivinelplkcifGTDMPF--------gdlQLSI-------------  235
DSSP  EEELlllllhhhhhhhhhhlllleelLLLLLL--------llhHHHH-------------


DSSP  hhhhhhllleeeeELLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeelLLLLeeee
Query irealdnrrtaayFHELLigredllrpffekcvkieevsrneqgvtlsitnvTDLVlklk  284
ident                                                        |    
Sbjct -----------eaIKKMS---------------------------------nDSYV----  247
DSSP  -----------hhHHHHL---------------------------------lLHHH----


DSSP  elllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query ktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                           
Sbjct -------------------------------------------anavlgdnisrllni  262
DSSP  -------------------------------------------hhhhhlhhhhhhhll


No 38: Query=3e38A Sbjct=2ob3A Z-score=5.2

back to top
DSSP  llllllllllllllleeEEEELLLLLLLL----------------lllllhHHHHHHHHH
Query aqrrneiqvpdldgyttLKCDFHXHSVFS----------------dglvwpTVRVDEAYR   44
ident                       | |   |                            |  
Sbjct --drintvrgpitiseaGFTLTHEHICGSsagflrawpeffgsrkalaekaVRGLRRARA   58
DSSP  --lleeelleeelhhhhLLEEEEELLEELlllhhhhlhhhhllhhhhhhhhHHHHHHHHH


DSSP  LLLLEELLEEElllllllllllllLLHHhHHHHHHHHHHLLEELLEEEEEL---------
Query DGLDAISLTEHieyrphkqdvvsdHNRSfDLCREQAEKLGILLIKGSEITR---------   95
ident  |   |                        |  |                          
Sbjct AGVRTIVDVST----------fdiGRDV-SLLAEVSRAADVHIVAATGLWFdpplsmrlr  107
DSSP  LLLLEEEELLL----------hhhLLLH-HHHHHHHHHHLLEEELEEELLLlllhhhhll


DSSP  -------------------------------LLLLleeeeelllllhhhllLLHHHHHHH
Query -------------------------------AXAPghfnaiflsdsnpleqKDYKDAFRE  124
ident                                                             
Sbjct sveeltqfflreiqygiedtgiragiixvatTGKA---------------tPFQELVLKA  152
DSSP  lhhhhhhhhhhhhhllllllllllleeeeelLLLL---------------lHHHHHHHHH


DSSP  HHHLL----LEEEELLLLllllllllLLLLhhHHHHHHLL-------llLEEEEeelleE
Query AKKQG----AFXFWNHPGwdsqqpdtTKWWpeHTALYQEG-------cxHGIEVanghlY  173
ident |                                                  |        
Sbjct AARASlatgVPVTTHTAA--------SQRD--GEQQAAIFeseglspsrVCIGH----sD  198
DSSP  HHHHHhhhlLLEEEELLH--------HHLH--HHHHHHHHhhllllhhhEEELL----hH


DSSP  LLH---hHHHHHHHLLEEE-----------------------------------------
Query XPE---aIQWCLDKNLTXI-----------------------------------------  189
ident                                                             
Sbjct DTDdlsyLTALAARGYLIGldhipysaiglednasasallgirswqtrallikalidqgy  258
DSSP  HLLlhhhHHHHHHLLLEEEelllllllllllllhhhhhhhllllhhhhhhhhhhhhhlll


DSSP  -----EELLLLL-----------lhHHHLLHhhllLLLE-------------------eE
Query -----GTSDIHQ-----------piQTDYDFekgeHRTX-------------------tF  214
ident         |                                                   
Sbjct mkqilVSNDWTFgfssyvtnimdvmDRVNPD--gmAFIPlrvipflrekgvpqetlagiT  316
DSSP  hhheeELLLLLLeellllllhhhhhHHHLLL--hhHHHHhlhhhhhhhllllhhhhhhhH


DSSP  EEEllllhhhhHHHHHllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeee
Query VFAkerslqgiREALDnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsit  274
ident |                                                           
Sbjct VTN--------PARFL--------------------------------------------  324
DSSP  LHH--------HHHHH--------------------------------------------


DSSP  ellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelle
Query nvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdk  334
ident                                                             
Sbjct ------------------------------------------------------------  324
DSSP  ------------------------------------------------------------


DSSP  eeeeeeel
Query glkytisl  342
ident         
Sbjct ---sptlr  329
DSSP  ---lllll


No 39: Query=3e38A Sbjct=1bf6A Z-score=5.1

back to top
DSSP  lllllllllllllllEEEEEELLLLlLLLL--------LLLLHH-HHHHHHHHLL---LL
Query aqrrneiqvpdldgyTTLKCDFHXHsVFSD--------GLVWPT-VRVDEAYRDG---LD   48
ident                 |     | |                        |          
Sbjct ------------sfdPTGYTLAHEHlHIDLsgfknnvdCRLDQYaFICQEMNDLMtrgVR   48
DSSP  ------------lllLLLEEEEEELlLEELhhhhllhhHEELLHhHHHHHHHHHHhllEE


DSSP  EELLEEELLLllllllllllllhHHHHHHHHHHHHLLEELLEEEEELL------------
Query AISLTEHIEYrphkqdvvsdhnrSFDLCREQAEKLGILLIKGSEITRA------------   96
ident                                    ||                       
Sbjct NVIEMTNRYM-----------grNAQFMLDVMRETGINVVACTGYYQDaffpehvatrsv   97
DSSP  EEEELLLHHH-----------llLHHHHHHHHHHHLLEEEEEELLLLHhhlllhhhhllh


DSSP  --------------------------------lLLLEeeeelllllhhhlllLHHHHHHH
Query --------------------------------xAPGHfnaiflsdsnpleqkDYKDAFRE  124
ident                                                          |  
Sbjct qelaqemvdeieqgidgtelkagiiaeigtsegKITP---------------LEEKVFIA  142
DSSP  hhhhhhhhhhhhllllllllleeeeeeeellllLLLH---------------HHHHHHHH


DSSP  HHHLL----LEEEELLLLLlllllllllllHHHHHHHHLLL---lLEEEEEellEELLH-
Query AKKQG----AFXFWNHPGWdsqqpdttkwwPEHTALYQEGC---xHGIEVAnghLYXPE-  176
ident |                                  |   |                    
Sbjct AALAHnqtgRPISTHTSFS-------tmglEQLALLQAHGVdlsrVTVGHC---DLKDNl  192
DSSP  HHHHHhhhlLLEEEELHHH-------llhhHHHHHHHHLLLlhhhEEELLL---LLLLLh


DSSP  -hHHHHHHHLLEEE--------------------------------EELLLL-LLHH---
Query -aIQWCLDKNLTXI--------------------------------GTSDIH-QPIQ---  199
ident   |    |                                         ||         
Sbjct dnILKMIDLGAYVQfdtigknsyypdekriamlhalrdrgllnrvmLSMDITrRSHLkan  252
DSSP  hhHHHHHHLLLEEEellllllllllhhhhhhhhhhhhhlllhhheeELLLLLlHHHLhhh


DSSP  ---hhllhhHLLL------------lleEEEEellllhhhHHHHHhllleeeeelleeel
Query ---tdydfeKGEH------------rtxTFVFakerslqgIREALdnrrtaayfhellig  244
ident                                                             
Sbjct ggygydyllTTFIpqlrqsgfsqadvdvMLRE-------nPSQFF---------------  290
DSSP  llllllhhhHLHHhhhhhllllhhhhhhHHLH-------hHHHHL---------------


DSSP  lhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellle
Query redllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkpht  304
ident                                                             
Sbjct ------------------------------------------------------------  290
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query rytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                       
Sbjct -------------------------------------q  291
DSSP  -------------------------------------l


No 40: Query=3e38A Sbjct=3e74A Z-score=4.9

back to top
DSSP  -lllllllllLLLLL----------------------------------lEEEEEELLLL
Query -aqrrneiqvPDLDG----------------------------------yTTLKCDFHXH   25
ident             |                                          | | |
Sbjct sfdliikngtVILENearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
DSSP  leeeeeelleEELLLleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL


DSSP  LlllllllLHHHHHHHHHHLLLLEELLEEEllLLLLlllllLLLLHHHH-HHHHHHhhhL
Query SvfsdglvWPTVRVDEAYRDGLDAISLTEHieYRPHkqdvvSDHNRSFD-LCREQAeklG   84
ident                 |   |                                       
Sbjct I-------GYETGTRAAAKGGITTXIEXPL--NQLP-atvdRASIELKFdAAKGKL---T  107
DSSP  L-------LHHHHHHHHHHLLEEEEEELLL--LLLL-llllHHHHHHHHhHHLLLL---L


DSSP  LEELLEEEEE-----------------------LLLLlleeeeelllllhhhlllLHHHH
Query ILLIKGSEIT-----------------------RAXApghfnaiflsdsnpleqkDYKDA  121
ident |                                                           
Sbjct IDAAQLGGLVsynidrlheldevgvvgfxcfvrDVND-----------------wQFFKG  150
DSSP  LEEEELEELLllllllhhhhhhhlllleeeellLLLH-----------------hHHHHH


DSSP  HHHHHHLLLEEEElLLLLllLLLL-------------------------LLLL--LHHHH
Query FREAKKQGAFXFWnHPGWdsQQPD-------------------------TTKW--WPEHT  154
ident        |      |                                  |          
Sbjct AQKLGELGQPVLV-HCEN--ALICdelgeeakregrvtahdyvasrpvfTEVEaiRRVLY  207
DSSP  HHHHHHHLLLEEE-ELLL--HHHHhhhhhhhhhhllllhhhhhhlllhhHHHHhhHHHHH


DSSP  HHHHLLLLLEEEEEelleELLHHHHHHHHHL-----LEEE--------------------
Query ALYQEGCXHGIEVAnghlYXPEAIQWCLDKN-----LTXI--------------------  189
ident      ||             ||               |                      
Sbjct LAKVAGCRLHVCHV----SSPEGVEEVTRARqegqdITCEscphyfvldtdqfeeigtla  263
DSSP  HHHHHLLLEEELLL----LLHHHHHHHHHHHhllllEEEEellhhhhllhhhhhhhlhhh


DSSP  --------------------------EELLLLLL------------hhHHLL--------
Query --------------------------GTSDIHQP------------iqTDYD--------  203
ident                             ||                              
Sbjct kcsppirdlenqkgxweklfngeidcLVSDHSPCppexkagnixkawgGIAGlqscxdvx  323
DSSP  llllllllhhhhhhhhhhhhllllleELLLLLLLllllllllllllllLLLLhhhhhhhh


DSSP  ---------hhhllllleEEEE-ellllHHHHhhhhhllleeeeelleeellhhhhhhhh
Query ---------fekgehrtxTFVF-akersLQGIrealdnrrtaayfhelligredllrpff  253
ident                             ||                              
Sbjct fdeavqkrgxslpxfgklXATNaadifgLQQK----------------------------  355
DSSP  hhhhlllllllhhhhhhhHLHHhhhhllLLLL----------------------------


DSSP  hhheeeeeeeeelleeeeeeeellLLLEeeeelllllleellleeeELLL----------
Query ekcvkieevsrneqgvtlsitnvtDLVLklkktahdtllvyfrdxtLKPH----------  303
ident                                                             
Sbjct -----------griapgkdadfvfIQPN------------------SSYVltnddleyrh  386
DSSP  -----------lllllllllleeeEELL------------------LLEEllhhhlllll


DSSP  ----eeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query ----trytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                            
Sbjct kvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  lllllllleelleeeeeeelleeeeelllllllllllleelll


No 41: Query=3e38A Sbjct=4rdvB Z-score=4.9

back to top
DSSP  llllllllllLLLLL----------------------------------EEEEEELLLLL
Query aqrrneiqvpDLDGY----------------------------------TTLKCDFHXHS   26
ident            |                                            | | 
Sbjct --saifaeraLLPEGwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHA   58
DSSP  --leeeeeeeEELLEeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELH


DSSP  lllLLLL------------------------------------LHHHHHHHHHHLLLLEE
Query vfsDGLV------------------------------------WPTVRVDEAYRDGLDAI   50
ident                                                   |    |  | 
Sbjct ---FQRAmaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYTAV  115
DSSP  ---HHHHhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEEEE


DSSP  LLEEEllLLLLLL----llLLLLLH-HHHHHHHHHhhhlLEELLEEEEELL---------
Query SLTEHieYRPHKQ----dvVSDHNR-SFDLCREQAeklgILLIKGSEITRA---------   96
ident                                        | |                  
Sbjct AEFHY--VHHDLDgrsyadPAELSLrISRAASAAG----IGLTLLPVLYSHagfggqpas  169
DSSP  EEEEL--LLLLLLllllllLLHHHHhHHHHHHHHL----LEEEEEELLLLEeellleell


DSSP  ---------------------lllleeeeELLL---llhhhllLLHHHHHHHhhHLLLEE
Query ---------------------xapghfnaIFLS---dsnpleqKDYKDAFREakKQGAFX  132
ident                                                             
Sbjct egqrrfingseaylellqrlrapleaaghSLGLcfhslravtpQQIATVLAA-gHDDLPV  228
DSSP  hhhllllllhhhhhhhhhhhhhhhhhhllEELEeelllllllhHHHHHHHLL-lLLLLLE


DSSP  EELlLLLLllLLLL---------lLLLHHH-HHHHhLLLL--------------------
Query FWNhPGWDsqQPDT---------tKWWPEH-TALYqEGCX--------------------  162
ident           |                                                 
Sbjct HIH-IAEQ--QKEVddcqawsgrrPLQWLYeNVAV-DQRWclvhathadpaevaamarsg  284
DSSP  EEE-ELLL--HHHHhhhhhhhlllHHHHHHhHLLL-LLLEeeeelllllhhhhhhhhhhl


DSSP  LEEEeEELLEE-----lLHHHHhHHHHLLEEEEELLLLLlhhhhllhhhllllleeeeee
Query HGIEvANGHLY-----xPEAIQwCLDKNLTXIGTSDIHQpiqtdydfekgehrtxtfvfa  217
ident                         |         || |                      
Sbjct AVAG-LCLSTEanlgdgIFPATdFLAQGGRLGIGSDSHV---------------------  322
DSSP  LEEE-ELHHHHhhllllLLLHHhHHHLLLEEEELLLLLL---------------------


DSSP  llllhhhhhhhhhllleeeeELLEE-----------eLLHHHHHH---------------
Query kerslqgirealdnrrtaayFHELL-----------iGREDLLRP---------------  251
ident                        |                |                   
Sbjct -------------slsvveeLRWLEygqrlrdrkrnrLYRDDQPMigrtlydaalaggaq  369
DSSP  -------------lllhhhhHHHHHhhhhhhhlllllLLLLLLLLhhhhhhhhhhhhhhh


DSSP  -----------------------------hhHHHEeeeeeeeelleeeeeeeelLLLLEe
Query -----------------------------ffEKCVkieevsrneqgvtlsitnvTDLVLk  282
ident                                                         |   
Sbjct algqpigslavgrradllvldgndpylasaeGDAL-----------------lnRWLFA-  411
DSSP  hhlllllllllllllleeeellllhhhhlllLHHH-----------------hhHHHHH-


DSSP  eeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query lkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                             
Sbjct --------------------ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  --------------------llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 42: Query=3e38A Sbjct=3mkvA Z-score=4.8

back to top
DSSP  ---llllllllLLLLL-------------------------------------llEEEEE
Query ---aqrrneiqVPDLD-------------------------------------gyTTLKC   20
ident                                                             
Sbjct lttflfrngalLDPDHpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeeLLLLLllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  ELLLLLllllLLLL-----------------hHHHHHHHHHLLLLEELLEEellllllll
Query DFHXHSvfsdGLVW-----------------pTVRVDEAYRDGLDAISLTEhieyrphkq   63
ident | | |                                   | |                 
Sbjct DLHVHV----VAIEfnlprvatlpnvlvtlraVPIMRAMLRRGFTTVRDAG---------  107
DSSP  EEEELL----LLLLllhhhhllllhhhhhhhhHHHHHHHHHLLEEEEEELL---------


DSSP  lllllllhHHHHHHHHHH---HHLLEELLE------------------------------
Query dvvsdhnrSFDLCREQAE---KLGILLIKG------------------------------   90
ident                  |     |  |                                 
Sbjct -------gAGYPFKQAVEsglVEGPRLFVSgralsqtgghadprarsdymppdspcgccv  160
DSSP  -------lLLHHHHHHHHlllLLLLEEEELlleeelllllllllllllllllllllllll


DSSP  -----------------------------EEEELLLllleeeeelllllhhhlLLLHHHH
Query -----------------------------SEITRAXapghfnaiflsdsnpleQKDYKDA  121
ident                                |                            
Sbjct rvgalgrvadgvdevrravreelqmgadqIXIMASG--gvasptdpvgvfgysEDEIRAI  218
DSSP  llllleeelllhhhhhhhhhhhhhhllllEEEELLL--lllllllllllllllHHHHHHH


DSSP  HHHHHHLLLE-------------------EEELLLLllllllllLLLLhhhhhhHHLLll
Query FREAKKQGAF-------------------XFWNHPGwdsqqpdtTKWWpehtalYQEGcx  162
ident   ||   |                         |                       |  
Sbjct VAEAQGRGTYvlahaytpaaiaravrcgvRTIEHGN-------lIDDE-tarlvAEHG--  268
DSSP  HHHHHLLLLLeeeeellhhhhhhhhhlllLEEEELL-------lLLHH-hhhhhHHHL--


DSSP  LEEEeEELL--------------------------eeLLHHHHHHHHHLLEEEEELLLLL
Query HGIEvANGH--------------------------lyXPEAIQWCLDKNLTXIGTSDIHQ  196
ident                                          |              |   
Sbjct AYVV-PTLVtydalasegekyglppesiakiadvhgaGLHSIEIMKRAGVKMGFGTDLLG  327
DSSP  LEEE-LLHHhhhhhhhhlllllllhhhhllhhhhhllHHHHHHHHHHHLLLLLLLLLLLH


DSSP  -LHHH--------hllhhhllllleEEEEellllhhhHHHHhhllleeeeelleeellhh
Query -PIQT--------dydfekgehrtxTFVFakerslqgIREAldnrrtaayfhelligred  247
ident                                                             
Sbjct eAQRLqsdefrilaevlspaeviasATIV----saevLGMQ-------------------  364
DSSP  hHHHHllhhhhhhhllllhhhhhhhLLHH----hhhhLLLL-------------------


DSSP  hhhhhhhhheeeeeeeeelleeeeeeeeLLLLLEeeeelllllleellleeeellleeee
Query llrpffekcvkieevsrneqgvtlsitnVTDLVLklkktahdtllvyfrdxtlkphtryt  307
ident                                |                            
Sbjct ----------dklgrivpgahadvlvvdGNPLKS--------------------------  388
DSSP  ----------llllllllllllleeeelLLLLLL--------------------------


DSSP  eeeeellllllleeeeeeeeeeeelleeeeeeeel
Query vrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                    
Sbjct ---------vdcllgqgehiplvmkdgrlfvnele  414
DSSP  ---------lllllllllllleeeelleeeeelll


No 43: Query=3e38A Sbjct=3giqA Z-score=4.7

back to top
DSSP  ----lllllllllLLLLL-----------------------------------lEEEEEE
Query ----aqrrneiqvPDLDG-----------------------------------yTTLKCD   21
ident                                                            |
Sbjct ekldfkitggwiiDGTGAprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelLLLLLlleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  LLLLLlllllllLHHH---hHHHHHHLLLLEELLE-------------eelLLLL-llll
Query FHXHSvfsdglvWPTV---rVDEAYRDGLDAISLT-------------ehiEYRP-hkqd   64
ident  | |           |           |                                
Sbjct VHGHD------dLMFVekpdLRWKTSQGITTVVVGncgvsaapaplpgntaAALAllget  114
DSSP  LLLLL------lLHHHhlllLHHHHLLLEEEEEELllllllllllllllllHHHHhhlll


DSSP  LLLLLL-HHHHHHH-HHHHhhlLEELLEEEEE----------------------------
Query VVSDHN-RSFDLCR-EQAEklgILLIKGSEIT----------------------------   94
ident          |            |                                     
Sbjct PLFADVpAYFAALDaQRPM---INVAALVGHAnlrlaamrdpqaaptaaeqqamqdmlqa  171
DSSP  LLLLLHhHHHHHHHhLLLL---LEEEEEEEHHhhhhhhlllllllllhhhhhhhhhhhhh


DSSP  -----------------LLLLlleeeeelllllhhhlllLHHHHHHHHHHLLLEEEELLL
Query -----------------RAXApghfnaiflsdsnpleqkDYKDAFREAKKQGAFXFWNHP  137
ident                   | |                        | |            
Sbjct aleagavgfstglayqpGAVA---------------qaaELEGLARVAAERRRLHTSHIR  216
DSSP  hhhhllleeeeelllllHHHL---------------lhhHHHHHHHHHHHLLLEEEEELL


DSSP  LLLllllLLLLL--LHHHHHHHHLLLLLEEEEE-----elleellHHHHHHHHHL-----
Query GWDsqqpDTTKW--WPEHTALYQEGCXHGIEVA-----nghlyxpEAIQWCLDKN-----  185
ident        |                ||                                  
Sbjct NEA----DGVEAavEEVLAIGRGTGCATVVSHHkcmmpqnwgrsrATLANIDRAReqgve  272
DSSP  LLL----LLHHHhhHHHHHHHHHHLLEEEELLLllllhhhlllhhHHHHHHHHHHhllll


DSSP  LEEEE-------------------------------------------------------
Query LTXIG-------------------------------------------------------  190
ident                                                             
Sbjct VALDIypypgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrl  332
DSSP  EEEEElllleeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhh


DSSP  --------------------------ELLLLLL-hHHHLlhhhlLLLL------------
Query --------------------------TSDIHQP-iQTDYdfekgEHRT------------  211
ident                            ||                               
Sbjct apagaiyfamdedevkrifqhpccmvGSDGLPNdaRPHP---rlWGSFtrvlgryvrear  389
DSSP  lleeeeeelllhhhhhhhhhllleeeLLLLLLLllLLLL---hhHHHHhhhhhhhhhhll


DSSP  --------eeEEEE--llllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeee
Query --------xtFVFA--kersLQGIrealdnrrtaayfhelligredllrpffekcvkiee  261
ident                                                             
Sbjct lmtleqavarMTALparvfgFAER----------------------------------gv  415
DSSP  lllhhhhhhhHLHHhhhhhlLLLL----------------------------------ll


DSSP  eeeelleeeeeeeELLLLleeeeelllllleellleeeellleeeeeeeeelllllllee
Query vsrneqgvtlsitNVTDLvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdv  321
ident                |                                            
Sbjct lqpgawadvvvfdPDTVA---------------------dratwdeptlasvgiagvlvn  454
DSSP  lllllllleeeelLLLLL---------------------lllllllllllllleeeeeel


DSSP  eeeeeeeeeelleeeeeeeel
Query nfevtnfivapdkglkytisl  342
ident                      
Sbjct gaevfpqppadgrpgqvlrax  475
DSSP  leeeellllllllllllllll


No 44: Query=3e38A Sbjct=4ofcA Z-score=4.7

back to top
DSSP  llllllllllllllleeeEEELLLLLLL--------------------------------
Query aqrrneiqvpdldgyttlKCDFHXHSVF--------------------------------   28
ident                   | | | |                                   
Sbjct -----------------mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdg   43
DSSP  -----------------lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeell


DSSP  ------lllLLLHHHHHHHHHHLLLLEELLEEELLLLL------lLLLLLLLLL-HHHHH
Query ------sdgLVWPTVRVDEAYRDGLDAISLTEHIEYRP------hKQDVVSDHN-RSFDL   75
ident             | ||  |    |     |                       |      
Sbjct kvfrvvrenCWDPEVRIREMDQKGVTVQALSTVPVMFSywakpedTLNLCQLLNnDLAST  103
DSSP  eeeeeeehhHLLHHHHHHHHHHHLLLEEEEELLHHHHLllllhhhHHHHHHHHHhHHHHH


DSSP  HHHHHhhhlLEELLE--------------------------eEEELLlllleeeeellll
Query CREQAeklgILLIKG--------------------------sEITRAxapghfnaiflsd  109
ident                                            |                
Sbjct VVSYP----RRFVGLgtlpmqapelavkemercvkelgfpgvQIGTH-----------vn  148
DSSP  HHHLL----LLEEEEellllllhhhhhhhhhhhhhllllleeEEELE-----------el


DSSP  lhhhlllLHHHHHHHHH-HLLL--------------------------------------
Query snpleqkDYKDAFREAK-KQGA--------------------------------------  130
ident                |                                            
Sbjct ewdlnaqELFPVYAAAErLKCSlfvhpwdmqmdgrmakywlpwlvgmpaettiaicsmim  208
DSSP  leelllhHHHHHHHHHHhHLLEeeeelllllllhhhhlllhhhhlhhhhhhhhhhhhhhl


DSSP  ----------EEEELLLLLLllllllLLLL----------------hhhhhhhhllllLE
Query ----------FXFWNHPGWDsqqpdtTKWW----------------pehtalyqegcxHG  164
ident                | |                                          
Sbjct ggvfekfpklKVCFAHGGGA-----fPFTVgrishgfsmrpdlcaqdnpmnpkkylgsFY  263
DSSP  llhhhhllllLEEELHHHLL-----hHHHHhhhhhhhhhlhhhhlllllllhhhhlllLE


DSSP  EEeEELLEE--LLHHHHHHHhhlLEEEEELLLLLlhhhhllhhhlLLLL-----------
Query IEvANGHLY--XPEAIQWCLdknLTXIGTSDIHQpiqtdydfekgEHRT-----------  211
ident    |  |                   |   |                             
Sbjct TD-ALVHDPlsLKLLTDVIG--kDKVILGTDYPF-------plgeLEPGkliesmeefde  313
DSSP  EE-LLLLLHhhHHHHHHHHL--lLLEELLLLLLL-------llllLLLLhhhhhlllllh


DSSP  -----eEEEE------eLLLLHhhhhhhhhllleeeeelleeellhhhhhhhhhhheeee
Query -----xTFVF------aKERSLqgirealdnrrtaayfhelligredllrpffekcvkie  260
ident                                                             
Sbjct etknklKAGNalaflglERKQF--------------------------------------  335
DSSP  hhhhhhHLHHhhhhhllLHHHL--------------------------------------


DSSP  eeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllle
Query evsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggd  320
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeeeelleeeeeeeel
Query vnfevtnfivapdkglkytisl  342
ident                       
Sbjct ----------------------  335
DSSP  ----------------------


No 45: Query=3e38A Sbjct=4c5yA Z-score=4.7

back to top
DSSP  -----llllllllLLLLLL---------------------------------------lE
Query -----aqrrneiqVPDLDG---------------------------------------yT   16
ident               |                                             
Sbjct deakvtiiyagllIPGDGEplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeeLLLLLLleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  EEEEELLLLLL----------------llllllLHHHHHHHHHHLLLLEELLEEelllll
Query TLKCDFHXHSV----------------fsdglvWPTVRVDEAYRDGLDAISLTEhieyrp   60
ident     | | |                               ||   |              
Sbjct PGLWDCHMHFGgdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLA------  114
DSSP  ELEEEEEELLLlllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL------


DSSP  llllllllllhHHHHHHHHHH---HHLLEELLE---------------------------
Query hkqdvvsdhnrSFDLCREQAE---KLGILLIKG---------------------------   90
ident                           |                                 
Sbjct ----------gYGCEVAKAINdgtIVGPNVYSSgaalsqtaghgdifalpagevlgsygv  164
DSSP  ----------lLHHHHHHHHHlllLLLLEEEELlleeellllllllllllhhhhhhhhll


DSSP  ------------------------------------eEEELLLllleeeeelllllhhhl
Query ------------------------------------sEITRAXapghfnaiflsdsnple  114
ident                                                             
Sbjct mnprpgywgagplciadgveevrravrlqirrgakviXVMASG--gvmsrddnpnfaqfs  222
DSSP  lllllllllllleeelllhhhhhhhhhhhhhhlllleEEELLL--lllllllllllllll


DSSP  LLLHHHHHHHHHHLLLE-------------------EEELLLLlllllllLLLLLhhhhh
Query QKDYKDAFREAKKQGAF-------------------XFWNHPGwdsqqpdTTKWWpehta  155
ident     |    ||  |                          |                   
Sbjct PEELKVIVEEAARQNRIvsahvhgkagimaaikagcKSLEHVS-------YADEE---vw  272
DSSP  HHHHHHHHHHHHHLLLLeeeeellhhhhhhhhhhllLEEEELL-------LLLHH---hh


DSSP  hhhlllLLEEEeEELLE-----------------------------eLLHHHHHHhhhlL
Query lyqegcXHGIEvANGHL-----------------------------yXPEAIQWCldknL  186
ident             |                                     ||        
Sbjct elmkekGILYV-ATRSVieiflasngeglvkeswaklqaladshlkaYQGAIKAG----V  327
DSSP  hhhhhhLLEEE-LLHHHhhhhhhhllllllllhhhlllhhhhhhhhhHHHHHHLL----L


DSSP  EEEEELLLLllhhhhllhhhllLLLE-----------------EEEE---ellllHHHHh
Query TXIGTSDIHqpiqtdydfekgeHRTX-----------------TFVF---akersLQGIr  226
ident |     |                                                     
Sbjct TIALGTDTA--------pggptALELqfaverggmtpleaikaATANaplsvgpqAPLT-  378
DSSP  LEELLLLLL--------lllllHHHHhhhhhlllllhhhhhhhHLLLhhhhhhhhLLLL-


DSSP  hhhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeeLLLLLEeeeel
Query ealdnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnVTDLVLklkkt  286
ident                                                     |       
Sbjct ----------------------------------gqlregyeadvialeENPLED-----  399
DSSP  ----------------------------------lllllllllleeeelLLLLLL-----


DSSP  llllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query ahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                         
Sbjct -------------------ikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  -------------------hhhhhlhhheeeeeelleeeellllllllllllllll


No 46: Query=3e38A Sbjct=2dvtA Z-score=4.6

back to top
DSSP  llllllllllllllleeEEEELLLLLLL-------------------lllLLLHH-HHHH
Query aqrrneiqvpdldgyttLKCDFHXHSVF-------------------sdgLVWPT-VRVD   40
ident                   |     |                         |      |  
Sbjct ---------------mqGKVALEEHFAIpetlqdsagfvpgdywkelqhrLLDIQdTRLK   45
DSSP  ---------------llLEEEEEEEELLhhhhhhhlllllllhhhhhhhhHHLLLlHHHH


DSSP  HHHHLLLLEELLEEELLLL------lllllllLLLL-HHHHHHHHHHHhhllEELLEeee
Query EAYRDGLDAISLTEHIEYR------phkqdvvSDHN-RSFDLCREQAEklgiLLIKGsei   93
ident      |     |                       |      |                 
Sbjct LMDAHGIETMILSLNAPAVqaipdrrkaieiaRRANdVLAEECAKRPD----RFLAF---   98
DSSP  HHHHLLEEEEEEEELLLHHhhlllhhhhhhhhHHHHhHHHHHHHHLLL----LEEEE---


DSSP  elllllleeeeelllLLHH----------------------------------hllLLHH
Query traxapghfnaiflsDSNP----------------------------------leqKDYK  119
ident                   |                                       | 
Sbjct ---------------AALPlqdpdaateelqrcvndlgfvgalvngfsqegdgqtpLYYD  143
DSSP  ---------------ELLLlllhhhhhhhhhhhhhllllleeeeelllllllllllLLLL


DSSP  -----hhhHHHHHLLLE-------------------------------------------
Query -----dafREAKKQGAF-------------------------------------------  131
ident          |  |                                               
Sbjct lpqyrpfwGEVEKLDVPfylhprnplpqdsriydghpwllgptwafaqetavhalrlmas  203
DSSP  lhhhhhhhHHHHHHLLLeeeelllllhhhlhhhlllhhhlhhhlhhhhhhhhhhhhhhhl


DSSP  ----------EEEL-LLLLlllllllLLLL-------------------HHHHHHHHlll
Query ----------XFWN-HPGWdsqqpdtTKWW-------------------PEHTALYQegc  161
ident                              |                              
Sbjct glfdehprlnIILGhMGEG-----lpYMMWridhrnawvklpprypakrRFMDYFNE---  255
DSSP  lhhhhlllllEEELhHHLL-----hhHHHHhhhhlllllllllllllllLHHHHHHH---


DSSP  LLEEEeEELLEE---LLHHHHHHHhhlLEEEEELLLLLlhhhhllhhhllLLLEeeeeel
Query XHGIEvANGHLY---XPEAIQWCLdknLTXIGTSDIHQpiqtdydfekgeHRTXtfvfak  218
ident    |    |         ||              |                         
Sbjct NFHIT-TSGNFRtqtLIDAILEIG--aDRILFSTDWPF---------eniDHAS------  297
DSSP  HEEEE-LLLLLLhhhHHHHHLLLL--hHHEELLLLLLL---------llhHHHH------


DSSP  lllhhhhhhhhhllleeeEELLEeellhhhhhhhhhhheeeeeeeeelleeeeeeeelll
Query erslqgirealdnrrtaaYFHELligredllrpffekcvkieevsrneqgvtlsitnvtd  278
ident                    |                                        
Sbjct -----------------dWFNAT-------------------------------------  303
DSSP  -----------------hHHHHL-------------------------------------


DSSP  lleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeEEEE------el
Query lvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtNFIV------ap  332
ident                                                             
Sbjct ------------------------------------------------SIAEadrvkigr  315
DSSP  ------------------------------------------------LLLHhhhhhhhl


DSSP  leeeeeeeel
Query dkglkytisl  342
ident           
Sbjct tnarrlfkld  325
DSSP  hhhhhhllll


No 47: Query=3e38A Sbjct=4b3zD Z-score=4.5

back to top
DSSP  -lllllllllLLLLL-----------------------------------lEEEEEELLL
Query -aqrrneiqvPDLDG-----------------------------------yTTLKCDFHX   24
ident              |                                          |   
Sbjct drllikggriINDDQslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
DSSP  leeeeeeeeeELLLLeeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE


DSSP  LLllllLLLLhhHHHH-HHHHLL---LLEELLEEELLLllllllllLLLLH-HHHHHHHH
Query HSvfsdGLVWptVRVD-EAYRDG---LDAISLTEHIEYrphkqdvvSDHNR-SFDLCREQ   79
ident                              |      |                       
Sbjct YL----QKTA-aDDFFqGTRAALvggTTMIIDHVVPEP----gsslLTSFEkWHEAADTK  111
DSSP  LL----LLLL-lLLHHhHHHHHHhllEEEEEEEELLLL----lllhHHHHHhHHHHHHLL


DSSP  HhhhLLEELLEEEEE-------------------------------LLLLlleeeeelll
Query AeklGILLIKGSEIT-------------------------------RAXApghfnaifls  108
ident              ||                                             
Sbjct S---CCDYSLHVDITswydgvreelevlvqdkgvnsfqvymaykdvYQMS----------  158
DSSP  L---LLEEEEEEELLlllllhhhhhhhhhhllllleeeeellllllLLLL----------


DSSP  llhhhlllLHHHHHHHHHHLLLEEEELlLLLLL-----------------------llll
Query dsnpleqkDYKDAFREAKKQGAFXFWNhPGWDS-----------------------qqpd  145
ident             ||   |  ||                                      
Sbjct ------dsQLYEAFTFLKGLGAVILVH-AENGDliaqeqkrilemgitgpeghalsrpee  211
DSSP  ------hhHHHHHHHHHHHHLLEEEEE-LLLHHhhhhhhhhhhhllllllhhhhhhllhh


DSSP  LLLL--lhhHHHHHH-LLLLlEEEEEelleELLHHHHHHHHHL-----LEEEE-------
Query TTKW--wpeHTALYQ-EGCXhGIEVAnghlYXPEAIQWCLDKN-----LTXIG-------  190
ident           |           |           |                         
Sbjct LEAEavfraITIAGRiNCPV-YITKV----MSKSAADIIALARkkgplVFGEPiaaslgt  266
DSSP  HHHHhhhhhHHHHHHhLLLE-EEEEE----LLHHHHHHHHHHHhhlllEEEEElhhhhhl


DSSP  --------------------------------------------ELLLLLL---------
Query --------------------------------------------TSDIHQP---------  197
ident                                              |              
Sbjct dgthywsknwakaaafvtspplspdpttpdyltsllacgdlqvtGSGHCPYstaqkavgk  326
DSSP  llhhhhlllhhhhhhllllllllllllhhhhhhhhhhhllllllLLLLLLLlhhhhhhhl


DSSP  ----------------------hhhhllhhhllllleeEEEEllllhhhhHHHHHlllee
Query ----------------------iqtdydfekgehrtxtFVFAkerslqgiREALDnrrta  235
ident                                                             
Sbjct dnftlipegvngieermtvvwdkavatgkmdenqfvavTSTN--------AAKIF-----  373
DSSP  llhhhllllllllllhhhhhhhhhlllllllhhhhhhhHLHH--------HHHHH-----


DSSP  eeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeELLLlleeeeelllllleell
Query ayfhelligredllrpffekcvkieevsrneqgvtlsitNVTDlvlklkktahdtllvyf  295
ident                                                             
Sbjct -----------------nlyprkgriavgsdadvviwdpDKLK---titakshksaveyn  413
DSSP  -----------------lllllllllllllllleeeeeeEEEE---elllllllllllll


DSSP  leeEELLL-----------------eeeeeeeeellllllleeeeeeeeeeeelleeeee
Query rdxTLKPH-----------------trytvrigfkqgikggdvnfevtnfivapdkglky  338
ident        |                                                    
Sbjct ifeGMECHgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglq  473
DSSP  lllLLEEEeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllll


DSSP  eeel
Query tisl  342
ident     
Sbjct gvsr  477
DSSP  llll


No 48: Query=3e38A Sbjct=2ogjA Z-score=4.4

back to top
DSSP  --lllllllllLLLLL-------------------------------------lEEEEEE
Query --aqrrneiqvPDLDG-------------------------------------yTTLKCD   21
ident                                                            |
Sbjct qapilltnvkpVGFGKgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
DSSP  llleeeeeeeeLLLLLlllllleeeeellllleeeeelllllllleeelllleeEELEEE


DSSP  LLLL--LLLLLLLLlhhhHHHH-HHHLLLLEELL-EEELllllllllllLLLLHHHHH-H
Query FHXH--SVFSDGLVwptvRVDE-AYRDGLDAISL-TEHIeyrphkqdvvSDHNRSFDL-C   76
ident  | |      |       |  |     |                                
Sbjct LHVHiwHGGTDISI----RPSEcGAERGVTTLVDaGSAG---------eANFHGFREYiI  107
DSSP  EEELllLLLLLLLL----LHHHlLHHHLEEEEEEeLLLL---------lLLHHHHHHHlL


DSSP  HHHhhhhLLEELLEEEEE------------LLLL------------lleeeeELLL----
Query REQaeklGILLIKGSEIT------------RAXA------------pghfnaIFLS----  108
ident                                                     |       
Sbjct EPS----RERIKAFLNLGsiglvacnrvpeLRDIkdidldrilecyaensehIVGLxvra  163
DSSP  LLL----LLEEEEEEELLllllllllllllLLLHhhllhhhhhhhhhlllllEEEEeeee


DSSP  ---llhhhlllLHHHHHHHHHHL-LLEEEElllllllllllllLLLHHHHHHHHLL--lL
Query ---dsnpleqkDYKDAFREAKKQ-GAFXFWnhpgwdsqqpdttKWWPEHTALYQEG--cX  162
ident              |     ||      |                                
Sbjct shvitgswgvtPVKLGKKIAKILkVPXXVH-----------vgEPPALYDEVLEILgpgD  212
DSSP  lhhhhlllllhHHHHHHHHHHHHlLLEEEE-----------elLLLLLHHHHHHHLlllL


DSSP  LEEEEeelleELLH-----------hhhhhhHHLLE------------------------
Query HGIEVanghlYXPE-----------aiqwclDKNLT------------------------  187
ident                                                             
Sbjct VVTHC-----FNGKsgssixededlfnlaerCEGIRldighggasfsfkvaeaaiargll  267
DSSP  EEELL-----LLLLllllllllhhhhhhhhhLLLLEeelllllllllhhhhhhhhhllll


DSSP  -EEEELLLLLL-HHHHLlhhhllLLLE------------------EEEEellllhhhHHH
Query -XIGTSDIHQP-IQTDYdfekgeHRTX------------------TFVFakerslqgIRE  227
ident       | |                                                || 
Sbjct pFSISTDLHGHsXNFPV------WDLAttxskllsvdxpfenvveAVTR---npasvIRL  318
DSSP  lLLLLLLLLLLlLLLLL------LLHHhhhhhhhhllllhhhhhhLLLH---hhhhhLLL


DSSP  HhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeelLLLLEEEeell
Query AldnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvTDLVLKLkkta  287
ident                                                   |||       
Sbjct D---------------------------------xenrldvgqradftvFDLVDAD----  341
DSSP  L---------------------------------llllllllllleeeeEEEEEEE----


DSSP  lllleellleeeellleeeeeeeeellllllleeeeEEEE--------eeeelleeeeee
Query hdtllvyfrdxtlkphtrytvrigfkqgikggdvnfEVTN--------fivapdkglkyt  339
ident                                                             
Sbjct -------------------------leatdsngdvsRLKRlfepryavigaeaiaasryi  376
DSSP  -------------------------eeeellllleeEEEEeeeeeeeeelleeeelllll


DSSP  eel
Query isl  342
ident    
Sbjct pra  379
DSSP  lll


No 49: Query=3e38A Sbjct=3iacA Z-score=4.3

back to top
DSSP  --------------lllllllLLLLlllleEEEEELLLLLLllllllLHHH---------
Query --------------aqrrneiQVPDldgytTLKCDFHXHSVfsdglvWPTV---------   37
ident                                   ||| |                     
Sbjct atfxtedfllkndiartlyhkYAAP-----XPIYDFHCHLS----pqEIADdrrfdnlgq   51
DSSP  llllllllllllhhhhhhhhhLLLL-----LLEEELLLLLL----hhHHHHllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   37
ident                                                             
Sbjct iwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrp  111
DSSP  hhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhll


DSSP  ------------------------------hHHHHHHLLLLEELLEEELlllllllllll
Query ------------------------------rVDEAYRDGLDAISLTEHIeyrphkqdvvs   67
ident                                              |              
Sbjct fgitgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTDDP----------i  161
DSSP  lllllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLLLL----------l


DSSP  LLLHHHHHHHHHhHHHLLEELLEEEEEL--------------------------llllle
Query DHNRSFDLCREQaEKLGILLIKGSEITR--------------------------axapgh  101
ident |                |                                          
Sbjct DSLEYHRQIAAD-DSIDIEVAPSWRPDKvfkieldgfvdylrkleaaadvsitrfddlrq  220
DSSP  LLLHHHHHHHHL-LLLLLEEELLLLLHHhhllllllhhhhhhhhhhhhllllllhhhhhh


DSSP  eeeellLLLH--------------------------------------------hhlllL
Query fnaiflSDSN--------------------------------------------pleqkD  117
ident                                                             
Sbjct altrrlDHFAacgcrasdhgietlrfapvpddaqldailgkrlagetlseleiaqfttaV  280
DSSP  hhhhhhHHHHhlllleeeeeellllllllllhhhhhhhhhhhhllllllhhhhhhhhhhH


DSSP  HHHHHHHHHHLLLEEEELlLLLL------------------LLLLLLLL--LLHHHHHHH
Query YKDAFREAKKQGAFXFWNhPGWD------------------SQQPDTTK--WWPEHTALY  157
ident      |     |  |     |                    |                  
Sbjct LVWLGRQYAARGWVXQLH-IGAIrnnntrxfrllgpdtgfdSIGDNNISwaLSRLLDSXD  339
DSSP  HHHHHHHHHHHLLEEEEE-ELEEllllhhhhhhhlllllllEELLLLLHhhHHHHHHHHH


DSSP  H--LLLLLEEEeeelleeLLHHHHHHHHHL-------LEEEE------------------
Query Q--EGCXHGIEvanghlyXPEAIQWCLDKN-------LTXIG------------------  190
ident    |                                                        
Sbjct VtnELPKTILY-clnprdNEVLATXIGNFQgpgiagkVQFGSgwwfndqkdgxlrqleql  398
DSSP  LllLLLEEEEE-ellhhhHHHHHHHHHHLLlllllllEEELLllhhhllhhhhhhhhhhh


DSSP  ------------ELLLLLLHhhhllhhhllllleeeeeellllhhhhhhhhhllleeeeE
Query ------------TSDIHQPIqtdydfekgehrtxtfvfakerslqgirealdnrrtaayF  238
ident               |                                            |
Sbjct sqxgllsqfvgxLTDSRSFL--------------------------------sytrheyF  426
DSSP  hhhllhhhllllLLLLLLLL--------------------------------llhhhhhH


DSSP  LLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeelllLLEEEeelllllleelllee
Query HELLigredllrpffekcvkieevsrneqgvtlsitnvtdLVLKLkktahdtllvyfrdx  298
ident    |                                      |                 
Sbjct RRIL------------------------------------CNLLG---------------  435
DSSP  HHHH------------------------------------HHHHH---------------


DSSP  eellleeeeeeeeellllllleeeeeeeeeeeelleeeEEEE------------------
Query tlkphtrytvrigfkqgikggdvnfevtnfivapdkglKYTI------------------  340
ident                                                             
Sbjct --------------------------------qwaqdgEIPDdeaxlsrxvqdicfnnaq  463
DSSP  --------------------------------hhhhllLLLLlhhhhhhhhhhhhlhhhh


DSSP  ----el
Query ----sl  342
ident       
Sbjct ryftik  469
DSSP  hhllll


No 50: Query=3e38A Sbjct=2qpxA Z-score=4.3

back to top
DSSP  lllllllLLLLlllleEEEEELLLL-----------------------------------
Query aqrrneiQVPDldgytTLKCDFHXH-----------------------------------   25
ident         |           | | |                                   
Sbjct gxddlseFVDQ-----VPLLDHHCHflidgkvpnrddrlaqvsteadkdypladtknrla   55
DSSP  lllllhhHHHH-----LLEEEEEELlllllllllhhhhhhhhlllllllllhhhhlllhh


DSSP  ------------------lllllllllhhhhhHHHHHLLLLEELLEEEllllllllllll
Query ------------------svfsdglvwptvrvDEAYRDGLDAISLTEHieyrphkqdvvs   67
ident                                                             
Sbjct yhgflalakefaldannplaaxndpgyatynhRIFGHFHFKELLIDTG--------fvpd  107
DSSP  hhhhhhhhhhhllllllllllllhhhhhhhhhHHHHHLLEEEEEEELL--------llll


DSSP  lllHHHHHHHHHHhhhLLEELLEEEEE------lllllleeeeelllllHHHL-------
Query dhnRSFDLCREQAeklGILLIKGSEIT------raxapghfnaiflsdsNPLE-------  114
ident       |   |     ||                                          
Sbjct dpiLDLDQTAELV---GIPVKAIYRLEthaedfxlehdnfaawwqafsnDVKQakahgfv  164
DSSP  lllLLHHHHHHHH---LLLEEEEEEHHhhhhhhhlllllhhhhhhhhhhHHHLlllllll


DSSP  -------------------------------------------lLLHHHHHHHHHHLLLE
Query -------------------------------------------qKDYKDAFREAKKQGAF  131
ident                                                         |   
Sbjct gfxsiaayrvglhlepvnvieaaagfdtwkhsgekrltskplidYXLYHVAPFIIAQDXP  224
DSSP  leeelhhhhlllllllllhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHHLLL


DSSP  EEELlLLLLL--LLLLLLLLLHhHHHHHHLL----LLLEEEEeelleeLLHHhHHHHHHL
Query XFWNhPGWDS--QQPDTTKWWPeHTALYQEG----CXHGIEVanghlyXPEAiQWCLDKN  185
ident       |                                          |          
Sbjct LQFH-VGYGDadTDXYLGNPLL-XRDYLKAFtkkgLKVVLLH-----cYPYH-REAGYLA  276
DSSP  EEEE-ELLLLllLLHHHLLHHH-HHHHHHHHhhhlLLEEEEE-----lLLLH-HHHHHHH


DSSP  -----LEEE-----------------------------EELLLLLLHHhhllhhhllLLL
Query -----LTXI-----------------------------GTSDIHQPIQtdydfekgeHRT  211
ident      |                                  ||                  
Sbjct svfpnLYFDislldnlgpsgasrvfneavelapytrilFASDASTYPE-------xyGLA  329
DSSP  hhlllEEEElllhhhhlhhhhhhhhhhhlllllhhheeLLLLLLLLHH-------hhHHH


DSSP  EeeeeellllhhhhhhhhhllleeeEELLEEellhhhhhhhhhhheeeeeeeeelleeee
Query XtfvfakerslqgirealdnrrtaaYFHELLigredllrpffekcvkieevsrneqgvtl  271
ident                           |   |                             
Sbjct A-----------------------rQFKQAL-----------------------------  337
DSSP  H-----------------------hHHHHHH-----------------------------


DSSP  eeeelllLLEEeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeee
Query sitnvtdLVLKlkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfiva  331
ident                                                             
Sbjct -------VAHF-------------------------------------------------  341
DSSP  -------HHHH-------------------------------------------------


DSSP  lleeEEEEE--------------------------el
Query pdkgLKYTI--------------------------sl  342
ident     |                                
Sbjct --nqLPFVDlaqkkawinaicwqtsaklyhqerelrv  376
DSSP  --hlLLLLLhhhhhhhhhhhhlhhhhhhlllhhhhll


No 51: Query=3e38A Sbjct=1a5kC Z-score=4.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -----lllllllllLLLLL-----------------------------------------
Query -----aqrrneiqvPDLDG-----------------------------------------   14
ident                |  |                                         
Sbjct aadcvdlvltnaliVDHWGivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeEELLEeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ----lEEEEEELLLLLLlllllllHHHHHHHHHHLLLLEELLE-----------EELLll
Query ----yTTLKCDFHXHSVfsdglvwPTVRVDEAYRDGLDAISLT-----------EHIEyr   59
ident      |    | | |               ||   |                        
Sbjct egkivTAGGIDTHIHWI-------CPQQAEEALVSGVTTMVGGgtgpaagthatTCTP--  171
DSSP  llleeEELEEEEEEELL-------LLLHHHHHHHHLEEEEEEElllllhhhhhlLLLL--


DSSP  lllllllLLLLHHHHHHHHHHhhhlLEELlEEEEEL------------------------
Query phkqdvvSDHNRSFDLCREQAeklgILLIkGSEITR------------------------   95
ident            |                                                
Sbjct -----gpWYISRMLQAADSLP----VNIG-LLGKGNvsqpdalreqvaagvigleihedw  221
DSSP  -----hhHHHHHHHHHHLLLL----LEEE-EEEELLlllhhhhhhhhhhllleeeeehhh


DSSP  LLLLleeeeelllllhhhllllhHHHHHHHHHLLLEEEElLLLLlllLLLLlLLLHHHHH
Query AXAPghfnaiflsdsnpleqkdyKDAFREAKKQGAFXFWnHPGWdsqQPDTtKWWPEHTA  155
ident    |                     |   |          |                  |
Sbjct GATP----------------aaiDCALTVADEMDIQVAL-HSDT---LNESgFVEDTLAA  261
DSSP  LLLH----------------hhhHHHHHHHHHHLLEEEE-ELLL---LLLLlLHHHHHHH


DSSP  HHHLllLLEEEEeelLEEL---lhhhHHHHHHL-LEEE----------------------
Query LYQEgcXHGIEVangHLYX---peaiQWCLDKN-LTXI----------------------  189
ident                                                             
Sbjct IGGR--TIHTFH--tEGAGgghapdiITACAHPnILPSstnptlpytlntidehldmlmv  317
DSSP  HLLL--LEEELL--lLLLLllllllhHHHHHLLlEEEEeehhhllllllhhhhhhhhhhh


DSSP  --------------------------------------EELLLLL---------------
Query --------------------------------------GTSDIHQ---------------  196
ident                                         ||                  
Sbjct chhldpdiaedvafaesrirretiaaedvlhdlgafslTSSDSQAmgrvgevilrtwqva  377
DSSP  hhllllllhhhhhlllllllhhhhhhhhhhhhllllleEELLLLLllllllhhhhhhhhh


DSSP  -----------lhhhhllhhhllllleEEEE---elllLHHHH-----------------
Query -----------piqtdydfekgehrtxTFVF---akerSLQGI-----------------  225
ident                                                             
Sbjct hrmkvqrgalaeetgdndnfrvkryiaKYTInpalthgIAHEVgsievgkladlvvwspa  437
DSSP  hhhhhhhlllllllllllhhhhhhhhhLLLHhhhhhllLLLLLlllllllllleeeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  225
ident                                                             
Sbjct ffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaa  497
DSSP  hlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhh


DSSP  -----------hhhhhllleeeeelleeeLLHHhhhhhhhhheeeeeeeeelleeeeeee
Query -----------realdnrrtaayfhelliGREDllrpffekcvkieevsrneqgvtlsit  274
ident                                                             
Sbjct ngvaerlnlrsaiavvkgcrtvqkadmvhNSLQ---------------------------  530
DSSP  hlhhhhllllleeeellllllllhhhlllLLLL---------------------------


DSSP  ellllleeeeelllllleellleeeellleeeeeeeeellllllleeeEEEEEeeeelle
Query nvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnFEVTNfivapdk  334
ident                                                    |        
Sbjct --------------------------------pnitvdaqtyevrvdgELITSepadvlp  558
DSSP  --------------------------------lleeelllllleeellEELLLlllllll


DSSP  eeeeeeel
Query glkytisl  342
ident         
Sbjct maqryflf  566
DSSP  llllllll


No 52: Query=3e38A Sbjct=3icjA Z-score=4.2

back to top
DSSP  -llllllllLLLL------------------------------------------lllEE
Query -aqrrneiqVPDL------------------------------------------dgyTT   17
ident                                                             
Sbjct cmkalingtIYTSfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleEEEEelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  EEEELLLLLllllLLLL-------------------------------------------
Query LKCDFHXHSvfsdGLVW-------------------------------------------   34
ident    | | |      |                                             
Sbjct AFFDSHLHL---dELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
DSSP  LEEEEEELH---hHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   34
ident                                                             
Sbjct redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiine  177
DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhh


DSSP  -----------HHHHHHHHHHLLLLEELLEEELllllllllllLLLLHHHHHHH--HHHH
Query -----------PTVRVDEAYRDGLDAISLTEHIeyrphkqdvvSDHNRSFDLCR--EQAE   81
ident                       |                                     
Sbjct kiltvkdykhyIESAQEHLLSLGVHSVGFMSVG----------EKALKALFELEreGRLK  227
DSSP  llllhhhhhhhHHHHHHHHHHLLEEEEEEEEEL----------HHHHHHHHHHHhlLLLL


DSSP  hhlLEELLEEeeelllllleeeeelllllHHHL---------------------------
Query klgILLIKGSeitraxapghfnaiflsdsNPLE---------------------------  114
ident                                |                            
Sbjct ---MNVFAYL------------------sPELLdkleelnlgkfegrrlriwgvxlfvdg  266
DSSP  ---LEEEEEE------------------lHHHHhhhhhhlllleellleeeeeeeeelll


DSSP  --------------------------lLLHHHHHHHHH-HLLLEE---------------
Query --------------------------qKDYKDAFREAK-KQGAFX---------------  132
ident                                     ||                      
Sbjct slgartallsepytdnpttsgelvmnkDEIVEVIERAKpLGLDVAvhaigdkavdvalda  326
DSSP  llllllllllllllllllllllllllhHHHHHHHHHHLlLLLEEEeeellhhhhhhhhhh


DSSP  --------EELLLLLlllLLLLLLLLhhhhhhhhllllLEEEeEELLE------------
Query --------FWNHPGWdsqQPDTTKWWpehtalyqegcxHGIEvANGHL------------  172
ident            |        |                   |  |  |             
Sbjct feeaefsgRIEHASL---VRDDQLER-------ikelkVRIS-AQPHFivsdwwivnrvg  375
DSSP  hhhhllllEEEELLL---LLHHHHHH-------hhhhlLEEE-ELLLHhhhlllhhhhhh


DSSP  --------eLLHHHHHHhhhllEEEEELLLLLlhhhhllhhhlLLLL-------------
Query --------yXPEAIQWCldknlTXIGTSDIHQpiqtdydfekgEHRT-------------  211
ident                             |                               
Sbjct eerakwayrLKTLSSIT-----KLGFSTDSPI------epadpWVSIdaavnryvvdpge  424
DSSP  hhhhhhlllHHHHHHHL-----LEEELLLLLL------llllhHHHHhhhhhlllllhhh


DSSP  ---------EEEE-eellllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeee
Query ---------XTFV-fakersLQGIrealdnrrtaayfhelligredllrpffekcvkiee  261
ident                                                             
Sbjct rvsreealhLYTHgsaqvtlAEDL-----------------------------------g  449
DSSP  lllhhhhhhHLLHhhhhhllLLLL-----------------------------------l


DSSP  eeeelleeeeeeeELLLLLeeeeelllllleellleeeellleeeeeeeeelllllllee
Query vsrneqgvtlsitNVTDLVlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdv  321
ident                  |                                          
Sbjct klergfraeyiilDRDPLK-----------------------------------------  468
DSSP  llllllllleeeeLLLLLL-----------------------------------------


DSSP  eeeeeeeeeelleeeeeeeel
Query nfevtnfivapdkglkytisl  342
ident                      
Sbjct ---------------------  468
DSSP  ---------------------


No 53: Query=3e38A Sbjct=2gwgA Z-score=4.0

back to top
DSSP  llllllllllllllleeEEEELLLLlllllLLLL--------------------------
Query aqrrneiqvpdldgyttLKCDFHXHsvfsdGLVW--------------------------   34
ident                     | | |                                   
Sbjct -----------------XIIDIHGH-----YTTApkaledwrnrqiagikdpsvxpkvse   38
DSSP  -----------------LLEEEEEE-----LLLLlhhhhhhhhhhhhhhhlhhhlllhhh


DSSP  --------hhhhhhHHHHLL----LLEELLEeellllllLLLLLLLLLHHHHHHHHHHHH
Query --------ptvrvdEAYRDG----LDAISLTehieyrphKQDVVSDHNRSFDLCREQAEK   82
ident                          |                          ||      
Sbjct lkisddelqasiieNQLKKXqergSDLTVFS---pragdFNVSSTWAAICNELCYRVSQL   95
DSSP  llllhhhhhhhhhlLHHHHHhhhlLLEEEEE---lllllHHHHHHHHHHHHHHHHHHHHH


DSSP  HL-LEELL----------------------------EEEEELLlllleeeeelllllhhh
Query LG-ILLIK----------------------------GSEITRAxapghfnaiflsdsnpl  113
ident                                                             
Sbjct FPdNFIGAaxlpqspgvdpktcipelekcvkeygfvAINLNPD------psgghwtsppl  149
DSSP  LLlLEEEEeellllllllhhhhhhhhhhhhhlllllEEEELLL------lllllllllll


DSSP  llLLHHHHHHHHHHLLLE-----------------------------------EEEL-LL
Query eqKDYKDAFREAKKQGAF-----------------------------------XFWN-HP  137
ident                                                             
Sbjct tdRIWYPIYEKXVELEIPaxihvstgahylnadttafxqcvagdlfkdfpelkFVIPhGG  209
DSSP  llHHHHHHHHHHHHHLLLeeellllllhhhhhhhhhhhhhhhllhhhhlllllEEELhHH


DSSP  LLlllllllLLLL------------hhhHHHHHlllLLEEEeEELLE--ELLHHH-HHHH
Query GWdsqqpdtTKWW------------pehTALYQegcXHGIEvANGHL--YXPEAI-QWCL  182
ident |          |                                                
Sbjct GA-----vpYHWGrfrglaqexkkplleDHVLN---NIFFD-TCVYHqpGIDLLNtVIPV  260
DSSP  LL-----lhHHHHhhhhhhhhlllllhhHHLLL---LEEEE-LLLLLhhHHHHHHhHLLH


DSSP  hhlLEEEEELLLLLlhhHHLLHH---HLLLLLeeeeeellllhhhhhhhhhllleeeEEL
Query dknLTXIGTSDIHQpiqTDYDFE---KGEHRTxtfvfakerslqgirealdnrrtaaYFH  239
ident          |                                                  
Sbjct ---DNVLFASEXIG---AVRGIDprtGFYYDD------------------------tKRY  290
DSSP  ---HHEELLLLLLL---LLLLEElllLEELLL------------------------lHHH


DSSP  LEEE-lLHHHHhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleelllee
Query ELLI-gREDLLrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdx  298
ident                                                             
Sbjct IEAStiLTPEE-------------------------------------------------  301
DSSP  HHHLllLLHHH-------------------------------------------------


DSSP  eellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query tlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                             
Sbjct ----------------kqqiyegnarrvyprldaalkakgkleh  329
DSSP  ----------------hhhhhlhhhhhhlhhhhhhhhhhhhhll


No 54: Query=3e38A Sbjct=3irsA Z-score=4.0

back to top
DSSP  llllllllllllllleEEEEELLLLL--LLLL--------------------------ll
Query aqrrneiqvpdldgytTLKCDFHXHS--VFSD--------------------------gl   32
ident                     ||                                      
Sbjct ----------------LKIIDFRLRPpaMGFLnariytrpdirnrftrqlgfepapsaee   44
DSSP  ----------------LLLEELLLLLllHHHHhlhhhhlhhhhhhhhhhhlllllhhhhh


DSSP  LLHHHHHHHHHHLLLLEELLEEElLLLLLLlllllLLLHHHHHHHHHHhhhlLEELLE--
Query VWPTVRVDEAYRDGLDAISLTEHiEYRPHKqdvvsDHNRSFDLCREQAeklgILLIKG--   90
ident         |    |                                              
Sbjct KSLELMFEEMAAAGIEQGVCVGR-NSSVLG---svSNADVAAVAKAYP----DKFHPVgs   96
DSSP  LLHHHHHHHHHHLLLLEEEEELL-EELLLE---elLHHHHHHHHHHLL----LLEEEEee


DSSP  ----eeeelllllleeeeelLLLL----------hhhlllLHHHHHHHHH-HLLL-----
Query ----seitraxapghfnaifLSDS----------npleqkDYKDAFREAK-KQGA-----  130
ident                                                             
Sbjct ieaatrkeamaqmqeildlgIRIVnlepgvwatpmhvddrRLYPLYAFCEdNGIPvimmt  156
DSSP  lllllhhhhhhhhhhhhhllLLLEeelhhhlllllllllhHHHHHHHHHHhLLLLeeeel


DSSP  --------------------------EEEELLLLLLlllllLLLLlhhhhhhhhlllLLE
Query --------------------------FXFWNHPGWDsqqpdTTKWwpehtalyqegcXHG  164
ident                                |  |                         
Sbjct ggnagpditytnpehidrvlgdfpdlTVVSSHGNWP-----WVQE---iihvafrrpNLY  208
DSSP  lllllllhhhhlhhhhhhhhhhllllLEEEEHHHLL-----LHHH---hhhhhhhllLEE


DSSP  EEeEELLEE----LLHHHHHHHHHLL-EEEEELLLLLLHhhhllhhhlLLLL--------
Query IEvANGHLY----XPEAIQWCLDKNL-TXIGTSDIHQPIqtdydfekgEHRT--------  211
ident        ||        ||                                |        
Sbjct LS-PDMYLYnlpgHADFIQAANSFLAdRMLFGTAYPMCP--------lKEYTewfltlpi  259
DSSP  EE-LHHHHLllllHHHHHHHHLLHHHhLLLLLLLLLLLL--------hHHHHhhhhllll


DSSP  ------eEEEEellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeeeeee
Query ------xTFVFakerslqgIREAldnrrtaayfhelligredllrpffekcvkieevsrn  265
ident                     |                                       
Sbjct kpdamekILHG------naERLL-------------------------------------  276
DSSP  lhhhhhhHHLH------hhHHHH-------------------------------------


DSSP  lleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeee
Query eqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfev  325
ident                                                             
Sbjct ------------------------------------------------------------  276
DSSP  ------------------------------------------------------------


DSSP  eeeeeelleeeeeeeel
Query tnfivapdkglkytisl  342
ident                  
Sbjct ------------aqagr  281
DSSP  ------------hhlll


No 55: Query=3e38A Sbjct=1bksA Z-score=3.7

back to top
DSSP  --llllllllLLLLllLEEEEEElLLLLLLlllllLHHHHHHHHHHLLLLEELLEEELLL
Query --aqrrneiqVPDLdgYTTLKCDfHXHSVFsdglvWPTVRVDEAYRDGLDAISLTEHIEY   58
ident             |                            |     | ||  |      
Sbjct meryenlfaqLNDR--REGAFVP-FVTLGD-pgieQSLKIIDTLIDAGADALELGVPFSD   56
DSSP  lhhhhhhhhhHHHL--LLLEEEE-EEELLL-llhhHHHHHHHHHHHLLLLLEEEELLLLL


DSSP  -----------LLLLlLLLLLLLHHHHHHHHHHHHHL-LEELLEE----------eeell
Query -----------RPHKqDVVSDHNRSFDLCREQAEKLG-ILLIKGS----------eitra   96
ident                          |       ||   |                     
Sbjct pladgptiqnaNLRAfAAGVTPAQCFEMLALIREKHPtIPIGLLMyanlvfnngidafya  116
DSSP  lllllhhhhhhHHHHhHHLLLHHHHHHHHHHHHHHLLlLLEEEEElhhhhhlllhhhhhh


DSSP  lllleeeeELLLllhhhllllhhhHHHHHHHLL-----LEEEEllllllllllllLLLLH
Query xapghfnaIFLSdsnpleqkdykdAFREAKKQG-----AFXFWnhpgwdsqqpdtTKWWP  151
ident           |                           |  |                  
Sbjct rceqvgvdSVLV------advpveESAPFRQAAlrhniAPIFI----------cpPNADD  160
DSSP  hhhhhlllEEEE------llllhhHLHHHHHHHhhlllEEEEE----------elLLLLH


DSSP  HHHHHHHLLL-llEEEEeelleellHHHHHHHHHL-----lEEEE---------------
Query EHTALYQEGC-xhGIEVanghlyxpEAIQWCLDKN-----lTXIG---------------  190
ident                                             |               
Sbjct DLLRQVASYGrgyTYLL------alPLHHLIEKLKeyhaapALQGfgisspeqvsaavra  214
DSSP  HHHHHHHHHLlllEEEL------llLHHHHHHHHHhhllllEEELlllllhhhhhhhhhh


DSSP  -----ELLL--LLLHhhhllhhhllllleeeeeellllhhhhhhhhhllleeeeelleee
Query -----TSDI--HQPIqtdydfekgehrtxtfvfakerslqgirealdnrrtaayfhelli  243
ident       |       |                                             
Sbjct gaagaISGSaiVKII---------------------------------------------  229
DSSP  llleeEELLhhHHHH---------------------------------------------


DSSP  llhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeelll
Query gredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkph  303
ident                                                             
Sbjct ------------------------------------------------------------  229
DSSP  ------------------------------------------------------------


DSSP  eeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query trytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                        
Sbjct -------------eknlaspkqmlaelrsfvsamkaasr  255
DSSP  -------------hhllllhhhhhhhhhhhhhhhhhlll


No 56: Query=3e38A Sbjct=4dziC Z-score=3.7

back to top
DSSP  lllllllllllllllEEEEEELLLLLLL--------------------------------
Query aqrrneiqvpdldgyTTLKCDFHXHSVF--------------------------------   28
ident                     |   |                                   
Sbjct -------------alNYRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavig   47
DSSP  -------------llLLLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeel


DSSP  ---------------------------------------------llllLLHH-HHHHHH
Query ---------------------------------------------sdglVWPT-VRVDEA   42
ident                                                        |    
Sbjct drvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdARIAVM  107
DSSP  leellllllllllleelllllhhhhhllllllllhhhllleelhhhlhhHLLHhHHHHHH


DSSP  HHLLLLEELLEEEllLLLL----------lllllLLLLHHHHHHHhhhHHHLlEELLE--
Query YRDGLDAISLTEHieYRPH----------kqdvvSDHNRSFDLCReqaEKLGiLLIKG--   90
ident                                                        |    
Sbjct DEQDIETAFMLPTfgCGVEealkhdieatmasvhAFNLWLDEDWG-fdRPDH-RIIAApi  165
DSSP  HHHLEEEEEEELLhhHHHHhhllllhhhhhhhhhHHHHHHHHHLL-llLLLL-LEEELll


DSSP  -----------------------eEEELLlllleeeeelllllhhhllllhhHHHHHHHH
Query -----------------------sEITRAxapghfnaiflsdsnpleqkdykDAFREAKK  127
ident                             |                               
Sbjct vsladptraveevdfvlargaklvLVRPA------pvpglvkprslgdrshdPVWARLAE  219
DSSP  lllllhhhhhhhhhhhhhllllleELLLL------lllllllllllllhhhhHHHHHHHH


DSSP  LLLE------------------------------------------------------EE
Query QGAF------------------------------------------------------XF  133
ident  |                                                          
Sbjct AGVPvgfhlsdsgylhiaaawggakdpldqvllddraihdtmasmivhgvftrhpklkAV  279
DSSP  HLLLeeeellllllhhhhhhllllllhhhhhhhllhhhhhhhhhhhhllhhhhlllllEE


DSSP  EL--LLLLlllllllLLLL----------------hhhHHHHhlllLLEEEEEellEELL
Query WN--HPGWdsqqpdtTKWW----------------pehTALYqegcXHGIEVAnghLYXP  175
ident                                                  |          
Sbjct SIenGSYF-------VHRLikrlkkaantqpqyfpedpVEQL--rnNVWIAPY---YEDD  327
DSSP  EEllLLLH-------HHHHhhhhhhhhhhlhhhllllhHHHH--hhHEEELLL---LLLL


DSSP  --HHHHHHHhhlLEEEEELLLLLlhhhhllhhhlLLLLeeeeeellllhhhhhhhhhlll
Query --EAIQWCLdknLTXIGTSDIHQpiqtdydfekgEHRTxtfvfakerslqgirealdnrr  233
ident   |               ||                                        
Sbjct lpELARVIG--vDKILFGSDWPH-------geglASPV----------------------  356
DSSP  hhHHHHHHL--hHHLLLLLLLLL-------llllLLHH----------------------


DSSP  eeeeELLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeellllllee
Query taayFHELLigredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllv  293
ident     |   |                                                   
Sbjct ---sFTAEL---------------------------------------------------  362
DSSP  ---hHHHHH---------------------------------------------------


DSSP  llleeeellleeeeeeeeellllllleeeeeeeEEEE----------elleeeeeeeel
Query yfrdxtlkphtrytvrigfkqgikggdvnfevtNFIV----------apdkglkytisl  342
ident                                                            
Sbjct ---------------------------------KGFSesdirkimrdnaldllgvqvgs  388
DSSP  ---------------------------------LLLLhhhhhhhhlhhhhhhhllllll


No 57: Query=3e38A Sbjct=2a3lA Z-score=3.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------lllllllllllLLLL---EEEEEEL-LLLL--------
Query ----------------------aqrrneiqvpdLDGY---TTLKCDF-HXHS--------   26
ident                                            | |    ||        
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksAPHRdfyNVRKVDThVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhLLLLlllLLLEEEEeEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   26
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -----------------------llllllllHHHHHHHHHHLLLLEELLEEellLLLLLL
Query -----------------------vfsdglvwPTVRVDEAYRDGLDAISLTEhieYRPHKQ   63
ident                                                             
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgeiTKQVFSDLEASKYQMAEYRI---SIYGRK  297
DSSP  hhhhllllllhhhhhhlllllllllllhhhhHHHHHHHHLLLLLEEEEEEE---ELLLLL


DSSP  L--LLLLllhhhhhhhHHHHhhllEELLE-------------------------------
Query D--VVSDhnrsfdlcrEQAEklgiLLIKG-------------------------------   90
ident                    |                                        
Sbjct MseWDQL-aswivnndLYSE----NVVWLiqlprlyniykdmgivtsfqnildnifiplf  352
DSSP  LlhHHHH-hhhhhlllLLLL----LEEEEeeeellhhhhlllllllllhhhhhhhllhhh


DSSP  ---------------------EEEE-----------------------------------
Query ---------------------SEIT-----------------------------------   94
ident                                                             
Sbjct eatvdpdshpqlhvflkqvvgFDLVddeskperrptkhmptpaqwtnafnpafsyyvyyc  412
DSSP  hhhhlhhhllllhhhhlleeeEEEElllllllllllllllllllllllllllhhhhhhhh


DSSP  ------------------------------lLLLLleeeeelllllhhhllllhhhhhhh
Query ------------------------------rAXAPghfnaiflsdsnpleqkdykdafre  124
ident                                                             
Sbjct yanlyvlnklreskgmttitlrphsgeagdiDHLA-------------------------  447
DSSP  hhhhhhhhhhhlllllllleellllllllllHHHH-------------------------


DSSP  hhhllLEEEeLLLLllllllllLLLLHHHHHHHHLLlLLEEEeEELLEE-------lLHH
Query akkqgAFXFwNHPGwdsqqpdtTKWWPEHTALYQEGcXHGIEvANGHLY-------xPEA  177
ident            |           |        |                           
Sbjct atfltCHSI-AHGI------nlRKSPVLQYLYYLAQ-IGLAM-SPLSNNslfldyhrNPF  498
DSSP  hhhhhLLLL-LLLH------hhHHLHHHHHHHHHHL-LLEEE-LHHHHLllllllllLLH


DSSP  HHHHHHHlLEEEEELLLlllhHHHLLHhhlLLLLeeeeeellllhhhhhhhhhllleeeE
Query IQWCLDKnLTXIGTSDIhqpiQTDYDFekgEHRTxtfvfakerslqgirealdnrrtaaY  237
ident     |   |      |                                            
Sbjct PVFFLRG-LNVSLSTDD---pLQIHLT---KEPL-----------------------veE  528
DSSP  HHHHHLL-LLEEELLLL---hHHHLLL---LLHH-----------------------hhH


DSSP  ELLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellle
Query FHELLigredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrd  297
ident                                                             
Sbjct YSIAA-------------------------------------------------------  533
DSSP  HHHHH-------------------------------------------------------


DSSP  eeellleeeeeeeeellllllleeeeeeeEEEE---------------------------
Query xtlkphtrytvrigfkqgikggdvnfevtNFIV---------------------------  330
ident                                                             
Sbjct -----------------------------SVWKlsacdlceiarnsvyqsgfshalkshw  564
DSSP  -----------------------------HHHLllhhhhhhhhhhhhhhllllhhhhhhh


DSSP  ----------------------------------------elleeeeeeeel
Query ----------------------------------------apdkglkytisl  342
ident                                                     
Sbjct igkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 58: Query=3e38A Sbjct=3ooqA Z-score=2.7

back to top
DSSP  -llllllllLLLLLL----------------------------------lEEEEEELLLL
Query -aqrrneiqVPDLDG----------------------------------yTTLKCDFHXH   25
ident           |                                            | | |
Sbjct kilfknatvFPITSRpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeeLLLLLLleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  -----------lLLLL--------------llllhHHHHHHHHHLLLLEELLEEELLLll
Query -----------sVFSD--------------glvwpTVRVDEAYRDGLDAISLTEHIEYrp   60
ident                                          |   |              
Sbjct iglfeegvgyyySDGNeatdpvtphvkaldgfnpqDPAIERALAGGVTSVXIVPGSAN--  118
DSSP  lllllllllhhhLLLLlllllllllllhhhhllllLHHHHHHHLLLEEEEEELLLLLL--


DSSP  llllllllllhhhhhhhhhHHHH-----lleelLEEEEELLL-llleeeeelllllhhhl
Query hkqdvvsdhnrsfdlcreqAEKL-----gilliKGSEITRAX-apghfnaiflsdsnple  114
ident                                   |                         
Sbjct ---------pvggqgsvikFRSIiveecivkdpAGLKXAFGEnpkrvygerkqtpstrxg  169
DSSP  ---------leeeeeeeeeLLLLlhhhheeeeeEEEEEELLHhhhhhhhhlllllllhhh


DSSP  lLLHHH------------------------------hhHHHH--HLLL------------
Query qKDYKD------------------------------afREAK--KQGA------------  130
ident                                        |    |               
Sbjct tAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevGEXVlrKKIParxhahraddil  229
DSSP  hHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHhlLLLLeeeeellhhhhh


DSSP  -----------EEEELLLLLlllllllLLLLhhhhhhhhllllLEEEeEELL--------
Query -----------FXFWNHPGWdsqqpdtTKWWpehtalyqegcxHGIEvANGH--------  171
ident                 |                                           
Sbjct tairiaeefgfNLVIEHGTE-----ayKISK------vlaekkIPVV-VGPLltfrtkle  277
DSSP  hhhhhhhhhllLEEEEELLL-----hhHHHH------hhhhhlLLEE-ELLLllllllhh


DSSP  -----EELL-HHHHHHhhhlLEEEEELLLLLLH----------hhhllhhhlllllEEEE
Query -----LYXP-EAIQWCldknLTXIGTSDIHQPI----------qtdydfekgehrtXTFV  215
ident                            |                               |
Sbjct lkdltXETIaKLLKDG----VLIALXCDHPVIPlefatvqaataxrygakeedllkILTV  333
DSSP  hllllLLHHhHHHHLL----LLEEELLLLLLLLhhhhhhhhhhhhhhlllhhhhhhLLLH


DSSP  eellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeee
Query fakerslqgIREAldnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitn  275
ident                                                             
Sbjct --npakilgLEDR-------------------------------igsiepgkdadlvvws  360
DSSP  --hhhhhllLLLL-------------------------------llllllllllleeeel


DSSP  LLLLLEeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeellee
Query VTDLVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkg  335
ident                                                             
Sbjct GHPFDX-------------------------------------------ksvvervyidg  377
DSSP  LLLLLL-------------------------------------------llleeeeeell


DSSP  eeeeeel
Query lkytisl  342
ident        
Sbjct vevfrre  384
DSSP  eeeeell


No 59: Query=3e38A Sbjct=1j5sA Z-score=2.3

back to top
DSSP  ------lllllllllllLLLLEeeeeelllllllllllllhhhhhhhhhhlLLLEELLee
Query ------aqrrneiqvpdLDGYTtlkcdfhxhsvfsdglvwptvrvdeayrdGLDAISLte   54
ident                  |                                          
Sbjct hmflgedylltnraavrLFNEV---------------------------kdLPIVDPH--   31
DSSP  llllllllllllhhhhhHHHHH---------------------------llLLEEELL--


DSSP  elllllllllllllllhHHHH---------------------------------------
Query hieyrphkqdvvsdhnrSFDL---------------------------------------   75
ident                    |                                        
Sbjct ----------------nHLDAkdivenkpwndiwevegatdhyvwelmrrcgvseeyitg   75
DSSP  ----------------lLLLHhhhhhllllllhhhhhllllhhhhhhhhhllllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   75
ident                                                             
Sbjct srsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpem  135
DSSP  lllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllll


DSSP  hhhhhHHHL--LEELL-------------------------EEEEE--------------
Query creqaEKLG--ILLIK-------------------------GSEIT--------------   94
ident              |                                              
Sbjct tpqklLRDMkvEILCTtddpvstlehhrkakeavegvtilpTWRPDramnvdkegwreyv  195
DSSP  lhhhhHHHLleEEEELllllllllhhhhhhhhhlllleeelLLLLHhhhllllllhhhhh


DSSP  ---------------------------------------llLLLL---------------
Query ---------------------------------------raXAPG---------------  100
ident                                                             
Sbjct ekmgerygedtstldgflnalwkshehfkehgcvasdhallEPSVyyvdenraravheka  255
DSSP  hhhhhhhllllllhhhhhhhhhhhhhhhhllllleeeeeelLLLLllllhhhhhhhhhhh


DSSP  -eeeeelllllhhhllLLHHHHHHHHHHLLLEEEELlLLLLL-----------------l
Query -hfnaiflsdsnpleqKDYKDAFREAKKQGAFXFWNhPGWDS-----------------q  142
ident                                       |                     
Sbjct fsgekltqdeindykaFMMVQFGKMNQETNWVTQLH-IGALRdyrdslfktlgpdsggdi  314
DSSP  lllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEE-ELEELlllhhhhhhlllllllle


DSSP  lLLLLLLLHHHHHHHHLL---LLLEEEeeelLEEL-LHHHHHHHHHL-LEEEEELLllll
Query qPDTTKWWPEHTALYQEG---CXHGIEvangHLYX-PEAIQWCLDKN-LTXIGTSDihqp  197
ident                 |                   |                       
Sbjct sTNFLRIAEGLRYFLNEFdgkLKIVLY--vlDPTHlPTISTIARAFPnVYVGAPWW----  368
DSSP  eLLLLLHHHHHHHHHHHLlllLLEEEE--elLHHHhHHHHHHHHHLLlEEELLLLL----


DSSP  hhhhllhhhllllleeeeeellllhhhhhhhhhllleeeeELLE--EELLH---------
Query iqtdydfekgehrtxtfvfakerslqgirealdnrrtaayFHEL--LIGRE---------  246
ident                                           |                 
Sbjct ----------------------------------fndspfGMEMhlKYLASvdllynlag  394
DSSP  ----------------------------------llllhhHHHHhhHHHHLlllhhhlll


DSSP  -------------------hhhhHHHHH-HEEEEeeeeelleeeeeeEELLllleeeeel
Query -------------------dllrPFFEK-CVKIEevsrneqgvtlsiTNVTdlvlklkkt  286
ident                                |                            
Sbjct mvtdsrkllsfgsrtemfrrvlsNVVGEmVEKGQ------------iPIKE---------  433
DSSP  lllllllllhhhhhhhhhhhhhhHHHHHhHHLLL------------lLHHH---------


DSSP  llllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel
Query ahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
ident                                                         
Sbjct --------------------------------------arelvkhvsydgpkalff  451
DSSP  --------------------------------------hhhhhhhhhlhhhhhhhl