Results: dupa

Query: 3dcpA

MOLECULE: HISTIDINOL-PHOSPHATASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3dcp-A 52.6  0.0  277   277  100 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
   2:  3au2-A 18.8  2.7  201   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   3:  1m65-A 17.3  2.5  187   234   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   4:  3qy6-A 12.5  3.6  188   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   5:  1v77-A 12.3  2.7  164   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
   6:  4cqb-A 12.0  2.9  186   402   14 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   7:  1k6w-A 11.5  3.3  186   423   11 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   8:  2oof-A 11.2  2.7  169   403   13 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   9:  2anu-A 11.0  3.6  166   224   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  10:  2imr-A 10.5  3.6  186   380   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  11:  4dlf-A 10.5  3.6  190   287    8 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  12:  2paj-A 10.3  3.0  167   421    9 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  13:  3ls9-A 10.2  3.1  172   453    7 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  14:  2vun-A 10.1  3.3  175   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  2uz9-A 10.0  3.0  169   444    9 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  16:  3gg7-A 10.0  2.8  159   243    9 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  17:  3mtw-A 10.0  3.6  166   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  18:  2y1h-B 10.0  3.1  167   265   11 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  19:  3mkv-A  9.9  3.0  168   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  20:  3cjp-A  9.8  3.4  174   262   16 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  21:  2ffi-A  9.8  3.1  178   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  22:  4mup-B  9.8  3.3  179   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  23:  3k2g-B  9.7  3.4  182   358   10 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  24:  1j6p-A  9.4  3.1  169   407    9 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  25:  4c5y-A  9.4  3.5  172   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  26:  1gkp-A  9.3  3.8  192   458   11 PDB  MOLECULE: HYDANTOINASE;                                              
  27:  4rdv-B  9.3  3.1  168   451    8 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  28:  4b3z-D  9.3  4.0  195   477   13 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  29:  1bf6-A  9.2  3.7  176   291    8 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  1a4m-A  9.1  3.3  176   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  31:  2dvt-A  9.1  4.6  187   325    9 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  32:  2yb1-A  9.0  3.8  165   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  33:  3icj-A  9.0  3.3  165   468   11 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  34:  2vc5-A  8.9  3.7  171   314    9 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  35:  3f2b-A  8.8  3.5  155   994   15 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  36:  3e38-A  8.8  3.7  162   342   15 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  37:  1onx-A  8.7  3.4  177   390    9 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  38:  3irs-A  8.5  3.3  173   281    6 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  39:  1yrr-B  8.5  3.7  174   334   10 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  40:  3nqb-A  8.5  3.2  162   587    7 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  41:  2ob3-A  8.4  3.6  167   329    8 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  42:  4hk5-D  8.2  3.8  180   380   10 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  43:  4qrn-A  8.2  3.7  178   352    6 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  44:  4ofc-A  8.2  3.5  169   335    7 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  45:  3gri-A  8.0  4.0  177   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  46:  2ogj-A  8.0  3.4  166   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  47:  3e74-A  7.7  4.2  186   429   10 PDB  MOLECULE: ALLANTOINASE;                                              
  48:  3pnu-A  7.5  4.3  175   338   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  49:  3ooq-A  7.3  3.5  159   384   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  1itq-A  7.2  3.7  174   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  51:  3giq-A  7.2  4.0  178   475   10 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  52:  4dzi-C  7.0  3.6  174   388    7 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  53:  1bks-A  7.0  3.7  156   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  54:  1a5k-C  6.3  3.4  155   566   14 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  55:  2gwg-A  6.2  4.5  159   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  56:  2qpx-A  6.1  4.0  156   376   14 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  57:  1j5s-A  6.1  3.6  168   451    8 PDB  MOLECULE: URONATE ISOMERASE;                                         
  58:  2a3l-A  5.9  3.4  163   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  59:  3iac-A  5.5  3.9  170   469    7 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3dcpA Sbjct=3dcpA Z-score=52.6

back to top
DSSP  LLEEEEELLLLLLLLLLLLHHHHHHHHHHLLLLEEEEEEELLLLHHHHHLLLLLLHHHHL
Query XKRDGHTHTEFCPHGTHDDVEEXVLKAIELDFDEYSIVEHAPLSSEFXKNTAGDKEAVTT   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct XKRDGHTHTEFCPHGTHDDVEEXVLKAIELDFDEYSIVEHAPLSSEFXKNTAGDKEAVTT   60
DSSP  LLEEEEELLLLLLLLLLLLHHHHHHHHHHLLLLEEEEEEELLLLHHHHHLLLLLLHHHHL


DSSP  LLLLHHHHHHHHHHHHHHHHHLLLLLEEEEEEEEELLLLLHHHHHHHHHHHHHHLLEEEE
Query ASXAXSDLPYYFKKXNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ASXAXSDLPYYFKKXNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVL  120
DSSP  LLLLHHHHHHHHHHHHHHHHHLLLLLEEEEEEEEELLLLLHHHHHHHHHHHHHHLLEEEE


DSSP  ELLEEEELLEEEELLLLHHHHHHHLHHHHLLHHHHHHHHHHHHHHHHHLLLLLLLLLEEL
Query SLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRXG  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRXG  180
DSSP  ELLEEEELLEEEELLLLHHHHHHHLHHHHLLHHHHHHHHHHHHHHHHHLLLLLLLLLEEL


DSSP  LLLHHHLLHHHHLLLHHHLLHHHHHHHHHHHHHHHHHLLEEEEELHHHHLLLLLLLLLLH
Query HISLCQKFQQFFGEDTSDFSEEVXEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPK  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HISLCQKFQQFFGEDTSDFSEEVXEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPK  240
DSSP  LLLHHHLLHHHHLLLHHHLLHHHHHHHHHHHHHHHHHLLEEEEELHHHHLLLLLLLLLLH


DSSP  HHHHHHHHLLLLEEEELLLLLHHHLLLLHHHHHHHLL
Query KIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQKLE  277
ident |||||||||||||||||||||||||||||||||||||
Sbjct KIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQKLE  277
DSSP  HHHHHHHHLLLLEEEELLLLLHHHLLLLHHHHHHHLL


No 2: Query=3dcpA Sbjct=3au2A Z-score=18.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------LLEEEEELLLLLllLLLLLHHHHH
Query ------------------------------------XKRDGHTHTEFCphGTHDDVEEXV   24
ident                                      | |   |            ||  
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTYS--DGQNTLEELW  358
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLLL--LLLLLHHHHH


DSSP  HHHHHLLLLEEEEEEELLLlhhhhhllllllhHHHLlLLLHHHHHHHHHHHHHHHHHLLl
Query LKAIELDFDEYSIVEHAPLssefxkntagdkeAVTTaSXAXSDLPYYFKKXNHIKKKYAs   84
ident   |            | |               |                          
Sbjct EAAKTMGYRYLAVTDHSPA------------vRVAG-GPSPEEALKRVGEIRRFNETHG-  404
DSSP  HHHHHHLLLEEEEEEELHH------------hHLLL-LLLHHHHHHHHHHHHHHHHHHL-


DSSP  LLEEEEEEEEELLLLLHhhhhhHHHHHHHHLLEEEEELLEEEElleeeellllhhhhhhh
Query DLLIHIGFEVDYLIGYEdftrdFLNEYGPQTDDGVLSLHFLEGqggfrsidfsaedyneg  144
ident       | |||                    |    | |                     
Sbjct PPYLLAGAEVDIHPDGT---ldYPDWVLRELDLVLVSVHSRFN-----------------  444
DSSP  LLEEEEEEEEELLLLLL---llLLHHHHLLLLEEEEELLLLLL-----------------


DSSP  lhhhhllhhhHHHHHHHHHHHHHHLLllllLLLEELLLLHhHLLHHhhlllhhhllhhhh
Query ivqfyggfeqAQLAYLEGVKQSIEADlglfKPRRXGHISLcQKFQQffgedtsdfseevx  204
ident                        |            |                       
Sbjct ---------lPKADQTKRLLKALENP----FVHVLAHPTA-RLLGR---------rapie  481
DSSP  ---------lLHHHHHHHHHHHHLLL----LLLEELLLLL-LLLLL---------lllll


DSSP  hHHHHHHHHHHHHLLEEEEELHHHhlllllLLLLLHHHHHHHHHLLLLEEEELLLLLHHH
Query eKFRVILALVKKRDYELDFNTAGLfkplcgETYPPKKIVTLASELQIPFVYGSDSHGVQD  264
ident           |                       |      |           | |    
Sbjct aDWEAVFQKAKEKGVAVEIDGYYD------RMDLPDDLARMAYGMGLWISLSTDAHQTDH  535
DSSP  lLHHHHHHHHHHHLLEEEEELLLL------LLLLLHHHHHHHHHLLLLEEEELLLLLHHH


DSSP  lLLLHHHHHHHLL----------------------------
Query iGRGYSTYCQKLE----------------------------  277
ident   |                                      
Sbjct -LRFMELAVGTAQrawigpervlntldyedllswlkarrgv  575
DSSP  -HHHHHHHHHHHHhllllllllhhhllhhhhhhhhhlllll


No 3: Query=3dcpA Sbjct=1m65A Z-score=17.3

back to top
DSSP  LLEEEEELLLLLLLLLlLLHHHHHHHHHHLLLLEEEEEEELLLlhhhhhllllllhhhhL
Query XKRDGHTHTEFCPHGThDDVEEXVLKAIELDFDEYSIVEHAPLssefxkntagdkeavtT   60
ident    | | ||    |            |         |  | |                  
Sbjct YPVDLHMHTVASTHAY-STLSDYIAQAKQKGIKLFAITDHGPD---------------mE   44
DSSP  LLEELLLLLLLLLLLL-LLHHHHHHHHHHHLLLEEEEEEELLL---------------lL


DSSP  LLLLHHHHHHHHHhhHHHHhhlLLLLEEEEEEEEELLLLlhhhhhhHHHHHHHHLLEEEE
Query ASXAXSDLPYYFKkxNHIKkkyASDLLIHIGFEVDYLIGyedftrdFLNEYGPQTDDGVL  120
ident                            |  | |                      |    
Sbjct DAPHHWHFINMRI--WPRV---VDGVGILRGIEANIKNV--dgeidCSGKMFDSLDLIIA   97
DSSP  LLLLLHHHHHHHH--LLLE---ELLEEEEEEEEEELLLL--lllllLLHHHHHHLLEEEE


DSSP  ELL---EEEElleeeellllhhhhhhhlhhhhllhhhHHHHHHHHHHHHHHLLllllLLL
Query SLH---FLEGqggfrsidfsaedynegivqfyggfeqAQLAYLEGVKQSIEADlglfKPR  177
ident   |   |                                          |          
Sbjct GFHepvFAPH---------------------------DKATNTQAMIATIASG----NVH  126
DSSP  ELLlllLLLL---------------------------LHHHHHHHHHHHHHLL----LLL


DSSP  EELLLLHHHllhhhhlllhhhllhhhhhHHHHHHHHHHHHLLEEEEELHHhhllllllll
Query RXGHISLCQkfqqffgedtsdfseevxeKFRVILALVKKRDYELDFNTAGlfkplcgety  237
ident    |                                  |    |  |             
Sbjct IISHPGNPK----------------yeiDVKAVAEAAAKHQVALEINNSS----------  160
DSSP  EELLLLLLL----------------lllLHHHHHHHHHHHLLEEEEELLL----------


DSSP  LLHHHHHHHHHLLLLEEEELLLLLHHHLLLlHHHHHHHLL--------------------
Query PPKKIVTLASELQIPFVYGSDSHGVQDIGRgYSTYCQKLE--------------------  277
ident                   |||||     |         |                     
Sbjct NCREVAAAVRDAGGWVALGSDSHTAFTMGE-FEECLKILDavdfpperilnvsprrllnf  219
DSSP  LHHHHHHHHHHHLLLEEEELLLLLHHHLLL-LHHHHHHHHhllllhhhlhhhlhhhhhhh


DSSP  ---------------
Query ---------------  277
ident                
Sbjct lesrgmapiaefadl  234
DSSP  hhhllllllhhhlll


No 4: Query=3dcpA Sbjct=3qy6A Z-score=12.5

back to top
DSSP  lLEEEEEL-LLLLLLLLLL--LHHHHHHHHHHLLLLEEEEEEELLLlhhhhhllllllhh
Query xKRDGHTH-TEFCPHGTHD--DVEEXVLKAIELDFDEYSIVEHAPLssefxkntagdkea   57
ident    | | |       |  |  |  |    |            |                 
Sbjct -MIDIHCHiLPAMDDGAGDsaDSIEMARAAVRQGIRTIIATPHHNN--------------   45
DSSP  -LEELLLLlLLLLLLLLLLhhHHHHHHHHHHHLLLLEEELLLEELL--------------


DSSP  hHLLLLlhhHHHHHHHHHHHHHHHLL---LLLEEEEEEEEELLLllhhHHHHHHHHHhhH
Query vTTASXaxsDLPYYFKKXNHIKKKYA---SDLLIHIGFEVDYLIgyedFTRDFLNEYgpQ  114
ident                       |        |    | |              |      
Sbjct -GVYKN---EPAAVREAADQLNKRLIkedIPLHVLPGQEIRIYG----EVEQDLAKR-qL   96
DSSP  -LLLLL---LHHHHHHHHHHHHHHHHhllLLLEEELLLEEELLL----LHHHHHHLL-lL


DSSP  LLE-----EEEELLEeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHhHHHHH-
Query TDD-----GVLSLHFlegqggfrsidfsaedynegivqfyggfeqaqlaYLEGvKQSIE-  168
ident               |                                             
Sbjct LSLndtkyILIEFPF----------------------------------DHVP-RYAEQl  121
DSSP  LLHhhlleEEEELLL----------------------------------LLLL-LLHHHh


DSSP  -LLLL--LLLLlEELLLLHHhllhhhhlllhhhllhhhhHHHHhHHHHHHHHLLEEEEEL
Query -ADLG--LFKPrRXGHISLCqkfqqffgedtsdfseevxEKFRvILALVKKRDYELDFNT  225
ident   ||      |    |                       |     |              
Sbjct fYDLQlkGYIP-VIAHPERN---------------reirENPS-LLYHLVEKGAASQITS  164
DSSP  hHHHHhlLLEE-EEELHHHL---------------hhhhHLLH-HHHHHHHLLLEEEEEH


DSSP  HH--HHLLLLLLlllLHHHHHHHhhllLLEEEELLLLLHH-HLLLlHHHHHHHLL-----
Query AG--LFKPLCGEtypPKKIVTLAselqIPFVYGSDSHGVQ-DIGRgYSTYCQKLE-----  277
ident                    |             || | |              ||     
Sbjct GSlaGIFGKQLK-afSLRLVEAN----LIHFVASDAHNVKtRNFH-TQEALYVLEkefgs  218
DSSP  HHhlLLLLHHHH-hhHHHHHHLL----LLLEEELLLLLLLlLLLL-HHHHHHHHHhhhll


DSSP  -----------------------------
Query -----------------------------  277
ident                              
Sbjct elpymltenaelllrnqtifrqppqpvkr  247
DSSP  hhhhhhhhhhhhhhlllllllllllllll


No 5: Query=3dcpA Sbjct=1v77A Z-score=12.3

back to top
DSSP  -LLEEEEELLllllllllllhHHHHHHHHHLlLLEEEEEEELLLLhhhhhllllllhhhh
Query -XKRDGHTHTefcphgthddvEEXVLKAIELdFDEYSIVEHAPLSsefxkntagdkeavt   59
ident                       |    | |  |||                         
Sbjct vKFIEMDIRD-----------KEAYELAKEW-FDEVVVSIKFNEE---------------   33
DSSP  lLLEEEEELL-----------HHHHHHHHHH-LLEEEEEEEELLL---------------


DSSP  lllllhhHHHHHHHHHHHHHhhllllleeEEEEEEELLLllHHHHHHHHHHhHHHLlEEE
Query tasxaxsDLPYYFKKXNHIKkkyasdlliHIGFEVDYLIgyEDFTRDFLNEyGPQTdDGV  119
ident        |                                     ||             
Sbjct ------vDKEKLREARKEYG---------KVAILLSNPK--PSLVRDTVQK-FKSY-LIY   74
DSSP  ------lLHHHHHHHHHHHL---------LEEEEEELLL--HHHHHHHHHH-LLLL-EEE


DSSP  EELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhhhHHHHHHLlllllLLLEE
Query LSLHflegqggfrsidfsaedynegivqfyggfeqaqlaylegVKQSIEAdlglfKPRRX  179
ident                                                |            
Sbjct VESN---------------------------------------DLRVIRY-siekGVDAI   94
DSSP  EELL---------------------------------------LHHHHHH-hhhlLLLEE


DSSP  LLLLHHHllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEELHHHHLLL---LLLL
Query GHISLCQkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNTAGLFKPL---CGET  236
ident                              |   |  |    | |    |           
Sbjct ISPWVNR---------------kdpgiDHVLAKLMVKKNVALGFSLRPLLYSNpyeRANL  139
DSSP  ELLLLLL---------------lllllLHHHHHHHHHHLLEEEEELHHHHHLLhhhHHHH


DSSP  -lLLHHHHHHHHHLLLLEEEELLLLLHHHLL--lLHHHHH-HHLL---------------
Query -yPPKKIVTLASELQIPFVYGSDSHGVQDIG--rGYSTYC-QKLE---------------  277
ident      |   |           |      |                               
Sbjct lrFMMKAWKLVEKYKVRRFLTSSAQEKWDVRyprDLISLGvVIGMeipqakasismypei  199
DSSP  hhHHHHHHHHHHHHLLLEEEELLLLLHHHLLlhhHHHHHHhHLLLlhhhhhhlllhhhhh


DSSP  ---
Query ---  277
ident    
Sbjct ilk  202
DSSP  hhl


No 6: Query=3dcpA Sbjct=4cqbA Z-score=12.0

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------XKRDGHT    7
ident                                                         | ||
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  LLLLlllLLLL------------------------------------LHHHHHHHHHHLL
Query HTEFcphGTHD------------------------------------DVEEXVLKAIELD   31
ident |                                               | |         
Sbjct HMDK---SFTStgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHG  117
DSSP  LHHH---LLLLllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLL


DSSP  LLEEEEEEellllhhhhhllllllhhhhllLLLHHHHHHHHHHHHHHHHHLLLLLEEEEE
Query FDEYSIVEhaplssefxkntagdkeavttaSXAXSDLPYYFKKXNHIKKKYASDLLIHIG   91
ident                                                |        |   
Sbjct TLYTRTHV----------------------DVDSVAKTKAVEAVLEAKEELKDLIDIQVV  155
DSSP  EEEEEEEE----------------------ELLLLLLLHHHHHHHHHHHHLLLLLEEEEE


DSSP  E---------------------------EEELL------LLLH-HHHHHHHHHHHHhlle
Query F---------------------------EVDYL------IGYE-DFTRDFLNEYGPqtdd  117
ident                                             |       ||      
Sbjct AfaqsgffvdleseslirksldmgcdlvGGVDPatrennVEGSlDLCFKLAKEYDV---d  212
DSSP  EellllllllllhhhhhhhhhhhllleeELLLLllllllHHHHhHHHHHHHHHLLL---e


DSSP  eEEELLEeeelleeeellllhhhhhhhlhhhhllhhhhHHHHHHHHHHHHHL--LLLLll
Query gVLSLHFlegqggfrsidfsaedynegivqfyggfeqaQLAYLEGVKQSIEA--DLGLfk  175
ident      |                                                  |   
Sbjct iDYHIHD------------------------------iGTVGVYSINRLAQKtiENGYkg  242
DSSP  eEEEELL------------------------------lHHHHHHHHHHHHHHhhHLLLll


DSSP  LLEELLLLHhhllhhhhlllhhhllhhHHHHHHHHHHHHHHHLLEEEEELHHhhllllll
Query PRRXGHISLcqkfqqffgedtsdfseeVXEKFRVILALVKKRDYELDFNTAGlfkplcge  235
ident      |                       |       | |                    
Sbjct RVTTSHAWC--------------fadaPSEWLDEAIPLYKDSGMKFVTCFSS--------  280
DSSP  LEEEEELLH--------------hhhlLHHHHHHHHHHHHHHLLEEEEELLL--------


DSSP  lLLLHHHHHHHHHLLLLEEEELLLLL-----hHHLLL--LHHHHH----------HHLL-
Query tYPPKKIVTLASELQIPFVYGSDSHG-----vQDIGR--GYSTYC----------QKLE-  277
ident   ||   |    |  |     ||                |                 |  
Sbjct -TPPTMPVIKLLEAGINLGCASDNIRdfwvpfGNGDMvqGALIETqrlelktnrdLGLIw  339
DSSP  -LLLLLLHHHHHHLLLEEEEELLLLLllllllLLLLHhhHHHHHHhhhllllhhhHHHHh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct kmitsegarvlgieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdev  399
DSSP  hhhlhhhhhhhllhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelle


DSSP  ---
Query ---  277
ident    
Sbjct iva  402
DSSP  ell


No 7: Query=3dcpA Sbjct=1k6wA Z-score=11.5

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------XKRDGHTH    8
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL


DSSP  LLllllLLLL---------------------------------LHHHHHHHHHHLLLLEE
Query TEfcphGTHD---------------------------------DVEEXVLKAIELDFDEY   35
ident        |                                            |       
Sbjct LD----TTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHV  116
DSSP  LL----LLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEE


DSSP  EEEEELLllhhhhhllllllhhhhlllllHHHHhHHHHHHHHHHHHLLLLLEEEEEEE--
Query SIVEHAPlssefxkntagdkeavttasxaXSDLpYYFKKXNHIKKKYASDLLIHIGFE--   93
ident                                 |    |     |   |      |     
Sbjct RTHVDVS----------------------DATL-TALKAMLEVKQEVAPWIDLQIVAFpq  153
DSSP  EEEEELL----------------------LLLL-HHHHHHHHHHHHHLLLLEEEEEEEll


DSSP  ------------------------EELL--------LLLH-HHHHHHH-HHHHhhlleeE
Query ------------------------VDYL--------IGYE-DFTRDFL-NEYGpqtddgV  119
ident                                            |                
Sbjct egilsypngealleealrlgadvvGAIPhfeftreyGVESlHKTFALAqKYDR----liD  209
DSSP  llllllllhhhhhhhhhhlllleeEELHhhlllhhhHHHHhHHHHHHHhHHLL----eeE


DSSP  EELLeeeelleeeellllhhhhhhhlhhhhllhhhhHHHHHhHHHHHHHLLL--llllLL
Query LSLHflegqggfrsidfsaedynegivqfyggfeqaQLAYLeGVKQSIEADL--glfkPR  177
ident                                            |                
Sbjct VHCD-----------------------------eidDEQSR-FVETVAALAHhegmgaRV  239
DSSP  EEEL-----------------------------lllLLLLL-HHHHHHHHHHhhllhhHE


DSSP  EELLLLHHHllhhhhlllhhhllhhHHHHHHHHHHHHHHHLLEEEEEL-HHHHLLLL---
Query RXGHISLCQkfqqffgedtsdfseeVXEKFRVILALVKKRDYELDFNT-AGLFKPLC---  233
ident    |                               | |        |             
Sbjct TASHTTAMH--------------syNGAYTSRLFRLLKMSGINFVANPlVNIHLQGRfdt  285
DSSP  EEEELHHHH--------------hlLHHHHHHHHHHHHHHLLEEEELHhHHHHHLLLlll


DSSP  ---lLLLLlhhHHHHHHHLLLLEEEELLLLL-----hHHLLL--LHHHHHHHLL------
Query ---gETYPpkkIVTLASELQIPFVYGSDSHG-----vQDIGR--GYSTYCQKLE------  277
ident             |    |  |    | |                                
Sbjct ypkrRGIT---RVKEMLESGINVCFGHDDVFdpwyplGTANMlqVLHMGLHVCQlmgygq  342
DSSP  llllLLLL---LHHHHHHLLLLEEELLLLLLllllllLLLLHhhHHHHHHHHLLlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct indglnlithhsartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkvia  402
DSSP  hhhhhhhhlhhhhhhllllllllllllllleeeellllhhhhhhhllllleeeelleeee


DSSP  ---------------------
Query ---------------------  277
ident                      
Sbjct stqpaqttvyleqpeaidykr  423
DSSP  ellllleeeellleeeellll


No 8: Query=3dcpA Sbjct=2oofA Z-score=11.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --LLEEEEELLLLLLL-------------------------------------llllLHH
Query --XKRDGHTHTEFCPH-------------------------------------gthdDVE   21
ident      | |||  |                                               
Sbjct tpGLIDCHTHLIFAGSraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  eeLEEEEEELLLLLLLlhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHLLLLEEEEEEEllllhhhhhllllllhhhhllLLLHH-HHHHHHHHHHHHHH
Query EXVLKAIELDFDEYSIVEHaplssefxkntagdkeavttaSXAXS-DLPYYFKKXNHIKK   80
ident   |   |        |                              |             
Sbjct PRVKSLIREGVTTVEIKSG---------------------YGLTLeDELKXLRVARRLGE  159
DSSP  HHHHHHHHHLEEEEEEELL---------------------LLLLHhHHHHHHHHHHHHHH


DSSP  HLllLLEEEEEE--------------------------------------EEEL-----L
Query KYasDLLIHIGF--------------------------------------EVDY-----L   97
ident                                                    |        
Sbjct AL--PIRVKTTLlaahavppeyrddpdswveticqeiipaaaeagladavDVFCehigfS  217
DSSP  HL--LLEEEEEEeeellllhhhlllhhhhhhhhhhlhhhhhhhllllleeEEEElllllL


DSSP  LLL-HHHHHHHHHHHHhhlleeEEELleeeelleeeellllhhhhhhhlhhhhllhhhhh
Query IGY-EDFTRDFLNEYGpqtddgVLSLhflegqggfrsidfsaedynegivqfyggfeqaq  156
ident     |                                                       
Sbjct LAQtEQVYLAADQYGL----avKGHX---------------------------------d  240
DSSP  HHHhHHHHHHHHHLLL----eeEEEE---------------------------------l


DSSP  hhHHHHhhhHHHLlllllLLLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHHHH
Query laYLEGvkqSIEAdlglfKPRRXGHISlcqkfqqffgedtsdfseevxekFRVILALVKK  216
ident      |                  |                                   
Sbjct qlSNLG---GSTL-aanfGALSVDHLE---------------------ylDPEGIQALAH  275
DSSP  llLLLL---HHHH-hhhlLLLEEEELL---------------------llLHHHHHHHHH


DSSP  HLLEEEEEL-HHHHLlLLLLllllhhHHHHHHHLLLLEEEELLLLL--hHHLL--LLHHH
Query RDYELDFNT-AGLFKpLCGEtyppkkIVTLASELQIPFVYGSDSHG--vQDIG--RGYST  271
ident |         |  |             |        |    ||                 
Sbjct RGVVATLLPtAFYFL-KETK----lpPVVALRKAGVPXAVSSDINPgtaPIVSlrXAXNX  330
DSSP  HLLEEEELHhHHHHL-LLLL----llLHHHHHHLLLLEEELLLLLLlllLLLLhhHHHHH


DSSP  HH--HHLL----------------------------------------------------
Query YC--QKLE----------------------------------------------------  277
ident  |    |                                                     
Sbjct ACtlFGLTpveaxagvtrhaaralgeqeqlgqlrvgxladflvwncghpaelsyligvdq  390
DSSP  HHhhHLLLhhhhhhhllhhhhhhllllllllllllllllleeeellllllhhhhllllll


DSSP  -------------
Query -------------  277
ident              
Sbjct lvsrvvngeetlh  403
DSSP  eeeeeelleelll


No 9: Query=3dcpA Sbjct=2anuA Z-score=11.0

back to top
DSSP  ---LLEEEEELLLLLlLLLLlLHHHHHHHHHHLLLLEEEEEEELLLLHHHHHlllLLLHh
Query ---XKRDGHTHTEFCpHGTHdDVEEXVLKAIELDFDEYSIVEHAPLSSEFXKntaGDKEa   57
ident       | | ||     |      | |        |  ||  |               | 
Sbjct tewLLCDFHVHTNXS-DGHL-PLGEVVDLFGKHGVDVVSITDHIVDRRTLEQ-rkRNGE-   56
DSSP  leeEEEEEEELLLLL-LLLL-LHHHHHHHHHHLLLLEEEEEEEEELHHHHHH-hhHLLL-


DSSP  hHLLLLLHHHHHHHHHHHHHHHHHLLL--LLEEEEEEEEELLLLlhhhhhhhhhHHHHhl
Query vTTASXAXSDLPYYFKKXNHIKKKYAS--DLLIHIGFEVDYLIGyedftrdflnEYGPqt  115
ident              | |      |            | |                      
Sbjct -PLGAITEDKFQDYLKRLWREQKRAWEeyGXILIPGVEITNNTD-lyhivavdvKEYV--  112
DSSP  -LLLLLLLLLHHHHHHHHHHHHHHHHHhhLLEEEEEEEEEELLL-leeeeeellLLLL--


DSSP  leeeeelleeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhhhhhhhhHLLL-LLL
Query ddgvlslhflegqggfrsidfsaedynegivqfyggfeqaqlaylegvkqsiEADL-GLF  174
ident                                                             
Sbjct -----------------------------------------------dpslpVEEIvEKL  125
DSSP  -----------------------------------------------lllllHHHHhHHH


DSSP  L----LLEELLLlHHHLlhhhhlllhhhllhhhhhhhhHHHHHHhHHLL-EEEEELHHhh
Query K----PRRXGHIsLCQKfqqffgedtsdfseevxekfrVILALVkKRDY-ELDFNTAGlf  229
ident |         |     |                            |              
Sbjct KeqnaLVIAAHP-DRKK---------------lswylwANXERF-KDTFdAWEIANRD--  166
DSSP  HhlllEEEELLL-LLLL---------------lllhhhHLLLLL-LLLLlEEEEEELL--


DSSP  llllllLLLLhhHHHHHHhllLLEEEELLLLLHHHLLLLH--------------------
Query kplcgeTYPPkkIVTLASelqIPFVYGSDSHGVQDIGRGY--------------------  269
ident              |          |  || |                             
Sbjct ------DLFN--SVGVKK---YRYVANSDFHELWHVYSWKtlvkseknieaikeairknt  215
DSSP  ------EELH--HHHHLL---LLEEEELLLLLHHHHLLEEeeeeelllhhhhhhhhhhll


DSSP  -HHHHhhll
Query -STYCqkle  277
ident          
Sbjct dVAIYlxrk  224
DSSP  lEEEEelll


No 10: Query=3dcpA Sbjct=2imrA Z-score=10.5

back to top
DSSP  -------------------------------------------------------LLEEE
Query -------------------------------------------------------XKRDG    5
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  EELLLLLLL-----------------LLLL----LHHHHHHHHHHLLLLEEEEEEellll
Query HTHTEFCPH-----------------GTHD----DVEEXVLKAIELDFDEYSIVEhapls   44
ident |||                       | |                |              
Sbjct HTHLDMSAYefqalpyfqwipevvirGRHLrgvaAAQAGADTLTRLGAGGVGDIV-----  115
DSSP  EEELLLLHHhhhhlhhhhllhhhhhhHLLLlhhhHHHHHHHHHHHLLLLLEEEEE-----


DSSP  hhhhhllllllhhhhlllllhhhhhhHHHHHHHHHHHllLLLEEEE--------------
Query sefxkntagdkeavttasxaxsdlpyYFKKXNHIKKKyaSDLLIHI--------------   90
ident                                         ||                  
Sbjct -------------------------wAPEVMDALLAR--EDLSGTLyfevlnpfpdkade  148
DSSP  -------------------------lLHHHHHHHHLL--LLLLEEEeeeellllhhhhhh


DSSP  ----------------------EEEE-ELLLlLHHHHHHHHHHH-HHHLlEEEEEL----
Query ----------------------GFEV-DYLIgYEDFTRDFLNEY-GPQTdDGVLSL----  122
ident                       |              |       |              
Sbjct vfaaarthlerwrrlerpglrlGLSPhTPFTvSHRLMRLLSDYAaGEGL-PLQIHVaehp  207
DSSP  hhhhhhhhhhhhhlllllleeeEEEElLLLLlLHHHHHHHHHHHhHHLL-LLEEEElllh


DSSP  lEEEElleeeellllhHHHHHH--------lhhhhllhhhHHHHhhHHHHHHHHLLLlll
Query hFLEGqggfrsidfsaEDYNEG--------ivqfyggfeqAQLAylEGVKQSIEADLglf  174
ident   ||                                            |    |      
Sbjct tELEM------frtggGPLWDNrmpalyphtlaevigrepGPDL--TPVRYLDELGV-la  258
DSSP  hHHHH------hhhllLLLHHHllhhhllllhhhhhllllLLLL--LHHHHHHHHLL-hh


DSSP  LLLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEEL-HHHHLllL
Query KPRRXGHISLcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNT-AGLFKplC  233
ident       |                              | |                    
Sbjct ARPTLVHMVN---------------------vTPDDIARVARAGCAVVTCPrSNHHL--E  295
DSSP  HLLEEEELLL---------------------lLHHHHHHHHHHLLLEEELHhHHHHL--L


DSSP  LLLLllhhHHHHHHHLLLLEEEELLLLL-hHHLLL--LHHHHHHHLL-------------
Query GETYppkkIVTLASELQIPFVYGSDSHG-vQDIGR--GYSTYCQKLE-------------  277
ident   |                   | ||                 |                
Sbjct CGTF----DWPAFAAAGVEVALGTDSVAsgETLNVreEVTFARQLYPgldprvlvraavk  351
DSSP  LLLL----LHHHHHHLLLLEEELLLLHHhhLLLLLhhHHHHHHHHLLlllhhhhhhhhhh


DSSP  -----------------------------
Query -----------------------------  277
ident                              
Sbjct ggqrvvgtpflrrgetwqegfrwelsrdl  380
DSSP  hhhhhhllllllllllllhhhlhhhllll


No 11: Query=3dcpA Sbjct=4dlfA Z-score=10.5

back to top
DSSP  -LLEEEEELLLL-------------llLLLLLLHHHHHHHHHHLLLLEEEEEEELLllhh
Query -XKRDGHTHTEF-------------cpHGTHDDVEEXVLKAIELDFDEYSIVEHAPlsse   46
ident     | | |                                          |        
Sbjct aLRIDSHQHFWRyraadypwigagmgvLARDYLPDALHPLMHAQALGASIAVQARA----   56
DSSP  lLLEEEEELLLLllhhhllllllllhhHLLLLLHHHHHHHHHHLLLLEEEEELLLL----


DSSP  hhhllllllhhhhlllllhhhHHHHHHHHHHHHHHLLllLEEEEE---------------
Query fxkntagdkeavttasxaxsdLPYYFKKXNHIKKKYAsdLLIHIG---------------   91
ident                                     |                       
Sbjct ---------------------GRDETAFLLELACDEA--RIAAVVgwedlrapqlaerva   93
DSSP  ---------------------LHHHHHHHHHHHLLLL--LEEEEEellllllllhhhhhh


DSSP  ---------EEEEL-----LLLLH--HHHHHHHHHHHHhllEEEEELleeeelleeeell
Query ---------FEVDY-----LIGYE--DFTRDFLNEYGPqtdDGVLSLhflegqggfrsid  135
ident          |                                                  
Sbjct ewrgtklrgFRHQLqdeadVRAFVddADFARGVAWLQAndyVYDVLV-------------  140
DSSP  lllllleeeEEELHhhlllHHHHHhlHHHHHHHHHHHHlllEEEELL-------------


DSSP  llhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHL--LLLLLllLEELL-LLHHHllhhhh
Query fsaedynegivqfyggfeqaqlaYLEGVKQSIEA--DLGLFkpRRXGH-ISLCQkfqqff  192
ident                                                |            
Sbjct -----------------------FERQLPDVQAFcaRHDAH-wLVLDHaGKPAL------  170
DSSP  -----------------------LHHHHHHHHHHhhHLLLL-lEEEHHhHLLLH------


DSSP  llLHHHLLHHHHHHHHHHHHHHHHHL-LEEEEElHHHH----lLLLL--llllLHHHHHH
Query geDTSDFSEEVXEKFRVILALVKKRD-YELDFNtAGLF----kPLCG--etypPKKIVTL  245
ident      |         |  |                                         
Sbjct --AEFDRDDTALARWRAALRELAALPhVVCKLS-GLVTeadwrRGLRasdlrhIEQCLDA  227
DSSP  --HHLLLLLLHHHHHHHHHHHHHLLLlEEEEEL-LLLLlllllLLLLhhhhhhHHHHHHH


DSSP  HHHLLL--LEEEELLLL---lhhHLLLLHHHHHHHLL-----------------------
Query ASELQI--PFVYGSDSH---gvqDIGRGYSTYCQKLE-----------------------  277
ident |           |||              |      |                       
Sbjct ALDAFGpqRLMFGSDWPvcllaaSYDEVASLVERWAEsrlsaaersalwggtaarcyalp  287
DSSP  HHHHHLhhHEEELLLLLhhhhllLHHHHHHHHHHHHHhhllhhhhhhhllhhhhhhllll


No 12: Query=3dcpA Sbjct=2pajA Z-score=10.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  -LLEEEEELLLllllLLLL----------------LHHHHHHHHHHLLLLEEEEEEElll
Query -XKRDGHTHTEfcphGTHD----------------DVEEXVLKAIELDFDEYSIVEHapl   43
ident       | |                                                   
Sbjct pAWVNTHHHLF----QSLLkgepfralfderrfrlAARIGLIELARSGCATVADHNY---  113
DSSP  eLEELLLLLHH----HHHLlllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLL---


DSSP  lhhhhhllllllhhhhllLLLHHHHHHHHHHHHHHHHHLLllLEEEEEEE----------
Query ssefxkntagdkeavttaSXAXSDLPYYFKKXNHIKKKYAsdLLIHIGFE----------   93
ident                                      |    |                 
Sbjct ------------------VYYPGMPFDSSAILFEEAEKLG--LRFVLLRGgatqtrqlea  153
DSSP  ------------------LLLLLLLLLHHHHHHHHHHHLL--LEEEEEELllllllllll


DSSP  ----------------------------------------EELLLL-LHHHHHHHHHHHH
Query ----------------------------------------VDYLIG-YEDFTRDFLNEYG  112
ident                                            |        |       
Sbjct dlptalrpetldayvadierlaaryhdaspramrrvvmapTTVLYSiSPREMRETAAVAR  213
DSSP  lllhhhllllhhhhhhhhhhhhhhllllllllleeeeellLLLLLLlLHHHHHHHHHHHH


DSSP  hhlleeEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhHHHHHHhHLLLl
Query pqtddgVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaylEGVKQSiEADLg  172
ident          |                                        |         
Sbjct rlglrmHSHLS-----------------------------------gkSPVAFC-GEHDw  237
DSSP  hllleeEEELL-----------------------------------llLHHHHH-HHLLl


DSSP  llllLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEEL-HHHHLl
Query lfkpRRXGHISLcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNT-AGLFKp  231
ident         |                              ||                   
Sbjct lgsdVWYAHLVK---------------------vDADEIALLAQTGTGVAHCPqSNGRL-  275
DSSP  llllEEEELLLL---------------------lLHHHHHHHHHHLLEEEELHhHHHLL-


DSSP  llllllllhhHHHHHHHLLLLEEEELLLLL-hHHLL--LLHHHHHHHLL-----------
Query lcgetyppkkIVTLASELQIPFVYGSDSHG-vQDIG--RGYSTYCQKLE-----------  277
ident            |        |   | |                                 
Sbjct ----------PVREMADAGVPVSIGVDGAAsnEAADmiSEVHMTWLAQRarlasiaevih  325
DSSP  ----------LLLLHHHHLLLEEELLLHHHhlLLLLhhHHHHHHHHHHHhllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct wgtaggarvmgldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfs  385
DSSP  hhlhhhhhhhllllllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeee


DSSP  ------------------------------------
Query ------------------------------------  277
ident                                     
Sbjct agkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  lleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 13: Query=3dcpA Sbjct=3ls9A Z-score=10.2

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------XKR    3
ident                                                             
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  EEEELLLllllLLLL--------------------------------------LHHHHHH
Query DGHTHTEfcphGTHD--------------------------------------DVEEXVL   25
ident   | |                                                      |
Sbjct NSHQHLY----EGAMraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLL  116
DSSP  EEEELHH----HHHHlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHH


DSSP  HHHHLLLLEEEEEEEllllhhhhhllllllhhhhllLLLH-HHHHhHHHHHHHHHHHLLl
Query KAIELDFDEYSIVEHaplssefxkntagdkeavttaSXAX-SDLPyYFKKXNHIKKKYAs   84
ident                                               |             
Sbjct ESLLGGITTVADQHL---------------------FFPGaTADS-YIDATIEAATDLG-  153
DSSP  HHHHLLEEEEEEEEL---------------------LLLLlLLLL-HHHHHHHHHHHHL-


DSSP  lLEEEEEE------------------------------------------------EEEL
Query dLLIHIGF------------------------------------------------EVDY   96
ident     |                                                       
Sbjct -IRFHAARssmtlgkseggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCG  212
DSSP  -LEEEEEEllllllhhhlllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLL


DSSP  LL-lLHHHHHHHHHHHhhhlleeEEEL------lEEEElleeeellllhhhhhhhlhhhh
Query LI-gYEDFTRDFLNEYgpqtddgVLSL------hFLEGqggfrsidfsaedynegivqfy  149
ident            |                                                
Sbjct VPydKPELFEAFAQMAadydvrlHTHFyepldagMSDH----------------------  250
DSSP  LLllLHHHHHHHHHHHhhhlleeEEEEllllhhhHHHH----------------------


DSSP  llhhhhhhhhhHHHHHHhHLLLlllllLEELLLLHhhllhhhhlllhhhllhhhhhhHHH
Query ggfeqaqlaylEGVKQSiEADLglfkpRRXGHISLcqkfqqffgedtsdfseevxekFRV  209
ident                   |            |                          | 
Sbjct -------lygmTPWRFL-EKHGwasdrVWLAHAVV---------------------pPRE  281
DSSP  -------hhllLHHHHH-HHLLlllllEEEEELLL---------------------lLHH


DSSP  HHHHHHHHLLEEEEEL-HHHHLllLLLLLllhhHHHHHHHLLLLEEEELLLLL-hHHLLL
Query ILALVKKRDYELDFNT-AGLFKplCGETYppkkIVTLASELQIPFVYGSDSHG-vQDIGR  267
ident                    |                      |    |            
Sbjct EIPEFADAGVAIAHLIaPDLRM--GWGLA----PIREYLDAGITVGFGTTGSAsnDGGNL  335
DSSP  HHHHHHHHLLEEEELHhHHHHL--LLLLL----LHHHHHHLLLEEEELLLLLLllLLLLH


DSSP  --LHHHHHHHLL------------------------------------------------
Query --GYSTYCQKLE------------------------------------------------  277
ident                                                             
Sbjct lgDLRLAALAHRpadpnepekwlsarellrmatrgsaeclgrpdlgvleegraadiacwr  395
DSSP  hhHHHHHHHHLHhhllllhhhlllhhhhhhhllhhhhhhlllllllllllllllleeeee


DSSP  ----------------------------------------------------------
Query ----------------------------------------------------------  277
ident                                                           
Sbjct ldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 14: Query=3dcpA Sbjct=2vunA Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEEEEELLL--lllLLLLLlhhHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhh
Query XKRDGHTHTE--fcpHGTHDdveEXVLKAIELDFDEYSIVEhaplssefxkntagdkeav   58
ident    | | |                    |                               
Sbjct GLLDTHVHVSggdyaPRQKT--mDFISSALHGGVTTMISAG-----------------sp  101
DSSP  LEEEEEELLLllleeHHHLE--eLHHHHHHLLLEEEEEELL-----------------ll


DSSP  hlllLLHH--HHHHHHHHHHHHHHHLLL-LLEEEE------------------------e
Query ttasXAXS--DLPYYFKKXNHIKKKYAS-DLLIHI------------------------g   91
ident                                  |                          
Sbjct hfpgRPKDaaGTKALAITLSKSYYNARPaGVKVHGgavilekglteedfiemkkegvwiv  161
DSSP  llllLLLLhhHHHHHHHHHHHHHHHLLHhHLEEELleelllllllhhhhhhhhhllllee


DSSP  EEEE-llllLHHHHHHHHHHHH-HHLLeEEEEL-LEEEElleEEELlllhhhhhhhlhhh
Query FEVD-yligYEDFTRDFLNEYG-PQTDdGVLSL-HFLEGqggFRSIdfsaedynegivqf  148
ident  ||                                         |               
Sbjct GEVGlgtikNPEDAAPMVEWAHkHGFK-VQMHTgGTSIP---GSST--------------  203
DSSP  EEELlllllLHHHHHHHHHHHHhLLLE-EEEELlLLLLL---LLLL--------------


DSSP  hllhhhhhhhhhhHHHHHHHLlllllLLLEELLLLHhhllhhhhlllhhhllhhHHHHHH
Query yggfeqaqlayleGVKQSIEAdlglfKPRRXGHISLcqkfqqffgedtsdfseeVXEKFR  208
ident                           ||    ||                          
Sbjct -------------VTADDVIK----tKPDVVSHING-------------gptaiSVQEVD  233
DSSP  -------------LLHHHHHH----hLLLEEELLLL-------------lllllLHHHHH


DSSP  HHHHHHhhhLLEEEEELHHhhllllllllLLHHHHHHHHHLLL--LEEEELLLLL-hHHL
Query VILALVkkrDYELDFNTAGlfkplcgetyPPKKIVTLASELQI--PFVYGSDSHG-vQDI  265
ident  |       |        |                  | |         | |       |
Sbjct RIMDET---DFAMEIVQCG-------npkIADYVARRAAEKGQlgRVIFGNDAPSgtGLI  283
DSSP  HHHHHL---LLEEEEELLL-------lhhHHHHHHHHHHHHLLhhHEEEELLLLLllLLL


DSSP  LLLHHHHHHHLL------------------------------------------------
Query GRGYSTYCQKLE------------------------------------------------  277
ident   |                                                         
Sbjct PLGILRNMCQIAsmsdidpevavcmatgnstavyglntgviapgkeadliimdtplgsva  343
DSSP  LLHHHHHHHHHHhhllllhhhhhhhhlhhhhhhhlllllllllllllleeeeelllllll


DSSP  ------------------------------------------
Query ------------------------------------------  277
ident                                           
Sbjct edamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  llhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 15: Query=3dcpA Sbjct=2uz9A Z-score=10.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------LLEEEEELLLllllLLLL--------------------------------L
Query ---------XKRDGHTHTEfcphGTHD--------------------------------D   19
ident             | | |                                           
Sbjct lshheffmpGLVDTHIHAS----QYSFagssidlpllewltkytfpaehrfqnidfaeeV  116
DSSP  llllleeeeLEEEEEEEHH----HHHHllllllllhhhhhhhlhhhhhhhhhlhhhhhhH


DSSP  HHHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhlllllhhhHHHHHHHHHHHH
Query VEEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttasxaxsdLPYYFKKXNHIK   79
ident     |                                                     | 
Sbjct YTRVVRRTLKNGTTTACYFA--------------------------tiHTDSSLLLADIT  150
DSSP  HHHHHHHHHHLLEEEEEEEL--------------------------llLHHHHHHHHHHH


DSSP  HHLLllLEEEE------------------------------------------EEEE-EL
Query KKYAsdLLIHI------------------------------------------GFEV-DY   96
ident  |                                                          
Sbjct DKFG--QRAFVgkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpIVTPrFS  208
DSSP  HHHL--LEEEEeleelllllllllllllhhhhhhhhhhhhhhhhhhlllleeeEEEElLH


DSSP  LLlLHHHHHHHHHHHHhhllEEEEEL--------lEEEElleeeellllhhhhhhhlhhh
Query LIgYEDFTRDFLNEYGpqtdDGVLSL--------hFLEGqggfrsidfsaedynegivqf  148
ident |   |       |                                               
Sbjct LScSETLMGELGNIAKtrdlHIQSHIsenrdeveaVKNL---------------------  247
DSSP  HHlLHHHHHHHHHHHHhhllEEEEEElllhhhhhhHHHH---------------------


DSSP  hllhhhhhhhhhHHHHHHhHLLLllllLLEELLLLHhhllhhhhlllhhhllhhhhhhHH
Query yggfeqaqlaylEGVKQSiEADLglfkPRRXGHISLcqkfqqffgedtsdfseevxekFR  208
ident                                 |                           
Sbjct -------ypsykNYTSVY-DKNNlltnKTVMAHGCY---------------------lSA  278
DSSP  -------lllllLHHHHH-HHLLllllLEEEEELLL---------------------lLH


DSSP  HHHHHHHHHLLEEEEEL-HHHHLlllLLLLLlhhHHHHHHHLLLLEEEELLLLlhHHLL-
Query VILALVKKRDYELDFNT-AGLFKplcGETYPpkkIVTLASELQIPFVYGSDSHgvQDIG-  266
ident   |     |           |              |            | |         
Sbjct EELNVFHERGASIAHCPnSNLSL---SSGFL---NVLEVLKHEVKIGLGTDVAggYSYSm  332
DSSP  HHHHHHHHHLLEEEELHhHHHHL---LLLLL---LHHHHHHLLLEEEELLLLLllLLLLh


DSSP  -LLHHHHHHHLL------------------------------------------------
Query -RGYSTYCQKLE------------------------------------------------  277
ident                                                             
Sbjct lDAIRRAVMVSNillinkvneksltlkevfrlatlggsqalgldgeignfevgkefdail  392
DSSP  hHHHHHHHHHHHhhhhlllllllllhhhhhhhhlhhhhhhllllllllllllllllleee


DSSP  ----------------------------------------------------
Query ----------------------------------------------------  277
ident                                                     
Sbjct inpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  elllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 16: Query=3dcpA Sbjct=3gg7A Z-score=10.0

back to top
DSSP  LLEEEEELLLLlllllLLLHHHHHHHHHHLLLlEEEEEEEllllhhhhhllllllhhhhl
Query XKRDGHTHTEFcphgtHDDVEEXVLKAIELDFdEYSIVEHaplssefxkntagdkeavtt   60
ident    | | |          |         |        |                      
Sbjct SLIDFHVHLDL-----YPDPVAVARACEERQL-TVLSVTT--------------------   34
DSSP  LLEEEEELHHH-----LLLHHHHHHHHHHLLL-EEEELLL--------------------


DSSP  llllhhhHHHHhHHHHHHHHHLlllLEEEEE----------------------------E
Query asxaxsdLPYYfKKXNHIKKKYasdLLIHIG----------------------------F   92
ident                                                             
Sbjct ------tPAAW-RGTLALAAGR---PHVWTAlgfhpevvseraadlpwfdrylpetrfvG   84
DSSP  ------lHHHH-HHHHHHHLLL---LLEEELllllhhhllllhhhlhhhhhhhhhlleeE


DSSP  EEELLL---------LLHHHHHHHHHHH-hhhllEEEEELLEeeelleeeellllhhhhh
Query EVDYLI---------GYEDFTRDFLNEY-gpqtdDGVLSLHFlegqggfrsidfsaedyn  142
ident ||                      |                                   
Sbjct EVGLDGspslrgtwtQQFAVFQHILRRCedhggrILSIHSRR------------------  126
DSSP  EEELLLlhhhhhhhhHHHHHHHHHHHHHhhllleEEEEELLL------------------


DSSP  hhlhhhhllhhhhhhhhhhHHHHHHHL--LLLLLLLLEELLLLhhhllhhhhlllhhhll
Query egivqfyggfeqaqlayleGVKQSIEA--DLGLFKPRRXGHISlcqkfqqffgedtsdfs  200
ident                                           |                 
Sbjct -------------------AESEVLNCleANPRSGTPILHWYS-----------------  150
DSSP  -------------------LHHHHHHHhhHLHHHEEEEEELLL-----------------


DSSP  hhhhhhHHHHHHHHHHHLLEEEEELhhhhllllllLLLL----HHHHHHHHhlLLLEEEE
Query eevxekFRVILALVKKRDYELDFNTaglfkplcgeTYPP----KKIVTLASelQIPFVYG  256
ident           |                        |                        
Sbjct -----gSVTELRRAISLGCWFSVGP----------TMVRtqkgAALIRSMP--RDRVLTE  193
DSSP  -----lLHHHHHHHHHLLLEEEELH----------HHHLlhhhHHHHHHLL--HHHEEEL


DSSP  LLLL------lhhHLLLlHHHHHHHLL------------------------
Query SDSH------gvqDIGRgYSTYCQKLE------------------------  277
ident  |                       |                         
Sbjct TDGPfleldgqaaLPWD-VKSVVEGLSkiwqipaseverivkenvsrllgt  243
DSSP  LLLLlleelleelLHHH-HHHHHHHHHhhhlllhhhhhhhhhhhhhhhhhl


No 17: Query=3dcpA Sbjct=3mtwA Z-score=10.0

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------XK    2
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EEEEELLLLlllLLLL---------------LHHHHHHHHHHLLLLEEEEEEellllhhh
Query RDGHTHTEFcphGTHD---------------DVEEXVLKAIELDFDEYSIVEhaplssef   47
ident  | | |                                |  |  |     |         
Sbjct IDMHVHLDS---LAEVggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG--------  109
DSSP  EEEEELLLL---LLLLlhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL--------


DSSP  hhllllllhhhhlllllhhhhhhHHHHHHHHHHHLL----LLLEEEEE------------
Query xkntagdkeavttasxaxsdlpyYFKKXNHIKKKYA----SDLLIHIG------------   91
ident                                             |               
Sbjct ----------------------aADYDDVGLREAIDagyvPGPRIVTAaisfgatgghcd  147
DSSP  ----------------------lLLLHHHHHHHHHHllllLLLEEEELllleelllllll


DSSP  ------------------------------------eEEEL---------------lLLL
Query ------------------------------------fEVDY---------------lIGY  100
ident                                                             
Sbjct stffppsmdqknpfnsdspdearkavrtlkkygaqviXICAtggvfsrgnepgqqqlTYE  207
DSSP  lllllhhhllllllllllhhhhhhhhhhhhhlllleeEEELllllllllllllllllLHH


DSSP  H-HHHHHHHHHHHHhlleeEEELleeeelleeeellllhhhhhhhlhhhhllhhhhhhhH
Query E-DFTRDFLNEYGPqtddgVLSLhflegqggfrsidfsaedynegivqfyggfeqaqlaY  159
ident |     |     |                                               
Sbjct EmKAVVDEAHMAGI---kvAAHA-----------------------------------hG  229
DSSP  HhHHHHHHHHHLLL---eeEEEE-----------------------------------lL


DSSP  HHHHHHHHHLllllllLLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLL
Query LEGVKQSIEAdlglfkPRRXGHISlcqkfqqffgedtsdfseevxekFRVILALVKKRDY  219
ident   |      |           | |                             |      
Sbjct ASGIREAVRA-----gVDTIEHAS---------------------lvDDEGIKLAVQKGA  263
DSSP  HHHHHHHHHL-----lLLEEEELL---------------------llLHHHHHHHHHHLL


DSSP  EEEEE-LHHHHL-------------LLLL--llllLHHHHHHHHHLLLLEEEELLLL--L
Query ELDFN-TAGLFK-------------PLCG--etypPKKIVTLASELQIPFVYGSDSH--G  261
ident                                           |       ||| |     
Sbjct YFSMDiYNTDYTqaegkkngvlednLRKDrdigelQRENFRKALKAGVKMVYGTDAGiyP  323
DSSP  EEELLlLLHHHHhhhhhhhlllhhhHHHHhhhhhhHHHHHHHHHHHLLEEELLLLLLllL


DSSP  HHHlLLLHHHHHHHLL--------------------------------------------
Query VQDiGRGYSTYCQKLE--------------------------------------------  277
ident   |                                                         
Sbjct HGD-NAKQFAVMVRYGatplqaiqsatltaaealgrskdvgqvavgrygdmiavagdpla  382
DSSP  LLL-HHHHHHHHHHLLllhhhhhhhllhhhhhhhlllllllllllllllleeeellllll


DSSP  ----------------------
Query ----------------------  277
ident                       
Sbjct dvttlekpvfvmkggavvkapx  404
DSSP  lhhhhhllleeeelleeeelll


No 18: Query=3dcpA Sbjct=2y1hB Z-score=10.0

back to top
DSSP  --LLEEEEELLLLllllLLLL--HHHHHHHHHHLLLLEEEEEEEllllhhhhhllllllh
Query --XKRDGHTHTEFcphgTHDD--VEEXVLKAIELDFDEYSIVEHaplssefxkntagdke   56
ident      | | |          |        ||          |                  
Sbjct gvGLVDCHCHLSA----PDFDrdLDDVLEKAKKANVVALVAVAE----------------   40
DSSP  llLEEEEEELLLL----HHHLllHHHHHHHHHHLLEEEEEELLL----------------


DSSP  hhhlllllhhhHHHHHHHHHHHHHHLLllLEEEEE-------------------------
Query avttasxaxsdLPYYFKKXNHIKKKYAsdLLIHIG-------------------------   91
ident                | |       |                                  
Sbjct -----------HSGEFEKIMQLSERYN--GFVLPClgvhpvqgldqrsvtlkdldvalpi   87
DSSP  -----------LHHHHHHHHHHHHHLL--LLEEEEelllleelllleellhhhhhhhhhh


DSSP  -----------EEEELLL------------LLHHHHHHHHHHHHHhlleEEEELLEeeel
Query -----------FEVDYLI------------GYEDFTRDFLNEYGPqtddGVLSLHFlegq  128
ident             ||                                              
Sbjct ienykdrllaiGEVGLDFsprfagtgeqkeEQRQVLIRQIQLAKRlnlpVNVHSRS----  143
DSSP  hhhhllllleeEEEEEELlllllllhhhhhHHHHHHHHHHHHHHHhlllEEEEEEL----


DSSP  leeeellllhhhhhhhlhhhhllhhhhhhhhhhHHHHHHHL--LLLLllLLEELLLLhhh
Query ggfrsidfsaedynegivqfyggfeqaqlayleGVKQSIEA--DLGLfkPRRXGHISlcq  186
ident                                       |      |              
Sbjct ---------------------------------AGRPTINLlqEQGA-eKVLLHAFD---  166
DSSP  ---------------------------------LHHHHHHHhhHLLL-lLEEEELLL---


DSSP  llhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEELHHhhlllLLLLllLHHHHHHH
Query kfqqffgedtsdfseevxekFRVILALVKKRDYELDFNTAGlfkplCGETypPKKIVTLA  246
ident                                 |                     | |   
Sbjct -------------------gRPSVAMEGVRAGYFFSIPPSI-----IRSG-qKQKLVKQL  201
DSSP  -------------------lLHHHHHHHHHLLLEEEELHHH-----HLLH-hHHHHHHHL


DSSP  HhlLLLEEEELLLL------lhHHLL-LLHHHHHHHLL----------------------
Query SelQIPFVYGSDSH------gvQDIG-RGYSTYCQKLE----------------------  277
ident            ||                                               
Sbjct P--LTSICLETDSPalgpekqvRNEPwNISISAEYIAQvkgisveevievttqnalklfp  259
DSSP  L--HHHEEELLLLLllllllllLLLHhHHHHHHHHHHHhhlllhhhhhhhhhhhhhhhll


DSSP  ------
Query ------  277
ident       
Sbjct klrhll  265
DSSP  lhhhhl


No 19: Query=3dcpA Sbjct=3mkvA Z-score=9.9

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------XKR    3
ident                                                             
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  EEEELLLllllLLLL---------------LHHHHHHHHHHLLLLEEEEEEellllhhhh
Query DGHTHTEfcphGTHD---------------DVEEXVLKAIELDFDEYSIVEhaplssefx   48
ident | | |                                      |                
Sbjct DLHVHVV----AIEFnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAG---------  107
DSSP  EEEELLL----LLLLlhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELL---------


DSSP  hllllllhhhhlllllhhhhhhhhhhHHHHHHHLL----lLLEEEEE-------------
Query kntagdkeavttasxaxsdlpyyfkkXNHIKKKYA----sDLLIHIG-------------   91
ident                               |                             
Sbjct ------------------------gaGYPFKQAVEsglveGPRLFVSgralsqtgghadp  143
DSSP  ------------------------llLHHHHHHHHlllllLLEEEELlleeellllllll


DSSP  ----------------------------------------------EEEEL---------
Query ----------------------------------------------FEVDY---------   96
ident                                                             
Sbjct rarsdymppdspcgccvrvgalgrvadgvdevrravreelqmgadqIXIMAsggvasptd  203
DSSP  lllllllllllllllllllllleeelllhhhhhhhhhhhhhhllllEEEELlllllllll


DSSP  ----LLLLHHHHHHHHHHH-HHHLleeEEELleeeelleeeellllhhhhhhhlhhhhll
Query ----LIGYEDFTRDFLNEY-GPQTddgVLSLhflegqggfrsidfsaedynegivqfygg  151
ident         ||  |    |  |  |                                    
Sbjct pvgvFGYSEDEIRAIVAEAqGRGT-yvLAHA-----------------------------  233
DSSP  llllLLLLHHHHHHHHHHHhLLLL-leEEEE-----------------------------


DSSP  hhhhhhhHHHHHHHHHHLLlllllLLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHH
Query feqaqlaYLEGVKQSIEADlglfkPRRXGHISLcqkfqqffgedtsdfseevxekFRVIL  211
ident                          |   |  |                           
Sbjct ------yTPAAIARAVRCG-----VRTIEHGNL---------------------iDDETA  261
DSSP  ------lLHHHHHHHHHLL-----LLEEEELLL---------------------lLHHHH


DSSP  HHHHHHLLEEEEEL-HHHHLL----------------LLLLlllLHHHHHHHHHLLLLEE
Query ALVKKRDYELDFNT-AGLFKP----------------LCGEtypPKKIVTLASELQIPFV  254
ident  ||                                                         
Sbjct RLVAEHGAYVVPTLvTYDALAsegekyglppesiakiADVH-gaGLHSIEIMKRAGVKMG  320
DSSP  HHHHHHLLEEELLHhHHHHHHhhlllllllhhhhllhHHHH-llHHHHHHHHHHHLLLLL


DSSP  EELLLLL--HHHLLLLHHHHHHHLL-----------------------------------
Query YGSDSHG--VQDIGRGYSTYCQKLE-----------------------------------  277
ident  | |  |                |                                    
Sbjct FGTDLLGeaQRLQSDEFRILAEVLSpaeviasativsaevlgmqdklgrivpgahadvlv  380
DSSP  LLLLLLHhhHHHLLHHHHHHHLLLLhhhhhhhllhhhhhhllllllllllllllllleee


DSSP  ----------------------------------
Query ----------------------------------  277
ident                                   
Sbjct vdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  ellllllllllllllllllleeeelleeeeelll


No 20: Query=3dcpA Sbjct=3cjpA Z-score=9.8

back to top
DSSP  LLEEEEELLllllllllLLHHHHHHHHHHLLLLEEEEEE--ellllhhhhhlllllLHHH
Query XKRDGHTHTefcphgthDDVEEXVLKAIELDFDEYSIVE--haplssefxkntagdKEAV   58
ident    |||||           ||       |   |                           
Sbjct LIIDGHTHV-------iLPVEKHIKIMDEAGVDKTILFStsihpetavnlrdvkkeMKKL   53
DSSP  LLEEEEEEL-------lLLHHHHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhHHHH


DSSP  HLL-----llLHHHHHHHHHHHHHHHHHLLlLLEEEEE----------------------
Query TTA-----sxAXSDLPYYFKKXNHIKKKYAsDLLIHIG----------------------   91
ident                    |        |        |                      
Sbjct NDVvngktnsMIDVRRNSIKELTNVIQAYP-SRYVGFGnvpvglsendtnsyieenivnn  112
DSSP  HHHhllllllLHHHHHHHHHHHHHHHHHLL-LLEEEEElllllllhhhhhhhhhhhllll


DSSP  -----EEEELLLLLHHHHHHHHHHH-hhhlleEEEELLEEeelleeeellllhhhhhhhl
Query -----FEVDYLIGYEDFTRDFLNEY-gpqtddGVLSLHFLegqggfrsidfsaedynegi  145
ident       |     |                                               
Sbjct klvgiGELTPASGQIKSLKPIFKYSmdsgslpIWIHAFNP--------------------  152
DSSP  llleeEEELLLLLLHHHHHHHHHHHhhlllllEEELLLLL--------------------


DSSP  hhhhllhhhhhhhHHHHHHHHHHL--LLLLlLLLEELLLLHHhllhhhhlllhhhllhhh
Query vqfyggfeqaqlaYLEGVKQSIEA--DLGLfKPRRXGHISLCqkfqqffgedtsdfseev  203
ident               |   |   |         |   ||                      
Sbjct ------------lVLQDIKEIAELckAFPK-VPVILGHMGGS------------------  181
DSSP  ------------lLHHHHHHHHHHhhHLLL-LLEEEHHHHHH------------------


DSSP  hhhhHHHHHHHHHHL-LEEEEELHHHhllllllllLLHHHHHHHHhllLLEEEELLLLlh
Query xekfRVILALVKKRD-YELDFNTAGLfkplcgetyPPKKIVTLASelqIPFVYGSDSHgv  262
ident          | |      ||                 |               | |    
Sbjct --nwMTAVELAKEIQnLYLDTSAYFS-------tfVLKIVINELP---LKCIFGTDMP--  227
DSSP  --hhHHHHHHHHHLLlEEEELLLLLL-------hhHHHHHHHHLL---LLEELLLLLL--


DSSP  hHLLL-LHHHHHHHLL-------------------
Query qDIGR-GYSTYCQKLE-------------------  277
ident                                    
Sbjct fGDLQlSIEAIKKMSNdsyvanavlgdnisrllni  262
DSSP  lLLHHhHHHHHHHHLLlhhhhhhhhlhhhhhhhll


No 21: Query=3dcpA Sbjct=2ffiA Z-score=9.8

back to top
DSSP  ---LLEEEEELLL----------lllllLLLLHHHHHHHHHHLLLLEEEEEEEllllhhh
Query ---XKRDGHTHTE----------fcphgTHDDVEEXVLKAIELDFDEYSIVEHaplssef   47
ident       | | |                                 |     |         
Sbjct lhlTAIDSHAHVFsrglnlasqrryapnYDAPLGDYLGQLRAHGFSHGVLVQP-------   53
DSSP  lllLLEELLLLLLlhhhhhhllllllllLLLLHHHHHHHHHHLLLLEELLLLL-------


DSSP  hhllllllhhhhlLLLLHhHHHHHHHHHHHHHHhlllllEEEEEE---------------
Query xkntagdkeavttASXAXsDLPYYFKKXNHIKKkyasdlLIHIGF---------------   92
ident                    |  |                                     
Sbjct -------------SFLGT-DNRYLLSALQTVPG------QLRGVVxlerdveqatlaexa   93
DSSP  -------------HHHLL-LLHHHHHHHHHLLL------LLLLLLlllllllhhhhhhhh


DSSP  -------EEEL---lLLLH--HHHHHHHHHHHHhlleeEEELleeeelleeeellllhhh
Query -------EVDY---lIGYE--DFTRDFLNEYGPqtddgVLSLhflegqggfrsidfsaed  140
ident                         |  |   |       |                    
Sbjct rlgvrgvRLNLxgqdXPDLtgAQWRPLLERIGEqgwhvELHR------------------  135
DSSP  llllleeELLLllllLLLLllLLLHHHHHHHHHhlleeEELL------------------


DSSP  hhhhlhhhhllhhhhhhhHHHHHHHHHHLL-lLLLLlLEELL-LLHHhllhhhhlllHHH
Query ynegivqfyggfeqaqlaYLEGVKQSIEAD-lGLFKpRRXGH-ISLCqkfqqffgedTSD  198
ident                             |            |                  
Sbjct ------------------QVADIPVLVRALqpYGLD-IVIDHfGRPD----------ARR  166
DSSP  ------------------LLLLHHHHHHHHllLLLL-EEELHhHLLL----------LLL


DSSP  LlhhHHHHHHHHHHHhHHHLLEEEEELHHHhllLLLL--lllLHHHHHHHHHLLL--LEE
Query FseeVXEKFRVILALvKKRDYELDFNTAGLfkpLCGE--typPKKIVTLASELQI--PFV  254
ident         |   | |                     |                       
Sbjct G--lGQPGFAELLTLsGRGKVWVKVSGIYR-lqGSPEenlafARQALCALEAHYGaeRLX  223
DSSP  L--lLLLLHHHHLLLlLLLLEEEEEELHHH-llLLHHhhhhhHHHHHHHHHHHLLhhHEE


DSSP  EELLLL-----lhhHLLLLHHHHHHHLL----------------------
Query YGSDSH-----gvqDIGRGYSTYCQKLE----------------------  277
ident  |||            |                                 
Sbjct WGSDWPhtqhesevSFGSAVEQFEALGCsaqlrqallldtaralfgfele  273
DSSP  EELLLLllllllllLHHHHHHHHHHHLLlhhhhhhhhlhhhhhhllllll


No 22: Query=3dcpA Sbjct=4mupB Z-score=9.8

back to top
DSSP  ----------------LLEEEEELLL---------llLLLL--LLLHHHHHHHHHHLLLL
Query ----------------XKRDGHTHTE---------fcPHGT--HDDVEEXVLKAIELDFD   33
ident                    |   |                       |        |  |
Sbjct lvrklsgtapnpafprGAVDTQMHMYlpgypalpggpGLPPgaLPGPEDYRRLMQWLGID   60
DSSP  llllllllllllllllLLEELLLLLLlllllllllllLLLLllLLLHHHHHHHHHHHLLL


DSSP  EEEEEEEllllhhhhhllllllhhhhlLLLLHhHHHHHHHHHHHHHHhlllllEEEEE--
Query EYSIVEHaplssefxkntagdkeavttASXAXsDLPYYFKKXNHIKKkyasdlLIHIG--   91
ident    |                             |                     |    
Sbjct RVIITQG--------------------NAHQR-DNGNTLACVAEMGE------AAHAVvi   93
DSSP  EEEEELL--------------------HHHLL-LLHHHHHHHHHHHH------HEEEEel


DSSP  --------------------EEEEL------LLLLHHHHHHHH-HHHHhhlleEEEELLe
Query --------------------FEVDY------LIGYEDFTRDFL-NEYGpqtddGVLSLHf  124
ident                                     |                       
Sbjct idatttekdmekltaagtvgARIMDlpggavNLSELDAVDERAhAADW----mVAVQFD-  148
DSSP  llllllhhhhhhhhhlleeeEEEELllllllLHHHHHHHHHHHhHLLL----eEEEELL-


DSSP  eeelleeeellllhhhhhhhlhhhhllhhhhhhHHHHHHHHHHHLLLlllLLLEELL-LL
Query legqggfrsidfsaedynegivqfyggfeqaqlAYLEGVKQSIEADLglfKPRRXGH-IS  183
ident                                    |                    |   
Sbjct --------------------------------gNGLLDHLPRLQKIR---SRWVFDHhGK  173
DSSP  --------------------------------hHHHHHHHHHHHLLL---LEEEELHhHH


DSSP  HHHllhhhhlllhhhllhhhHHHHHHHHHHHHHHL-LEEEEELHHHhlLLLLllllLHHH
Query LCQkfqqffgedtsdfseevXEKFRVILALVKKRD-YELDFNTAGLfkPLCGetypPKKI  242
ident                            |     |      |                   
Sbjct FFK-------------girtDGPEMAALLKLIDRGnLWFKFAGVYEssRKSWpyadVAAF  220
DSSP  LLL-------------llllLLHHHHHHHHHHHHLlEEEEELLHHHllLLLLllhhHHHH


DSSP  HHHHHHLLL-LEEEELLLL--------lhhhLLLLHHHHHHHLL----------------
Query VTLASELQI-PFVYGSDSH--------gvqdIGRGYSTYCQKLE----------------  277
ident             | |                  |        |                 
Sbjct SRVIAAHAPeRIVWGTNWPhnsvretaaypdDARLAELTLGWLPdeaarhralvenpeal  280
DSSP  HHHHHHHLHhHEEELLLLLllllllhhhlllHHHHHHHHHLLLLlhhhhhhhhlhhhhhh


DSSP  ------
Query ------  277
ident       
Sbjct fklspv  286
DSSP  hlllll


No 23: Query=3dcpA Sbjct=3k2gB Z-score=9.7

back to top
DSSP  ---------------------------LLEEEEELLLLLL--------------------
Query ---------------------------XKRDGHTHTEFCP--------------------   13
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNDCrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEELhhhllllllhhhhhhhhlll


DSSP  ------------------LLLLL--LHHHHHHHHHHLLLLEEEEEEELLllhhhhhllll
Query ------------------HGTHD--DVEEXVLKAIELDFDEYSIVEHAPlssefxkntag   53
ident                       |       |                             
Sbjct sieilselrqdpfvnkhnIALDDldLAIAEVKQFAAVGGRSIVDPTCRG-----------  109
DSSP  lhhhhhhhhllhhhllllLEELLhhHHHHHHHHHHHLLLLEEEELLLLL-----------


DSSP  llhhhhlllllhhhhhhHHHHHHHHHHHLllLLEEEEE----------------------
Query dkeavttasxaxsdlpyYFKKXNHIKKKYasDLLIHIG----------------------   91
ident                     |   |            |                      
Sbjct --------------igrDPVKLRRISAET--GVQVVXGagyylassxpetaarlsaddia  153
DSSP  --------------lllLHHHHHHHHHHH--LLEEEELlllllhhhllhhhhlllhhhhh


DSSP  ---------------------EEEEL---LLLL-HHHHHHHHHHH-hHHLLeeEEELLee
Query ---------------------FEVDY---LIGY-EDFTRDFLNEY-gPQTDdgVLSLHfl  125
ident                       |           |   |                 |   
Sbjct deivaealegtdgtdarigliGEIGVssdFTAEeEKSLRGAARAQvrTGLP-lXVHLP--  210
DSSP  hhhhhhhhlllllllllllleEEELLlllLLHHhHHHHHHHHHHHhhHLLL-eEELLL--


DSSP  eelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHhHLLL--LLLL--lLEELL
Query egqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSiEADL--GLFK--pRRXGH  181
ident                                                            |
Sbjct --------------------------------gWFRLAHRV-LDLVeeEGADlrhTVLCH  237
DSSP  --------------------------------lLLLLHHHH-HHHHhhLLLLhhhEEELL


DSSP  LLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEE-ELHHhHLLL------LL
Query ISLCqkfqqffgedtsdfseevxekFRVILALVKKRDYELDF-NTAGlFKPL------CG  234
ident                            |  |    |   | |                | 
Sbjct XNPS-------------------hxDPVYQATLAQRGAFLEFdXIGX-DFFYadqgvqCP  277
DSSP  LHHH-------------------llLHHHHHHHHHHLLEEEElLLLL-LLEElllleeLL


DSSP  LLllLHHHHHHHHHLLL--LEEEELLLLL--------hHHLLLLH-HHHHHHLL------
Query ETypPKKIVTLASELQI--PFVYGSDSHG--------vQDIGRGY-STYCQKLE------  277
ident                          |                                  
Sbjct SDdeVARAILGLADHGYldRILLSHDVFVkxxltryggNGYAFVTkHFLPRLRRhgldda  337
DSSP  LHhhHHHHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLHHHhLHHHHHHHllllhh


DSSP  ---------------------
Query ---------------------  277
ident                      
Sbjct aletlxvtnprrvfdasiegh  358
DSSP  hhhhhhlhhhhhhhlllllll


No 24: Query=3dcpA Sbjct=1j6pA Z-score=9.4

back to top
DSSP  ---------------------------------------------------LLEEEEELL
Query ---------------------------------------------------XKRDGHTHT    9
ident                                                         ||| 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH


DSSP  LllllLLLL-------------------------------LHHHHHHHHHHLLLLEEEEE
Query EfcphGTHD-------------------------------DVEEXVLKAIELDFDEYSIV   38
ident       |                                                     
Sbjct P----XTLLrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDX  116
DSSP  H----HHHHllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEE


DSSP  EellllhhhhhllllllhhhhlllllhhhhhhHHHHHHHHHHHLLllLEEEEE-------
Query EhaplssefxkntagdkeavttasxaxsdlpyYFKKXNHIKKKYAsdLLIHIG-------   91
ident                                                             
Sbjct Y------------------------------fHEEWIAKAVRDFG--XRALLTrglvdsn  144
DSSP  E------------------------------lLHHHHHHHHHHHL--LEEEEEeeellll


DSSP  ---------------------------EEEELLL-lLHHHHHHHHHHHHHhllEEEEELL
Query ---------------------------FEVDYLI-gYEDFTRDFLNEYGPqtdDGVLSLH  123
ident                            |         |                    | 
Sbjct gddggrleenlklynewngfegrifvgFGPHSPYlcSEEYLKRVFDTAKSlnaPVTIHLY  204
DSSP  lllllhhhhhhhhhhhhllhhhleeeeEEELLLLllLHHHHHHHHHHHHHhllLEEEEEL


DSSP  eeeelleeeellllhhhhhhhlhhhhllhhhhhhHHHHHHHHHhHLLLlllLLLEELLLL
Query flegqggfrsidfsaedynegivqfyggfeqaqlAYLEGVKQSiEADLglfKPRRXGHIS  183
ident                                                          |  
Sbjct -------------------------------etsKEEYDLEDI-LNIGlkeVKTIAAHCV  232
DSSP  -------------------------------lllLLLLLLHHH-HLLLlllLLEEEEELL


DSSP  HhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEEL-HHHHLllLLLLLllhhH
Query LcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNT-AGLFKplCGETYppkkI  242
ident                                |        |    |              
Sbjct H---------------------lPERYFGVLKDIPFFVSHNPaSNLKL--GNGIA----P  265
DSSP  L---------------------lLHHHHHHHLLLLEEEEELHhHHHHL--LLLLL----L


DSSP  HHHHHHLLLLEEEELLLLL-hHHLL--LLHHHHHHHLL----------------------
Query VTLASELQIPFVYGSDSHG-vQDIG--RGYSTYCQKLE----------------------  277
ident |    |       | |                                            
Sbjct VQRXIEHGXKVTLGTDGAAsnNSLNlfFEXRLASLLQKaqnprnldvntclkxvtydgaq  325
DSSP  HHHHHHLLLEEEELLLLLLllLLLLhhHHHHHHHHHHHllllllllhhhhhhhhlhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct axgfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdge  385
DSSP  hhlllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeelll


DSSP  ----------------------
Query ----------------------  277
ident                       
Sbjct yptidseevkrelariekelys  407
DSSP  lllllhhhhhhhhhhhhhhhhl


No 25: Query=3dcpA Sbjct=4c5yA Z-score=9.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -LLEEEEELLlllllLLLL-------------------LHHHHHHHHHHLLLLEEEEEE-
Query -XKRDGHTHTefcphGTHD-------------------DVEEXVLKAIELDFDEYSIVE-   39
ident     | | |      |  |                           |       |     
Sbjct pGLWDCHMHF-----GGDDdyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAg  115
DSSP  eLEEEEEELL-----LLLLllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLl


DSSP  -----------------------ELLLLHhhhhlLLLLLH----------------hhhL
Query -----------------------HAPLSSefxknTAGDKE----------------avtT   60
ident                         |                                   
Sbjct ygcevakaindgtivgpnvyssgAALSQTaghgdIFALPAgevlgsygvmnprpgywgaG  175
DSSP  lhhhhhhhhhllllllleeeellLEEELLlllllLLLLLHhhhhhhhllllllllllllL


DSSP  LLLL-----------hhhHHHHHhhhhhhhhhllllleeeEEEEEEL-------------
Query ASXA-----------xsdLPYYFkkxnhikkkyasdllihIGFEVDY-------------   96
ident                                             |               
Sbjct PLCIadgveevrravrlqIRRGA-----------------KVIXVMAsggvmsrddnpnf  218
DSSP  LEEElllhhhhhhhhhhhHHHLL-----------------LLEEEELlllllllllllll


DSSP  -LLLLhHHHHHHHHHHH-HHLLeeEEELleeeelleeeellllhhhhhhhlhhhhllhhh
Query -LIGYeDFTRDFLNEYG-PQTDdgVLSLhflegqggfrsidfsaedynegivqfyggfeq  154
ident               |                                             
Sbjct aQFSP-EELKVIVEEAArQNRI-vSAHV--------------------------------  244
DSSP  lLLLH-HHHHHHHHHHHhLLLL-eEEEE--------------------------------


DSSP  hhhhHHHHHHHHHHLlllllLLLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHH
Query aqlaYLEGVKQSIEAdlglfKPRRXGHISlcqkfqqffgedtsdfseevxekFRVILALV  214
ident        |    | |           | |                             | 
Sbjct ---hGKAGIMAAIKA-----GCKSLEHVS---------------------yaDEEVWELM  275
DSSP  ---lLHHHHHHHHHH-----LLLEEEELL---------------------llLHHHHHHH


DSSP  HHHLLEEEEE-LHHHHL-----------LLLL---llllLHHHHHHHHHLLLLEEEELLL
Query KKRDYELDFN-TAGLFK-----------PLCG---etypPKKIVTLASELQIPFVYGSDS  259
ident |                                        |    |         | | 
Sbjct KEKGILYVATrSVIEIFlasngeglvkeSWAKlqaladsHLKAYQGAIKAGVTIALGTDT  335
DSSP  HHHLLEEELLhHHHHHHhhhllllllllHHHLllhhhhhHHHHHHHHHHLLLLEELLLLL


DSSP  LLHhHLLLL-HHHHHHHLL-----------------------------------------
Query HGVqDIGRG-YSTYCQKLE-----------------------------------------  277
ident                                                             
Sbjct APG-GPTALeLQFAVERGGmtpleaikaatanaplsvgpqapltgqlregyeadvialee  394
DSSP  LLL-LLLHHhHHHHHHLLLllhhhhhhhhlllhhhhhhhhlllllllllllllleeeell


DSSP  ------------------------------------------
Query ------------------------------------------  277
ident                                           
Sbjct npledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 26: Query=3dcpA Sbjct=1gkpA Z-score=9.3

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------XKRDGHTH    8
ident                                                        | | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LlLLLL---LLLLLHHHHHHHHHHLLLLEEEEEEElLLLHhhhhllllllhhhhllllLH
Query TeFCPH---GTHDDVEEXVLKAIELDFDEYSIVEHaPLSSefxkntagdkeavttasxAX   65
ident     |       |  |     |       |      |                       
Sbjct I-YLPFmatFAKDTHETGSKAALMGGTTTYIEMCC-PSRN-----------------dDA  101
DSSP  L-LLEElleELLLLHHHHHHHHHHLLEEEEEEEEL-LLLL-----------------lLH


DSSP  HH-HHHHHHHHHHHHhhlllLLEEEEEE------------------------EEEL----
Query SD-LPYYFKKXNHIKkkyasDLLIHIGF------------------------EVDY----   96
ident          |                                                  
Sbjct LEgYQLWKSKAEGNS-----YCDYTFHMavskfdektegqlreivadgissfXIFLsykn  156
DSSP  HHhHHHHHHHHLLLL-----LLEEEEEEelllllllhhhhhhhhhhlllleeEEEEllll


DSSP  ---LLLL-HHHHHHHH-HHHHhhlleeEEELLEEE--ELLE----eeelllLHHHHHHhl
Query ---LIGY-EDFTRDFL-NEYGpqtddgVLSLHFLE--GQGG----frsidfSAEDYNEgi  145
ident            |                      |  |                      
Sbjct ffgVDDGeMYQTLRLAkELGV----ivTAHCENAElvGRLQqkllsegktgPEWHEPS--  210
DSSP  lllLLHHhHHHHHHHHhHHLL----eeEEEELLHHhhHHHHhhhhhlllllHHHLLLL--


DSSP  hhhhllhhhHHHHHHHHHHHHHHL--LLLLlllLEELLLLhhhllhhhhlllhhhllhhh
Query vqfyggfeqAQLAYLEGVKQSIEA--DLGLfkpRRXGHISlcqkfqqffgedtsdfseev  203
ident                ||           |        | |                    
Sbjct --------rPEAVEAEGTARFATFleTTGA--tGYVVHLS-------------------c  241
DSSP  --------lLHHHHHHHHHHHHHHhhHHLL--eEEELLLL-------------------l


DSSP  hhhHHHHHHHHHH-HLLEEEEELHHHHLLL---------------------llllllLHH
Query xekFRVILALVKK-RDYELDFNTAGLFKPL---------------------cgetypPKK  241
ident         |                                                   
Sbjct kpaLDAAMAAKARgVPIYIESVIPHFLLDKtyaerggveamkyimspplrdkrnqkvLWD  301
DSSP  hhhHHHHHHHHHLlLLEEEEEEHHHHHLLHhhhhllhhhhhlllllllllllhhhhhHHH


DSSP  HHHHHhhllLLEEEELLLLL-------------------hHHLLLLHHHHHHHLL-----
Query IVTLAselqIPFVYGSDSHG-------------------vQDIGRGYSTYCQKLE-----  277
ident               | |                         |                 
Sbjct ALAQG----FIDTVGTDHCPfdteqkllgkeaftaipngiPAIEDRVNLLYTYGVsrgrl  357
DSSP  HHHLL----LLLEEELLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct dihrfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfe  417
DSSP  lhhhhhhhhlhhhhhhllllllllllllllllleeeeelllleellhhhlllllllllll


DSSP  -----------------------------------------
Query -----------------------------------------  277
ident                                          
Sbjct gfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lleelleeeeeeelleeeeelleelllllllllllllllll


No 27: Query=3dcpA Sbjct=4rdvB Z-score=9.3

back to top
DSSP  -------------------------------------------------LLEEEEELLL-
Query -------------------------------------------------XKRDGHTHTE-   10
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHh


DSSP  ------------------------------llllllllLHHHHHHHHHHLLLLEEEEEEE
Query ------------------------------fcphgthdDVEEXVLKAIELDFDEYSIVEH   40
ident                                                             
Sbjct ramaglaevagnpndsfwtwrelmyrmvarlspeqievIACQLYIEMLKAGYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHHLEEEEEEEEL


DSSP  llllhhhhhllllllhhhhlllLLHH-------hhHHHHHHHHHHHHHLLllLEEEEEE-
Query aplssefxkntagdkeavttasXAXS-------dlPYYFKKXNHIKKKYAsdLLIHIGF-   92
ident                                                             
Sbjct ----------------------VHHDldgrsyadpAELSLRISRAASAAG--IGLTLLPv  156
DSSP  ----------------------LLLLlllllllllLHHHHHHHHHHHHHL--LEEEEEEl


DSSP  -----------------------------------------------eEELLllLHHHHH
Query -----------------------------------------------eVDYLigYEDFTR  105
ident                                                             
Sbjct lyshagfggqpasegqrrfingseaylellqrlrapleaaghslglcfHSLRavTPQQIA  216
DSSP  llleeellleellhhhllllllhhhhhhhhhhhhhhhhhhlleeleeeLLLLllLHHHHH


DSSP  HHHHHHHHhllEEEEELleeeelleeeellllhhhhhhhlhhhhllhhhhHHHH------
Query DFLNEYGPqtdDGVLSLhflegqggfrsidfsaedynegivqfyggfeqaQLAY------  159
ident   |                                               |         
Sbjct TVLAAGHD-dlPVHIHI------------------------------aeqQKEVddcqaw  245
DSSP  HHHLLLLL-llLEEEEE------------------------------lllHHHHhhhhhh


DSSP  --hHHHHHHHHLLlllllLLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHH
Query --lEGVKQSIEADlglfkPRRXGHISLcqkfqqffgedtsdfseevxekFRVILALVKKR  217
ident           |            |                              |     
Sbjct sgrRPLQWLYENV-avdqRWCLVHATH---------------------aDPAEVAAMARS  283
DSSP  hllLHHHHHHHHL-llllLEEEEELLL---------------------lLHHHHHHHHHH


DSSP  LLEEEEEL-HHHHLlllLLLLLlhhHHHHHHHLLLLEEEELLLLlhHHLL--LLHHHHHH
Query DYELDFNT-AGLFKplcGETYPpkkIVTLASELQIPFVYGSDSHgvQDIG--RGYSTYCQ  274
ident                  |         |           |||||                
Sbjct GAVAGLCLsTEANL---GDGIF---PATDFLAQGGRLGIGSDSH--VSLSvvEELRWLEY  335
DSSP  LLEEEELHhHHHHL---LLLLL---LHHHHHHLLLEEEELLLLL--LLLLhhHHHHHHHH


DSSP  HLL---------------------------------------------------------
Query KLE---------------------------------------------------------  277
ident                                                             
Sbjct GQRlrdrkrnrlyrddqpmigrtlydaalaggaqalgqpigslavgrradllvldgndpy  395
DSSP  HHHhhhlllllllllllllhhhhhhhhhhhhhhhhhlllllllllllllleeeellllhh


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  277
ident                                                         
Sbjct lasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  hhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 28: Query=3dcpA Sbjct=4b3zD Z-score=9.3

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------XKRDGHT    7
ident                                                         |  |
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  LLLLllllLLLLHHHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhllLLLH-H
Query HTEFcphgTHDDVEEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttaSXAX-S   66
ident           ||       |                                       |
Sbjct YLQK---tAADDFFQGTRAALVGGTTMIIDHV----------------------VPEPgS   95
DSSP  LLLL---lLLLLHHHHHHHHHHLLEEEEEEEE----------------------LLLLlL


DSSP  HHHHHHHHHHHHHHHLLlLLEEEEEE-------------------------EEEL-----
Query DLPYYFKKXNHIKKKYAsDLLIHIGF-------------------------EVDY-----   96
ident  |   | |                                            |       
Sbjct SLLTSFEKWHEAADTKS-CCDYSLHVditswydgvreelevlvqdkgvnsfQVYMaykdv  154
DSSP  LHHHHHHHHHHHHHLLL-LLEEEEEEelllllllhhhhhhhhhhllllleeEEELlllll


DSSP  --LLLL-HHHHHHHH-HHHHhhlleeEEELLEEE--ELLE----eeelllLHHHHHHhlh
Query --LIGY-EDFTRDFL-NEYGpqtddgVLSLHFLE--GQGG----frsidfSAEDYNEgiv  146
ident              ||                      |                      
Sbjct yqMSDSqLYEAFTFLkGLGA----viLVHAENGDliAQEQkrilemgitgPEGHALS---  207
DSSP  llLLHHhHHHHHHHHhHHLL----eeEEELLLHHhhHHHHhhhhhlllllLHHHHHH---


DSSP  hhhllhhhHHHHHHHHHHHHHHL--LLLLlllLEELLLLHhhllhhhhlllhhhllhhhh
Query qfyggfeqAQLAYLEGVKQSIEA--DLGLfkpRRXGHISLcqkfqqffgedtsdfseevx  204
ident               | |   |                                       
Sbjct -------rPEELEAEAVFRAITIagRINC--pVYITKVMS-------------------k  239
DSSP  -------lLHHHHHHHHHHHHHHhhHHLL--lEEEEEELL-------------------h


DSSP  hhHHHHHHHHHH-HLLEEEEELHH-HHLLL----------------------LLLLllLH
Query ekFRVILALVKK-RDYELDFNTAG-LFKPL----------------------CGETypPK  240
ident      |    ||          |                                     
Sbjct saADIIALARKKgPLVFGEPIAASlGTDGThywsknwakaaafvtspplspdPTTPdyLT  299
DSSP  hhHHHHHHHHHHlLLEEEEELHHHhHLLLHhhhlllhhhhhhllllllllllLLHHhhHH


DSSP  HHHHHHhhllLLEEEELLLLL-------------------hHHLLLLHHHHHHHLL----
Query KIVTLAselqIPFVYGSDSHG-------------------vQDIGRGYSTYCQKLE----  277
ident              | ||                          |         |      
Sbjct SLLACG----DLQVTGSGHCPystaqkavgkdnftlipegvNGIEERMTVVWDKAVatgk  355
DSSP  HHHHHL----LLLLLLLLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct mdenqfvavtstnaakifnlyprkgriavgsdadvviwdpdklktitakshksaveynif  415
DSSP  llhhhhhhhhlhhhhhhhlllllllllllllllleeeeeeeeeeelllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct egmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgv  475
DSSP  llleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllll


DSSP  --
Query --  277
ident   
Sbjct sr  477
DSSP  ll


No 29: Query=3dcpA Sbjct=1bf6A Z-score=9.2

back to top
DSSP  -----LLEEEEELLLLLLL------lLLLLHH-HHHHHHHHLL---LLEEEEEEEllllh
Query -----XKRDGHTHTEFCPH------gTHDDVE-EXVLKAIELD---FDEYSIVEHaplss   45
ident           | |                |           |                  
Sbjct sfdptGYTLAHEHLHIDLSgfknnvdCRLDQYaFICQEMNDLMtrgVRNVIEMTN-----   55
DSSP  lllllLEEEEEELLLEELHhhhllhhHEELLHhHHHHHHHHHHhllEEEEEELLL-----


DSSP  hhhhllllllhhhhLLLLlhhhhhhhhhhHHHHHHHLLL--LLEEEEE------------
Query efxkntagdkeavtTASXaxsdlpyyfkkXNHIKKKYAS--DLLIHIG------------   91
ident                                                             
Sbjct --------------RYMG----------rNAQFMLDVMRetGINVVACtgyyqdaffpeh   91
DSSP  --------------HHHL----------lLHHHHHHHHHhhLLEEEEEellllhhhlllh


DSSP  -------------------------------EEEEL----LLLL-HHHHHHHHHHH-hHH
Query -------------------------------FEVDY----LIGY-EDFTRDFLNEY-gPQ  114
ident                                 |            |              
Sbjct vatrsvqelaqemvdeieqgidgtelkagiiAEIGTsegkITPLeEKVFIAAALAHnqTG  151
DSSP  hhhllhhhhhhhhhhhhhllllllllleeeeEEEELllllLLHHhHHHHHHHHHHHhhHL


DSSP  LLeeEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhHHHHHHHhLLLLL-
Query TDdgVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaylEGVKQSIeADLGL-  173
ident                                                       | |   
Sbjct RP-iSTHTS-----------------------------------fsTMGLEQL-ALLQAh  174
DSSP  LL-eEEELH-----------------------------------hhLLHHHHH-HHHHHl


DSSP  ---lllLEELLLLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEE-LHHHh
Query ---fkpRRXGHISLCqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFN-TAGLf  229
ident          ||  |                                      |       
Sbjct gvdlsrVTVGHCDLK--------------------dNLDNILKMIDLGAYVQFDtIGKN-  213
DSSP  lllhhhEEELLLLLL--------------------lLHHHHHHHHHLLLEEEELlLLLL-


DSSP  llLLLLLllLHHHHHHHH-HLLL-LEEEELLLLLHH--------HLLLLH-HHHHHHLL-
Query kpLCGETypPKKIVTLAS-ELQI-PFVYGSDSHGVQ--------DIGRGY-STYCQKLE-  277
ident                               |                        |    
Sbjct --SYYPDekRIAMLHALRdRGLLnRVMLSMDITRRShlkanggyGYDYLLtTFIPQLRQs  271
DSSP  --LLLLHhhHHHHHHHHHhLLLHhHEEELLLLLLHHhlhhhlllLLLHHHhLHHHHHHHl


DSSP  --------------------
Query --------------------  277
ident                     
Sbjct gfsqadvdvmlrenpsqffq  291
DSSP  lllhhhhhhhhlhhhhhhll


No 30: Query=3dcpA Sbjct=1a4mA Z-score=9.1

back to top
DSSP  ------LLEEEEELLLllllLLLL------------------------------------
Query ------XKRDGHTHTEfcphGTHD------------------------------------   18
ident        |   | |      |                                       
Sbjct tpafnkPKVELHVHLD----GAIKpetilyfgkkrgialpadtveelrniigmdkplslp   56
DSSP  llllllLEEEEEEEHH----HLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhh


DSSP  ----------------------LHHHHHHHHHHLLLLEEEEEEellllhhhhhllllllh
Query ----------------------DVEEXVLKAIELDFDEYSIVEhaplssefxkntagdke   56
ident                          | |                                
Sbjct gflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRY-----------------   99
DSSP  hhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEE-----------------


DSSP  hhhllLLLHHH-----------------HHHHHHHHHHHHHHLLL--LLEEEEE------
Query avttaSXAXSD-----------------LPYYFKKXNHIKKKYAS--DLLIHIG------   91
ident      |                              |                       
Sbjct -----SPHLLAnskvdpmpwnqtegdvtPDDVVDLVNQGLQEGEQafGIKVRSIlccmrh  154
DSSP  -----LLHHHLlllllllhhhlllllllHHHHHHHHHHHHHHHHHhhLLEEEEEeeeell


DSSP  ---------------------EEEE--------lLLLL--HHHHHHHHHHHHhhlleeEE
Query ---------------------FEVD--------yLIGY--EDFTRDFLNEYGpqtddgVL  120
ident                                                             
Sbjct qpswslevlelckkynqktvvAMDLagdetiegsSLFPghVEAYEGAVKNGI----hrTV  210
DSSP  lhhhhhhhhhhhhhllllleeEEEEelllllllhHHLHhhHHHHHHHHHHLL----eeEE


DSSP  ELleeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLLllllLLLEEL
Query SLhflegqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEADlglfKPRRXG  180
ident                                         | |           |  | |
Sbjct HA--------------------------------gevgSPEVVREAVDIL----KTERVG  234
DSSP  EE--------------------------------llllLHHHHHHHHHLL----LLLEEE


DSSP  LLLhhhllhhhhlllhhhllhhhhhHHHHHHHHHHHHLLEEEEEL-HHHHLllLLLLlll
Query HISlcqkfqqffgedtsdfseevxeKFRVILALVKKRDYELDFNT-AGLFKplCGETypp  239
ident |                                  |                        
Sbjct HGY-------------------htiEDEALYNRLLKENMHFEVCPwSSYLT--GAWDpkt  273
DSSP  ELH-------------------hhhHLHHHHHHHHHLLLEEEELHhHHHHL--LLLLlll


DSSP  HHHHHHHHHLLLLEEEELLLLL-hHHLL-LLHHHHH-HHLL-------------------
Query KKIVTLASELQIPFVYGSDSHG-vQDIG-RGYSTYC-QKLE-------------------  277
ident    |              |            |                            
Sbjct THAVVRFKNDKANYSLNTDDPLifKSTLdTDYQMTKkDMGFteeefkrlninaakssflp  333
DSSP  LLHHHHHHHLLLLEEELLLLLLllLLLHhHHHHHHHhLLLLlhhhhhhhhhhhhhlllll


DSSP  ----------------
Query ----------------  277
ident                 
Sbjct eeekkellerlyreyq  349
DSSP  hhhhhhhhhhhhhhll


No 31: Query=3dcpA Sbjct=2dvtA Z-score=9.1

back to top
DSSP  --LLEEEEELLLL---------------lllLLLL--LHHH-HHHHHHHLLLLEEEEEEE
Query --XKRDGHTHTEF---------------cphGTHD--DVEE-XVLKAIELDFDEYSIVEH   40
ident    |     |                       |   |                      
Sbjct mqGKVALEEHFAIpetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSLN   60
DSSP  llLEEEEEEEELLhhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEEL


DSSP  llllhhhhhllllllhhhhLLLL--------LHHHHHHHHHHHHHHHHHLLllLEEEEE-
Query aplssefxkntagdkeavtTASX--------AXSDLPYYFKKXNHIKKKYAsdLLIHIG-   91
ident                                |                |           
Sbjct -------------------APAVqaipdrrkAIEIARRANDVLAEECAKRP--DRFLAFa   99
DSSP  -------------------LLHHhhlllhhhHHHHHHHHHHHHHHHHHHLL--LLEEEEe


DSSP  -------------------------EEEELL---------LLLH----HHHHHHHHHHHH
Query -------------------------FEVDYL---------IGYE----DFTRDFLNEYGP  113
ident                            |              |                 
Sbjct alplqdpdaateelqrcvndlgfvgALVNGFsqegdgqtpLYYDlpqyRPFWGEVEKLDV  159
DSSP  llllllhhhhhhhhhhhhhllllleEEEELLlllllllllLLLLlhhhHHHHHHHHHHLL


DSSP  hlleeEEELLEEEElleeeellllhHHHHhhLHHHhlLHHHH--hhHHHHHHHHHHHLL-
Query qtddgVLSLHFLEGqggfrsidfsaEDYNegIVQFygGFEQA--qlAYLEGVKQSIEAD-  170
ident       |                   |    |              |             
Sbjct ---pfYLHPRNPLP-----------QDSR--IYDG--HPWLLgptwAFAQETAVHALRLm  201
DSSP  ---leEEELLLLLH-----------HHLH--HHLL--LHHHLhhhlHHHHHHHHHHHHHh


DSSP  -------lLLLLlLEELLLlhhhllhhhhlllhhhllhhhhhhhhhHHHH----------
Query -------lGLFKpRRXGHIslcqkfqqffgedtsdfseevxekfrvILAL----------  213
ident                 ||                                          
Sbjct asglfdehPRLN-IILGHM------------------------gegLPYMmwridhrnaw  236
DSSP  hllhhhhlLLLL-EEELHH------------------------hllHHHHhhhhhhllll


DSSP  ------------hHHHL---LEEEEELhhhhlllllllLLLHHHHHHHHHLLL--LEEEE
Query ------------vKKRD---YELDFNTaglfkplcgetYPPKKIVTLASELQI--PFVYG  256
ident                                                |            
Sbjct vklpprypakrrfMDYFnenFHITTSG-----------NFRTQTLIDAILEIGadRILFS  285
DSSP  llllllllllllhHHHHhhhEEEELLL-----------LLLHHHHHHHHLLLLhhHEELL


DSSP  LLLLlhhHLLLLHHHHHHHLL--------------------
Query SDSHgvqDIGRGYSTYCQKLE--------------------  277
ident  |      |                                
Sbjct TDWP-feNIDHASDWFNATSIaeadrvkigrtnarrlfkld  325
DSSP  LLLL-llLHHHHHHHHHHLLLlhhhhhhhhlhhhhhhllll


No 32: Query=3dcpA Sbjct=2yb1A Z-score=9.0

back to top
DSSP  LLEEEEELLLLLllLLLLLHHHHHHHHHHLLLLEEEEEEELLllhhhhhllllllhhhhl
Query XKRDGHTHTEFCphGTHDDVEEXVLKAIELDFDEYSIVEHAPlssefxkntagdkeavtt   60
ident    | | |             |    |            |                    
Sbjct ANIDLHFHSRTS--DGALTPTEVIDRAAARAPALLALTDHDC------------------   40
DSSP  LLEELLLLLLLL--LLLLLHHHHHHHHHLLLLLEEEELLLLL------------------


DSSP  llllhhhhhhHHHHHHHHHHHLLllLEEEEEEEEELL----------lllhhhhHHHHHH
Query asxaxsdlpyYFKKXNHIKKKYAsdLLIHIGFEVDYL----------igyedftRDFLNE  110
ident                               | ||                          
Sbjct --------tgGLAEAAAAAARRG--IPFLNGVEVSVSwgrhtvhivglgidpaePALAAG   90
DSSP  --------llLHHHHHHHHHHLL--LLEEEEEEEEEEelleeeeeeeellllllHHHHHH


DSSP  HhhhlleeeeelleeeELLE--------------------------------------ee
Query YgpqtddgvlslhfleGQGG--------------------------------------fr  132
ident                                                             
Sbjct L--ksiregrlerarqMGASleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkd  148
DSSP  H--hhhhllhhhhhhhHHHHhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllll


DSSP  elllLHHH-HHHHlhhhhllhhhhhhhhhhhhhhHHHL----llLLLLLLEELLLLHHHl
Query sidfSAED-YNEGivqfyggfeqaqlaylegvkqSIEA----dlGLFKPRRXGHISLCQk  187
ident                                   | |       |        |      
Sbjct mrtvFRKYlTPGK------------pgyvshqwaSLEDavgwivGAGGMAVIAHPGRYD-  195
DSSP  hhhhHHHLlLLLL------------lllllllllLHHHhhhhhhHLLLEEEELLHHHLL-


DSSP  lhhhhlllhhhllhhHHHHHHHHHHHHHH-HLLEEE-EELHHHhllllllllLLHHHHHH
Query fqqffgedtsdfseeVXEKFRVILALVKK-RDYELD-FNTAGLfkplcgetyPPKKIVTL  245
ident                                                        |    
Sbjct --------------mGRTLIERLILDFQAaGGQGIEvASGSHS-------ldDMHKFALH  234
DSSP  --------------lLHHHHHHHHHHHHHlLLLEEEeEELLLL-------hhHHHHHHHH


DSSP  HHHLLLLEEEELLLLLH-hHLLLLHhhhHHHLL--------------------
Query ASELQIPFVYGSDSHGV-qDIGRGYstyCQKLE--------------------  277
ident |         ||| |    | |                               
Sbjct ADRHGLYASSGSDFHAPgeDVGHTE---DLPPIcrpiwrelearilrpadaen  284
DSSP  HHHHLLEEEEELLLLLLllLLLLLL---LLLLLlllhhhhlhhhlllllhhhl


No 33: Query=3dcpA Sbjct=3icjA Z-score=9.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEEEEELLLLllLLLL-------------------------------------------
Query XKRDGHTHTEFcpHGTH-------------------------------------------   17
ident    | | |                                                    
Sbjct AFFDSHLHLDElgMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   17
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  ------lLHHHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhlllllhhhHHHH
Query ------dDVEEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttasxaxsdLPYY   71
ident          |        |                                         
Sbjct tvkdykhYIESAQEHLLSLGVHSVGFMS---------------------------vGEKA  213
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEE---------------------------eLHHH


DSSP  HHHHHHHH--HHLLllLEEEEE--------------------------EEEEL-------
Query FKKXNHIK--KKYAsdLLIHIG--------------------------FEVDY-------   96
ident  |                                                          
Sbjct LKALFELEreGRLK--MNVFAYlspelldkleelnlgkfegrrlriwgVXLFVdgslgar  271
DSSP  HHHHHHHHhlLLLL--LEEEEEelhhhhhhhhhhlllleellleeeeeEEEELlllllll


DSSP  -------------------LLLL-HHHHHHHHHHHHHhlleeEEELleeeelleeeelll
Query -------------------LIGY-EDFTRDFLNEYGPqtddgVLSLhflegqggfrsidf  136
ident                                    |                        
Sbjct tallsepytdnpttsgelvMNKDeIVEVIERAKPLGL---dvAVHA--------------  314
DSSP  lllllllllllllllllllLLHHhHHHHHHHHLLLLL---eeEEEE--------------


DSSP  lhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHL--LLLLlllLEELLLLHhhllhhhhll
Query saedynegivqfyggfeqaqlaYLEGVKQSIEA--DLGLfkpRRXGHISLcqkfqqffge  194
ident                           |     |          |  | ||          
Sbjct ---------------------iGDKAVDVALDAfeEAEF--sGRIEHASL----------  341
DSSP  ---------------------lLHHHHHHHHHHhhHHLL--lLEEEELLL----------


DSSP  lhhhllhhhhhhHHHHHHHHHHHLLEEEEELHHH-HLLLL-----llllllhhHHHHHHH
Query dtsdfseevxekFRVILALVKKRDYELDFNTAGL-FKPLC-----getyppkkIVTLASE  248
ident                 |   |                                     | 
Sbjct -----------vRDDQLERIKELKVRISAQPHFIvSDWWIvnrvgeerakwayRLKTLSS  390
DSSP  -----------lLHHHHHHHHHHLLEEEELLLHHhHLLLHhhhhhhhhhhhllLHHHHHH


DSSP  LlLLEEEELLLLlhhHLLL--LHHHH-------------HHHL-----------------
Query LqIPFVYGSDSHgvqDIGR--GYSTY-------------CQKL-----------------  276
ident          ||                                                 
Sbjct I-TKLGFSTDSP-iePADPwvSIDAAvnryvvdpgervsREEAlhlythgsaqvtlaedl  448
DSSP  H-LLEEELLLLL-llLLLHhhHHHHHhhlllllhhhlllHHHHhhhllhhhhhhllllll


DSSP  -------------------l
Query -------------------e  277
ident                     
Sbjct gklergfraeyiildrdplk  468
DSSP  lllllllllleeeellllll


No 34: Query=3dcpA Sbjct=2vc5A Z-score=8.9

back to top
DSSP  ----------------LLEEEEELLlLLLL--------------llllLHHHHHHHHHHL
Query ----------------XKRDGHTHTeFCPH--------------gthdDVEEXVLKAIEL   30
ident                      | |                             |  |   
Sbjct mriplvgkdsieskdiGFTLIHEHL-RVFSeavrqqwphlynedeefrNAVNEVKRAMQF   59
DSSP  llllllllllllhhhlLLEELLLLL-LLLLhhhhhhlhhhllhhhhhhHHHHHHHHHHHL


DSSP  LLLEEEEEEEllllhhhhhllllllhhhhlLLLLhhhhhhHHHHHHHHHHHLLllLEEEE
Query DFDEYSIVEHaplssefxkntagdkeavttASXAxsdlpyYFKKXNHIKKKYAsdLLIHI   90
ident                                                  |          
Sbjct GVKTIVDPTV--------------------MGLG-----rDIRFMEKVVKATG--INLVA   92
DSSP  LLLEEEELLL--------------------LLLL-----lLHHHHHHHHHLLL--LEEEE


DSSP  E------------------------------------------eEEEL---LLLL-HHHH
Query G------------------------------------------fEVDY---LIGY-EDFT  104
ident |                                                   |       
Sbjct GtgiyiyidlpfyflnrsideiadlfihdikegiqgtlnkagfvXIAAdepGITKdVEKV  152
DSSP  LeellllllllhhhllllhhhhhhhhhhhhhlllllllllllleEEELlllLLLHhHHHH


DSSP  HHHHHHHHH-hlleEEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhHHHH
Query RDFLNEYGP-qtddGVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlayLEGV  163
ident                                                             
Sbjct IRAAAIANKetkvpIITHSN-----------------------------------aHNNT  177
DSSP  HHHHHHHHHhhlllEEEELL-----------------------------------lLLLH


DSSP  hhHHHL--LLLL----llLLEELLLLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHH
Query kqSIEA--DLGL----fkPRRXGHISLCqkfqqffgedtsdfseevxekFRVILALVKKR  217
ident     |    |            ||                                    
Sbjct --GLEQqrILTEegvdpgKILIGHLGDT--------------------dNIDYIKKIADK  215
DSSP  --HHHHhhHHHHllllhhHEEELLHHHL--------------------lLHHHHHHHHHL


DSSP  LLEEEEE-LHHHhllLLLLLllLHHHHHHHHHLLL--LEEEELLLLL-------------
Query DYELDFN-TAGLfkpLCGETypPKKIVTLASELQI--PFVYGSDSHG-------------  261
ident                |                           |                
Sbjct GSFIGLDrYGLD---LFLPVdkRNETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykp  272
DSSP  LLEEEELlLLLL---LLLLHhhHHHHHHHHHHLLLllLEEELLLLLLllllllllhhhhh


DSSP  ----hhHLLLLHHHHHHHLL----------------------
Query ----vqDIGRGYSTYCQKLE----------------------  277
ident        |          |                       
Sbjct klaprwSITLIFEDTIPFLKrngvneeviatifkenpkkffs  314
DSSP  hhllllLLLHHHHLHHHHHHlllllhhhhhhhhlhhhhhhll


No 35: Query=3dcpA Sbjct=3f2bA Z-score=8.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEEEEELLLLL
Query ------------------------------------------------XKRDGHTHTEFC   12
ident                                                      | ||   
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL


DSSP  -LLLLlLLHHHHHHHHHHLLLLEEEEEEELLllhhhhhllllllhhhhlllllhhhhhhH
Query -PHGThDDVEEXVLKAIELDFDEYSIVEHAPlssefxkntagdkeavttasxaxsdlpyY   71
ident         |      |            ||                              
Sbjct qMDAV-TSVTKLIEQAKKWGHPAIAVTDHAV--------------------------vqS  153
DSSP  lLLLL-LLHHHHHHHHHHLLLLLEEELLLLL--------------------------llL


DSSP  HHHHHHHHHHLLllLEEEEEEEEELLLL-lhhhhhhhhHHHHHHLleeeeelleeeellE
Query FKKXNHIKKKYAsdLLIHIGFEVDYLIG-yedftrdflNEYGPQTddgvlslhflegqgG  130
ident |       ||         | |                                      
Sbjct FPEAYSAAKKHG--MKVIYGLEANIVDDpfhvtllaqnETGLKNL---fklvslshiqyF  208
DSSP  HHHHHHHHHHHL--LLEEEEEEEEEELLleeeeeeellHHHHHHH---hhhhhhhhlllL


DSSP  EEEllllhhhhhhhlhhhhllhhhhhhhhhhhhhhhhhLLLLLLLLLEELL----LLHHh
Query FRSidfsaedynegivqfyggfeqaqlaylegvkqsieADLGLFKPRRXGH----ISLCq  186
ident  |                                               |          
Sbjct HRV---------------------------priprsvlVKHRDGLLVGSGCdkgeLFDN-  240
DSSP  LLL---------------------------lleehhhhHHLLLLEEEELLLllllLLLL-


DSSP  llhhhhlllhhhllhhhhhhHHHHHHHHhhhlLEEEEELhHHHLLLL------lllllLH
Query kfqqffgedtsdfseevxekFRVILALVkkrdYELDFNTaGLFKPLC------getypPK  240
ident                        |          |                         
Sbjct --------------------VEDIARFY----DFLEVHP-PDVYKPLyvkdeemikniIR  275
DSSP  --------------------LLLLHHHL----LLEEELL-HHHHLLLllllhhhhhhhHH


DSSP  HHHHHHHHLLLLEEEELLLLLHH----------------------------HLLL--LHH
Query KIVTLASELQIPFVYGSDSHGVQ----------------------------DIGR--GYS  270
ident  || |   | || |     |                                        
Sbjct SIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelpdvYFRTtnEML  335
DSSP  HHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllllllLLLLhhHHH


DSSP  H--------hHHHL----------------------------------------------
Query T--------yCQKL----------------------------------------------  276
ident                                                             
Sbjct DcfsflgpekAKEIvvdntqkiasligdvkpikdelytpriegadeeiremsyrrakeiy  395
DSSP  HhhhhhhhhhHHHHhlhhhhhhhhlllllllllllllllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct gdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmt  455
DSSP  lllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct eitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflg  515
DSSP  lllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct fkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhn  575
DSSP  lllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct lelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthf  635
DSSP  llllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct dfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeq  695
DSSP  ehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct imcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtct  755
DSSP  hllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct lsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsck  815
DSSP  hhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct kikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkri  875
DSSP  hllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  276
ident                                                             
Sbjct eeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfna  935
DSSP  hhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhh


DSSP  ----------------------------------------------------------l
Query ----------------------------------------------------------e  277
ident                                                            
Sbjct ipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 36: Query=3dcpA Sbjct=3e38A Z-score=8.8

back to top
DSSP  -----------------LLEEEEELLLLLllLLLLLHHHHHHHHHHLLLLEEEEEEELLl
Query -----------------XKRDGHTHTEFCphGTHDDVEEXVLKAIELDFDEYSIVEHAPl   43
ident                   | | | |  |            |  |     |  |  ||   
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVFS--DGLVWPTVRVDEAYRDGLDAISLTEHIE-   57
DSSP  llllllllllllllleeEEEELLLLLLLL--LLLLLHHHHHHHHHHLLLLEELLEEELL-


DSSP  lhhhhhllllllhhhhlLLLLHH-HHHHHHHHHHHHHHHLL-LLLEEEEEEEEELL----
Query ssefxkntagdkeavttASXAXS-DLPYYFKKXNHIKKKYA-SDLLIHIGFEVDYL----   97
ident                                              |   | |        
Sbjct -----------------YRPHKQdVVSDHNRSFDLCREQAEkLGILLIKGSEITRAxapg  100
DSSP  -----------------LLLLLLlLLLLLLHHHHHHHHHHHhHLLEELLEEEEELLllll


DSSP  -----------lllHHHHHHHHhhhhhhlleeeeelleeeelleeeellllhhhhhhhlh
Query -----------igyEDFTRDFLneygpqtddgvlslhflegqggfrsidfsaedynegiv  146
ident                    |                                        
Sbjct hfnaiflsdsnpleQKDYKDAF--------------------------------------  122
DSSP  eeeeelllllhhhlLLLHHHHH--------------------------------------


DSSP  hhhllhhhhhhhhhhhhhhhhhlllLLLL----LLEELLLLHH--HLLHhhhlllhhhll
Query qfyggfeqaqlaylegvkqsieadlGLFK----PRRXGHISLC--QKFQqffgedtsdfs  200
ident                             |         |      |              
Sbjct -------------------------REAKkqgaFXFWNHPGWDsqQPDT-----------  146
DSSP  -------------------------HHHHhlllEEEELLLLLLllLLLL-----------


DSSP  hhhhhhHHHHHHHHHHHL--LEEE-EELHHhhlllllllLLLHhHHHHHHHLLLLEEEEL
Query eevxekFRVILALVKKRD--YELD-FNTAGlfkplcgetYPPKkIVTLASELQIPFVYGS  257
ident                           |            | |                 |
Sbjct ----tkWWPEHTALYQEGcxHGIEvANGHL---------YXPE-AIQWCLDKNLTXIGTS  192
DSSP  ----llLLHHHHHHHHLLllLEEEeEELLE---------ELLH-HHHHHHHHLLEEEEEL


DSSP  LLLLHH---------hlLLLH--------------------HHHH----HHLL-------
Query DSHGVQ---------diGRGY--------------------STYC----QKLE-------  277
ident | |                                                         
Sbjct DIHQPIqtdydfekgehRTXTfvfakerslqgirealdnrrTAAYfhelLIGRedllrpf  252
DSSP  LLLLLHhhhllhhhlllLLEEeeeellllhhhhhhhhhlllEEEEelleEELLhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct fekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigf  312
DSSP  hhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeee


DSSP  ------------------------------
Query ------------------------------  277
ident                               
Sbjct kqgikggdvnfevtnfivapdkglkytisl  342
DSSP  llllllleeeeeeeeeeeelleeeeeeeel


No 37: Query=3dcpA Sbjct=1onxA Z-score=8.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --LLEEEEEL-LLLLLL----lLLLLHhhHHHHHHHLLLLEEEEEEEllllhhhhhllll
Query --XKRDGHTH-TEFCPH----gTHDDVeeXVLKAIELDFDEYSIVEHaplssefxkntag   53
ident      | | |                |        |                        
Sbjct cpGFIDQHVHlIGGGGEagpttRTPEV--ALSRLTEAGVTSVVGLLG-------------  105
DSSP  eeLEEEEEELlLLLLLLllhhhLLLLL--LHHHHHHLLEEEEEELLL-------------


DSSP  llhhhhlLLLLhhhhhhHHHHHHHHHHHLL-LLLEEEEE---------------------
Query dkeavttASXAxsdlpyYFKKXNHIKKKYA-SDLLIHIG---------------------   91
ident                                                             
Sbjct -------TDSI----srHPESLLAKTRALNeEGISAWMLtgayhvpsrtitgsvekdvai  154
DSSP  -------LLLL----llLHHHHHHHHHHHHhHLLEEEEEeellllllllllllhhhhhhh


DSSP  ------EEEEL-----lLLLHHHHHHHHHHHHHH------lleEEEELLEeeelleeeel
Query ------FEVDY-----lIGYEDFTRDFLNEYGPQ------tddGVLSLHFlegqggfrsi  134
ident                              |              |               
Sbjct idrvigVXCAIsdhrsaAPDVYHLANMAAESRVGgllggkpgvTVFHMGD----------  204
DSSP  llleeeEEEEEllllllLLLHHHHHHHHHHHHHHhhhhlllleEEEEELL----------


DSSP  lllhhhhhhhlhhhhllhhhhhhhHHHHHhHHHHLL--LLLL--lLLEELLLLHHHllhh
Query dfsaedynegivqfyggfeqaqlaYLEGVkQSIEAD--LGLF--kPRRXGHISLCQkfqq  190
ident                               | |                 |         
Sbjct ------------------------SKKAL-QPIYDLleNCDVpisKLLPTHVNRNV----  235
DSSP  ------------------------LLLLL-HHHHHHhhLLLLlhhHEEEELHHHLH----


DSSP  hhlllhhhllhhhhhhhhhHHHHHHHHLLEEEEELHHHhlllLLLLllLHHHHHHhHHLL
Query ffgedtsdfseevxekfrvILALVKKRDYELDFNTAGLfkplCGETypPKKIVTLaSELQ  250
ident                                |                            
Sbjct ---------------plfeQALEFARKGGTIDITSSID---ePVAPaeGIARAVQ-AGIP  276
DSSP  ---------------hhhhHHHHHHHLLLLEEEELLLL---lLLLHhhHHHHHHH-LLLL


DSSP  -LLEEEELLLLL--------------hHHLLLLHHHHHHHLL------------------
Query -IPFVYGSDSHG--------------vQDIGRGYSTYCQKLE------------------  277
ident        ||  |                          | |                   
Sbjct lARVTLSSDGNGsqpffddegnlthigVAGFETLLETVQVLVkdydfsisdalrpltssv  336
DSSP  hHHEEEELLLLLeeeeellllleeeeeELLLHHHHHHHHHHHhhhlllhhhhhhhhlhhh


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  277
ident                                                       
Sbjct agflnltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  hhhlllllllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 38: Query=3dcpA Sbjct=3irsA Z-score=8.5

back to top
DSSP  -LLEEEEELLL----LLLLLL----------------------lLLHHHHHHHHHHLLLL
Query -XKRDGHTHTE----FCPHGT----------------------hDDVEEXVLKAIELDFD   33
ident     |                                          |            
Sbjct lKIIDFRLRPPamgfLNARIYtrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
DSSP  lLLEELLLLLLlhhhHHLHHHhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL


DSSP  EEEEEEELLllhhhhhllllllhhHHLLLLlhhHHHHHHHHHHHHHHhlllllEEEEEEe
Query EYSIVEHAPlssefxkntagdkeaVTTASXaxsDLPYYFKKXNHIKKkyasdlLIHIGFe   93
ident     |                       |                          |    
Sbjct QGVCVGRNS---------------SVLGSV---SNADVAAVAKAYPD------KFHPVG-   95
DSSP  EEEEELLEE---------------LLLEEL---LHHHHHHHHHHLLL------LEEEEE-


DSSP  eellllLHHHHHHHHHHHH-HHLLEE--------------------------------EE
Query vdyligYEDFTRDFLNEYG-PQTDDG--------------------------------VL  120
ident                 |                                           
Sbjct -sieaaTRKEAMAQMQEILdLGIRIVnlepgvwatpmhvddrrlyplyafcedngipvIM  154
DSSP  -ellllLHHHHHHHHHHHHhLLLLLEeelhhhlllllllllhhhhhhhhhhhhlllleEE


DSSP  EL---LEEEelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLLllllllL
Query SL---HFLEgqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEADlglfkpR  177
ident                                            |                
Sbjct MTggnAGPD----------------------------itytNPEHIDRVLGDF--pdltV  184
DSSP  ELlllLLLL----------------------------hhhhLHHHHHHHHHHL--llllE


DSSP  EELLLLHHhllhhhhlllhhhllhhhhHHHHHHHHHHhhHLLEEEEELHHHhllllllll
Query RXGHISLCqkfqqffgedtsdfseevxEKFRVILALVkkRDYELDFNTAGLfkplcgety  237
ident    |                                       |                
Sbjct VSSHGNWP-----------------wvQEIIHVAFRR--PNLYLSPDMYLY-------nl  218
DSSP  EEEHHHLL-----------------lhHHHHHHHHHL--LLEEEELHHHHL-------ll


DSSP  lLHHHHHHHHHLLL--LEEEELLLLlhhHLLLLHHHHHHHLL------------------
Query pPKKIVTLASELQI--PFVYGSDSHgvqDIGRGYSTYCQKLE------------------  277
ident         |           |                                       
Sbjct pGHADFIQAANSFLadRMLFGTAYP-mcPLKEYTEWFLTLPIkpdamekilhgnaerlla  277
DSSP  lLHHHHHHHHLLHHhhLLLLLLLLL-llLHHHHHHHHHLLLLlhhhhhhhhlhhhhhhhh


DSSP  ----
Query ----  277
ident     
Sbjct qagr  281
DSSP  hlll


No 39: Query=3dcpA Sbjct=1yrrB Z-score=8.5

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------XKRDGHTH    8
ident                                                        |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  ----lLLLLLLLL---lLHHHHHHHHHHLLLLEEEEEEELLllhhhhhllllllhhhhll
Query ----tEFCPHGTH---dDVEEXVLKAIELDFDEYSIVEHAPlssefxkntagdkeavtta   61
ident       |            |             |                          
Sbjct gcggvQFNDTAEAvsveTLEIMQKANEKSGCTNYLPTLITT-------------------  101
DSSP  eelleELLLLLLLllhhHHHHHHHHHHLLLEEEEEEEELLL-------------------


DSSP  llLHHHHHHHHHHHHHHHHHLLllLEEE-EEEE----------------------EELL-
Query sxAXSDLPYYFKKXNHIKKKYAsdLLIH-IGFE----------------------VDYL-   97
ident                    |            |                           
Sbjct --SDELMKQGVRVMREYLAKHP--NQALgLHLEgpwlnaalvdflcenadvitkvTLAPe  157
DSSP  --LHHHHHHHHHHHHHHHHHLL--LLLLlEEEEllllllhhhhhhhhlhhheeeeEELHh


DSSP  LLLHHHHHHHHHHHHhhlleeeEELLEEeelleeeellllhhhhhhhlhhhhllhhhhhh
Query IGYEDFTRDFLNEYGpqtddgvLSLHFLegqggfrsidfsaedynegivqfyggfeqaql  157
ident            |             |                                  
Sbjct MVPAEVISKLANAGI-----vvSAGHSN--------------------------------  180
DSSP  HLLHHHHHHHHHHLL-----eeEELLLL--------------------------------


DSSP  hHHHHHHHHhHLLLlllllLEELLLLHHhllhhhhlllhhhLLHHHhhhhhHHHHHHHhh
Query aYLEGVKQSiEADLglfkpRRXGHISLCqkfqqffgedtsdFSEEVxekfrVILALVKkr  217
ident   |   |                |                                    
Sbjct aTLKEAKAG-FRAG----iTFATHLYNA----------mpyITGRE-pglaGAILDEA--  222
DSSP  lLHHHHHHH-HHHL----eEEELLLLLL----------lllLLLLL-lhhhHHHHHLL--


DSSP  LLEEEEELhhhhllllLLLLlLHHHHHHHHHL-LLLEEEELLLLlhhHLLL--LHHHHHH
Query DYELDFNTaglfkplcGETYpPKKIVTLASEL-QIPFVYGSDSHgvqDIGR--GYSTYCQ  274
ident |               |           |  |         |           |      
Sbjct DIYCGIIA-------dGLHV-DYANIRNAKRLkGDKLCLVTDATsgsSLTMieGVRNLVE  274
DSSP  LLEEEEEL-------lLLLL-LHHHHHHHHHHhHHHEEEELLLLlllLLLHhhHHHHHHH


DSSP  HLL---------------------------------------------------------
Query KLE---------------------------------------------------------  277
ident                                                             
Sbjct HCGialdevlrmatlyparaigvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  HHLllhhhhhhhhlhhhhhhllllllllllllllllleeeellllleeeeeelleeeeel


No 40: Query=3dcpA Sbjct=3nqbA Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------LLEEEEELLLllllLLLLLHHHHHHHHHHLLLLEEEEEEEll
Query ------------------XKRDGHTHTEfcphGTHDDVEEXVLKAIELDFDEYSIVEHap   42
ident                      | | | |                             |  
Sbjct srrdaaqvidaggayvspGLIDTHXHIE----SSXITPAAYAAAVVARGVTTIVWDPH--  114
DSSP  lllleeeeeelllleeeeLEEEEEELHH----HHLLLHHHHHHHHHLLLEEEEEELLH--


DSSP  llhhhhhllllllhhhhlllllhHHHHHHHHHHHHHHHHLllLLEEEEE-----------
Query lssefxkntagdkeavttasxaxSDLPYYFKKXNHIKKKYasDLLIHIG-----------   91
ident                                            |                
Sbjct -------------------efgnVHGVDGVRWAAKAIENL--PLRAILLapscvpsapgl  153
DSSP  -------------------hhhhHHLHHHHHHHHHHHLLL--LLEEEEEellllllllll


DSSP  ------------------------EEEELLL---LLHHHHHHHHHHHhhhlleeEEELLE
Query ------------------------FEVDYLI---GYEDFTRDFLNEYgpqtddgVLSLHF  124
ident                          |                                  
Sbjct erggadfdaailadllswpeiggiAEIXNXRgviERDPRXSGIVQAGlaaeklvCGHARG  213
DSSP  llllllllhhhhhhhhlllleeeeEEELLHHhhhLLLHHHHHHHHHHhhhlleeEELLLL


DSSP  eeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLlllllLLLEELLLLh
Query legqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEAdlglfKPRRXGHISl  184
ident                                             |               
Sbjct ---------------------------------lKNADLNAFXAA-----GVSSDHELV-  234
DSSP  ---------------------------------lLHHHHHHHHHL-----LLLEELLLL-


DSSP  hhllhhhhlllhhhllhhhhhhhHHHHHHHhhhlLEEEEELHHhhlllLLLLllLHHHHH
Query cqkfqqffgedtsdfseevxekfRVILALVkkrdYELDFNTAGlfkplCGETypPKKIVT  244
ident                           |                                 
Sbjct ------------------sgedlXAKLRAG----LTIELRGSH-----DHLLpeFVAALN  267
DSSP  ------------------lhhhhHHHHHLL----LEEEEELLL-----HHHHhhHHHHHH


DSSP  HhhHLLLLEEEELLLLL-----hHHLL-LLHHHHH-HHLL--------------------
Query LasELQIPFVYGSDSHG-----vQDIG-RGYSTYC-QKLE--------------------  277
ident     |        |                        |                     
Sbjct TlgHLPQTVTLCTDDVFpddllqGGGLdDVVRRLVrYGLKpewalraatlnaaqrlgrsd  327
DSSP  HhlLLLLLEEEELLLLLhhhhhhLLLHhHHHHHHHhLLLLhhhhhhhhlhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct lgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplr  387
DSSP  llllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct xandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaept  447
DSSP  lhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct tktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvt  507
DSSP  eeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct ailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqt  567
DSSP  eeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleel


DSSP  --------------------
Query --------------------  277
ident                     
Sbjct dxgiadvltgkvxespviev  587
DSSP  llleeelllleeellleeel


No 41: Query=3dcpA Sbjct=2ob3A Z-score=8.4

back to top
DSSP  ---------------LLEEEEELLLLLL--------------lllllLHHHHHHHHHHLL
Query ---------------XKRDGHTHTEFCP--------------hgthdDVEEXVLKAIELD   31
ident                     | |                                |    
Sbjct drintvrgpitiseaGFTLTHEHICGSSagflrawpeffgsrkalaeKAVRGLRRARAAG   60
DSSP  lleeelleeelhhhhLLEEEEELLEELLllhhhhlhhhhllhhhhhhHHHHHHHHHHHLL


DSSP  LLEEEEEEELLllhhhhhllllllhhhhlllllhhhhhhHHHHHHHHHHHLLllLEEEEE
Query FDEYSIVEHAPlssefxkntagdkeavttasxaxsdlpyYFKKXNHIKKKYAsdLLIHIG   91
ident       |                                                 |   
Sbjct VRTIVDVSTFD-------------------------igrDVSLLAEVSRAAD--VHIVAA   93
DSSP  LLEEEELLLHH-------------------------hllLHHHHHHHHHHHL--LEEELE


DSSP  ------eeeellllLHHHHHHHHHHHHH--------HLLEE-------------------
Query ------fevdyligYEDFTRDFLNEYGP--------QTDDG-------------------  118
ident                      |                                      
Sbjct tglwfdpplsmrlrSVEELTQFFLREIQygiedtgiRAGIIxvattgkatpfqelvlkaa  153
DSSP  eellllllhhhhllLHHHHHHHHHHHHHllllllllLLLEEeeellllllhhhhhhhhhh


DSSP  -----------EEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHH
Query -----------VLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSI  167
ident                                                          |  
Sbjct araslatgvpvTTHTA----------------------------------aSQRDGEQQA  179
DSSP  hhhhhhhllleEEELL----------------------------------hHHLHHHHHH


DSSP  HLL---llllllLEELLLLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEE
Query EAD---lglfkpRRXGHISLCqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFN  224
ident                ||                             |     | |     
Sbjct AIFeseglspsrVCIGHSDDT--------------------dDLSYLTALAARGYLIGLD  219
DSSP  HHHhhllllhhhEEELLHHHL--------------------lLHHHHHHHHHLLLEEEEL


DSSP  LHhHHLL--------------LLLLlllLHHHHHHHHHLLL--LEEEELLLLL-------
Query TAgLFKP--------------LCGEtypPKKIVTLASELQI--PFVYGSDSHG-------  261
ident                                                  |          
Sbjct HI-PYSAiglednasasallgIRSW-qtRALLIKALIDQGYmkQILVSNDWTFgfssyvt  277
DSSP  LL-LLLLllllllhhhhhhhlLLLH-hhHHHHHHHHHHLLLhhHEEELLLLLLeelllll


DSSP  ----------hHHLLLLHHHHHHHLL--------------------------
Query ----------vQDIGRGYSTYCQKLE--------------------------  277
ident                         |                           
Sbjct nimdvmdrvnpDGMAFIPLRVIPFLRekgvpqetlagitvtnparflsptlr  329
DSSP  lhhhhhhhhllLHHHHHHHLHHHHHHhllllhhhhhhhhlhhhhhhhlllll


No 42: Query=3dcpA Sbjct=4hk5D Z-score=8.2

back to top
DSSP  --LLEEEEELLLL-----------------------------------------------
Query --XKRDGHTHTEF-----------------------------------------------   11
ident      | |||                                                  
Sbjct tpVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  llLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  --lllLLLL--LHHHHHHHHHHLLLLEEEEEEE--LLLLHhhhhllllllhhhhllllLH
Query --cphGTHD--DVEEXVLKAIELDFDEYSIVEH--APLSSefxkntagdkeavttasxAX   65
ident                              |                            | 
Sbjct lpgrpLSTHfaSLAQKMHFMDTNGIRVSVISLAnpWFDFL--------------apdeAP  106
DSSP  llleeLLHHhlLHHHHHHHHHHLLLLEEEEEELllLLLLL--------------llllHH


DSSP  HHHHHHHHHHHHHHHHlLLLLeEEEE---------------------------EEEELL-
Query SDLPYYFKKXNHIKKKyASDLlIHIG---------------------------FEVDYL-   97
ident                                                             
Sbjct GIADAVNAEFSDMCAQ-HVGR-LFFFaalplsapvdavkasiervknlkycrgIILGTSg  164
DSSP  HHHHHHHHHHHHHHHL-LLLL-EEEEeellllllhhhhhhhhhhhhlllleeeEEELLLl


DSSP  -LLLH--HHHHHHHHHHHHhlLEEEEELLEEEElleeeellllhhhhhhhlHHHHLL---
Query -IGYE--DFTRDFLNEYGPqtDDGVLSLHFLEGqggfrsidfsaedynegiVQFYGG---  151
ident                          |  |                         ||    
Sbjct lGKGLddPHLLPVFEAVADakLLVFLHPHYGLP------------------NEVYGPrse  206
DSSP  lLLLLllHHHHHHHHHHHHllLEEEELLLLLLL------------------HHHHLLlhh


DSSP  ----hhhhhhhhHHHHHHHHHLLL--------LLLLlLEELLLlhhhllhhhhlllhhhl
Query ----feqaqlayLEGVKQSIEADL--------GLFKpRRXGHIslcqkfqqffgedtsdf  199
ident                                          |                  
Sbjct eyghvlplalgfPMETTIAVARMYmagvfdhvRNLQ-MLLAHS-----------------  248
DSSP  hlllhhhhhlhhHHHHHHHHHHHHhllhhhhlLLLL-EEEHHH-----------------


DSSP  lhhhhhhhhhHHHH--------------------------hHHHL---LEEEEElhhhhl
Query seevxekfrvILAL--------------------------vKKRD---YELDFNtaglfk  230
ident              |                                    ||        
Sbjct -------ggtLPFLagriescivhdghlvktgkvpkdrrtiWTVLkeqIYLDAV------  295
DSSP  -------hllHHHHhhhhhhhhhllhhhhhllllllllllhHHHHhhlEEEELL------


DSSP  llllllLLLHHHHHHHHHLLL--LEEEELLLL-------lhhhlLLLHHHHHHHLL----
Query plcgetYPPKKIVTLASELQI--PFVYGSDSH-------gvqdiGRGYSTYCQKLE----  277
ident                |           | |                      |       
Sbjct ------IYSEVGLQAAIASSGadRLMFGTDHPffppieedvqgpWDSSRLNAQAVIkavg  349
DSSP  ------LLLHHHHHHHHHHHLhhHEELLLLLLllllllllllllLHHHHHHHHHHHhhhl


DSSP  -------------------------------
Query -------------------------------  277
ident                                
Sbjct egssdaaavmglnavrvlslkaelehhhhhh  380
DSSP  lllhhhhhhhlhhhhhhlllhhhhhhhhhhl


No 43: Query=3dcpA Sbjct=4qrnA Z-score=8.2

back to top
DSSP  --------------LLEEEEELLLL---------------------------------ll
Query --------------XKRDGHTHTEF---------------------------------cp   13
ident                                                             
Sbjct smtqdlktggeqgyLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllllLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  LLLL---LLHH-HHHHHHHHLLLLEEEEEEE--LLLLHHhhhllllllhhhhllllLHHH
Query HGTH---DDVE-EXVLKAIELDFDEYSIVEH--APLSSEfxkntagdkeavttasxAXSD   67
ident         |              |                                |   
Sbjct TQILerlLDLGeRRIADMDATGIDKAILALTspGVQPLH-------------dldeARTL  107
DSSP  HHHHhhhHLLLhHHHHHHHHLLLLEEEEEELllLLLLLL-------------lhhhHHHH


DSSP  HHHHHHHHHHHHHHLLllLEEEEEeeeelllllhHHHHHHHHHHHHH------LLEE---
Query LPYYFKKXNHIKKKYAsdLLIHIGfevdyligyeDFTRDFLNEYGPQ------TDDG---  118
ident              ||                                             
Sbjct ATRANDTLADACQKYP--DRFIGM------gtvaPQDPEWSAREIHRgarelgFKGIqin  159
DSSP  HHHHHHHHHHHHHHLL--LLEEEL------llllLLLHHHHHHHHHHhhhlllLLLEeel


DSSP  ---------------------------EEELLEEEelLEEEellllhHHHHHHLhhhhll
Query ---------------------------VLSLHFLEgqGGFRsidfsaEDYNEGIvqfygg  151
ident                                                     |       
Sbjct shtqgryldeeffdpifralvevdqplYIHPATSP--DSMI-----dPMLEAGL------  206
DSSP  llllllllllhhhhhhhhhhhhhllleEELLLLLL--LLLL-----hHHHHHLL------


DSSP  hhhhhhHHHHHHHHHHHLL-------llllllLEELLLlhhhllhhhhlllhhhllhhhh
Query feqaqlAYLEGVKQSIEAD-------lglfkpRRXGHIslcqkfqqffgedtsdfseevx  204
ident                                    ||                       
Sbjct -dgaifGFGVETGMHLLRLitigifdkypslqIMVGHM----------------------  243
DSSP  -lllllHHHHHHHHHHHHHhhhlhhhhlllllEEELHH----------------------


DSSP  hhhhhHHHH-----------------------------hHHHLLEEEEELhhhhllllll
Query ekfrvILAL-----------------------------vKKRDYELDFNTaglfkplcge  235
ident                                         |                   
Sbjct --geaLPYWlyrldymhqagvrsqryermkplkktiegyLKSNVLVTNSG----------  291
DSSP  --hhlHHHHhhhhhhhhhhhhhlllllllllllllhhhhHHHLEEEELLL----------


DSSP  lLLLHHHHHHHHHLLL--LEEEELLLLlhhHLLL-LHHHHHHHLL---------------
Query tYPPKKIVTLASELQI--PFVYGSDSHgvqDIGR-GYSTYCQKLE---------------  277
ident                      |  |                                   
Sbjct -VAWEPAIKFCQQVMGedRVMYAMDYP--yQYVAdEVRAMDAMDMsaqtkkkffqtnaek  348
DSSP  -LLLHHHHHHHHHHHLhhHEELLLLLL--lLLLHhHHHHHHLLLLlhhhhhhhhlhhhhh


DSSP  ----
Query ----  277
ident     
Sbjct wfkl  352
DSSP  hlll


No 44: Query=3dcpA Sbjct=4ofcA Z-score=8.2

back to top
DSSP  lLEEEEELLLL----------------------------------llLLLL-LLHH-HHH
Query xKRDGHTHTEF----------------------------------cpHGTH-DDVE-EXV   24
ident  | | | |                                                    
Sbjct mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrVVREnCWDPeVRI   60
DSSP  lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeEEEHhHLLHhHHH


DSSP  HHHHHLLLLEEEEEEE---LLLLHHhhhllllllhhhhllllLHHHHHHHHHHHHHHHHH
Query LKAIELDFDEYSIVEH---APLSSEfxkntagdkeavttasxAXSDLPYYFKKXNHIKKK   81
ident                                                             
Sbjct REMDQKGVTVQALSTVpvmFSYWAK--------------pedTLNLCQLLNNDLASTVVS  106
DSSP  HHHHHHLLLEEEEELLhhhHLLLLL--------------hhhHHHHHHHHHHHHHHHHHH


DSSP  LLllLEEEEEEeeelllllhhHHHHHHHH-HHHH-----LLEE-----------------
Query YAsdLLIHIGFevdyligyedFTRDFLNE-YGPQ-----TDDG-----------------  118
ident |                                                           
Sbjct YP--RRFVGLG------tlpmQAPELAVKeMERCvkelgFPGVqigthvnewdlnaqelf  158
DSSP  LL--LLEEEEE------llllLLHHHHHHhHHHHhhlllLLEEeeeleelleelllhhhh


DSSP  -------------EEELLEEEELleeeellllhhhhhHHLHhhhllhhhhHHHHHHHHHH
Query -------------VLSLHFLEGQggfrsidfsaedynEGIVqfyggfeqaQLAYLEGVKQ  165
ident                                                             
Sbjct pvyaaaerlkcslFVHPWDMQMD--------------GRMA---kywlpwLVGMPAETTI  201
DSSP  hhhhhhhhhlleeEEELLLLLLL--------------HHHH---lllhhhHLHHHHHHHH


DSSP  HHHLL-------llllllLEELLLlhhhllhhhhlllhhhllhhhhhhhhhHHHH-----
Query SIEAD-------lglfkpRRXGHIslcqkfqqffgedtsdfseevxekfrvILAL-----  213
ident  |                    |                                     
Sbjct AICSMimggvfekfpklkVCFAHG------------------------ggaFPFTvgris  237
DSSP  HHHHHhlllhhhhlllllEEELHH------------------------hllHHHHhhhhh


DSSP  -------------------hHHHLLEEEEElhhhhlllllllLLLHHHHHHHHHLLL--L
Query -------------------vKKRDYELDFNtaglfkplcgetYPPKKIVTLASELQI--P  252
ident                            |                      |         
Sbjct hgfsmrpdlcaqdnpmnpkkYLGSFYTDAL------------VHDPLSLKLLTDVIGkdK  285
DSSP  hhhhhlhhhhlllllllhhhHLLLLEEELL------------LLLHHHHHHHHHHHLllL


DSSP  EEEELLLLlhhhlLLLHHHHHHH-------------------------ll
Query FVYGSDSHgvqdiGRGYSTYCQK-------------------------le  277
ident    | |                                            
Sbjct VILGTDYPfplgeLEPGKLIESMeefdeetknklkagnalaflglerkqf  335
DSSP  EELLLLLLlllllLLLLHHHHHLllllhhhhhhhhlhhhhhhhlllhhhl


No 45: Query=3dcpA Sbjct=3griA Z-score=8.0

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------XKRDGHTH    8
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLlllllLLLLHHHHHHHHHHLLLLEEEEEEEllllhhhhhllllllhhhhlllllhhHH
Query TEfcphgTHDDVEEXVLKAIELDFDEYSIVEHaplssefxkntagdkeavttasxaxsDL   68
ident             |     |    |                                  | 
Sbjct LRepggeYKETIETGTKAAARGGFTTVCPXPN---------------------trpvpDS   99
DSSP  LLlllllLLLLHHHHHHHHHHLLEEEEEELLL---------------------lllllLL


DSSP  HHHHHHHHHHHHHLLlLLEEEEE-------------------------EEEE-lLLLLHH
Query PYYFKKXNHIKKKYAsDLLIHIG-------------------------FEVD-yLIGYED  102
ident    |          |                                 |  |        
Sbjct VEHFEALQKLIDDNA-QVRVLPYasittrqlgkelvdfpalvkegafaFTDDgvGVQTAS  158
DSSP  HHHHHHHHHHHHHHL-LLEELLLeellhhhlllllllhhhhhllllllEEELllLLLLHH


DSSP  HHHHHHHHHhhhlleeEEELLEEEelleeeellllhhhhhhHLHH------hhllhhHHH
Query FTRDFLNEYgpqtddgVLSLHFLEgqggfrsidfsaedyneGIVQ------fyggfeQAQ  156
ident        |        |                                           
Sbjct XXYEGXIEAakvnkaiVAHCEDNS---------------liYGGAxhegkrskelgiPGI  203
DSSP  HHHHHHHHHhhhllleEELLLLHH---------------hlLLLLeellhhhhhhllLEE


DSSP  HhhHHHHHHHHH--LLLL---LLLLlEELLLLhhhllhhhhlllhhhllhhhhhhHHHHH
Query LayLEGVKQSIE--ADLG---LFKPrRXGHISlcqkfqqffgedtsdfseevxekFRVIL  211
ident           |     |            | |                            
Sbjct P--NICESVQIArdVLLAeaaGCHY-HVCHVS-----------------------TKESV  237
DSSP  L--LHHHHHHHHhhHHHHhhhLLLE-EELLLL-----------------------LHHHH


DSSP  HHHHHHL-----LEEEEELhhhhllllllLLLL------------------------HHH
Query ALVKKRD-----YELDFNTaglfkplcgeTYPP------------------------KKI  242
ident                                                             
Sbjct RVIRDAKragihVTAEVTP----------HHLLlteddipgnnaiykxnpplrstedREA  287
DSSP  HHHHHHHhllllEEEEELH----------HHHHllhhhlllllhhhllllllllhhhHHH


DSSP  HHHHHHLLLLEEEELLLLL---------------hHHLL-LLHHHHHHHLL---------
Query VTLASELQIPFVYGSDSHG---------------vQDIG-RGYSTYCQKLE---------  277
ident                |                                            
Sbjct LLEGLLDGTIDCIATDHAPhardekaqpxekapfgIVGSeTAFPLLYTHFVkngdwtlqq  347
DSSP  HHHHHHLLLLLEELLLLLLllhhhhllllllllllLLLLlLHHHHHHHHHLllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct lvdyltikpcetfnleygtlkengyadltiidldseqeikgedflskadntpfigykvyg  407
DSSP  hhhhhlhhhhhhllllllllllllllleeeeelllleellhhhllllllllllllleell


DSSP  ---------------
Query ---------------  277
ident                
Sbjct npiltxvegevkfeg  422
DSSP  eeeeeeelleeeeel


No 46: Query=3dcpA Sbjct=2ogjA Z-score=8.0

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------XKRD    4
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  EEEL--LLLLllllLLLHhhHHHH-HHHLLLLEEEEEEellllhhhhhllllllhhhhll
Query GHTH--TEFCphgtHDDVeeXVLK-AIELDFDEYSIVEhaplssefxkntagdkeavtta   61
ident  | |                       |                                
Sbjct LHVHiwHGGT----DISI--RPSEcGAERGVTTLVDAG----------------------   92
DSSP  EEELllLLLL----LLLL--LHHHlLHHHLEEEEEEEL----------------------


DSSP  lllhhhHHHHhHHHHH-HHHHLllLLEEEEEE----------------------------
Query sxaxsdLPYYfKKXNH-IKKKYasDLLIHIGF----------------------------   92
ident                  |         |                                
Sbjct ---sagEANF-HGFREyIIEPS--RERIKAFLnlgsiglvacnrvpelrdikdidldril  146
DSSP  ---lllLLLH-HHHHHhLLLLL--LLEEEEEEelllllllllllllllllhhhllhhhhh


DSSP  -------------EEEL--------LLLLHHHHHHHHHHHHHhlleeEEELLEEEellee
Query -------------EVDY--------LIGYEDFTRDFLNEYGPqtddgVLSLHFLEgqggf  131
ident               |                                             
Sbjct ecyaensehivglXVRAshvitgswGVTPVKLGKKIAKILKV---pxXVHVGEPP-----  198
DSSP  hhhhllllleeeeEEEElhhhhlllLLHHHHHHHHHHHHHLL---leEEEELLLL-----


DSSP  eellllhhhhhhhlhhhhllhhhhhhhhhhHHHHHHHLLlllllLLEELLLLHHHllhhh
Query rsidfsaedynegivqfyggfeqaqlayleGVKQSIEADlglfkPRRXGHISLCQkfqqf  191
ident                                     |            |          
Sbjct -----------------------------aLYDEVLEIL---gpGDVVTHCFNGK-----  221
DSSP  -----------------------------lLHHHHHHHL---llLLEEELLLLLL-----


DSSP  hlllhhhllhhhhhHHHHHHHHHHHHL-LEEEEELHHhhlllllllLLLHHHHHHHHHLL
Query fgedtsdfseevxeKFRVILALVKKRD-YELDFNTAGlfkplcgetYPPKKIVTLASELQ  250
ident                      |        ||    |             |    |    
Sbjct --------sgssixEDEDLFNLAERCEgIRLDIGHGG--------aSFSFKVAEAAIARG  265
DSSP  --------llllllLLHHHHHHHHHLLlLEEELLLLL--------lLLLHHHHHHHHHLL


DSSP  LLE-EEELLLLLHHH---lLLLHHHHHHHLL-----------------------------
Query IPF-VYGSDSHGVQD---iGRGYSTYCQKLE-----------------------------  277
ident         | ||            |    |                              
Sbjct LLPfSISTDLHGHSXnfpvWDLATTXSKLLSvdxpfenvveavtrnpasvirldxenrld  325
DSSP  LLLlLLLLLLLLLLLllllLLHHHHHHHHHHllllhhhhhhlllhhhhhhllllllllll


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  277
ident                                                       
Sbjct vgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 47: Query=3dcpA Sbjct=3e74A Z-score=7.7

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------XKRDGHTH    8
ident                                                        | |||
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LlllllllllLHHHHHHHHHHLLLLEEEEEEEllllhhhhhllllllhhhhllLLLHhhH
Query TefcphgthdDVEEXVLKAIELDFDEYSIVEHaplssefxkntagdkeavttaSXAXsdL   68
ident             |     |                                         
Sbjct I---------GYETGTRAAAKGGITTXIEXPL-----------------nqlpATVD--R   92
DSSP  L---------LHHHHHHHHHHLLEEEEEELLL-----------------llllLLLL--H


DSSP  HHHHHHHHHHhHHLLlLLEEEEE---------------------EEEELlllLHHHHHHH
Query PYYFKKXNHIkKKYAsDLLIHIG---------------------FEVDYligYEDFTRDF  107
ident      |     |                                |               
Sbjct ASIELKFDAA-KGKL-TIDAAQLgglvsynidrlheldevgvvgFXCFVrdvNDWQFFKG  150
DSSP  HHHHHHHHHH-LLLL-LLEEEELeellllllllhhhhhhhllllEEEELlllLHHHHHHH


DSSP  HHHHHHhlleeEEELLEEEElleeeellllhhhhhhHLHHHH--------lLHHHH-HHH
Query LNEYGPqtddgVLSLHFLEGqggfrsidfsaedyneGIVQFY--------gGFEQA-QLA  158
ident     |                                                       
Sbjct AQKLGElgqpvLVHCENALI--------------cdELGEEAkregrvtahDYVASrPVF  196
DSSP  HHHHHHhllleEEELLLHHH--------------hhHHHHHHhhhllllhhHHHHLlLHH


DSSP  HH-HHHHHHHHL-LLLLLLlLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHHHH
Query YL-EGVKQSIEA-DLGLFKpRRXGHISlcqkfqqffgedtsdfseevxekFRVILALVKK  216
ident    |                    | |                              |  
Sbjct TEvEAIRRVLYLaKVAGCR-LHVCHVS-----------------------SPEGVEEVTR  232
DSSP  HHhHHHHHHHHHhHHHLLL-EEELLLL-----------------------LHHHHHHHHH


DSSP  HL-----LEEEEELHH---------hhlLLLL-----llllLHHHHHHHHHLLLLEEEEL
Query RD-----YELDFNTAG---------lfkPLCG-----etypPKKIVTLASELQIPFVYGS  257
ident                              |             |               |
Sbjct ARqegqdITCESCPHYfvldtdqfeeigTLAKcsppirdleNQKGXWEKLFNGEIDCLVS  292
DSSP  HHhllllEEEEELLHHhhllhhhhhhhlHHHLlllllllhhHHHHHHHHHHLLLLLEELL


DSSP  LLLL----------------hHHLLLLHHHHHHHLL------------------------
Query DSHG----------------vQDIGRGYSTYCQKLE------------------------  277
ident |                                                           
Sbjct DHSPcppexkagnixkawggiAGLQSCXDVXFDEAVqkrgxslpxfgklxatnaadifgl  352
DSSP  LLLLlllllllllllllllllLLHHHHHHHHHHHHLllllllhhhhhhhhlhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct qqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviyd  412
DSSP  llllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeee


DSSP  -----------------
Query -----------------  277
ident                  
Sbjct ieqgfpvapkgqfilkh  429
DSSP  lllllllllllleelll


No 48: Query=3dcpA Sbjct=3pnuA Z-score=7.5

back to top
DSSP  -------------LLEEEEELLLllllllllLHHHHHHHHHhLLLLEEEEEEEllllhhh
Query -------------XKRDGHTHTEfcphgthdDVEEXVLKAIeLDFDEYSIVEHaplssef   47
ident                 | | |            |         ||    |          
Sbjct enlyfqsnamklkNPLDMHLHLR-----dnqMLELIAPLSA-RDFCAAVIMPN-------   47
DSSP  llllllllleeeeLLEEEEELLL-----lhhHHHHHHHHHH-LLLLEEEELLL-------


DSSP  hhllllllhhhhlLLLLhhHHHHHHHHHHHHHHHLLLL-LEEEEE---------------
Query xkntagdkeavttASXAxsDLPYYFKKXNHIKKKYASD-LLIHIG---------------   91
ident                     |         | |                           
Sbjct -----------liPPLC--NLEDLKAYKMRILKACKDEnFTPLMTlffknydekflysak   94
DSSP  -----------llLLLL--LHHHHHHHHHHHHHHHLLLlLEEEEEeelllllhhhhhhhl


DSSP  -----EEEEL----------LLLLHH-hhhHHHHHhhhhlleEEEELLEEEelleeeell
Query -----FEVDY----------LIGYED-ftrDFLNEygpqtddGVLSLHFLEgqggfrsid  135
ident                                 |                           
Sbjct deifgIXLYPagittnsnggVSSFDIeylkPTLEAmsdlnipLLVHGETND---------  145
DSSP  lllleEEELLllllllllllLLLLLHhhhhHHHHHhhhllllEEELLLLLL---------


DSSP  llhhhhhhhlhhhhllhhHHHHHHHHHhHHHHHLL---lLLLLlLEELLLLhhhllhhhh
Query fsaedynegivqfyggfeQAQLAYLEGvKQSIEAD---lGLFKpRRXGHISlcqkfqqff  192
ident                                 |         |     ||          
Sbjct ------------------FVMDRESNF-AKIYEKLakhfPRLK-IVMEHIT---------  176
DSSP  ------------------LHHHLLHHH-HHHHHHHhhhlLLLL-EEELLLL---------


DSSP  lllhhhllhhhhhhHHHHHHHHHHHL-LEEEEELHHHHL-----------LLLL------
Query gedtsdfseevxekFRVILALVKKRD-YELDFNTAGLFK-----------PLCG------  234
ident                     | |             |             |         
Sbjct --------------TKTLCELLKDYEnLYATITLHHLIItlddviggkmnPHLFckpiak  222
DSSP  --------------LHHHHHHHHHLLlEEEEELLHHHLLlhhhhhlllllHHHLllllll


DSSP  ---llllLHHHHHHHHhllLLEEEELLLLL--------hHHLLLLHHHHHHHLL------
Query ---etypPKKIVTLASelqIPFVYGSDSHG--------vQDIGRGYSTYCQKLE------  277
ident                         ||||                                
Sbjct ryedkeaLCELAFSGY---EKVMFGSDSAPhpkgcaagvFSAPVILPVLAELFKqnssee  279
DSSP  lhhhhhhHHHHHHLLL---LLEEELLLLLLlllllllllLLHHHHHHHHHHHHHhhllhh


DSSP  -----------------------------------------------------------
Query -----------------------------------------------------------  277
ident                                                            
Sbjct nlqkflsdntckiydlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  hhhhhhlhhhhhhhlllllllleeeeellleelllleelllleellllllleelleell


No 49: Query=3dcpA Sbjct=3ooqA Z-score=7.3

back to top
DSSP  ----------------------------------------------------LLEEEEEL
Query ----------------------------------------------------XKRDGHTH    8
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL


DSSP  -----------lLLLLL-----------llLLLH-HHHHHHHHHLLLLEEEEEEELLLlh
Query -----------tEFCPH-----------gtHDDV-EEXVLKAIELDFDEYSIVEHAPLss   45
ident                                          |         ||       
Sbjct iglfeegvgyyySDGNEatdpvtphvkaldGFNPqDPAIERALAGGVTSVXIVPGSAN--  118
DSSP  lllllllllhhhLLLLLllllllllllhhhHLLLlLHHHHHHHLLLEEEEEELLLLLL--


DSSP  hhhhllllllhhhhlllllhhhhhhhhhhhhhhHHHLLllleeeEEEEEEL---------
Query efxkntagdkeavttasxaxsdlpyyfkkxnhiKKKYAsdllihIGFEVDY---------   96
ident                                              |              
Sbjct ------------------pvggqgsvikfrsiiVEECI--vkdpAGLKXAFgenpkrvyg  158
DSSP  ------------------leeeeeeeeelllllHHHHE--eeeeEEEEEELlhhhhhhhh


DSSP  -----------LLLLHHHHHH--------------------------hhHHHH--HHLLe
Query -----------LIGYEDFTRD--------------------------flNEYG--PQTDd  117
ident              |                                    |         
Sbjct erkqtpstrxgTAGVIRDYFTkvknyxkkkelaqkegkeftetdlkxevGEXVlrKKIP-  217
DSSP  hlllllllhhhHHHHHHHHHHhhhhhhhhhhhhhhlllllllllhhhhhHHHHhlLLLL-


DSSP  EEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHL-LLLLLLL
Query GVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEA-DLGLFKP  176
ident      |                                           |       |  
Sbjct ARXHAH-----------------------------------RADDILTAIRIaEEFGFNL  242
DSSP  EEEEEL-----------------------------------LHHHHHHHHHHhHHHLLLE


DSSP  lEELLLLhhhllhhhhlllhhhllhhhhhhhHHHHHHHHHHLLEEEEELhHHHLLLL-ll
Query rRXGHISlcqkfqqffgedtsdfseevxekfRVILALVKKRDYELDFNTaGLFKPLC-ge  235
ident     |                            |                 |        
Sbjct -VIEHGT----------------------eaYKISKVLAEKKIPVVVGP-LLTFRTKlel  278
DSSP  -EEEELL----------------------lhHHHHHHHHHHLLLEEELL-LLLLLLLhhh


DSSP  lllLHHHHHHHHHLLLLEEEELLLLlhhHLLLLHHHHHHH--------------------
Query typPKKIVTLASELQIPFVYGSDSHgvqDIGRGYSTYCQK--------------------  275
ident                       |                                     
Sbjct kdlTXETIAKLLKDGVLIALXCDHP-viPLEFATVQAATAxrygakeedllkiltvnpak  337
DSSP  lllLLLHHHHHHHLLLLEEELLLLL-llLHHHHHHHHHHHhhhlllhhhhhhlllhhhhh


DSSP  ---------------------------------------------ll
Query ---------------------------------------------le  277
ident                                                
Sbjct ilgledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  hllllllllllllllllleeeelllllllllleeeeeelleeeeell


No 50: Query=3dcpA Sbjct=1itqA Z-score=7.2

back to top
DSSP  --------------LLEEEEELL--LLLL-----------llllllhhhHHHH-HHHLLL
Query --------------XKRDGHTHT--EFCP-----------hgthddveeXVLK-AIELDF   32
ident                  |||                                        
Sbjct dffrdeaerimrdsPVIDGHNDLpwQLLDmfnnrlqderanlttlagthTNIPkLRAGFV   60
DSSP  lhhhhhhhhhhlllLEEEEEELHhhHHHHhhllllllhhhlllllllllLLHHhHHHLLE


DSSP  LEEEEEEELLLLhhhhhllllllhhhhllllLHHHHHHHHHHHHHHH---HHLL------
Query DEYSIVEHAPLSsefxkntagdkeavttasxAXSDLPYYFKKXNHIK---KKYA------   83
ident          |                     |                            
Sbjct GGQFWSVYTPCD--------------tqnkdAVRRTLEQMDVVHRMCrmyPETFlyvtss  106
DSSP  EEEEEEELLLHH--------------hllllHHHHHHHHHHHHHHHHhhlLLLEeelllh


DSSP  ---------LLLEEEEEEEEELllllhhHHHHHHHHHHH-HLLEE--------eeelLEE
Query ---------SDLLIHIGFEVDYligyedFTRDFLNEYGP-QTDDG--------vlslHFL  125
ident                || |              |                         |
Sbjct agirqafreGKVASLIGVEGGH---sidSSLGVLRALYQlGMRYLtlthscntpwadNWL  163
DSSP  hhhhhhhhlLLEEEEEEEELHH---hllLLHHHHHHHHHlLEEEEelllllllllllLHH


DSSP  EelLEEE---ellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLLllllllLEEL-L
Query EgqGGFR---sidfsaedynegivqfyggfeqaqlaYLEGVKQSIEADlglfkpRRXG-H  181
ident    |                                     |                  
Sbjct VdtGDSEpqsqglspfgqrvvkelnrlgvlidlahvSVATMKATLQLS---rapVIFShS  220
DSSP  HllLLLLlllllllhhhhhhhhhhhhhlleeellllLHHHHHHHHHHL---lllLEELlL


DSSP  LLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEELH--HHHLLLLL----l
Query ISLcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNTA--GLFKPLCG----e  235
ident                              | |||  |     |                 
Sbjct SAY-------------svcasrrnvPDDVLRLVKQTDSLVMVNFYnnYISCTNKAnlsqv  267
DSSP  LLL-------------lllllllllLHHHHHHHHHHLLEEEELLLhhHHLLLLLLlhhhh


DSSP  llLLHHHHHHHHhlLLLEEEELLLL-------lhHHLLllHHHHHHHLL-----------
Query tyPPKKIVTLASelQIPFVYGSDSH-------gvQDIGrgYSTYCQKLE-----------  277
ident       |   |         | |            |    |      |            
Sbjct adHLDHIKEVAG--ARAVGFGGDFDgvprvpeglEDVS-kYPDLIAELLrrnwteaevkg  324
DSSP  hhHHHHHHHHLL--HHHEEELLLLLlllllllllLLLL-lHHHHHHHHHhllllhhhhhh


DSSP  ---------------------------------------------
Query ---------------------------------------------  277
ident                                              
Sbjct aladnllrvfeaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhlhhhhhhhhhhhhllllllllllllllhhhlllllllllllll


No 51: Query=3dcpA Sbjct=3giqA Z-score=7.2

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------XKRD    4
ident                                                            |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  EEELLLllllllllLHHH--hHHHHHHLLLLEEEEEEellllhhhhhllllllhhHHLL-
Query GHTHTEfcphgthdDVEE--xVLKAIELDFDEYSIVEhaplssefxkntagdkeaVTTA-   61
ident  | |             |                                        | 
Sbjct VHGHDD-------lMFVEkpdLRWKTSQGITTVVVGN-----cgvsaapaplpgnTAAAl  108
DSSP  LLLLLL-------lHHHHlllLHHHHLLLEEEEEELL-----lllllllllllllLLHHh


DSSP  --lllhhHHHHhHHHHH-HHHHHLLlLLEEEEEE--------------------------
Query --sxaxsDLPYyFKKXN-HIKKKYAsDLLIHIGF--------------------------   92
ident                                                             
Sbjct allgetpLFAD-VPAYFaALDAQRP-MINVAALVghanlrlaamrdpqaaptaaeqqamq  166
DSSP  hhhllllLLLL-HHHHHhHHHHLLL-LLEEEEEEehhhhhhhhlllllllllhhhhhhhh


DSSP  --------------EEEL--------lLLLH-HHHHHHHHHHHhhlleeEEELLeeeell
Query --------------EVDY--------lIGYE-DFTRDFLNEYGpqtddgVLSLHflegqg  129
ident                                    |                        
Sbjct dmlqaaleagavgfSTGLayqpgavaqAAELeGLARVAAERRR----lhTSHIR------  216
DSSP  hhhhhhhhhllleeEEELllllhhhllHHHHhHHHHHHHHLLL----eeEEELL------


DSSP  eeeellllhhhhhhhlhhhhllhhhhHHHHHHHHHHHHHL-LLLLLLlLEELLLLHHhll
Query gfrsidfsaedynegivqfyggfeqaQLAYLEGVKQSIEA-DLGLFKpRRXGHISLCqkf  188
ident                                  |                  |       
Sbjct ------------------------neADGVEAAVEEVLAIgRGTGCA-TVVSHHKCM---  248
DSSP  ------------------------llLLLHHHHHHHHHHHhHHHLLE-EEELLLLLL---


DSSP  hhhhlllhhhlLHHHHhHHHHHHHHHHHHL-----LEEEEELHHHHL-------------
Query qqffgedtsdfSEEVXeKFRVILALVKKRD-----YELDFNTAGLFK-------------  230
ident                    |  ||             ||                     
Sbjct ----------mPQNWG-RSRATLANIDRAReqgveVALDIYPYPGSStiliperaetidd  297
DSSP  ----------lHHHLL-LHHHHHHHHHHHHhllllEEEEELLLLEEEeellhhhllllll


DSSP  ---------------------------------------LLLL--llllLHHHHHHhhhl
Query ---------------------------------------PLCG--etypPKKIVTLasel  249
ident                                                   | |       
Sbjct iritwstphpecsgeyladiaarwgcdkttaarrlapagAIYFamdedeVKRIFQH----  353
DSSP  leeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeEEEElllhhhHHHHHHL----


DSSP  lLLEEEELLLLLH-----hHLLLLHHHHH-HHLL--------------------------
Query qIPFVYGSDSHGV-----qDIGRGYSTYC-QKLE--------------------------  277
ident       |||                                                   
Sbjct -PCCMVGSDGLPNdarphpRLWGSFTRVLgRYVRearlmtleqavarmtalparvfgfae  412
DSSP  -LLEEELLLLLLLllllllHHHHHHHHHHhHHHHhlllllhhhhhhhhlhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct rgvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvl  472
DSSP  llllllllllleeeelllllllllllllllllllleeeeeelleeeelllllllllllll


DSSP  ---
Query ---  277
ident    
Sbjct rax  475
DSSP  lll


No 52: Query=3dcpA Sbjct=4dziC Z-score=7.0

back to top
DSSP  ----LLEEEEELLLL----------------------------------------lLLLL
Query ----XKRDGHTHTEF----------------------------------------cPHGT   16
ident        |   |                                            |   
Sbjct alnyRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnPTFD   60
DSSP  llllLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllLLLL


DSSP  ------------------------------------lLLHHHHHHHHHHLLLLEEEEEEE
Query ------------------------------------hDDVEEXVLKAIELDFDEYSIVEH   40
ident                                                 | |         
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPT  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELL


DSSP  --LLLL-HHHHHllllllhhhhllllLHHHHHHHHHHHHhhHHHLLlllEEEEEeeeell
Query --APLS-SEFXKntagdkeavttasxAXSDLPYYFKKXNhiKKKYAsdlLIHIGfevdyl   97
ident                                                   |         
Sbjct fgCGVEeALKHD-------ieatmasVHAFNLWLDEDWG-fDRPDH---RIIAA------  163
DSSP  hhHHHHhHLLLL-------hhhhhhhHHHHHHHHHHHLL-lLLLLL---LEEEL------


DSSP  lllhhhHHHH------hHHHHH--HLLE--------------------------------
Query igyedfTRDF------lNEYGP--QTDD--------------------------------  117
ident                                                             
Sbjct ---pivSLADptraveeVDFVLarGAKLvlvrpapvpglvkprslgdrshdpvwarlaea  220
DSSP  ---lllLLLLhhhhhhhHHHHHhlLLLLeelllllllllllllllllhhhhhhhhhhhhh


DSSP  ---eEEELL--EEEE--LLEEeellllhHHHHhhlhhhhlLHHHHhhHHHHHHHHHHHLL
Query ---gVLSLH--FLEG--QGGFrsidfsaEDYNegivqfygGFEQAqlAYLEGVKQSIEAD  170
ident        |                                                    
Sbjct gvpvGFHLSdsGYLHiaAAWG------gAKDP--------LDQVL--LDDRAIHDTMASM  264
DSSP  llleEEELLllLLHHhhHHLL------lLLLH--------HHHHH--HLLHHHHHHHHHH


DSSP  -------llllllLEELLLLhhhllhhhhlllhhhllhhhhhHHHHH-------------
Query -------lglfkpRRXGHISlcqkfqqffgedtsdfseevxeKFRVI-------------  210
ident                                                             
Sbjct ivhgvftrhpklkAVSIENG--------------------syFVHRLikrlkkaantqpq  304
DSSP  hhllhhhhlllllEEEELLL--------------------llHHHHHhhhhhhhhhhlhh


DSSP  ------hhHHHHhLLEEEEelhhhhlllllllLLLHHhHHHHHHLLL--LEEEELLLLlh
Query ------laLVKKrDYELDFntaglfkplcgetYPPKKiVTLASELQI--PFVYGSDSHgv  262
ident                                 |                    |||    
Sbjct yfpedpveQLRN-NVWIAP-------------YYEDD-LPELARVIGvdKILFGSDWPhg  349
DSSP  hllllhhhHHHH-HEEELL-------------LLLLL-HHHHHHHHLhhHLLLLLLLLll


DSSP  hhlLLLHHhHHHHLL-------------------------
Query qdiGRGYStYCQKLE-------------------------  277
ident        |     |                          
Sbjct eglASPVS-FTAELKgfsesdirkimrdnaldllgvqvgs  388
DSSP  lllLLHHH-HHHHHLlllhhhhhhhhlhhhhhhhllllll


No 53: Query=3dcpA Sbjct=1bksA Z-score=7.0

back to top
DSSP  ---------------LLEEeEELLlLLLL---llLLLHHHHHHHHhhlllleEEEEEELL
Query ---------------XKRDgHTHTeFCPH---gtHDDVEEXVLKAieldfdeYSIVEHAP   42
ident                                                            |
Sbjct meryenlfaqlndrrEGAF-VPFVtLGDPgieqsLKIIDTLIDAG------aDALELGVP   53
DSSP  lhhhhhhhhhhhhllLLEE-EEEEeLLLLlhhhhHHHHHHHHHLL------lLLEEEELL


DSSP  LLHhhhhlllllLHHHHL------llLLHHH-HHHHHHHHHHHHhhlllllEEEEEEEEE
Query LSSefxkntagdKEAVTT------asXAXSD-LPYYFKKXNHIKkkyasdlLIHIGFEVD   95
ident  |                                                  | ||    
Sbjct FSD----pladgPTIQNAnlrafaagVTPAQcFEMLALIREKHP-------TIPIGLLMY  102
DSSP  LLL----lllllHHHHHHhhhhhhhlLLHHHhHHHHHHHHHHLL-------LLLEEEEEL


DSSP  LLllLHHHHHHHHHHHHH-HLLEEEEELleeeelleeeellllhhhhhhhlhhhhllhhh
Query YLigYEDFTRDFLNEYGP-QTDDGVLSLhflegqggfrsidfsaedynegivqfyggfeq  154
ident            |         |                                      
Sbjct ANlvFNNGIDAFYARCEQvGVDSVLVAD--------------------------------  130
DSSP  HHhhHLLLHHHHHHHHHHhLLLEEEELL--------------------------------


DSSP  hhhhhhhHHHHhhHLLL-----LLLLLLEElLLLHhhllhhhhlllhhhllhhhhhhHHH
Query aqlayleGVKQsiEADL-----GLFKPRRXgHISLcqkfqqffgedtsdfseevxekFRV  209
ident         |     |                                             
Sbjct ------vPVEE--SAPFrqaalRHNIAPIF-ICPP--------------------naDDD  161
DSSP  ------lLHHH--LHHHhhhhhHLLLEEEE-EELL--------------------llLHH


DSSP  HHHHHHHHLL-EEEEElhhhhlllllllllLHHHHHHHHHLLL-LEEEElllllhhhlll
Query ILALVKKRDY-ELDFNtaglfkplcgetypPKKIVTLASELQI-PFVYGsdshgvqdigr  267
ident  |  |                                  |    |   |           
Sbjct LLRQVASYGRgYTYLL-----------alpLHHLIEKLKEYHAaPALQG----fgisspe  206
DSSP  HHHHHHHHLLlLEEEL-----------lllHHHHHHHHHHHLLlLEEEL----lllllhh


DSSP  LHHHHHHHL---------------------------------------l
Query GYSTYCQKL---------------------------------------e  277
ident   |                                              
Sbjct QVSAAVRAGaagaisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
DSSP  HHHHHHHHLlleeeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll


No 54: Query=3dcpA Sbjct=1a5kC Z-score=6.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------LLEEEEELLLlllllllllHHHHHHHHHHLLLLEEEEEEellllhhhhhllll
Query -------XKRDGHTHTEfcphgthddVEEXVLKAIELDFDEYSIVEhaplssefxkntag   53
ident           | | |                  |                          
Sbjct egkivtaGGIDTHIHWI---------CPQQAEEALVSGVTTMVGGG--------------  157
DSSP  llleeeeLEEEEEEELL---------LLLHHHHHHHHLEEEEEEEL--------------


DSSP  llhhhhLLLL---lhhhHHHHHHHHHHHHHHLllLLEEEEEEeeelllllHHHHhHHHHH
Query dkeavtTASX---axsdLPYYFKKXNHIKKKYasDLLIHIGFevdyligyEDFTrDFLNE  110
ident        |          | |                |                 | | |
Sbjct ---tgpAAGThattctpGPWYISRMLQAADSL--PVNIGLLG-----kgnVSQP-DALRE  206
DSSP  ---lllLHHHhhlllllHHHHHHHHHHHHLLL--LLEEEEEE-----ellLLLH-HHHHH


DSSP  HHH-HLLEE---------------------------EEELLEEEElleeeellllhhhhh
Query YGP-QTDDG---------------------------VLSLHFLEGqggfrsidfsaedyn  142
ident                                      |    |                 
Sbjct QVAaGVIGLeihedwgatpaaidcaltvademdiqvALHSDTLNE---------------  251
DSSP  HHHhLLLEEeeehhhlllhhhhhhhhhhhhhhlleeEEELLLLLL---------------


DSSP  hhlhhhhllhhhhhhHHHHHHHHHHHLlllllllLEELLLLHHhllhhhhlllhhhllhh
Query egivqfyggfeqaqlAYLEGVKQSIEAdlglfkpRRXGHISLCqkfqqffgedtsdfsee  202
ident                                       |                     
Sbjct -------------sgFVEDTLAAIGGR------tIHTFHTEGA--------------ggg  278
DSSP  -------------llLHHHHHHHHLLL------lEEELLLLLL--------------lll


DSSP  hhhhhhhHHHHhhhHLLEEEEELHHH--------hLLLL---------------------
Query vxekfrvILALvkkRDYELDFNTAGL--------fKPLC---------------------  233
ident          |               |                                  
Sbjct hapdiitACAH---PNILPSSTNPTLpytlntideHLDMlmvchhldpdiaedvafaesr  335
DSSP  llllhhhHHHL---LLEEEEEEHHHLlllllhhhhHHHHhhhhhllllllhhhhhlllll


DSSP  ---lllllLHHHHHHHHhllllEEEELLLLlhhHLLLLHHHHHHHLL-------------
Query ---getypPKKIVTLASelqipFVYGSDSHgvqDIGRGYSTYCQKLE-------------  277
ident               |           |||      |       |                
Sbjct irretiaaEDVLHDLGA----fSLTSSDSQamgRVGEVILRTWQVAHrmkvqrgalaeet  391
DSSP  llhhhhhhHHHHHHLLL----lLEEELLLLlllLLLLHHHHHHHHHHhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct gdndnfrvkryiakytinpalthgiahevgsievgkladlvvwspaffgvkpatvikggm  451
DSSP  llllhhhhhhhhhlllhhhhhhllllllllllllllllleeeelhhhlllllleeeelle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct iaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaia  511
DSSP  eeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleee


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  277
ident                                                        
Sbjct vvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  ellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 55: Query=3dcpA Sbjct=2gwgA Z-score=6.2

back to top
DSSP  LLEEEEELLL------------------------------llllllllLHHH-HHHHHHH
Query XKRDGHTHTE------------------------------fcphgthdDVEE-XVLKAIE   29
ident |  | | |                                           |    |  |
Sbjct XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQE   60
DSSP  LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHH


DSSP  LLLLEEEEEEEllllhhhhhllllllhhhhllllLHHHHHHHHHHHHHHHHHLLllLEEE
Query LDFDEYSIVEHaplssefxkntagdkeavttasxAXSDLPYYFKKXNHIKKKYAsdLLIH   89
ident    |                                                        
Sbjct RGSDLTVFSPR-----------------agdfnvSSTWAAICNELCYRVSQLFP--DNFI  101
DSSP  HLLLEEEEELL-----------------lllhhhHHHHHHHHHHHHHHHHHHLL--LLEE


DSSP  EE-----------------------------EEEELL------------lLLHHHHHHHH
Query IG-----------------------------FEVDYL------------iGYEDFTRDFL  108
ident                                                             
Sbjct GAaxlpqspgvdpktcipelekcvkeygfvaINLNPDpsgghwtsppltdRIWYPIYEKX  161
DSSP  EEeellllllllhhhhhhhhhhhhhllllleEEELLLlllllllllllllHHHHHHHHHH


DSSP  HHHHHhlleEEEELLeeeelleeeELLLlhhhhhhhlhhhhllhhhhhhhhHHHHHHHHH
Query NEYGPqtddGVLSLHflegqggfrSIDFsaedynegivqfyggfeqaqlayLEGVKQSIE  168
ident  |                                                 |        
Sbjct VELEI---pAXIHVS---------TGAH----------------------yLNADTTAFX  187
DSSP  HHHLL---lEEELLL---------LLLH----------------------hHHHHHHHHH


DSSP  L--------llLLLLlLEELLLlhhhllhhhhlllhhhllhhhhhhhhHHHH--------
Query A--------dlGLFKpRRXGHIslcqkfqqffgedtsdfseevxekfrVILA--------  212
ident               |     |                                       
Sbjct QcvagdlfkdfPELK-FVIPHG------------------------ggAVPYhwgrfrgl  222
DSSP  HhhhllhhhhlLLLL-EEELHH------------------------hlLLHHhhhhhhhh


DSSP  --------hhHHHL--LEEEEElhhhhlllllllLLLHHHHHHHHHLLL--LEEEELLLL
Query --------lvKKRD--YELDFNtaglfkplcgetYPPKKIVTLASELQI--PFVYGSDSH  260
ident                    |                      |             |   
Sbjct aqexkkplleDHVLnnIFFDTC------------VYHQPGIDLLNTVIPvdNVLFASEXI  270
DSSP  hhhlllllhhHHLLllEEEELL------------LLLHHHHHHHHHHLLhhHEELLLLLL


DSSP  L---------hhhllLLHHHHHHHLL---------------------------------
Query G---------vqdigRGYSTYCQKLE---------------------------------  277
ident |                                                          
Sbjct GavrgidprtgfyydDTKRYIEASTIltpeekqqiyegnarrvyprldaalkakgkleh  329
DSSP  LlllleelllleellLLHHHHHHLLLllhhhhhhhhlhhhhhhlhhhhhhhhhhhhhll


No 56: Query=3dcpA Sbjct=2qpxA Z-score=6.1

back to top
DSSP  ------------LLEEEEELL---------------------------------------
Query ------------XKRDGHTHT---------------------------------------    9
ident                | | |                                        
Sbjct gxddlsefvdqvPLLDHHCHFlidgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
DSSP  lllllhhhhhhlLEEEEEELLllllllllhhhhhhhhlllllllllhhhhlllhhhhhhh


DSSP  ------------llllllllllhhhhhHHHHHLLLLEEEEEEEllllhhhhhllllllhh
Query ------------efcphgthddveexvLKAIELDFDEYSIVEHaplssefxkntagdkea   57
ident                                   | |  |                    
Sbjct alakefaldannplaaxndpgyatynhRIFGHFHFKELLIDTG-----------------  103
DSSP  hhhhhhllllllllllllhhhhhhhhhHHHHHLLEEEEEEELL-----------------


DSSP  hhlllllhhhhhhhhhhhhHHHHHLLL--LLEEEEE------------------------
Query vttasxaxsdlpyyfkkxnHIKKKYAS--DLLIHIG------------------------   91
ident                          |                                  
Sbjct ------------fvpddpiLDLDQTAElvGIPVKAIyrlethaedfxlehdnfaawwqaf  151
DSSP  ------------lllllllLLHHHHHHhhLLLEEEEeehhhhhhhhhlllllhhhhhhhh


DSSP  --------------EEEEL------------------------------------LLLLH
Query --------------FEVDY------------------------------------LIGYE  101
ident               |                                             
Sbjct sndvkqakahgfvgFXSIAayrvglhlepvnvieaaagfdtwkhsgekrltskplIDYXL  211
DSSP  hhhhhlllllllllEEELHhhhlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHH


DSSP  HHHHHHHHHHHHhlleeEEELleeeelleeeelLLLHhhhhhhlhhhhllhhhhhHHHHh
Query DFTRDFLNEYGPqtddgVLSLhflegqggfrsiDFSAedynegivqfyggfeqaqLAYLe  161
ident      |                                                      
Sbjct YHVAPFIIAQDX---plQFHV----------gyGDAD---------------tdxYLGN-  242
DSSP  HHHHHHHHHHLL---leEEEE----------llLLLL---------------llhHHLL-


DSSP  hHHHHH--HLLL--LLLLlLEELLLLHhhllhhhhlllhhhllhhhhhhhHHHHHHHHHH
Query gVKQSI--EADL--GLFKpRRXGHISLcqkfqqffgedtsdfseevxekfRVILALVKKR  217
ident                  |     |                          |    |    
Sbjct -PLLXRdyLKAFtkKGLK-VVLLHCYP---------------------yhREAGYLASVF  279
DSSP  -HHHHHhhHHHHhhHLLL-EEEEELLL---------------------lhHHHHHHHHHL


DSSP  L-LEEEEE--LHHHHlllllllllLHHHHHHHHHLLL--LEEEELLLLLH-HHLLLLHHH
Query D-YELDFN--TAGLFkplcgetypPKKIVTLASELQI--PFVYGSDSHGV-QDIGRGYST  271
ident      |                         | ||         ||        |     
Sbjct PnLYFDISllDNLGP-------sgASRVFNEAVELAPytRILFASDASTYpEXYGLAARQ  332
DSSP  LlEEEELLlhHHHLH-------hhHHHHHHHHLLLLLhhHEELLLLLLLLhHHHHHHHHH


DSSP  HHHHLL--------------------------------------
Query YCQKLE--------------------------------------  277
ident   | |                                       
Sbjct FKQALVahfnqlpfvdlaqkkawinaicwqtsaklyhqerelrv  376
DSSP  HHHHHHhhhhllllllhhhhhhhhhhhhlhhhhhhlllhhhhll


No 57: Query=3dcpA Sbjct=1j5sA Z-score=6.1

back to top
DSSP  -------------------------LLEEEEELLL-------------------------
Query -------------------------XKRDGHTHTE-------------------------   10
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLDakdivenkpwndiwevegatdhyvw   60
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLLhhhhhhllllllhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   10
ident                                                             
Sbjct elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh


DSSP  ----lllllllllhhHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhlllllhH
Query ----fcphgthddveEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttasxaxS   66
ident                                                             
Sbjct aeeiweetkkklpemTPQKLLRDMKVEILCTTD-------------------------dP  155
DSSP  hhhhhhhhhhhllllLHHHHHHHLLEEEEELLL-------------------------lL


DSSP  HHHhhHHHHHHHHHHLlLLLEEEEEE----------------------------------
Query DLPyyFKKXNHIKKKYaSDLLIHIGF----------------------------------   92
ident             |        |                                      
Sbjct VST--LEHHRKAKEAV-EGVTILPTWrpdramnvdkegwreyvekmgerygedtstldgf  212
DSSP  LLL--LHHHHHHHHHL-LLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhh


DSSP  -------------------EEEL----------------------------------lLL
Query -------------------EVDY----------------------------------lIG   99
ident                                                             
Sbjct lnalwkshehfkehgcvasDHALlepsvyyvdenraravhekafsgekltqdeindykAF  272
DSSP  hhhhhhhhhhhhllllleeEEEElllllllllhhhhhhhhhhhlllllllhhhhhhhhHH


DSSP  LHHHHHHHHHHHHhhlleeEEELLeeeelleeeelLLLHHH-hhhhlhhhhllhhhHHHH
Query YEDFTRDFLNEYGpqtddgVLSLHflegqggfrsiDFSAED-ynegivqfyggfeqAQLA  158
ident           |         |                   |                   
Sbjct MMVQFGKMNQETN---wvtQLHIG----------aLRDYRDslfktlgpdsggdisTNFL  319
DSSP  HHHHHHHHHHHHL---leeEEEEL----------eELLLLHhhhhhlllllllleeLLLL


DSSP  HHHHHHHhhHLLLlllLLLEEllLLHHhllhhhhlllhhhllhhhhhHHHHHHHHHHHHL
Query YLEGVKQsiEADLglfKPRRXghISLCqkfqqffgedtsdfseevxeKFRVILALVKKRD  218
ident                          |                         |        
Sbjct RIAEGLRyfLNEFdgkLKIVL--YVLD------------------ptHLPTISTIARAFP  359
DSSP  LHHHHHHhhHHHLlllLLEEE--EELL------------------hhHHHHHHHHHHHLL


DSSP  -LEEEEelhhhhllllLLLL--LLHHHHHHHHHL---LLLEEEELLLLLHHHLLLLHHHH
Query -YELDFntaglfkplcGETY--PPKKIVTLASEL---QIPFVYGSDSHGVQDIGRGYSTY  272
ident                                              ||      |      
Sbjct nVYVGA-------pwwFNDSpfGMEMHLKYLASVdllYNLAGMVTDSRKLLSFGSRTEMF  412
DSSP  lEEELL-------lllLLLLhhHHHHHHHHHHLLllhHHLLLLLLLLLLLLHHHHHHHHH


DSSP  HHHLL----------------------------------
Query CQKLE----------------------------------  277
ident    |                                   
Sbjct RRVLSnvvgemvekgqipikearelvkhvsydgpkalff  451
DSSP  HHHHHhhhhhhhhlllllhhhhhhhhhhhhlhhhhhhhl


No 58: Query=3dcpA Sbjct=2a3lA Z-score=5.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------LLEEEEELLL--------
Query ------------------------------------------XKRDGHTHTE--------   10
ident                                            | | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   10
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  ----------------------llllllllLHHHHHHHHHHLLLLEEEEEEellllhhhh
Query ----------------------fcphgthdDVEEXVLKAIELDFDEYSIVEhaplssefx   48
ident                                                             
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRI---------  291
DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEE---------


DSSP  hllllllhhhhllLLLH---HHHHHHHHHhhhhhHHLLlllEEEEEE-------------
Query kntagdkeavttaSXAX---SDLPYYFKKxnhikKKYAsdlLIHIGF-------------   92
ident              |      |                                       
Sbjct -------------SIYGrkmSEWDQLASWivnndLYSE---NVVWLIqlprlyniykdmg  335
DSSP  -------------ELLLlllLHHHHHHHHhhlllLLLL---LEEEEEeeellhhhhllll


DSSP  ---------------------------------------EEEL-----------------
Query ---------------------------------------EVDY-----------------   96
ident                                                             
Sbjct ivtsfqnildnifiplfeatvdpdshpqlhvflkqvvgfDLVDdeskperrptkhmptpa  395
DSSP  lllllhhhhhhhllhhhhhhhlhhhllllhhhhlleeeeEEELlllllllllllllllll


DSSP  ---------LLLL-HHHHHHHHHHH-------hHHLLeeEEELleeeelleeeellllhh
Query ---------LIGY-EDFTRDFLNEY-------gPQTDdgVLSLhflegqggfrsidfsae  139
ident             |                                               
Sbjct qwtnafnpaFSYYvYYCYANLYVLNklreskgmTTIT-lRPHS-----------------  437
DSSP  lllllllllHHHHhHHHHHHHHHHHhhhlllllLLLE-eLLLL-----------------


DSSP  hhhhhlhhhhllhhhhhhHHHHHHHHHHHLllllllLLEELLLLhhhllhhhhlllhhhl
Query dynegivqfyggfeqaqlAYLEGVKQSIEAdlglfkPRRXGHISlcqkfqqffgedtsdf  199
ident                                          |                  
Sbjct ---------------geaGDIDHLAATFLT------CHSIAHGI----------------  460
DSSP  ---------------lllLLLHHHHHHHHH------LLLLLLLH----------------


DSSP  lhhhhhHHHHHHHHHHHHLLEEEEEL-HHHHLlLLLLllllhhHHHHHHHLLLLEEEELL
Query seevxeKFRVILALVKKRDYELDFNT-AGLFKpLCGEtyppkkIVTLASELQIPFVYGSD  258
ident       |  |   |       |                                     |
Sbjct ---nlrKSPVLQYLYYLAQIGLAMSPlSNNSL-FLDY---hrnPFPVFFLRGLNVSLSTD  513
DSSP  ---hhhHLHHHHHHHHHHLLLEEELHhHHLLL-LLLL---lllLHHHHHHLLLLEEELLL


DSSP  LLL----hhhLLLLH-HHHHHHLL------------------------------------
Query SHG----vqdIGRGY-STYCQKLE------------------------------------  277
ident                 |                                           
Sbjct DPLqihltkePLVEEySIAASVWKlsacdlceiarnsvyqsgfshalkshwigkdyykrg  573
DSSP  LHHhhlllllHHHHHhHHHHHHHLllhhhhhhhhhhhhhhllllhhhhhhhlllllllll


DSSP  -------------------------------------------
Query -------------------------------------------  277
ident                                            
Sbjct pdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 59: Query=3dcpA Sbjct=3iacA Z-score=5.5

back to top
DSSP  --------------------------LLEEEEELLLllllllllLHHH------------
Query --------------------------XKRDGHTHTEfcphgthdDVEE------------   22
ident                              | | |                          
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLS------pqEIADdrrfdnlgqiwl   54
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL------hhHHHHllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   22
ident                                                             
Sbjct egdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgi  114
DSSP  llllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllll


DSSP  ---------------------------HHHHHHHLLLLEEEEEEellllhhhhhllllll
Query ---------------------------XVLKAIELDFDEYSIVEhaplssefxkntagdk   55
ident                                                             
Sbjct tgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTD----------------  158
DSSP  llllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLL----------------


DSSP  hhhhlllllHHHHhhhHHHHHHHHHHllLLLEEEEEE-----------------------
Query eavttasxaXSDLpyyFKKXNHIKKKyaSDLLIHIGF-----------------------   92
ident            |          |      |                              
Sbjct --------dPIDS---LEYHRQIAADdsIDIEVAPSWrpdkvfkieldgfvdylrkleaa  207
DSSP  --------lLLLL---LHHHHHHHHLllLLLEEELLLllhhhhllllllhhhhhhhhhhh


DSSP  ------------------------------EEEL--------------------------
Query ------------------------------EVDY--------------------------   96
ident                                                             
Sbjct advsitrfddlrqaltrrldhfaacgcrasDHGIetlrfapvpddaqldailgkrlaget  267
DSSP  hllllllhhhhhhhhhhhhhhhhhlllleeEEEEllllllllllhhhhhhhhhhhhllll


DSSP  ---------lLLLH-HHHHHHHHHHHhhlleeEEELleeeelleeeeLLLLHHH--hhhh
Query ---------lIGYE-DFTRDFLNEYGpqtddgVLSLhflegqggfrsIDFSAED--yneg  144
ident                   |              |                          
Sbjct lseleiaqftTAVLvWLGRQYAARGW----vxQLHI-----------GAIRNNNtrxfrl  312
DSSP  llhhhhhhhhHHHHhHHHHHHHHHLL----eeEEEE-----------LEELLLLhhhhhh


DSSP  lhhhhllhhhhHHHHHHHHHHHHHLL--llllLLLEEllLLHHHllhhhhlllhhhllhh
Query ivqfyggfeqaQLAYLEGVKQSIEAD--lglfKPRRXghISLCQkfqqffgedtsdfsee  202
ident                                          |                  
Sbjct lgpdtgfdsigDNNISWALSRLLDSXdvtnelPKTIL--YCLNP---------------r  355
DSSP  hllllllleelLLLLHHHHHHHHHHHhlllllLEEEE--EELLH---------------h


DSSP  hhhHHHHHHHHHHH----hLLEEEE-elHHHHlllLLLLllLHHHHH--HHHHllLLEEE
Query vxeKFRVILALVKK----rDYELDF-ntAGLFkplCGETypPKKIVT--LASElqIPFVY  255
ident                                                             
Sbjct dneVLATXIGNFQGpgiagKVQFGSgwwFNDQ---KDGXlrQLEQLSqxGLLS--QFVGX  410
DSSP  hhhHHHHHHHHLLLlllllLEEELLllhHHLL---HHHHhhHHHHHHhhLLHH--HLLLL


DSSP  ELLLLLHHHlLLLHHHHHHHLL--------------------------------------
Query GSDSHGVQDiGRGYSTYCQKLE--------------------------------------  277
ident   ||                |                                       
Sbjct LTDSRSFLS-YTRHEYFRRILCnllgqwaqdgeipddeaxlsrxvqdicfnnaqryftik  469
DSSP  LLLLLLLLL-LHHHHHHHHHHHhhhhhhhhlllllllhhhhhhhhhhhhlhhhhhhllll