Results: dupa

Query: 3cjpA

MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3cjp-A 51.6  0.0  262   262  100 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   2:  3irs-A 23.8  2.3  224   281   19 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   3:  4hk5-D 22.4  2.5  225   380   23 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   4:  2dvt-A 22.0  2.5  233   325   20 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   5:  4dlf-A 21.6  2.4  217   287   15 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   6:  4ofc-A 21.6  2.4  225   335   23 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   7:  4qrn-A 20.7  2.6  225   352   20 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   8:  2gwg-A 19.9  2.6  222   329   18 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   9:  2ffi-A 19.7  2.3  213   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  10:  4mup-B 19.5  2.5  210   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  11:  2vun-A 18.9  2.5  214   385   16 PDB  MOLECULE: ENAMIDASE;                                                 
  12:  1gkp-A 18.8  2.7  225   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  4b3z-D 18.7  2.8  226   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  14:  2y1h-B 18.6  3.0  215   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  15:  1bf6-A 18.4  2.7  218   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  16:  3pnu-A 17.9  3.0  213   338   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  17:  2qpx-A 17.8  2.8  212   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  18:  2ob3-A 17.4  2.6  213   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  19:  3gg7-A 17.4  3.0  206   243   18 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  20:  4cqb-A 17.3  3.4  218   402   15 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  21:  3nqb-A 17.3  2.9  206   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  22:  3k2g-B 16.8  2.7  215   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  23:  4dzi-C 16.8  3.0  221   388   14 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  24:  3mtw-A 16.7  2.7  206   404   15 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  25:  2vc5-A 16.7  2.7  213   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  26:  1onx-A 16.6  2.6  211   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  27:  1yrr-B 16.5  3.0  211   334   10 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  28:  3gri-A 16.3  3.0  214   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  29:  1k6w-A 16.3  3.4  216   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  30:  2paj-A 16.2  2.9  205   421   10 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  31:  3giq-A 16.1  2.9  221   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  32:  2oof-A 16.0  3.4  211   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  33:  3mkv-A 15.9  2.6  200   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  34:  3ls9-A 15.5  3.3  219   453    8 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  35:  4c5y-A 15.5  2.8  202   436   13 PDB  MOLECULE: OCHRATOXINASE;                                             
  36:  2ogj-A 15.5  2.8  213   379   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  37:  1j6p-A 15.3  3.2  211   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  38:  3e74-A 15.2  2.7  207   429   12 PDB  MOLECULE: ALLANTOINASE;                                              
  39:  1a5k-C 15.2  2.7  208   566   12 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  40:  3icj-A 15.2  2.9  201   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  41:  1itq-A 14.9  2.9  219   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  42:  2imr-A 14.9  3.3  213   380   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  43:  1a4m-A 14.5  3.4  217   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  44:  1j5s-A 13.7  2.7  209   451   13 PDB  MOLECULE: URONATE ISOMERASE;                                         
  45:  2uz9-A 13.7  3.5  213   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  46:  3qy6-A 13.4  2.8  181   247   11 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  3iac-A 13.0  2.8  214   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  4rdv-B 12.9  3.1  206   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  49:  1v77-A 12.4  3.1  167   202   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  50:  3ooq-A 11.6  3.0  177   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  51:  2a3l-A 11.2  3.7  213   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3au2-A 10.4  3.7  180   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3dcp-A  9.8  3.4  174   277   16 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  9.4  3.3  177   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  1bks-A  8.5  3.9  180   255    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  56:  3f2b-A  7.6  3.5  154   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  57:  2yb1-A  6.2  3.4  140   284   18 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.2  4.0  141   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  3.5  3.3  112   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3cjpA Sbjct=3cjpA Z-score=51.6

back to top
DSSP  LLEEEEEELLLLHHHHHHHHHHHLLLEEEEELLLLLHHHLLLHHHHHHHHHHHHHHHLLL
Query LIIDGHTHVILPVEKHIKIMDEAGVDKTILFSTSIHPETAVNLRDVKKEMKKLNDVVNGK   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LIIDGHTHVILPVEKHIKIMDEAGVDKTILFSTSIHPETAVNLRDVKKEMKKLNDVVNGK   60
DSSP  LLEEEEEELLLLHHHHHHHHHHHLLLEEEEELLLLLHHHLLLHHHHHHHHHHHHHHHLLL


DSSP  LLLLHHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLLHHHHHHHHHHHLLLLLLLEEEEE
Query TNSMIDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSENDTNSYIEENIVNNKLVGIGEL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TNSMIDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSENDTNSYIEENIVNNKLVGIGEL  120
DSSP  LLLLHHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLLHHHHHHHHHHHLLLLLLLEEEEE


DSSP  LLLLLLHHHHHHHHHHHHHLLLLLEEELLLLLLLHHHHHHHHHHHHHLLLLLEEEHHHHH
Query TPASGQIKSLKPIFKYSMDSGSLPIWIHAFNPLVLQDIKEIAELCKAFPKVPVILGHMGG  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TPASGQIKSLKPIFKYSMDSGSLPIWIHAFNPLVLQDIKEIAELCKAFPKVPVILGHMGG  180
DSSP  LLLLLLHHHHHHHHHHHHHLLLLLEEELLLLLLLHHHHHHHHHHHHHLLLLLEEEHHHHH


DSSP  HHHHHHHHHHHHLLLEEEELLLLLLHHHHHHHHHHLLLLEELLLLLLLLLHHHHHHHHHH
Query SNWMTAVELAKEIQNLYLDTSAYFSTFVLKIVINELPLKCIFGTDMPFGDLQLSIEAIKK  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SNWMTAVELAKEIQNLYLDTSAYFSTFVLKIVINELPLKCIFGTDMPFGDLQLSIEAIKK  240
DSSP  HHHHHHHHHHHHLLLEEEELLLLLLHHHHHHHHHHLLLLEELLLLLLLLLHHHHHHHHHH


DSSP  HLLLHHHHHHHHLHHHHHHHLL
Query MSNDSYVANAVLGDNISRLLNI  262
ident ||||||||||||||||||||||
Sbjct MSNDSYVANAVLGDNISRLLNI  262
DSSP  HLLLHHHHHHHHLHHHHHHHLL


No 2: Query=3cjpA Sbjct=3irsA Z-score=23.8

back to top
DSSP  -LLEEEEEELLL---------------------------------LHHHHHHHHHHHLLL
Query -LIIDGHTHVIL---------------------------------PVEKHIKIMDEAGVD   26
ident   |||                                          |     |  ||  
Sbjct lKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeekSLELMFEEMAAAGIE   60
DSSP  lLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhlLHHHHHHHHHHLLLL


DSSP  EEEEELLlllhhhlllhhhhhhhhhhHHHHhlllllllhhhhhHHHHHHHHHHHHLLLLE
Query KTILFSTsihpetavnlrdvkkemkkLNDVvngktnsmidvrrNSIKELTNVIQAYPSRY   86
ident                                             |      |  |||   
Sbjct QGVCVGR------------------nSSVL-----------gsVSNADVAAVAKAYPDKF   91
DSSP  EEEEELL------------------eELLL-----------eeLLHHHHHHHHHHLLLLE


DSSP  EEEELLLlLLLHHHHHHHHHhHLLLLLLLEEEeELLL----lLLHHH--HHHHHHHHHHl
Query VGFGNVPvGLSENDTNSYIEeNIVNNKLVGIGeLTPA----sGQIKS--LKPIFKYSMDs  140
ident    |                  |          | |             | |      | 
Sbjct HPVGSIE-AATRKEAMAQMQ-EILDLGIRIVN-LEPGvwatpMHVDDrrLYPLYAFCED-  147
DSSP  EEEEELL-LLLHHHHHHHHH-HHHHLLLLLEE-ELHHhllllLLLLLhhHHHHHHHHHH-


DSSP  LLLLEEELLLLLL---LHHH-HHHHHHHHHHLLLLLEEEHHHHHHHHHHHHHHHHHLLLE
Query GSLPIWIHAFNPL---VLQD-IKEIAELCKAFPKVPVILGHMGGSNWMTAVELAKEIQNL  196
ident    |                    |      ||   |   |            |    ||
Sbjct NGIPVIMMTGGNAgpdITYTnPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNL  207
DSSP  LLLLEEEELLLLLlllHHHHlHHHHHHHHHHLLLLLEEEEHHHLLLHHHHHHHHHHLLLE


DSSP  EEELL-LLLL---HHHHHHHHHH-LLLLEELLLLLLLLLHHHHHHHHHHHLLLHHHHHHH
Query YLDTS-AYFS---TFVLKIVINE-LPLKCIFGTDMPFGDLQLSIEAIKKMSNDSYVANAV  251
ident ||                   |  |     |||  |   |    |               
Sbjct YLSPDmYLYNlpgHADFIQAANSfLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKI  267
DSSP  EEELHhHHLLlllHHHHHHHHLLhHHHLLLLLLLLLLLLHHHHHHHHHLLLLLHHHHHHH


DSSP  HLHHHHHHHL---l
Query LGDNISRLLN---i  262
ident |  |  |||     
Sbjct LHGNAERLLAqagr  281
DSSP  HLHHHHHHHHhlll


No 3: Query=3cjpA Sbjct=4hk5D Z-score=22.4

back to top
DSSP  --LLEEEEEEL-------------------------------------------------
Query --LIIDGHTHV-------------------------------------------------    9
ident      | |||                                                  
Sbjct tpVVVDIHTHMyppsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  llLLEEEEEEEllhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  ---------LLLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlll
Query ---------ILPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngk   60
ident                    ||  |                                    
Sbjct lpgrplsthFASLAQKMHFMDTNGIRVSVISLA------------------------npw   96
DSSP  llleellhhHLLHHHHHHHHHHLLLLEEEEEEL------------------------lll


DSSP  LLLL-----HHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLLHHHHHHHHHHhLLLLL-L
Query TNSM-----IDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSENDTNSYIEEnIVNNK-L  114
ident                   |          |   |   |           ||    | |  
Sbjct FDFLapdeaPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIER-VKNLKyC  155
DSSP  LLLLllllhHHHHHHHHHHHHHHHHLLLLLEEEEEELLLLLLHHHHHHHHHH-HHLLLlE


DSSP  LEEEeELLL--lLLHHH--HHHHHHHHHhLLLLLEEELL---------------------
Query VGIGeLTPA--sGQIKS--LKPIFKYSMdSGSLPIWIHA---------------------  149
ident  ||  |             | | |        |    |                      
Sbjct RGII-LGTSglgKGLDDphLLPVFEAVA-DAKLLVFLHPhyglpnevygprseeyghvlp  213
DSSP  EEEE-ELLLlllLLLLLhhHHHHHHHHH-HLLLEEEELLlllllhhhhlllhhhlllhhh


DSSP  -----LLLLlHHHHHHHH--HHHHHLLLLLEEEHHHHHHHHHH-----------------
Query -----FNPLvLQDIKEIA--ELCKAFPKVPVILGHMGGSNWMT-----------------  185
ident                                 | | ||                      
Sbjct lalgfPMET-TIAVARMYmaGVFDHVRNLQMLLAHSGGTLPFLagriescivhdghlvkt  272
DSSP  hhlhhHHHH-HHHHHHHHhlLHHHHLLLLLEEEHHHHLLHHHHhhhhhhhhhllhhhhhl


DSSP  ---------hhHHHHhlLLEEEELLlLLLHHHHHHHHHH-LLLLEELLLLLLLL------
Query ---------avELAKeiQNLYLDTSaYFSTFVLKIVINE-LPLKCIFGTDMPFG------  229
ident               |     |||     |   |   |         |||| ||       
Sbjct gkvpkdrrtiwTVLK--EQIYLDAV-IYSEVGLQAAIASsGADRLMFGTDHPFFppieed  329
DSSP  lllllllllhhHHHH--HLEEEELL-LLLHHHHHHHHHHhLHHHEELLLLLLLLllllll


DSSP  ------LHHHHHHHHHHHLL-LHHHHHHHHLHHHHHHHLL-----------
Query ------DLQLSIEAIKKMSN-DSYVANAVLGDNISRLLNI-----------  262
ident          |   |  |     |  | || | |  | |             
Sbjct vqgpwdSSRLNAQAVIKAVGeGSSDAAAVMGLNAVRVLSLkaelehhhhhh  380
DSSP  lllllhHHHHHHHHHHHHHLlLLHHHHHHHLHHHHHHLLLhhhhhhhhhhl


No 4: Query=3cjpA Sbjct=2dvtA Z-score=22.0

back to top
DSSP  --LLEEEEEEL------------------------LLLH-HHHHHHHHHHLLLEEEEELL
Query --LIIDGHTHV------------------------ILPV-EKHIKIMDEAGVDKTILFST   33
ident          |                          |       | ||  |    ||   
Sbjct mqGKVALEEHFaipetlqdsagfvpgdywkelqhrLLDIqDTRLKLMDAHGIETMILSLN   60
DSSP  llLEEEEEEEEllhhhhhhhlllllllhhhhhhhhHHLLlLHHHHHHHHLLEEEEEEEEL


DSSP  lllhhhlllhhhhhhhhhhHHHHhlLLLL---LLHHHHHHHHHHHHHHHHHLLLLEEEEE
Query sihpetavnlrdvkkemkkLNDVvnGKTN---SMIDVRRNSIKELTNVIQAYPSRYVGFG   90
ident                       |           |   |     |       | |   | 
Sbjct -------------------APAV--QAIPdrrKAIEIARRANDVLAEECAKRPDRFLAFA   99
DSSP  -------------------LLHH--HHLLlhhHHHHHHHHHHHHHHHHHHHLLLLEEEEE


DSSP  LLLLLLLHhHHHHHHHHHLLLLLLLEEEeELLL--------LLLHHH--HHHHHHHHHHl
Query NVPVGLSEnDTNSYIEENIVNNKLVGIGeLTPA--------SGQIKS--LKPIFKYSMDs  140
ident   |                     ||                         |        
Sbjct ALPLQDPD-AATEELQRCVNDLGFVGAL-VNGFsqegdgqtPLYYDLpqYRPFWGEVEK-  156
DSSP  LLLLLLHH-HHHHHHHHHHHLLLLLEEE-EELLllllllllLLLLLLhhHHHHHHHHHH-


DSSP  LLLLEEELL------------------------LLLLLhHHHHHHH--HHHHHLLLLLEE
Query GSLPIWIHA------------------------FNPLVlQDIKEIA--ELCKAFPKVPVI  174
ident    |   |                                         |    |    |
Sbjct LDVPFYLHPrnplpqdsriydghpwllgptwafAQETA-VHALRLMasGLFDEHPRLNII  215
DSSP  HLLLEEEELllllhhhlhhhlllhhhlhhhlhhHHHHH-HHHHHHHhlLHHHHLLLLLEE


DSSP  EHHHHHHHHHH----------------------hhHHHHhlLLEEEELLLLLLHHHHHHH
Query LGHMGGSNWMT----------------------avELAKeiQNLYLDTSAYFSTFVLKIV  212
ident |||||                                     |    ||  | |  |   
Sbjct LGHMGEGLPYMmwridhrnawvklpprypakrrfmDYFN--ENFHITTSGNFRTQTLIDA  273
DSSP  ELHHHLLHHHHhhhhhhllllllllllllllllhhHHHH--HHEEEELLLLLLHHHHHHH


DSSP  HHH-LLLLEELLLLLLLLLHHHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL-
Query INE-LPLKCIFGTDMPFGDLQLSIEAIKKMSNDSYVANAVLGDNISRLLNI-  262
ident | |       | || ||             |            |  ||    
Sbjct ILEiGADRILFSTDWPFENIDHASDWFNATSIAEADRVKIGRTNARRLFKLd  325
DSSP  HLLlLHHHEELLLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHLLLl


No 5: Query=3cjpA Sbjct=4dlfA Z-score=21.6

back to top
DSSP  -LLEEEEEELL--------------------LLHHHHHHHHHHHLLLEEEEELLLllhhh
Query -LIIDGHTHVI--------------------LPVEKHIKIMDEAGVDKTILFSTSihpet   39
ident  | || | |                               |        |          
Sbjct aLRIDSHQHFWryraadypwigagmgvlardYLPDALHPLMHAQALGASIAVQAR-----   55
DSSP  lLLEEEEELLLlllhhhllllllllhhhlllLLHHHHHHHHHHLLLLEEEEELLL-----


DSSP  lllhhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHlLLLE-EEEELLLLLLLh
Query avnlrdvkkemkklndvvngktnsmidvRRNSIKELTNVIQAyPSRY-VGFGNVPVGLSe   98
ident                              |     |         |     |        
Sbjct ---------------------------aGRDETAFLLELACD-EARIaAVVGWEDLRAP-   86
DSSP  ---------------------------lLHHHHHHHHHHHLL-LLLEeEEEELLLLLLL-


DSSP  hHHHHHHHHhlLLLL-LLEEeEELL-----LLLLHHH--HHHHHHHHHHLlLLLEEELLl
Query nDTNSYIEEniVNNK-LVGIgELTP-----ASGQIKS--LKPIFKYSMDSgSLPIWIHAf  150
ident         |       | |                                         
Sbjct -QLAERVAE--WRGTkLRGF-RHQLqdeadVRAFVDDadFARGVAWLQAN-DYVYDVLV-  140
DSSP  -LHHHHHHL--LLLLlEEEE-EELHhhlllHHHHHHLhhHHHHHHHHHHL-LLEEEELL-


DSSP  llLLHHhHHHHHHHHHHLLLLLEEEHHHHHH--------------HHHHHHHHHhHLLLE
Query npLVLQdIKEIAELCKAFPKVPVILGHMGGS--------------NWMTAVELAkEIQNL  196
ident      |        |         | | |                      |||      
Sbjct --FERQ-LPDVQAFCARHDAHWLVLDHAGKPalaefdrddtalarWRAALRELA-ALPHV  196
DSSP  --LHHH-HHHHHHHHHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHHHHHHH-LLLLE


DSSP  EEELLLLL----------------LHHHHHHHHHH-LLLLEELLLLLLLL----LHHHHH
Query YLDTSAYF----------------STFVLKIVINE-LPLKCIFGTDMPFG----DLQLSI  235
ident     |                       |        |    || | |            
Sbjct VCKLSGLVteadwrrglrasdlrhIEQCLDAALDAfGPQRLMFGSDWPVCllaaSYDEVA  256
DSSP  EEEELLLLllllllllllhhhhhhHHHHHHHHHHHhLHHHEEELLLLLHHhhllLHHHHH


DSSP  HHHHHHL---LLHHHHHHHHLHHHHHHHLL-
Query EAIKKMS---NDSYVANAVLGDNISRLLNI-  262
ident                  |  |    |     
Sbjct SLVERWAesrLSAAERSALWGGTAARCYALp  287
DSSP  HHHHHHHhhhLLHHHHHHHLLHHHHHHLLLl


No 6: Query=3cjpA Sbjct=4ofcA Z-score=21.6

back to top
DSSP  lLEEEEEEL-------------------------------------------LLLHHHHH
Query lIIDGHTHV-------------------------------------------ILPVEKHI   17
ident   || | |                                                |  |
Sbjct mKIDIHSHIlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
DSSP  lLEEEEEELlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH


DSSP  HHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhHHHHhlllLLLL-----HHHHHHHH
Query KIMDEAGVDKTILFSTsihpetavnlrdvkkemkkLNDVvngkTNSM-----IDVRRNSI   72
ident   ||  ||    |                                               
Sbjct REMDQKGVTVQALSTV-------------------PVMF----SYWAkpedtLNLCQLLN   97
DSSP  HHHHHHLLLEEEEELL-------------------HHHH----LLLLlhhhhHHHHHHHH


DSSP  HHHHHHHHHLLLLEEEEELLLLLLlHHHHHHHHHHHLLLLLLLEEEeELLL--lLLHHH-
Query KELTNVIQAYPSRYVGFGNVPVGLsENDTNSYIEENIVNNKLVGIGeLTPA--sGQIKS-  129
ident   |      || | || |  |            |         |                
Sbjct NDLASTVVSYPRRFVGLGTLPMQA-PELAVKEMERCVKELGFPGVQ-IGTHvneWDLNAq  155
DSSP  HHHHHHHHHLLLLEEEEELLLLLL-HHHHHHHHHHHHHLLLLLEEE-EELEellEELLLh


DSSP  -HHHHHHHHHHLlLLLEEELL--------------------LLLLLHhHHHHHH--HHHH
Query -LKPIFKYSMDSgSLPIWIHA--------------------FNPLVLqDIKEIA--ELCK  166
ident  | |               |                             |          
Sbjct eLFPVYAAAERL-KCSLFVHPwdmqmdgrmakywlpwlvgmPAETTI-AICSMImgGVFE  213
DSSP  hHHHHHHHHHHH-LLEEEEELllllllhhhhlllhhhhlhhHHHHHH-HHHHHHllLHHH


DSSP  HLLLLLEEEHHHHHHHHHH----------------------hhHHHHhllLEEEELLlLL
Query AFPKVPVILGHMGGSNWMT----------------------avELAKeiqNLYLDTSaYF  204
ident  |||  |   | ||    |                                 | |     
Sbjct KFPKLKVCFAHGGGAFPFTvgrishgfsmrpdlcaqdnpmnpkKYLG---SFYTDAL-VH  269
DSSP  HLLLLLEEELHHHLLHHHHhhhhhhhhhhlhhhhlllllllhhHHLL---LLEEELL-LL


DSSP  LHHHHHHHHHH-LLLLEELLLLLLL--LLHHhHHHHHHHH-lLLHHHHHHHHLHHHHHHH
Query STFVLKIVINE-LPLKCIFGTDMPF--GDLQlSIEAIKKM-sNDSYVANAVLGDNISRLL  260
ident     ||         | | ||| ||  | |      |  |   |    |     |    |
Sbjct DPLSLKLLTDViGKDKVILGTDYPFplGELE-PGKLIESMeeFDEETKNKLKAGNALAFL  328
DSSP  LHHHHHHHHHHhLLLLEELLLLLLLllLLLL-LLHHHHHLllLLHHHHHHHHLHHHHHHH


DSSP  LL-----
Query NI-----  262
ident        
Sbjct GLerkqf  335
DSSP  LLlhhhl


No 7: Query=3cjpA Sbjct=4qrnA Z-score=20.7

back to top
DSSP  --------------LLEEEEEEL-------------------------------------
Query --------------LIIDGHTHV-------------------------------------    9
ident               | |                                           
Sbjct smtqdlktggeqgyLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllllLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  ------LLLH-HHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllLL
Query ------ILPV-EKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngkTN   62
ident        |   |  |  ||  | || ||  |                             
Sbjct tqilerLLDLgERRIADMDATGIDKAILALT------------------------spgVQ   96
DSSP  hhhhhhHHLLlHHHHHHHHHLLLLEEEEEEL------------------------lllLL


DSSP  LL------HHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLLHhHHHHHHHhHLLL-LLLL
Query SM------IDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSEnDTNSYIEeNIVN-NKLV  115
ident                   |    | || |  | | |     |      |           
Sbjct PLhdldeaRTLATRANDTLADACQKYPDRFIGMGTVAPQDPE-WSAREIH-RGAReLGFK  154
DSSP  LLllhhhhHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLHH-HHHHHHH-HHHHlLLLL


DSSP  EEEeELLL--lLLHHH--HHHHHHHHHhLLLLLEEELL----------------------
Query GIGeLTPA--sGQIKS--LKPIFKYSMdSGSLPIWIHA----------------------  149
ident ||                  |||         |  ||                       
Sbjct GIQ-INSHtqgRYLDEefFDPIFRALV-EVDQPLYIHPatspdsmidpmleagldgaifg  212
DSSP  LEE-ELLLlllLLLLLhhHHHHHHHHH-HHLLLEEELLllllllllhhhhhhlllllllh


DSSP  -LLLLLhHHHHHHH--HHHHHLLLLLEEEHHHHHHHHHH---------------------
Query -FNPLVlQDIKEIA--ELCKAFPKVPVILGHMGGSNWMT---------------------  185
ident                       |      ||||                           
Sbjct fGVETG-MHLLRLItiGIFDKYPSLQIMVGHMGEALPYWlyrldymhqagvrsqryermk  271
DSSP  hHHHHH-HHHHHHHhhLHHHHLLLLLEEELHHHHLHHHHhhhhhhhhhhhhhllllllll


DSSP  -----hhHHHHhlLLEEEELLLLLLHHHHHHHHHH-LLLLEELLLLLLLLLHHHHHHHHH
Query -----avELAKeiQNLYLDTSAYFSTFVLKIVINE-LPLKCIFGTDMPFGDLQLSIEAIK  239
ident           |   |     |        |               | |         |  
Sbjct plkktieGYLK--SNVLVTNSGVAWEPAIKFCQQVmGEDRVMYAMDYPYQYVADEVRAMD  329
DSSP  lllllhhHHHH--HLEEEELLLLLLHHHHHHHHHHhLHHHEELLLLLLLLLLHHHHHHHH


DSSP  HHLLLHHHHHHHHLHHHHHHHLL
Query KMSNDSYVANAVLGDNISRLLNI  262
ident  |             |       
Sbjct AMDMSAQTKKKFFQTNAEKWFKL  352
DSSP  LLLLLHHHHHHHHLHHHHHHLLL


No 8: Query=3cjpA Sbjct=2gwgA Z-score=19.9

back to top
DSSP  LLEEEEEELLL-------------------------------------LHHH-HHHHHHH
Query LIIDGHTHVIL-------------------------------------PVEK-HIKIMDE   22
ident  ||| | |                                               |   |
Sbjct XIIDIHGHYTTapkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQE   60
DSSP  LLEEEEEELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHH


DSSP  HLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhlllllLLHHHHHHHHHHHHHHHHHL
Query AGVDKTILFSTSihpetavnlrdvkkemkklndvvngktnSMIDVRRNSIKELTNVIQAY   82
ident  | | |                                                 | |  
Sbjct RGSDLTVFSPRA------------------------gdfnVSSTWAAICNELCYRVSQLF   96
DSSP  HLLLEEEEELLL------------------------llhhHHHHHHHHHHHHHHHHHHHL


DSSP  LLLEEEEELLLL---LLLHhHHHHHHHHHLLLLLLLEEEeELLL-------LLLHH--HH
Query PSRYVGFGNVPV---GLSEnDTNSYIEENIVNNKLVGIGeLTPA-------SGQIK--SL  130
ident |    |    |               |        | |  | |        |        
Sbjct PDNFIGAAXLPQspgVDPK-TCIPELEKCVKEYGFVAIN-LNPDpsgghwtSPPLTdrIW  154
DSSP  LLLEEEEEELLLlllLLHH-HHHHHHHHHHHLLLLLEEE-ELLLlllllllLLLLLlhHH


DSSP  HHHHHHHHHlLLLLEEEL-----lLLLLlHHHHHHHH--HHHHHLLLLLEEEHHHHHHHH
Query KPIFKYSMDsGSLPIWIH-----aFNPLvLQDIKEIA--ELCKAFPKVPVILGHMGGSNW  183
ident  ||          |  ||                      | | ||       | ||   
Sbjct YPIYEKXVE-LEIPAXIHvstgahYLNAdTTAFXQCVagDLFKDFPELKFVIPHGGGAVP  213
DSSP  HHHHHHHHH-HLLLEEELlllllhHHHHhHHHHHHHHhlLHHHHLLLLLEEELHHHLLLH


DSSP  HH------------hhhHHHHL-LLEEEELLlLLLHHHHHHHHHH-LLLLEELLLLLLLL
Query MT------------aveLAKEI-QNLYLDTSaYFSTFVLKIVINE-LPLKCIFGTDMPFG  229
ident                  |      |   ||                      |       
Sbjct YHwgrfrglaqexkkplLEDHVlNNIFFDTC-VYHQPGIDLLNTViPVDNVLFASEXIGA  272
DSSP  HHhhhhhhhhhhlllllHHHHLlLLEEEELL-LLLHHHHHHHHHHlLHHHEELLLLLLLL


DSSP  L----------hhHHHHHHHHH-LLLHHHHHHHHLHHHHHHHL-------------l
Query D----------lqLSIEAIKKM-SNDSYVANAVLGDNISRLLN-------------i  262
ident                   |                 |  |                 
Sbjct VrgidprtgfyydDTKRYIEAStILTPEEKQQIYEGNARRVYPrldaalkakgkleh  329
DSSP  LlleelllleellLLHHHHHHLlLLLHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll


No 9: Query=3cjpA Sbjct=2ffiA Z-score=19.7

back to top
DSSP  ---LLEEEEEELL-----------------LLHHHHHHHHHHHLLLEEEEELLLLlhhhl
Query ---LIIDGHTHVI-----------------LPVEKHIKIMDEAGVDKTILFSTSIhpeta   40
ident      || | ||                   |           |     |   |      
Sbjct lhlTAIDSHAHVFsrglnlasqrryapnydAPLGDYLGQLRAHGFSHGVLVQPSF-----   55
DSSP  lllLLEELLLLLLlhhhhhhllllllllllLLHHHHHHHHHHLLLLEELLLLLHH-----


DSSP  llhhhhhhhhhhhhhhhlllllllhhHHHHhHHHHHHHHHHLLLLEEEEELLLllllhhH
Query vnlrdvkkemkklndvvngktnsmidVRRNsIKELTNVIQAYPSRYVGFGNVPvglsenD  100
ident                                   |    |  |    |            
Sbjct --------------------------LGTD-NRYLLSALQTVPGQLRGVVXLE------R   82
DSSP  --------------------------HLLL-LHHHHHHHHHLLLLLLLLLLLL------L


DSSP  HHHhhHHHLLLLL---LLEEeEELL--LLLLHH---HHHHHHHHHHhLLLLLEEELLlll
Query TNSyiEENIVNNK---LVGIgELTP--ASGQIK---SLKPIFKYSMdSGSLPIWIHAfnp  152
ident                   |   |                |               |    
Sbjct DVE--QATLAEXArlgVRGV-RLNLxgQDXPDLtgaQWRPLLERIG-EQGWHVELHR---  135
DSSP  LLL--HHHHHHHHlllLLEE-ELLLllLLLLLLlllLLHHHHHHHH-HHLLEEEELL---


DSSP  lLHHHHHHHHHHHHHLLlLLEEEHHHHHH---------HHHHHHHhhHHLL-LEEEELLL
Query lVLQDIKEIAELCKAFPkVPVILGHMGGS---------NWMTAVElaKEIQ-NLYLDTSA  202
ident     ||                  | |                               | 
Sbjct -QVADIPVLVRALQPYG-LDIVIDHFGRPdarrglgqpGFAELLT--LSGRgKVWVKVSG  191
DSSP  -LLLLHHHHHHHHLLLL-LLEEELHHHLLlllllllllLHHHHLL--LLLLlLEEEEEEL


DSSP  LL--------LHHHHHHHHHHL-----LLLEELLLLLLL------LLHHHHHHHHHHHLL
Query YF--------STFVLKIVINEL-----PLKCIFGTDMPF------GDLQLSIEAIKKMSN  243
ident                      |           | | |              |       
Sbjct IYrlqgspeeNLAFARQALCALeahygAERLXWGSDWPHtqheseVSFGSAVEQFEALGC  251
DSSP  HHhllllhhhHHHHHHHHHHHHhhhllHHHEEEELLLLLllllllLLHHHHHHHHHHHLL


DSSP  LHHHHHHHHLHHHHHHHLL---
Query DSYVANAVLGDNISRLLNI---  262
ident       | | |    |      
Sbjct SAQLRQALLLDTARALFGFele  273
DSSP  LHHHHHHHHLHHHHHHLLLlll


No 10: Query=3cjpA Sbjct=4mupB Z-score=19.5

back to top
DSSP  ----------------LLEEEEEELL------------------LLHHHHHHHHHHHLLL
Query ----------------LIIDGHTHVI------------------LPVEKHIKIMDEAGVD   26
ident                    |   |                       |     |   | |
Sbjct lvrklsgtapnpafprGAVDTQMHMYlpgypalpggpglppgalPGPEDYRRLMQWLGID   60
DSSP  llllllllllllllllLLEELLLLLLllllllllllllllllllLLHHHHHHHHHHHLLL


DSSP  EEEEELLLLlhhhlllhhhhhhhhhhhhhhhlllllllhhHHHHhHHHHHHHHHHLLLLE
Query KTILFSTSIhpetavnlrdvkkemkklndvvngktnsmidVRRNsIKELTNVIQAYPSRY   86
ident   |                                       |                 
Sbjct RVIITQGNA-------------------------------HQRD-NGNTLACVAEMGEAA   88
DSSP  EEEEELLHH-------------------------------HLLL-LHHHHHHHHHHHHHE


DSSP  EEEELLlllllhhhHHHHHHHHLLLLL---LLEEEeELLL---lllHHHHHHHHHHHHhL
Query VGFGNVpvglsendTNSYIEENIVNNK---LVGIGeLTPA---sgqIKSLKPIFKYSMdS  140
ident                    |           ||                |          
Sbjct HAVVII--------DATTTEKDMEKLTaagTVGAR-IMDLpggavnLSELDAVDERAH-A  138
DSSP  EEEELL--------LLLLLHHHHHHHHhllEEEEE-EELLllllllHHHHHHHHHHHH-H


DSSP  LLLLEEELLLLLLLHHHHHHHHHHhhhllLLLEEEHHHHHH---------HHHHHHHHHH
Query GSLPIWIHAFNPLVLQDIKEIAELckafpKVPVILGHMGGS---------NWMTAVELAK  191
ident               |                     | |                  |  
Sbjct ADWMVAVQFDGNGLLDHLPRLQKI-----RSRWVFDHHGKFfkgirtdgpEMAALLKLID  193
DSSP  LLLEEEEELLHHHHHHHHHHHHLL-----LLEEEELHHHHLllllllllhHHHHHHHHHH


DSSP  hLLLEEEELLLLL-----------LHHHHHHHHHHLLLLEELLLLLLL---------lLH
Query eIQNLYLDTSAYF-----------STFVLKIVINELPLKCIFGTDMPF---------gDL  231
ident    ||                               |     ||  |           | 
Sbjct -RGNLWFKFAGVYessrkswpyadVAAFSRVIAAHAPERIVWGTNWPHnsvretaaypDD  252
DSSP  -HLLEEEEELLHHhllllllllhhHHHHHHHHHHHLHHHEEELLLLLLlllllhhhllLH


DSSP  HHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL---
Query QLSIEAIKKMSNDSYVANAVLGDNISRLLNI---  262
ident     |       |       |  |   |      
Sbjct ARLAELTLGWLPDEAARHRALVENPEALFKLspv  286
DSSP  HHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLlll


No 11: Query=3cjpA Sbjct=2vunA Z-score=18.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEEEEEELLLLHH-------HHHHHHHHHLLLEEEE-ELLLLLhhhlllhhhhhhhhhh
Query LIIDGHTHVILPVE-------KHIKIMDEAGVDKTIL-FSTSIHpetavnlrdvkkemkk   52
ident    | | ||              |      ||   |   |                    
Sbjct GLLDTHVHVSGGDYaprqktmDFISSALHGGVTTMISaGSPHFP----------------  104
DSSP  LEEEEEELLLLLLEehhhleeLHHHHHHLLLEEEEEElLLLLLL----------------


DSSP  hhhhhlllllLLHHHHHHHHHHH-HHHHHHL--lLLEEE-EELLLLLLlhhhHHHHHHHH
Query lndvvngktnSMIDVRRNSIKEL-TNVIQAY--pSRYVG-FGNVPVGLsendTNSYIEEN  108
ident                       |      |        |       ||    |     | 
Sbjct -------grpKDAAGTKALAITLsKSYYNARpagVKVHGgAVILEKGL----TEEDFIEM  153
DSSP  -------lllLLHHHHHHHHHHHhHHHHHLLhhhLEEELlEELLLLLL----LHHHHHHH


DSSP  lLLLLLLEEEEEL-llllLHHHHHHHHHHHHHLLlLLEEELLLL------LLLHhhHHHH
Query iVNNKLVGIGELT-pasgQIKSLKPIFKYSMDSGsLPIWIHAFN------PLVLqdIKEI  161
ident          ||             |        |      |           |       
Sbjct -KKEGVWIVGEVGlgtikNPEDAAPMVEWAHKHG-FKVQMHTGGtsipgsSTVT--ADDV  209
DSSP  -HHLLLLEEEEELlllllLHHHHHHHHHHHHHLL-LEEEEELLLllllllLLLL--HHHH


DSSP  HHHHhhllllLEEEHHH----hHHHHHHHHHHHHHLLlEEEELL-LLLLhHHHHHHHHHL
Query AELCkafpkvPVILGHM----gGSNWMTAVELAKEIQnLYLDTS-AYFStFVLKIVINEL  216
ident           |    |                  |                    |    
Sbjct IKTK------PDVVSHInggptAISVQEVDRIMDETD-FAMEIVqCGNP-KIADYVARRA  261
DSSP  HHHL------LLEEELLlllllLLLHHHHHHHHHHLL-LEEEEElLLLH-HHHHHHHHHH


DSSP  -----LLLEELLLLLLL---LLHHHHHHHHHHHL----LLHHHHHHHHLHHHHHHHLL--
Query -----PLKCIFGTDMPF---GDLQLSIEAIKKMS----NDSYVANAVLGDNISRLLNI--  262
ident          ||| | |                       |  ||      |         
Sbjct aekgqLGRVIFGNDAPSgtgLIPLGILRNMCQIAsmsdIDPEVAVCMATGNSTAVYGLnt  321
DSSP  hhhllHHHEEEELLLLLlllLLLLHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakra  381
DSSP  lllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllll


DSSP  ----
Query ----  262
ident     
Sbjct akil  385
DSSP  leel


No 12: Query=3cjpA Sbjct=1gkpA Z-score=18.8

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------LIIDGHTH    8
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LL---------LLHHHHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhll
Query VI---------LPVEKHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkklndvvng   59
ident               |   |     |    |                              
Sbjct IYlpfmatfakDTHETGSKAALMGGTTTYIEMCCP-------------------------   95
DSSP  LLleelleellLLHHHHHHHHHHLLEEEEEEEELL-------------------------


DSSP  llLLLHhHHHHHHHHHHHHHHHLL-LLEEEEELLLLLLLhhHHHHHHHHHlLLLLLLEEE
Query ktNSMIdVRRNSIKELTNVIQAYP-SRYVGFGNVPVGLSenDTNSYIEENiVNNKLVGIG  118
ident                            |     |        |     |  |        
Sbjct --SRND-DALEGYQLWKSKAEGNSyCDYTFHMAVSKFDE--KTEGQLREI-VADGISSFX  149
DSSP  --LLLL-LHHHHHHHHHHHHLLLLlLEEEEEEELLLLLL--LHHHHHHHH-HHLLLLEEE


DSSP  eELLL-----llLHHHHHHHHHHHHHLlLLLEEELLLLL---------------------
Query eLTPA-----sgQIKSLKPIFKYSMDSgSLPIWIHAFNP---------------------  152
ident                                   |  |                      
Sbjct -IFLSyknffgvDDGEMYQTLRLAKEL-GVIVTAHCENAelvgrlqqkllsegktgpewh  207
DSSP  -EEELlllllllLHHHHHHHHHHHHHH-LLEEEEEELLHhhhhhhhhhhhhlllllhhhl


DSSP  -------LLHHHHHHHHHHHHHLLlLLEEEHHHHHH-HHHHHHHHHHHLLLEEEELL-LL
Query -------LVLQDIKEIAELCKAFPkVPVILGHMGGS-NWMTAVELAKEIQNLYLDTS-AY  203
ident                 |              |         |          |       
Sbjct epsrpeaVEAEGTARFATFLETTG-ATGYVVHLSCKpALDAAMAAKARGVPIYIESViPH  266
DSSP  lllllhhHHHHHHHHHHHHHHHHL-LEEEELLLLLHhHHHHHHHHHHLLLLEEEEEEhHH


DSSP  LL---------------------------HHHHHHHHHHLLlLEELLLLLL---------
Query FS---------------------------TFVLKIVINELPlKCIFGTDMP---------  227
ident |                              ||             |||           
Sbjct FLldktyaerggveamkyimspplrdkrnQKVLWDALAQGF-IDTVGTDHCpfdteqkll  325
DSSP  HHllhhhhhllhhhhhlllllllllllhhHHHHHHHHHLLL-LLEEELLLLlllhhhhhh


DSSP  -----------LLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL---------
Query -----------FGDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI---------  262
ident                                 |              |            
Sbjct gkeaftaipngIPAIEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGLfprkgtiav  385
DSSP  hlllhhhllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgek  445
DSSP  llllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleellll


DSSP  -------------
Query -------------  262
ident              
Sbjct gwgkllrrepmyf  458
DSSP  lllllllllllll


No 13: Query=3cjpA Sbjct=4b3zD Z-score=18.7

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------LIIDGHT    7
ident                                                        ||  |
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  ELL----LLHHHHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhlllLLL
Query HVI----LPVEKHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkklndvvngkTNS   63
ident                     |    |                                  
Sbjct YLQktaaDDFFQGTRAALVGGTTMIIDHVVP--------------------------EPG   94
DSSP  LLLllllLLHHHHHHHHHHLLEEEEEEEELL--------------------------LLL


DSSP  LHhhHHHHHHHHHHHHHHLL-LLEEEEELLLLLLLhhHHHHHHHHHLLLLLLLEEEeELL
Query MIdvRRNSIKELTNVIQAYP-SRYVGFGNVPVGLSenDTNSYIEENIVNNKLVGIGeLTP  122
ident        |               |                   |                
Sbjct SS--LLTSFEKWHEAADTKScCDYSLHVDITSWYD--GVREELEVLVQDKGVNSFQ-VYM  149
DSSP  LL--HHHHHHHHHHHHHLLLlLEEEEEEELLLLLL--LHHHHHHHHHHLLLLLEEE-EEL


DSSP  LL-----lLHHHHHHHHHHHHHLlLLLEEELLLLL-------------------------
Query AS-----gQIKSLKPIFKYSMDSgSLPIWIHAFNP-------------------------  152
ident |           |   |          |  || |                          
Sbjct AYkdvyqmSDSQLYEAFTFLKGL-GAVILVHAENGdliaqeqkrilemgitgpeghalsr  208
DSSP  LLllllllLHHHHHHHHHHHHHH-LLEEEEELLLHhhhhhhhhhhhhllllllhhhhhhl


DSSP  ---LLHHHHHHHHHHHHHLLlLLEEEHHHHH-HHHHHHHHHHHHLLLEEEELL-LLLL--
Query ---LVLQDIKEIAELCKAFPkVPVILGHMGG-SNWMTAVELAKEIQNLYLDTS-AYFS--  205
ident    |                  ||        |         |           |     
Sbjct peeLEAEAVFRAITIAGRIN-CPVYITKVMSkSAADIIALARKKGPLVFGEPIaASLGtd  267
DSSP  lhhHHHHHHHHHHHHHHHHL-LLEEEEEELLhHHHHHHHHHHHHLLLEEEEELhHHHHll


DSSP  ---------------------------HHHHHHHHHHLllLEELLLLLL-----------
Query ---------------------------TFVLKIVINELplKCIFGTDMP-----------  227
ident                               |             |               
Sbjct gthywsknwakaaafvtspplspdpttPDYLTSLLACG-dLQVTGSGHCpystaqkavgk  326
DSSP  lhhhhlllhhhhhhllllllllllllhHHHHHHHHHHL-lLLLLLLLLLlllhhhhhhhl


DSSP  ---------LLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL-----------
Query ---------FGDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI-----------  262
ident                               |     ||   |     |            
Sbjct dnftlipegVNGIEERMTVVWDKAvatgkMDENQFVAVTSTNAAKIFNLyprkgriavgs  386
DSSP  llhhhllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHHLLlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct dadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgm  446
DSSP  llleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllll


DSSP  -------------------------------
Query -------------------------------  262
ident                                
Sbjct grfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  llllllllllhhhhhhhhhhhhhllllllll


No 14: Query=3cjpA Sbjct=2y1hB Z-score=18.6

back to top
DSSP  --LLEEEEEELL-----lLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhh
Query --LIIDGHTHVI-----lPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkkl   53
ident      | | |                   | |                            
Sbjct gvGLVDCHCHLSapdfdrDLDDVLEKAKKANVVALVAVAE--------------------   40
DSSP  llLEEEEEELLLlhhhllLHHHHHHHHHHLLEEEEEELLL--------------------


DSSP  hhhhlllllllhhhHHHHHHHHHHHHHHLLLLEEEEELLLL--------LLLHhHHHHHH
Query ndvvngktnsmidvRRNSIKELTNVIQAYPSRYVGFGNVPV--------GLSEnDTNSYI  105
ident                             |         |               |     
Sbjct --------------HSGEFEKIMQLSERYNGFVLPCLGVHPvqgldqrsVTLK-DLDVAL   85
DSSP  --------------LHHHHHHHHHHHHHLLLLEEEEELLLLeelllleeLLHH-HHHHHH


DSSP  hHHLLLL--LLLEEEEELLLL-----------LLHHH-HHHHHHHHHhLLLLLEEELLLL
Query eENIVNN--KLVGIGELTPAS-----------GQIKS-LKPIFKYSMdSGSLPIWIHAFN  151
ident    | |    |  |||                      |            ||   |   
Sbjct -PIIENYkdRLLAIGEVGLDFsprfagtgeqkEEQRQvLIRQIQLAK-RLNLPVNVHSRS  143
DSSP  -HHHHHHllLLLEEEEEEEELlllllllhhhhHHHHHhHHHHHHHHH-HHLLLEEEEEEL


DSSP  lllhhHHHHHHHHHHHLLLLLEEEHHhHHHHHHHHhHHHHHLLlEEEELL-LLLLHHHHH
Query plvlqDIKEIAELCKAFPKVPVILGHmGGSNWMTAvELAKEIQnLYLDTS-AYFSTFVLK  210
ident             |        | |          |                         
Sbjct -----AGRPTINLLQEQGAEKVLLHA-FDGRPSVA-MEGVRAG-YFFSIPpSIIRSGQKQ  195
DSSP  -----LHHHHHHHHHHLLLLLEEEEL-LLLLHHHH-HHHHHLL-LEEEELhHHHLLHHHH


DSSP  HHHHH-LLLLEELLLLLLL--------LLHHHHHHHHHHHLL-----LHHHHHHHhLHHH
Query IVINE-LPLKCIFGTDMPF--------GDLQLSIEAIKKMSN-----DSYVANAVlGDNI  256
ident               || |                                |       | 
Sbjct KLVKQlPLTSICLETDSPAlgpekqvrNEPWNISISAEYIAQvkgisVEEVIEVT-TQNA  254
DSSP  HHHHHlLHHHEEELLLLLLllllllllLLHHHHHHHHHHHHHhhlllHHHHHHHH-HHHH


DSSP  HHHHLL-----
Query SRLLNI-----  262
ident   |        
Sbjct LKLFPKlrhll  265
DSSP  HHHLLLhhhhl


No 15: Query=3cjpA Sbjct=1bf6A Z-score=18.4

back to top
DSSP  -----LLEEEEEELL--------------LLHHHHHHHHHHHL---LLEEEEELllllhh
Query -----LIIDGHTHVI--------------LPVEKHIKIMDEAG---VDKTILFStsihpe   38
ident           | |                         |       |   |         
Sbjct sfdptGYTLAHEHLHidlsgfknnvdcrlDQYAFICQEMNDLMtrgVRNVIEMT------   54
DSSP  lllllLEEEEEELLLeelhhhhllhhheeLLHHHHHHHHHHHHhllEEEEEELL------


DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhHHHHHhhHHHHHHHLL----LLEEEEELLLL
Query tavnlrdvkkemkklndvvngktnsmidvRRNSIkeLTNVIQAYP----SRYVGFGNVPV   94
ident                              |                      |       
Sbjct ----------------------------nRYMGR--NAQFMLDVMretgINVVACTGYYQ   84
DSSP  ----------------------------lHHHLL--LHHHHHHHHhhhlLEEEEEELLLL


DSSP  L---------LLHHHHHHHHHHHLLLL------LLLEEEEELL-LLLL---HHHH-HHHH
Query G---------LSENDTNSYIEENIVNN------KLVGIGELTP-ASGQ---IKSL-KPIF  134
ident            |           |         |   | |                    
Sbjct DaffpehvatRSVQELAQEMVDEIEQGidgtelKAGIIAEIGTsEGKItplEEKVfIAAA  144
DSSP  HhhlllhhhhLLHHHHHHHHHHHHHLLllllllLEEEEEEEELlLLLLlhhHHHHhHHHH


DSSP  HHHHHLlLLLEEELLLLLLlhhHHHHHHHHHHH-LLLL-LEEEHHHHHHHHHHHHHHHHH
Query KYSMDSgSLPIWIHAFNPLvlqDIKEIAELCKA-FPKV-PVILGHMGGSNWMTAVELAKE  192
ident          ||  |           |   |  |       |  ||               
Sbjct LAHNQT-GRPISTHTSFST---MGLEQLALLQAhGVDLsRVTVGHCDLKDNLDNILKMID  200
DSSP  HHHHHH-LLLEEEELHHHL---LHHHHHHHHHHlLLLHhHEEELLLLLLLLHHHHHHHHH


DSSP  LLlEEEELLLL-----LLHHHHHHHHHHL-----LLLEELLLLLLL---------lLHHH
Query IQnLYLDTSAY-----FSTFVLKIVINEL-----PLKCIFGTDMPF---------gDLQL  233
ident     |                       |             |                 
Sbjct LG-AYVQFDTIgknsyYPDEKRIAMLHALrdrglLNRVMLSMDITRrshlkanggyGYDY  259
DSSP  LL-LEEEELLLlllllLLHHHHHHHHHHHhhlllHHHEEELLLLLLhhhlhhhlllLLLH


DSSP  HH-HHHHHHL---LLHHHHHHHHLHHHHHHHLl
Query SI-EAIKKMS---NDSYVANAVLGDNISRLLNi  262
ident      |                |  | |     
Sbjct LLtTFIPQLRqsgFSQADVDVMLRENPSQFFQ-  291
DSSP  HHhLHHHHHHhllLLHHHHHHHHLHHHHHHLL-


No 16: Query=3cjpA Sbjct=3pnuA Z-score=17.9

back to top
DSSP  -------------LLEEEEEELLL--LHHHHHHHHHHHlLLEEEEELLLllhhhlllhhh
Query -------------LIIDGHTHVIL--PVEKHIKIMDEAgVDKTILFSTSihpetavnlrd   45
ident                 | | |       |                               
Sbjct enlyfqsnamklkNPLDMHLHLRDnqMLELIAPLSARD-FCAAVIMPNL-----------   48
DSSP  llllllllleeeeLLEEEEELLLLhhHHHHHHHHHHLL-LLEEEELLLL-----------


DSSP  hhhhhhhhhhhhlllllllhhhhHHHH---HHHHHHHHHLL-------LLEEEEELLLLl
Query vkkemkklndvvngktnsmidvrRNSI---KELTNVIQAYP-------SRYVGFGNVPVg   95
ident                                 |                           
Sbjct -----------------------IPPLcnlEDLKAYKMRILkackdenFTPLMTLFFKN-   84
DSSP  -----------------------LLLLllhHHHHHHHHHHHhhhllllLEEEEEEELLL-


DSSP  llhhhHHHHHHHHLLllLLLEEEeELLL---------lLLHH--HHHHHHHHHHHLlLLL
Query lsendTNSYIEENIVnnKLVGIGeLTPA---------sGQIK--SLKPIFKYSMDSgSLP  144
ident                     ||  | ||                 |||      |    |
Sbjct ----yDEKFLYSAKD--EIFGIX-LYPAgittnsnggvSSFDieYLKPTLEAMSDL-NIP  136
DSSP  ----lLHHHHHHHLL--LLLEEE-ELLLllllllllllLLLLhhHHHHHHHHHHHL-LLL


DSSP  EEELLLLL-----LLHHHHHHHHHHHHHLLLLLEEEHHHHhhhHHHHHHHHHHLLLEEEE
Query IWIHAFNP-----LVLQDIKEIAELCKAFPKVPVILGHMGgsnWMTAVELAKEIQNLYLD  199
ident    |               |    | | ||       |       |  || |   |||  
Sbjct LLVHGETNdfvmdRESNFAKIYEKLAKHFPRLKIVMEHIT---TKTLCELLKDYENLYAT  193
DSSP  EEELLLLLllhhhLLHHHHHHHHHHHHHLLLLLEEELLLL---LHHHHHHHHHLLLEEEE


DSSP  LL-LLLL--------------------------HHHHHHHHHHLLLLEELLLLLL-----
Query TS-AYFS--------------------------TFVLKIVINELPLKCIFGTDMP-----  227
ident                                     |         |  || |       
Sbjct ITlHHLIitlddviggkmnphlfckpiakryedKEALCELAFSGYEKVMFGSDSAphpkg  253
DSSP  ELlHHHLllhhhhhlllllhhhllllllllhhhHHHHHHHHHLLLLLEEELLLLLlllll


DSSP  ----LLLHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHHLL------------------
Query ----FGDLQLSIEAIKKMS---NDSYVANAVLGDNISRLLNI------------------  262
ident                                | ||                         
Sbjct caagVFSAPVILPVLAELFkqnSSEENLQKFLSDNTCKIYDLkfkedkiltleekewqvp  313
DSSP  llllLLLHHHHHHHHHHHHhhhLLHHHHHHHHLHHHHHHHLLlllllleeeeellleell


DSSP  -------------------------
Query -------------------------  262
ident                          
Sbjct nvyedkynqvvpymageilkfqlkh  338
DSSP  lleelllleellllllleelleell


No 17: Query=3cjpA Sbjct=2qpxA Z-score=17.8

back to top
DSSP  ------------LLEEEEEELLLL------------------------------------
Query ------------LIIDGHTHVILP------------------------------------   12
ident                | | |                                        
Sbjct gxddlsefvdqvPLLDHHCHFLIDgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
DSSP  lllllhhhhhhlLEEEEEELLLLLlllllhhhhhhhhlllllllllhhhhlllhhhhhhh


DSSP  ----------------------hHHHHHHHHHHLLLEEEEELLLLLHHHlllhhhhhhhh
Query ----------------------vEKHIKIMDEAGVDKTILFSTSIHPETavnlrdvkkem   50
ident                             |                               
Sbjct alakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFVPDDP-----------  109
DSSP  hhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLLLLLL-----------


DSSP  hhhhhhhlllllllhhhhhhhhhhhhHHHHHLL----LLEEEEELLL------------l
Query kklndvvngktnsmidvrrnsikeltNVIQAYP----SRYVGFGNVP------------v   94
ident                                                             
Sbjct -------------------------iLDLDQTAelvgIPVKAIYRLEthaedfxlehdnf  144
DSSP  -------------------------lLLHHHHHhhhlLLEEEEEEHHhhhhhhhlllllh


DSSP  llLHHHHHHHHHHhLLLLLLLEEeEELL-LLLLH--------------------------
Query glSENDTNSYIEEnIVNNKLVGIgELTP-ASGQI--------------------------  127
ident                     ||                                      
Sbjct aaWWQAFSNDVKQ-AKAHGFVGF-XSIAaYRVGLhlepvnvieaaagfdtwkhsgekrlt  202
DSSP  hhHHHHHHHHHHL-LLLLLLLLE-EELHhHHLLLllllllhhhhhhhhhhhhhhllllll


DSSP  ------HHHHHHHHHHHhLLLLLEEELLLL-------LLLHhhHHHHHHHHHHLL--LLL
Query ------KSLKPIFKYSMdSGSLPIWIHAFN-------PLVLqdIKEIAELCKAFP--KVP  172
ident         |             |   |           |            |||      
Sbjct skplidYXLYHVAPFII-AQDXPLQFHVGYgdadtdxYLGN--PLLXRDYLKAFTkkGLK  259
DSSP  lhhhhhHHHHHHHHHHH-HHLLLEEEEELLllllllhHHLL--HHHHHHHHHHHHhhLLL


DSSP  EEEHHhHHHHHHHHHHHHHHLLLEEEELLLL------LLHHHHHHHH-hHLLLLEELLLL
Query VILGHmGGSNWMTAVELAKEIQNLYLDTSAY------FSTFVLKIVI-nELPLKCIFGTD  225
ident | | |        |  ||    ||| | |            |              |  |
Sbjct VVLLH-CYPYHREAGYLASVFPNLYFDISLLdnlgpsGASRVFNEAVelAPYTRILFASD  318
DSSP  EEEEE-LLLLHHHHHHHHHHLLLEEEELLLHhhhlhhHHHHHHHHHLllLLHHHEELLLL


DSSP  LL--llLHHHHHHHHHHHLL-------------LHHHHHHHHLHHHHHHHLL------
Query MP--fgDLQLSIEAIKKMSN-------------DSYVANAVLGDNISRLLNI------  262
ident          |     |                      ||        |         
Sbjct AStypeXYGLAARQFKQALVahfnqlpfvdlaqKKAWINAICWQTSAKLYHQerelrv  376
DSSP  LLllhhHHHHHHHHHHHHHHhhhhllllllhhhHHHHHHHHHLHHHHHHLLLhhhhll


No 18: Query=3cjpA Sbjct=2ob3A Z-score=17.4

back to top
DSSP  ---------------LLEEEEEELL---------------------LLHHHHHHHHHHHL
Query ---------------LIIDGHTHVI---------------------LPVEKHIKIMDEAG   24
ident                     | |                                   ||
Sbjct drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkalaEKAVRGLRRARAAG   60
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhhhHHHHHHHHHHHHLL


DSSP  LLEEEEELllllhhhlllhhhhhhhhhhhhhhhlllllllhhhHHHHHhhHHHHHHHLL-
Query VDKTILFStsihpetavnlrdvkkemkklndvvngktnsmidvRRNSIkeLTNVIQAYP-   83
ident |      |                                                    
Sbjct VRTIVDVS----------------------------------tFDIGR--DVSLLAEVSr   84
DSSP  LLEEEELL----------------------------------lHHHLL--LHHHHHHHHh


DSSP  ---LLEEEEELLLL-------lLLHHHHHHHHHHHLLLL------LLLEEEeELLLLLL-
Query ---SRYVGFGNVPV-------gLSENDTNSYIEENIVNN------KLVGIGeLTPASGQ-  126
ident       |                |           |             |          
Sbjct aadVHIVAATGLWFdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGIIX-VATTGKAt  143
DSSP  hhlLEEELEEELLLlllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEEE-EELLLLLl


DSSP  --HHHH-HHHHHHHHhLLLLLEEELL-LLLLlhhHHHHHHHHHHHLLLL--LEEEHHH-h
Query --IKSL-KPIFKYSMdSGSLPIWIHA-FNPLvlqDIKEIAELCKAFPKV--PVILGHM-g  179
ident        |     |      |   |         |    |            |  ||   
Sbjct pfQELVlKAAARASL-ATGVPVTTHTaASQR---DGEQQAAIFESEGLSpsRVCIGHSdd  199
DSSP  hhHHHHhHHHHHHHH-HHLLLEEEELlHHHL---HHHHHHHHHHHLLLLhhHEEELLHhh


DSSP  HHHHHHHHHHHHHLllEEEELLLL-----------------------LLHHHHHHHHH-H
Query GSNWMTAVELAKEIqnLYLDTSAY-----------------------FSTFVLKIVIN-E  215
ident          ||                                          |  |   
Sbjct TDDLSYLTALAARG--YLIGLDHIpysaiglednasasallgirswqTRALLIKALIDqG  257
DSSP  LLLHHHHHHHHHLL--LEEEELLLllllllllllhhhhhhhllllhhHHHHHHHHHHHlL


DSSP  LLLLEELLLLLL------------------llLHHHHH-HHHHHHL---LLHHHHHHHHL
Query LPLKCIFGTDMP------------------fgDLQLSI-EAIKKMS---NDSYVANAVLG  253
ident          |                               |                  
Sbjct YMKQILVSNDWTfgfssyvtnimdvmdrvnpdGMAFIPlRVIPFLRekgVPQETLAGITV  317
DSSP  LHHHEEELLLLLleellllllhhhhhhhhlllHHHHHHhLHHHHHHhllLLHHHHHHHHL


DSSP  HHHHHHHL---l
Query DNISRLLN---i  262
ident  |  | |     
Sbjct TNPARFLSptlr  329
DSSP  HHHHHHHLllll


No 19: Query=3cjpA Sbjct=3gg7A Z-score=17.4

back to top
DSSP  LLEEEEEEL-----LLLH-HHHHHHHhhhllLEEEEELLlllhhhlllhhhhhhhhhhhh
Query LIIDGHTHV-----ILPV-EKHIKIMdeagvDKTILFSTsihpetavnlrdvkkemkkln   54
ident   || | |         |                    |                     
Sbjct SLIDFHVHLdlypdPVAVaRACEERQ-----LTVLSVTT---------------------   34
DSSP  LLEEEEELHhhlllHHHHhHHHHHLL-----LEEEELLL---------------------


DSSP  hhhlllllllhhhHHHHHHHHHHHHHHLlLLEEEEELLLL---lllHHHHhHHHHHHLLl
Query dvvngktnsmidvRRNSIKELTNVIQAYpSRYVGFGNVPV---glsENDTnSYIEENIVn  111
ident                                                 |           
Sbjct -------------TPAAWRGTLALAAGR-PHVWTALGFHPevvserAADL-PWFDRYLP-   78
DSSP  -------------LHHHHHHHHHHHLLL-LLEEELLLLLHhhllllHHHL-HHHHHHHH-


DSSP  lLLLEEEEELLLLL--------LHHH-HHHHHHHHHHLLLLLEEELLLLlllhhHHHHHH
Query nKLVGIGELTPASG--------QIKS-LKPIFKYSMDSGSLPIWIHAFNplvlqDIKEIA  162
ident       ||              |       |     | |     ||           |  
Sbjct -ETRFVGEVGLDGSpslrgtwtQQFAvFQHILRRCEDHGGRILSIHSRR-----AESEVL  132
DSSP  -HLLEEEEEELLLLhhhhhhhhHHHHhHHHHHHHHHHLLLEEEEEELLL-----LHHHHH


DSSP  HHHHHLLL-LLEEEHHhHHHHhHHHHHHHHHLLlEEEELLLLL-LHHHHHHHHHHL-LLL
Query ELCKAFPK-VPVILGHmGGSNwMTAVELAKEIQnLYLDTSAYF-STFVLKIVINEL-PLK  219
ident     | |     ||         |    |                |      |       
Sbjct NCLEANPRsGTPILHW-YSGS-VTELRRAISLG-CWFSVGPTMvRTQKGAALIRSMpRDR  189
DSSP  HHHHHLHHhEEEEEEL-LLLL-HHHHHHHHHLL-LEEEELHHHhLLHHHHHHHHHLlHHH


DSSP  EELLLLLLLL----------LHHHHHHHHHHHLLLH--HHHHHhHLHHHHHHHLl
Query CIFGTDMPFG----------DLQLSIEAIKKMSNDS--YVANAvLGDNISRLLNi  262
ident     || ||           |     |   |        |       | ||||  
Sbjct VLTETDGPFLeldgqaalpwDVKSVVEGLSKIWQIPasEVERI-VKENVSRLLGt  243
DSSP  EEELLLLLLLeelleellhhHHHHHHHHHHHHHLLLhhHHHHH-HHHHHHHHHHl


No 20: Query=3cjpA Sbjct=4cqbA Z-score=17.3

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------LIIDGHT    7
ident                                                         | ||
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  EL-----------------------------------------lLLHHhHHHHHHHHLLL
Query HV-----------------------------------------iLPVEkHIKIMDEAGVD   26
ident |                                              | |       |  
Sbjct HMdksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIE-HAHMQVLHGTL  119
DSSP  LHhhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHH-HHHHHHHLLEE


DSSP  EEEEELLlllhhhlllhhhhhhhhhhhhhhhllllllLHHHHHHHHHHHHHHHHHLL--L
Query KTILFSTsihpetavnlrdvkkemkklndvvngktnsMIDVRRNSIKELTNVIQAYP--S   84
ident  |                                                          
Sbjct YTRTHVD-----------------------------vDSVAKTKAVEAVLEAKEELKdlI  150
DSSP  EEEEEEE-----------------------------lLLLLLLHHHHHHHHHHHHLLllL


DSSP  LEEEEELL--LLLLlhHHHHHHHHHHLlLLLLLEEEeELLLL---LLHHH-HHHHHHHHH
Query RYVGFGNV--PVGLseNDTNSYIEENIvNNKLVGIGeLTPAS---GQIKS-LKPIFKYSM  138
ident                     | |            |               |   ||   
Sbjct DIQVVAFAqsGFFV-dLESESLIRKSL-DMGCDLVG-GVDPAtreNNVEGsLDLCFKLAK  207
DSSP  EEEEEEELllLLLL-lLLHHHHHHHHH-HHLLLEEE-LLLLLlllLLHHHhHHHHHHHHH


DSSP  HLLlLLEEELLLLL--LLHHHHHHHHHHHHHLLL-lLEEEHHhHHHH-------hhHHHH
Query DSGsLPIWIHAFNP--LVLQDIKEIAELCKAFPK-vPVILGHmGGSN-------wmTAVE  188
ident       |  |           |   |           |   |               |  
Sbjct EYD-VDIDYHIHDIgtVGVYSINRLAQKTIENGYkgRVTTSH-AWCFadapsewldEAIP  265
DSSP  HLL-LEEEEEELLLhhHHHHHHHHHHHHHHHLLLllLEEEEE-LLHHhhllhhhhhHHHH


DSSP  HHHHLLlEEEELL--LLLLHHHHHHHHHHLlLLEELLLLLL------LLLHH--HHHHHH
Query LAKEIQnLYLDTS--AYFSTFVLKIVINELpLKCIFGTDMP------FGDLQ--LSIEAI  238
ident | |        |       |                  |        ||           
Sbjct LYKDSG-MKFVTCfsSTPPTMPVIKLLEAG-INLGCASDNIrdfwvpFGNGDmvQGALIE  323
DSSP  HHHHHL-LEEEEEllLLLLLLLHHHHHHLL-LEEEEELLLLllllllLLLLLhhHHHHHH


DSSP  HHH-----lLLHHHHHHHHLHHHHHHHLL-------------------------------
Query KKM-----sNDSYVANAVLGDNISRLLNI-------------------------------  262
ident           |             | | |                               
Sbjct TQRlelktnRDLGLIWKMITSEGARVLGIeknygievgkkadlvvlnslspqwaiidqak  383
DSSP  HHHhllllhHHHHHHHHHHLHHHHHHHLLhhhlllllllllleeeellllhhhhhhhlll


DSSP  -------------------
Query -------------------  262
ident                    
Sbjct rlcvikngriivkdeviva  402
DSSP  eeeeeelleeeeelleell


No 21: Query=3cjpA Sbjct=3nqbA Z-score=17.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------LLEEEEEELL---LLHHHHHHHHHHHLLLEEEEELLLllhhh
Query ------------------LIIDGHTHVI---LPVEKHIKIMDEAGVDKTILFSTSihpet   39
ident                     || | |                  ||              
Sbjct srrdaaqvidaggayvspGLIDTHXHIEssxITPAAYAAAVVARGVTTIVWDPHE-----  115
DSSP  lllleeeeeelllleeeeLEEEEEELHHhhlLLHHHHHHHHHLLLEEEEEELLHH-----


DSSP  lllhhhhhhhhhhhhhhhlllllllHHHHHHHHHHHHHHHHHLlLLEEEEELLL------
Query avnlrdvkkemkklndvvngktnsmIDVRRNSIKELTNVIQAYpSRYVGFGNVP------   93
ident                                        |     |              
Sbjct -----------------------fgNVHGVDGVRWAAKAIENLpLRAILLAPSCvpsapg  152
DSSP  -----------------------hhHHHLHHHHHHHHHHHLLLlLEEEEEELLLllllll


DSSP  -llllhhHHHHHHHHhLLLLL-LLEEEEELLLLlLHHH---HHHHHHHHHHLlLLLEEEL
Query -vglsenDTNSYIEEnIVNNK-LVGIGELTPASgQIKS---LKPIFKYSMDSgSLPIWIH  148
ident                         || |       |        |              |
Sbjct lerggadFDAAILAD-LLSWPeIGGIAEIXNXRgVIERdprXSGIVQAGLAA-EKLVCGH  210
DSSP  lllllllLLHHHHHH-HHLLLlEEEEEEELLHHhHHLLlhhHHHHHHHHHHH-LLEEEEL


DSSP  LLLlLLHHHHHHHHHHHhhlllllEEEHhHHHH--HHHHHHHHHhhlllEEEELL-LLLL
Query AFNpLVLQDIKEIAELCkafpkvpVILGhMGGS--NWMTAVELAkeiqnLYLDTS-AYFS  205
ident |   |   |                       |                |          
Sbjct ARG-LKNADLNAFXAAG------vSSDH-ELVSgeDLXAKLRAG-----LTIELRgSHDH  257
DSSP  LLL-LLHHHHHHHHHLL------lLEEL-LLLLhhHHHHHHHLL-----LEEEEElLLHH


DSSP  -HHHHHHHHH---HLLLLEELLLLLLL-------lLHHHHHHHHH-HHLLlHHHHHHHHL
Query -TFVLKIVIN---ELPLKCIFGTDMPF-------gDLQLSIEAIK-KMSNdSYVANAVLG  253
ident          |    ||      ||  |         |                 |     
Sbjct lLPEFVAALNtlgHLPQTVTLCTDDVFpddllqggGLDDVVRRLVrYGLK-PEWALRAAT  316
DSSP  hHHHHHHHHHhhlLLLLLEEEELLLLLhhhhhhllLHHHHHHHHHhLLLL-HHHHHHHHL


DSSP  HHHHHHHLL---------------------------------------------------
Query DNISRLLNI---------------------------------------------------  262
ident  |    |                                                     
Sbjct LNAAQRLGRsdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdtt  376
DSSP  HHHHHHHLLllllllllllllleeeellllllleeeeeelleeeeelleelllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct vlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxis  436
DSSP  hhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct vthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgg  496
DSSP  eellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfga  556
DSSP  eeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhll


DSSP  -------------------------------
Query -------------------------------  262
ident                                
Sbjct tlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllllleelllleeelllleeellleeel


No 22: Query=3cjpA Sbjct=3k2gB Z-score=16.8

back to top
DSSP  ---------------------------LLEEEEEELL-----------------------
Query ---------------------------LIIDGHTHVI-----------------------   10
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlll


DSSP  ------------------------LLHHHHHHHHHHHLLLEEEEELllllhhhlllhhhh
Query ------------------------LPVEKHIKIMDEAGVDKTILFStsihpetavnlrdv   46
ident                                |     |                      
Sbjct sieilselrqdpfvnkhnialddlDLAIAEVKQFAAVGGRSIVDPT--------------  106
DSSP  lhhhhhhhhllhhhllllleellhHHHHHHHHHHHHLLLLEEEELL--------------


DSSP  hhhhhhhhhhhlllllllhhhHHHHHhhHHHHHHHLL----LLEEEEeLLLL--------
Query kkemkklndvvngktnsmidvRRNSIkeLTNVIQAYP----SRYVGFgNVPV--------   94
ident                      |                      |               
Sbjct --------------------cRGIGR--DPVKLRRISaetgVQVVXG-AGYYlassxpet  143
DSSP  --------------------lLLLLL--LHHHHHHHHhhhlLEEEEL-LLLLlhhhllhh


DSSP  --lLLHHHHHHHHHHHLLL------LLLLEEEEELLLLL---LHHH-HHHHHHHHHHLlL
Query --gLSENDTNSYIEENIVN------NKLVGIGELTPASG---QIKS-LKPIFKYSMDSgS  142
ident    ||  |    |                 |||    |         |            
Sbjct aarLSADDIADEIVAEALEgtdgtdARIGLIGEIGVSSDftaEEEKsLRGAARAQVRT-G  202
DSSP  hhlLLHHHHHHHHHHHHHLllllllLLLLLEEEELLLLLllhHHHHhHHHHHHHHHHH-L


DSSP  LLEEELL-LLLLlhhHHHHHHHHHHHLLLL--LEEEHHHhHHHH---HHHHHHHHHLllE
Query LPIWIHA-FNPLvlqDIKEIAELCKAFPKV--PVILGHMgGSNW---MTAVELAKEIqnL  196
ident ||   |                |            | |              ||      
Sbjct LPLXVHLpGWFR---LAHRVLDLVEEEGADlrHTVLCHX-NPSHxdpVYQATLAQRG--A  256
DSSP  LLEEELLlLLLL---LHHHHHHHHHHLLLLhhHEEELLL-HHHLllhHHHHHHHHHL--L


DSSP  EEELLLL-------------LLHHHHHHHHHH-----LLLLEELLLLLLL---------L
Query YLDTSAY-------------FSTFVLKIVINE-----LPLKCIFGTDMPF---------G  229
ident  |                   |       |                |             
Sbjct FLEFDXIgxdffyadqgvqcPSDDEVARAILGladhgYLDRILLSHDVFVkxxltryggN  316
DSSP  EEEELLLlllleelllleelLLHHHHHHHHHHhhhllLHHHEEELLLLLLhhhlhhhllL


DSSP  LHHHHH-HHHHHHL---LLHHHHHHHHLHHHHHHHL-----l
Query DLQLSI-EAIKKMS---NDSYVANAVLGDNISRLLN-----i  262
ident                   |          |  |         
Sbjct GYAFVTkHFLPRLRrhgLDDAALETLXVTNPRRVFDasiegh  358
DSSP  LLLHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHHLllllll


No 23: Query=3cjpA Sbjct=4dziC Z-score=16.8

back to top
DSSP  ----LLEEEEEEL-----------------------------------------------
Query ----LIIDGHTHV-----------------------------------------------    9
ident       ||   |                                                
Sbjct alnyRVIDVDNHYyepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  llllLEEEEEEELllllllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  ------------------------------------LLLHHHHHHHHHHHLLLEEEEELL
Query ------------------------------------ILPVEKHIKIMDEAGVDKTILFST   33
ident                                            |  |||          |
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIETAFMLPT  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEEEEEEELL


DSSP  LLlhhhlllhhhhhhhhhhhhhhhllLLLL--------LHHHHHHHHHHHHHHHH--HLL
Query SIhpetavnlrdvkkemkklndvvngKTNS--------MIDVRRNSIKELTNVIQ--AYP   83
ident                                                  |          
Sbjct FG-----------------------cGVEEalkhdieaTMASVHAFNLWLDEDWGfdRPD  157
DSSP  HH-----------------------hHHHHhllllhhhHHHHHHHHHHHHHHHLLllLLL


DSSP  LLEEEEELLLLLLlHHHHHHHHHHhLLLLLLLEEEeELLLL-------LLHHH--HHHHH
Query SRYVGFGNVPVGLsENDTNSYIEEnIVNNKLVGIGeLTPAS-------GQIKS--LKPIF  134
ident  |      |                             ||                 |  
Sbjct HRIIAAPIVSLAD-PTRAVEEVDF-VLARGAKLVL-VRPAPvpglvkpRSLGDrsHDPVW  214
DSSP  LLEEELLLLLLLL-HHHHHHHHHH-HHHLLLLLEE-LLLLLlllllllLLLLLhhHHHHH


DSSP  HHHHHlLLLLEEEL------------------------llLLLLHHHHHHHH--HHHHHL
Query KYSMDsGSLPIWIH------------------------afNPLVLQDIKEIA--ELCKAF  168
ident          |   |                                              
Sbjct ARLAE-AGVPVGFHlsdsgylhiaaawggakdpldqvlldDRAIHDTMASMIvhGVFTRH  273
DSSP  HHHHH-HLLLEEEEllllllhhhhhhllllllhhhhhhhlLHHHHHHHHHHHhlLHHHHL


DSSP  LLLLEEEH-HHHHhHHHH-------------------hhHHHHhlLLEEEELlLLLLhhH
Query PKVPVILG-HMGGsNWMT-------------------avELAKeiQNLYLDTsAYFStfV  208
ident ||                                     |      |       |     
Sbjct PKLKAVSIeNGSY-FVHRlikrlkkaantqpqyfpedpvEQLR--NNVWIAP-YYED--D  327
DSSP  LLLLEEEElLLLL-HHHHhhhhhhhhhhhlhhhllllhhHHHH--HHEEELL-LLLL--L


DSSP  HHHHHHH-LLLLEELLLLLLL--LLHHhHHHHhHHHL--LLHHHHHHHHLHHHHHHHL--
Query LKIVINE-LPLKCIFGTDMPF--GDLQlSIEAiKKMS--NDSYVANAVLGDNISRLLN--  261
ident |          |  || | |   |                          ||   ||   
Sbjct LPELARViGVDKILFGSDWPHgeGLAS-PVSF-TAELkgFSESDIRKIMRDNALDLLGvq  385
DSSP  HHHHHHHhLHHHLLLLLLLLLllLLLL-HHHH-HHHHllLLHHHHHHHHLHHHHHHHLll


DSSP  --l
Query --i  262
ident    
Sbjct vgs  388
DSSP  lll


No 24: Query=3cjpA Sbjct=3mtwA Z-score=16.7

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------LI    2
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EEEEEELL-------------------LLHHHHHHHHHHHLLLEEEEELLlllhhhlllh
Query IDGHTHVI-------------------LPVEKHIKIMDEAGVDKTILFSTsihpetavnl   43
ident || | |                            |   |||                   
Sbjct IDMHVHLDslaevggynsleysdrfwsVVQTANAKKTLEAGFTTVRNVGA----------  110
DSSP  EEEEELLLllllllhhhhhhllhhhhhHHHHHHHHHHHHLLEEEEEELLL----------


DSSP  hhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHLL------lLEEEE-ELLLL--
Query rdvkkemkklndvvngktnsmidvrrnSIKELTNVIQAYP------sRYVGF-GNVPV--   94
ident                                      |         | |          
Sbjct ---------------------------ADYDDVGLREAIDagyvpgpRIVTAaISFGAtg  143
DSSP  ---------------------------LLLHHHHHHHHHHlllllllEEEELlLLEELll


DSSP  -------------------LLLHHHHHHHHHHhLLLLLLLEEEeELLL-----------L
Query -------------------GLSENDTNSYIEEnIVNNKLVGIGeLTPA-----------S  124
ident                      |                   |                  
Sbjct ghcdstffppsmdqknpfnSDSPDEARKAVRT-LKKYGAQVIX-ICATggvfsrgnepgQ  201
DSSP  lllllllllhhhlllllllLLLHHHHHHHHHH-HHHLLLLEEE-EELLlllllllllllL


DSSP  LLHH--HHHHHHHHHHHLLlLLEEELLLlllLHHHHHHHHHHHhhlllllEEEHHhHHHH
Query GQIK--SLKPIFKYSMDSGsLPIWIHAFnplVLQDIKEIAELCkafpkvpVILGHmGGSN  182
ident  |      |         |      ||        | |                |     
Sbjct QQLTyeEMKAVVDEAHMAG-IKVAAHAH---GASGIREAVRAG------vDTIEH-ASLV  250
DSSP  LLLLhhHHHHHHHHHHHLL-LEEEEEEL---LHHHHHHHHHLL------lLEEEE-LLLL


DSSP  HHHHHHHHHHLlLEEEELLL---------------------------lLLHHHHHHHHHH
Query WMTAVELAKEIqNLYLDTSA---------------------------yFSTFVLKIVINE  215
ident       ||      |                                             
Sbjct DDEGIKLAVQK-GAYFSMDIyntdytqaegkkngvlednlrkdrdigeLQRENFRKALKA  309
DSSP  LHHHHHHHHHH-LLEEELLLllhhhhhhhhhhhlllhhhhhhhhhhhhHHHHHHHHHHHH


DSSP  LllLEELLLLLLLL---LHHHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL----------
Query LplKCIFGTDMPFG---DLQLSIEAIKKMSNDSYVANAVLGDNISRLLNI----------  262
ident    |   |||       |                 |           |            
Sbjct G-vKMVYGTDAGIYphgDNAKQFAVMVRYGATPLQAIQSATLTAAEALGRskdvgqvavg  368
DSSP  L-lEEELLLLLLLLlllLHHHHHHHHHHLLLLHHHHHHHLLHHHHHHHLLllllllllll


DSSP  ------------------------------------
Query ------------------------------------  262
ident                                     
Sbjct rygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  lllleeeelllllllhhhhhllleeeelleeeelll


No 25: Query=3cjpA Sbjct=2vc5A Z-score=16.7

back to top
DSSP  ----------------LLEEEEEELL--------------------LLHHHHHHHHHHHL
Query ----------------LIIDGHTHVI--------------------LPVEKHIKIMDEAG   24
ident                      | |                             |     |
Sbjct mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeefRNAVNEVKRAMQFG   60
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhHHHHHHHHHHHHLL


DSSP  LLEEEEELllllhhhlllhhhhhhhhhhhhhhhlllllllhhhHHHHHHhhHHHHHHLL-
Query VDKTILFStsihpetavnlrdvkkemkklndvvngktnsmidvRRNSIKelTNVIQAYP-   83
ident |                                                           
Sbjct VKTIVDPT----------------------------------vMGLGRD--IRFMEKVVk   84
DSSP  LLEEEELL----------------------------------lLLLLLL--HHHHHHHHh


DSSP  ---LLEEEEELLLL---------llLHHHHHHHHHHHLLLL------LLLEEEeELLLLL
Query ---SRYVGFGNVPV---------glSENDTNSYIEENIVNN------KLVGIGeLTPASG  125
ident       |                  |           |         |            
Sbjct atgINLVAGTGIYIyidlpfyflnrSIDEIADLFIHDIKEGiqgtlnKAGFVX-IAADEP  143
DSSP  lllLEEEELEELLLlllllhhhlllLHHHHHHHHHHHHHLLllllllLLLLEE-EELLLL


DSSP  L----HHHH-HHHHHHHHhLLLLLEEELLLLllLHHHHHHHHHHHHHLLLL--LEEEHHH
Query Q----IKSL-KPIFKYSMdSGSLPIWIHAFNplVLQDIKEIAELCKAFPKV--PVILGHM  178
ident                        ||  |           |                 || 
Sbjct GitkdVEKViRAAAIANK-ETKVPIITHSNA--HNNTGLEQQRILTEEGVDpgKILIGHL  200
DSSP  LllhhHHHHhHHHHHHHH-HHLLLEEEELLL--LLLHHHHHHHHHHHLLLLhhHEEELLH


DSSP  -hHHHHHHHHHHHHHLllEEEELLLL---------LLHHHHHHHHH-HLLLLEELLLLLL
Query -gGSNWMTAVELAKEIqnLYLDTSAY---------FSTFVLKIVIN-ELPLKCIFGTDMP  227
ident     |       |            |                  |      |     |  
Sbjct gdTDNIDYIKKIADKG--SFIGLDRYgldlflpvdKRNETTLRLIKdGYSDKIMISHDYC  258
DSSP  hhLLLHHHHHHHHHLL--LEEEELLLlllllllhhHHHHHHHHHHHlLLLLLEEELLLLL


DSSP  ------------------lLLHHHHH-HHHHHH---lLLHHHHHHHHLHHHHHHHLl
Query ------------------fGDLQLSI-EAIKKM---sNDSYVANAVLGDNISRLLNi  262
ident                        |     |           |       |       
Sbjct ctidwgtakpeykpklaprWSITLIFeDTIPFLkrngVNEEVIATIFKENPKKFFS-  314
DSSP  lllllllllhhhhhhhlllLLLLHHHhLHHHHHhlllLLHHHHHHHHLHHHHHHLL-


No 26: Query=3cjpA Sbjct=1onxA Z-score=16.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --LLEEEEEELL------------LLHHhhHHHHHHHLLLEEEEELLLLlhhhlllhhhh
Query --LIIDGHTHVI------------LPVEkhIKIMDEAGVDKTILFSTSIhpetavnlrdv   46
ident     || | | |              |        ||||                     
Sbjct cpGFIDQHVHLIggggeagpttrtPEVA--LSRLTEAGVTSVVGLLGTD-----------  107
DSSP  eeLEEEEEELLLlllllllhhhllLLLL--HHHHHHLLEEEEEELLLLL-----------


DSSP  hhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHLL---LLEEEEEL-LLLLllhhhhh
Query kkemkklndvvngktnsmidvrrNSIKELTNVIQAYP---SRYVGFGN-VPVGlsendtn  102
ident                             |     |                |        
Sbjct --------------------sisRHPESLLAKTRALNeegISAWMLTGaYHVP--srtit  145
DSSP  --------------------lllLLHHHHHHHHHHHHhhlLEEEEEEElLLLL--lllll


DSSP  HHHHHHLLLLL-LLEEEeELLLL----lLHHH-HHHHHHHHHHLL-----LLLEEELLlL
Query SYIEENIVNNK-LVGIGeLTPAS----gQIKS-LKPIFKYSMDSG-----SLPIWIHAfN  151
ident    |          |                  |      |   |           |   
Sbjct GSVEKDVAIIDrVIGVX-CAISDhrsaaPDVYhLANMAAESRVGGllggkPGVTVFHM-G  203
DSSP  LLHHHHHHHLLlEEEEE-EEELLlllllLLHHhHHHHHHHHHHHHhhhllLLEEEEEE-L


DSSP  LLLhHHHHHHHHHHH--HLLLLLEEEHHHHHH--HHHHHHHHHHHLllEEEELL-LLLLh
Query PLVlQDIKEIAELCK--AFPKVPVILGHMGGS--NWMTAVELAKEIqnLYLDTS-AYFSt  206
ident          |  |      |       |          | | |        |        
Sbjct DSK-KALQPIYDLLEncDVPISKLLPTHVNRNvpLFEQALEFARKG--GTIDITsSIDEp  260
DSSP  LLL-LLLHHHHHHHHllLLLHHHEEEELHHHLhhHHHHHHHHHHLL--LLEEEElLLLLl


DSSP  HHHHHHHHHL------LLLEELLLLLLL----------------LLHHhHHHHHHHHL--
Query FVLKIVINEL------PLKCIFGTDMPF----------------GDLQlSIEAIKKMS--  242
ident       |                 |                                   
Sbjct VAPAEGIARAvqagipLARVTLSSDGNGsqpffddegnlthigvAGFE-TLLETVQVLvk  319
DSSP  LLHHHHHHHHhhllllHHHEEEELLLLLeeeeellllleeeeeeLLLH-HHHHHHHHHhh


DSSP  ---LLHHHHHHHHLHHHHHHHLL-------------------------------------
Query ---NDSYVANAVLGDNISRLLNI-------------------------------------  262
ident         |   |       ||                                      
Sbjct dydFSISDALRPLTSSVAGFLNLtgkgeilpgndadllvmtpelrieqvyargklmvkdg  379
DSSP  hhlLLHHHHHHHHLHHHHHHLLLllllllllllllleeeellllleeeeeelleeeeell


DSSP  -----------
Query -----------  262
ident            
Sbjct kacvkgtfetd  390
DSSP  eelllllllll


No 27: Query=3cjpA Sbjct=1yrrB Z-score=16.5

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------LIIDGHTH    8
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  --------------llLLHHHHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhh
Query --------------viLPVEKHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkkln   54
ident                    |   |     |                              
Sbjct gcggvqfndtaeavsvETLEIMQKANEKSGCTNYLPTLIT--------------------  100
DSSP  eelleelllllllllhHHHHHHHHHHHLLLEEEEEEEELL--------------------


DSSP  hhhlllllLLHHHHHHHHHHHHHHHHHLLLLEEE-EELLLLlllhHHHHHHHHHHLllLL
Query dvvngktnSMIDVRRNSIKELTNVIQAYPSRYVG-FGNVPVglseNDTNSYIEENIvnNK  113
ident                             |    |     |             ||     
Sbjct --------TSDELMKQGVRVMREYLAKHPNQALGlHLEGPW--lnAALVDFLCENA--DV  148
DSSP  --------LLHHHHHHHHHHHHHHHHHLLLLLLLeEEELLL--llLHHHHHHHHLH--HH


DSSP  LLEeEEELlllllHHHHHHHHHHHHHLLlLLEEELLlllLLHHhHHHHHHHHHHlllLLE
Query LVGiGELTpasgqIKSLKPIFKYSMDSGsLPIWIHAfnpLVLQdIKEIAELCKAfpkVPV  173
ident       |                    |                 ||      |      
Sbjct ITK-VTLA----pEMVPAEVISKLANAG-IVVSAGH---SNAT-LKEAKAGFRA---GIT  195
DSSP  EEE-EEEL----hHHLLHHHHHHHHHHL-LEEEELL---LLLL-HHHHHHHHHH---LEE


DSSP  EEHHHHH-HHHH-----HHHHHHHHLLLEEEELL---lLLLHHHHHHHHHHLLLLEELLL
Query ILGHMGG-SNWM-----TAVELAKEIQNLYLDTS---aYFSTFVLKIVINELPLKCIFGT  224
ident    |                         |                        |    |
Sbjct FATHLYNaMPYItgrepGLAGAILDEADIYCGIIadglHVDYANIRNAKRLKGDKLCLVT  255
DSSP  EELLLLLlLLLLlllllHHHHHHHHLLLLEEEEEllllLLLHHHHHHHHHHHHHHEEEEL


DSSP  LLL--LLLH-HHHHHHHHH-HLLLHHHHHHHHLHHHHHHHLL------------------
Query DMP--FGDL-QLSIEAIKK-MSNDSYVANAVLGDNISRLLNI------------------  262
ident |                                    |                      
Sbjct DATsgSSLTmIEGVRNLVEhCGIALDEVLRMATLYPARAIGVekrlgtlaagkvanltaf  315
DSSP  LLLllLLLLhHHHHHHHHHhHLLLHHHHHHHHLHHHHHHLLLlllllllllllllleeee


DSSP  -------------------
Query -------------------  262
ident                    
Sbjct tpdfkitktivngnevvtq  334
DSSP  llllleeeeeelleeeeel


No 28: Query=3cjpA Sbjct=3griA Z-score=16.3

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------LIIDGHTH    8
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  LL-------LLHHHHHHHHHHHLLLEEEEELLLLlhhhlllhhhhhhhhhhhhhhhllll
Query VI-------LPVEKHIKIMDEAGVDKTILFSTSIhpetavnlrdvkkemkklndvvngkt   61
ident             |   |     |                                     
Sbjct LRepggeykETIETGTKAAARGGFTTVCPXPNTR--------------------------   94
DSSP  LLlllllllLLHHHHHHHHHHLLEEEEEELLLLL--------------------------


DSSP  lllhhhHHHHHHHHHHHHHHLL-LLEEEEELLL----LLLLhhhhhhHHHHhLLLLLLLE
Query nsmidvRRNSIKELTNVIQAYP-SRYVGFGNVP----VGLSendtnsYIEEnIVNNKLVG  116
ident              |   |      |                            |      
Sbjct --pvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKEL-----vDFPA-LVKEGAFA  146
DSSP  --llllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLLL-----lLHHH-HHLLLLLL


DSSP  EEeELLL-lLLHHHHHHHHHHHHHLlLLLEEELLLLL-----------------------
Query IGeLTPA-sGQIKSLKPIFKYSMDSgSLPIWIHAFNP-----------------------  152
ident                              |  |                           
Sbjct FT-DDGVgvQTASXXYEGXIEAAKV-NKAIVAHCEDNsliyggaxhegkrskelgipgip  204
DSSP  EE-ELLLllLLHHHHHHHHHHHHHH-LLLEEELLLLHhhllllleellhhhhhhllleel


DSSP  --LLHHHHHHHHHHHHHLLlLLEEEHHHHhhhHHHHHHHHHHLL----LEEEELL-LLLL
Query --LVLQDIKEIAELCKAFPkVPVILGHMGgsnWMTAVELAKEIQ----NLYLDTS-AYFS  205
ident        |     |  |         |         |                       
Sbjct niCESVQIARDVLLAEAAG-CHYHVCHVS---TKESVRVIRDAKragiHVTAEVTpHHLL  260
DSSP  lhHHHHHHHHHHHHHHHHL-LLEEELLLL---LHHHHHHHHHHHhlllLEEEEELhHHHH


DSSP  ------------------------HHHHHHHHHHLllLEELLLLLL--------------
Query ------------------------TFVLKIVINELplKCIFGTDMP--------------  227
ident                            |              ||                
Sbjct lteddipgnnaiykxnpplrstedREALLEGLLDG-tIDCIATDHAphardekaqpxeka  319
DSSP  llhhhlllllhhhllllllllhhhHHHHHHHHHLL-lLLEELLLLLlllhhhhlllllll


DSSP  ---LLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL-----------------
Query ---FGDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI-----------------  262
ident                                 |        |                  
Sbjct pfgIVGSETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLeygtlkengyadltiid  379
DSSP  lllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllllllleeeee


DSSP  -------------------------------------------
Query -------------------------------------------  262
ident                                            
Sbjct ldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  lllleellhhhllllllllllllleelleeeeeeelleeeeel


No 29: Query=3cjpA Sbjct=1k6wA Z-score=16.3

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------LIIDGHTH    8
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL


DSSP  LL------------------------------------LLHHHHHHHHHHHLLLEEEEEL
Query VI------------------------------------LPVEKHIKIMDEAGVDKTILFS   32
ident                                              |     |        
Sbjct LDttqtagqpnwnqsgtlfegierwaerkallthddvkQRAWQTLKWQIANGIQHVRTHV  120
DSSP  LLlllllllllllllllhhhhhhhhhllhhhllhhhhhHHHHHHHHHHHHLLEEEEEEEE


DSSP  LlllhhhlllhhhhhhhhhhhhhhhllllllLHHHhHHHHHHHHHHHHHLL--LLEEEEE
Query TsihpetavnlrdvkkemkklndvvngktnsMIDVrRNSIKELTNVIQAYP--SRYVGFG   90
ident                                         |    | |            
Sbjct D-----------------------------vSDAT-LTALKAMLEVKQEVApwIDLQIVA  150
DSSP  E-----------------------------lLLLL-LHHHHHHHHHHHHHLllLEEEEEE


DSSP  LL--LLLLlhhHHHHHHHHHLlLLLLLEEEeELLL----LLLHHHH-HHHHHHHHHLLlL
Query NV--PVGLsenDTNSYIEENIvNNKLVGIGeLTPA----SGQIKSL-KPIFKYSMDSGsL  143
ident                  ||          |   |                |         
Sbjct FPqeGILS-ypNGEALLEEAL-RLGADVVG-AIPHfeftREYGVESlHKTFALAQKYD-R  206
DSSP  ELllLLLL-llLHHHHHHHHH-HLLLLEEE-ELHHhlllHHHHHHHhHHHHHHHHHHL-L


DSSP  LEEE-LLLL-llLHHHHHHHHHHHHHLLL-lLEEEHHhHHHHHHH-------hHHHHHHL
Query PIWI-HAFN-plVLQDIKEIAELCKAFPK-vPVILGHmGGSNWMT-------aVELAKEI  193
ident  |                  | |         |   |                  | |  
Sbjct LIDVhCDEIddeQSRFVETVAALAHHEGMgaRVTASH-TTAMHSYngaytsrlFRLLKMS  265
DSSP  EEEEeELLLlllLLLHHHHHHHHHHHHLLhhHEEEEE-LHHHHHLlhhhhhhhHHHHHHH


DSSP  LlEEEELL--LLLL----------HHHHhhHHHHLL---LLEELLLLLLL------LLHH
Query QnLYLDTS--AYFS----------TFVLkiVINELP---LKCIFGTDMPF------GDLQ  232
ident                                  |         || |  |      |   
Sbjct G-INFVANplVNIHlqgrfdtypkRRGI-tRVKEMLesgINVCFGHDDVFdpwyplGTAN  323
DSSP  L-LEEEELhhHHHHhlllllllllLLLL-lLHHHHHhllLLEEELLLLLLllllllLLLL


DSSP  --HHHHHHHHHL------LLHHhHHHHHLHHHHHHHLL----------------------
Query --LSIEAIKKMS------NDSYvANAVLGDNISRLLNI----------------------  262
ident                                  | ||                       
Sbjct mlQVLHMGLHVCqlmgygQIND-GLNLITHHSARTLNLqdygiaagnsanliilpaengf  382
DSSP  hhHHHHHHHHHLllllhhHHHH-HHHHHLHHHHHHLLLlllllllllllleeeellllhh


DSSP  -----------------------------------------
Query -----------------------------------------  262
ident                                          
Sbjct dalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  hhhhhllllleeeelleeeeellllleeeellleeeellll


No 30: Query=3cjpA Sbjct=2pajA Z-score=16.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  -LLEEEEEELL-------------------LLHHHHHHHHHHHLLLEEEEELLLllhhhl
Query -LIIDGHTHVI-------------------LPVEKHIKIMDEAGVDKTILFSTSihpeta   40
ident       | |                     |            |                
Sbjct pAWVNTHHHLFqsllkgepfralfderrfrLAARIGLIELARSGCATVADHNYV------  114
DSSP  eLEELLLLLHHhhhllllllhhhllhhhhhHHHHHHHHHHHLLLEEEEEELLLL------


DSSP  llhhhhhhhhhhhhhhhllllllLHHHhhhhhHHHHHHHHHLL---LLEEEEELLLLL--
Query vnlrdvkkemkklndvvngktnsMIDVrrnsiKELTNVIQAYP---SRYVGFGNVPVG--   95
ident                                                | |          
Sbjct ----------------------yYPGM---pfDSSAILFEEAEklgLRFVLLRGGATQtr  149
DSSP  ----------------------lLLLL---llLHHHHHHHHHHhllLEEEEEELLLLLll


DSSP  ------------LLHHHHHHHHHHHlLLLL---------LLEEE-EELLLllLHHHHHHH
Query ------------LSENDTNSYIEENiVNNK---------LVGIG-ELTPAsgQIKSLKPI  133
ident                      ||                 |                   
Sbjct qleadlptalrpETLDAYVADIERL-AARYhdaspramrRVVMApTTVLYsiSPREMRET  208
DSSP  lllllllhhhllLLHHHHHHHHHHH-HHHLlllllllleEEEELlLLLLLllLHHHHHHH


DSSP  HHHHHHLLlLLEEELLLllllHHHHHHHHHHHhhllllLEEEHHHhHHHHHHHHHHHHHL
Query FKYSMDSGsLPIWIHAFnplvLQDIKEIAELCkafpkvPVILGHMgGSNWMTAVELAKEI  193
ident        | |    |              |         |   |           |    
Sbjct AAVARRLG-LRMHSHLS---gKSPVAFCGEHD--wlgsDVWYAHL-VKVDADEIALLAQT  261
DSSP  HHHHHHLL-LEEEEELL---lLLHHHHHHHLL--llllLEEEELL-LLLLHHHHHHHHHH


DSSP  LlEEEELL--LLLLhhhhhhHHHHLL---lLEELLLLLL--LLLH--HHHHHHHHHHL--
Query QnLYLDTS--AYFStfvlkiVINELP---lKCIFGTDMP--FGDL--QLSIEAIKKMS--  242
ident                        |          | |                       
Sbjct G-TGVAHCpqSNGR-----lPVREMAdagvPVSIGVDGAasNEAAdmISEVHMTWLAQra  315
DSSP  L-LEEEELhhHHHL-----lLLLLHHhhllLEEELLLHHhhLLLLlhHHHHHHHHHHHhh


DSSP  --LLHHHHHHHHLHHHHHHHLL--------------------------------------
Query --NDSYVANAVLGDNISRLLNI--------------------------------------  262
ident                  |                                          
Sbjct rlASIAEVIHWGTAGGARVMGLdevgkvavgyaadiavyrlddpryfglhdpaigpvasg  375
DSSP  llLLHHHHHHHHLHHHHHHHLLllllllllllllleeeeelllhhhlllllhhhhhhhll


DSSP  ----------------------------------------------
Query ----------------------------------------------  262
ident                                               
Sbjct grpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  llleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 31: Query=3cjpA Sbjct=3giqA Z-score=16.1

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------LIID    4
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  EEEE-LLLL--HHHHhHHHHHHLLLEEEEE----------------llLLLHHHlllhhh
Query GHTH-VILP--VEKHiKIMDEAGVDKTILF----------------stSIHPETavnlrd   45
ident  | |                  |                                     
Sbjct VHGHdDLMFveKPDL-RWKTSQGITTVVVGncgvsaapaplpgntaaaLALLGE------  113
DSSP  LLLLlLLHHhhLLLL-HHHHLLLEEEEEELllllllllllllllllhhHHHHLL------


DSSP  hhhhhhhhhhhhlllllllhhhhHHHHHHHHHHHH-HLLL-LEEEEELLL----------
Query vkkemkklndvvngktnsmidvrRNSIKELTNVIQ-AYPS-RYVGFGNVP----------   93
ident                                       |                     
Sbjct --------------------tplFADVPAYFAALDaQRPMiNVAALVGHAnlrlaamrdp  153
DSSP  --------------------lllLLLHHHHHHHHHhLLLLlEEEEEEEHHhhhhhhllll


DSSP  ----lllLHHHHHHHHHHhLLLLLLLEEEeELLL----LLLHH-HHHHHHHHHHhLLLLL
Query ----vglSENDTNSYIEEnIVNNKLVGIGeLTPA----SGQIK-SLKPIFKYSMdSGSLP  144
ident                          ||      |           |              
Sbjct qaaptaaEQQAMQDMLQA-ALEAGAVGFS-TGLAyqpgAVAQAaELEGLARVAA-ERRRL  210
DSSP  lllllhhHHHHHHHHHHH-HHHHLLLEEE-EELLlllhHHLLHhHHHHHHHHHH-HLLLE


DSSP  EEELL--LLLLLHHHHHHHHHHHHHLLlLLEEEHHHHHH------HHHHHHHHHHHLL--
Query IWIHA--FNPLVLQDIKEIAELCKAFPkVPVILGHMGGS------NWMTAVELAKEIQ--  194
ident    |       |     |                |                         
Sbjct HTSHIrnEADGVEAAVEEVLAIGRGTG-CATVVSHHKCMmpqnwgRSRATLANIDRAReq  269
DSSP  EEEELllLLLLHHHHHHHHHHHHHHHL-LEEEELLLLLLlhhhllLHHHHHHHHHHHHhl


DSSP  --LEEEELLLLL------------------------------------------------
Query --NLYLDTSAYF------------------------------------------------  204
ident      ||   |                                                 
Sbjct gvEVALDIYPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaa  329
DSSP  llLEEEEELLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhh


DSSP  -------------LHHHHHHHHHHLllLEELLLLLL------LLLHHHHHHHH-HHHL--
Query -------------STFVLKIVINELplKCIFGTDMP------FGDLQLSIEAI-KKMS--  242
ident                   |         |  | |           |  |           
Sbjct rrlapagaiyfamDEDEVKRIFQHP--CCMVGSDGLpndarpHPRLWGSFTRVlGRYVre  387
DSSP  hhhlleeeeeellLHHHHHHHHHLL--LEEELLLLLllllllLLHHHHHHHHHhHHHHhh


DSSP  ---LLHHHHHHHHLHHHHHHHLL-------------------------------------
Query ---NDSYVANAVLGDNISRLLNI-------------------------------------  262
ident         | |       |                                         
Sbjct arlMTLEQAVARMTALPARVFGFaergvlqpgawadvvvfdpdtvadratwdeptlasvg  447
DSSP  lllLLHHHHHHHHLHHHHHHHLLllllllllllllleeeellllllllllllllllllll


DSSP  ----------------------------
Query ----------------------------  262
ident                             
Sbjct iagvlvngaevfpqppadgrpgqvlrax  475
DSSP  eeeeeelleeeellllllllllllllll


No 32: Query=3cjpA Sbjct=2oofA Z-score=16.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --LLEEEEEELLL--------------------------------------------LHH
Query --LIIDGHTHVIL--------------------------------------------PVE   14
ident     || ||| |                                                
Sbjct tpGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  eeLEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhlllllllhhHHHHHHHH
Query KHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkklndvvngktnsmidVRRNSIKE   74
ident    |     ||      |                                        | 
Sbjct PRVKSLIREGVTTVEIKSGY------------------------------glTLEDELKX  150
DSSP  HHHHHHHHHLEEEEEEELLL------------------------------llLHHHHHHH


DSSP  HHHHHHHLL---LLEEEEELLL----------lLLLHHHHH-HHHHHHlLLLL-LLEEEe
Query LTNVIQAYP---SRYVGFGNVP----------vGLSENDTN-SYIEENiVNNK-LVGIGe  119
ident |            |                              |               
Sbjct LRVARRLGEalpIRVKTTLLAAhavppeyrddpDSWVETICqEIIPAA-AEAGlADAVD-  208
DSSP  HHHHHHHHHhllLEEEEEEEEEllllhhhlllhHHHHHHHHhLHHHHH-HHLLlLLEEE-


DSSP  ELLLLL--LHHHHHHHHHHHHHLLlLLEEELL-LLLLLhhhhhHHHHHHhhlLLLLEEEH
Query LTPASG--QIKSLKPIFKYSMDSGsLPIWIHA-FNPLVlqdikEIAELCkafPKVPVILG  176
ident                        | |    |                |            
Sbjct VFCEHIgfSLAQTEQVYLAADQYG-LAVKGHXdQLSNL-----GGSTLA--aNFGALSVD  260
DSSP  EEELLLllLHHHHHHHHHHHHHLL-LEEEEEElLLLLL-----LHHHHH--hHLLLLEEE


DSSP  HhHHHHHHHHHHHHHHLLlEEEELL--LLLL-----hhHHHHHHHHLllLEELLLLLL--
Query HmGGSNWMTAVELAKEIQnLYLDTS--AYFS-----tfVLKIVINELplKCIFGTDMP--  227
ident |                          |                           |    
Sbjct H-LEYLDPEGIQALAHRG-VVATLLptAFYFlketklpPVVALRKAG-vPXAVSSDINpg  317
DSSP  E-LLLLLHHHHHHHHHHL-LEEEELhhHHHHlllllllLHHHHHHLL-lLEEELLLLLll


DSSP  --LLLH-HHHHHHHH--HHLLlHHHHHHHHLHHHHH-HHLL-------------------
Query --FGDL-QLSIEAIK--KMSNdSYVANAVLGDNISR-LLNI-------------------  262
ident                          | |       | |                      
Sbjct taPIVSlRXAXNXACtlFGLT-PVEAXAGVTRHAARaLGEQeqlgqlrvgxladflvwnc  376
DSSP  llLLLLhHHHHHHHHhhHLLL-HHHHHHHLLHHHHHhLLLLllllllllllllleeeell


DSSP  ---------------------------
Query ---------------------------  262
ident                            
Sbjct ghpaelsyligvdqlvsrvvngeetlh  403
DSSP  llllhhhhlllllleeeeeelleelll


No 33: Query=3cjpA Sbjct=3mkvA Z-score=15.9

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------LII    3
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  EEEEELL------------------LLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhh
Query DGHTHVI------------------LPVEKHIKIMDEAGVDKTILFSTsihpetavnlrd   45
ident | | ||                   |        |   |                     
Sbjct DLHVHVVaiefnlprvatlpnvlvtLRAVPIMRAMLRRGFTTVRDAGG------------  108
DSSP  EEEELLLlllllhhhhllllhhhhhHHHHHHHHHHHHLLEEEEEELLL------------


DSSP  hhhhhhhhhhhhlllllllhhhhhhhhhhHHHHHHHLL------lLEEEEE-LLLLL---
Query vkkemkklndvvngktnsmidvrrnsikeLTNVIQAYP------sRYVGFG-NVPVG---   95
ident                                   ||         |    |         
Sbjct ----------------------------aGYPFKQAVEsglvegpRLFVSGrALSQTggh  140
DSSP  ----------------------------lLHHHHHHHHlllllllEEEELLlEEELLlll


DSSP  -----------------------------LLHHHHHHHHHHhLLLLLLLEEEeELLL---
Query -----------------------------LSENDTNSYIEEnIVNNKLVGIGeLTPA---  123
ident                                         |         |         
Sbjct adprarsdymppdspcgccvrvgalgrvaDGVDEVRRAVRE-ELQMGADQIX-IMASggv  198
DSSP  llllllllllllllllllllllllleeelLLHHHHHHHHHH-HHHHLLLLEE-EELLlll


DSSP  --------LLLHHH--HHHHHHHHHHLLlLLEEELLLlllLHHHHHHHHHHHhhllllLE
Query --------SGQIKS--LKPIFKYSMDSGsLPIWIHAFnplVLQDIKEIAELCkafpkvPV  173
ident                    |       |      ||        |               
Sbjct asptdpvgVFGYSEdeIRAIVAEAQGRG-TYVLAHAY---TPAAIARAVRCG------VR  248
DSSP  llllllllLLLLLHhhHHHHHHHHHLLL-LLEEEEEL---LHHHHHHHHHLL------LL


DSSP  EEHHhHHHHHHHHHHHHHHLLlEEEELLL---------------------------lLLH
Query ILGHmGGSNWMTAVELAKEIQnLYLDTSA---------------------------yFST  206
ident    | |         |  |    |                                    
Sbjct TIEH-GNLIDDETARLVAEHG-AYVVPTLvtydalasegekyglppesiakiadvhgAGL  306
DSSP  EEEE-LLLLLHHHHHHHHHHL-LEEELLHhhhhhhhhhlllllllhhhhllhhhhhlLHH


DSSP  HHHHHHHHHLllLEELLLLLL---llLHHHHHHHHHHHLlLHHHHHHHHLHHHHHHHLL-
Query FVLKIVINELplKCIFGTDMP---fgDLQLSIEAIKKMSnDSYVANAVLGDNISRLLNI-  262
ident     |       |  ||||                           |         |   
Sbjct HSIEIMKRAG-vKMGFGTDLLgeaqrLQSDEFRILAEVL-SPAEVIASATIVSAEVLGMq  364
DSSP  HHHHHHHHHL-lLLLLLLLLLhhhhhHLLHHHHHHHLLL-LHHHHHHHLLHHHHHHLLLl


DSSP  --------------------------------------------------
Query --------------------------------------------------  262
ident                                                   
Sbjct dklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllleeeellllllllllllllllllleeeelleeeeelll


No 34: Query=3cjpA Sbjct=3ls9A Z-score=15.5

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------LII    3
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  EEEEELL-----------------------------------------LLHHHHHHHHHH
Query DGHTHVI-----------------------------------------LPVEKHIKIMDE   22
ident   | |                                                       
Sbjct NSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAVLLESLL  120
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHHHHHHHH


DSSP  HLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhllllllLHHHhHHHHHHHHHHHHHL
Query AGVDKTILFSTSihpetavnlrdvkkemkklndvvngktnsMIDVrRNSIKELTNVIQAY   82
ident  |                                               |          
Sbjct GGITTVADQHLF---------------------------fpGATA-DSYIDATIEAATDL  152
DSSP  LLEEEEEEEELL---------------------------llLLLL-LLHHHHHHHHHHHH


DSSP  LLLEEEEELLLLL-------------LLHHHHHHHHHHHLLLLL--------LLEEEEEL
Query PSRYVGFGNVPVG-------------LSENDTNSYIEENIVNNK--------LVGIGELT  121
ident   |                                    |                |   
Sbjct GIRFHAARSSMTLgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvRIALGPCG  212
DSSP  LLEEEEEELLLLLlhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleEEEELLLL


DSSP  LLllLHHH-HHHHHHHHHHLLlLLEEELL-LLLLL--------hHHHHHHHH-HHHHlll
Query PAsgQIKS-LKPIFKYSMDSGsLPIWIHA-FNPLV--------lQDIKEIAE-LCKAfpk  170
ident                   |        |                                
Sbjct VP-yDKPElFEAFAQMAADYD-VRLHTHFyEPLDAgmsdhlygmTPWRFLEKhGWAS---  267
DSSP  LL-lLLHHhHHHHHHHHHHHL-LEEEEEElLLLHHhhhhhhhllLHHHHHHHlLLLL---


DSSP  lLEEEHHHhHHHHHHHHHHHHHLLlEEEELL--LLLL--HHHHhhHHHHLL---LLEELL
Query vPVILGHMgGSNWMTAVELAKEIQnLYLDTS--AYFS--TFVLkiVINELP---LKCIFG  223
ident   | | |                                       | |         ||
Sbjct dRVWLAHA-VVPPREEIPEFADAG-VAIAHLiaPDLRmgWGLA--PIREYLdagITVGFG  323
DSSP  lLEEEEEL-LLLLHHHHHHHHHHL-LEEEELhhHHHHllLLLL--LHHHHHhllLEEEEL


DSSP  LLLL--LLLHH--HHHHHHHHH-----------lLLHHHHHHHHLHHHHH--HHLL----
Query TDMP--FGDLQ--LSIEAIKKM-----------sNDSYVANAVLGDNISR--LLNI----  262
ident |                                                           
Sbjct TTGSasNDGGNllGDLRLAALAhrpadpnepekwLSARELLRMATRGSAEclGRPDlgvl  383
DSSP  LLLLllLLLLLhhHHHHHHHHHlhhhllllhhhlLLHHHHHHHLLHHHHHhlLLLLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct eegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladler  443
DSSP  llllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhh


DSSP  ----------
Query ----------  262
ident           
Sbjct ivanttalip  453
DSSP  hhhhhhhhll


No 35: Query=3cjpA Sbjct=4c5yA Z-score=15.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -LLEEEEEELLL---------------------LHHHHHHHHHHHLLLEEEEELLlllhh
Query -LIIDGHTHVIL---------------------PVEKHIKIMDEAGVDKTILFSTsihpe   38
ident     | | |                                    |              
Sbjct pGLWDCHMHFGGdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAG-----  115
DSSP  eLEEEEEELLLLllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLL-----


DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHLL------lLEEEE-EL
Query tavnlrdvkkemkklndvvngktnsmidvrrnsikELTNVIQAYP------sRYVGF-GN   91
ident                                        |  |                 
Sbjct -----------------------------------YGCEVAKAINdgtivgpNVYSSgAA  140
DSSP  -----------------------------------LHHHHHHHHHlllllllEEEELlLE


DSSP  LLLL------------------------------------LLHHHHHHHHHhHLLLLLLL
Query VPVG------------------------------------LSENDTNSYIEeNIVNNKLV  115
ident                                                             
Sbjct LSQTaghgdifalpagevlgsygvmnprpgywgagplciaDGVEEVRRAVR-LQIRRGAK  199
DSSP  EELLllllllllllhhhhhhhhlllllllllllllleeelLLHHHHHHHHH-HHHHHLLL


DSSP  EEEeELLL-----------LLLHH--HHHHHHHHHHhLLLLLEEELLLlllLHHHHHHHH
Query GIGeLTPA-----------SGQIK--SLKPIFKYSMdSGSLPIWIHAFnplVLQDIKEIA  162
ident  |                   |     || |              |         |    
Sbjct VIX-VMASggvmsrddnpnFAQFSpeELKVIVEEAA-RQNRIVSAHVH---GKAGIMAAI  254
DSSP  LEE-EELLlllllllllllLLLLLhhHHHHHHHHHH-HLLLLEEEEEL---LHHHHHHHH


DSSP  HHHhhllllLEEEHHhHHHHHHHHHHHHHHLLlEEEELLL--------------------
Query ELCkafpkvPVILGHmGGSNWMTAVELAKEIQnLYLDTSA--------------------  202
ident             | |          || ||                              
Sbjct KAG------CKSLEH-VSYADEEVWELMKEKG-ILYVATRsvieiflasngeglvkeswa  306
DSSP  HHL------LLEEEE-LLLLLHHHHHHHHHHL-LEEELLHhhhhhhhhhllllllllhhh


DSSP  ------lLLHHHHHHHHHHLllLEELLLLLL-llLHHHHHHHHHH-HLLLHHHHHHHHLH
Query ------yFSTFVLKIVINELplKCIFGTDMP-fgDLQLSIEAIKK-MSNDSYVANAVLGD  254
ident                 |         |||        |               |      
Sbjct klqaladSHLKAYQGAIKAG-vTIALGTDTApggPTALELQFAVErGGMTPLEAIKAATA  365
DSSP  lllhhhhHHHHHHHHHHHLL-lLEELLLLLLlllLLHHHHHHHHHlLLLLHHHHHHHHLL


DSSP  HHHH---HHLL-------------------------------------------------
Query NISR---LLNI-------------------------------------------------  262
ident |                                                           
Sbjct NAPLsvgPQAPltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgig  425
DSSP  LHHHhhhHHLLlllllllllllleeeelllllllhhhhhlhhheeeeeelleeeelllll


DSSP  -----------
Query -----------  262
ident            
Sbjct pwgedarnpfl  436
DSSP  lllllllllll


No 36: Query=3cjpA Sbjct=2ogjA Z-score=15.5

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------LIID    4
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  EEEELLLL----hhhHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlll
Query GHTHVILP----vekHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngk   60
ident  | |                 | ||                                   
Sbjct LHVHIWHGgtdisirPSECGAERGVTTLVDAGS---------------------------   93
DSSP  EEELLLLLlllllllHHHLLHHHLEEEEEEELL---------------------------


DSSP  llllhhhHHHHHHHHHH-HHHHLLLLEEEEELLL------------LLLLhhHHHHHHHH
Query tnsmidvRRNSIKELTN-VIQAYPSRYVGFGNVP------------VGLSenDTNSYIEE  107
ident                    |     |   | |                         | |
Sbjct ------aGEANFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIkdIDLDRILE  147
DSSP  ------lLLLLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHhhLLHHHHHH


DSSP  HLLLLL--LLEEEeELLLL-----LLHHHHHHHHHHHHHLLlLLEEELLlLLLLhhHHHH
Query NIVNNK--LVGIGeLTPAS-----GQIKSLKPIFKYSMDSGsLPIWIHAfNPLVlqDIKE  160
ident     |    ||                   |   |        |   |           |
Sbjct CYAENSehIVGLX-VRASHvitgsWGVTPVKLGKKIAKILK-VPXXVHV-GEPP-aLYDE  203
DSSP  HHHLLLllEEEEE-EEELHhhhllLLLHHHHHHHHHHHHHL-LLEEEEE-LLLL-lLHHH


DSSP  HHHHHhhllLLLEEEHHHHH----HHHH---HHHHHHHHLLLEEEELLL---LLLHHHHH
Query IAELCkafpKVPVILGHMGG----SNWM---TAVELAKEIQNLYLDTSA---YFSTFVLK  210
ident   |             |       |          ||       ||       ||  |  
Sbjct VLEIL----GPGDVVTHCFNgksgSSIXedeDLFNLAERCEGIRLDIGHggaSFSFKVAE  259
DSSP  HHHHL----LLLLEEELLLLllllLLLLllhHHHHHHHHLLLLEEELLLlllLLLHHHHH


DSSP  HHHH-HLLLlEELLLLLL------LLLH-HHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL
Query IVIN-ELPLkCIFGTDMP------FGDL-QLSIEAIKKMSNDSYVANAVLGDNISRLLNI  262
ident   |   |       ||                                    |       
Sbjct AAIArGLLP-FSISTDLHghsxnfPVWDlATTXSKLLSVDXPFENVVEAVTRNPASVIRL  318
DSSP  HHHHlLLLL-LLLLLLLLllllllLLLLhHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct dxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipr  378
DSSP  lllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeelllllll


DSSP  -
Query -  262
ident  
Sbjct a  379
DSSP  l


No 37: Query=3cjpA Sbjct=1j6pA Z-score=15.3

back to top
DSSP  ---------------------------------------------------LLEEEEEEL
Query ---------------------------------------------------LIIDGHTHV    9
ident                                                         ||| 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH


DSSP  L----------------------------------LLHHHHHHHHHHHLLLEEEEELLll
Query I----------------------------------LPVEKHIKIMDEAGVDKTILFSTsi   35
ident                                                 |           
Sbjct PxtllrgvaedlsfeewlfskvlpiedrltekxayYGTILAQXEXARHGIAGFVDXYF--  118
DSSP  HhhhhllllllllhhhhhhllhhhhhllllhhhhhHHHHHHHHHHHLLLEEEEEEEEL--


DSSP  lhhhlllhhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHLlLLEE-EEELLLL
Query hpetavnlrdvkkemkklndvvngktnsmidvrrnSIKELTNVIQAYpSRYV-GFGNVPV   94
ident                                                             
Sbjct -----------------------------------HEEWIAKAVRDF-GXRAlLTRGLVD  142
DSSP  -----------------------------------LHHHHHHHHHHH-LLEEeEEEEELL


DSSP  --LLLHhHHHHHHHHHLLLLL------LLEEEEELLLllLHHHHHHHHHHHHHLlLLLEE
Query --GLSEnDTNSYIEENIVNNK------LVGIGELTPAsgQIKSLKPIFKYSMDSgSLPIW  146
ident   |                         || |   |       ||  |         |  
Sbjct snGDDG-GRLEENLKLYNEWNgfegriFVGFGPHSPYlcSEEYLKRVFDTAKSL-NAPVT  200
DSSP  llLLLL-LHHHHHHHHHHHHLlhhhleEEEEEELLLLllLHHHHHHHHHHHHHH-LLLEE


DSSP  ELLLLL--LLHHhHHHHH-HHHHhllLLLEEEHHHhHHHHHHHHHHHHHlLLEEEELLL-
Query IHAFNP--LVLQdIKEIA-ELCKafpKVPVILGHMgGSNWMTAVELAKEiQNLYLDTSA-  202
ident ||              |     |    |  |  |             |            
Sbjct IHLYETskEEYD-LEDILnIGLK---EVKTIAAHC-VHLPERYFGVLKD-IPFFVSHNPa  254
DSSP  EEELLLllLLLL-LHHHHlLLLL---LLLEEEEEL-LLLLHHHHHHHLL-LLEEEEELHh


DSSP  -----lLLHHHHHHHHHHLllLEELLLLLL--LLLHH--HHHHHHHHHL-------LLHH
Query -----yFSTFVLKIVINELplKCIFGTDMP--FGDLQ--LSIEAIKKMS-------NDSY  246
ident                |     |   |||       |                     |  
Sbjct snlklgNGIAPVQRXIEHG-xKVTLGTDGAasNNSLNlfFEXRLASLLQkaqnprnLDVN  313
DSSP  hhhhllLLLLLHHHHHHLL-lEEEELLLLLllLLLLLhhHHHHHHHHHHhllllllLLHH


DSSP  HHHHHHLHHHHHHHLL--------------------------------------------
Query VANAVLGDNISRLLNI--------------------------------------------  262
ident                                                             
Sbjct TCLKXVTYDGAQAXGFksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfat  373
DSSP  HHHHHHLHHHHHHHLLlllllllllllleeeeelllhhhllhhhhhhhhhhlllllllee


DSSP  ----------------------------------
Query ----------------------------------  262
ident                                   
Sbjct xvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  eelleeeeellllllllhhhhhhhhhhhhhhhhl


No 38: Query=3cjpA Sbjct=3e74A Z-score=15.2

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------LIIDGHTH    8
ident                                                        | |||
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LllLHHHHHHHHHHHLLLEEEEELLLLLhhhlllhhhhhhhhhhhhhhhlllllllhhhh
Query VilPVEKHIKIMDEAGVDKTILFSTSIHpetavnlrdvkkemkklndvvngktnsmidvr   68
ident      |         |    |                                       
Sbjct I--GYETGTRAAAKGGITTXIEXPLNQL--------------------------------   86
DSSP  L--LHHHHHHHHHHLLEEEEEELLLLLL--------------------------------


DSSP  HHHH--HHHHHHHHHL----llLEEEEELLLLlllhhHHHHHHHhHLLLLLLLEEeEELL
Query RNSI--KELTNVIQAY----psRYVGFGNVPVglsenDTNSYIEeNIVNNKLVGIgELTP  122
ident               |            |                        ||      
Sbjct PATVdrASIELKFDAAkgkltiDAAQLGGLVS-----YNIDRLH-ELDEVGVVGF-XCFV  139
DSSP  LLLLlhHHHHHHHHHHllllllEEEELEELLL-----LLLLLHH-HHHHHLLLLE-EEEL


DSSP  lllLHHHHHHHHHHHHHLlLLLEEELLLLL----------------------------lL
Query asgQIKSLKPIFKYSMDSgSLPIWIHAFNP----------------------------lV  154
ident                      |   |  |                               
Sbjct rdvNDWQFFKGAQKLGEL-GQPVLVHCENAlicdelgeeakregrvtahdyvasrpvftE  198
DSSP  lllLHHHHHHHHHHHHHH-LLLEEEELLLHhhhhhhhhhhhhhllllhhhhhhlllhhhH


DSSP  HHHHHHHHHHHHHLLlLLEEEHHHHhhhHHHHHHHHHHLL----LEEEELLlLLLH----
Query LQDIKEIAELCKAFPkVPVILGHMGgsnWMTAVELAKEIQ----NLYLDTSaYFST----  206
ident    |     | |          |         ||                          
Sbjct VEAIRRVLYLAKVAG-CRLHVCHVS---SPEGVEEVTRARqegqDITCESCpHYFVldtd  254
DSSP  HHHHHHHHHHHHHHL-LLEEELLLL---LHHHHHHHHHHHhlllLEEEEELlHHHHllhh


DSSP  ---------------------HHHHHHHHHLllLEELLLLLL-----------------L
Query ---------------------FVLKIVINELplKCIFGTDMP-----------------F  228
ident                                        |                    
Sbjct qfeeigtlakcsppirdlenqKGXWEKLFNG-eIDCLVSDHSpcppexkagnixkawggI  313
DSSP  hhhhhlhhhllllllllhhhhHHHHHHHHLL-lLLEELLLLLlllllllllllllllllL


DSSP  LLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL---------------------
Query GDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI---------------------  262
ident   ||                           |                            
Sbjct AGLQSCXDVXFDEAvqkrgXSLPXFGKLXATNAADIFGLqqkgriapgkdadfvfiqpns  373
DSSP  LLHHHHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLllllllllllllleeeeelll


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  262
ident                                                         
Sbjct syvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  leellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 39: Query=3cjpA Sbjct=1a5kC Z-score=15.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------LLEEEEEELLLLhhHHHHHHHHHLLLEEEEElLLLLHhhlllhhhhhhhhhhh
Query -------LIIDGHTHVILPveKHIKIMDEAGVDKTILFsTSIHPetavnlrdvkkemkkl   53
ident          || | | | |           ||                            
Sbjct egkivtaGGIDTHIHWICP--QQAEEALVSGVTTMVGG-GTGPA----------------  161
DSSP  llleeeeLEEEEEEELLLL--LHHHHHHHHLEEEEEEE-LLLLL----------------


DSSP  hhhhlllllllhhhHHHHHHHHHHHHHHLlLLEEEEELLLLLllhhhHHHHHHHHLlLLL
Query ndvvngktnsmidvRRNSIKELTNVIQAYpSRYVGFGNVPVGlsendTNSYIEENIvNNK  113
ident                   |                 |   |            |      
Sbjct ----agthattctpGPWYISRMLQAADSLpVNIGLLGKGNVS-----QPDALREQV-AAG  211
DSSP  ----hhhhhlllllHHHHHHHHHHHHLLLlLEEEEEEELLLL-----LHHHHHHHH-HHL


DSSP  LLEEEeELLLllLHHH-HHHHHHHHHHLLlLLEEELLlllLLHH---HHHHHHHHHHHLl
Query LVGIGeLTPAsgQIKS-LKPIFKYSMDSGsLPIWIHAfnpLVLQ---DIKEIAELCKAFp  169
ident   |                                |      |                 
Sbjct VIGLE-IHEDwgATPAaIDCALTVADEMD-IQVALHS---DTLNesgFVEDTLAAIGGR-  265
DSSP  LLEEE-EEHHhlLLHHhHHHHHHHHHHHL-LEEEEEL---LLLLlllLHHHHHHHHLLL-


DSSP  llLEEEHHHHHH---hhHHHHHHHHhLLLEEEELLLLLLHH-------------------
Query kvPVILGHMGGS---nwMTAVELAKeIQNLYLDTSAYFSTF-------------------  207
ident        |  |                 |                               
Sbjct --TIHTFHTEGAggghaPDIITACA-HPNILPSSTNPTLPYtlntidehldmlmvchhld  322
DSSP  --LEEELLLLLLlllllLLHHHHHH-LLLEEEEEEHHHLLLlllhhhhhhhhhhhhhlll


DSSP  --------------------HHHHHHHHLLlLEELLLLLLL-LLHHHHHHHHHHHLL---
Query --------------------VLKIVINELPlKCIFGTDMPF-GDLQLSIEAIKKMSN---  243
ident                                      |    |     |           
Sbjct pdiaedvafaesrirretiaAEDVLHDLGA-FSLTSSDSQAmGRVGEVILRTWQVAHrmk  381
DSSP  lllhhhhhlllllllhhhhhHHHHHHHLLL-LLEEELLLLLlLLLLLHHHHHHHHHHhhh


DSSP  ----------------LHHHHHHHHLHHHHHHHLL-------------------------
Query ----------------DSYVANAVLGDNISRLLNI-------------------------  262
ident                       |    |      |                         
Sbjct vqrgalaeetgdndnfRVKRYIAKYTINPALTHGIahevgsievgkladlvvwspaffgv  441
DSSP  hhhlllllllllllhhHHHHHHHLLLHHHHHHLLLlllllllllllllleeeelhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct kpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangva  501
DSSP  llleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct erlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaq  561
DSSP  hhllllleeeellllllllhhhllllllllleeelllllleeelleelllllllllllll


DSSP  -----
Query -----  262
ident      
Sbjct ryflf  566
DSSP  lllll


No 40: Query=3cjpA Sbjct=3icjA Z-score=15.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEEEEEELLL-------------------------------------------------
Query LIIDGHTHVIL-------------------------------------------------   11
ident    | | |                                                    
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   11
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  -------LHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllllll
Query -------PVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngktnsm   64
ident          |         ||      |                                
Sbjct tvkdykhYIESAQEHLLSLGVHSVGFMSV-------------------------------  209
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEEE-------------------------------


DSSP  hhhhhhHHHHHHHHHHH-----LLLLEEEEELLLllllhhhhhhHHHHH---lLLLL---
Query idvrrnSIKELTNVIQA-----YPSRYVGFGNVPvglsendtnsYIEEN---iVNNK---  113
ident         | |                                                 
Sbjct ------GEKALKALFELeregrLKMNVFAYLSPE----------LLDKLeelnLGKFegr  253
DSSP  ------LHHHHHHHHHHhhlllLLLEEEEEELHH----------HHHHHhhhlLLLEell


DSSP  ---LLEEEeELLL-----------------------LLLHH-HHHHHHHHHHHLLlLLEE
Query ---LVGIGeLTPA-----------------------SGQIK-SLKPIFKYSMDSGsLPIW  146
ident      |   |                              |             | |   
Sbjct rlrIWGVX-LFVDgslgartallsepytdnpttsgeLVMNKdEIVEVIERAKPLG-LDVA  311
DSSP  leeEEEEE-EELLlllllllllllllllllllllllLLLLHhHHHHHHHHHLLLL-LEEE


DSSP  ELLLlllLHHHHHHHHHHHHHLLlLLEEEHHhHHHHHHHHHHHHHHLLlEEEELL--LLL
Query IHAFnplVLQDIKEIAELCKAFPkVPVILGHmGGSNWMTAVELAKEIQnLYLDTS--AYF  204
ident  ||                           |          |  ||              
Sbjct VHAI---GDKAVDVALDAFEEAE-FSGRIEH-ASLVRDDQLERIKELK-VRISAQphFIV  365
DSSP  EEEL---LHHHHHHHHHHHHHHL-LLLEEEE-LLLLLHHHHHHHHHHL-LEEEELllHHH


DSSP  L---------------hhHHHHHHHHLllLEELLLLLLLLLHH--HHHHHHHH-------
Query S---------------tfVLKIVINELplKCIFGTDMPFGDLQ--LSIEAIKK-------  240
ident |                  ||        |  | || |        || |          
Sbjct SdwwivnrvgeerakwayRLKTLSSIT--KLGFSTDSPIEPADpwVSIDAAVNryvvdpg  423
DSSP  HlllhhhhhhhhhhhhllLHHHHHHHL--LEEELLLLLLLLLLhhHHHHHHHHlllllhh


DSSP  -HLLLHhHHHHHHLHHHHH--HHLL---------------------
Query -MSNDSyVANAVLGDNISR--LLNI---------------------  262
ident         |            |                        
Sbjct eRVSRE-EALHLYTHGSAQvtLAEDlgklergfraeyiildrdplk  468
DSSP  hLLLHH-HHHHHLLHHHHHhlLLLLllllllllllleeeellllll


No 41: Query=3cjpA Sbjct=1itqA Z-score=14.9

back to top
DSSP  --------------LLEEEEEELL---------------lLHHH------HHHHHHHHLL
Query --------------LIIDGHTHVI---------------lPVEK------HIKIMDEAGV   25
ident                 ||||                               |       |
Sbjct dffrdeaerimrdsPVIDGHNDLPwqlldmfnnrlqderaNLTTlagthtNIPKLRAGFV   60
DSSP  lhhhhhhhhhhlllLEEEEEELHHhhhhhhhllllllhhhLLLLllllllLHHHHHHLLE


DSSP  LEEEEELLLllhhhlllhhhhhhhhhhhhhhhlLLLLL--LHHHHHHHHHHHHHHHH---
Query DKTILFSTSihpetavnlrdvkkemkklndvvnGKTNS--MIDVRRNSIKELTNVIQ---   80
ident                                    |                        
Sbjct GGQFWSVYT-----------------------pCDTQNkdAVRRTLEQMDVVHRMCRmyp   97
DSSP  EEEEEEELL-----------------------lHHHLLllHHHHHHHHHHHHHHHHHhll


DSSP  -HLLL----------------LEEEEELLLLlllhhHHHHHHHHHlLLLLLLEEEEEL--
Query -AYPS----------------RYVGFGNVPVglsenDTNSYIEENiVNNKLVGIGELT--  121
ident                                                             
Sbjct eTFLYvtssagirqafregkvASLIGVEGGH--sidSSLGVLRAL-YQLGMRYLTLTHsc  154
DSSP  lLEEElllhhhhhhhhhllleEEEEEEELHH--hllLLHHHHHHH-HHLLEEEEELLLll


DSSP  ------LLLL---------LHHH--HHHHHHHHHHLlLLLEEELLlllllhhHHHHHHHH
Query ------PASG---------QIKS--LKPIFKYSMDSgSLPIWIHAfnplvlqDIKEIAEL  164
ident                    |  |       |         |                   
Sbjct ntpwadNWLVdtgdsepqsQGLSpfGQRVVKELNRL-GVLIDLAH------vSVATMKAT  207
DSSP  llllllLHHHlllllllllLLLLhhHHHHHHHHHHH-LLEEELLL------lLHHHHHHH


DSSP  HHHLlLLLEEEH-HHHHH-------HHHHHHHHHHHLLlEEEELLL-------------l
Query CKAFpKVPVILG-HMGGS-------NWMTAVELAKEIQnLYLDTSA-------------y  203
ident        |||       |              | |                         
Sbjct LQLS-RAPVIFShSSAYSvcasrrnVPDDVLRLVKQTD-SLVMVNFynnyisctnkanls  265
DSSP  HHHL-LLLLEELlLLLLLlllllllLLHHHHHHHHHHL-LEEEELLlhhhhlllllllhh


DSSP  LLHHHHHHHHHH-LLLLEELLLLLLLL--------LHHHHHHHHHHHL---LLHHHHHHH
Query FSTFVLKIVINE-LPLKCIFGTDMPFG--------DLQLSIEAIKKMS---NDSYVANAV  251
ident      |             || |            |       |                
Sbjct QVADHLDHIKEVaGARAVGFGGDFDGVprvpegleDVSKYPDLIAELLrrnWTEAEVKGA  325
DSSP  HHHHHHHHHHHHlLHHHEEELLLLLLLllllllllLLLLHHHHHHHHHhllLLHHHHHHH


DSSP  HLHHHHHHHL---------------------------------l
Query LGDNISRLLN---------------------------------i  262
ident | ||  |                                     
Sbjct LADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll


No 42: Query=3cjpA Sbjct=2imrA Z-score=14.9

back to top
DSSP  -------------------------------------------------------LLEEE
Query -------------------------------------------------------LIIDG    5
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  EEELL----------------------------LLHHHHHHHHHHHLLLEEEEELLlllh
Query HTHVI----------------------------LPVEKHIKIMDEAGVDKTILFSTsihp   37
ident |||                                           |             
Sbjct HTHLDmsayefqalpyfqwipevvirgrhlrgvAAAQAGADTLTRLGAGGVGDIVW----  116
DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllllhhHHHHHHHHHHHHLLLLLEEEEEL----


DSSP  hhlllhhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHhLLLLE-EEEELLLLLL
Query etavnlrdvkkemkklndvvngktnsmidvrrnSIKELTNVIQaYPSRY-VGFGNVPVGL   96
ident                                                        |    
Sbjct ---------------------------------APEVMDALLA-REDLSgTLYFEVLNPF  142
DSSP  ---------------------------------LHHHHHHHHL-LLLLLeEEEEEELLLL


DSSP  --LHHHHHHHHHHHLLLLL-------LLEEEEELLLllLHHH-HHHHHHHHHHLlLLLEE
Query --SENDTNSYIEENIVNNK-------LVGIGELTPAsgQIKS-LKPIFKYSMDSgSLPIW  146
ident                             |    ||              |      ||  
Sbjct pdKADEVFAAARTHLERWRrlerpglRLGLSPHTPF-tVSHRlMRLLSDYAAGE-GLPLQ  200
DSSP  hhHHHHHHHHHHHHHHHHHlllllleEEEEEELLLL-lLLHHhHHHHHHHHHHH-LLLLE


DSSP  ELLL--LLLL----------------------------------HHHHHHHH--HHHHhl
Query IHAF--NPLV----------------------------------LQDIKEIA--ELCKaf  168
ident ||                                          |               
Sbjct IHVAehPTELemfrtgggplwdnrmpalyphtlaevigrepgpdLTPVRYLDelGVLA--  258
DSSP  EEELllHHHHhhhhhlllllhhhllhhhllllhhhhhlllllllLLHHHHHHhhLLHH--


DSSP  llLLEEEHHhHHHHHHHHHHHHHHLLlEEEELL--LLLL----HHHHHHHHHHLllLEEL
Query pkVPVILGHmGGSNWMTAVELAKEIQnLYLDTS--AYFS----TFVLKIVINELplKCIF  222
ident       | |                      |           ||               
Sbjct --ARPTLVH-MVNVTPDDIARVARAG-CAVVTCprSNHHlecgTFDWPAFAAAG-vEVAL  313
DSSP  --HLLEEEE-LLLLLHHHHHHHHHHL-LLEEELhhHHHHllllLLLHHHHHHLL-lLEEE


DSSP  LLLLL-LLLH---HHHHHHHHHHL--LLHHHHHHHHLHHHHHHHLL--------------
Query GTDMP-FGDL---QLSIEAIKKMS--NDSYVANAVLGDNISRLLNI--------------  262
ident |||    |                   |  |          |                  
Sbjct GTDSVaSGETlnvREEVTFARQLYpgLDPRVLVRAAVKGGQRVVGTpflrrgetwqegfr  373
DSSP  LLLLHhHHLLlllHHHHHHHHHHLllLLHHHHHHHHHHHHHHHHLLllllllllllhhhl


DSSP  -------
Query -------  262
ident        
Sbjct welsrdl  380
DSSP  hhhllll


No 43: Query=3cjpA Sbjct=1a4mA Z-score=14.5

back to top
DSSP  ------LLEEEEEEL---------------------------------------------
Query ------LIIDGHTHV---------------------------------------------    9
ident            | |                                              
Sbjct tpafnkPKVELHVHLdgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
DSSP  llllllLEEEEEEEHhhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl


DSSP  ----------------lLLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhh
Query ----------------iLPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkkl   53
ident                               ||                            
Sbjct kfdyympviagcreaikRIAYEFVEMKAKEGVVYVEVRYS--------------------  100
DSSP  lhhhhhhhhlllhhhhhHHHHHHHHHHHHLLEEEEEEEEL--------------------


DSSP  hhhhllllllLHHH-----------------HHHHHHHHHHHHHHLL----LLEEEEELL
Query ndvvngktnsMIDV-----------------RRNSIKELTNVIQAYP----SRYVGFGNV   92
ident                                            |                
Sbjct ---------pHLLAnskvdpmpwnqtegdvtPDDVVDLVNQGLQEGEqafgIKVRSILCC  151
DSSP  ---------lHHHLlllllllhhhlllllllHHHHHHHHHHHHHHHHhhhlLEEEEEEEE


DSSP  L-LLLLhhHHHHHHHhHLLLLL---LLEEEEELLLL--LLHHH--HHHHHHHHHHLLlLL
Query P-VGLSenDTNSYIEeNIVNNK---LVGIGELTPAS--GQIKS--LKPIFKYSMDSGsLP  144
ident      |        |           |           |                 |   
Sbjct MrHQPS--WSLEVLE-LCKKYNqktVVAMDLAGDETieGSSLFpgHVEAYEGAVKNG-IH  207
DSSP  ElLLHH--HHHHHHH-HHHHLLlllEEEEEEELLLLllLHHHLhhHHHHHHHHHHHL-LE


DSSP  EEELLLLLLLHHHHHHHHHHhhhlllLLEEEHHhHHHHHHH--HHHHHHHLLlEEEELL-
Query IWIHAFNPLVLQDIKEIAELckafpkVPVILGHmGGSNWMT--AVELAKEIQnLYLDTS-  201
ident    ||          |               || |                         
Sbjct RTVHAGEVGSPEVVREAVDI-----lKTERVGH-GYHTIEDeaLYNRLLKEN-MHFEVCp  260
DSSP  EEEEELLLLLHHHHHHHHHL-----lLLLEEEE-LHHHHHLhhHHHHHHHLL-LEEEELh


DSSP  -LLLL--------HHHHHHHHHHLLlLEELLLLLLL---LLHHHHHHHHH-HHLLLHHHH
Query -AYFS--------TFVLKIVINELPlKCIFGTDMPF---GDLQLSIEAIK-KMSNDSYVA  248
ident              |       |         || |      |       |  |       
Sbjct wSSYLtgawdpktTHAVVRFKNDKA-NYSLNTDDPLifkSTLDTDYQMTKkDMGFTEEEF  319
DSSP  hHHHHllllllllLLHHHHHHHLLL-LEEELLLLLLlllLLHHHHHHHHHhLLLLLHHHH


DSSP  HHHhLHHHHHHHLL-----------------
Query NAVlGDNISRLLNI-----------------  262
ident       |                        
Sbjct KRL-NINAAKSSFLpeeekkellerlyreyq  349
DSSP  HHH-HHHHHHLLLLlhhhhhhhhhhhhhhll


No 44: Query=3cjpA Sbjct=1j5sA Z-score=13.7

back to top
DSSP  -------------------------LLEEEEEELL-LLHH--------------------
Query -------------------------LIIDGHTHVI-LPVE--------------------   14
ident                           | | | |                           
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLDaKDIVenkpwndiwevegatdhyvw   60
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLLhHHHHhllllllhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   14
ident                                                             
Sbjct elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh


DSSP  ---------------HHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhhhhhhhhhll
Query ---------------KHIKIMDEAGVDKTILFStsihpetavnlrdvkkemkklndvvng   59
ident                   |      |                                  
Sbjct aeeiweetkkklpemTPQKLLRDMKVEILCTTD---------------------------  153
DSSP  hhhhhhhhhhhllllLHHHHHHHLLEEEEELLL---------------------------


DSSP  lllllhhhhhhHHHHhhHHHHHLL-----LLEEEEELL--LLLL----------------
Query ktnsmidvrrnSIKEltNVIQAYP-----SRYVGFGNV--PVGL----------------   96
ident                                                             
Sbjct ---------dpVSTL--EHHRKAKeavegVTILPTWRPdrAMNVdkegwreyvekmgery  202
DSSP  ---------llLLLL--HHHHHHHhhlllLEEELLLLLhhHHLLllllhhhhhhhhhhhh


DSSP  -----lhHHHHHHHHHHLLLLL---LLEEeEELLlLLLHH--------------------
Query -----seNDTNSYIEENIVNNK---LVGIgELTPaSGQIK--------------------  128
ident                      |    |                                 
Sbjct gedtstlDGFLNALWKSHEHFKehgCVAS-DHAL-LEPSVyyvdenraravhekafsgek  260
DSSP  llllllhHHHHHHHHHHHHHHHlllLLEE-EEEE-LLLLLllllhhhhhhhhhhhlllll


DSSP  ------------HHHHHHHHHHhLLLLLEEELLLLL---------------------llH
Query ------------SLKPIFKYSMdSGSLPIWIHAFNP---------------------lvL  155
ident                   |            |                           |
Sbjct ltqdeindykafMMVQFGKMNQ-ETNWVTQLHIGALrdyrdslfktlgpdsggdistnfL  319
DSSP  llhhhhhhhhhhHHHHHHHHHH-HHLLEEEEEELEEllllhhhhhhlllllllleelllL


DSSP  HHHHHHHHHHHHLL-LLLEEEhhHHHH--HHHHHHHHHHHLLLEEEEL-LLLL----LHH
Query QDIKEIAELCKAFP-KVPVILghMGGS--NWMTAVELAKEIQNLYLDT-SAYF----STF  207
ident             |  |    |           |    |    | |               
Sbjct RIAEGLRYFLNEFDgKLKIVL--YVLDptHLPTISTIARAFPNVYVGApWWFNdspfGME  377
DSSP  LHHHHHHHHHHHLLlLLLEEE--EELLhhHHHHHHHHHHHLLLEEELLlLLLLllhhHHH


DSSP  H-HHHH--hhHLLLLEELLLLLLL-lLHHHHHHHHHHHLL----------------LHHH
Query V-LKIV--inELPLKCIFGTDMPF-gDLQLSIEAIKKMSN----------------DSYV  247
ident   ||       |       ||           |                           
Sbjct MhLKYLasvdLLYNLAGMVTDSRKllSFGSRTEMFRRVLSnvvgemvekgqipikeAREL  437
DSSP  HhHHHHhlllLHHHLLLLLLLLLLllHHHHHHHHHHHHHHhhhhhhhhlllllhhhHHHH


DSSP  HHHHHLHHHHHHHLl
Query ANAVLGDNISRLLNi  262
ident    |  |    |   
Sbjct VKHVSYDGPKALFF-  451
DSSP  HHHHHLHHHHHHHL-


No 45: Query=3cjpA Sbjct=2uz9A Z-score=13.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------LLEEEEEELL-----------------------------------LLHHHH
Query ---------LIIDGHTHVI-----------------------------------LPVEKH   16
ident             | | |                                           
Sbjct lshheffmpGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidfaeEVYTRV  120
DSSP  llllleeeeLEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhhhhHHHHHH


DSSP  HHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllllllhhhHHHHHHHHH
Query IKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngktnsmidvRRNSIKELT   76
ident        |      | |                                     |   | 
Sbjct VRRTLKNGTTTACYFAT---------------------------------iHTDSSLLLA  147
DSSP  HHHHHHLLEEEEEEELL---------------------------------lLHHHHHHHH


DSSP  HHHHHLLLLEEEEELLLL--------lLLHHHHHHHHHHHLLLLL-------LLEEEEEL
Query NVIQAYPSRYVGFGNVPV--------gLSENDTNSYIEENIVNNK-------LVGIGELT  121
ident         |                            |                      
Sbjct DITDKFGQRAFVGKVCMDlndtfpeykETTEESIKETERFVSEMLqknysrvKPIVTPRF  207
DSSP  HHHHHHLLEEEEELEELLlllllllllLLHHHHHHHHHHHHHHHHhhlllleEEEEEELL


DSSP  LLlllHHHH-HHHHHHHHHLlLLLEEELLL---LLLL---------HHHHHHHHHHHhhl
Query PAsgqIKSL-KPIFKYSMDSgSLPIWIHAF---NPLV---------LQDIKEIAELCkaf  168
ident         |             | |  |                                
Sbjct SL-scSETLmGELGNIAKTR-DLHIQSHISenrDEVEavknlypsyKNYTSVYDKNN--l  263
DSSP  HH-hlLHHHhHHHHHHHHHH-LLEEEEEELllhHHHHhhhhhllllLLHHHHHHHLL--l


DSSP  lLLLEEEHHHhHHHHHHHHHHHHHLlLEEEELL--LLLL--hHHHHhhHHHLL---lLEE
Query pKVPVILGHMgGSNWMTAVELAKEIqNLYLDTS--AYFS--tFVLKivINELP---lKCI  221
ident         |              |              |     |     |      |  
Sbjct lTNKTVMAHG-CYLSAEELNVFHER-GASIAHCpnSNLSlssGFLN--VLEVLkhevKIG  319
DSSP  lLLLEEEEEL-LLLLHHHHHHHHHH-LLEEEELhhHHHHlllLLLL--HHHHHhlllEEE


DSSP  LLLLLLL-LLHH--HHHHHHHHHL------------LLHHHHHHHHLHHHHH-HHLL---
Query FGTDMPF-GDLQ--LSIEAIKKMS------------NDSYVANAVLGDNISR-LLNI---  262
ident  |||            |      |                          |  |      
Sbjct LGTDVAGgYSYSmlDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQaLGLDgei  379
DSSP  ELLLLLLlLLLLhhHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHhLLLLlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gnfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkq  439
DSSP  lllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeellee


DSSP  -----
Query -----  262
ident      
Sbjct vvpfs  444
DSSP  eelll


No 46: Query=3cjpA Sbjct=3qy6A Z-score=13.4

back to top
DSSP  lLEEEEEELLL----------LHHHHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhh
Query lIIDGHTHVIL----------PVEKHIKIMDEAGVDKTILFStsihpetavnlrdvkkem   50
ident   || | |                         |    |                     
Sbjct -MIDIHCHILPamddgagdsaDSIEMARAAVRQGIRTIIATP------------------   41
DSSP  -LEELLLLLLLllllllllhhHHHHHHHHHHHLLLLEEELLL------------------


DSSP  hhhhhhhLLLLLLlhhHHHHHHHHHHHHHHHLL-----LLEEEEelllllllhhhhhhhh
Query kklndvvNGKTNSmidVRRNSIKELTNVIQAYP-----SRYVGFgnvpvglsendtnsyi  105
ident        |                                                    
Sbjct -----hhNNGVYK--nEPAAVREAADQLNKRLIkedipLHVLPG----------------   78
DSSP  -----eeLLLLLL--lLHHHHHHHHHHHHHHHHhllllLEEELL----------------


DSSP  hhhllllllleeEEELLllllHHHHHHHHHH---hhhlllLLEEELLLLlLLHHhhHHHH
Query eenivnnklvgiGELTPasgqIKSLKPIFKY---smdsgsLPIWIHAFNpLVLQdiKEIA  162
ident              |                            | |               
Sbjct ------------QEIRI----YGEVEQDLAKrqllslndtKYILIEFPF-DHVP--RYAE  119
DSSP  ------------LEEEL----LLLHHHHHHLlllllhhhlLEEEEELLL-LLLL--LLHH


DSSP  HHHHHLL--LLLEEEHHH-hHHHH----HHHHHHHHHLllEEEELL--------lllLHH
Query ELCKAFP--KVPVILGHM-gGSNW----MTAVELAKEIqnLYLDTS--------ayfSTF  207
ident  |              |                |                          
Sbjct QLFYDLQlkGYIPVIAHPerNREIrenpSLLYHLVEKG--AASQITsgslagifgkqLKA  177
DSSP  HHHHHHHhlLLEEEEELHhhLHHHhhllHHHHHHHHLL--LEEEEEhhhhlllllhhHHH


DSSP  HHHHHHHHLllLEELLLLLL---LLLHhHHHHHHHHHL--LLHHHHHHHhLHHHHHHHL-
Query VLKIVINELplKCIFGTDMP---FGDLqLSIEAIKKMS--NDSYVANAVlGDNISRLLN-  261
ident                  |             ||         |         |   ||  
Sbjct FSLRLVEAN-lIHFVASDAHnvkTRNF-HTQEALYVLEkeFGSELPYML-TENAELLLRn  234
DSSP  HHHHHHHLL-lLLEEELLLLlllLLLL-LHHHHHHHHHhhHLLHHHHHH-HHHHHHHHLl


DSSP  ------------l
Query ------------i  262
ident              
Sbjct qtifrqppqpvkr  247
DSSP  lllllllllllll


No 47: Query=3cjpA Sbjct=3iacA Z-score=13.0

back to top
DSSP  --------------------------LLEEEEEELL-LLHH-------------------
Query --------------------------LIIDGHTHVI-LPVE-------------------   14
ident                            | | | |                          
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLSpQEIAddrrfdnlgqiwlegdhyk   60
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLLhHHHHhllllllhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   14
ident                                                             
Sbjct wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll


DSSP  --------------------HHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhhhhhh
Query --------------------KHIKIMDEAGVDKTILFStsihpetavnlrdvkkemkkln   54
ident                         |     |                             
Sbjct pdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD----------------------  158
DSSP  hhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL----------------------


DSSP  hhhlllllllhhhhhhHHHHhhHHHHHLL------LLEEEEELL--LLLL----------
Query dvvngktnsmidvrrnSIKEltNVIQAYP------SRYVGFGNV--PVGL----------   96
ident                                                             
Sbjct --------------dpIDSL--EYHRQIAaddsidIEVAPSWRPdkVFKIeldgfvdylr  202
DSSP  --------------llLLLL--HHHHHHHhlllllLEEELLLLLhhHHLLllllhhhhhh


DSSP  -----------lHHHHHHHHHHHLLLLL---LLEEEeELLLlLLHH--------------
Query -----------sENDTNSYIEENIVNNK---LVGIGeLTPAsGQIK--------------  128
ident               |                                             
Sbjct kleaaadvsitrFDDLRQALTRRLDHFAacgCRASD-HGIE-TLRFapvpddaqldailg  260
DSSP  hhhhhhllllllHHHHHHHHHHHHHHHHhllLLEEE-EEEL-LLLLlllllhhhhhhhhh


DSSP  ----------------HHHHHHHHHHH--LLLLLEEELLLLL------------------
Query ----------------SLKPIFKYSMD--SGSLPIWIHAFNP------------------  152
ident                                      |                      
Sbjct krlagetlseleiaqfTTAVLVWLGRQyaARGWVXQLHIGAIrnnntrxfrllgpdtgfd  320
DSSP  hhhllllllhhhhhhhHHHHHHHHHHHhhHHLLEEEEEELEEllllhhhhhhhlllllll


DSSP  --LLHHHHHHHHHHHHHLL----LLLEEEhhHHHH--HHHHHHHHHHHLL------LEEE
Query --LVLQDIKEIAELCKAFP----KVPVILghMGGS--NWMTAVELAKEIQ------NLYL  198
ident              |             ||                    |          
Sbjct siGDNNISWALSRLLDSXDvtneLPKTIL--YCLNprDNEVLATXIGNFQgpgiagKVQF  378
DSSP  eeLLLLLHHHHHHHHHHHHllllLLEEEE--EELLhhHHHHHHHHHHHLLllllllLEEE


DSSP  EL-LLLL----LHHHHHHHHH---HLLLLEELLLLLLL-lLHHHhHHHHHHHLL------
Query DT-SAYF----STFVLKIVIN---ELPLKCIFGTDMPF-gDLQLsIEAIKKMSN------  243
ident                          |       ||           |             
Sbjct GSgWWFNdqkdGXLRQLEQLSqxgLLSQFVGXLTDSRSflSYTR-HEYFRRILCnllgqw  437
DSSP  LLlLHHHllhhHHHHHHHHHHhhlLHHHLLLLLLLLLLllLLHH-HHHHHHHHHhhhhhh


DSSP  ------------LHHHHHHHHLHHHHHHHL-l
Query ------------DSYVANAVLGDNISRLLN-i  262
ident              |         |  |     
Sbjct aqdgeipddeaxLSRXVQDICFNNAQRYFTik  469
DSSP  hhlllllllhhhHHHHHHHHHLHHHHHHLLll


No 48: Query=3cjpA Sbjct=4rdvB Z-score=12.9

back to top
DSSP  -------------------------------------------------LLEEEEEELL-
Query -------------------------------------------------LIIDGHTHVI-   10
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHh


DSSP  -------------------------------------LLHHHHHHHHHHHLLLEEEEELL
Query -------------------------------------LPVEKHIKIMDEAGVDKTILFST   33
ident                                               |  ||      |  
Sbjct ramaglaevagnpndsfwtwrelmyrmvarlspeqieVIACQLYIEMLKAGYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhHHHHHHHHHHHHHLEEEEEEEEL


DSSP  LllhhhlllhhhhhhhhhhhhhhhllllllLHHHhhhhHHHHHHHHHHLL---LLEEEEE
Query SihpetavnlrdvkkemkklndvvngktnsMIDVrrnsIKELTNVIQAYP---SRYVGFG   90
ident                                                |            
Sbjct V------------------------hhdldGRSY-adpAELSLRISRAASaagIGLTLLP  155
DSSP  L------------------------lllllLLLL-lllLHHHHHHHHHHHhhlLEEEEEE


DSSP  LLLLL------------llhhhHHHHHHHHLLLLL--------lLEEEEELLLlllhhHH
Query NVPVG------------lsendTNSYIEENIVNNK--------lVGIGELTPAsgqikSL  130
ident                             |                |              
Sbjct VLYSHagfggqpasegqrrfinGSEAYLELLQRLRapleaaghsLGLCFHSLR---avTP  212
DSSP  LLLLEeellleellhhhlllllLHHHHHHHHHHHHhhhhhhlleELEEELLLL---llLH


DSSP  HHHHHHHHHLLL-LLEEELL-LLLLLH---------HHHHHHHHHHHhllllLEEEHHhH
Query KPIFKYSMDSGS-LPIWIHA-FNPLVL---------QDIKEIAELCKafpkvPVILGHmG  179
ident   |          ||  ||                        |           | |  
Sbjct QQIATVLAAGHDdLPVHIHIaEQQKEVddcqawsgrRPLQWLYENVA--vdqRWCLVH-A  269
DSSP  HHHHHHHLLLLLlLLEEEEElLLHHHHhhhhhhhllLHHHHHHHHLL--lllLEEEEE-L


DSSP  HHHHHHHHHHHHHLLlEEEELL--LLLL----hhHHHHHHHHLllLEELLLLLLlLLHH-
Query GSNWMTAVELAKEIQnLYLDTS--AYFS----tfVLKIVINELplKCIFGTDMPfGDLQ-  232
ident        |                                         | |     |  
Sbjct THADPAEVAAMARSG-AVAGLClsTEANlgdgifPATDFLAQG-gRLGIGSDSH-VSLSv  326
DSSP  LLLLHHHHHHHHHHL-LEEEELhhHHHHllllllLHHHHHHLL-lEEEELLLLL-LLLLh


DSSP  -HHHHHHHH----------HLLL------HHHHHHHHLHHHHH--HHLL-----------
Query -LSIEAIKK----------MSND------SYVANAVLGDNISR--LLNI-----------  262
ident                                                 |           
Sbjct vEELRWLEYgqrlrdrkrnRLYRddqpmiGRTLYDAALAGGAQalGQPIgslavgrradl  386
DSSP  hHHHHHHHHhhhhhhllllLLLLlllllhHHHHHHHHHHHHHHhhLLLLlllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct lvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqv  446
DSSP  eeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhh


DSSP  -----
Query -----  262
ident      
Sbjct lgell  451
DSSP  hhhhl


No 49: Query=3cjpA Sbjct=1v77A Z-score=12.4

back to top
DSSP  -LLEEEEEELLLlhhhHHHHHHhhLLLEEEEElllllhhhlllhhhhhhhhhhhhhhhll
Query -LIIDGHTHVILpvekHIKIMDeaGVDKTILFstsihpetavnlrdvkkemkklndvvng   59
ident    |                      |                                 
Sbjct vKFIEMDIRDKE---aYELAKE--WFDEVVVS----------------------------   27
DSSP  lLLEEEEELLHH---hHHHHHH--HLLEEEEE----------------------------


DSSP  lllllhhhhhhhhhhhhhhhhhlllleeeeELLLLLllhhhhhhhHHHHLlLLLL-----
Query ktnsmidvrrnsikeltnviqaypsryvgfGNVPVGlsendtnsyIEENIvNNKL-----  114
ident                                                |            
Sbjct ------------------------------IKFNEE--------vDKEKL-REARkeygk   48
DSSP  ------------------------------EEELLL--------lLHHHH-HHHHhhhll


DSSP  LEEEeELLLllLHHHHHHHHHHHHhllLLLEEELLlllLLHHHHHHHHHHHhhllllLEE
Query VGIGeLTPAsgQIKSLKPIFKYSMdsgSLPIWIHAfnpLVLQDIKEIAELCkafpkvPVI  174
ident | |  |                     |  |         |  |    |           
Sbjct VAIL-LSNP--KPSLVRDTVQKFK---SYLIYVES---NDLRVIRYSIEKG------VDA   93
DSSP  EEEE-EELL--LHHHHHHHHHHLL---LLEEEEEL---LLHHHHHHHHHLL------LLE


DSSP  EhHHHH-----HHHH-HHHHHHHHLlLEEEELLL-----------llLHHHHHHHHHHLL
Query LgHMGG-----SNWM-TAVELAKEIqNLYLDTSA-----------yfSTFVLKIVINELP  217
ident                     |     |  |  |                           
Sbjct I-ISPWvnrkdPGIDhVLAKLMVKK-NVALGFSLrpllysnpyeranLLRFMMKAWKLVE  151
DSSP  E-ELLLlllllLLLLhHHHHHHHHH-LLEEEEELhhhhhllhhhhhhHHHHHHHHHHHHH


DSSP  ---lLEELLLLLLL--LLHH--HHHHHHHHHLLLHHHHHHHHLHHHHHHHLl
Query ---lKCIFGTDMPF--GDLQ--LSIEAIKKMSNDSYVANAVLGDNISRLLNi  262
ident                         |            | |         |  
Sbjct kykvRRFLTSSAQEkwDVRYprDLISLGVVIGMEIPQAKASISMYPEIILK-  202
DSSP  hhllLEEEELLLLLhhHLLLhhHHHHHHHHLLLLHHHHHHLLLHHHHHHHL-


No 50: Query=3cjpA Sbjct=3ooqA Z-score=11.6

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------LIIDGHTH    8
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL


DSSP  --LLLL----------------------------HHHHHHHHHHHLLLEEEEELLlllhh
Query --VILP----------------------------VEKHIKIMDEAGVDKTILFSTsihpe   38
ident                                       |      ||             
Sbjct igLFEEgvgyyysdgneatdpvtphvkaldgfnpQDPAIERALAGGVTSVXIVPG-----  115
DSSP  llLLLLlllhhhlllllllllllllllhhhhlllLLHHHHHHHLLLEEEEEELLL-----


DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhhhhhhhhhhHHHHHLLLleeeeelllllllh
Query tavnlrdvkkemkklndvvngktnsmidvrrnsikeltNVIQAYPSryvgfgnvpvglse   98
ident                                                             
Sbjct ----------------------sanpvggqgsvikfrsIIVEECIV--------------  139
DSSP  ----------------------lllleeeeeeeeelllLLHHHHEE--------------


DSSP  hhhhhhhhhhllllLLLEEEeELLLL-----------------lLHHHHHH---------
Query ndtnsyieenivnnKLVGIGeLTPAS-----------------gQIKSLKP---------  132
ident                  |                                          
Sbjct -------------kDPAGLK-XAFGEnpkrvygerkqtpstrxgTAGVIRDyftkvknyx  185
DSSP  -------------eEEEEEE-EELLHhhhhhhhhlllllllhhhHHHHHHHhhhhhhhhh


DSSP  ---------------------hHHHHHHLLlLLEEELLLlllLHHHHHHHHHHHHHLLlL
Query ---------------------iFKYSMDSGsLPIWIHAFnplVLQDIKEIAELCKAFPkV  171
ident                                 |   ||       ||         |   
Sbjct kkkelaqkegkeftetdlkxevGEXVLRKK-IPARXHAH---RADDILTAIRIAEEFG-F  240
DSSP  hhhhhhhhlllllllllhhhhhHHHHHLLL-LLEEEEEL---LHHHHHHHHHHHHHHL-L


DSSP  LEEEHHhHHHHHHHhHHHHHHLLlEEEELLLL-----------LLHHHHHHHHHHLllLE
Query PVILGHmGGSNWMTaVELAKEIQnLYLDTSAY-----------FSTFVLKIVINELplKC  220
ident      | |            |                                       
Sbjct NLVIEH-GTEAYKI-SKVLAEKK-IPVVVGPLltfrtklelkdLTXETIAKLLKDG-vLI  296
DSSP  LEEEEE-LLLHHHH-HHHHHHHL-LLEEELLLllllllhhhllLLLLHHHHHHHLL-lLE


DSSP  ELLLLLLLLL---HHHHHHHHH-HHLLlHHHHHHHHLHHHHHHHLL--------------
Query IFGTDMPFGD---LQLSIEAIK-KMSNdSYVANAVLGDNISRLLNI--------------  262
ident     | |                            |  |    |                
Sbjct ALXCDHPVIPlefATVQAATAXrYGAK-EEDLLKILTVNPAKILGLedrigsiepgkdad  355
DSSP  EELLLLLLLLhhhHHHHHHHHHhHLLL-HHHHHHLLLHHHHHHLLLllllllllllllll


DSSP  -----------------------------
Query -----------------------------  262
ident                              
Sbjct lvvwsghpfdxksvvervyidgvevfrre  384
DSSP  eeeelllllllllleeeeeelleeeeell


No 51: Query=3cjpA Sbjct=2a3lA Z-score=11.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------LLEEEEEELL--------
Query ------------------------------------------LIIDGHTHVI--------   10
ident                                              | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   10
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -----------------------------lLHHHHHHHHHHHLLLEEEEELLlllhhhll
Query -----------------------------lPVEKHIKIMDEAGVDKTILFSTsihpetav   41
ident                                                             
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRIS--------  292
DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEE--------


DSSP  lhhhhhhhhhhhhhhhllllLLLH-HHHHHHhHHHHhhhHHLLLLEEEEELLLLLL----
Query nlrdvkkemkklndvvngktNSMI-DVRRNSiKELTnviQAYPSRYVGFGNVPVGL----   96
ident                                          |    |     |       
Sbjct -------------------iYGRKmSEWDQL-ASWIvnnDLYSENVVWLIQLPRLYniyk  332
DSSP  -------------------lLLLLlLHHHHH-HHHHhllLLLLLLEEEEEEEELLHhhhl


DSSP  -------LHHHHHHHHHHH------------lLLLL--LLEEEeELLLL-----------
Query -------SENDTNSYIEEN------------iVNNK--LVGIGeLTPAS-----------  124
ident          |                             ||   |               
Sbjct dmgivtsFQNILDNIFIPLfeatvdpdshpqlHVFLkqVVGFD-LVDDEskperrptkhm  391
DSSP  lllllllLHHHHHHHLLHHhhhhhlhhhllllHHHHllEEEEE-EELLLlllllllllll


DSSP  ------------LLHHHHHHHHHHHHHLL---------LLLEEEL-LLLLlLHHHHHHHH
Query ------------GQIKSLKPIFKYSMDSG---------SLPIWIH-AFNPlVLQDIKEIA  162
ident                                             |               
Sbjct ptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmtTITLRPHsGEAG-DIDHLAATF  450
DSSP  llllllllllllLHHHHHHHHHHHHHHHHhhhllllllLLEELLLlLLLL-LLHHHHHHH


DSSP  HHHhhlllllEEEHHhHHHHHHH--HHHHHHHLLlEEEELLLL------LLHH--HHHHH
Query ELCkafpkvpVILGHmGGSNWMT--AVELAKEIQnLYLDTSAY------FSTF--VLKIV  212
ident   |           | |           |    |   |  |                   
Sbjct LTC-------HSIAH-GINLRKSpvLQYLYYLAQ-IGLAMSPLsnnslfLDYHrnPFPVF  501
DSSP  HHL-------LLLLL-LHHHHHLhhHHHHHHHHL-LLEEELHHhhllllLLLLllLHHHH


DSSP  HHHLllLEELLLLLLL------lLHHHHHHHHHHHL-LLHHHHHHHHlHHHHH-HHLL--
Query INELplKCIFGTDMPF------gDLQLSIEAIKKMS-NDSYVANAVLgDNISR-LLNI--  262
ident            || |         |                        |          
Sbjct FLRG-lNVSLSTDDPLqihltkePLVEEYSIAASVWkLSACDLCEIA-RNSVYqSGFSha  559
DSSP  HHLL-lLEEELLLLHHhhlllllHHHHHHHHHHHHHlLLHHHHHHHH-HHHHHhLLLLhh


DSSP  ---------------------------------------------------------
Query ---------------------------------------------------------  262
ident                                                          
Sbjct lkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=3cjpA Sbjct=3au2A Z-score=10.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------LLEEEEEELL-----LLHHHHHHH
Query ------------------------------------LIIDGHTHVI-----LPVEKHIKI   19
ident                                        |   |          |     
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTysdgqNTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLlllllLLHHHHHHH


DSSP  HHHHLLLEEEEELllllhhhlllhhhhhhhhhhhhHHHLllLLLLhhHHHHHHHHHHHHH
Query MDEAGVDKTILFStsihpetavnlrdvkkemkklnDVVNgkTNSMidVRRNSIKELTNVI   79
ident     |                                |               |      
Sbjct AKTMGYRYLAVTD--------------------hsPAVR--VAGG-pSPEEALKRVGEIR  397
DSSP  HHHHLLLEEEEEE--------------------elHHHH--LLLL-lLHHHHHHHHHHHH


DSSP  HHLL----lLEEEEelllllllhhhhhhhhhhhllllllleeEEELLLLLLHhhhhhHHH
Query QAYP----sRYVGFgnvpvglsendtnsyieenivnnklvgiGELTPASGQIkslkpIFK  135
ident                                            |                
Sbjct RFNEthgppYLLAG----------------------------AEVDIHPDGT--ldyPDW  427
DSSP  HHHHhhlllEEEEE----------------------------EEEELLLLLL--lllLHH


DSSP  HHHhllllLEEELLLLL------lLHHHHHHHHHHHhhlllLLEEEHHHHH---------
Query YSMdsgslPIWIHAFNP------lVLQDIKEIAELCkafpkVPVILGHMGG---------  180
ident                                  |           | |            
Sbjct VLR--eldLVLVSVHSRfnlpkadQTKRLLKALENP-----FVHVLAHPTArllgrrapi  480
DSSP  HHL--lllEEEEELLLLllllhhhHHHHHHHHHLLL-----LLLEELLLLLlllllllll


DSSP  -HHHHHHHHHHHHLlLEEEELL------LLLLhHHHHHHHHHLllLEELLLLLLL-lLHH
Query -SNWMTAVELAKEIqNLYLDTS------AYFStFVLKIVINELplKCIFGTDMPF-gDLQ  232
ident    |      |||                                     ||      | 
Sbjct eADWEAVFQKAKEK-GVAVEIDgyydrmDLPD-DLARMAYGMG-lWISLSTDAHQtdHLR  537
DSSP  lLLHHHHHHHHHHH-LLEEEEEllllllLLLH-HHHHHHHHLL-lLEEEELLLLLhhHHH


DSSP  HhHHHHHHHL---LLHHHhhHHHLHhhHHHHL-------l
Query LsIEAIKKMS---NDSYVanAVLGDniSRLLN-------i  262
ident    |                         ||         
Sbjct F-MELAVGTAqraWIGPE-rVLNTLdyEDLLSwlkarrgv  575
DSSP  H-HHHHHHHHhhlLLLLL-lLHHHLlhHHHHHhhhlllll


No 53: Query=3cjpA Sbjct=3dcpA Z-score=9.8

back to top
DSSP  LLEEEEEEL-------lLLHHHHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhHHHH
Query LIIDGHTHV-------iLPVEKHIKIMDEAGVDKTILFStsihpetavnlrdvkkeMKKL   53
ident    |||||           ||       |   |                           
Sbjct XKRDGHTHTefcphgthDDVEEXVLKAIELDFDEYSIVE--haplssefxkntagdKEAV   58
DSSP  LLEEEEELLllllllllLLHHHHHHHHHHLLLLEEEEEE--ellllhhhhhlllllLHHH


DSSP  HHHhllllllLHHHHHHHHHHHHHHHHHLL-LLEEEEElllllllhhhhhhhhhhhllll
Query NDVvngktnsMIDVRRNSIKELTNVIQAYP-SRYVGFGnvpvglsendtnsyieenivnn  112
ident                    |        |        |                      
Sbjct TTA-----sxAXSDLPYYFKKXNHIKKKYAsDLLIHIG----------------------   91
DSSP  HLL-----llLHHHHHHHHHHHHHHHHHLLlLLEEEEE----------------------


DSSP  llleeEEELLLLLLHHHHHHHHHHHhhlllllEEELLLLL--------------------
Query klvgiGELTPASGQIKSLKPIFKYSmdsgslpIWIHAFNP--------------------  152
ident       |     |                                               
Sbjct -----FEVDYLIGYEDFTRDFLNEY-gpqtddGVLSLHFLegqggfrsidfsaedynegi  145
DSSP  -----EEEELLLLLHHHHHHHHHHH-hhhlleEEEELLEEeelleeeellllhhhhhhhl


DSSP  ------------lLHHHHHHHHHHhhHLLL-LLEEEHHHHHH------------------
Query ------------lVLQDIKEIAELckAFPK-VPVILGHMGGS------------------  181
ident               |   |   |         |   ||                      
Sbjct vqfyggfeqaqlaYLEGVKQSIEA--DLGLfKPRRXGHISLCqkfqqffgedtsdfseev  203
DSSP  hhhhllhhhhhhhHHHHHHHHHHL--LLLLlLLLEELLLLHHhllhhhhlllhhhllhhh


DSSP  --hhHHHHHHHHHLLlEEEELLLLLL-------hhHHHHHHHHLL---LLEELLLLLL--
Query --nwMTAVELAKEIQnLYLDTSAYFS-------tfVLKIVINELP---LKCIFGTDMP--  227
ident          | |      ||                 |               | |    
Sbjct xekfRVILALVKKRD-YELDFNTAGLfkplcgetyPPKKIVTLASelqIPFVYGSDSHgv  262
DSSP  hhhhHHHHHHHHHHL-LEEEEELHHHhllllllllLLHHHHHHHHhllLLEEEELLLLlh


DSSP  lLLHHhHHHHHHHHLLlhhhhhhhhlhhhhhhhll
Query fGDLQlSIEAIKKMSNdsyvanavlgdnisrllni  262
ident                                    
Sbjct qDIGR-GYSTYCQKLE-------------------  277
DSSP  hHLLL-LHHHHHHHLL-------------------


No 54: Query=3cjpA Sbjct=1m65A Z-score=9.4

back to top
DSSP  lLEEEEEEL------lLLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhh
Query lIIDGHTHV------iLPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkkln   54
ident    | | |              |      |                              
Sbjct yPVDLHMHTvasthaySTLSDYIAQAKQKGIKLFAITDH---------------------   39
DSSP  lLEELLLLLlllllllLLHHHHHHHHHHHLLLEEEEEEE---------------------


DSSP  hhhllllllLHHHHHHHhHHHHHHHHHLLL----LEEEEELLLLLLLHhhhhhHHHHHLL
Query dvvngktnsMIDVRRNSiKELTNVIQAYPS----RYVGFGNVPVGLSEndtnsYIEENIV  110
ident                       |                                     
Sbjct -------gpDMEDAPHH-WHFINMRIWPRVvdgvGILRGIEANIKNVD--geiDCSGKMF   89
DSSP  -------llLLLLLLLL-HHHHHHHHLLLEelleEEEEEEEEELLLLL--lllLLLHHHH


DSSP  lLLLLEEEEEL----LLLL----LHHHHHHHHHHHhhllLLLEEELL-LLLLlhHHHHhh
Query nNKLVGIGELT----PASG----QIKSLKPIFKYSmdsgSLPIWIHA-FNPLvlQDIKei  161
ident    |  |         |                         |  |              
Sbjct -DSLDLIIAGFhepvFAPHdkatNTQAMIATIASG----NVHIISHPgNPKY--EIDV--  140
DSSP  -HHLLEEEEELllllLLLLlhhhHHHHHHHHHHLL----LLLEELLLlLLLL--LLLH--


DSSP  HHHHHHLLLLLEEEHHhhhhHHHHHHHHHHHLLlEEEELL--------llllHHHHHHHH
Query AELCKAFPKVPVILGHmggsNWMTAVELAKEIQnLYLDTS--------ayfsTFVLKIVI  213
ident      |  |  | |      |                                  |||  
Sbjct KAVAEAAAKHQVALEInnssNCREVAAAVRDAG-GWVALGsdshtaftmgefEECLKILD  199
DSSP  HHHHHHHHHHLLEEEEelllLHHHHHHHHHHHL-LLEEEElllllhhhllllHHHHHHHH


DSSP  --HHLLLLEELllllllllhhhhhhhhhhhlllhhhhhhHHLHHHHHHHL----------
Query --NELPLKCIFgtdmpfgdlqlsieaikkmsndsyvanaVLGDNISRLLN----------  261
ident      |                                 |        |           
Sbjct avDFPPERILN----------------------------VSPRRLLNFLEsrgmapiaef  231
DSSP  hlLLLHHHLHH----------------------------HLHHHHHHHHHhllllllhhh


DSSP  --l
Query --i  262
ident    
Sbjct adl  234
DSSP  lll


No 55: Query=3cjpA Sbjct=1bksA Z-score=8.5

back to top
DSSP  ---------------llEEEEEE--------lLLLH-HHHHHHHhhhllleEEEELLLLl
Query ---------------liIDGHTH--------vILPV-EKHIKIMdeagvdkTILFSTSIh   36
ident                                  |      |            |      
Sbjct meryenlfaqlndrregAFVPFVtlgdpgieqSLKIiDTLIDAG------aDALELGVP-   53
DSSP  lhhhhhhhhhhhhllllEEEEEEelllllhhhHHHHhHHHHHLL------lLLEEEELL-


DSSP  hhhlllhhhhhhhhhHHHHHH-------lllllllhHHHHHHHHHHHHHHHHLLLlEEEE
Query petavnlrdvkkemkKLNDVV-------ngktnsmiDVRRNSIKELTNVIQAYPSrYVGF   89
ident                                              |       |      
Sbjct --------------fSDPLADgptiqnanlrafaagVTPAQCFEMLALIREKHPT-IPIG   98
DSSP  --------------lLLLLLLlhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHLLL-LLEE


DSSP  ELLLLL-lLHHHHHHHHHHhLLLLLLLEEEeELLLllLHHHHHHHHHHHHHLLlLLEEEL
Query GNVPVG-lSENDTNSYIEEnIVNNKLVGIGeLTPAsgQIKSLKPIFKYSMDSGsLPIWIH  148
ident           |                                |                
Sbjct LLMYANlvFNNGIDAFYAR-CEQVGVDSVL-VADV--PVEESAPFRQAALRHN-IAPIFI  153
DSSP  EEELHHhhHLLLHHHHHHH-HHHHLLLEEE-ELLL--LHHHLHHHHHHHHHLL-LEEEEE


DSSP  LLllLLHHhhHHHHHHHHhlllLLEEEHHHhhHHHHHHHHHHHHLLLEEEELLLL----l
Query AFnpLVLQdiKEIAELCKafpkVPVILGHMggSNWMTAVELAKEIQNLYLDTSAY----f  204
ident                                        |  ||                
Sbjct CP--PNAD-dDLLRQVAS---yGRGYTYLL-aLPLHHLIEKLKEYHAAPALQGFGisspe  206
DSSP  EL--LLLL-hHHHHHHHH---hLLLLEEEL-lLLHHHHHHHHHHHLLLLEEELLLlllhh


DSSP  LHHHHHHHHhhllllEELLLLLLL-------------------lLHHHHHHHHHhhlllh
Query STFVLKIVInelplkCIFGTDMPF-------------------gDLQLSIEAIKkmsnds  245
ident                                                    |        
Sbjct QVSAAVRAG-----aAGAISGSAIvkiieknlaspkqmlaelrsFVSAMKAASR------  255
DSSP  HHHHHHHHL-----lLEEEELLHHhhhhhhllllhhhhhhhhhhHHHHHHHLLL------


DSSP  hhhhhhhlhhhhhhhll
Query yvanavlgdnisrllni  262
ident                  
Sbjct -----------------  255
DSSP  -----------------


No 56: Query=3cjpA Sbjct=3f2bA Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEEEEEELL--
Query ------------------------------------------------LIIDGHTHVI--   10
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLll


DSSP  -----LLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllllllh
Query -----LPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngktnsmi   65
ident        | | |      |                                         
Sbjct qmdavTSVTKLIEQAKKWGHPAIAVTDH--------------------------------  148
DSSP  lllllLLHHHHHHHHHHLLLLLEEELLL--------------------------------


DSSP  hhhhhHHHHHHHHHHHLL---LLEEEEelllllllhhhhhhhhhhhllllllleeEEELL
Query dvrrnSIKELTNVIQAYP---SRYVGFgnvpvglsendtnsyieenivnnklvgiGELTP  122
ident                |                                        |   
Sbjct ----aVVQSFPEAYSAAKkhgMKVIYG----------------------------LEANI  176
DSSP  ----lLLLLHHHHHHHHHhhlLLEEEE----------------------------EEEEE


DSSP  llllHHHH-----------------------------------HHHHHHHHhlLLLLeee
Query asgqIKSL-----------------------------------KPIFKYSMdsGSLPiwi  147
ident                                                        |    
Sbjct ----VDDPfhvtllaqnetglknlfklvslshiqyfhrvpripRSVLVKHR--DGLL---  227
DSSP  ----ELLLeeeeeeellhhhhhhhhhhhhhhhllllllllleeHHHHHHLL--LLEE---


DSSP  lllllllhhhhhhhhhhhhhlllllEEEHH---hHHHHhhhhHHHHhhLLLEEEELLLLL
Query hafnplvlqdikeiaelckafpkvpVILGH---mGGSNwmtaVELAkeIQNLYLDTSAYF  204
ident                          |  |        |       |       |      
Sbjct -------------------------VGSGCdkgeLFDN---vEDIA--RFYDFLEVHPPD  257
DSSP  -------------------------EELLLllllLLLL---lLLLH--HHLLLEEELLHH


DSSP  ------------LHHHHHHHHHHLL---LLEELLLLLL----------------------
Query ------------STFVLKIVINELP---LKCIFGTDMP----------------------  227
ident                                                             
Sbjct vykplyvkdeemIKNIIRSIVALGEkldIPVVATGNVHylnpedkiyrkilihsqgganp  317
DSSP  hhlllllllhhhHHHHHHHHHHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhll


DSSP  --------LLLHHhhHHHHHHHL--LLHHHHHHHHLHHHHHHHLL---------------
Query --------FGDLQlsIEAIKKMS--NDSYVANAVLGDNISRLLNI---------------  262
ident                               |     ||                      
Sbjct lnrhelpdVYFRT--TNEMLDCFsfLGPEKAKEIVVDNTQKIASLigdvkpikdelytpr  375
DSSP  llllllllLLLLL--HHHHHHHHhhHHHHHHHHHHLHHHHHHHHLlllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  262
ident                                                             
Sbjct rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh


DSSP  -------------------
Query -------------------  262
ident                    
Sbjct lesrgcldslpdhnqlslf  994
DSSP  hhhllllllllllllllll


No 57: Query=3cjpA Sbjct=2yb1A Z-score=6.2

back to top
DSSP  LLEEEEEEL------lllHHHHHHHHHhHLLLEEEEELLlllhhhlllhhhhhhhhhhhh
Query LIIDGHTHV------ilpVEKHIKIMDeAGVDKTILFSTsihpetavnlrdvkkemkkln   54
ident   || | |           |               |                        
Sbjct ANIDLHFHSrtsdgaltpTEVIDRAAA-RAPALLALTDH---------------------   38
DSSP  LLEELLLLLllllllllhHHHHHHHHL-LLLLEEEELLL---------------------


DSSP  hhhlllllllhhhhhhHHHHHHHHHHHLL---LLEEEEELLLLL----------llhhhh
Query dvvngktnsmidvrrnSIKELTNVIQAYP---SRYVGFGNVPVG----------lsendt  101
ident                     |     |             | |                 
Sbjct ---------------dCTGGLAEAAAAAArrgIPFLNGVEVSVSwgrhtvhivglgidpa   83
DSSP  ---------------lLLLLHHHHHHHHHhllLLEEEEEEEEEEelleeeeeeeelllll


DSSP  hHHHHHHL----------------------------------------------------
Query nSYIEENI----------------------------------------------------  109
ident                                                             
Sbjct ePALAAGLksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvds  143
DSSP  lHHHHHHHhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhl


DSSP  --------lllllleeeeellllllhhHHHHHHHHHHHLLlLLEEE-LLLLLLL-HHHHH
Query --------vnnklvgigeltpasgqikSLKPIFKYSMDSGsLPIWI-HAFNPLV-LQDIK  159
ident                            ||          |     | |          | 
Sbjct gavkdmrtvfrkyltpgkpgyvshqwaSLEDAVGWIVGAG-GMAVIaHPGRYDMgRTLIE  202
DSSP  lllllhhhhhhhlllllllllllllllLHHHHHHHHHHLL-LEEEElLHHHLLLlHHHHH


DSSP  HHHHHHHHLllLLEEEHH----hhhHHHHHHHHHHHHLLlEEEEllllllhhhhhhhhhh
Query EIAELCKAFpkVPVILGH----mggSNWMTAVELAKEIQnLYLDtsayfstfvlkivine  215
ident        |                          |     ||                  
Sbjct RLILDFQAA--GGQGIEVasgshslDDMHKFALHADRHG-LYAS----------------  243
DSSP  HHHHHHHHL--LLLEEEEeellllhHHHHHHHHHHHHHL-LEEE----------------


DSSP  lllleeLLLLLLLllhhhhhhhhhhhlllhhhhhhhhlhHHHHHHLL----------
Query lplkciFGTDMPFgdlqlsieaikkmsndsyvanavlgdNISRLLNI----------  262
ident        | |                              | | |            
Sbjct ------SGSDFHA----------pgedvghtedlppicrPIWRELEArilrpadaen  284
DSSP  ------EELLLLL----------llllllllllllllllLHHHHLHHhlllllhhhl


No 58: Query=3cjpA Sbjct=3e38A Z-score=5.2

back to top
DSSP  -----------------LLEEEEEELL-----LLHHHHHHHHHHHLLLEEEEELLlllhh
Query -----------------LIIDGHTHVI-----LPVEKHIKIMDEAGVDKTILFSTsihpe   38
ident                  |  | | |                    | |   |        
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVfsdglVWPTVRVDEAYRDGLDAISLTEH-----   55
DSSP  llllllllllllllleeEEEELLLLLLlllllLLHHHHHHHHHHLLLLEELLEEE-----


DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHLLL----LEEEEELLLL
Query tavnlrdvkkemkklndvvngktnsmidvrrNSIKELTNVIQAYPS----RYVGFGNVPV   94
ident                                                             
Sbjct --------------------ieyrphkqdvvSDHNRSFDLCREQAEklgiLLIKGSEITR   95
DSSP  --------------------lllllllllllLLLLHHHHHHHHHHHhhllEELLEEEEEL


DSSP  L-------llhhhhhhHHHHhllllllleeeeellllllhhhHHHHHHHHHhLLLLLEEE
Query G-------lsendtnsYIEEnivnnklvgigeltpasgqiksLKPIFKYSMdSGSLPIWI  147
ident                   |                        |  |             
Sbjct AxapghfnaiflsdsnPLEQ--------------------kdYKDAFREAK-KQGAFXFW  134
DSSP  LlllleeeeelllllhHHLL--------------------llHHHHHHHHH-HLLLEEEE


DSSP  L-LLLL-----lLHHHhHHHHHHHHHLllLLEEEHH----hhHHHH-HHHHHHHhhlllE
Query H-AFNP-----lVLQDiKEIAELCKAFpkVPVILGH----mgGSNW-MTAVELAkeiqnL  196
ident                   |   |                                    |
Sbjct NhPGWDsqqpdtTKWW-PEHTALYQEG--CXHGIEVanghlyXPEAiQWCLDKN-----L  186
DSSP  LlLLLLllllllLLLL-HHHHHHHHLL--LLLEEEEeelleeLLHHhHHHHHHL-----L


DSSP  EEELlllllhhhhhhhhhhlllleelLLLLLL--------llhHHHH-------------
Query YLDTsayfstfvlkivinelplkcifGTDMPF--------gdlQLSI-------------  235
ident                             |                               
Sbjct TXIG----------------------TSDIHQpiqtdydfekgEHRTxtfvfakerslqg  224
DSSP  EEEE----------------------ELLLLLlhhhhllhhhlLLLLeeeeeellllhhh


DSSP  -----------hhHHHHL---------------------------------lLHHH----
Query -----------eaIKKMS---------------------------------nDSYV----  247
ident                                                        |    
Sbjct irealdnrrtaayFHELLigredllrpffekcvkieevsrneqgvtlsitnvTDLVlklk  284
DSSP  hhhhhhllleeeeELLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeelLLLLeeee


DSSP  -------------------------------------------hhhhhlhhhhhhhll
Query -------------------------------------------anavlgdnisrllni  262
ident                                                           
Sbjct ktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  elllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=3cjpA Sbjct=2anuA Z-score=3.5

back to top
DSSP  lleeeeeellllhhhhhhhhhhhllleeeeelllllhhhlllhhhhhhhhhhhhhhhlll
Query liidghthvilpvekhikimdeagvdktilfstsihpetavnlrdvkkemkklndvvngk   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhhhllLLEEEE-ELLLLlllhhhhhhHHHHHlLLLL------
Query tnsmidvrrnsikeltnviqaypSRYVGF-GNVPVglsendtnsYIEENiVNNK------  113
ident                             |                  |  |         
Sbjct ---------------------teWLLCDFhVHTNX----sdghlPLGEV-VDLFgkhgvd   34
DSSP  ---------------------leEEEEEEeELLLL----lllllLHHHH-HHHHhhllll


DSSP  lLEEEeELLLLL----------------LHHHHHHHHHHHHHLL---------lLLEEEL
Query lVGIGeLTPASG----------------QIKSLKPIFKYSMDSG---------sLPIWIH  148
ident  | |                                 |                |     
Sbjct vVSIT-DHIVDRrtleqrkrngeplgaiTEDKFQDYLKRLWREQkraweeygxiLIPGVE   93
DSSP  eEEEE-EEEELHhhhhhhhhllllllllLLLLHHHHHHHHHHHHhhhhhhhlleEEEEEE


DSSP  LLLL-----llhhhhhHHHHhhhhllllleeehhhhhhHHHHHHHHHHHLLlEEEELLL-
Query AFNP-----lvlqdikEIAElckafpkvpvilghmggsNWMTAVELAKEIQnLYLDTSA-  202
ident   |             |                          ||  ||           
Sbjct ITNNtdlyhivavdvkEYVD---------------pslPVEEIVEKLKEQN-ALVIAAHp  137
DSSP  EEELllleeeeeelllLLLL---------------lllLHHHHHHHHHHLL-LEEEELLl


DSSP  ---------LLLHHHHHHHHhhllllEELLLLLLllLHHHHHHHH---------------
Query ---------YFSTFVLKIVInelplkCIFGTDMPfgDLQLSIEAI---------------  238
ident                 |                                           
Sbjct drkklswylWANXERFKDTF------DAWEIANRddLFNSVGVKKyryvansdfhelwhv  191
DSSP  lllllllhhHHLLLLLLLLL------LEEEEEELleELHHHHHLLlleeeelllllhhhh


DSSP  ---hhhlllhhhhhhhhlHHHH------hhhll
Query ---kkmsndsyvanavlgDNIS------rllni  262
ident                                  
Sbjct yswktlvkseknieaikeAIRKntdvaiylxrk  224
DSSP  lleeeeeeelllhhhhhhHHHHllleeeeelll