Results: dupa

Query: 3au2A

MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  3au2-A 67.2  0.0  575   575  100 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   2:  1m65-A 27.3  2.0  218   234   27 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   3:  3dcp-A 18.8  2.7  201   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
   4:  1v77-A 14.1  2.9  176   202   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
   5:  3qy6-A 13.8  3.2  191   247   19 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   6:  2anu-A 12.4  3.1  169   224   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
   7:  4mup-B 10.9  3.3  186   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   8:  2oof-A 10.9  3.6  181   403   14 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   9:  1yrr-B 10.8  7.6  194   334   18 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  10:  3mtw-A 10.8  7.8  187   404   15 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  11:  2yb1-A 10.7  3.5  162   284   24 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  12:  3gg7-A 10.6  3.3  166   243   11 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  13:  2vun-A 10.6  8.4  197   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  14:  3cjp-A 10.4  3.7  180   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  15:  3f2b-A 10.2  8.5  186   994   17 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  16:  4dlf-A 10.2  3.7  188   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  17:  4cqb-A 10.1  7.3  196   402    9 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  18:  4c5y-A 10.1  8.7  179   436   17 PDB  MOLECULE: OCHRATOXINASE;                                             
  19:  2ffi-A 10.1  3.2  171   273    9 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  20:  3mkv-A 10.1  7.0  175   414   14 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  21:  1k6w-A 10.1  5.2  194   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  22:  2y1h-B 10.0  3.6  177   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  23:  3irs-A  9.9  3.3  180   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  24:  2paj-A  9.9  4.3  188   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  25:  3e38-A  9.8  3.4  163   342   18 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  26:  4hk5-D  9.6  3.7  185   380   16 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  27:  2imr-A  9.6  4.9  197   380   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  28:  1bf6-A  9.3  4.0  183   291   10 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  29:  2ogj-A  9.3  7.3  192   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  3k2g-B  9.1  4.0  182   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  31:  1gkp-A  9.1  6.8  184   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  32:  3ls9-A  9.0  3.8  181   453   14 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  33:  3gri-A  8.9  8.1  184   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  34:  1j6p-A  8.8  6.6  178   407   11 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  35:  1a4m-A  8.7  3.6  182   349   14 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  36:  1itq-A  8.6  4.6  200   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  37:  2dvt-A  8.6  3.6  175   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  38:  3icj-A  8.6  8.3  178   468   15 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  39:  4rdv-B  8.6  6.8  191   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  40:  2uz9-A  8.6  3.6  180   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  41:  2ob3-A  8.5  3.6  186   329   12 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  42:  2vc5-A  8.5  4.2  176   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  43:  1onx-A  8.2  7.2  193   390   13 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  44:  3nqb-A  8.2 11.5  189   587   15 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  45:  4b3z-D  8.1  9.4  184   477   10 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  46:  2qpx-A  8.0  4.1  202   376   10 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  47:  3iac-A  8.0  4.1  202   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  4dzi-C  8.0  4.1  177   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  1j5s-A  8.0  3.9  196   451   10 PDB  MOLECULE: URONATE ISOMERASE;                                         
  50:  4ofc-A  7.6  3.8  175   335   10 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  51:  4qrn-A  7.6  3.6  180   352    7 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  52:  3pnu-A  7.5  5.6  180   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  53:  1a5k-C  7.5  6.4  196   566    9 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  54:  3giq-A  7.5  7.0  189   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  55:  3ooq-A  7.5  8.3  169   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  56:  2gwg-A  7.0  3.7  172   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  57:  3e74-A  6.6  7.6  179   429   11 PDB  MOLECULE: ALLANTOINASE;                                              
  58:  2a3l-A  6.2  3.6  174   616   13 PDB  MOLECULE: AMP DEAMINASE;                                             
  59:  1bks-A  5.8  3.7  146   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=3au2A Sbjct=3au2A Z-score=67.2

back to top
DSSP  LLHHHHHHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHLLLLHHHHHLLLHHHHLLLLL
Query MRNQELARIFEEIGLMSEFLGDNPFRVRAYHQAARTLYDLDTPIEEIAEKGKEALMELPG   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MRNQELARIFEEIGLMSEFLGDNPFRVRAYHQAARTLYDLDTPIEEIAEKGKEALMELPG   60
DSSP  LLHHHHHHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHLLLLHHHHHLLLHHHHLLLLL


DSSP  LLHHHHHHHHHHHHHLLLHHHHHHHHHLLHHHHHHHLLLLLLHHHHHHHHHHHLLLLHHH
Query VGPDLAEKILEFLRTGKVRKHEELSRKVPRGVLEVMEVPGVGPKTARLLYEGLGIDSLEK  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VGPDLAEKILEFLRTGKVRKHEELSRKVPRGVLEVMEVPGVGPKTARLLYEGLGIDSLEK  120
DSSP  LLHHHHHHHHHHHHHLLLHHHHHHHHHLLHHHHHHHLLLLLLHHHHHHHHHHHLLLLHHH


DSSP  HHHHHHHLHHHHLLLLLHHHHHHHHHHHHHHHHLLLLEEHHHHHHHHHHHHHHHHLLLLL
Query LKAALDRGDLTRLKGFGPKRAERIREGLALAQAAGKRRPLGAVLSLARSLLEAIRALPGV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LKAALDRGDLTRLKGFGPKRAERIREGLALAQAAGKRRPLGAVLSLARSLLEAIRALPGV  180
DSSP  HHHHHHHLHHHHLLLLLHHHHHHHHHHHHHHHHLLLLEEHHHHHHHHHHHHHHHHLLLLL


DSSP  LEEEELHHHHLLLLEELLEEEEEELLLHHHHHHHHHLLLLEEEEEEELLLEEEEEELLLL
Query ERAELCGSARRYKDTVGDLDFLVASREGERAVEGFVRLPQVKEVYAKGKERATVFLKNGL  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ERAELCGSARRYKDTVGDLDFLVASREGERAVEGFVRLPQVKEVYAKGKERATVFLKNGL  240
DSSP  LEEEELHHHHLLLLEELLEEEEEELLLHHHHHHHHHLLLLEEEEEEELLLEEEEEELLLL


DSSP  EEEEEEELHHHHHHHHHHHHLLHHHHHHHHHHHHHLLLEEELLEEEELLEEEELLLHHHH
Query QVDLRVVPPESYGAGLQYLTGSKAHSIRLRALAQEKGLKLSEYGVFRGEKRIAGETEEEV  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QVDLRVVPPESYGAGLQYLTGSKAHSIRLRALAQEKGLKLSEYGVFRGEKRIAGETEEEV  300
DSSP  EEEEEEELHHHHHHHHHHHHLLHHHHHHHHHHHHHLLLEEELLEEEELLEEEELLLHHHH


DSSP  HHHLLLLLLLHHHLLLLLHHHHHHLLLLLLLLLHHHLLEEEEELLLLLLLLLLHHHHHHH
Query YAALGLPWIPPPLREDQGEVEAALEGRLPKLLELPQVKGDLQVHSTYSDGQNTLEELWEA  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YAALGLPWIPPPLREDQGEVEAALEGRLPKLLELPQVKGDLQVHSTYSDGQNTLEELWEA  360
DSSP  HHHLLLLLLLHHHLLLLLHHHHHHLLLLLLLLLHHHLLEEEEELLLLLLLLLLHHHHHHH


DSSP  HHHHLLLEEEEEEELHHHHLLLLLLHHHHHHHHHHHHHHHHHHLLLEEEEEEEEELLLLL
Query AKTMGYRYLAVTDHSPAVRVAGGPSPEEALKRVGEIRRFNETHGPPYLLAGAEVDIHPDG  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AKTMGYRYLAVTDHSPAVRVAGGPSPEEALKRVGEIRRFNETHGPPYLLAGAEVDIHPDG  420
DSSP  HHHHLLLEEEEEEELHHHHLLLLLLHHHHHHHHHHHHHHHHHHLLLEEEEEEEEELLLLL


DSSP  LLLLLHHHHLLLLEEEEELLLLLLLLHHHHHHHHHHHHLLLLLLEELLLLLLLLLLLLLL
Query TLDYPDWVLRELDLVLVSVHSRFNLPKADQTKRLLKALENPFVHVLAHPTARLLGRRAPI  480
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TLDYPDWVLRELDLVLVSVHSRFNLPKADQTKRLLKALENPFVHVLAHPTARLLGRRAPI  480
DSSP  LLLLLHHHHLLLLEEEEELLLLLLLLHHHHHHHHHHHHLLLLLLEELLLLLLLLLLLLLL


DSSP  LLLHHHHHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHHLLLLEEEELLLLLHHHHHHHH
Query EADWEAVFQKAKEKGVAVEIDGYYDRMDLPDDLARMAYGMGLWISLSTDAHQTDHLRFME  540
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EADWEAVFQKAKEKGVAVEIDGYYDRMDLPDDLARMAYGMGLWISLSTDAHQTDHLRFME  540
DSSP  LLLHHHHHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHHLLLLEEEELLLLLHHHHHHHH


DSSP  HHHHHHHHLLLLLLLLHHHLLHHHHHHHHHLLLLL
Query LAVGTAQRAWIGPERVLNTLDYEDLLSWLKARRGV  575
ident |||||||||||||||||||||||||||||||||||
Sbjct LAVGTAQRAWIGPERVLNTLDYEDLLSWLKARRGV  575
DSSP  HHHHHHHHLLLLLLLLHHHLLHHHHHHHHHLLLLL


No 2: Query=3au2A Sbjct=1m65A Z-score=27.3

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLLL-LLLLLHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTYS-DGQNTLEELWE  359
ident                                        ||  |   |     ||     
Sbjct ------------------------------------YPVDLHMHTVAStHAYSTLSDYIA   24
DSSP  ------------------------------------LLEELLLLLLLLlLLLLLHHHHHH


DSSP  HHHHHLLLEEEEEEELHHHHLllLLLHHHHHHHHHhhHHHHhhHLLLEEEEEEEEELLL-
Query AAKTMGYRYLAVTDHSPAVRVagGPSPEEALKRVGeiRRFNetHGPPYLLAGAEVDIHP-  418
ident  ||  |    | ||| |       |                        | | |  |   
Sbjct QAKQKGIKLFAITDHGPDMED--APHHWHFINMRI--WPRV--VDGVGILRGIEANIKNv   78
DSSP  HHHHHLLLEEEEEEELLLLLL--LLLLHHHHHHHH--LLLE--ELLEEEEEEEEEELLLl


DSSP  LLLLLLLHHHHLLLLEEEEELL---LLLLlLHHHHHHHHHHHHLLLLLLEELLLLLLlll
Query DGTLDYPDWVLRELDLVLVSVH---SRFNlPKADQTKRLLKALENPFVHVLAHPTARllg  475
ident ||  |        |||     |         ||  |           ||   ||      
Sbjct DGEIDCSGKMFDSLDLIIAGFHepvFAPH-DKATNTQAMIATIASGNVHIISHPGNP---  134
DSSP  LLLLLLLHHHHHHLLEEEEELLlllLLLL-LHHHHHHHHHHHHHLLLLLEELLLLLL---


DSSP  lllLLLLLHHHHHHHHHHHLLEEEEELLLlllllLHHHHHHHHHLLLLEEEELLLLLHHH
Query rraPIEADWEAVFQKAKEKGVAVEIDGYYdrmdlPDDLARMAYGMGLWISLSTDAHQTDH  535
ident      | |  ||   |    || ||             |      | |  |  | |    
Sbjct ---KYEIDVKAVAEAAAKHQVALEINNSS----nCREVAAAVRDAGGWVALGSDSHTAFT  187
DSSP  ---LLLLLHHHHHHHHHHHLLEEEEELLL----lHHHHHHHHHHHLLLEEEELLLLLHHH


DSSP  HHHHHHHHHHHHHLLLLLLLLHHHLlHHHHHHHHHLLL--------ll
Query LRFMELAVGTAQRAWIGPERVLNTLdYEDLLSWLKARR--------gv  575
ident     |            ||| ||      ||  |  |           
Sbjct MGEFEECLKILDAVDFPPERILNVS-PRRLLNFLESRGmapiaefadl  234
DSSP  LLLLHHHHHHHHHLLLLHHHLHHHL-HHHHHHHHHHLLllllhhhlll


No 3: Query=3au2A Sbjct=3dcpA Z-score=18.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLLL--LLLLLHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTYS--DGQNTLEELW  358
ident                                      | |   |            ||  
Sbjct ------------------------------------XKRDGHTHTEFCphGTHDDVEEXV   24
DSSP  ------------------------------------LLEEEEELLLLLllLLLLLHHHHH


DSSP  HHHHHHLLLEEEEEEELHH------------hHLLL-LLLHHHHHHHHHHHHHHHHHHL-
Query EAAKTMGYRYLAVTDHSPA------------vRVAG-GPSPEEALKRVGEIRRFNETHG-  404
ident   |            | |               |                          
Sbjct LKAIELDFDEYSIVEHAPLssefxkntagdkeAVTTaSXAXSDLPYYFKKXNHIKKKYAs   84
DSSP  HHHHHLLLLEEEEEEELLLlhhhhhllllllhHHHLlLLLHHHHHHHHHHHHHHHHHLLl


DSSP  LLEEEEEEEEELLLLLL---llLLHHHHLLLLEEEEELLLLLL-----------------
Query PPYLLAGAEVDIHPDGT---ldYPDWVLRELDLVLVSVHSRFN-----------------  444
ident       | |||                    |    | |                     
Sbjct DLLIHIGFEVDYLIGYEdftrdFLNEYGPQTDDGVLSLHFLEGqggfrsidfsaedyneg  144
DSSP  LLEEEEEEEEELLLLLHhhhhhHHHHHHHHLLEEEEELLEEEElleeeellllhhhhhhh


DSSP  ---------lLHHHHHHHHHHHHLLL----LLLEELLLLL-LLLLL---------lllll
Query ---------lPKADQTKRLLKALENP----FVHVLAHPTA-RLLGR---------rapie  481
ident                        |            |                       
Sbjct ivqfyggfeqAQLAYLEGVKQSIEADlglfKPRRXGHISLcQKFQQffgedtsdfseevx  204
DSSP  lhhhhllhhhHHHHHHHHHHHHHHLLllllLLLEELLLLHhHLLHHhhlllhhhllhhhh


DSSP  lLHHHHHHHHHHHLLEEEEELLLL------LLLLLHHHHHHHHHLLLLEEEELLLLLHHH
Query aDWEAVFQKAKEKGVAVEIDGYYD------RMDLPDDLARMAYGMGLWISLSTDAHQTDH  535
ident           |                       |      |           | |    
Sbjct eKFRVILALVKKRDYELDFNTAGLfkplcgETYPPKKIVTLASELQIPFVYGSDSHGVQD  264
DSSP  hHHHHHHHHHHHHLLEEEEELHHHhlllllLLLLLHHHHHHHHHLLLLEEEELLLLLHHH


DSSP  -HHHHHHHHHHHHhllllllllhhhllhhhhhhhhhlllll
Query -LRFMELAVGTAQrawigpervlntldyedllswlkarrgv  575
ident   |                                      
Sbjct iGRGYSTYCQKLE----------------------------  277
DSSP  lLLLHHHHHHHLL----------------------------


No 4: Query=3au2A Sbjct=1v77A Z-score=14.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLllllllllhHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHStysdgqntlEELWEA  360
ident                                                        |  | 
Sbjct -----------------------------------VKFIEMDIRD---------KEAYEL   16
DSSP  -----------------------------------LLLEEEEELL---------HHHHHH


DSSP  HHHHlLLEEEEEEELHhhhllllLLHHhhHHHHHHHHHHHhhhllleEEEEEEEELLLlL
Query AKTMgYRYLAVTDHSPavrvaggPSPEeaLKRVGEIRRFNethgppyLLAGAEVDIHPdG  420
ident ||        |                       | |                       
Sbjct AKEW-FDEVVVSIKFN-------EEVD--KEKLREARKEY-------GKVAILLSNPK-P   58
DSSP  HHHH-LLEEEEEEEEL-------LLLL--HHHHHHHHHHH-------LLEEEEEELLL-H


DSSP  LLL--LLHHhHLLLlEEEEELLllllllhhhHHHHHHHHHLLLlLLEELLLLLlllllll
Query TLD--YPDWvLRELdLVLVSVHsrfnlpkadQTKRLLKALENPfVHVLAHPTArllgrra  478
ident  |             |  |                     |   |     |         
Sbjct SLVrdTVQK-FKSY-LIYVESN---------DLRVIRYSIEKG-VDAIISPWV-------   99
DSSP  HHHhhHHHH-LLLL-EEEEELL---------LHHHHHHHHHLL-LLEEELLLL-------


DSSP  LLLL--lHHHHHHHHHHHLLEEEEELLLL----------llllLHHHHHHHHHLLLLEEE
Query PIEA--dWEAVFQKAKEKGVAVEIDGYYD----------rmdlPDDLARMAYGMGLWISL  526
ident                  | ||                                      |
Sbjct NRKDpgiDHVLAKLMVKKNVALGFSLRPLlysnpyeranllrfMMKAWKLVEKYKVRRFL  159
DSSP  LLLLlllLHHHHHHHHHHLLEEEEELHHHhhllhhhhhhhhhhHHHHHHHHHHHLLLEEE


DSSP  ELLLLLHHHHH---HHHHHHHHHHhlLLLLL-lLHHHLlhhhhhHHHHLllll
Query STDAHQTDHLR---FMELAVGTAQraWIGPE-rVLNTLdyedllSWLKArrgv  575
ident    |      |                  |                       
Sbjct TSSAQEKWDVRyprDLISLGVVIG--MEIPQakASISM----ypEIILK----  202
DSSP  ELLLLLHHHLLlhhHHHHHHHHLL--LLHHHhhHLLLH----hhHHHHL----


No 5: Query=3au2A Sbjct=3qy6A Z-score=13.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELL--LLLLLLL---LHH
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHS--TYSDGQN---TLE  355
ident                                        |   |      ||        
Sbjct -------------------------------------MIDIHCHIlpAMDDGAGdsaDSI   23
DSSP  -------------------------------------LEELLLLLllLLLLLLLlhhHHH


DSSP  HHHHHHHHHLLLEEEEEEELHHhhlLLLLlhhHHHHHHHHHHHHHHHHL----LLEEEEE
Query ELWEAAKTMGYRYLAVTDHSPAvrvAGGPspeEALKRVGEIRRFNETHG----PPYLLAG  411
ident |   ||   | |    | |             |           |        |   | |
Sbjct EMARAAVRQGIRTIIATPHHNN---GVYK--nEPAAVREAADQLNKRLIkediPLHVLPG   78
DSSP  HHHHHHHHLLLLEEELLLEELL---LLLL--lLHHHHHHHHHHHHHHHHhlllLLEEELL


DSSP  EEEELLllLLLL--LLHHHhlLLLE-----EEEELLLLLlllhhhHHHHHHHHHLLL---
Query AEVDIHpdGTLD--YPDWVlrELDL-----VLVSVHSRFnlpkadQTKRLLKALENP---  461
ident  |  |   |             | |      |                            
Sbjct QEIRIY--GEVEqdLAKRQ--LLSLndtkyILIEFPFDH------VPRYAEQLFYDLqlk  128
DSSP  LEEELL--LLHHhhHHLLL--LLLHhhlleEEEELLLLL------LLLLHHHHHHHHhhl


DSSP  -LLLEELLLLLLllllllLLLL-LHHHHHHHHhhhlLEEEEELLL-------lllllLHH
Query -FVHVLAHPTARllgrraPIEA-DWEAVFQKAkekgVAVEIDGYY-------drmdlPDD  512
ident     | |||                     |      |  |                   
Sbjct gYIPVIAHPERN---reiRENPsLLYHLVEKG----AASQITSGSlagifgkqlkafSLR  181
DSSP  lLEEEEELHHHL---hhhHHLLhHHHHHHHLL----LEEEEEHHHhlllllhhhhhhHHH


DSSP  HHHHHhhllLLEEEELLLLLH--HHHHhHHHHHHHHHHLL---LLLLLL-HHHLlhhhHH
Query LARMAygmgLWISLSTDAHQT--DHLRfMELAVGTAQRAW---IGPERV-LNTLdyedLL  566
ident |        |      |||            |                     |    | 
Sbjct LVEAN----LIHFVASDAHNVktRNFH-TQEALYVLEKEFgseLPYMLTeNAEL---lLR  233
DSSP  HHHLL----LLLEEELLLLLLllLLLL-HHHHHHHHHHHHllhHHHHHHhHHHH---hHL


DSSP  HH-----hhlllll
Query SW-----lkarrgv  575
ident               
Sbjct NQtifrqppqpvkr  247
DSSP  LLllllllllllll


No 6: Query=3au2A Sbjct=2anuA Z-score=12.4

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLLLLLLLLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTYSDGQNTLEELWEA  360
ident                                        |  ||   |||   | |    
Sbjct ---------------------------------teWLLCDFHVHTNXSDGHLPLGEVVDL   27
DSSP  ---------------------------------leEEEEEEEELLLLLLLLLLHHHHHHH


DSSP  HHHHLLLEEEEEEELHH---------hhLLLL-LLHHHHHHHHHHHHHHHHHHL---LLE
Query AKTMGYRYLAVTDHSPA---------vrVAGG-PSPEEALKRVGEIRRFNETHG---PPY  407
ident     |      |||                 |               |            
Sbjct FGKHGVDVVSITDHIVDrrtleqrkrngEPLGaITEDKFQDYLKRLWREQKRAWeeyGXI   87
DSSP  HHHLLLLEEEEEEEEELhhhhhhhhhllLLLLlLLLLLHHHHHHHHHHHHHHHHhhhLLE


DSSP  EEEEEEEELLLL---llllllHHHHlllleeeeellllllllhhhhhhHHHHHhLLLL--
Query LLAGAEVDIHPD---gtldypDWVLreldlvlvsvhsrfnlpkadqtkRLLKAlENPF--  462
ident |  | |     |                                                
Sbjct LIPGVEITNNTDlyhivavdvKEYV-------------------dpslPVEEI-VEKLke  127
DSSP  EEEEEEEEELLLleeeeeellLLLL-------------------llllLHHHH-HHHHhh


DSSP  ---LLEELLllLLLLllLLLLL--LLHHHHHHHHhhhlLEEEEELLLllLLLLhhHHHHH
Query ---VHVLAHptARLLgrRAPIE--ADWEAVFQKAkekgVAVEIDGYYdrMDLPddLARMA  517
ident        ||               |  |           | ||                 
Sbjct qnaLVIAAH--PDRK--KLSWYlwANXERFKDTF----DAWEIANRD--DLFN--SVGVK  175
DSSP  lllEEEELL--LLLL--LLLLHhhHLLLLLLLLL----LEEEEEELL--EELH--HHHHL


DSSP  HhllLLEEEELLLLLHHHHHHHhhhhhhhhhllllllllhHHLL----HHHHHHHH----
Query YgmgLWISLSTDAHQTDHLRFMelavgtaqrawigpervlNTLD----YEDLLSWL----  569
ident            | |   |                               |          
Sbjct K---YRYVANSDFHELWHVYSW-----------------kTLVKseknIEAIKEAIrknt  215
DSSP  L---LLEEEELLLLLHHHHLLE-----------------eEEEEelllHHHHHHHHhhll


DSSP  ---hlllll
Query ---karrgv  575
ident          
Sbjct dvaiylxrk  224
DSSP  leeeeelll


No 7: Query=3au2A Sbjct=4mupB Z-score=10.9

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhllllllllLHHH-lLEEEEELLL-------------
Query yaalglpwippplredqgeveaalegrlpkllELPQ-vKGDLQVHST-------------  346
ident                                         | | |               
Sbjct ---------------------lvrklsgtapnPAFPrgAVDTQMHMYlpgypalpggpgl   39
DSSP  ---------------------lllllllllllLLLLllLEELLLLLLlllllllllllll


DSSP  llllLLLHHHHHHHHHHHLLLEEEEEEELhhhhlllLLLHhHHHHHHHHHHHHHHhhlll
Query ysdgQNTLEELWEAAKTMGYRYLAVTDHSpavrvagGPSPeEALKRVGEIRRFNEthgpp  406
ident         |         |      |                            |     
Sbjct ppgaLPGPEDYRRLMQWLGIDRVIITQGN-------AHQR-DNGNTLACVAEMGE-----   86
DSSP  llllLLLHHHHHHHHHHHLLLEEEEELLH-------HHLL-LLHHHHHHHHHHHH-----


DSSP  EEEEE----------------------EEEEL----lllLLLL-lLHHHHL-lllEEEEE
Query YLLAG----------------------AEVDI----hpdGTLD-yPDWVLR-eldLVLVS  438
ident    |                       |                  |         | | 
Sbjct AAHAVviidatttekdmekltaagtvgARIMDlpggavnLSELdaVDERAHaadwMVAVQ  146
DSSP  HEEEEelllllllhhhhhhhhhlleeeEEEELlllllllHHHHhhHHHHHHhlllEEEEE


DSSP  LLllllllhhHHHHHHHHHHLLLLLLEELL-LLLLlllllLLLL---LLHHHHHHHHHHH
Query VHsrfnlpkaDQTKRLLKALENPFVHVLAH-PTARllgrrAPIE---ADWEAVFQKAKEK  494
ident                |          |  |            |        |        
Sbjct FD------gnGLLDHLPRLQKIRSRWVFDHhGKFF-----KGIRtdgPEMAALLKLIDRG  195
DSSP  LL------hhHHHHHHHHHHLLLLEEEELHhHHLL-----LLLLlllHHHHHHHHHHHHL


DSSP  LLEEEEElLLLL-------lllLHHHHHHHHHLL-lLEEEELLLLL--------hHHHH-
Query GVAVEIDgYYDR-------mdlPDDLARMAYGMG-lWISLSTDAHQ--------tDHLR-  537
ident                            |         |   |                  
Sbjct NLWFKFA-GVYEssrkswpyadVAAFSRVIAAHApeRIVWGTNWPHnsvretaayPDDAr  254
DSSP  LEEEEEL-LHHHllllllllhhHHHHHHHHHHHLhhHEEELLLLLLlllllhhhlLLHHh


DSSP  HHHHHHHHHhhlLLLLL-lLHHHLlhhhHHHHHHlllll
Query FMELAVGTAqraWIGPE-rVLNTLdyedLLSWLKarrgv  575
ident   ||  |                          |     
Sbjct LAELTLGWL---PDEAArhRALVE---nPEALFK-lspv  286
DSSP  HHHHHHLLL---LLHHHhhHHHLH---hHHHHHL-llll


No 8: Query=3au2A Sbjct=2oofA Z-score=10.9

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllLLLL-----------------------------
Query yaalglpwippplredqgeveaalegrLPKL-----------------------------  331
ident                            |                                
Sbjct ---------lncervwlnvtpatlrsdLADYgllephalgvhegrihalvpxqdlkypah   51
DSSP  ---------lllleeeeeeeellllllLLLLllllleeeeeelleeeeeeehhhllllll


DSSP  ------llhHHLLEEEEELLLL--------------------------------------
Query ------lelPQVKGDLQVHSTY--------------------------------------  347
ident               |   |                                         
Sbjct wqdxkgklvTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraas  111
DSSP  leelllleeEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhll


DSSP  -lllllLHHHHHHHHHHHLLLEEEEEEElhhhhlllLLLHHHHHHHHHHHHHHHHHHLLl
Query -sdgqnTLEELWEAAKTMGYRYLAVTDHspavrvagGPSPEEALKRVGEIRRFNETHGPp  406
ident                   |                 |   |  ||     ||  |     
Sbjct edqlfeLALPRVKSLIREGVTTVEIKSG-------yGLTLEDELKXLRVARRLGEALPI-  163
DSSP  hhhhhhHHHHHHHHHHHHLEEEEEEELL-------lLLLHHHHHHHHHHHHHHHHHLLL-


DSSP  EEEEEE--------------------------------------EEEL------LLLLL-
Query YLLAGA--------------------------------------EVDI------HPDGT-  421
ident                                              |              
Sbjct RVKTTLlaahavppeyrddpdswveticqeiipaaaeagladavDVFCehigfsLAQTEq  223
DSSP  EEEEEEeeellllhhhlllhhhhhhhhhhlhhhhhhhllllleeEEEEllllllHHHHHh


DSSP  -LLLLH-HHHLllleEEEELlllllllhhhHHHHHHHHHLLLlLLEELLLLlllllllll
Query -LDYPD-WVLReldlVLVSVhsrfnlpkadQTKRLLKALENPfVHVLAHPTarllgrrap  479
ident      |   |     |                     |          |           
Sbjct vYLAADqYGLA----VKGHX------dqlsNLGGSTLAANFG-ALSVDHLE---------  263
DSSP  hHHHHHhLLLE----EEEEE------llllLLLHHHHHHHLL-LLEEEELL---------


DSSP  llllHHHHHHHHHHHLLEEEEELLLLL--llllHHHHHHHHHLLLLEEEELLLL----LH
Query ieadWEAVFQKAKEKGVAVEIDGYYDR--mdlpDDLARMAYGMGLWISLSTDAH----QT  533
ident          |     ||                          |     | |        
Sbjct --ylDPEGIQALAHRGVVATLLPTAFYflketkLPPVVALRKAGVPXAVSSDINpgtaPI  321
DSSP  --llLHHHHHHHHHHLLEEEELHHHHHhlllllLLLHHHHHHLLLLEEELLLLLllllLL


DSSP  HHH-HHHHHHHH-HHHHlllllllLHHHL---lhhhHHHH--------------------
Query DHL-RFMELAVG-TAQRawigperVLNTL---dyedLLSW--------------------  568
ident   |      |                 |                                
Sbjct VSLrXAXNXACTlFGLT--pveaxAGVTRhaaralgEQEQlgqlrvgxladflvwncghp  379
DSSP  LLHhHHHHHHHHhHLLL--hhhhhHHLLHhhhhhllLLLLllllllllllleeeelllll


DSSP  -----------------hhlllll
Query -----------------lkarrgv  575
ident                         
Sbjct aelsyligvdqlvsrvvngeetlh  403
DSSP  lhhhhlllllleeeeeelleelll


No 9: Query=3au2A Sbjct=1yrrB Z-score=10.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
ident                                                        |    
Sbjct ----------------------yaltqgriftgheflddhavviadgliksvcPVAELP-   37
DSSP  ----------------------leeelleeelllleelleeeeeelleeeeeeEHHHLL-


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   37
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   37
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELL----LLLL-----ll
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHS----TYSD-----gq  351
ident                                        | |          |       
Sbjct ---------------------peieqrslngailSPGFIDVQLNGcggvQFNDtaeavsv   76
DSSP  ---------------------lllleeelllleeEELEEEEEELEelleELLLllllllh


DSSP  lLHHHHHHHHHHHLLLEEEEEEELHhhhlllllLHHHHHHHHHHHHHHHHHHLLLEEEEE
Query nTLEELWEAAKTMGYRYLAVTDHSPavrvaggpSPEEALKRVGEIRRFNETHGPPYLLAG  411
ident  |||    |    |      |            | |     |   |     |    |   
Sbjct eTLEIMQKANEKSGCTNYLPTLITT--------SDELMKQGVRVMREYLAKHPNQALGLH  128
DSSP  hHHHHHHHHHHLLLEEEEEEEELLL--------LHHHHHHHHHHHHHHHHHLLLLLLLEE


DSSP  EE-EELLlllllllLHHHHLL---LLEEE----------------------EELLLllll
Query AE-VDIHpdgtldyPDWVLRE---LDLVL----------------------VSVHSrfnl  445
ident  |             |           |                                
Sbjct LEgPWLN----aalVDFLCENadvITKVTlapemvpaevisklanagivvsAGHSN----  180
DSSP  EElLLLL----lhhHHHHHHLhhhEEEEEelhhhllhhhhhhhhhhlleeeELLLL----


DSSP  lhhhHHHHHHHHHLLLlLLEELLLLLLllllllLLLL------lHHHHHHHhhhHLLEEE
Query pkadQTKRLLKALENPfVHVLAHPTARllgrraPIEA------dWEAVFQKakeKGVAVE  499
ident       |               |                       |             
Sbjct ---aTLKEAKAGFRAG-ITFATHLYNA------MPYItgrepglAGAILDE---ADIYCG  227
DSSP  ---lLHHHHHHHHHHL-EEEELLLLLL------LLLLlllllhhHHHHHHL---LLLEEE


DSSP  EELLLLLLllLHHHHHHHHHL-LLLEEEELLLLlhhHHHHHHHHHHHHH-HLLLLLLL--
Query IDGYYDRMdlPDDLARMAYGM-GLWISLSTDAHqtdHLRFMELAVGTAQ-RAWIGPER--  555
ident |              | |    |    | |||        |   |        |      
Sbjct IIADGLHV--DYANIRNAKRLkGDKLCLVTDAT-sgSSLTMIEGVRNLVeHCGIALDEvl  284
DSSP  EELLLLLL--LHHHHHHHHHHhHHHEEEELLLL-llLLLLHHHHHHHHHhHHLLLHHHhh


DSSP  LHHHL-lhhhHHHH-----------------------------hhlllll
Query VLNTL-dyedLLSW-----------------------------lkarrgv  575
ident    ||                                             
Sbjct RMATLyparaIGVEkrlgtlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  HHHLHhhhhhLLLLllllllllllllleeeellllleeeeeelleeeeel


No 10: Query=3au2A Sbjct=3mtwA Z-score=10.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
ident                                                             
Sbjct -----------------aeikavsaarlldvasgkyvdnplvivtdgritsigKKGDAV-   42
DSSP  -----------------lleeeeeeeeeeelllleeeeleeeeeelleeeeeeELLLLL-


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   42
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   42
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLL--------------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHST--------------  346
ident                                        |  ||                
Sbjct --------------------pagatavdlpgvtlLPGLIDMHVHLDslaevggynsleys   82
DSSP  --------------------lllleeeeeeeeeeEELEEEEEELLLllllllhhhhhhll


DSSP  llllllLHHHHHHHHHHHLLLEEEEE---------------------------EELH---
Query ysdgqnTLEELWEAAKTMGYRYLAVT---------------------------DHSP---  376
ident                   |                                    |    
Sbjct drfwsvVQTANAKKTLEAGFTTVRNVgaadyddvglreaidagyvpgprivtaAISFgat  142
DSSP  hhhhhhHHHHHHHHHHHLLEEEEEELlllllhhhhhhhhhhllllllleeeelLLLEell


DSSP  --HHHL---------LLLL----------LHHHHHHHHhhhhhhhhhhllleeeEEEEEE
Query --AVRV---------AGGP----------SPEEALKRVgeirrfnethgppyllAGAEVD  415
ident                                    |                        
Sbjct ggHCDStffppsmdqKNPFnsdspdearkAVRTLKKYG---------------aQVIXIC  187
DSSP  llLLLLllllhhhllLLLLllllhhhhhhHHHHHHHLL---------------lLEEEEE


DSSP  L--------------LLLL--LLLLLHHHH-LLLLeEEEELlllllllhhhHHHHHHHHH
Query I--------------HPDG--TLDYPDWVL-RELDlVLVSVhsrfnlpkadQTKRLLKAL  458
ident                           |         |                     | 
Sbjct AtggvfsrgnepgqqQLTYeeMKAVVDEAHmAGIK-VAAHA---------hGASGIREAV  237
DSSP  LllllllllllllllLLLHhhHHHHHHHHHhLLLE-EEEEE---------lLHHHHHHHH


DSSP  LLLlLLEELLLLlllllllllllLLHHHHHHHHHHHLLEEEEE-LLLL------------
Query ENPfVHVLAHPTarllgrrapieADWEAVFQKAKEKGVAVEID-GYYD------------  505
ident     |    |                      |  ||     |    |            
Sbjct RAG-VDTIEHAS-----------LVDDEGIKLAVQKGAYFSMDiYNTDytqaegkkngvl  285
DSSP  HLL-LLEEEELL-----------LLLHHHHHHHHHHLLEEELLlLLHHhhhhhhhhhlll


DSSP  ---------llllLHHHHHHHHHLLLLEEEELLLLLhHHHHHHHhHHHHHHHLLLLLLL-
Query ---------rmdlPDDLARMAYGMGLWISLSTDAHQtDHLRFMElAVGTAQRAWIGPER-  555
ident                   | |   |      |||    |            |    |   
Sbjct ednlrkdrdigelQRENFRKALKAGVKMVYGTDAGIyPHGDNAK-QFAVMVRYGATPLQa  344
DSSP  hhhhhhhhhhhhhHHHHHHHHHHHLLEEELLLLLLLlLLLLHHH-HHHHHHHLLLLHHHh


DSSP  -LHHHLlhhhHHHHHH------------------------------------------ll
Query -VLNTLdyedLLSWLK------------------------------------------ar  572
ident     ||        |                                             
Sbjct iQSATL---tAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvk  401
DSSP  hHHLLH---hHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeee


DSSP  lll
Query rgv  575
ident    
Sbjct apx  404
DSSP  lll


No 11: Query=3au2A Sbjct=2yb1A Z-score=10.7

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLLLLLLLLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTYSDGQNTLEELWEA  360
ident                                        ||  ||  |||  |  |    
Sbjct ------------------------------------ANIDLHFHSRTSDGALTPTEVIDR   24
DSSP  ------------------------------------LLEELLLLLLLLLLLLLHHHHHHH


DSSP  HHHHLLLEEEEEEELhhhhllllllhhhhhHHHHHHHHHHHHHLLlEEEEEEEEELLLL-
Query AKTMGYRYLAVTDHSpavrvaggpspeealKRVGEIRRFNETHGPpYLLAGAEVDIHPD-  419
ident |       || |||                    |        |    | | ||      
Sbjct AAARAPALLALTDHD-------------ctGGLAEAAAAAARRGI-PFLNGVEVSVSWGr   70
DSSP  HHLLLLLEEEELLLL-------------llLLHHHHHHHHHHLLL-LEEEEEEEEEEELl


DSSP  ----------lllllLHHHHL---------------------------------------
Query ----------gtldyPDWVLR---------------------------------------  430
ident                                                             
Sbjct htvhivglgidpaepALAAGLksiregrlerarqmgasleaagiagcfdgamrwcdnpem  130
DSSP  eeeeeeeellllllhHHHHHHhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhh


DSSP  ---------------llleeeeellllllllhhhhhhhhhHHHL-LLLL------LEELL
Query ---------------eldlvlvsvhsrfnlpkadqtkrllKALE-NPFV------HVLAH  468
ident                                                         | ||
Sbjct isrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDaVGWIvgaggmAVIAH  190
DSSP  llhhhhhhhhhhllllllhhhhhhhlllllllllllllllLHHHhHHHHhhllleEEELL


DSSP  LLLLllllllLLLL-LHHHHHHHHHH-HLLEEEE-ELLLLlllLLHHHHHHHHHLLLLEE
Query PTARllgrraPIEA-DWEAVFQKAKE-KGVAVEI-DGYYDrmdLPDDLARMAYGMGLWIS  525
ident |                |          |   |   |           |  |   ||  |
Sbjct PGRY------DMGRtLIERLILDFQAaGGQGIEVaSGSHS-ldDMHKFALHADRHGLYAS  243
DSSP  HHHL------LLLHhHHHHHHHHHHHlLLLEEEEeELLLL-hhHHHHHHHHHHHHLLEEE


DSSP  EELLLLLHHHH-hHHHHhhhHHHHllllllLLHHHllhhHHHH--hhhlllll
Query LSTDAHQTDHL-rFMELavgTAQRawigpeRVLNTldyeDLLS--wlkarrgv  575
ident    | |         |              |         |            
Sbjct SGSDFHAPGEDvgHTED---LPPI-----cRPIWR----ELEArilrpadaen  284
DSSP  EELLLLLLLLLllLLLL---LLLL-----lLLHHH----HLHHhlllllhhhl


No 12: Query=3au2A Sbjct=3gg7A Z-score=10.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLlllLLLLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTysdGQNTLEELWEA  360
ident                                        |  ||               |
Sbjct ------------------------------------SLIDFHVHLD---LYPDPVAVARA   21
DSSP  ------------------------------------LLEEEEELHH---HLLLHHHHHHH


DSSP  HHHHLLlEEEEEEElhhhhllllllhhhHHHHHHHHHHHHHhHLLLeEEEE---------
Query AKTMGYrYLAVTDHspavrvaggpspeeALKRVGEIRRFNEtHGPPyLLAG---------  411
ident                                             |               
Sbjct CEERQL-TVLSVTT--------------TPAAWRGTLALAA-GRPH-VWTAlgfhpevvs   64
DSSP  HHHLLL-EEEELLL--------------LHHHHHHHHHHHL-LLLL-EEELllllhhhll


DSSP  -------------------EEEELLLL------------llllLLHHH-hllllEEEEEL
Query -------------------AEVDIHPD------------gtldYPDWV-lreldLVLVSV  439
ident                     ||                                      
Sbjct eraadlpwfdrylpetrfvGEVGLDGSpslrgtwtqqfavfqhILRRCedhggrILSIHS  124
DSSP  llhhhlhhhhhhhhhlleeEEEELLLLhhhhhhhhhhhhhhhhHHHHHhhllleEEEEEL


DSSP  LllllllhhhhhhHHHHHHLLL------LLLEELLLLlllllllllllllHHHHHHHHHH
Query HsrfnlpkadqtkRLLKALENP------FVHVLAHPTarllgrrapieadWEAVFQKAKE  493
ident                   |             |                        |  
Sbjct R-----------rAESEVLNCLeanprsGTPILHWYS------------gSVTELRRAIS  161
DSSP  L-----------lLHHHHHHHHhhlhhhEEEEEELLL------------lLHHHHHHHHH


DSSP  HLLEEEEELllllLLLL----HHHHHHHHhlllLEEEELLLL------lHHHHHHHHHHH
Query KGVAVEIDGyydrMDLP----DDLARMAYgmglWISLSTDAH------qTDHLRFMELAV  543
ident  |                     | |            ||                   |
Sbjct LGCWFSVGP----TMVRtqkgAALIRSMP--rdRVLTETDGPfleldgqAALPWDVKSVV  215
DSSP  LLLEEEELH----HHHLlhhhHHHHHHLL--hhHEEELLLLLlleelleELLHHHHHHHH


DSSP  HHHHHLL-----lLLLLlHHHLlhhhHHHHHHLllll
Query GTAQRAW-----iGPERvLNTLdyedLLSWLKArrgv  575
ident       |                       |      
Sbjct EGLSKIWqipaseVERI-VKEN----VSRLLGT----  243
DSSP  HHHHHHHlllhhhHHHH-HHHH----HHHHHHL----


No 13: Query=3au2A Sbjct=2vunA Z-score=10.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
ident                                                             
Sbjct --------------sktiiknigkivsgdikspvlqadtivvedgliaaiggeELMKDA-   45
DSSP  --------------leeeeellleeellllllleellleeeeelleeeeeelhHHHLLL-


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   45
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   45
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllllllLHHH----
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysdgqnTLEE----  356
ident                                        |  ||                
Sbjct ---------------------gdatiidaagstvTPGLLDTHVHVS------GGDYaprq   78
DSSP  ---------------------llleeeelllleeEELEEEEEELLL------LLLEehhh


DSSP  ----HHHHHHHHLLLEEEEEEE-lhhhhLLLL-lLHHHHHHHHHHHHHHHhhHLLLEEEE
Query ----LWEAAKTMGYRYLAVTDH-spavrVAGG-pSPEEALKRVGEIRRFNetHGPPYLLA  410
ident         |   |                         |                     
Sbjct ktmdFISSALHGGVTTMISAGSphfpgrPKDAagTKALAITLSKSYYNAR--PAGVKVHG  136
DSSP  leelHHHHHHLLLEEEEEELLLllllllLLLHhhHHHHHHHHHHHHHHLL--HHHLEEEL


DSSP  EE-----------------------EEEL---LLLLL------llLLHHHHllllEEEEE
Query GA-----------------------EVDI---HPDGT------ldYPDWVLreldLVLVS  438
ident ||                                                      |   
Sbjct GAvilekglteedfiemkkegvwivGEVGlgtIKNPEdaapmvewAHKHGF----KVQMH  192
DSSP  LEelllllllhhhhhhhhhlllleeEEELlllLLLHHhhhhhhhhHHHLLL----EEEEE


DSSP  L-LLLLlllhhhHHHHHHHHHllllLLEELLL-LLLLlllllLLLL-LHHHHHHHHhhhL
Query V-HSRFnlpkadQTKRLLKALenpfVHVLAHP-TARLlgrraPIEA-DWEAVFQKAkekG  495
ident                   |        |  |            |                
Sbjct TgGTSIpgsstvTADDVIKTK----PDVVSHInGGPT-----AISVqEVDRIMDET---D  240
DSSP  LlLLLLllllllLHHHHHHHL----LLEEELLlLLLL-----LLLHhHHHHHHHHL---L


DSSP  LEEEEELlllLLLL--LHHHHHHHHHLLL--LEEEELLLLL--hHHHHHHHHHHHHHH-H
Query VAVEIDGyydRMDL--PDDLARMAYGMGL--WISLSTDAHQ--tDHLRFMELAVGTAQ-R  548
ident  | ||            |  || |   |         ||                     
Sbjct FAMEIVQ---CGNPkiADYVARRAAEKGQlgRVIFGNDAPSgtgLIPLGILRNMCQIAsM  297
DSSP  LEEEEEL---LLLHhhHHHHHHHHHHHLLhhHEEEELLLLLlllLLLLHHHHHHHHHHhH


DSSP  LLLLLLL--LHHHLLhhhHHHHHH------------------------------------
Query AWIGPER--VLNTLDyedLLSWLK------------------------------------  570
ident   | ||      |                                               
Sbjct SDIDPEVavCMATGN---STAVYGlntgviapgkeadliimdtplgsvaedamgaiaagd  354
DSSP  LLLLHHHhhHHHLHH---HHHHHLllllllllllllleeeeelllllllllhhhhhhhll


DSSP  --------------------------lllll
Query --------------------------arrgv  575
ident                                
Sbjct ipgisvvlidgeavvtksrntppakraakil  385
DSSP  lleeeeeeelleeeellllllllllllleel


No 14: Query=3au2A Sbjct=3cjpA Z-score=10.4

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLlllllLLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTysdgqNTLEELWEA  360
ident                                        |   |          |     
Sbjct ------------------------------------LIIDGHTHVI-----LPVEKHIKI   19
DSSP  ------------------------------------LLEEEEEELL-----LLHHHHHHH


DSSP  HHHHLLLEEEEEE--------------------elHHHH--LLLL-lLHHHHHHHHHHHH
Query AKTMGYRYLAVTD--------------------hsPAVR--VAGG-pSPEEALKRVGEIR  397
ident     |                                |               |      
Sbjct MDEAGVDKTILFStsihpetavnlrdvkkemkklnDVVNgkTNSMidVRRNSIKELTNVI   79
DSSP  HHHHLLLEEEEELllllhhhlllhhhhhhhhhhhhHHHLllLLLLhhHHHHHHHHHHHHH


DSSP  HHHHhhlllEEEEE----------------------------EEEELLLLLL--lllLHH
Query RFNEthgppYLLAG----------------------------AEVDIHPDGT--ldyPDW  427
ident                                            |                
Sbjct QAYP----sRYVGFgnvpvglsendtnsyieenivnnklvgiGELTPASGQIkslkpIFK  135
DSSP  HHLL----lLEEEEelllllllhhhhhhhhhhhllllllleeEEELLLLLLHhhhhhHHH


DSSP  HHL--lllEEEEELLLLllllhhhHHHHHHHHHLLL-----LLLEELLLLLlllllllll
Query VLR--eldLVLVSVHSRfnlpkadQTKRLLKALENP-----FVHVLAHPTArllgrrapi  480
ident                                  |           | |            
Sbjct YSMdsgslPIWIHAFNP------lVLQDIKEIAELCkafpkVPVILGHMGG---------  180
DSSP  HHHhllllLEEELLLLL------lLHHHHHHHHHHHhhlllLLEEEHHHHH---------


DSSP  lLLHHHHHHHHHHH-LLEEEEEllllllLLLH-HHHHHHHHLL-lLEEEELLLLLhhHHH
Query eADWEAVFQKAKEK-GVAVEIDgyydrmDLPD-DLARMAYGMG-lWISLSTDAHQtdHLR  537
ident    |      |||                                     ||      | 
Sbjct -SNWMTAVELAKEIqNLYLDTS------AYFStFVLKIVINELplKCIFGTDMPF-gDLQ  232
DSSP  -HHHHHHHHHHHHLlLEEEELL------LLLLhHHHHHHHHHLllLEELLLLLLL-lLHH


DSSP  H-HHHHHHHHhhlLLLLL-lLHHHLlhHHHHHhhhlllll
Query F-MELAVGTAqraWIGPE-rVLNTLdyEDLLSwlkarrgv  575
ident    |                         ||         
Sbjct LsIEAIKKMS---NDSYVanAVLGDniSRLLN-------i  262
DSSP  HhHHHHHHHL---LLHHHhhHHHLHhhHHHHL-------l


No 15: Query=3au2A Sbjct=3f2bA Z-score=10.2

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhHHHHLLLLl
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarsllEAIRALPGv  180
ident                                                             
Sbjct --------------------------------------------------vRRLETIVE-    9
DSSP  --------------------------------------------------lLLHHHLLL-


DSSP  leeeelhhhhlllleelleeeeeelllhhHHHH---------------------------
Query eraelcgsarrykdtvgdldflvasregeRAVE---------------------------  213
ident                                                             
Sbjct -----------------------------EERRvvvqgyvfdaevselksgrtlltmkit   40
DSSP  -----------------------------LEEEeeeeeeeeeeeeeellllleeeeeeee


DSSP  hhhllLLEE--------------------------------------EEEEellleeeee
Query gfvrlPQVK--------------------------------------EVYAkgkeratvf  235
ident        ||                                                   
Sbjct dytnsILVKmfsrdkedaelmsgvkkgmwvkvrgsvqndtfvrdlviIAND---------   91
DSSP  lllleEEEEeelllhhhhhhhhlllllleeeeeeeeeeelllleeeeEEEE---------


DSSP  elllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeell
Query lknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriage  295
ident                                                             
Sbjct ------------------------------------------------------------   91
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLL--LLLLL
Query teeevyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYS--DGQNT  353
ident                                              |  |   |  |    
Sbjct ------------------------lneiaanerqdtapeGEKRVELHLHTPMSqmDAVTS  127
DSSP  ------------------------eeeelllllllllllLLLLLLLLLLLLLLllLLLLL


DSSP  HHHHHHHHHHHLLLEEEEEEELhhhhllllllhhhHHHHHHHHHHHHHHHLLlEEEEEEE
Query LEELWEAAKTMGYRYLAVTDHSpavrvaggpspeeALKRVGEIRRFNETHGPpYLLAGAE  413
ident    | | ||  |    |||||                    |       ||      | |
Sbjct VTKLIEQAKKWGHPAIAVTDHA-------------VVQSFPEAYSAAKKHGM-KVIYGLE  173
DSSP  HHHHHHHHHHLLLLLEEELLLL-------------LLLLHHHHHHHHHHHLL-LEEEEEE


DSSP  EELLLL-------llllllHHHHLllleeeeellllllllhhhhhhhhhHHHL--LLLL-
Query VDIHPD-------gtldypDWVLReldlvlvsvhsrfnlpkadqtkrllKALE--NPFV-  463
ident   |  |                |                            |        
Sbjct ANIVDDpfhvtllaqnetgLKNLF------klvslshiqyfhrvpriprSVLVkhRDGLl  227
DSSP  EEEELLleeeeeeellhhhHHHHH------hhhhhhhllllllllleehHHHHhlLLLEe


DSSP  LEELLLLLlllllllllLLLHhHHHHHHhhhlLEEEEELlLLLL------------llLH
Query HVLAHPTArllgrrapiEADWeAVFQKAkekgVAVEIDGyYDRM------------dlPD  511
ident                                    |     |                  
Sbjct VGSGCDKG------elfDNVE-DIARFY----DFLEVHP-PDVYkplyvkdeemikniIR  275
DSSP  EELLLLLL------lllLLLL-LLHHHL----LLEEELL-HHHHlllllllhhhhhhhHH


DSSP  HHHHHHHHLLLLEEEELLLLLHH----------------------------HHHHhHHHH
Query DLARMAYGMGLWISLSTDAHQTD----------------------------HLRFmELAV  543
ident                    |                                 |      
Sbjct SIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelpdvYFRTtNEML  335
DSSP  HHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllllllLLLLhHHHH


DSSP  HHHHHLL--LLLL--lLHHHLlhhHHHH--------------------------------
Query GTAQRAW--IGPE--rVLNTLdyeDLLS--------------------------------  567
ident             |            |                                  
Sbjct DCFSFLGpeKAKEivvDNTQK-iaSLIGdvkpikdelytpriegadeeiremsyrrakei  394
DSSP  HHHHHHHhhHHHHhhlHHHHH-hhHLLLllllllllllllllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct ygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatm  454
DSSP  hlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct teitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetfl  514
DSSP  llllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct gfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdh  574
DSSP  llllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct nlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtth  634
DSSP  lllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct fdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpe  694
DSSP  eehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct qimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtc  754
DSSP  hhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct tlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsc  814
DSSP  lhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct kkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkr  874
DSSP  hhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  567
ident                                                             
Sbjct ieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfn  934
DSSP  hhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhh


DSSP  ----------------------------------------------------hhhlllll
Query ----------------------------------------------------wlkarrgv  575
ident                                                             
Sbjct aipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 16: Query=3au2A Sbjct=4dlfA Z-score=10.2

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLL-------------
Query yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTY-------------  347
ident                                        |   |                
Sbjct -----------------------------------ALRIDSHQHFWRyraadypwigagm   25
DSSP  -----------------------------------LLLEEEEELLLLllhhhllllllll


DSSP  --lllLLLHHHHHHHHHHHLLLEEEEEEELHhhhllllllHHHHHHHHHHHHHHHhhhlL
Query --sdgQNTLEELWEAAKTMGYRYLAVTDHSPavrvaggpsPEEALKRVGEIRRFNethgP  405
ident            |                                     |          
Sbjct gvlarDYLPDALHPLMHAQALGASIAVQARA---------GRDETAFLLELACDE----A   72
DSSP  hhhllLLLHHHHHHHHHHLLLLEEEEELLLL---------LHHHHHHHHHHHLLL----L


DSSP  LEEEEE------------------------EEEEL-----LLLLL-----lllLHHHhll
Query PYLLAG------------------------AEVDI-----HPDGT-----ldyPDWVlre  431
ident                                                        |    
Sbjct RIAAVVgwedlrapqlaervaewrgtklrgFRHQLqdeadVRAFVddadfargVAWLqan  132
DSSP  LEEEEEellllllllhhhhhhlllllleeeEEELHhhlllHHHHHhlhhhhhhHHHHhhl


DSSP  llEEEEELLllllllhhhHHHHHHHHHLLL--LLLEELLLLLLLLLLL---lllllLHHH
Query ldLVLVSVHsrfnlpkadQTKRLLKALENP--FVHVLAHPTARLLGRR---apieaDWEA  486
ident      | |          |                || |     |            | |
Sbjct dyVYDVLVF-------erQLPDVQAFCARHdaHWLVLDHAGKPALAEFdrddtalaRWRA  185
DSSP  llEEEELLL-------hhHHHHHHHHHHHLllLLEEEHHHHLLLHHHLlllllhhhHHHH


DSSP  HHHHHHHH-LLEEEEELLLLL-----------lllLHHHHHHHHHLLL--LEEEELLLLL
Query VFQKAKEK-GVAVEIDGYYDR-----------mdlPDDLARMAYGMGL--WISLSTDAHQ  532
ident           |     |                         |             |   
Sbjct ALRELAALpHVVCKLSGLVTEadwrrglrasdlrhIEQCLDAALDAFGpqRLMFGSDWPV  245
DSSP  HHHHHHLLlLEEEEELLLLLLllllllllhhhhhhHHHHHHHHHHHHLhhHEEELLLLLH


DSSP  ---hHHHH-HHHHHHHHHHHlLLLLLL--LHHHLlhhhHHHHHHlllll
Query ---tDHLR-FMELAVGTAQRaWIGPER--VLNTLdyedLLSWLKarrgv  575
ident             |    |            |                  
Sbjct cllaASYDeVASLVERWAES-RLSAAErsALWGG---tAARCYA---lp  287
DSSP  hhhlLLHHhHHHHHHHHHHH-HLLHHHhhHHLLH---hHHHHLL---ll


No 17: Query=3au2A Sbjct=4cqbA Z-score=10.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhHLLLLl
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaiRALPGv  180
ident                                                             
Sbjct --------------------skdfdliirnaylsekdsvydigivgdriikieaKIEGT-   39
DSSP  --------------------llleeeeeeeeeelllleeeeeeeelleeeeeelLLLLL-


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   39
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   39
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLllLLLL---------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStySDGQ---------  351
ident                                        |   |                
Sbjct ----------------------vkdeidakgnlvSPGFVDAHTHM--DKSFtstgerlpk   75
DSSP  ----------------------eeeeeellllleEELEEEEEELH--HHLLlllllllll


DSSP  ----------------------------lLHHHHHHHHHHHLLLEEEEEEelhhhhllll
Query ----------------------------nTLEELWEAAKTMGYRYLAVTDhspavrvagg  383
ident                                 |        |  |               
Sbjct fwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTLYTRTHV---------d  126
DSSP  lllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEEEE---------e


DSSP  LLHHHHHHHHHHHHHHHHHHL-LLEEEEE---------------------------EEEE
Query PSPEEALKRVGEIRRFNETHG-PPYLLAG---------------------------AEVD  415
ident        | |       |                                          
Sbjct VDSVAKTKAVEAVLEAKEELKdLIDIQVVafaqsgffvdleseslirksldmgcdlVGGV  186
DSSP  LLLLLLLHHHHHHHHHHHHLLlLLEEEEEeellllllllllhhhhhhhhhhhllleEELL


DSSP  LLL------LLLL--LLLH---HHHLllleEEEELLLlllllHHHHHHHHHHHHLLL---
Query IHP------DGTL--DYPD---WVLReldlVLVSVHSrfnlpKADQTKRLLKALENP---  461
ident           | |                      |                        
Sbjct DPAtrennvEGSLdlCFKLakeYDVD----IDYHIHD----iGTVGVYSINRLAQKTien  238
DSSP  LLLlllllhHHHHhhHHHHhhhLLLE----EEEEELL----lHHHHHHHHHHHHHHHhhl


DSSP  ---lLLEELLLLllllllllLLLL--LHHHHHHHHHHHLLEEEEELllLLLLlLHHHHHH
Query ---fVHVLAHPTarllgrraPIEA--DWEAVFQKAKEKGVAVEIDGyyDRMDlPDDLARM  516
ident          |                         |  |              |      
Sbjct gykgRVTTSHAW------cfADAPseWLDEAIPLYKDSGMKFVTCF--SSTP-PTMPVIK  289
DSSP  llllLEEEEELL------hhHHLLhhHHHHHHHHHHHHLLEEEEEL--LLLL-LLLLHHH


DSSP  HHHLLLLEEEELLLLL-----hHHHHhHHHHHHHHHH---------llLLLL--lLHHHL
Query AYGMGLWISLSTDAHQ-----tDHLRfMELAVGTAQR---------awIGPE--rVLNTL  560
ident     |       |              |                                
Sbjct LLEAGINLGCASDNIRdfwvpfGNGD-MVQGALIETQrlelktnrdlgLIWKmitSEGAR  348
DSSP  HHHLLLEEEEELLLLLllllllLLLL-HHHHHHHHHHhhllllhhhhhHHHHhhlHHHHH


DSSP  lhhhHHHH-----------------------------------------hhlllll
Query dyedLLSW-----------------------------------------lkarrgv  575
ident                                                         
Sbjct --vlGIEKnygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  --hhLLHHhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 18: Query=3au2A Sbjct=4c5yA Z-score=10.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLLL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPGV  180
ident                                                             
Sbjct --------------deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadIPKKY   46
DSSP  --------------lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhLLHHH


DSSP  Leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query Eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct L-----------------------------------------------------------   47
DSSP  H-----------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   47
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELlllllLLLL-------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHstysdGQNT-------  353
ident                                        |   |                
Sbjct ----------------------rstqsthrvpvlMPGLWDCHMH-----FGGDddyyndy   80
DSSP  ----------------------hhllleeeeeeeEELEEEEEEL-----LLLLlllllll


DSSP  --------------HHHHHHHHHHHLLLEEEEEE-------------------------E
Query --------------LEELWEAAKTMGYRYLAVTD-------------------------H  374
ident               |      |   ||                                 
Sbjct tsglathpassgarLARGCWEALQNGYTSYRDLAgygcevakaindgtivgpnvyssgaA  140
DSSP  hhhhhllhhhhhhhHHHHHHHHHHLLEEEEEELLllhhhhhhhhhllllllleeeelllE


DSSP  LHH---HHLL-----------------------------------lllLHHHHHHHHhhh
Query SPA---VRVA-----------------------------------ggpSPEEALKRVgei  396
ident                                                        |    
Sbjct LSQtagHGDIfalpagevlgsygvmnprpgywgagplciadgveevrrAVRLQIRRG---  197
DSSP  EELlllLLLLllllhhhhhhhhlllllllllllllleeelllhhhhhhHHHHHHHHL---


DSSP  hhhhhhhllleeeEEEEEEL--------------LLLLL--llLLHHHHLLLLEEEEELl
Query rrfnethgppyllAGAEVDI--------------HPDGT--ldYPDWVLRELDLVLVSVh  440
ident                  |                               |    |   | 
Sbjct ------------aKVIXVMAsggvmsrddnpnfaQFSPEelkvIVEEAARQNRIVSAHV-  244
DSSP  ------------lLLEEEELllllllllllllllLLLHHhhhhHHHHHHHLLLLEEEEE-


DSSP  llllllhhhHHHHHHHHHLLLlLLEELLLLlllllllllllllHHHHHHHHHHHLLEEEE
Query srfnlpkadQTKRLLKALENPfVHVLAHPTarllgrrapieadWEAVFQKAKEKGVAVEI  500
ident                 |        | |                | |    ||||     
Sbjct --------hGKAGIMAAIKAG-CKSLEHVS-----------yaDEEVWELMKEKGILYVA  284
DSSP  --------lLHHHHHHHHHHL-LLEEEELL-----------llLHHHHHHHHHHLLEEEL


DSSP  E-LLLL--------------------llllLHHHHHHHHHLLLLEEEELLLlLHHHhHHH
Query D-GYYD--------------------rmdlPDDLARMAYGMGLWISLSTDAhQTDHlRFM  539
ident                                      |   |  | | ||          
Sbjct TrSVIEiflasngeglvkeswaklqaladsHLKAYQGAIKAGVTIALGTDT-APGG-PTA  342
DSSP  LhHHHHhhhhhllllllllhhhlllhhhhhHHHHHHHHHHLLLLEELLLLL-LLLL-LLH


DSSP  HhHHHHHH-HLLLLLLL--LHHHL---------lHHHH----------------------
Query ElAVGTAQ-RAWIGPER--VLNTL---------dYEDL----------------------  565
ident       |  |    |       |                                     
Sbjct L-ELQFAVeRGGMTPLEaiKAATAnaplsvgpqaPLTGqlregyeadvialeenpledik  401
DSSP  H-HHHHHHhLLLLLHHHhhHHHLLlhhhhhhhhlLLLLllllllllleeeelllllllhh


DSSP  -------------------------hhhhhlllll
Query -------------------------lswlkarrgv  575
ident                                    
Sbjct vfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  hhhlhhheeeeeelleeeellllllllllllllll


No 19: Query=3au2A Sbjct=2ffiA Z-score=10.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLL------------l
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTY------------s  348
ident                                        |   |                
Sbjct ---------------------------------lhltAIDSHAHVFSrglnlasqrryap   27
DSSP  ---------------------------------llllLEELLLLLLLhhhhhhlllllll


DSSP  llLLLHHHHHHHHHHHLLLEEEEEEELhhhhlllLLLHhhHHHHHHHHHHHHHhhlllEE
Query dgQNTLEELWEAAKTMGYRYLAVTDHSpavrvagGPSPeeALKRVGEIRRFNEthgppYL  408
ident      |          |         |                                |
Sbjct nyDAPLGDYLGQLRAHGFSHGVLVQPS-------FLGT--DNRYLLSALQTVP----gQL   74
DSSP  llLLLHHHHHHHHHHLLLLEELLLLLH-------HHLL--LLHHHHHHHHHLL----lLL


DSSP  EEE----------------------EEEEL---lLLLL-----lllLHHHhlllleEEEE
Query LAG----------------------AEVDI---hPDGT-----ldyPDWVlreldlVLVS  438
ident                                                         |   
Sbjct RGVvxlerdveqatlaexarlgvrgVRLNLxgqdXPDLtgaqwrplLERIgeqgwhVELH  134
DSSP  LLLllllllllhhhhhhhhllllleEELLLllllLLLLlllllhhhHHHHhhhlleEEEL


DSSP  LLllllllhhhhhhHHHHHHLLL----LLLEELL-LLLLLLllllllLLLHHHHHHHhHH
Query VHsrfnlpkadqtkRLLKALENP----FVHVLAH-PTARLLgrrapiEADWEAVFQKaKE  493
ident                               |  |                          
Sbjct RQ----------vaDIPVLVRALqpygLDIVIDHfGRPDAR--rglgQPGFAELLTLsGR  182
DSSP  LL----------llLHHHHHHHHllllLLEEELHhHLLLLL--llllLLLHHHHLLLlLL


DSSP  HLLEEEEElLLLL--------lllLHHHHHHHHHLLL--LEEEELLLL-----lhHHHH-
Query KGVAVEIDgYYDR--------mdlPDDLARMAYGMGL--WISLSTDAH-----qtDHLR-  537
ident   | |       |                                |              
Sbjct GKVWVKVS-GIYRlqgspeenlafARQALCALEAHYGaeRLXWGSDWPhtqheseVSFGs  241
DSSP  LLEEEEEE-LHHHllllhhhhhhhHHHHHHHHHHHLLhhHEEEELLLLlllllllLLHHh


DSSP  HHHHHHHHHHhllLLLL-lLHHHLlhhHHHHhhhlllll
Query FMELAVGTAQrawIGPE-rVLNTLdyeDLLSwlkarrgv  575
ident   |                 |       |          
Sbjct AVEQFEALGC---SAQLrqALLLDtarALFG----fele  273
DSSP  HHHHHHHHLL---LHHHhhHHHLHhhhHHLL----llll


No 20: Query=3au2A Sbjct=3mkvA Z-score=10.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllLL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpGV  180
ident                                                             
Sbjct ---------------------lttflfrngalldpdhpdllqgfeiliedgfirevsdKP   39
DSSP  ---------------------lleeeeeeeeelllllllleeeeeeeeelleeeeeelLL


DSSP  LEeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query ERaelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct IK----------------------------------------------------------   41
DSSP  LL----------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   41
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLllLLLL---------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStySDGQ---------  351
ident                                        || ||                
Sbjct --------------------ssnahvidvkgktiMPGLIDLHVHV--VAIEfnlprvatl   79
DSSP  --------------------lllleeeelllleeEELEEEEEELL--LLLLllhhhhlll


DSSP  ------lLHHHHHHHHHHHLLLEEEEEEelhhhhllllllhhhhhhhHHHHHHHHHH--H
Query ------nTLEELWEAAKTMGYRYLAVTDhspavrvaggpspeealkrVGEIRRFNET--H  403
ident               |    |                                   |    
Sbjct pnvlvtlRAVPIMRAMLRRGFTTVRDAG-----------------gaGYPFKQAVESglV  122
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEELL-----------------llLHHHHHHHHLllL


DSSP  LLLEEEEE----------------------------------------------------
Query GPPYLLAG----------------------------------------------------  411
ident   | |                                                       
Sbjct EGPRLFVSgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvdevrravree  182
DSSP  LLLEEEELlleeelllllllllllllllllllllllllllllleeelllhhhhhhhhhhh


DSSP  -------EEEELL-----------LLLL-----llLLHHHHLLlleEEEELlllllllhh
Query -------AEVDIH-----------PDGT-----ldYPDWVLREldlVLVSVhsrfnlpka  448
ident                           |                   ||            
Sbjct lqmgadqIXIMASggvasptdpvgVFGYsedeiraIVAEAQGRgtyVLAHA---------  233
DSSP  hhhllllEEEELLlllllllllllLLLLlhhhhhhHHHHHHLLlllEEEEE---------


DSSP  hHHHHHHHHHLLLlLLEELLLLlllllllllllllHHHHHHHHHHHLLEEEEE-LLLL--
Query dQTKRLLKALENPfVHVLAHPTarllgrrapieadWEAVFQKAKEKGVAVEID-GYYD--  505
ident         |     |    |                        | |  |      ||  
Sbjct yTPAAIARAVRCG-VRTIEHGN-----------liDDETARLVAEHGAYVVPTlVTYDal  281
DSSP  lLHHHHHHHHHLL-LLEEEELL-----------llLHHHHHHHHHHLLEEELLhHHHHhh


DSSP  -------------------llllLHHHHHHHHHLLLLEEEELLLL--LHHHHHHHHHHHH
Query -------------------rmdlPDDLARMAYGMGLWISLSTDAH--QTDHLRFMELAVG  544
ident                                   |      ||                 
Sbjct asegekyglppesiakiadvhgaGLHSIEIMKRAGVKMGFGTDLLgeAQRLQSDEFRILA  341
DSSP  hhhlllllllhhhhllhhhhhllHHHHHHHHHHHLLLLLLLLLLLhhHHHHLLHHHHHHH


DSSP  hhHHLLLLLllLHHHL-lhhhHHHH-----------------------------------
Query taQRAWIGPerVLNTL-dyedLLSW-----------------------------------  568
ident               |      |                                      
Sbjct --EVLSPAEviASATIvsaevLGMQdklgrivpgahadvlvvdgnplksvdcllgqgehi  399
DSSP  --LLLLHHHhhHHLLHhhhhhLLLLllllllllllllleeeellllllllllllllllll


DSSP  --------hhlllll
Query --------lkarrgv  575
ident                
Sbjct plvmkdgrlfvnele  414
DSSP  leeeelleeeeelll


No 21: Query=3au2A Sbjct=1k6wA Z-score=10.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeeLLLHHhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriaGETEEev  300
ident                                                             
Sbjct ----------------------alqtiinarlpgeeglwqihlqdgkisaidaQSGVM--   36
DSSP  ----------------------llleeeeellllllleeeeeeelleeeeeeeELLLL--


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllLLLL--------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysDGQN--------  352
ident                                            |      |         
Sbjct --------------------pitensldaeqglvIPPFVEPHIHLD--TTQTagqpnwnq   74
DSSP  --------------------llllleeelllleeELLEEEEEELLL--LLLLllllllll


DSSP  -------------------------LHHHHHHHHHHHLLLEEEEEEelhhhhllllLLHH
Query -------------------------TLEELWEAAKTMGYRYLAVTDhspavrvaggPSPE  387
ident                                      |                   |  
Sbjct sgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRTHV---------dVSDA  125
DSSP  lllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEEEE---------eLLLL


DSSP  HhHHHHHHHHHHHHHHL-LLEEEEEE---------------------------EEELL--
Query EaLKRVGEIRRFNETHG-PPYLLAGA---------------------------EVDIH--  417
ident   |                  |   |                               |  
Sbjct T-LTALKAMLEVKQEVApWIDLQIVAfpqegilsypngealleealrlgadvvGAIPHfe  184
DSSP  L-LHHHHHHHHHHHHHLlLLEEEEEEellllllllllhhhhhhhhhhlllleeEELHHhl


DSSP  ---LLLL--LLLLHHHHL-lllEEEE-ELLLlLLLLhhhhhHHHHHHHLLL------lLL
Query ---PDGT--LDYPDWVLR-eldLVLV-SVHSrFNLPkadqtKRLLKALENP------fVH  464
ident      |   |            |  |                                  
Sbjct ftrEYGVesLHKTFALAQkydrLIDVhCDEI-DDEQ----sRFVETVAALAhhegmgaRV  239
DSSP  llhHHHHhhHHHHHHHHHhhllEEEEeELLL-LLLL----lLHHHHHHHHHhhhllhhHE


DSSP  EELLLLLlllllllLLLL--LHHHHHHHHHHHLLEEEEELlLLLL-----------lllh
Query VLAHPTArllgrraPIEA--DWEAVFQKAKEKGVAVEIDGyYDRM-----------dlpd  511
ident    | ||                  |   |  |                           
Sbjct TASHTTA------mHSYNgaYTSRLFRLLKMSGINFVANP-LVNIhlqgrfdtypkrrgi  292
DSSP  EEEELHH------hHHLLhhHHHHHHHHHHHHLLEEEELH-HHHHhhlllllllllllll


DSSP  hHHHHHHHLLLLEEEELLLLL-----hHHHHhHHHHHHHHHH---------llLLLL--l
Query dLARMAYGMGLWISLSTDAHQ-----tDHLRfMELAVGTAQR---------awIGPE--r  555
ident          |       |              |                     |     
Sbjct tRVKEMLESGINVCFGHDDVFdpwyplGTAN-MLQVLHMGLHvcqlmgygqinDGLNlit  351
DSSP  lLHHHHHHLLLLEEELLLLLLllllllLLLL-HHHHHHHHHHhlllllhhhhhHHHHhhl


DSSP  LHHHLlhhhHHHH-----------------------------------------------
Query VLNTLdyedLLSW-----------------------------------------------  568
ident           |                                                 
Sbjct HHSAR--tlNLQDygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqt  409
DSSP  HHHHH--hlLLLLlllllllllleeeellllhhhhhhhllllleeeelleeeeellllle


DSSP  -------hhlllll
Query -------lkarrgv  575
ident               
Sbjct tvyleqpeaidykr  423
DSSP  eeellleeeellll


No 22: Query=3au2A Sbjct=2y1hB Z-score=10.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLllLLLL--HHHHH
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYsdGQNT--LEELW  358
ident                                        |   |           |    
Sbjct ----------------------------------GVGLVDCHCHLSA--PDFDrdLDDVL   24
DSSP  ----------------------------------LLLEEEEEELLLL--HHHLllHHHHH


DSSP  HHHHHHLLLEEEEEEElhhhhllllllhhhHHHHHHHHHHHHHHHLLlEEEEE-------
Query EAAKTMGYRYLAVTDHspavrvaggpspeeALKRVGEIRRFNETHGPpYLLAG-------  411
ident | ||      |                          |    |       |         
Sbjct EKAKKANVVALVAVAE--------------HSGEFEKIMQLSERYNG-FVLPClgvhpvq   69
DSSP  HHHHHLLEEEEEELLL--------------LHHHHHHHHHHHHHLLL-LEEEEellllee


DSSP  -----------------------------EEEELLL-------------lLLLL--LLHH
Query -----------------------------AEVDIHP-------------dGTLD--YPDW  427
ident                               ||                            
Sbjct gldqrsvtlkdldvalpiienykdrllaiGEVGLDFsprfagtgeqkeeqRQVLirQIQL  129
DSSP  lllleellhhhhhhhhhhhhhhllllleeEEEEEELlllllllhhhhhhhHHHHhhHHHH


DSSP  HhlllleEEEELLLlllllhhhhhHHHHHHHL--LLLLLEELLLLlllllllllllllHH
Query VlreldlVLVSVHSrfnlpkadqtKRLLKALE--NPFVHVLAHPTarllgrrapieadWE  485
ident        | |   |                |         |                   
Sbjct AkrlnlpVNVHSRS--------agRPTINLLQeqGAEKVLLHAFD------------gRP  169
DSSP  HhhhlllEEEEEEL--------lhHHHHHHHHhlLLLLEEEELLL------------lLH


DSSP  HHHHHHHHHLLEEEEELLLLLLllLHHHHHHHHhllLLEEEELLLL-------lHHHHHH
Query AVFQKAKEKGVAVEIDGYYDRMdlPDDLARMAYgmgLWISLSTDAH-------qTDHLRF  538
ident  |       |    |     |      |          | | ||                
Sbjct SVAMEGVRAGYFFSIPPSIIRSgqKQKLVKQLP--lTSICLETDSPalgpekqvRNEPWN  227
DSSP  HHHHHHHHLLLEEEELHHHHLLhhHHHHHHHLL--hHHEEELLLLLllllllllLLLHHH


DSSP  HHHHHHHHHHLL--lLLLL--LHHHllhhhHHHHHH-lllll
Query MELAVGTAQRAW--iGPER--VLNTldyedLLSWLK-arrgv  575
ident                  |   |         |          
Sbjct ISISAEYIAQVKgisVEEVieVTTQ----nALKLFPklrhll  265
DSSP  HHHHHHHHHHHHlllHHHHhhHHHH----hHHHHLLlhhhhl


No 23: Query=3au2A Sbjct=3irsA Z-score=9.9

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELL--LLLL---------
Query yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHS--TYSD---------  349
ident                                        |                    
Sbjct -----------------------------------LKIIDFRLRPpaMGFLnariytrpd   25
DSSP  -----------------------------------LLLEELLLLLllHHHHhlhhhhlhh


DSSP  -----------------llLLHHHHHHHHHHHLLLEEEEEEELHHhhLLLLLlhhHHHHH
Query -----------------gqNTLEELWEAAKTMGYRYLAVTDHSPAvrVAGGPspeEALKR  392
ident                      ||   |     |              | |          
Sbjct irnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGRNSS--VLGSV---SNADV   80
DSSP  hhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELLEEL--LLEEL---LHHHH


DSSP  HHHHHHHHhhhlllEEEEE-------------------------EEEELL-----LLLL-
Query VGEIRRFNethgppYLLAG-------------------------AEVDIH-----PDGT-  421
ident                                                             
Sbjct AAVAKAYP-----dKFHPVgsieaatrkeamaqmqeildlgiriVNLEPGvwatpMHVDd  135
DSSP  HHHHHHLL-----lLEEEEeelllllhhhhhhhhhhhhhlllllEEELHHhllllLLLLl


DSSP  ---llllhhhhlllleEEEEL---LLLLLLlhhhHHHHHHHHHL--LLLLLEELLLLLLl
Query ---ldypdwvlreldlVLVSV---HSRFNLpkadQTKRLLKALE--NPFVHVLAHPTARl  473
ident                 |                         |        |  |     
Sbjct rrlyplyafcedngipVIMMTggnAGPDIT--ytNPEHIDRVLGdfPDLTVVSSHGNWP-  192
DSSP  hhhhhhhhhhhhllllEEEELlllLLLLHH--hhLHHHHHHHHHhlLLLLEEEEHHHLL-


DSSP  lllllllllLHHHHHHHHhhHLLEEEEEllllLLLL---LHHHHHHHHHLLL--LEEEEL
Query lgrrapieaDWEAVFQKAkeKGVAVEIDgyydRMDL---PDDLARMAYGMGL--WISLST  528
ident              |             |                  |    |       |
Sbjct ------wvqEIIHVAFRR--PNLYLSPD----MYLYnlpGHADFIQAANSFLadRMLFGT  240
DSSP  ------lhhHHHHHHHHL--LLEEEELH----HHHLlllLHHHHHHHHLLHHhhLLLLLL


DSSP  LLLlhHHHH-HHHHHHHHhhhlLLLLLL--LHHHLlhhhHHHHHHLllll
Query DAHqtDHLR-FMELAVGTaqraWIGPER--VLNTLdyedLLSWLKArrgv  575
ident        |    |          | |                 |      
Sbjct AYP-mCPLKeYTEWFLTL----PIKPDAmeKILHG---nAERLLAQ-agr  281
DSSP  LLL-lLLHHhHHHHHHLL----LLLHHHhhHHHLH---hHHHHHHH-lll


No 24: Query=3au2A Sbjct=2pajA Z-score=9.9

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelLLHHhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagETEEev  300
ident                                                             
Sbjct -------------------------------------------------pstliRNAA--    9
DSSP  -------------------------------------------------leeeeELLL--


DSSP  hhhlllllllhhhlllllhhhhhhlLLLLL------------------------------
Query yaalglpwippplredqgeveaaleGRLPK------------------------------  330
ident                             |                               
Sbjct ----------------aimtggrgtADDPSrvpgpdirivgdtidaigalaprpgetivd   53
DSSP  ----------------eelllllllLLLLLlllllleeeelleeeeellllllllleeee


DSSP  ----lllHHHL------------------------------------------LEEEeEL
Query ----lleLPQV------------------------------------------KGDLqVH  344
ident           |                                                 
Sbjct atdcviyPAWVnthhhlfqsllkgepfralfderrfrlaariglielarsgcaTVAD-HN  112
DSSP  lllleeeELEElllllhhhhhllllllhhhllhhhhhhhhhhhhhhhhllleeEEEE-LL


DSSP  LLLL--llLLLHHHHHHHHHHHLLLEEEEEEELHH--------hhlLLLLLHHHHHHHHH
Query STYS--dgQNTLEELWEAAKTMGYRYLAVTDHSPA--------vrvAGGPSPEEALKRVG  394
ident   |           | | |   | |                                   
Sbjct YVYYpgmpFDSSAILFEEAEKLGLRFVLLRGGATQtrqleadlptaLRPETLDAYVADIE  172
DSSP  LLLLllllLLHHHHHHHHHHHLLLEEEEEELLLLLlllllllllhhHLLLLHHHHHHHHH


DSSP  HHHHHH--hhhlLLEEEEEE-EEELlllllLLLL----HHHHLLL----LEEEEELLlll
Query EIRRFN--ethgPPYLLAGA-EVDIhpdgtLDYP----DWVLREL----DLVLVSVHsrf  443
ident                    |                                        
Sbjct RLAARYhdasprAMRRVVMApTTVL-----YSISpremRETAAVArrlgLRMHSHLS---  224
DSSP  HHHHHLllllllLLEEEEELlLLLL-----LLLLhhhhHHHHHHHhhllLEEEEELL---


DSSP  lllhhhhhHHHHHHHLLLLL---LEELLLLlllllllllllLLHHHHHHHHHHHLLEEEE
Query nlpkadqtKRLLKALENPFV---HVLAHPTarllgrrapieADWEAVFQKAKEKGVAVEI  500
ident                |          ||                          |  |  
Sbjct ------gkSPVAFCGEHDWLgsdVWYAHLV-----------KVDADEIALLAQTGTGVAH  267
DSSP  ------llLHHHHHHHLLLLlllEEEELLL-----------LLLHHHHHHHHHHLLEEEE


DSSP  ELlLLLLlllhhHHHHHHHLLLLEEEELLLllhhhhHHHHHHHHHHHH---------lLL
Query DGyYDRMdlpddLARMAYGMGLWISLSTDAhqtdhlRFMELAVGTAQR---------aWI  551
ident               |     |   |   |         |   |                 
Sbjct CP-QSNG---rlPVREMADAGVPVSIGVDGaasneaADMISEVHMTWLaqrarlasiaEV  323
DSSP  LH-HHHH---llLLLLHHHHLLLEEELLLHhhhlllLLHHHHHHHHHHhhhhllllhhHH


DSSP  LLL--LLHHhllhhhHHHH-----------------------------------------
Query GPE--RVLNtldyedLLSW-----------------------------------------  568
ident                                                             
Sbjct IHWgtAGGA----rvMGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrps  379
DSSP  HHHhlHHHH----hhHLLLlllllllllllleeeeelllhhhlllllhhhhhhhllllle


DSSP  -----------------------------------hhlllll
Query -----------------------------------lkarrgv  575
ident                                           
Sbjct vmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 25: Query=3au2A Sbjct=3e38A Z-score=9.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLLLLLLLLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTYSDGQNTLEELWEA  360
ident                                      | |   ||  |||          
Sbjct -------------------aqrrneiqvpdldgytTLKCDFHXHSVFSDGLVWPTVRVDE   41
DSSP  -------------------llllllllllllllleEEEEELLLLLLLLLLLLLHHHHHHH


DSSP  HHHHLLLEEEEEEELHhHHLLLlllhHHHHHHHHHHHHHHHHHLlLEEEEEEEEEL----
Query AKTMGYRYLAVTDHSPaVRVAGgpspEEALKRVGEIRRFNETHGpPYLLAGAEVDI----  416
ident |   |      | |    |                 |   |  |   |  | |       
Sbjct AYRDGLDAISLTEHIE-YRPHKqdvvSDHNRSFDLCREQAEKLG-ILLIKGSEITRaxap   99
DSSP  HHHLLLLEELLEEELL-LLLLLllllLLLLHHHHHHHHHHHHHL-LEELLEEEEELllll


DSSP  ----------------LLLLLLlllhhhhlllleeeeellllllllhhhhhhhhhhhhLL
Query ----------------HPDGTLdypdwvlreldlvlvsvhsrfnlpkadqtkrllkalEN  460
ident                                                             
Sbjct ghfnaiflsdsnpleqKDYKDA--------------------------------freaKK  127
DSSP  leeeeelllllhhhllLLHHHH--------------------------------hhhhHH


DSSP  LLL-LEELLLLLLllllLLLL-----LLLHHHHHHHHhhhlLEEEEELLlLLLLllHHHH
Query PFV-HVLAHPTARllgrRAPI-----EADWEAVFQKAkekgVAVEIDGYyDRMDlpDDLA  514
ident         ||                     |  |         |               
Sbjct QGAfXFWNHPGWD----SQQPdttkwWPEHTALYQEG--cxHGIEVANG-HLYX--PEAI  178
DSSP  LLLeEEELLLLLL----LLLLlllllLHHHHHHHHLL--llLEEEEEEL-LEEL--LHHH


DSSP  HHHHHLLLLEEEELLLLLHH---------hHHHHhhhhhhhhhllllllllhHHLL----
Query RMAYGMGLWISLSTDAHQTD---------hLRFMelavgtaqrawigpervlNTLD----  561
ident        |      | ||             |                            
Sbjct QWCLDKNLTXIGTSDIHQPIqtdydfekgeHRTX------------------TFVFaker  220
DSSP  HHHHHHLLEEEEELLLLLLHhhhllhhhllLLLE------------------EEEEelll


DSSP  -HHHHHHHHH--------------------------------------------------
Query -YEDLLSWLK--------------------------------------------------  570
ident         |                                                   
Sbjct sLQGIREALDnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvtdlv  280
DSSP  lHHHHHHHHHllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeelllll


DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------arr  573
ident                                                             
Sbjct lklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkyti  340
DSSP  eeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeee


DSSP  ll
Query gv  575
ident   
Sbjct sl  342
DSSP  el


No 26: Query=3au2A Sbjct=4hk5D Z-score=9.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLL-------------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTY-------------  347
ident                                     |  |   |                
Sbjct ----------------------------------TPVVVDIHTHMYPpsyiamlekrqti   26
DSSP  ----------------------------------LLLLEEEEEEELLhhhhhhhhlllll


DSSP  ----------------------------------------lllLLLHHHHHHHHHHHLLL
Query ----------------------------------------sdgQNTLEELWEAAKTMGYR  367
ident                                               |        | | |
Sbjct plvrtfpqadeprlillsselaaldaaladpaaklpgrplsthFASLAQKMHFMDTNGIR   86
DSSP  leeeeelleeeeeeellhhhhhhhhhhhhlllllllleellhhHLLHHHHHHHHHHLLLL


DSSP  EEEEEEELhHHHLLL--llLHHHHHHHHHHHHHHHHHHLLlEEEEE--------------
Query YLAVTDHSpAVRVAG--gpSPEEALKRVGEIRRFNETHGPpYLLAG--------------  411
ident                     |  |     |       |    |                 
Sbjct VSVISLAN-PWFDFLapdeAPGIADAVNAEFSDMCAQHVG-RLFFFaalplsapvdavka  144
DSSP  EEEEEELL-LLLLLLllllHHHHHHHHHHHHHHHHHLLLL-LEEEEeellllllhhhhhh


DSSP  -------------EEEELL---LLLL----lllLHHHhllllEEEEELLLLLL-------
Query -------------AEVDIH---PDGT----ldyPDWVlreldLVLVSVHSRFN-------  444
ident                                     |     ||    |           
Sbjct siervknlkycrgIILGTSglgKGLDdphllpvFEAVadaklLVFLHPHYGLPnevygpr  204
DSSP  hhhhhhlllleeeEEELLLlllLLLLlhhhhhhHHHHhhlllEEEELLLLLLLhhhhlll


DSSP  ------------llhhhhHHHHHHH-------hllLLLLEELLLLLllllllllllllHH
Query ------------lpkadqTKRLLKA-------lenPFVHVLAHPTArllgrrapieadWE  485
ident                   |                     |||                 
Sbjct seeyghvlplalgfpmetTIAVARMymagvfdhvrNLQMLLAHSGG----------tlPF  254
DSSP  hhhlllhhhhhlhhhhhhHHHHHHHhhllhhhhllLLLEEEHHHHL----------lhHH


DSSP  HH--------------------------hHHHHhHLLEEEEEllllllLLLHHHHHHHHH
Query AV--------------------------fQKAKeKGVAVEIDgyydrmDLPDDLARMAYG  519
ident                                 |                        |  
Sbjct LAgriescivhdghlvktgkvpkdrrtiwTVLK-EQIYLDAV------IYSEVGLQAAIA  307
DSSP  HHhhhhhhhhllhhhhhllllllllllhhHHHH-HLEEEELL------LLLHHHHHHHHH


DSSP  LLL--LEEEELLLLLHH--------hHHHHHHHHHHHHHLL----lLLLLLHHHLlhHHH
Query MGL--WISLSTDAHQTD--------hLRFMELAVGTAQRAW----iGPERVLNTLdyEDL  565
ident           ||                   |       |          |         
Sbjct SSGadRLMFGTDHPFFPpieedvqgpWDSSRLNAQAVIKAVgegssDAAAVMGLN-aVRV  366
DSSP  HHLhhHEELLLLLLLLLlllllllllLHHHHHHHHHHHHHHllllhHHHHHHLHH-hHHH


DSSP  HH----hhhlllll
Query LS----wlkarrgv  575
ident ||            
Sbjct LSlkaelehhhhhh  380
DSSP  LLlhhhhhhhhhhl


No 27: Query=3au2A Sbjct=2imrA Z-score=9.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhLLLLLLLH------------hhlllllhhhHHHLL----------lllllllHHHL-
Query yaaLGLPWIPP------------plredqgeveAALEG----------rlpklleLPQV-  337
ident      |                              |                   | | 
Sbjct -htPRLLTCDVlytgaqspggvvvvgetvaaagHPDELrrqyphaaeeragaviaPPPVn   59
DSSP  -llEEEEEELEeelleelleeeeeelleeeeeeLHHHHhhhlllleeeellleelLLLLe


DSSP  --------------------------------------------------LEEEeELLLL
Query --------------------------------------------------KGDLqVHSTY  347
ident                                                             
Sbjct ahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadtltrlgagGVGD-IVWAP  118
DSSP  eeeellllhhhhhhlhhhhllhhhhhhhllllhhhhhhhhhhhhhhllllLEEE-EELLH


DSSP  llllLLHHHHHHhhHHHLlLEEEEEEELHHhhLLLL-lLHHHHHHHHHHHHHHHhhhLLL
Query sdgqNTLEELWEaaKTMGyRYLAVTDHSPAvrVAGG-pSPEEALKRVGEIRRFNethGPP  406
ident          |                                |       ||      | 
Sbjct ----EVMDALLA--REDL-SGTLYFEVLNP-fPDKAdeVFAAARTHLERWRRLE---RPG  167
DSSP  ----HHHHHHHL--LLLL-LEEEEEEELLL-lHHHHhhHHHHHHHHHHHHHLLL---LLL


DSSP  EEEEEEEEELLllllllLLHHHHLLL----LEEEEEL---lLLLLL--------------
Query YLLAGAEVDIHpdgtldYPDWVLREL----DLVLVSV---hSRFNL--------------  445
ident   |                                 |                       
Sbjct LRLGLSPHTPF-tvshrLMRLLSDYAagegLPLQIHVaehpTELEMfrtgggplwdnrmp  226
DSSP  EEEEEEELLLL-lllhhHHHHHHHHHhhhlLLLEEEElllhHHHHHhhhlllllhhhllh


DSSP  ---------------LHHHhhHHHHHHHL---LLLLLEELLLLlllllllllllLLHHHH
Query ---------------PKADqtKRLLKALE---NPFVHVLAHPTarllgrrapieADWEAV  487
ident                             |         | |                   
Sbjct alyphtlaevigrepGPDL--TPVRYLDElgvLAARPTLVHMV-----------NVTPDD  273
DSSP  hhllllhhhhhllllLLLL--LHHHHHHHhllHHHLLEEEELL-----------LLLHHH


DSSP  HHHHHHHLLEEEEELlLLLL--lllhhHHHHHHHLLLLEEEELLLllhhhhHHHHHHHHH
Query FQKAKEKGVAVEIDGyYDRM--dlpddLARMAYGMGLWISLSTDAhqtdhlRFMELAVGT  545
ident        | ||                        |    | ||             |  
Sbjct IARVARAGCAVVTCP-RSNHhlecgtfDWPAFAAAGVEVALGTDSvasgetLNVREEVTF  332
DSSP  HHHHHHHLLLEEELH-HHHHhllllllLHHHHHHLLLLEEELLLLhhhhllLLLHHHHHH


DSSP  HHH------lLLLLLL--LHHHL-lHHHH---------hhhhhlllll
Query AQR------aWIGPER--VLNTL-dYEDL---------lswlkarrgv  575
ident |                                               
Sbjct ARQlypgldpRVLVRAavKGGQRvvGTPFlrrgetwqegfrwelsrdl  380
DSSP  HHHhlllllhHHHHHHhhHHHHHhhLLLLllllllllhhhlhhhllll


No 28: Query=3au2A Sbjct=1bf6A Z-score=9.3

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLLLL---------lL
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTYSD---------gQ  351
ident                                            |                
Sbjct -------------------------------sfdptgYTLAHEHLHIDLsgfknnvdcrL   29
DSSP  -------------------------------llllllEEEEEELLLEELhhhhllhhheE


DSSP  LLHHHHHHHHHHHL---LLEEEEEEElhhhhllLLLLhhhhhhHHHHHHHHHHHHLlLEE
Query NTLEELWEAAKTMG---YRYLAVTDHspavrvaGGPSpeealkRVGEIRRFNETHGpPYL  408
ident                   |                                    |    
Sbjct DQYAFICQEMNDLMtrgVRNVIEMTN-------RYMG-----rNAQFMLDVMRETG-INV   76
DSSP  LLHHHHHHHHHHHHhllEEEEEELLL-------HHHL-----lLHHHHHHHHHHHL-LEE


DSSP  EEE-------------------------------------------EEEELLLLLL----
Query LAG-------------------------------------------AEVDIHPDGT----  421
ident  |                                            ||            
Sbjct VACtgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkagiiAEIGTSEGKItple  136
DSSP  EEEellllhhhlllhhhhllhhhhhhhhhhhhhllllllllleeeeEEEELLLLLLlhhh


DSSP  llLLHHHHLL----lleEEEELLLlllllhhhhhhHHHHHHLLL-------lLLEELLLL
Query ldYPDWVLRE----ldlVLVSVHSrfnlpkadqtkRLLKALENP-------fVHVLAHPT  470
ident                                      |  |                |  
Sbjct ekVFIAAALAhnqtgrpISTHTSF---------stMGLEQLALLqahgvdlsRVTVGHCD  187
DSSP  hhHHHHHHHHhhhhlllEEEELHH---------hlLHHHHHHHHhhllllhhHEEELLLL


DSSP  LLlllllllllllHHHHHHHHHHHLLEEEEE-LLLL---lLLLLHHHHHHHHHLLL--LE
Query ARllgrrapieadWEAVFQKAKEKGVAVEID-GYYD---rMDLPDDLARMAYGMGL--WI  524
ident                    |    |  |  |                       ||    
Sbjct LK----------dNLDNILKMIDLGAYVQFDtIGKNsyypDEKRIAMLHALRDRGLlnRV  237
DSSP  LL----------lLHHHHHHHHHLLLEEEELlLLLLllllHHHHHHHHHHHHHLLLhhHE


DSSP  EEELLLLL--------hHHHHHHH-HHHHHHHHLLL---LLLLlHHHLlhhhHHHHHHll
Query SLSTDAHQ--------tDHLRFME-LAVGTAQRAWI---GPERvLNTLdyedLLSWLKar  572
ident  || |                                                       
Sbjct MLSMDITRrshlkanggYGYDYLLtTFIPQLRQSGFsqaDVDV-MLRE---nPSQFFQ--  291
DSSP  EELLLLLLhhhlhhhllLLLLHHHhLHHHHHHHLLLlhhHHHH-HHLH---hHHHHLL--


DSSP  lll
Query rgv  575
ident    
Sbjct ---  291
DSSP  ---


No 29: Query=3au2A Sbjct=2ogjA Z-score=9.3

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
ident                                                        ||   
Sbjct -----------------qapilltnvkpvgfgkgasqsstdiliggdgkiaavGSALQA-   42
DSSP  -----------------llleeeeeeeellllllllllleeeeellllleeeeELLLLL-


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   42
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   42
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLL---LLLLLllhhhH
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHST---YSDGQntleeL  357
ident                                        || ||                
Sbjct ----------------------padtqridaafiSPGWVDLHVHIWhggTDISI-----R   75
DSSP  ----------------------llleeelllleeEELEEEEEELLLlllLLLLL-----L


DSSP  HHH-HHHHLLLEEEEEEelhhhhllllllhhhHHHHHHHHH-HHHHhHLLLEEEEE----
Query WEA-AKTMGYRYLAVTDhspavrvaggpspeeALKRVGEIR-RFNEtHGPPYLLAG----  411
ident         |   |                           |    |        |     
Sbjct PSEcGAERGVTTLVDAG-------------saGEANFHGFReYIIE-PSRERIKAFlnlg  121
DSSP  HHHlLHHHLEEEEEEEL-------------llLLLLHHHHHhHLLL-LLLLEEEEEeell


DSSP  -------------------------------------EEEELLL------LLLLL-LLHH
Query -------------------------------------AEVDIHP------DGTLD-YPDW  427
ident                                        |            |       
Sbjct siglvacnrvpelrdikdidldrilecyaensehivgLXVRASHvitgswGVTPVkLGKK  181
DSSP  lllllllllllllllhhhllhhhhhhhhhllllleeeEEEEELHhhhlllLLHHHhHHHH


DSSP  HHL-llleEEEELLLLLlllhhhhhhHHHHHHLLLL-lLEELLLLLLllllllLLLL---
Query VLR-eldlVLVSVHSRFnlpkadqtkRLLKALENPF-vHVLAHPTARllgrraPIEA---  482
ident           | |                  ||      |  |                 
Sbjct IAKilkvpXXVHVGEPP--------aLYDEVLEILGpgDVVTHCFNG------KSGSsix  227
DSSP  HHHhhlllEEEEELLLL--------lLHHHHHHHLLllLEEELLLLL------LLLLlll


DSSP  LHHHHHHHHHHH-LLEEEEELLlLLLLlLHHHHHHHHHLLLLE-EEELLLLLHHH---hH
Query DWEAVFQKAKEK-GVAVEIDGYyDRMDlPDDLARMAYGMGLWI-SLSTDAHQTDH---lR  537
ident   |  |  |    |    |             |  |   ||   | ||| |         
Sbjct EDEDLFNLAERCeGIRLDIGHG-GASF-SFKVAEAAIARGLLPfSISTDLHGHSXnfpvW  285
DSSP  LLHHHHHHHHHLlLLEEELLLL-LLLL-LHHHHHHHHHLLLLLlLLLLLLLLLLLllllL


DSSP  HHHHHHHHHHHLLLLLLL--LHHHLlhhHHHH----------------------------
Query FMELAVGTAQRAWIGPER--VLNTLdyeDLLS----------------------------  567
ident                 |      |                                    
Sbjct DLATTXSKLLSVDXPFENvvEAVTRnpaSVIRldxenrldvgqradftvfdlvdadleat  345
DSSP  LHHHHHHHHHHLLLLHHHhhHLLLHhhhHHLLllllllllllllleeeeeeeeeeeeeee


DSSP  --------------------------hhhlllll
Query --------------------------wlkarrgv  575
ident                                   
Sbjct dsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeelleeeellllllll


No 30: Query=3au2A Sbjct=3k2gB Z-score=9.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLLLL-----------
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTYSD-----------  349
ident                                            |                
Sbjct ---------slselspchvrsgrixtvdgpipssalgHTLXHEHLQNDCrcwwnppqepe   51
DSSP  ---------llllllllllllleeeelleeeehhhllLEELLLLLLEELhhhllllllhh


DSSP  -------------------------------lllLHHHHHHHHHHHLLLEEEEEEELHhh
Query -------------------------------gqnTLEELWEAAKTMGYRYLAVTDHSPav  378
ident                                               | |           
Sbjct rqylaeapisieilselrqdpfvnkhnialddldLAIAEVKQFAAVGGRSIVDPTCRG--  109
DSSP  hhhhhhllllhhhhhhhhllhhhllllleellhhHHHHHHHHHHHLLLLEEEELLLLL--


DSSP  hllllllhhhhhhHHHHHHHHHHHHLlLEEEEE---------------------------
Query rvaggpspeealkRVGEIRRFNETHGpPYLLAG---------------------------  411
ident                   ||     |      |                           
Sbjct ----------igrDPVKLRRISAETG-VQVVXGagyylassxpetaarlsaddiadeiva  158
DSSP  ----------lllLHHHHHHHHHHHL-LEEEELlllllhhhllhhhhlllhhhhhhhhhh


DSSP  ----------------EEEELLLLL-----lLLLL-HHHHL-lllEEEEELLllllllhh
Query ----------------AEVDIHPDG-----tLDYP-DWVLR-eldLVLVSVHsrfnlpka  448
ident                  |     |                        |           
Sbjct ealegtdgtdarigliGEIGVSSDFtaeeekSLRGaARAQVrtglPLXVHLP--------  210
DSSP  hhhlllllllllllleEEELLLLLLlhhhhhHHHHhHHHHHhhllLEEELLL--------


DSSP  hHHHHHHHHHLLL-------lLLEELLLLLlllllllllllLHHHHHHHHHHHLLEEEEE
Query dQTKRLLKALENP-------fVHVLAHPTArllgrrapieaDWEAVFQKAKEKGVAVEID  501
ident          |             || |                          |   | |
Sbjct gWFRLAHRVLDLVeeegadlrHTVLCHXNP---------shXDPVYQATLAQRGAFLEFD  261
DSSP  lLLLLHHHHHHHHhhllllhhHEEELLLHH---------hlLLHHHHHHHHHHLLEEEEL


DSSP  -LLLL-----------llllLHHHHHHHHHLLL--LEEEELLLLL--------hHHHHHH
Query -GYYD-----------rmdlPDDLARMAYGMGL--WISLSTDAHQ--------tDHLRFM  539
ident     |                          |    | || |                | 
Sbjct xIGXDffyadqgvqcpsddeVARAILGLADHGYldRILLSHDVFVkxxltryggNGYAFV  321
DSSP  lLLLLleelllleelllhhhHHHHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLHH


DSSP  H-HHHHHHHHLLL---LLLLLhHHLLhhhHHHHHHLL-lll
Query E-LAVGTAQRAWI---GPERVlNTLDyedLLSWLKAR-rgv  575
ident          |        |                |     
Sbjct TkHFLPRLRRHGLddaALETL-XVTN---PRRVFDASiegh  358
DSSP  HhLHHHHHHHLLLlhhHHHHH-HLHH---HHHHHLLLllll


No 31: Query=3au2A Sbjct=1gkpA Z-score=9.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelLLHHhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagETEEev  300
ident                                                          |  
Sbjct -----------------------pllikngeiitadsrykadiyaegetitrigQNLE--   35
DSSP  -----------------------leeeelleeeelleeeeleeeelllllleeeLLLL--


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLL----LLLLLHHH
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYS----DGQNTLEE  356
ident                                        |  ||            | | 
Sbjct -------------------appgtevidatgkyvFPGFIDPHVHIYLPfmatFAKDTHET   76
DSSP  -------------------llllleeeelllleeEELEEEEEELLLLEelleELLLLHHH


DSSP  HHHHHHHHLLLEEEEEEELHHhhllLLLLHHHHHHHHHHHHHHHhhhllLEEEEEEEEEL
Query LWEAAKTMGYRYLAVTDHSPAvrvaGGPSPEEALKRVGEIRRFNethgpPYLLAGAEVDI  416
ident    ||   |                     |                          |  
Sbjct GSKAALMGGTTTYIEMCCPSR----NDDALEGYQLWKSKAEGNS----yCDYTFHMAVSK  128
DSSP  HHHHHHHLLEEEEEEEELLLL----LLLHHHHHHHHHHHHLLLL----lLEEEEEEELLL


DSSP  LllllllLLHHHHL-LLLEEEEE-LLLLllllhhhHHHHHHHHHLLL----LLLEElLLL
Query HpdgtldYPDWVLR-ELDLVLVS-VHSRfnlpkadQTKRLLKALENP----FVHVLaHPT  470
ident                                            |             |  
Sbjct FdektegQLREIVAdGISSFXIFlSYKN---ffgvDDGEMYQTLRLAkelgVIVTA-HCE  184
DSSP  LlllhhhHHHHHHHlLLLEEEEEeLLLL---llllLHHHHHHHHHHHhhhlLEEEE-EEL


DSSP  L--------------------llLLLLLL--llllHHHHHHHHH--HHLLEEEEelllll
Query A--------------------rlLGRRAP--ieadWEAVFQKAK--EKGVAVEIdgyydr  506
ident                           |                        |        
Sbjct NaelvgrlqqkllsegktgpewhEPSRPEaveaegTARFATFLEttGATGYVVH------  238
DSSP  LhhhhhhhhhhhhhlllllhhhlLLLLLHhhhhhhHHHHHHHHHhhLLEEEELL------


DSSP  llLLHH-HHHHHHHLL-----LLEE-----------------------------------
Query mdLPDD-LARMAYGMG-----LWIS-----------------------------------  525
ident   |        |           |                                    
Sbjct --LSCKpALDAAMAAKargvpIYIEsviphflldktyaerggveamkyimspplrdkrnq  296
DSSP  --LLLHhHHHHHHHHHhllllEEEEeehhhhhllhhhhhllhhhhhlllllllllllhhh


DSSP  --------------EELLLLL-------------------hHHHHHH-----hhhhhhhh
Query --------------LSTDAHQ-------------------tDHLRFM-----elavgtaq  547
ident                 ||                                          
Sbjct kvlwdalaqgfidtVGTDHCPfdteqkllgkeaftaipngiPAIEDRvnllytygvsrgr  356
DSSP  hhhhhhhhllllleEELLLLLllhhhhhhhlllhhhlllllLLLLLHhhhhhhhhlllll


DSSP  hllllllllhHHLLHhHHHH----------------------------------------
Query rawigpervlNTLDYeDLLS----------------------------------------  567
ident            |     |                                          
Sbjct ldihrfvdaaSTKAA-KLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyng  415
DSSP  llhhhhhhhhLHHHH-HHLLllllllllllllllleeeeelllleellhhhlllllllll


DSSP  -------------------------------------hhHLLLll
Query -------------------------------------wlKARRgv  575
ident                                              
Sbjct fegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrePMYF--  458
DSSP  lllleelleeeeeeelleeeeelleelllllllllllllLLLL--


No 32: Query=3au2A Sbjct=3ls9A Z-score=9.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ---------------------------------------milirgltrvitfddqerele   21
DSSP  ---------------------------------------leeeeeeeeeellllllleee


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLlllLLLL--------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysDGQN--------  352
ident                                            |                
Sbjct dadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLINSHQHL---YEGAmraipqle   78
DSSP  eeeeeeelleeeeeellllllllleeeellleeeEELEEEEEELH---HHHHhlllhhhl


DSSP  -------------------------------LHHHHHHHHHHHLLLEEEEEEElhhhhll
Query -------------------------------TLEELWEAAKTMGYRYLAVTDHspavrva  381
ident                                            |    |           
Sbjct rvtmaswlegvltrsagwwrdgkfgpdvireVARAVLLESLLGGITTVADQHL-------  131
DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHHHHLLEEEEEEEEL-------


DSSP  llLLHH-hhhHHHHHHHHHHHHHLlLEEEEEE----------------------------
Query ggPSPE-ealKRVGEIRRFNETHGpPYLLAGA----------------------------  412
ident     |                  |     |                              
Sbjct --FFPGatadSYIDATIEAATDLG-IRFHAARssmtlgkseggfcddlfvepvdrvvqhc  188
DSSP  --LLLLllllLHHHHHHHHHHHHL-LEEEEEEllllllhhhlllllhhhlllhhhhhhhh


DSSP  --------------------EEELLL----lllllLLHHHhlllleEEEE--LLLLLLLL
Query --------------------EVDIHP----dgtldYPDWVlreldlVLVS--VHSRFNLP  446
ident                          |                                  
Sbjct lglidqyhepepfgmvrialGPCGVPydkpelfeaFAQMAadydvrLHTHfyEPLDAGMS  248
DSSP  hhhhhhhlllllllleeeeeLLLLLLlllhhhhhhHHHHHhhhlleEEEEelLLLHHHHH


DSSP  H---HHHH-HHHHH-hHLLLLLlEELLLLLlllllllllllLHHHhHHHHHHHLLEEEEE
Query K---ADQT-KRLLK-aLENPFVhVLAHPTArllgrrapieaDWEAvFQKAKEKGVAVEID  501
ident            | |       |  |||                |         |||    
Sbjct DhlyGMTPwRFLEKhgWASDRV-WLAHAVV----------pPREE-IPEFADAGVAIAHL  296
DSSP  HhhhLLLHhHHHHHllLLLLLE-EEEELLL----------lLHHH-HHHHHHHLLEEEEL


DSSP  LLLLL-llllhhHHHHHHHLLLLEEEELLLLL-hHHHHHHHHHHHHHHH-----------
Query GYYDR-mdlpddLARMAYGMGLWISLSTDAHQ-tDHLRFMELAVGTAQR-----------  548
ident    |          |     |      |      |           |             
Sbjct IAPDLrmgwglaPIREYLDAGITVGFGTTGSAsnDGGNLLGDLRLAALAhrpadpnepek  356
DSSP  HHHHHhllllllLHHHHHHLLLEEEELLLLLLllLLLLHHHHHHHHHHHlhhhllllhhh


DSSP  LLLLLL-lLHHHL--lhhhHHHH-------------------------------------
Query AWIGPE-rVLNTL--dyedLLSW-------------------------------------  568
ident      |     |                                                
Sbjct WLSAREllRMATRgsaeclGRPDlgvleegraadiacwrldgvdrvgvhdpaiglimtgl  416
DSSP  LLLHHHhhHHLLHhhhhhlLLLLllllllllllleeeeelllhhhlllllhhhhhhhlll


DSSP  ------------------------------hhlllll
Query ------------------------------lkarrgv  575
ident                                      
Sbjct sdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  llllleeeelleeeeelleellllhhhhhhhhhhhll


No 33: Query=3au2A Sbjct=3griA Z-score=8.9

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhHLLLll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaiRALPgv  180
ident                                                             
Sbjct ---------------------xklikngkvlqngelqqadilidgkvikqiapaIEPS--   37
DSSP  ---------------------leeeelleeeelleeeeleeeeelleeeeeellLLLL--


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   37
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   37
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEEL-LLLLL-lLLLHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVH-STYSD-gQNTLEELW  358
ident                                        |  ||          | |   
Sbjct ---------------------ngvdiidakghfvspgFVDVHVHlREPGGeyKETIETGT   76
DSSP  ---------------------llleeeelllleeeelEEEEEELlLLLLLllLLLHHHHH


DSSP  HHHHHHLLLEEEEEEElhhhhlllllLHHHHHHHHHHHHHHHhhhllLEEEeEEEEE---
Query EAAKTMGYRYLAVTDHspavrvaggpSPEEALKRVGEIRRFNethgpPYLLaGAEVD---  415
ident  ||   |                   | |        |            |         
Sbjct KAAARGGFTTVCPXPN----trpvpdSVEHFEALQKLIDDNA----qVRVL-PYASIttr  127
DSSP  HHHHHLLEEEEEELLL----llllllLHHHHHHHHHHHHHHL----lLEEL-LLEELlhh


DSSP  LLLLlLLLLLHHHHLLLLEEEEELLLlllllhhHHHHHHHHHHLLL---LLLEELLLLLL
Query IHPDgTLDYPDWVLRELDLVLVSVHSrfnlpkaDQTKRLLKALENP---FVHVLAHPTAR  472
ident       |        |                                      ||    
Sbjct QLGK-ELVDFPALVKEGAFAFTDDGV-----gvQTASXXYEGXIEAakvNKAIVAHCEDN  181
DSSP  HLLL-LLLLHHHHHLLLLLLEEELLL-----llLLHHHHHHHHHHHhhhLLLEEELLLLH


DSSP  -LLLLL------------------llllllHHHHHHHHH--HHLLEEEEellllllllLH
Query -LLGRR------------------apieadWEAVFQKAK--EKGVAVEIdgyydrmdlPD  511
ident  |                                   |        |             
Sbjct sLIYGGaxhegkrskelgipgipnicesvqIARDVLLAEaaGCHYHVCH-------vsTK  234
DSSP  hHLLLLleellhhhhhhllleellhhhhhhHHHHHHHHHhhLLLEEELL-------llLH


DSSP  HHHHHHHHLL-----LLEEEelllllhhhhhhHHHHH-----------------------
Query DLARMAYGMG-----LWISLstdahqtdhlrfMELAV-----------------------  543
ident    |                                                        
Sbjct ESVRVIRDAKragihVTAEV------------TPHHLllteddipgnnaiykxnpplrst  282
DSSP  HHHHHHHHHHhllllEEEEE------------LHHHHhllhhhlllllhhhllllllllh


DSSP  ---HHHHHlLLLLL-LLHH-----------------------------------------
Query ---GTAQRaWIGPE-RVLN-----------------------------------------  558
ident                                                             
Sbjct edrEALLE-GLLDGtIDCIatdhaphardekaqpxekapfgivgsetafpllythfvkng  341
DSSP  hhhHHHHH-HHHLLlLLEEllllllllhhhhllllllllllllllllhhhhhhhhhllll


DSSP  ---------HLLHhHHHHHHHL--------------------------------------
Query ---------TLDYeDLLSWLKA--------------------------------------  571
ident           |                                                 
Sbjct dwtlqqlvdYLTI-KPCETFNLeygtlkengyadltiidldseqeikgedflskadntpf  400
DSSP  lllhhhhhhHHLH-HHHHHLLLlllllllllllleeeeelllleellhhhllllllllll


DSSP  ------------------llll
Query ------------------rrgv  575
ident                       
Sbjct igykvygnpiltxvegevkfeg  422
DSSP  llleelleeeeeeelleeeeel


No 34: Query=3au2A Sbjct=1j6pA Z-score=8.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllLL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpGV  180
ident                                                           | 
Sbjct -----------------------hhxiignclilkdfssepfwgaveiengtikrvlqGE   37
DSSP  -----------------------leeeeeeeeelllllllleeeeeeeelleeeeeeeLL


DSSP  LEeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query ERaelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct VK----------------------------------------------------------   39
DSSP  LL----------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   39
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllLLLL--------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysDGQN--------  352
ident                                            |                
Sbjct ------------------------vdldlsgklvXPALFNTHTHAP--XTLLrgvaedls   73
DSSP  ------------------------lleellleeeEELEEEEEELHH--HHHHllllllll


DSSP  -----------------------LHHHHHHHHHHHLLLEEEEEEelhhhhllllllhhhh
Query -----------------------TLEELWEAAKTMGYRYLAVTDhspavrvaggpspeea  389
ident                                    |                        
Sbjct feewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY----------------  117
DSSP  hhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE----------------


DSSP  hhHHHHHHHHHHHHLLlEEEEE-----------------------------------eeE
Query lkRVGEIRRFNETHGPpYLLAG-----------------------------------aeV  414
ident       |       |    |                                        
Sbjct -fHEEWIAKAVRDFGX-RALLTrglvdsngddggrleenlklynewngfegrifvgfgpH  175
DSSP  -lLHHHHHHHHHHHLL-EEEEEeeelllllllllhhhhhhhhhhhhllhhhleeeeeeeL


DSSP  ELL-lllllLLLH-HHHL-lllEEEEEL--llLLLLlhhhHHHHHHHhhLLLLLLEELLL
Query DIH-pdgtlDYPD-WVLR-eldLVLVSV--hsRFNLpkadQTKRLLKalENPFVHVLAHP  469
ident                        |                     |           || 
Sbjct SPYlcseeyLKRVfDTAKslnaPVTIHLyetsKEEY----DLEDILNigLKEVKTIAAHC  231
DSSP  LLLlllhhhHHHHhHHHHhhllLEEEEEllllLLLL----LLHHHHLllLLLLLEEEEEL


DSSP  LLllllllllllllHHHHHHHHHHHLLEEEEE-LLLL---LLLLlhhHHHHHHHLLLLEE
Query TArllgrrapieadWEAVFQKAKEKGVAVEID-GYYD---RMDLpddLARMAYGMGLWIS  525
ident                |  |   |     |                          |    
Sbjct VH-----------lPERYFGVLKDIPFFVSHNpASNLklgNGIA---PVQRXIEHGXKVT  277
DSSP  LL-----------lLHHHHHHHLLLLEEEEELhHHHHhllLLLL---LHHHHHHLLLEEE


DSSP  EELLLLL-hHHHHhHHHHHHHHHHL------LLLLLL--LHHHL------lHHHH-----
Query LSTDAHQ-tDHLRfMELAVGTAQRA------WIGPER--VLNTL------dYEDL-----  565
ident | ||       |                              |                 
Sbjct LGTDGAAsnNSLNlFFEXRLASLLQkaqnprNLDVNTclKXVTYdgaqaxgFKSGkieeg  337
DSSP  ELLLLLLllLLLLhHHHHHHHHHHHhlllllLLLHHHhhHHHLHhhhhhhlLLLLlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  565
ident                                                             
Sbjct wnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkre  397
DSSP  lllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhh


DSSP  hhhhhlllll
Query lswlkarrgv  575
ident           
Sbjct lariekelys  407
DSSP  hhhhhhhhhl


No 35: Query=3au2A Sbjct=1a4mA Z-score=8.7

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhllllllllLHHHlLEEEEELLlllLLLL--------
Query yaalglpwippplredqgeveaalegrlpkllELPQvKGDLQVHStysDGQN--------  352
ident                                      |  | ||    ||          
Sbjct ------------------------------tpAFNKpKVELHVHL---DGAIkpetilyf   27
DSSP  ------------------------------llLLLLlEEEEEEEH---HHLLlhhhhhhh


DSSP  ---------------------------------------------------LHHHHHHHH
Query ---------------------------------------------------TLEELWEAA  361
ident                                                       |  |  
Sbjct gkkrgialpadtveelrniigmdkplslpgflakfdyympviagcreaikrIAYEFVEMK   87
DSSP  hhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllhhhhhhHHHHHHHHH


DSSP  HHHLLLEEEEEE------------------------------------------------
Query KTMGYRYLAVTD------------------------------------------------  373
ident    |  |  |                                                  
Sbjct AKEGVVYVEVRYsphllanskvdpmpwnqtegdvtpddvvdlvnqglqegeqafgikvrs  147
DSSP  HHLLEEEEEEEEllhhhllllllllhhhlllllllhhhhhhhhhhhhhhhhhhhlleeee


DSSP  --ELHHhhLLLL--LLHHHHHHHHHHHHhhhhhhllleeeEEEEEE---llLLLL-----
Query --HSPAvrVAGG--PSPEEALKRVGEIRrfnethgppyllAGAEVD---ihPDGT-----  421
ident                  |   |                                      
Sbjct ilCCMR-hQPSWslEVLELCKKYNQKTV------------VAMDLAgdetiEGSSlfpgh  194
DSSP  eeEEEL-lLHHHhhHHHHHHHHLLLLLE------------EEEEEElllllLLHHhlhhh


DSSP  llLLHHHH-LLLLeEEEELlllllllhhhHHHHHHHHHLLLLLLEELLLLllllllllll
Query ldYPDWVL-RELDlVLVSVhsrfnlpkadQTKRLLKALENPFVHVLAHPTarllgrrapi  480
ident                 |                   |          |            
Sbjct veAYEGAVkNGIH-RTVHA------gevgSPEVVREAVDILKTERVGHGY---------h  238
DSSP  hhHHHHHHhHLLE-EEEEE------llllLHHHHHHHHHLLLLLEEEELH---------h


DSSP  lLLHHHHHHHHHHHLLEEEEEL-LLLL----llllhHHHHHHHHLLLLEEEELLLlLHHH
Query eADWEAVFQKAKEKGVAVEIDG-YYDR----mdlpdDLARMAYGMGLWISLSTDAhQTDH  535
ident     ||            |                              || ||      
Sbjct tIEDEALYNRLLKENMHFEVCPwSSYLtgawdpkttHAVVRFKNDKANYSLNTDD-PLIF  297
DSSP  hHHLHHHHHHHHHLLLEEEELHhHHHHlllllllllLHHHHHHHLLLLEEELLLL-LLLL


DSSP  hHHHHHHHHHHH-HLLL---LLLLL--HHHL-------lHHHHHhhhhlllll
Query lRFMELAVGTAQ-RAWI---GPERV--LNTL-------dYEDLLswlkarrgv  575
ident                        |                  ||         
Sbjct kSTLDTDYQMTKkDMGFteeEFKRLniNAAKssflpeeeKKELL-erlyreyq  349
DSSP  lLLHHHHHHHHHhLLLLlhhHHHHHhhHHHHlllllhhhHHHHH-hhhhhhll


No 36: Query=3au2A Sbjct=1itqA Z-score=8.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhHHHHhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlsLARSlleairalpgv  180
ident                                                             
Sbjct ---------------------------------------------DFFR-----------    4
DSSP  ---------------------------------------------LHHH-----------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    4
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    4
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLlLLLL----------
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHStYSDG----------  350
ident                                        |                    
Sbjct --------------------------deaerimrdspVIDGHNDL-PWQLldmfnnrlqd   37
DSSP  --------------------------hhhhhhhllllEEEEEELH-HHHHhhhhllllll


DSSP  ---------lLLHHhhHHHHHHHLLLEEEEEEELhhHHLL---LLLL-HHHHHHHHHHHH
Query ---------qNTLEelWEAAKTMGYRYLAVTDHSpaVRVA---GGPS-PEEALKRVGEIR  397
ident                                                   |    |    
Sbjct eranlttlagTHTN--IPKLRAGFVGGQFWSVYT--PCDTqnkDAVRrTLEQMDVVHRMC   93
DSSP  hhhlllllllLLLL--HHHHHHLLEEEEEEEELL--LHHHlllLHHHhHHHHHHHHHHHH


DSSP  HHHHHHL----------------LLEEEeEEEEELlllllLLLL------HHHHLLLLEE
Query RFNETHG----------------PPYLLaGAEVDIhpdgtLDYP------DWVLRELDLV  435
ident |                          |                                
Sbjct RMYPETFlyvtssagirqafregKVASL-IGVEGG-----HSIDsslgvlRALYQLGMRY  147
DSSP  HHLLLLEeelllhhhhhhhhhllLEEEE-EEEELH-----HHLLllhhhhHHHHHLLEEE


DSSP  EEE-LLLL-------------LLLLhhHHHHH--HHHHHLLL---LLLEELLLLLlllll
Query LVS-VHSR-------------FNLPkaDQTKR--LLKALENP---FVHVLAHPTArllgr  476
ident |                           |                 |             
Sbjct LTLtHSCNtpwadnwlvdtgdSEPQ--SQGLSpfGQRVVKELnrlGVLIDLAHVS-----  200
DSSP  EELlLLLLllllllhhhllllLLLL--LLLLLhhHHHHHHHHhhhLLEEELLLLL-----


DSSP  lllllLLHHHHHHHHhHHLLEEEEEL----llLLLLLLHHHHHHHHHLLLLEEEEL----
Query rapieADWEAVFQKAkEKGVAVEIDG----yyDRMDLPDDLARMAYGMGLWISLST----  528
ident      |   |  |      |             |   |||  |                 
Sbjct ----vATMKATLQLS-RAPVIFSHSSaysvcaSRRNVPDDVLRLVKQTDSLVMVNFynny  255
DSSP  ----hHHHHHHHHHL-LLLLEELLLLllllllLLLLLLHHHHHHHHHHLLEEEELLlhhh


DSSP  -llllhhhhhhHHHHHHHHHHlLLLLLLLHH-----------------------------
Query -dahqtdhlrfMELAVGTAQRaWIGPERVLN-----------------------------  558
ident                         |   |                               
Sbjct isctnkanlsqVADHLDHIKE-VAGARAVGFggdfdgvprvpegledvskypdliaellr  314
DSSP  hlllllllhhhHHHHHHHHHH-HLLHHHEEElllllllllllllllllllhhhhhhhhhh


DSSP  ----------HLLHhhhHHHHH--LLLL---------------------------l
Query ----------TLDYedlLSWLK--ARRG---------------------------v  575
ident            |     |                                      
Sbjct rnwteaevkgALAD-nlLRVFEavEQASnltqapeeepipldqlggscrthygyss  369
DSSP  llllhhhhhhHHLH-hhHHHHHhhHHLLllllllllllllhhhlllllllllllll


No 37: Query=3au2A Sbjct=2dvtA Z-score=8.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLL-------------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTY-------------  347
ident                                    | |  |  |                
Sbjct ----------------------------------MQGKVALEEHFAIpetlqdsagfvpg   26
DSSP  ----------------------------------LLLEEEEEEEELLhhhhhhhllllll


DSSP  ------llLLLLHH-HHHHHHHHHLLLEEEEEEEL-HHHHL----lLLLLHHHHHHHHHH
Query ------sdGQNTLE-ELWEAAKTMGYRYLAVTDHS-PAVRV----aGGPSPEEALKRVGE  395
ident                         |                            |     |
Sbjct dywkelqhRLLDIQdTRLKLMDAHGIETMILSLNApAVQAIpdrrkAIEIARRANDVLAE   86
DSSP  lhhhhhhhHHHLLLlHHHHHHHHLLEEEEEEEELLlHHHHLllhhhHHHHHHHHHHHHHH


DSSP  HHHHHHhhlllEEEEE--------------------------EEEELL--------LLLL
Query IRRFNEthgppYLLAG--------------------------AEVDIH--------PDGT  421
ident              ||                           | |           |   
Sbjct ECAKRP----dRFLAFaalplqdpdaateelqrcvndlgfvgALVNGFsqegdgqtPLYY  142
DSSP  HHHHLL----lLEEEEellllllhhhhhhhhhhhhhllllleEEEELLllllllllLLLL


DSSP  -----llllhhhhllllEEEEELLLLLL-----------------llhhhhHHHHHHH--
Query -----ldypdwvlreldLVLVSVHSRFN-----------------lpkadqTKRLLKA--  457
ident                                                        |    
Sbjct dlpqyrpfwgevekldvPFYLHPRNPLPqdsriydghpwllgptwafaqetAVHALRLma  202
DSSP  llhhhhhhhhhhhhhllLEEEELLLLLHhhlhhhlllhhhlhhhlhhhhhhHHHHHHHhh


DSSP  -----hllLLLLEELLllllllllllllllLHHH----------------------hhHH
Query -----lenPFVHVLAHptarllgrrapieaDWEA----------------------vfQK  490
ident              | |                                            
Sbjct sglfdehpRLNIILGH----------mgegLPYMmwridhrnawvklpprypakrrfmDY  252
DSSP  llhhhhllLLLEEELH----------hhllHHHHhhhhhhllllllllllllllllhhHH


DSSP  HHHHlLEEEEELlllllLLLHHHHHHHHHLLL--LEEEELLLLLhhHHHHH-HHHHHhhH
Query AKEKgVAVEIDGyydrmDLPDDLARMAYGMGL--WISLSTDAHQtdHLRFM-ELAVGtaQ  547
ident   |        |              |        |  |||                   
Sbjct FNEN-FHITTSG-----NFRTQTLIDAILEIGadRILFSTDWPF-eNIDHAsDWFNA--T  303
DSSP  HHHH-EEEELLL-----LLLHHHHHHHHLLLLhhHEELLLLLLL-lLHHHHhHHHHH--L


DSSP  HLL-lLLLLlHHHLlhhhHHHHHHlllll
Query RAW-iGPERvLNTLdyedLLSWLKarrgv  575
ident                        |     
Sbjct SIAeaDRVK-IGRT---nARRLFK---ld  325
DSSP  LLLhhHHHH-HHLH---hHHHHLL---ll


No 38: Query=3au2A Sbjct=3icjA Z-score=8.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLL-LL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRAL-PG  179
ident                                                             
Sbjct -------------------cmkalingtiytsfspvkkvsglvisnervlyagDSSTaLR   41
DSSP  -------------------leeeeelleeeeeelleeeeleeeeelleeeeeeLHHHhHH


DSSP  LLeeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeelll
Query VEraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkng  239
ident                                                             
Sbjct IA----------------------------------------------------------   43
DSSP  HH----------------------------------------------------------


DSSP  leeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhh
Query lqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteee  299
ident                                                             
Sbjct ------------------------------------------------------------   43
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLlllLLLL-------
Query vyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysDGQN-------  352
ident                                         |   |    |          
Sbjct --------------------elaggeiidlkgkfvMPAFFDSHLHL---DELGmslemvd   80
DSSP  --------------------hhhlleeeelllleeEELEEEEEELH---HHHHhhhhlee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  352
ident                                                             
Sbjct lrgvksmeelvervkkgrgriifgfgwdqdelgrwptredldvidrpvflyrrcfhvavm  140
DSSP  llllllhhhhhhhhhlllllleeeeeelhhhhlllllhhhhlllllleeeeelllleeee


DSSP  -----------------------------------------------LHHHHHHHHHHHL
Query -----------------------------------------------TLEELWEAAKTMG  365
ident                                                  |   |     |
Sbjct nskmidllnlkpskdfdestgivreraleesrkiinekiltvkdykhYIESAQEHLLSLG  200
DSSP  lhhhhhhhllllllleelllleeehhhhhhhhhhhhhllllhhhhhhHHHHHHHHHHHLL


DSSP  LLEEEEEEelhhhhllllllhhhHHHHHHHHHHHHH-HHLLLEEEEE-------------
Query YRYLAVTDhspavrvaggpspeeALKRVGEIRRFNE-THGPPYLLAG-------------  411
ident                          |                   |              
Sbjct VHSVGFMS--------------vGEKALKALFELEReGRLKMNVFAYlspelldkleeln  246
DSSP  EEEEEEEE--------------eLHHHHHHHHHHHHlLLLLLEEEEEelhhhhhhhhhhl


DSSP  -------------EEEELL-----------------------LLLL---lllLHHHHL-l
Query -------------AEVDIH-----------------------PDGT---ldyPDWVLR-e  431
ident                                                             
Sbjct lgkfegrrlriwgVXLFVDgslgartallsepytdnpttsgeLVMNkdeiveVIERAKpl  306
DSSP  llleellleeeeeEEEELLlllllllllllllllllllllllLLLLhhhhhhHHHHHLll


DSSP  llEEEEELlllllllhhhHHHHHHHHHLLL----LLLEELLLLlllllllllllLLHHHH
Query ldLVLVSVhsrfnlpkadQTKRLLKALENP----FVHVLAHPTarllgrrapieADWEAV  487
ident    | |              |    ||       |     |                   
Sbjct glDVAVHA---------iGDKAVDVALDAFeeaeFSGRIEHAS-----------LVRDDQ  346
DSSP  llEEEEEE---------lLHHHHHHHHHHHhhhlLLLEEEELL-----------LLLHHH


DSSP  HHHHHHHLLEEEEELLLL------------lllllhhHHHHHHHlLLLEEEELLLLlhhH
Query FQKAKEKGVAVEIDGYYD------------rmdlpddLARMAYGmGLWISLSTDAHqtdH  535
ident     ||  |                                          |||      
Sbjct LERIKELKVRISAQPHFIvsdwwivnrvgeerakwayRLKTLSS-ITKLGFSTDSP-ieP  404
DSSP  HHHHHHHLLEEEELLLHHhhlllhhhhhhhhhhhhllLHHHHHH-HLLEEELLLLL-llL


DSSP  HHHhHHHHHHHHH-------LLLL--lllLHHHL------lHHHH----------hhhhh
Query LRFmELAVGTAQR-------AWIG--perVLNTL------dYEDL----------lswlk  570
ident           |                   | |         |||               
Sbjct ADP-WVSIDAAVNryvvdpgERVSreealHLYTHgsaqvtlAEDLgklergfraeyiild  463
DSSP  LLH-HHHHHHHHHlllllhhHLLLhhhhhHHLLHhhhhhllLLLLlllllllllleeeel


DSSP  lllll
Query arrgv  575
ident      
Sbjct rdplk  468
DSSP  lllll


No 39: Query=3au2A Sbjct=4rdvB Z-score=8.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhllLLL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalPGV  180
ident                                                             
Sbjct -----------------------saifaerallpegwarnvrfeisadgvlaeirpdANA   37
DSSP  -----------------------leeeeeeeeelleeeeeeeeeellllleeeeellLLL


DSSP  L--eEEELhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeell
Query E--rAELCgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkn  238
ident                                                             
Sbjct DgaeRLGG----------------------------------------------------   45
DSSP  LlleELLL----------------------------------------------------


DSSP  lleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhh
Query glqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagetee  298
ident                                                             
Sbjct ------------------------------------------------------------   45
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllllllhhhlllllhhhhhhlllllllllHHHL---------------------
Query evyaalglpwippplredqgeveaalegrlpklleLPQV---------------------  337
ident                                                             
Sbjct --------------------------------avlPGMPnlhshafqramaglaevagnp   73
DSSP  --------------------------------leeELEEeeeelhhhhhhllllllllll


DSSP  ---------------------------------------LEEEEELLLL--------lll
Query ---------------------------------------KGDLQVHSTY--------sdg  350
ident                                              |              
Sbjct ndsfwtwrelmyrmvarlspeqieviacqlyiemlkagyTAVAEFHYVHhdldgrsyadp  133
DSSP  lllhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhleEEEEEEELLLlllllllllll


DSSP  llLHHHHHHHHHHHLLLEEEEEEELHH----------hhlllLLLHHHHHHHHHHHHHHH
Query qnTLEELWEAAKTMGYRYLAVTDHSPA----------vrvagGPSPEEALKRVGEIRRFN  400
ident          ||   |                               |  |      |   
Sbjct aeLSLRISRAASAAGIGLTLLPVLYSHagfggqpasegqrrfINGSEAYLELLQRLRAPL  193
DSSP  lhHHHHHHHHHHHHLLEEEEEELLLLEeellleellhhhlllLLLHHHHHHHHHHHHHHH


DSSP  hHHLLlEEEEEEEEELLllllllLLHHHHLL---lLEEEEEL---lLLLLL--LHHHHhH
Query eTHGPpYLLAGAEVDIHpdgtldYPDWVLRE---lDLVLVSV---hSRFNL--PKADQtK  452
ident         |                  ||        |                      
Sbjct -EAAG-HSLGLCFHSLR-avtpqQIATVLAAghddLPVHIHIaeqqKEVDDcqAWSGR-R  249
DSSP  -HHHL-LEELEEELLLL-lllhhHHHHHHLLllllLLEEEEElllhHHHHHhhHHHLL-L


DSSP  HHHHHH-LLLL--lLEELLLLlllllllllllllHHHHHHHHHHHLLEEEEELlLLLL--
Query RLLKAL-ENPF--vHVLAHPTarllgrrapieadWEAVFQKAKEKGVAVEIDGyYDRM--  507
ident  |              | | |               |        |              
Sbjct PLQWLYeNVAVdqrWCLVHAT-----------haDPAEVAAMARSGAVAGLCL-STEAnl  297
DSSP  HHHHHHhHLLLlllEEEEELL-----------llLHHHHHHHHHHLLEEEELH-HHHHhl


DSSP  lllhhHHHHHHHLLLLEEEELLlllhhHHHHhHHHHHHHHHLL-----------------
Query dlpddLARMAYGMGLWISLSTDahqtdHLRFmELAVGTAQRAW-----------------  550
ident       |      |       |             |                        
Sbjct gdgifPATDFLAQGGRLGIGSD-----SHVS-LSVVEELRWLEygqrlrdrkrnrlyrdd  351
DSSP  lllllLHHHHHHLLLEEEELLL-----LLLL-LLHHHHHHHHHhhhhhhhllllllllll


DSSP  ------lLLLLL--HHHL--lHHHH-----------------------------------
Query ------iGPERV--LNTL--dYEDL-----------------------------------  565
ident                                                             
Sbjct qpmigrtLYDAAlaGGAQalgQPIGslavgrradllvldgndpylasaegdallnrwlfa  411
DSSP  lllhhhhHHHHHhhHHHHhhlLLLLllllllllleeeellllhhhhllllhhhhhhhhhh


DSSP  ------------------------------hhhhhlllll
Query ------------------------------lswlkarrgv  575
ident                                         
Sbjct ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 40: Query=3au2A Sbjct=2uz9A Z-score=8.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllLLLL-----------------------------
Query yaalglpwippplredqgeveaalegrLPKL-----------------------------  331
ident                                                             
Sbjct ------------plahifrgtfvhstwTCPMevlrdhllgvsdsgkivfleeasqqekla   48
DSSP  ------------llleeeeeeeeelllLLLLeeeeeeeeeellllleeeeeehhhhhhhh


DSSP  ----------------llhHHLLEEEEELLlllLLLL-----------------------
Query ----------------lelPQVKGDLQVHStysDGQN-----------------------  352
ident                         |   |                               
Sbjct kewcfkpceirelshheffMPGLVDTHIHA---SQYSfagssidlpllewltkytfpaeh  105
DSSP  hhhlllhhheeellllleeEELEEEEEEEH---HHHHhllllllllhhhhhhhlhhhhhh


DSSP  ----------LHHHHHHHHHHHLLLEEEEEEelhhhhllllllhhHHHHHHHHHHHHHHH
Query ----------TLEELWEAAKTMGYRYLAVTDhspavrvaggpspeEALKRVGEIRRFNET  402
ident                       |                                     
Sbjct rfqnidfaeeVYTRVVRRTLKNGTTTACYFA-------------tIHTDSSLLLADITDK  152
DSSP  hhhlhhhhhhHHHHHHHHHHHLLEEEEEEEL-------------lLLHHHHHHHHHHHHH


DSSP  HLLlEEEEE-------------------------------------------EEEELL--
Query HGPpYLLAG-------------------------------------------AEVDIH--  417
ident  |      |                                                   
Sbjct FGQ-RAFVGkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpivTPRFSLsc  211
DSSP  HLL-EEEEEleelllllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLHHhl


DSSP  -llllllLLHHHhllllEEEEEL---lLLLLL----lhHHHHhHHHHHHLLLLL---LEE
Query -pdgtldYPDWVlreldLVLVSV---hSRFNL----pkADQTkRLLKALENPFV---HVL  466
ident                                                   |       | 
Sbjct setlmgeLGNIAktrdlHIQSHIsenrDEVEAvknlypSYKN-YTSVYDKNNLLtnkTVM  270
DSSP  lhhhhhhHHHHHhhhllEEEEEElllhHHHHHhhhhllLLLL-HHHHHHHLLLLlllEEE


DSSP  LLLLLllllllllllllHHHHHHHHHHHLLEEEEE-LLLL---LLLLlhhHHHHHHHLLL
Query AHPTArllgrrapieadWEAVFQKAKEKGVAVEID-GYYD---RMDLpddLARMAYGMGL  522
ident ||                        | |                 |             
Sbjct AHGCY-----------lSAEELNVFHERGASIAHCpNSNLslsSGFL---NVLEVLKHEV  316
DSSP  EELLL-----------lLHHHHHHHHHHLLEEEELhHHHHhllLLLL---LHHHHHHLLL


DSSP  LEEEELLLLlhHHHH--HHHHHHHHHHH---------lLLLL--lllHHHL---lhhHHH
Query WISLSTDAHqtDHLR--FMELAVGTAQR---------aWIGP--ervLNTL---dyeDLL  566
ident  | | ||                                        | ||       | 
Sbjct KIGLGTDVAggYSYSmlDAIRRAVMVSNillinkvnekSLTLkevfrLATLggsqalGLD  376
DSSP  EEEELLLLLllLLLLhhHHHHHHHHHHHhhhhllllllLLLHhhhhhHHLHhhhhhlLLL


DSSP  H-----------------------------------------------------------
Query S-----------------------------------------------------------  567
ident                                                             
Sbjct Geignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvg  436
DSSP  Llllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeel


DSSP  hhhlllll
Query wlkarrgv  575
ident         
Sbjct gkqvvpfs  444
DSSP  leeeelll


No 41: Query=3au2A Sbjct=2ob3A Z-score=8.5

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLeEEEEL----------------
Query yaalglpwippplredqgeveaalegrlpkllelPQVKgDLQVH----------------  344
ident                                            |                
Sbjct --------------------drintvrgpitiseAGFT-LTHEHicgssagflrawpeff   39
DSSP  --------------------lleeelleeelhhhHLLE-EEEELleellllhhhhlhhhh


DSSP  ----------------------------llLLLLlLLHHHHHHHHHHHLLLeEEEEeeLH
Query ----------------------------stYSDGqNTLEELWEAAKTMGYRyLAVTdhSP  376
ident                                  |      | |                 
Sbjct gsrkalaekavrglrraraagvrtivdvstFDIG-RDVSLLAEVSRAADVH-IVAAtgLW   97
DSSP  llhhhhhhhhhhhhhhhhhlllleeeelllHHHL-LLHHHHHHHHHHHLLE-EELEeeLL


DSSP  HHHLLLL------lLHHHHHHHHHHH---HHHHhhhllleeeEEEEEELLLLL---lLLL
Query AVRVAGG------pSPEEALKRVGEI---RRFNethgppyllAGAEVDIHPDG---tLDY  424
ident                    |                          |             
Sbjct FDPPLSMrlrsveeLTQFFLREIQYGiedTGIR--------aGIIXVATTGKAtpfqELV  149
DSSP  LLLLHHHhlllhhhHHHHHHHHHHLLlllLLLL--------lLEEEEELLLLLlhhhHHH


DSSP  LHHHHLLL----LEEEEELlllllllhhhHHHHHHHHHLLL-------lLLEELLLLLll
Query PDWVLREL----DLVLVSVhsrfnlpkadQTKRLLKALENP-------fVHVLAHPTArl  473
ident      |        |                                       |     
Sbjct LKAAARASlatgVPVTTHT--------aaSQRDGEQQAAIFeseglspsRVCIGHSDD--  199
DSSP  HHHHHHHHhhhlLLEEEEL--------lhHHLHHHHHHHHHhhllllhhHEEELLHHH--


DSSP  llllllllLLHHHHHHHHHHHLLEEEEE-LLLL-----------------llllLHHHHH
Query lgrrapieADWEAVFQKAKEKGVAVEID-GYYD-----------------rmdlPDDLAR  515
ident          |           |     |   |                         |  
Sbjct --------TDDLSYLTALAARGYLIGLDhIPYSaiglednasasallgirswqtRALLIK  251
DSSP  --------LLLHHHHHHHHHLLLEEEELlLLLLlllllllhhhhhhhllllhhhHHHHHH


DSSP  HHHHLLL--LEEEELLLLL--------------hhhhHHHHHHH-HHHHHLL------lL
Query MAYGMGL--WISLSTDAHQ--------------tdhlRFMELAV-GTAQRAW------iG  552
ident      |    |  | |                       |                    
Sbjct ALIDQGYmkQILVSNDWTFgfssyvtnimdvmdrvnpDGMAFIPlRVIPFLRekgvpqeT  311
DSSP  HHHHLLLhhHEEELLLLLLeellllllhhhhhhhhllLHHHHHHhLHHHHHHhllllhhH


DSSP  LLLLhHHLLhhHHHHhHHLLlll
Query PERVlNTLDyeDLLSwLKARrgv  575
ident              ||    |   
Sbjct LAGI-TVTNpaRFLS-PTLR---  329
DSSP  HHHH-HLHHhhHHHL-LLLL---


No 42: Query=3au2A Sbjct=2vc5A Z-score=8.5

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLLL------------
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTYS------------  348
ident                                            |                
Sbjct --------------------mriplvgkdsieskdigFTLIHEHLRVFseavrqqwphly   40
DSSP  --------------------llllllllllllhhhllLEELLLLLLLLlhhhhhhlhhhl


DSSP  ---llllLHHHHHHHHHHHLLLEEEEEEElhhhhllllllhhhhhhHHHHHHHHHHHHLL
Query ---dgqnTLEELWEAAKTMGYRYLAVTDHspavrvaggpspeealkRVGEIRRFNETHGP  405
ident                |   |                                      | 
Sbjct nedeefrNAVNEVKRAMQFGVKTIVDPTV------------mglgrDIRFMEKVVKATGI   88
DSSP  lhhhhhhHHHHHHHHHHHLLLLEEEELLL------------lllllLHHHHHHHHHLLLL


DSSP  lEEEEE------------------------------------------EEEELLL-----
Query pYLLAG------------------------------------------AEVDIHP-----  418
ident   | ||                                                      
Sbjct -NLVAGtgiyiyidlpfyflnrsideiadlfihdikegiqgtlnkagfVXIAADEpgitk  147
DSSP  -EEEELeellllllllhhhllllhhhhhhhhhhhhhllllllllllllEEEELLLllllh


DSSP  -lllLLLL-HHHHL-lllEEEEELLLLLlllhhhhhHHHHHHHLLL-------lLLEELL
Query -dgtLDYP-DWVLR-eldLVLVSVHSRFnlpkadqtKRLLKALENP-------fVHVLAH  468
ident                                        |                   |
Sbjct dvekVIRAaAIANKetkvPIITHSNAHN--------NTGLEQQRILteegvdpgKILIGH  199
DSSP  hhhhHHHHhHHHHHhhllLEEEELLLLL--------LHHHHHHHHHhhllllhhHEEELL


DSSP  LLLLllllllllllLHHHhHHHHHHHLLEEEEE-LLLL---llllLHHHHHHHHHLLL--
Query PTARllgrrapieaDWEAvFQKAKEKGVAVEID-GYYD---rmdlPDDLARMAYGMGL--  522
ident                      |   ||     |    |                  |   
Sbjct LGDT---------dNIDY-IKKIADKGSFIGLDrYGLDlflpvdkRNETTLRLIKDGYsd  249
DSSP  HHHL---------lLHHH-HHHHHHLLLEEEELlLLLLllllhhhHHHHHHHHHHLLLll


DSSP  LEEEELLLLL-----------------hHHHHHHH-HHHHHHHHLLLLLLL--LHHHLlh
Query WISLSTDAHQ-----------------tDHLRFME-LAVGTAQRAWIGPER--VLNTLdy  562
ident  |  | |                                    |     |          
Sbjct KIMISHDYCCtidwgtakpeykpklaprWSITLIFeDTIPFLKRNGVNEEViaTIFKE--  307
DSSP  LEEELLLLLLllllllllhhhhhhhlllLLLLHHHhLHHHHHHLLLLLHHHhhHHHLH--


DSSP  hhHHHHHHlllll
Query edLLSWLKarrgv  575
ident              
Sbjct -nPKKFFS-----  314
DSSP  -hHHHHLL-----


No 43: Query=3au2A Sbjct=1onxA Z-score=8.2

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLL-
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPG-  179
ident                                                          |  
Sbjct ---------------midytaagftllqgahlyapedrgicdvlvangkiiavasNIPSd   45
DSSP  ---------------llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeelLLLLl


DSSP  ------llEEEElhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleee
Query ------veRAELcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkerat  233
ident                                                             
Sbjct ivpnctvvDLSG------------------------------------------------   57
DSSP  llllleeeELLL------------------------------------------------


DSSP  eeelllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeee
Query vflknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekria  293
ident                                                             
Sbjct ------------------------------------------------------------   57
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLLL----
Query geteeevyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYSD----  349
ident                                               |  ||         
Sbjct --------------------------------------qilCPGFIDQHVHLIGGGgeag   79
DSSP  --------------------------------------leeEELEEEEEELLLLLLllll


DSSP  ---lLLLHhhHHHHHHHHLLLEEEEEEElhhhHLLLLLlhhHHHHHHHHHHHHHhHHLLl
Query ---gQNTLeeLWEAAKTMGYRYLAVTDHspavRVAGGPspeEALKRVGEIRRFNeTHGPp  406
ident                   |                               |  |   |  
Sbjct pttrTPEV--ALSRLTEAGVTSVVGLLG----TDSISR---HPESLLAKTRALN-EEGI-  128
DSSP  hhhlLLLL--LHHHHHHLLEEEEEELLL----LLLLLL---LHHHHHHHHHHHH-HHLL-


DSSP  EEEEE---------------------------EEEELLLL-------lllllLHHHHL--
Query YLLAG---------------------------AEVDIHPD-------gtldyPDWVLR--  430
ident                                     |                    |  
Sbjct SAWMLtgayhvpsrtitgsvekdvaiidrvigVXCAISDHrsaapdvyhlanMAAESRvg  188
DSSP  EEEEEeellllllllllllhhhhhhhllleeeEEEEELLLllllllhhhhhhHHHHHHhh


DSSP  -----llleEEEELLLlllllhhhHHHHHhHHHL---------LLLLlEELLLLLlllll
Query -----eldlVLVSVHSrfnlpkadQTKRLlKALE---------NPFVhVLAHPTArllgr  476
ident                           | |                      |        
Sbjct gllggkpgvTVFHMGD--------SKKAL-QPIYdllencdvpISKL-LPTHVNR-----  233
DSSP  hhhhlllleEEEEELL--------LLLLL-HHHHhhhhlllllHHHE-EEELHHH-----


DSSP  lllLLLLHHHHHHHHHHHLLeEEEELLLLlllLLHHHHHHHHH-LLLL--EEEELLLL--
Query rapIEADWEAVFQKAKEKGVaVEIDGYYDrmdLPDDLARMAYG-MGLW--ISLSTDAH--  531
ident         |     |   |    |    |    |      |           || |    
Sbjct ---NVPLFEQALEFARKGGT-IDITSSIDepvAPAEGIARAVQaGIPLarVTLSSDGNgs  289
DSSP  ---LHHHHHHHHHHHHLLLL-EEEELLLLlllLHHHHHHHHHHlLLLHhhEEEELLLLle


DSSP  -------------lhhHHHHHHHHHHHHH-HLLLLLL--lLHHHLlhhhHHHHHH-----
Query -------------qtdHLRFMELAVGTAQ-RAWIGPE--rVLNTLdyedLLSWLK-----  570
ident                         |                  |         |      
Sbjct qpffddegnlthigvaGFETLLETVQVLVkDYDFSISdalRPLTS---sVAGFLNltgkg  346
DSSP  eeeellllleeeeeelLLHHHHHHHHHHHhHHLLLHHhhhHHHLH---hHHHHLLlllll


DSSP  ---------------------------------------lllll
Query ---------------------------------------arrgv  575
ident                                             
Sbjct eilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  llllllllleeeellllleeeeeelleeeeelleelllllllll


No 44: Query=3au2A Sbjct=3nqbA Z-score=8.2

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhHHHHHHHLL--L
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarSLLEAIRAL--P  178
ident                                                   | |       
Sbjct -----------------------------------------epadlndDTLRARAVAaaR   19
DSSP  -----------------------------------------llhhhllHHHHHHHHHhhH


DSSP  LLLEeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeell
Query GVERaelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkn  238
ident |  |                                                        
Sbjct GDQR--------------------------------------------------------   23
DSSP  LLLL--------------------------------------------------------


DSSP  lleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeellLHH
Query glqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageTEE  298
ident                                                             
Sbjct -----------------------fdvlitggtlvdvvtgelrpadigivgaliasvhEPA   60
DSSP  -----------------------eeeeeelleeelllllleeeleeeeelleeeeeeLLL


DSSP  HhhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllLLLLLHHHHH
Query EvyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysDGQNTLEELW  358
ident                                          |   |        |     
Sbjct S--------------------rrdaaqvidaggayvSPGLIDTHXHIE--SSXITPAAYA   98
DSSP  L--------------------llleeeeeelllleeEELEEEEEELHH--HHLLLHHHHH


DSSP  HHHHHHLLLEEEEEEElhhhhllllllhhhhHHHHHHHHHHHHhHLLLEEEEE-------
Query EAAKTMGYRYLAVTDHspavrvaggpspeeaLKRVGEIRRFNEtHGPPYLLAG-------  411
ident  |    |        |                  |       |   |             
Sbjct AAVVARGVTTIVWDPH--------efgnvhgVDGVRWAAKAIE-NLPLRAILLapscvps  149
DSSP  HHHHLLLEEEEEELLH--------hhhhhhlHHHHHHHHHHHL-LLLLEEEEEellllll


DSSP  ----------------------------EEEELLLLLL------llLLHHHhlllleEEE
Query ----------------------------AEVDIHPDGT------ldYPDWVlreldlVLV  437
ident                             ||                           |  
Sbjct apglerggadfdaailadllswpeiggiAEIXNXRGVIerdprxsgIVQAGlaaeklVCG  209
DSSP  llllllllllllhhhhhhhhlllleeeeEEELLHHHHHlllhhhhhHHHHHhhhlleEEE


DSSP  ELLLlllllhhhHHHHHHHHHLLLlLLEELlLLLLlllllllllllhHHHHHHHhhhlLE
Query SVHSrfnlpkadQTKRLLKALENPfVHVLAhPTARllgrrapieadwEAVFQKAkekgVA  497
ident                 |        |                      |           
Sbjct HARG-------lKNADLNAFXAAG-VSSDH-ELVS--------gedlXAKLRAG----LT  248
DSSP  LLLL-------lLHHHHHHHHHLL-LLEEL-LLLL--------hhhhHHHHHLL----LE


DSSP  EEEELL-LLLLllLHHHHHHhhHLLL-LEEEELLLLL-----HHHH-HHHHHHHHhhHHL
Query VEIDGY-YDRMdlPDDLARMayGMGL-WISLSTDAHQ-----TDHL-RFMELAVGtaQRA  549
ident  |  |                 |       | ||                          
Sbjct IELRGShDHLLpeFVAALNT-lGHLPqTVTLCTDDVFpddllQGGGlDDVVRRLV-rYGL  306
DSSP  EEEELLlHHHHhhHHHHHHH-hLLLLlLEEEELLLLLhhhhhHLLLhHHHHHHHH-hLLL


DSSP  LLLLllLHHHLlhhHHHHH-----------------------------------------
Query WIGPerVLNTLdyeDLLSW-----------------------------------------  568
ident          ||     |                                           
Sbjct KPEWalRAATLnaaQRLGRsdlgliaagrradivvfedlngfsarhvlasgravaeggrx  366
DSSP  LHHHhhHHHLHhhhHHHLLllllllllllllleeeellllllleeeeeelleeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  568
ident                                                             
Sbjct lvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfv  426
DSSP  lllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  568
ident                                                             
Sbjct vppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxal  486
DSSP  llllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  568
ident                                                             
Sbjct aanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqpp  546
DSSP  hhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhllllll


DSSP  ----------------------------------hhlllll
Query ----------------------------------lkarrgv  575
ident                                          
Sbjct ylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllhhhhhlllllllllleelllleeelllleeellleeel


No 45: Query=3au2A Sbjct=4b3zD Z-score=8.1

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhllllL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgV  180
ident                                                             
Sbjct ----------------------------drllikggriinddqslyadvyledglikqiG   32
DSSP  ----------------------------leeeeeeeeeelllleeeeeeeeelleeeeeE


DSSP  LEEeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query ERAelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident |                                                           
Sbjct ENL---------------------------------------------------------   35
DSSP  LLL---------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelLLHHhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagETEEev  300
ident                                                             
Sbjct -----------------------------------------------------iVPGG--   40
DSSP  -----------------------------------------------------lLLLL--


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLlllLLLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYsdgQNTLEELWEA  360
ident                                        |                   |
Sbjct -----------------------vktieangrmvIPGGIDVNTYLQK-taADDFFQGTRA   76
DSSP  -----------------------leeeelllleeEELEEEEEELLLL-llLLLHHHHHHH


DSSP  HHHHLLLEEEEEEELHHhhllLLLLHHHHHHHHHHHHHHHhhhllLEEEEEEEEELLlll
Query AKTMGYRYLAVTDHSPAvrvaGGPSPEEALKRVGEIRRFNethgpPYLLAGAEVDIHpdg  420
ident |   |                |        |                             
Sbjct ALVGGTTMIIDHVVPEP----GSSLLTSFEKWHEAADTKS----cCDYSLHVDITSWydg  128
DSSP  HHHLLEEEEEEEELLLL----LLLHHHHHHHHHHHHHLLL----lLEEEEEEELLLLlll


DSSP  lllLLHHHH--LLLLEEEEELLLLLlllhhhHHHHHHHHHLLL----LLLEElLLLL---
Query tldYPDWVL--RELDLVLVSVHSRFnlpkadQTKRLLKALENP----FVHVLaHPTA---  471
ident                   |                |  |         |    |      
Sbjct vreELEVLVqdKGVNSFQVYMAYKD--vyqmSDSQLYEAFTFLkglgAVILV-HAENgdl  185
DSSP  hhhHHHHHHhlLLLLEEEEELLLLL--llllLHHHHHHHHHHHhhhlLEEEE-ELLLhhh


DSSP  -----------------llLLLLLL--llllhhhHHHHHH--HHLLEEEEELlllllllL
Query -----------------rlLGRRAP--ieadweaVFQKAK--EKGVAVEIDGyydrmdlP  510
ident                       |               |      |              
Sbjct iaqeqkrilemgitgpeghALSRPEeleaeavfrAITIAGriNCPVYITKVM----sksA  241
DSSP  hhhhhhhhhhllllllhhhHHHLLHhhhhhhhhhHHHHHHhhLLLEEEEEEL----lhhH


DSSP  HHHHHHHHHLL--LLEEE------------------------------------------
Query DDLARMAYGMG--LWISL------------------------------------------  526
ident  |    |   |                                                 
Sbjct ADIIALARKKGplVFGEPiaaslgtdgthywsknwakaaafvtspplspdpttpdyltsl  301
DSSP  HHHHHHHHHHLllEEEEElhhhhhlllhhhhlllhhhhhhllllllllllllhhhhhhhh


DSSP  ---------ELLLLL------------------HHHH-----hhhhhhhhhhhhllllll
Query ---------STDAHQ------------------TDHL-----rfmelavgtaqrawigpe  554
ident                                                             
Sbjct lacgdlqvtGSGHCPystaqkavgkdnftlipeGVNGieermtvvwdkavatgkmdenqf  361
DSSP  hhhllllllLLLLLLllhhhhhhhlllhhhlllLLLLlllhhhhhhhhhlllllllhhhh


DSSP  llhHHLLHHHHHH-----------------------------------------------
Query rvlNTLDYEDLLS-----------------------------------------------  567
ident                                                             
Sbjct vavTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitakshksaveynifegmech  421
DSSP  hhhHLHHHHHHHLllllllllllllllleeeeeeeeeeelllllllllllllllllleee


DSSP  --------------------------------hhHLLLL----------------l
Query --------------------------------wlKARRG----------------v  575
ident                                                         
Sbjct gsplvvisqgkivfedgninvnkgmgrfiprkafPEHLYqrvkirnkvfglqgvsr  477
DSSP  eeeeeeeelleeeeelleelllllllllllllllLHHHHhhhhhhhhhllllllll


No 46: Query=3au2A Sbjct=2qpxA Z-score=8.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct -----------------------------------------------gxddlsefvdqvp   13
DSSP  -----------------------------------------------lllllhhhhhhll


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhHLLL--LEEH--HHHH-HHHHHHHHHHh
Query lkaaldrgdltrlkgfgpkraerireglalaqAAGK--RRPL--GAVL-SLARSLLEAIr  175
ident                                        |    |         |     
Sbjct lldhhchflidgkvpnrddrlaqvsteadkdyPLADtkNRLAyhGFLAlAKEFALDANN-   72
DSSP  eeeeeellllllllllhhhhhhhhllllllllLHHHhlLLHHhhHHHHhHHHHLLLLLL-


DSSP  lllllleeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeee
Query alpgveraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvf  235
ident                                                             
Sbjct ------------------------------------------------------------   72
DSSP  ------------------------------------------------------------


DSSP  elllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeell
Query lknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriage  295
ident                                                             
Sbjct ------------------------------------------------------------   72
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhlllllllhhhlllllhhhhhhlllllllllHHHLLEEeEELLllLLLL-llh
Query teeevyaalglpwippplredqgeveaalegrlpklleLPQVKGDlQVHStySDGQ-ntl  354
ident                                           |                 
Sbjct -------------------plaaxndpgyatynhrifgHFHFKEL-LIDT--GFVPddpi  110
DSSP  -------------------llllllhhhhhhhhhhhhhHLLEEEE-EEEL--LLLLllll


DSSP  HHHHHHHHHHLLlEEEEEEELHHhHLLL-----------llLHHHHHHHHHHHhhhhhhh
Query EELWEAAKTMGYrYLAVTDHSPAvRVAG-----------gpSPEEALKRVGEIrrfneth  403
ident   |   |   |                                                 
Sbjct LDLDQTAELVGI-PVKAIYRLEThAEDFxlehdnfaawwqaFSNDVKQAKAHG-------  162
DSSP  LLHHHHHHHHLL-LEEEEEEHHHhHHHHhlllllhhhhhhhHHHHHHLLLLLL-------


DSSP  llleeeEEEEEEL--LLLLL---------------------------------lllLHHH
Query gppyllAGAEVDI--HPDGT---------------------------------ldyPDWV  428
ident        |                                                    
Sbjct -----fVGFXSIAayRVGLHlepvnvieaaagfdtwkhsgekrltskplidyxlyhVAPF  217
DSSP  -----lLLEEELHhhHLLLLlllllhhhhhhhhhhhhhhlllllllhhhhhhhhhhHHHH


DSSP  HL-LLLEEEEEL---llLLLLlhHHHHhhHHHHHLLL-------LLLEELLLLlllllll
Query LR-ELDLVLVSV---hsRFNLpkADQTkrLLKALENP-------FVHVLAHPTarllgrr  477
ident            |                  |                || |         
Sbjct IIaQDXPLQFHVgygdaDTDX--YLGN--PLLXRDYLkaftkkgLKVVLLHCY-------  266
DSSP  HHhHLLLEEEEElllllLLLH--HHLL--HHHHHHHHhhhhhhlLLEEEEELL-------


DSSP  llllLLHHHHHHHHHHH-LLEEEEEL-lLLLLllLHHHHHHHHHLL---LLEEEELLLll
Query apieADWEAVFQKAKEK-GVAVEIDG-yYDRMdlPDDLARMAYGMG---LWISLSTDAhq  532
ident              |         |                 |            |     
Sbjct ----PYHREAGYLASVFpNLYFDISLldNLGPsgASRVFNEAVELApytRILFASDAS--  320
DSSP  ----LLHHHHHHHHHHLlLEEEELLLhhHHLHhhHHHHHHHHLLLLlhhHEELLLLLL--


DSSP  hHHHHHHHHHHHHHHHLL-----------------lLLLLLHhhllhhhHHHHHH--lll
Query tDHLRFMELAVGTAQRAW-----------------iGPERVLntldyedLLSWLK--arr  573
ident         ||      |                                           
Sbjct -TYPEXYGLAARQFKQALvahfnqlpfvdlaqkkawINAICW-----qtSAKLYHqerel  374
DSSP  -LLHHHHHHHHHHHHHHHhhhhhllllllhhhhhhhHHHHHL-----hhHHHHLLlhhhh


DSSP  ll
Query gv  575
ident   
Sbjct rv  376
DSSP  ll


No 47: Query=3au2A Sbjct=3iacA Z-score=8.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leEEELHHHHLLlleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query erAELCGSARRYkdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident   |                                                         
Sbjct --ATFXTEDFLL------------------------------------------------   10
DSSP  --LLLLLLLLLL------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   10
DSSP  ------------------------------------------------------------


DSSP  hhhlllllLLHHHlllllhhhhhhllllllllLHHHLLEEEEELLllllllLLHHH----
Query yaalglpwIPPPLredqgeveaalegrlpkllELPQVKGDLQVHStysdgqNTLEE----  356
ident                                   |    |   |          |     
Sbjct -------kNDIAR-------------tlyhkyAAPXPIYDFHCHL------SPQEIaddr   44
DSSP  -------lLHHHH-------------hhhhhlLLLLLEEELLLLL------LHHHHhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct rfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwt  104
DSSP  llllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhh


DSSP  -------------------------------------hHHHHHHHLLLEEEEEE------
Query -------------------------------------lWEAAKTMGYRYLAVTD------  373
ident                                                |    ||      
Sbjct hlelrrpfgitgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTDdpidsl  164
DSSP  hhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLLllllll


DSSP  --------------------ELHHhHLLL---------------------------llLH
Query --------------------HSPAvRVAG---------------------------gpSP  386
ident                                                             
Sbjct eyhrqiaaddsidievapswRPDK-VFKIeldgfvdylrkleaaadvsitrfddlrqaLT  223
DSSP  hhhhhhhhlllllleeelllLLHH-HHLLllllhhhhhhhhhhhhllllllhhhhhhhHH


DSSP  HHHHHHHHHHhhhhhhhllleeeEEEEEEL-LLLL-------------------------
Query EEALKRVGEIrrfnethgppyllAGAEVDI-HPDG-------------------------  420
ident                              |                              
Sbjct RRLDHFAACG------------cRASDHGIeTLRFapvpddaqldailgkrlagetlsel  271
DSSP  HHHHHHHHLL------------lLEEEEEElLLLLlllllhhhhhhhhhhhhllllllhh


DSSP  --------llllLHHHHL-LLLEEEEELLLL-------------------lLLLHhhHHH
Query --------tldyPDWVLR-ELDLVLVSVHSR-------------------fNLPKadQTK  452
ident                                                             
Sbjct eiaqfttavlvwLGRQYAaRGWVXQLHIGAIrnnntrxfrllgpdtgfdsiGDNN--ISW  329
DSSP  hhhhhhhhhhhhHHHHHHhHLLEEEEEELEEllllhhhhhhhllllllleeLLLL--LHH


DSSP  HHHHHHL------lLLLLEEllLLLLlllllllllLLHHHHHHHHHHH-------LLEEE
Query RLLKALE------nPFVHVLahPTARllgrrapieADWEAVFQKAKEK-------GVAVE  499
ident  |   |             |                | |                 |   
Sbjct ALSRLLDsxdvtneLPKTIL--YCLN--------pRDNEVLATXIGNFqgpgiagKVQFG  379
DSSP  HHHHHHHhhhllllLLEEEE--EELL--------hHHHHHHHHHHHHLlllllllLEEEL


DSSP  EelllLLLL--lLHHHHHHHHHLLL---LEEEELLLLLHHHHHHHHHHHHHHHHLL----
Query IdgyyDRMD--lPDDLARMAYGMGL---WISLSTDAHQTDHLRFMELAVGTAQRAW----  550
ident                        ||        ||          |              
Sbjct S-gwwFNDQkdgXLRQLEQLSQXGLlsqFVGXLTDSRSFLSYTRHEYFRRILCNLLgqwa  438
DSSP  L-llhHHLLhhhHHHHHHHHHHHLLhhhLLLLLLLLLLLLLLHHHHHHHHHHHHHHhhhh


DSSP  --------------LLLLllHHHLlhhhHHHHHHLLlll
Query --------------IGPErvLNTLdyedLLSWLKARrgv  575
ident                                        
Sbjct qdgeipddeaxlsrXVQD--ICFN---nAQRYFTIK---  469
DSSP  hlllllllhhhhhhHHHH--HHLH---hHHHHLLLL---


No 48: Query=3au2A Sbjct=4dziC Z-score=8.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllHHHLLEEEEELLLL-------------
Query yaalglpwippplredqgeveaalegrlpklleLPQVKGDLQVHSTY-------------  347
ident                                  |     |   |                
Sbjct --------------------------------aLNYRVIDVDNHYYEpldsftrhldkkf   28
DSSP  --------------------------------lLLLLEEEEEEELLLllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  347
ident                                                             
Sbjct krrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkv   88
DSSP  lllleeeeelllleeeeelleellllllllllleelllllhhhhhllllllllhhhllle


DSSP  -----lllLLLHHHHHHHHHHHLLLEEEEEEELHhHHLL----------lllLHHHHHHH
Query -----sdgQNTLEELWEAAKTMGYRYLAVTDHSPaVRVA----------ggpSPEEALKR  392
ident                                      |                   |  
Sbjct erladhpeYQNRDARIAVMDEQDIETAFMLPTFG-CGVEealkhdieatmasVHAFNLWL  147
DSSP  elhhhlhhHLLHHHHHHHHHHHLEEEEEEELLHH-HHHHhhllllhhhhhhhHHHHHHHH


DSSP  HHHHHhhhhHHLLlEEEEE-------------------------EEEELLL---------
Query VGEIRrfneTHGPpYLLAG-------------------------AEVDIHP---------  418
ident                  |                            |   |         
Sbjct DEDWG--fdRPDH-RIIAApivsladptraveevdfvlargaklVLVRPAPvpglvkprs  204
DSSP  HHHLL--llLLLL-LEEELlllllllhhhhhhhhhhhhhlllllEELLLLLlllllllll


DSSP  ---lllllllhhhhllllEEEEELL-LLLL-------------LLHHHHHHHHHHHHLLL
Query ---dgtldypdwvlreldLVLVSVH-SRFN-------------LPKADQTKRLLKALENP  461
ident                    |      |                                 
Sbjct lgdrshdpvwarlaeagvPVGFHLSdSGYLhiaaawggakdplDQVLLDDRAIHDTMASM  264
DSSP  lllhhhhhhhhhhhhhllLEEEELLlLLLHhhhhhllllllhhHHHHHLLHHHHHHHHHH


DSSP  -----------LLLEELLLLlllllllllllllhhHHHH---------------------
Query -----------FVHVLAHPTarllgrrapieadweAVFQ---------------------  489
ident               |                                             
Sbjct ivhgvftrhpkLKAVSIENG--------------sYFVHrlikrlkkaantqpqyfpedp  310
DSSP  hhllhhhhlllLLEEEELLL--------------lLHHHhhhhhhhhhhhhlhhhllllh


DSSP  -hhHHHLLEEEEellllllLLLHhHHHHHHHLLL--LEEEELLLLL-hhHHHHHHhHHHH
Query -kaKEKGVAVEIdgyydrmDLPDdLARMAYGMGL--WISLSTDAHQ-tdHLRFMElAVGT  545
ident        |              |              |    |                 
Sbjct veqLRNNVWIAP-------YYED-DLPELARVIGvdKILFGSDWPHgegLASPVS-FTAE  361
DSSP  hhhHHHHEEELL-------LLLL-LHHHHHHHHLhhHLLLLLLLLLlllLLLHHH-HHHH


DSSP  hHHLL--lLLLLlHHHLlhhhHHHHHHLLlll
Query aQRAW--iGPERvLNTLdyedLLSWLKARrgv  575
ident                       |  |      
Sbjct -LKGFsesDIRK-IMRD---nALDLLGVQvgs  388
DSSP  -HLLLlhhHHHH-HHLH---hHHHHHLLLlll


No 49: Query=3au2A Sbjct=1j5sA Z-score=8.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leEEELHhHHLLlleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query erAELCGsARRYkdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident       |                                                     
Sbjct --HMFLG-EDYL------------------------------------------------    9
DSSP  --LLLLL-LLLL------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    9
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhHHLLLllhhhhhhllllllllLHHHLLEEEEELLllllllLLHHH----
Query yaalglpwippPLREDqgeveaalegrlpkllELPQVKGDLQVHStysdgqNTLEE----  356
ident                                        |   |                
Sbjct -----------LTNRA---------avrlfneVKDLPIVDPHNHL------DAKDIvenk   43
DSSP  -----------LLLHH---------hhhhhhhHLLLLEEELLLLL------LHHHHhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct pwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewih  103
DSSP  llllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhh


DSSP  ---------------------------------hhHHHHHHLLLEEEEEE----------
Query ---------------------------------lwEAAKTMGYRYLAVTD----------  373
ident                                         |    |  ||          
Sbjct ldlwrrfnikkviseetaeeiweetkkklpemtpqKLLRDMKVEILCTTDdpvstlehhr  163
DSSP  hhhhhhllllllllhhhhhhhhhhhhhhlllllhhHHHHHLLEEEEELLLllllllhhhh


DSSP  --------------ELHHhHLLL----------------------------llLHHHHHH
Query --------------HSPAvRVAG----------------------------gpSPEEALK  391
ident                 |  |                                        
Sbjct kakeavegvtilptWRPD-RAMNvdkegwreyvekmgerygedtstldgflnaLWKSHEH  222
DSSP  hhhhhlllleeellLLLH-HHHLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHH


DSSP  HHHHHhhhhhhhllleeeEEEEEELLLLLL------------------------------
Query RVGEIrrfnethgppyllAGAEVDIHPDGT------------------------------  421
ident                                                             
Sbjct FKEHG------------cVASDHALLEPSVyyvdenraravhekafsgekltqdeindyk  270
DSSP  HHLLL------------lLEEEEEELLLLLllllhhhhhhhhhhhlllllllhhhhhhhh


DSSP  ---lllLHHHHL-LLLEEEEELLLL-------------------LLLLHhHHHHHHHHHH
Query ---ldyPDWVLR-ELDLVLVSVHSR-------------------FNLPKaDQTKRLLKAL  458
ident                                                        |   |
Sbjct afmmvqFGKMNQeTNWVTQLHIGALrdyrdslfktlgpdsggdiSTNFL-RIAEGLRYFL  329
DSSP  hhhhhhHHHHHHhHLLEEEEEELEEllllhhhhhhlllllllleELLLL-LHHHHHHHHH


DSSP  LLL---LLLEEllLLLLlllllllllLLHHHHHHHHHHHL-LEEEEelllLLLL--lLHH
Query ENP---FVHVLahPTARllgrrapieADWEAVFQKAKEKG-VAVEIdgyyDRMD--lPDD  512
ident          ||                        |     | |                
Sbjct NEFdgkLKIVL--YVLD--------pTHLPTISTIARAFPnVYVGA-pwwFNDSpfgMEM  378
DSSP  HHLlllLLEEE--EELL--------hHHHHHHHHHHHHLLlEEELL-lllLLLLhhhHHH


DSSP  HHHHHHHLLL--LEEE-ELLLLLHHHHH-HHHHHHHHHHHLL----------------lL
Query LARMAYGMGL--WISL-STDAHQTDHLR-FMELAVGTAQRAW----------------iG  552
ident          |        ||           |                            
Sbjct HLKYLASVDLlyNLAGmVTDSRKLLSFGsRTEMFRRVLSNVVgemvekgqipikearelV  438
DSSP  HHHHHHLLLLhhHLLLlLLLLLLLLHHHhHHHHHHHHHHHHHhhhhhlllllhhhhhhhH


DSSP  LLL--lHHHLlhhhhhhhhhlllll
Query PER--vLNTLdyedllswlkarrgv  575
ident                          
Sbjct KHVsydGPKA------------lff  451
DSSP  HHHhlhHHHH------------hhl


No 50: Query=3au2A Sbjct=4ofcA Z-score=7.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLL-------------
Query yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTY-------------  347
ident                                      | |   |                
Sbjct ------------------------------------MKIDIHSHILPkewpdlkkrfgyg   24
DSSP  ------------------------------------LLEEEEEELLLlllllhhhhhlll


DSSP  ------------------------lllLLLHH-HHHHHHHHHLLLEEEEEEELHhhHLLL
Query ------------------------sdgQNTLE-ELWEAAKTMGYRYLAVTDHSPavRVAG  382
ident                                           |    |            
Sbjct gwvqlqhhskgeakllkdgkvfrvvreNCWDPeVRIREMDQKGVTVQALSTVPV-mFSYW   83
DSSP  lleeeeeeelleeeeeelleeeeeeehHHLLHhHHHHHHHHHLLLEEEEELLHH-hHLLL


DSSP  ---llLHHHHHHHHHHHHHHHHHHLLlEEEEE--------------------------EE
Query ---gpSPEEALKRVGEIRRFNETHGPpYLLAG--------------------------AE  413
ident                                                             
Sbjct akpedTLNLCQLLNNDLASTVVSYPR-RFVGLgtlpmqapelavkemercvkelgfpgVQ  142
DSSP  llhhhHHHHHHHHHHHHHHHHHHLLL-LEEEEellllllhhhhhhhhhhhhhllllleEE


DSSP  EELL---LLLL---lllLHHH-hllllEEEEELLLL-------------llllhhhhhHH
Query VDIH---PDGT---ldyPDWV-lreldLVLVSVHSR-------------fnlpkadqtKR  453
ident    |    |                     |                             
Sbjct IGTHvneWDLNaqelfpVYAAaerlkcSLFVHPWDMqmdgrmakywlpwlvgmpaettIA  202
DSSP  EELEellEELLlhhhhhHHHHhhhhllEEEEELLLLlllhhhhlllhhhhlhhhhhhhHH


DSSP  HHHHH-------llLLLLEELL-LLLLlllllllllLLHH-------------------h
Query LLKAL-------enPFVHVLAH-PTARllgrrapieADWE-------------------a  486
ident                     ||   |                                  
Sbjct ICSMImggvfekfpKLKVCFAHgGGAF--------pFTVGrishgfsmrpdlcaqdnpmn  254
DSSP  HHHHHlllhhhhllLLLEEELHhHLLH--------hHHHHhhhhhhhhlhhhhlllllll


DSSP  hhHHHHhhLLEEEEELLLlllllLHHHHHHHHhllLLEEEELLLLLhhHHHHH-HHHHHh
Query vfQKAKekGVAVEIDGYYdrmdlPDDLARMAYgmgLWISLSTDAHQtdHLRFM-ELAVGt  545
ident                           |            | ||            |    
Sbjct pkKYLG--SFYTDALVHD--plsLKLLTDVIG--kDKVILGTDYPFplGELEPgKLIES-  307
DSSP  hhHHLL--LLEEELLLLL--hhhHHHHHHHHL--lLLEELLLLLLLllLLLLLlHHHHH-


DSSP  hHHLL--lLLLLLHHHllhhhHHHHHH-lllll
Query aQRAW--iGPERVLNTldyedLLSWLK-arrgv  575
ident                       |  |       
Sbjct -MEEFdeeTKNKLKAG----nALAFLGlerkqf  335
DSSP  -LLLLlhhHHHHHHLH----hHHHHHLllhhhl


No 51: Query=3au2A Sbjct=4qrnA Z-score=7.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLL-------------
Query yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTY-------------  347
ident                                                             
Sbjct ----------------------smtqdlktggeqgYLRIATEEAFATreiidvylrmird   38
DSSP  ----------------------lllllllllllllLLLEEEEEEELLhhhhhhhhhhhhh


DSSP  --------------------------llLLLLHHHHHHHHHHHLLLEEEEEEE-lHHHHL
Query --------------------------sdGQNTLEELWEAAKTMGYRYLAVTDH-sPAVRV  380
ident                                  |         |                
Sbjct gtadkgmvslwgfyaqspseratqilerLLDLGERRIADMDATGIDKAILALTspGVQPL   98
DSSP  llllhhhhhhhhhhhhlllhhhhhhhhhHHLLLHHHHHHHHHLLLLEEEEEELllLLLLL


DSSP  ------lLLLLhHHHHHHHHHHHHHHhhhlllEEEEEEEEELLllllLLLL-HHHHL--L
Query ------aGGPSpEEALKRVGEIRRFNethgppYLLAGAEVDIHpdgtLDYP-DWVLR--E  431
ident                                        |                |   
Sbjct hdldearTLAT-RANDTLADACQKYP-----dRFIGMGTVAPQdpewSAREiHRGARelG  152
DSSP  llhhhhhHHHH-HHHHHHHHHHHHLL-----lLEEELLLLLLLlhhhHHHHhHHHHHllL


DSSP  LLEEEEEL-LLLLlllhhhHHHH-hHHHHLL---LLLLEELL---------------lll
Query LDLVLVSV-HSRFnlpkadQTKR-lLKALEN---PFVHVLAH---------------pta  471
ident                                          |                  
Sbjct FKGIQINShTQGR-----yLDEEffDPIFRAlveVDQPLYIHpatspdsmidpmleagld  207
DSSP  LLLEEELLlLLLL-----lLLLHhhHHHHHHhhhHLLLEEELlllllllllhhhhhhlll


DSSP  lLLLL-----lllllLLHH-HHHHHhhHHLLEEEEEllllllLLLHH-------------
Query rLLGR-----rapieADWE-AVFQKakEKGVAVEIDgyydrmDLPDD-------------  512
ident                       | |                                   
Sbjct gAIFGfgvetgmhllRLITiGIFDK-yPSLQIMVGH-----mGEALPywlyrldymhqag  261
DSSP  lLLLHhhhhhhhhhhHHHHhLHHHH-lLLLLEEELH-----hHHLHHhhhhhhhhhhhhh


DSSP  --------------hhhHHHHLLLLEEEElllllhhhhhHHHHhhHHHHHL--LLLLLLL
Query --------------larMAYGMGLWISLStdahqtdhlrFMELavGTAQRA--WIGPERV  556
ident                             |                          |  ||
Sbjct vrsqryermkplkktieGYLKSNVLVTNS----------GVAW-ePAIKFCqqVMGEDRV  310
DSSP  hhlllllllllllllhhHHHHHLEEEELL----------LLLL-hHHHHHHhhHHLHHHE


DSSP  HH----------------------------HLLHhHHHHHHHlllll
Query LN----------------------------TLDYeDLLSWLKarrgv  575
ident                                        | |     
Sbjct MYamdypyqyvadevramdamdmsaqtkkkFFQT-NAEKWFK----l  352
DSSP  ELlllllllllhhhhhhhhlllllhhhhhhHHLH-HHHHHLL----l


No 52: Query=3au2A Sbjct=3pnuA Z-score=7.5

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhHHHHlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarsllEAIRalpgv  180
ident                                                    |        
Sbjct ---------------------------------------------------ENLY-----    4
DSSP  ---------------------------------------------------LLLL-----


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    4
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    4
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLL-lllllLHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTY-sdgqnTLEELWE  359
ident                                        |   |                
Sbjct ---------------------------fqsnamklknPLDMHLHLRDnqmlelIAPLSAR   37
DSSP  ---------------------------llllleeeelLEEEEELLLLhhhhhhHHHHHHL


DSSP  HHhhhllLEEEEEEElhhhhlLLLL-LHHHHHHHHHHHHHHHHHHLlLEEEeEEEEELLl
Query AAktmgyRYLAVTDHspavrvAGGP-SPEEALKRVGEIRRFNETHGpPYLLaGAEVDIHp  418
ident                             |        |            |         
Sbjct DF-----CAAVIMPN-----lIPPLcNLEDLKAYKMRILKACKDEN-FTPL-MTLFFKN-   84
DSSP  LL-----LEEEELLL-----lLLLLlLHHHHHHHHHHHHHHHLLLL-LEEE-EEEELLL-


DSSP  llllllLHHHHLLLlEEEEEL----------LLLLlllhhhHHHHHHHHHLLL---LLLE
Query dgtldyPDWVLRELdLVLVSV----------HSRFnlpkadQTKRLLKALENP---FVHV  465
ident             |                                |   ||         
Sbjct -ydekfLYSAKDEI-FGIXLYpagittnsngGVSS-----fDIEYLKPTLEAMsdlNIPL  137
DSSP  -llhhhHHHHLLLL-LEEEELllllllllllLLLL-----lLHHHHHHHHHHHhhlLLLE


DSSP  ELLLLlLLLLLLLL---llLLHHHHHHHHHHHLLEEEEellllllLLLHHHHHHHHHLL-
Query LAHPTaRLLGRRAP---ieADWEAVFQKAKEKGVAVEIdgyydrmDLPDDLARMAYGMG-  521
ident | |                   |             |             |         
Sbjct LVHGE-TNDFVMDResnfaKIYEKLAKHFPRLKIVMEH-------ITTKTLCELLKDYEn  189
DSSP  EELLL-LLLLHHHLlhhhhHHHHHHHHHLLLLLEEELL-------LLLHHHHHHHHHLLl


DSSP  LLEEEElllllhhhhhhHHHH---------------------------hHHHHH-lllLL
Query LWISLStdahqtdhlrfMELA---------------------------vGTAQR-awiGP  553
ident |                                                         | 
Sbjct LYATIT-----------LHHLiitlddviggkmnphlfckpiakryedkEALCElafsGY  238
DSSP  EEEEEL-----------LHHHlllhhhhhlllllhhhllllllllhhhhHHHHHhhhlLL


DSSP  LLLHH----------------------------------------HLLHhHHHHHHHL--
Query ERVLN----------------------------------------TLDYeDLLSWLKA--  571
ident | |                                           |             
Sbjct EKVMFgsdsaphpkgcaagvfsapvilpvlaelfkqnsseenlqkFLSD-NTCKIYDLkf  297
DSSP  LLEEElllllllllllllllllhhhhhhhhhhhhhhhllhhhhhhHHLH-HHHHHHLLll


DSSP  -------------------------------------llll
Query -------------------------------------rrgv  575
ident                                          
Sbjct kedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  lllleeeeellleelllleelllleellllllleelleell


No 53: Query=3au2A Sbjct=1a5kC Z-score=7.5

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLLL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPGV  180
ident                                                             
Sbjct ---------------------------------------------------snisRQAYA    9
DSSP  ---------------------------------------------------leeeHHHHH


DSSP  L------eEEEL-hHHHLllleelleeeeeelllhhhhhhhhhlllleeeeeeellleee
Query E------rAELC-gSARRykdtvgdldflvasregeravegfvrlpqvkevyakgkerat  233
ident                                                             
Sbjct DmfgptvgDKVRlaDTEL------------------------------------------   27
DSSP  HhhlllllLEEEllLLLL------------------------------------------


DSSP  eeelllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeee
Query vflknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekria  293
ident                                                             
Sbjct ---------------------------------------------------------wie   30
DSSP  ---------------------------------------------------------eee


DSSP  llLHHH------------------------------------------------------
Query geTEEE------------------------------------------------------  299
ident                                                             
Sbjct veDDLTtygeevkfgggkvirdgmgqgqmlaadcvdlvltnalivdhwgivkadigvkdg   90
DSSP  llEELLllllllllllllllllllllllllhhhllleeeeeeeeeelleeeeeeeeeell


DSSP  hhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLllllllLLHHhHHH
Query vyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysdgqNTLEeLWE  359
ident                                         |   |              |
Sbjct rifaigkagnpdiqpnvtipigaateviaaegkivTAGGIDTHIHW------ICPQ-QAE  143
DSSP  eeeeeeleellllllllleellllleeeelllleeEELEEEEEEEL------LLLL-HHH


DSSP  HHHHHLLLEEEEEEelhhhhllllllhhHHHHHHHHHHHHHHhHLLLEEEEE--------
Query AAKTMGYRYLAVTDhspavrvaggpspeEALKRVGEIRRFNEtHGPPYLLAG--------  411
ident  |   |                                       |              
Sbjct EALVSGVTTMVGGG-tgpaagthattctPGPWYISRMLQAAD-SLPVNIGLLgkgnvsqp  201
DSSP  HHHHHLEEEEEEEL-llllhhhhhllllLHHHHHHHHHHHHL-LLLLEEEEEeelllllh


DSSP  -------------EEEE----LLLLlLLLLLHHhhllllEEEEELLLLLLLlhhHHHHHH
Query -------------AEVD----IHPDgTLDYPDWvlreldLVLVSVHSRFNLpkaDQTKRL  454
ident               |        |                |                   
Sbjct dalreqvaagvigLEIHedwgATPAaIDCALTVademdiQVALHSDTLNES---GFVEDT  258
DSSP  hhhhhhhhhllleEEEEhhhlLLHHhHHHHHHHhhhhllEEEEELLLLLLL---LLHHHH


DSSP  HHHHLLLLLlEELLLLLLlllllllLLLLHhHHHHHhhhHLLEEEEELLL----------
Query LKALENPFVhVLAHPTARllgrrapIEADWeAVFQKakeKGVAVEIDGYY----------  504
ident | |          |                                              
Sbjct LAAIGGRTI-HTFHTEGA---ggghAPDII-TACAH---PNILPSSTNPTlpytlntide  310
DSSP  HHHHLLLLE-EELLLLLL---llllLLLHH-HHHHL---LLEEEEEEHHHllllllhhhh


DSSP  ----------------------------lllllLHHHHHHHHhllllEEEELLLLLhhHH
Query ----------------------------drmdlPDDLARMAYgmglwISLSTDAHQtdHL  536
ident                                   | |             | |       
Sbjct hldmlmvchhldpdiaedvafaesrirretiaaEDVLHDLGA----fSLTSSDSQAmgRV  366
DSSP  hhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHHLLL----lLEEELLLLLllLL


DSSP  HHHHHHHHHHHH---------------------lLLLL--lLLHH--hlLHHH-------
Query RFMELAVGTAQR---------------------aWIGP--eRVLN--tlDYED-------  564
ident     |                                                       
Sbjct GEVILRTWQVAHrmkvqrgalaeetgdndnfrvkRYIAkytINPAlthgIAHEvgsievg  426
DSSP  LLHHHHHHHHHHhhhhhhlllllllllllhhhhhHHHHlllHHHHhhllLLLLlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  564
ident                                                             
Sbjct kladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhc  486
DSSP  lllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhh


DSSP  -------------------------hHHHHhLLLL-------------------------
Query -------------------------lLSWLkARRG-------------------------  574
ident                                                             
Sbjct rltflsqaaaangvaerlnlrsaiavVKGC-RTVQkadmvhnslqpnitvdaqtyevrvd  545
DSSP  leeeelhhhhhhlhhhhllllleeeeLLLL-LLLLhhhllllllllleeelllllleeel


DSSP  --------------------l
Query --------------------v  575
ident                      
Sbjct gelitsepadvlpmaqryflf  566
DSSP  leellllllllllllllllll


No 54: Query=3au2A Sbjct=3giqA Z-score=7.5

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPgv  180
ident                                                        | |  
Sbjct ----------------ekldfkitggwiidgtgaprrradlgvrdgriaaigeLGAHP--   42
DSSP  ----------------lleeeeeelleelllllllleeleeeeelleeeeeelLLLLL--


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   42
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   42
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLlllllLLHHH--hH
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysdgqNTLEE--lW  358
ident                                        |   |           |    
Sbjct ----------------------arhawdasgkivAPGFIDVHGHDD-----LMFVEkpdL   75
DSSP  ----------------------eeeeeelllleeEELEEELLLLLL-----LHHHHlllL


DSSP  HHHHHHLLLEEEEEEEL-------hhhhLLLLL----lhhhhhHHHHHHHHHHHHHLLLE
Query EAAKTMGYRYLAVTDHS-------pavrVAGGP----speealKRVGEIRRFNETHGPPY  407
ident       |     |                |                              
Sbjct RWKTSQGITTVVVGNCGvsaapaplpgnTAAALallgetplfaDVPAYFAALDAQRPMIN  135
DSSP  HHHHLLLEEEEEELLLLlllllllllllLLHHHhhhlllllllLHHHHHHHHHHLLLLLE


DSSP  EEEE----------------------------------------EEEELL-------lll
Query LLAG----------------------------------------AEVDIH-------pdg  420
ident   |                                                         
Sbjct VAALvghanlrlaamrdpqaaptaaeqqamqdmlqaaleagavgFSTGLAyqpgavaqaa  195
DSSP  EEEEeehhhhhhhhlllllllllhhhhhhhhhhhhhhhhhllleEEEELLlllhhhllhh


DSSP  llllLHHHHL-llleEEEELLLlllllhhHHHHHHHHHHLLL----LLLEELLLLLLlll
Query tldyPDWVLR-eldlVLVSVHSrfnlpkaDQTKRLLKALENP----FVHVLAHPTARllg  475
ident        |                              |          |  |       
Sbjct elegLARVAAerrrlHTSHIRN----eadGVEAAVEEVLAIGrgtgCATVVSHHKCM---  248
DSSP  hhhhHHHHHHhllleEEEELLL----lllLHHHHHHHHHHHHhhhlLEEEELLLLLL---


DSSP  lLLLLLLLHHHHHHHHHHHL-----LEEEEELLLLL------------------------
Query rRAPIEADWEAVFQKAKEKG-----VAVEIDGYYDR------------------------  506
ident           |              ||  |  |                           
Sbjct -MPQNWGRSRATLANIDRAReqgveVALDIYPYPGSstiliperaetiddiritwstphp  307
DSSP  -LHHHLLLHHHHHHHHHHHHhllllEEEEELLLLEEeeellhhhllllllleeeeelllh


DSSP  ------------------------------------lllLHHHHHHhhhllLLEEEELLL
Query ------------------------------------mdlPDDLARMaygmgLWISLSTDA  530
ident                                                           | 
Sbjct ecsgeyladiaarwgcdkttaarrlapagaiyfamdedeVKRIFQH-----PCCMVGSDG  362
DSSP  hhllllhhhhhhhhlllhhhhhhhhlleeeeeelllhhhHHHHHHL-----LLEEELLLL


DSSP  LL-----hHHHH-HHHHHH-HHHH--HLLLLLL-lLHHHLlhhhHHHHHH----------
Query HQ-----tDHLR-FMELAV-GTAQ--RAWIGPE-rVLNTLdyedLLSWLK----------  570
ident           |               |           |                     
Sbjct LPndarphPRLWgSFTRVLgRYVReaRLMTLEQavARMTA---lPARVFGfaergvlqpg  419
DSSP  LLllllllLHHHhHHHHHHhHHHHhlLLLLHHHhhHHHLH---hHHHHHLllllllllll


DSSP  ---------------------------------------------------lllll
Query ---------------------------------------------------arrgv  575
ident                                                         
Sbjct awadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  lllleeeelllllllllllllllllllleeeeeelleeeellllllllllllllll


No 55: Query=3au2A Sbjct=3ooqA Z-score=7.5

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLLL
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPGV  180
ident                                                          |  
Sbjct --------------------kilfknatvfpitsrpfkgdvlvsngkvekvgeniEDPDA   40
DSSP  --------------------leeeeeeeellllllleeeeeeeelleeeeeelllLLLLL


DSSP  LEEeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query ERAelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident |                                                           
Sbjct EIV---------------------------------------------------------   43
DSSP  EEE---------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   43
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEEL-----------lLLLL
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVH-----------sTYSD  349
ident                                        |   |                
Sbjct ---------------------------dltgkflFPGFVDAHSHiglfeegvgyyySDGN   76
DSSP  ---------------------------elllleeEELEEEEEELlllllllllhhhLLLL


DSSP  -----------lllLHHHhHHHHHHHL---LLEEEEEEELHHHhllllllhhhhhhhhhh
Query -----------gqnTLEElWEAAKTMG---YRYLAVTDHSPAVrvaggpspeealkrvge  395
ident                      |                 |                    
Sbjct eatdpvtphvkaldGFNPqDPAIERALaggVTSVXIVPGSANP-------vggqgsvikf  129
DSSP  lllllllllllhhhHLLLlLHHHHHHHlllEEEEEELLLLLLL-------eeeeeeeeel


DSSP  hhhHHHHHLlleeeEEEEEELLL-------------------------------------
Query irrFNETHGppyllAGAEVDIHP-------------------------------------  418
ident      |        ||                                            
Sbjct rsiIVEECI-vkdpAGLKXAFGEnpkrvygerkqtpstrxgtagvirdyftkvknyxkkk  188
DSSP  lllLHHHHE-eeeeEEEEEELLHhhhhhhhhlllllllhhhhhhhhhhhhhhhhhhhhhh


DSSP  ------------llllllLHHHH--LLLLeEEEELlllllllhhhHHHHHHHHHLL----
Query ------------dgtldyPDWVL--RELDlVLVSVhsrfnlpkadQTKRLLKALEN----  460
ident                                                   | |       
Sbjct elaqkegkeftetdlkxeVGEXVlrKKIP-ARXHA---------hRADDILTAIRIaeef  238
DSSP  hhhhhlllllllllhhhhHHHHHhlLLLL-EEEEE---------lLHHHHHHHHHHhhhh


DSSP  -LLLLeELLLLlllllllllllllHHHHHHHHHHHLLEEEEELLLL------llllLHHH
Query -PFVHvLAHPTarllgrrapieadWEAVFQKAKEKGVAVEIDGYYD------rmdlPDDL  513
ident         | |                      ||   |                     
Sbjct gFNLV-IEHGT------------eAYKISKVLAEKKIPVVVGPLLTfrtklelkdlTXET  285
DSSP  lLLEE-EEELL------------lHHHHHHHHHHHLLLEEELLLLLllllhhhlllLLLH


DSSP  HHHHHHLLLLEEEELLLLlhhHHHHHHHHHHHHH-HLLLLLL-lLHHHL-lhhhHHHH--
Query ARMAYGMGLWISLSTDAHqtdHLRFMELAVGTAQ-RAWIGPE-rVLNTL-dyedLLSW--  568
ident        |  | |  |      | |      ||              |      |     
Sbjct IAKLLKDGVLIALXCDHP-viPLEFATVQAATAXrYGAKEEDllKILTVnpakiLGLEdr  344
DSSP  HHHHHHLLLLEEELLLLL-llLHHHHHHHHHHHHhHLLLHHHhhHLLLHhhhhhLLLLll


DSSP  ---------------------------------hhlllll
Query ---------------------------------lkarrgv  575
ident                                         
Sbjct igsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  llllllllllleeeelllllllllleeeeeelleeeeell


No 56: Query=3au2A Sbjct=2gwgA Z-score=7.0

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLL--------------
Query yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHST--------------  346
ident                                        |   | |              
Sbjct ------------------------------------xIIDIHGHYTtapkaledwrnrqi   24
DSSP  ------------------------------------lLEEEEEELLlllhhhhhhhhhhh


DSSP  ------------------llllllLHHH-HHHHHHHHLLLEEEEEEElhhhhLLLL--LL
Query ------------------ysdgqnTLEE-LWEAAKTMGYRYLAVTDHspavrVAGG--PS  385
ident                            |         |                      
Sbjct agikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVFSPR--agdFNVSstWA   82
DSSP  hhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEELL--lllHHHHhhHH


DSSP  HHHHHHHHHHHHHHHhhhlllEEEEEEEE--ellLLLL--LLLLHHHHL--LLLEEEEEL
Query PEEALKRVGEIRRFNethgppYLLAGAEV--dihPDGT--LDYPDWVLR--ELDLVLVSV  439
ident              |            |        |                        
Sbjct AICNELCYRVSQLFP-----dNFIGAAXLpqspgVDPKtcIPELEKCVKeyGFVAINLNP  137
DSSP  HHHHHHHHHHHHHLL-----lLEEEEEELlllllLLHHhhHHHHHHHHHllLLLEEEELL


DSSP  LLL---LLLLHhhhHHHHHHHHLLL---LLLEELLlllllLLLL-----llllLLHH-HH
Query HSR---FNLPKadqTKRLLKALENP---FVHVLAHptarlLGRR-----apieADWE-AV  487
ident          |            |           |      |                  
Sbjct DPSgghWTSPP-ltDRIWYPIYEKXvelEIPAXIH---vsTGAHylnadttafXQCVaGD  193
DSSP  LLLlllLLLLL-llLHHHHHHHHHHhhhLLLEEEL---llLLLHhhhhhhhhhHHHHhLL


DSSP  HHhhHHHLLEEEEEllllllLLLHH-------------hhhhhHHLL--LLEEEelllll
Query FQkaKEKGVAVEIDgyydrmDLPDD-------------larmaYGMG--LWISLstdahq  532
ident           |                                                 
Sbjct LFkdFPELKFVIPH-----gGGAVPyhwgrfrglaqexkkpllEDHVlnNIFFD------  242
DSSP  HHhhLLLLLEEELH-----hHLLLHhhhhhhhhhhhhlllllhHHHLllLEEEE------


DSSP  hhhhhHHHH--hhHHHHHlLLLLLLLHH--------------------------------
Query tdhlrFMEL--avGTAQRaWIGPERVLN--------------------------------  558
ident                     |    ||                                 
Sbjct ----tCVYHqpgiDLLNT-VIPVDNVLFasexigavrgidprtgfyyddtkryieastil  297
DSSP  ----lLLLLhhhhHHHHH-HLLHHHEELlllllllllleelllleellllhhhhhhllll


DSSP  -------HLLHhhhHHHHHL---------llll
Query -------TLDYedlLSWLKA---------rrgv  575
ident                                  
Sbjct tpeekqqIYEG-naRRVYPRldaalkakgkleh  329
DSSP  lhhhhhhHHLH-hhHHHLHHhhhhhhhhhhhll


No 57: Query=3au2A Sbjct=3e74A Z-score=6.6

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPgv  180
ident                                                             
Sbjct --------------------sfdliikngtvilenearvvdiavkggkiaaigQDLGD--   38
DSSP  --------------------leeeeeelleeelllleeeleeeeelleeeeeeLLLLL--


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------   38
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------   38
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLlllllllLHHHHHHH
Query yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysdgqnTLEELWEA  360
ident                                        |   |          |    |
Sbjct ----------------------akevxdasglvvSPGXVDAHTHI-------GYETGTRA   69
DSSP  ----------------------eeeeeelllleeEELEEEEEELL-------LHHHHHHH


DSSP  HHHHLLLEEEEEEElhhhhllllllhhHHHH---HHHHHHHHhHHHLLLEEEEE------
Query AKTMGYRYLAVTDHspavrvaggpspeEALK---RVGEIRRFnETHGPPYLLAG------  411
ident |   |                                                       
Sbjct AAKGGITTXIEXPL---------nqlpATVDrasIELKFDAA-KGKLTIDAAQLgglvsy  119
DSSP  HHHLLEEEEEELLL---------llllLLLLhhhHHHHHHHH-LLLLLLEEEELeellll


DSSP  ---------------eEEEL---lllllllLLHHhhlllleEEEELL-LLLL--------
Query ---------------aEVDI---hpdgtldYPDWvlreldlVLVSVH-SRFN--------  444
ident                                          |||                
Sbjct nidrlheldevgvvgfXCFVrdvndwqffkGAQKlgelgqpVLVHCEnALICdelgeeak  179
DSSP  llllhhhhhhhlllleEEELllllhhhhhhHHHHhhhhlllEEEELLlHHHHhhhhhhhh


DSSP  -------------LLHHHHHHHHHHHHLL-----LLLLeELLLLllllllllllllLHHH
Query -------------LPKADQTKRLLKALEN-----PFVHvLAHPTarllgrrapieaDWEA  486
ident               |           |          |   |                  
Sbjct regrvtahdyvasRPVFTEVEAIRRVLYLakvagCRLH-VCHVS----------spEGVE  228
DSSP  hhllllhhhhhhlLLHHHHHHHHHHHHHHhhhhlLLEE-ELLLL----------lhHHHH


DSSP  HHHHHHH--HLLEEEEEllLLLL--------------------------llLHHHHHHHH
Query VFQKAKE--KGVAVEIDgyYDRM--------------------------dlPDDLARMAY  518
ident     |         |                                             
Sbjct EVTRARQegQDITCESC--PHYFvldtdqfeeigtlakcsppirdlenqkgXWEKLFNGE  286
DSSP  HHHHHHHllLLEEEEEL--LHHHhllhhhhhhhlhhhllllllllhhhhhhHHHHHHLLL


DSSP  hllllEEEELLLLL----------------HHHH-HHHHHHHHHHH-HLLLLLLL--LHH
Query gmglwISLSTDAHQ----------------TDHL-RFMELAVGTAQ-RAWIGPER--VLN  558
ident        |  |                      |          |             | 
Sbjct ----iDCLVSDHSPcppexkagnixkawggIAGLqSCXDVXFDEAVqKRGXSLPXfgKLX  342
DSSP  ----lLEELLLLLLllllllllllllllllLLLHhHHHHHHHHHHLlLLLLLHHHhhHHH


DSSP  HLlhhhHHHHHH------------------------------------------------
Query TLdyedLLSWLK------------------------------------------------  570
ident                                                             
Sbjct AT---nAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigar  399
DSSP  LH---hHHHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelle


DSSP  -------------------------lllll
Query -------------------------arrgv  575
ident                               
Sbjct itktilrgdviydieqgfpvapkgqfilkh  429
DSSP  eeeeeelleeeeelllllllllllleelll


No 58: Query=3au2A Sbjct=2a3lA Z-score=6.2

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllLLLL-----------------------------
Query yaalglpwippplredqgeveaalegrLPKL-----------------------------  331
ident                             |                               
Sbjct ---------------------------QPDPiaadilrkepeqetfvrlnvplevptsde   33
DSSP  ---------------------------LLLLlllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  331
ident                                                             
Sbjct veaykclqeclelrkryvfqetvapwekeepfahypqgksdhcfemqdgvvhvfankdak   93
DSSP  lllhhhhhhhhhhhhlllllllllllllllllllllllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  331
ident                                                             
Sbjct edlfpvadatafftdlhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqks  153
DSSP  llllllllhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh


DSSP  ----lLHHHLLEEEEELLL-----------------------------------------
Query ----lELPQVKGDLQVHST-----------------------------------------  346
ident           | |  ||                                           
Sbjct aphrdFYNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesl  213
DSSP  lllllLLLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhh


DSSP  ---------------------------------------------------llllllLHH
Query ---------------------------------------------------ysdgqnTLE  355
ident                                                             
Sbjct dltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeITK  273
DSSP  lllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHHH


DSSP  HHHHHHHHHLLLEEEE-------------------------------EEELhhHHLL---
Query ELWEAAKTMGYRYLAV-------------------------------TDHSpaVRVA---  381
ident           |                                           |     
Sbjct QVFSDLEASKYQMAEYrisiygrkmsewdqlaswivnndlysenvvwLIQL--PRLYniy  331
DSSP  HHHHHHLLLLLEEEEEeeelllllllhhhhhhhhhhlllllllleeeEEEE--ELLHhhh


DSSP  ------------lllLHHH-----------hhhhhHHHHhhhhhhllleeeEEEEEE---
Query ------------ggpSPEE-----------alkrvGEIRrfnethgppyllAGAEVD---  415
ident                                                     |       
Sbjct kdmgivtsfqnildnIFIPlfeatvdpdshpqlhvFLKQ-----------vVGFDLVdde  380
DSSP  lllllllllhhhhhhHLLHhhhhhhlhhhllllhhHHLL-----------eEEEEEElll


DSSP  ---------------------llLLLLLL--LLHHHH----------lllLEEEEELlll
Query ---------------------ihPDGTLD--YPDWVL----------relDLVLVSVhsr  442
ident                                                             
Sbjct skperrptkhmptpaqwtnafnpAFSYYVyyCYANLYvlnklreskgmttITLRPHS---  437
DSSP  lllllllllllllllllllllllLHHHHHhhHHHHHHhhhhhhlllllllLEELLLL---


DSSP  llllhhHHHHHHHHHHLLllLLEELLLLllllllllllllLHHHHHHHHHHHLLEEEEEl
Query fnlpkaDQTKRLLKALENpfVHVLAHPTarllgrrapieaDWEAVFQKAKEKGVAVEIDg  502
ident            |         |  ||                                  
Sbjct ---geaGDIDHLAATFLT--CHSIAHGI---------nlrKSPVLQYLYYLAQIGLAMS-  482
DSSP  ---lllLLLHHHHHHHHH--LLLLLLLH---------hhhHLHHHHHHHHHHLLLEEEL-


DSSP  lLLLL----lllhHHHHHHHHLLLLEEEELLLLL--hhhhHHHHHHHHHHHHLL-----L
Query yYDRM----dlpdDLARMAYGMGLWISLSTDAHQ--tdhlRFMELAVGTAQRAW-----I  551
ident                       ||  |||||                  |   |      
Sbjct pLSNNslfldyhrNPFPVFFLRGLNVSLSTDDPLqihltkEPLVEEYSIAASVWklsacD  542
DSSP  hHHHLllllllllLLHHHHHHLLLLEEELLLLHHhhllllLHHHHHHHHHHHHHlllhhH


DSSP  LLLL-LHHHL-------LHHH---------------------------------------
Query GPER-VLNTL-------DYED---------------------------------------  564
ident   |                                                         
Sbjct LCEIaRNSVYqsgfshaLKSHwigkdyykrgpdgndihktnvphirvefrdtiwkeemqq  602
DSSP  HHHHhHHHHHhllllhhHHHHhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhh


DSSP  -----hhhhhHLLLll
Query -----llswlKARRgv  575
ident                 
Sbjct vylgkavisdEVVP--  616
DSSP  hlllllllllLLLL--


No 59: Query=3au2A Sbjct=1bksA Z-score=5.8

back to top
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll
Query mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh
Query vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll
Query lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll
Query eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh
Query qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllllllhhhlllllhhhhhhlllllllLLHHHLLEEeeELLLLL-llllLHHHHHH
Query yaalglpwippplredqgeveaalegrlpklLELPQVKGDlqVHSTYS-dgqnTLEELWE  359
ident                                                       |     
Sbjct --------------------meryenlfaqlNDRREGAFV-pFVTLGDpgieqSLKIIDT   39
DSSP  --------------------lhhhhhhhhhhHHLLLLEEE-eEEELLLllhhhHHHHHHH


DSSP  HHHHhlLLEEEeEEELHhHHLL----------------llLLHHHHHHHHHHHHHHHHhh
Query AAKTmgYRYLAvTDHSPaVRVA----------------ggPSPEEALKRVGEIRRFNEth  403
ident                 |                         |         ||      
Sbjct LIDA--GADAL-ELGVP-FSDPladgptiqnanlrafaagVTPAQCFEMLALIREKHP--   93
DSSP  HHHL--LLLLE-EEELL-LLLLllllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHLL--


DSSP  lllEEEEEEEEELL--lllllllLHHHHL--LLLEEEEELlllllllhhhhhhHHHHH--
Query gppYLLAGAEVDIH--pdgtldyPDWVLR--ELDLVLVSVhsrfnlpkadqtkRLLKA--  457
ident        |                         | |||                      
Sbjct ---TIPIGLLMYANlvfnngidaFYARCEqvGVDSVLVAD------------vPVEESap  138
DSSP  ---LLLEEEEELHHhhhlllhhhHHHHHHhhLLLEEEELL------------lLHHHLhh


DSSP  hLLLL-----LLEElLLLLllllllllllLLHHHHHHHHHHHLL-EEEEEllllllllLH
Query lENPF-----VHVLaHPTArllgrrapieADWEAVFQKAKEKGV-AVEIDgyydrmdlPD  511
ident                                           |                 
Sbjct fRQAAlrhniAPIF-ICPP----------NADDDLLRQVASYGRgYTYLL-----alpLH  182
DSSP  hHHHHhhlllEEEE-EELL----------LLLHHHHHHHHHHLLlLEEEL-----lllHH


DSSP  HHHHHHHHLLL-LEEE---------------------ELLL-LLHHhhhhhhhhhhhhhh
Query DLARMAYGMGL-WISL---------------------STDA-HQTDhlrfmelavgtaqr  548
ident  |                                                          
Sbjct HLIEKLKEYHAaPALQgfgisspeqvsaavragaagaISGSaIVKI--------------  228
DSSP  HHHHHHHHHLLlLEEEllllllhhhhhhhhhhllleeEELLhHHHH--------------


DSSP  llllllllhhhllhhhhhhhhhlllll
Query awigpervlntldyedllswlkarrgv  575
ident                            
Sbjct ieknlaspkqmlaelrsfvsamkaasr  255
DSSP  hhhllllhhhhhhhhhhhhhhhhhlll