Results: dupa

Query: 2yb1A

MOLECULE: AMIDOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2yb1-A 53.1  0.0  284   284  100 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   2:  3e38-A 16.6  2.5  173   342   22 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
   3:  3f2b-A 15.3  3.2  185   994   15 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
   4:  2anu-A 13.5  3.0  164   224   22 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
   5:  3au2-A 10.7  3.5  162   575   24 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   6:  1m65-A 10.4  3.4  157   234   23 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   7:  3dcp-A  9.0  3.8  165   277   13 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
   8:  3qy6-A  8.1  3.0  144   247   20 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   9:  3gg7-A  7.3  3.6  153   243   12 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  10:  1k6w-A  7.2  4.4  162   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  11:  1v77-A  7.2  3.7  140   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  12:  2ffi-A  6.9  3.8  148   273   19 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  13:  3nqb-A  6.8  4.1  151   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  2vun-A  6.8  3.6  141   385   11 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  2oof-A  6.7  4.2  150   403   11 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  16:  2paj-A  6.5  4.2  160   421   12 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  17:  1bf6-A  6.5  4.4  156   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  18:  2y1h-B  6.4  4.3  149   265    9 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  19:  1yrr-B  6.3  4.1  141   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  20:  4mup-B  6.3  3.5  147   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  21:  3ls9-A  6.2  4.0  159   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  22:  3cjp-A  6.2  3.4  140   262   18 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  23:  4cqb-A  6.1  3.7  147   402   12 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  24:  3k2g-B  6.1  3.9  155   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  25:  4hk5-D  6.0  3.8  148   380   11 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  26:  2ob3-A  6.0  3.8  153   329   12 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  27:  1onx-A  6.0  3.7  151   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  28:  2uz9-A  6.0  4.2  151   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  29:  4dlf-A  5.9  3.7  147   287   15 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  30:  2imr-A  5.8  3.7  146   380   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  31:  1gkp-A  5.7  3.9  161   458   11 PDB  MOLECULE: HYDANTOINASE;                                              
  32:  2vc5-A  5.7  4.2  151   314    8 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  1a4m-A  5.6  3.5  144   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  34:  3mtw-A  5.6  4.1  157   404   12 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  35:  1j6p-A  5.6  3.8  144   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  36:  3mkv-A  5.4  4.1  142   414   15 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  37:  2dvt-A  5.3  4.0  149   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  38:  3irs-A  5.1  4.0  147   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  39:  3icj-A  5.1  4.0  149   468   11 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  40:  3e74-A  5.0  3.3  134   429   10 PDB  MOLECULE: ALLANTOINASE;                                              
  41:  4ofc-A  4.8  3.8  144   335   11 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  42:  2qpx-A  4.7  4.2  147   376   16 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  43:  1itq-A  4.6  3.7  142   369   15 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  44:  4qrn-A  4.6  3.7  143   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  45:  3gri-A  4.5  4.2  144   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  46:  4b3z-D  4.5  3.6  138   477   13 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  47:  4c5y-A  4.5  4.4  153   436   11 PDB  MOLECULE: OCHRATOXINASE;                                             
  48:  2ogj-A  4.5  4.1  146   379   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  49:  4rdv-B  4.3  4.1  146   451   14 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  50:  3giq-A  4.3  3.9  150   475   13 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  51:  1a5k-C  4.3  4.0  143   566   12 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  52:  3ooq-A  4.2  4.7  149   384   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  53:  3pnu-A  4.2  3.9  140   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  54:  1bks-A  4.0  3.5  121   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  55:  1j5s-A  3.8  4.4  140   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  56:  3iac-A  3.8  4.3  149   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  57:  4dzi-C  3.2  4.1  127   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  58:  2gwg-A  2.6  4.1  121   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  59:  2a3l-A  2.5  4.7  130   616    6 PDB  MOLECULE: AMP DEAMINASE;                                             


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2yb1A Sbjct=2yb1A Z-score=53.1

back to top
DSSP  LLEELLLLLLLLLLLLLHHHHHHHHHLLLLLEEEELLLLLLLLHHHHHHHHHHLLLLEEE
Query ANIDLHFHSRTSDGALTPTEVIDRAAARAPALLALTDHDCTGGLAEAAAAAARRGIPFLN   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ANIDLHFHSRTSDGALTPTEVIDRAAARAPALLALTDHDCTGGLAEAAAAAARRGIPFLN   60
DSSP  LLEELLLLLLLLLLLLLHHHHHHHHHLLLLLEEEELLLLLLLLHHHHHHHHHHLLLLEEE


DSSP  EEEEEEEELLEEEEEEEELLLLLLHHHHHHHHHHHLLHHHHHHHHHHHHHHLLLLLHHHH
Query GVEVSVSWGRHTVHIVGLGIDPAEPALAAGLKSIREGRLERARQMGASLEAAGIAGCFDG  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GVEVSVSWGRHTVHIVGLGIDPAEPALAAGLKSIREGRLERARQMGASLEAAGIAGCFDG  120
DSSP  EEEEEEEELLEEEEEEEELLLLLLHHHHHHHHHHHLLHHHHHHHHHHHHHHLLLLLHHHH


DSSP  HHLLLLLHHHLLHHHHHHHHHHLLLLLLHHHHHHHLLLLLLLLLLLLLLLLHHHHHHHHH
Query AMRWCDNPEMISRTHFARHLVDSGAVKDMRTVFRKYLTPGKPGYVSHQWASLEDAVGWIV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AMRWCDNPEMISRTHFARHLVDSGAVKDMRTVFRKYLTPGKPGYVSHQWASLEDAVGWIV  180
DSSP  HHLLLLLHHHLLHHHHHHHHHHLLLLLLHHHHHHHLLLLLLLLLLLLLLLLHHHHHHHHH


DSSP  HLLLEEEELLHHHLLLLHHHHHHHHHHHHHLLLLEEEEEELLLLHHHHHHHHHHHHHHLL
Query GAGGMAVIAHPGRYDMGRTLIERLILDFQAAGGQGIEVASGSHSLDDMHKFALHADRHGL  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GAGGMAVIAHPGRYDMGRTLIERLILDFQAAGGQGIEVASGSHSLDDMHKFALHADRHGL  240
DSSP  HLLLEEEELLHHHLLLLHHHHHHHHHHHHHLLLLEEEEEELLLLHHHHHHHHHHHHHHLL


DSSP  EEEEELLLLLLLLLLLLLLLLLLLLLLHHHHLHHHLLLLLHHHL
Query YASSGSDFHAPGEDVGHTEDLPPICRPIWRELEARILRPADAEN  284
ident ||||||||||||||||||||||||||||||||||||||||||||
Sbjct YASSGSDFHAPGEDVGHTEDLPPICRPIWRELEARILRPADAEN  284
DSSP  EEEEELLLLLLLLLLLLLLLLLLLLLLHHHHLHHHLLLLLHHHL


No 2: Query=2yb1A Sbjct=3e38A Z-score=16.6

back to top
DSSP  -----------------LLEELLLLLLLLLLLLLHHHHHHHHHLLLLLEEEELLLL----
Query -----------------ANIDLHFHSRTSDGALTPTEVIDRAAARAPALLALTDHD----   39
ident                     | | ||  |||   ||   | |         || |     
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVFSDGLVWPTVRVDEAYRDGLDAISLTEHIeyrp   60
DSSP  llllllllllllllleeEEEELLLLLLLLLLLLLHHHHHHHHHHLLLLEELLEEELllll


DSSP  --------LLLLHHHHHHHHHHLLLLEEEEEEEEEEEllEEEEEEEELLLLllhhhHHHH
Query --------CTGGLAEAAAAAARRGIPFLNGVEVSVSWgrHTVHIVGLGIDPaepalAAGL   91
ident                    |   ||    | |          |                 
Sbjct hkqdvvsdHNRSFDLCREQAEKLGILLIKGSEITRAX--APGHFNAIFLSD----sNPLE  114
DSSP  llllllllLLHHHHHHHHHHHHHLLEELLEEEEELLL--LLLEEEEELLLL----lHHHL


DSSP  HHhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhh
Query KSiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrt  151
ident                                                             
Sbjct QK----------------------------------------------------------  116
DSSP  LL----------------------------------------------------------


DSSP  hhhhlllllllllllllllLHHHHHHHHHHLLLEEEELLHHH--LLLLHhHHHHHHHHHH
Query vfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAHPGR--YDMGRtLIERLILDFQ  209
ident                       ||       |      |||                   
Sbjct -------------------DYKDAFREAKKQGAFXFWNHPGWdsQQPDTtKWWPEHTALY  157
DSSP  -------------------LHHHHHHHHHHLLLEEEELLLLLllLLLLLlLLLHHHHHHH


DSSP  HLLL-LEEEEEELLLLhhhHHHHHHHHHHHLLEEEEELLLL--LLLL------lllLLLL
Query AAGG-QGIEVASGSHSlddMHKFALHADRHGLYASSGSDFH--APGE------dvgHTED  260
ident   |   ||||| |                  |     || |                   
Sbjct QEGCxHGIEVANGHLY---XPEAIQWCLDKNLTXIGTSDIHqpIQTDydfekgehrTXTF  214
DSSP  HLLLlLEEEEEELLEE---LLHHHHHHHHHLLEEEEELLLLllHHHHllhhhllllLEEE


DSSP  ---------------------------LLLL-----------------------------
Query ---------------------------LPPI-----------------------------  264
ident                            |                                
Sbjct vfakerslqgirealdnrrtaayfhelLIGRedllrpffekcvkieevsrneqgvtlsit  274
DSSP  eeellllhhhhhhhhhllleeeeelleEELLhhhhhhhhhhheeeeeeeeelleeeeeee


DSSP  ------------------------------------------------lllhhhhlhhhl
Query ------------------------------------------------crpiwreleari  276
ident                                                             
Sbjct nvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdk  334
DSSP  ellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelle


DSSP  llllhhhl
Query lrpadaen  284
ident         
Sbjct glkytisl  342
DSSP  eeeeeeel


No 3: Query=2yb1A Sbjct=3f2bA Z-score=15.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEELLLLLLLL
Query ------------------------------------------------ANIDLHFHSRTS   12
ident                                                     || |   |
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL


DSSP  --LLLLLHHHHHHHHHLLLLLEEEELLLLLLLLHHHHHHHHHHLLLLEEEEEEEEEEELl
Query --DGALTPTEVIDRAAARAPALLALTDHDCTGGLAEAAAAAARRGIPFLNGVEVSVSWGr   70
ident   |     |  |  |        | |||       ||  ||   |     | |       
Sbjct qmDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYGLEANIVDD-  179
DSSP  llLLLLLHHHHHHHHHHLLLLLEEELLLLLLLLHHHHHHHHHHHLLLEEEEEEEEEELL-


DSSP  eEEEEEEELL---LLLLhhHHHHHHHHH--LLHHhhhhhhhhhhhhlllllhhhhhhlll
Query hTVHIVGLGI---DPAEpaLAAGLKSIR--EGRLerarqmgasleaagiagcfdgamrwc  125
ident    |   |           |                                        
Sbjct -PFHVTLLAQnetGLKN--LFKLVSLSHiqYFHR--------------------------  210
DSSP  -LEEEEEEELlhhHHHH--HHHHHHHHHllLLLL--------------------------


DSSP  llhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllLLLHHHHHHHhhHLLLE
Query dnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqWASLEDAVGWivGAGGM  185
ident                                                   |      |  
Sbjct -----------------------------------------vpRIPRSVLVKH--RDGLL  227
DSSP  -----------------------------------------llLEEHHHHHHL--LLLEE


DSSP  EEELL----HHHLlllhhhHHHHHHhhhhlLLLEEEeEELL------------lLHHHHH
Query AVIAH----PGRYdmgrtlIERLILdfqaaGGQGIEvASGS------------hSLDDMH  229
ident                     |              |                        
Sbjct VGSGCdkgeLFDN------VEDIAR-----FYDFLE-VHPPdvykplyvkdeemIKNIIR  275
DSSP  EELLLllllLLLL------LLLLHH-----HLLLEE-ELLHhhhlllllllhhhHHHHHH


DSSP  HHHHHHHHHLLEEEEELLLLLLLL---------------------------LLLL-----
Query KFALHADRHGLYASSGSDFHAPGE---------------------------DVGH-----  257
ident                    |                                        
Sbjct SIVALGEKLDIPVVATGNVHYLNPedkiyrkilihsqgganplnrhelpdvYFRTtneml  335
DSSP  HHHHHHHHLLLLEEELLLLLLLLHhhhhhhhhhhhllhhhlllllllllllLLLLhhhhh


DSSP  -----llllLLLLL---LHHHHLHHHLL--------------------------------
Query -----tedlPPICR---PIWRELEARIL--------------------------------  277
ident                                                             
Sbjct dcfsflgpeKAKEIvvdNTQKIASLIGDvkpikdelytpriegadeeiremsyrrakeiy  395
DSSP  hhhhhhhhhHHHHHhlhHHHHHHHLLLLlllllllllllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct gdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmt  455
DSSP  lllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct eitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflg  515
DSSP  lllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct fkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhn  575
DSSP  lllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct lelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthf  635
DSSP  llllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct dfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeq  695
DSSP  ehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct imcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtct  755
DSSP  hllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct lsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsck  815
DSSP  hhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct kikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkri  875
DSSP  hllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  277
ident                                                             
Sbjct eeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfna  935
DSSP  hhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhh


DSSP  ----------------------------------------------------lllhhhl
Query ----------------------------------------------------rpadaen  284
ident                                                            
Sbjct ipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 4: Query=2yb1A Sbjct=2anuA Z-score=13.5

back to top
DSSP  ---LLEELLLLLLLLLLLLLHHHHHHHHHLLLLLEEEELLLL------------------
Query ---ANIDLHFHSRTSDGALTPTEVIDRAAARAPALLALTDHD------------------   39
ident       | | |   ||| |   || |            |||                   
Sbjct tewLLCDFHVHTNXSDGHLPLGEVVDLFGKHGVDVVSITDHIvdrrtleqrkrngeplga   60
DSSP  leeEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEEEEEelhhhhhhhhhlllllll


DSSP  --------lLLLHHHHHHHHHH-LLLLEEEEEEEEEEelLEEEEEEEELLLlllhhhHHH
Query --------cTGGLAEAAAAAAR-RGIPFLNGVEVSVSwgRHTVHIVGLGIDpaepalAAG   90
ident             |      |    |     |||          |||              
Sbjct itedkfqdyLKRLWREQKRAWEeYGXILIPGVEITNN--TDLYHIVAVDVK------EYV  112
DSSP  lllllhhhhHHHHHHHHHHHHHhHLLEEEEEEEEEEL--LLLEEEEEELLL------LLL


DSSP  Hhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhh
Query Lksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmr  150
ident                                                             
Sbjct D-----------------------------------------------------------  113
DSSP  L-----------------------------------------------------------


DSSP  hhhhhlllllllllllllLLLHHHHHHHHHHLLLEEEELLHHH-LLLLhhhHHHHhHHHH
Query tvfrkyltpgkpgyvshqWASLEDAVGWIVGAGGMAVIAHPGR-YDMGrtlIERLiLDFQ  209
ident                       |  |            ||| |               | 
Sbjct -----------------pSLPVEEIVEKLKEQNALVIAAHPDRkKLSW-ylWANX-ERFK  154
DSSP  -----------------lLLLHHHHHHHHHHLLLEEEELLLLLlLLLL-hhHHLL-LLLL


DSSP  HlLLLEEEEEELLLLhhhHHHHHHHHhhhlLEEEEELLLLLLLLLlllLLLLllllllhh
Query AaGGQGIEVASGSHSlddMHKFALHAdrhgLYASSGSDFHAPGEDvghTEDLppicrpiw  269
ident        | |                          ||||                    
Sbjct D-TFDAWEIANRDDL---FNSVGVKK----YRYVANSDFHELWHVyswKTLV-kseknie  205
DSSP  L-LLLEEEEEELLEE---LHHHHHLL----LLEEEELLLLLHHHHlleEEEE-eelllhh


DSSP  HHLH----hhlllllhhhl
Query RELE----arilrpadaen  284
ident    |               
Sbjct AIKEairkntdvaiylxrk  224
DSSP  HHHHhhhhllleeeeelll


No 5: Query=2yb1A Sbjct=3au2A Z-score=10.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------LLEELLLLLLLLLLLLLHHHHHHH
Query ------------------------------------ANIDLHFHSRTSDGALTPTEVIDR   24
ident                                        ||  ||  |||  |  |    
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTYSDGQNTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLLLLLLLLHHHHHHH


DSSP  HHLLLLLEEEELLLL-------------llLLHHHHHHHHHHLLL-LEEEEEEEEEEELl
Query AAARAPALLALTDHD-------------ctGGLAEAAAAAARRGI-PFLNGVEVSVSWGr   70
ident |       || |||                    |        |    | | ||      
Sbjct AKTMGYRYLAVTDHSpavrvaggpspeealKRVGEIRRFNETHGPpYLLAGAEVDIHPD-  419
DSSP  HHHHLLLEEEEEEELhhhhllllllhhhhhHHHHHHHHHHHHHLLlEEEEEEEEELLLL-


DSSP  eeeeeeeellllllhHHHHHHhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhh
Query htvhivglgidpaepALAAGLksiregrlerarqmgasleaagiagcfdgamrwcdnpem  130
ident                                                             
Sbjct ----------gtldyPDWVLR---------------------------------------  430
DSSP  ----------lllllLHHHHL---------------------------------------


DSSP  llhhhhhhhhhhllllllhhhhhhhlllllllllllllllLHHHhHHHHhhllleEEELL
Query isrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDaVGWIvgaggmAVIAH  190
ident                                                         | ||
Sbjct ---------------eldlvlvsvhsrfnlpkadqtkrllKALE-NPFV------HVLAH  468
DSSP  ---------------llleeeeellllllllhhhhhhhhhHHHL-LLLL------LEELL


DSSP  HHHL------LLLHhHHHHHHHHHHHlLLLEEEEeELLLL-hhHHHHHHHHHHHHLLEEE
Query PGRY------DMGRtLIERLILDFQAaGGQGIEVaSGSHS-ldDMHKFALHADRHGLYAS  243
ident |                |          |   |   |           |  |   ||  |
Sbjct PTARllgrraPIEA-DWEAVFQKAKE-KGVAVEI-DGYYDrmdLPDDLARMAYGMGLWIS  525
DSSP  LLLLllllllLLLL-LHHHHHHHHHH-HLLEEEE-ELLLLlllLLHHHHHHHHHLLLLEE


DSSP  EELLLLLLLLLllLLLL---LLLL-----lLLHHH----HLHHhlllllhhhl
Query SGSDFHAPGEDvgHTED---LPPI-----cRPIWR----ELEArilrpadaen  284
ident    | |         |              |         |            
Sbjct LSTDAHQTDHL-rFMELavgTAQRawigpeRVLNTldyeDLLS--wlkarrgv  575
DSSP  EELLLLLHHHH-hHHHHhhhHHHHllllllLLHHHllhhHHHH--hhhlllll


No 6: Query=2yb1A Sbjct=1m65A Z-score=10.4

back to top
DSSP  LLEELLLLLLLL-LLLLLHHHHHHHHHLLLLLEEEELLLL-----------LLLLHHHhh
Query ANIDLHFHSRTS-DGALTPTEVIDRAAARAPALLALTDHD-----------CTGGLAEaa   48
ident    ||| |   |     |    |  |      | | |||                     
Sbjct YPVDLHMHTVAStHAYSTLSDYIAQAKQKGIKLFAITDHGpdmedaphhwhFINMRIW--   58
DSSP  LLEELLLLLLLLlLLLLLHHHHHHHHHHHLLLEEEEEEELlllllllllhhHHHHHHL--


DSSP  hhhHHLLLLEEEEEEEEEEELLeeeeeeeellllllhhHHHHHhhhhllhhhhhhhhhhh
Query aaaARRGIPFLNGVEVSVSWGRhtvhivglgidpaepaLAAGLksiregrlerarqmgas  108
ident       |   | | |                                             
Sbjct -prVVDGVGILRGIEANIKNVD------------geidCSGKM-----------------   88
DSSP  -llEELLEEEEEEEEEELLLLL------------llllLLHHH-----------------


DSSP  hhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllll
Query leaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshq  168
ident                                                             
Sbjct ----------------------------------fdsldliiagfhepvfaphdkatntq  114
DSSP  ----------------------------------hhhlleeeeellllllllllhhhhhh


DSSP  lllhhhhHHHHhhllleEEELLHHHL-LLLHhhHHHHHHHHHHlLLLEEEEeELLLlhhH
Query wasledaVGWIvgaggmAVIAHPGRY-DMGRtlIERLILDFQAaGGQGIEVaSGSHsldD  227
ident         |          | |||                         |    |     
Sbjct amiatiaSGNV------HIISHPGNPkYEID--VKAVAEAAAK-HQVALEI-NNSS---N  161
DSSP  hhhhhhhLLLL------LEELLLLLLlLLLL--HHHHHHHHHH-HLLEEEE-ELLL---L


DSSP  HHHHHHHHHHHLLEEEEELLLLLlllLLLLLLLL---LLLL-----LLHHH---HLHH--
Query MHKFALHADRHGLYASSGSDFHApgeDVGHTEDL---PPIC-----RPIWR---ELEA--  274
ident     |      |     ||| |      |  |              |        |    
Sbjct CREVAAAVRDAGGWVALGSDSHT-afTMGEFEEClkiLDAVdfppeRILNVsprRLLNfl  220
DSSP  HHHHHHHHHHHLLLEEEELLLLL-hhHLLLLHHHhhhHHHLlllhhHLHHHlhhHHHHhh


DSSP  ------hllLLLHhhl
Query ------rilRPADaen  284
ident            ||   
Sbjct esrgmapiaEFAD--l  234
DSSP  hhllllllhHHLL--l


No 7: Query=2yb1A Sbjct=3dcpA Z-score=9.0

back to top
DSSP  LLEELLLLLLLL--LLLLLHHHHHHHHHLLLLLEEEELLLLL------------------
Query ANIDLHFHSRTS--DGALTPTEVIDRAAARAPALLALTDHDC------------------   40
ident    | | |             |    |            |                    
Sbjct XKRDGHTHTEFCphGTHDDVEEXVLKAIELDFDEYSIVEHAPlssefxkntagdkeavtt   60
DSSP  LLEEEEELLLLLllLLLLLHHHHHHHHHHLLLLEEEEEEELLllhhhhhllllllhhhhl


DSSP  --------llLHHHHHHHHHHLL--LLEEEEEEEEEEelleeeeeeeellllllHHHHHH
Query --------tgGLAEAAAAAARRG--IPFLNGVEVSVSwgrhtvhivglgidpaePALAAG   90
ident                               | ||                          
Sbjct asxaxsdlpyYFKKXNHIKKKYAsdLLIHIGFEVDYL----------igyedftRDFLNE  110
DSSP  llllhhhhhhHHHHHHHHHHHLLllLEEEEEEEEELL----------lllhhhhHHHHHH


DSSP  H--hhhhllhhhhhhhHHHHhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllll
Query L--ksiregrlerarqMGASleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkd  148
ident                                                             
Sbjct YgpqtddgvlslhfleGQGG--------------------------------------fr  132
DSSP  HhhhlleeeeelleeeELLE--------------------------------------ee


DSSP  hhhhHHHLlLLLL------------lllllllllLHHHhhhhhhHLLLEEEELLHHHLL-
Query mrtvFRKYlTPGK------------pgyvshqwaSLEDavgwivGAGGMAVIAHPGRYD-  195
ident                                   | |       |        |      
Sbjct sidfSAED-YNEGivqfyggfeqaqlaylegvkqSIEA----dlGLFKPRRXGHISLCQk  187
DSSP  elllLHHH-HHHHlhhhhllhhhhhhhhhhhhhhHHHL----llLLLLLLEELLLLHHHl


DSSP  --------------lLHHHHHHHHHHHHHlLLLEEEeEELLLL-------hhHHHHHHHH
Query --------------mGRTLIERLILDFQAaGGQGIEvASGSHS-------ldDMHKFALH  234
ident                                                        |    
Sbjct fqqffgedtsdfseeVXEKFRVILALVKK-RDYELD-FNTAGLfkplcgetyPPKKIVTL  245
DSSP  lhhhhlllhhhllhhHHHHHHHHHHHHHH-HLLEEE-EELHHHhllllllllLLHHHHHH


DSSP  HHHHLLEEEEELLLLLLllLLLLLL---LLLLLlllhhhhlhhhlllllhhhl
Query ADRHGLYASSGSDFHAPgeDVGHTE---DLPPIcrpiwrelearilrpadaen  284
ident |         ||| |    | |                               
Sbjct ASELQIPFVYGSDSHGV-qDIGRGYstyCQKLE--------------------  277
DSSP  HHHLLLLEEEELLLLLH-hHLLLLHhhhHHHLL--------------------


No 8: Query=2yb1A Sbjct=3qy6A Z-score=8.1

back to top
DSSP  lLEELLLL--LLLLLLLLLhHHHHHHHHLLL----LLEEEELLLL--------llLLHHH
Query aNIDLHFH--SRTSDGALTpTEVIDRAAARA----PALLALTDHD--------ctGGLAE   46
ident   || | |      |||          |  |          | |                
Sbjct -MIDIHCHilPAMDDGAGD-SADSIEMARAAvrqgIRTIIATPHHnngvyknepaAVREA   58
DSSP  -LEELLLLllLLLLLLLLL-HHHHHHHHHHHhhllLLEEELLLEEllllllllhhHHHHH


DSSP  HHHHHHHL-----LLLEEEEEEEEEE----elleeeeeeEELLllllhhhhhhhhhhhll
Query AAAAAARR-----GIPFLNGVEVSVS----wgrhtvhivGLGIdpaepalaaglksireg   97
ident |     |          | | |                  |                   
Sbjct ADQLNKRLikediPLHVLPGQEIRIYgeveqdlakrqllSLND-----------------  101
DSSP  HHHHHHHHhhlllLLEEELLLEEELLllhhhhhhlllllLHHH-----------------


DSSP  hhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhll
Query rlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyl  157
ident                                                             
Sbjct ------------------------------------------------------------  101
DSSP  ------------------------------------------------------------


DSSP  llllllllllllllhhhhhhhhhhlLLEE---------------------------EELL
Query tpgkpgyvshqwasledavgwivgaGGMA---------------------------VIAH  190
ident                                                         ||||
Sbjct -------------------------TKYIliefpfdhvpryaeqlfydlqlkgyipVIAH  136
DSSP  -------------------------LLEEeeelllllllllhhhhhhhhhhllleeEEEL


DSSP  HHHLLL---LHHHHHHHHHHHHhllllEEEEeELLL--------LHHHHHHHHHHHhhhl
Query PGRYDM---GRTLIERLILDFQaaggqGIEVaSGSH--------SLDDMHKFALHAdrhg  239
ident | |         |   |                                           
Sbjct PERNREireNPSLLYHLVEKGA-----ASQI-TSGSlagifgkqLKAFSLRLVEAN----  186
DSSP  HHHLHHhhhLLHHHHHHHHLLL-----EEEE-EHHHhlllllhhHHHHHHHHHHLL----


DSSP  leEEEELLLLLLLLLllLLLL----------llLLLL---LHHHHLHHH----lllllhh
Query lyASSGSDFHAPGEDvgHTED----------lpPICR---PIWRELEAR----ilrpada  282
ident       || |                                   |              
Sbjct liHFVASDAHNVKTR-nFHTQealyvlekefgsELPYmltENAELLLRNqtifrqppqpv  245
DSSP  llLEEELLLLLLLLL-lLLHHhhhhhhhhhhllHHHHhhhHHHHHHHLLlllllllllll


DSSP  hl
Query en  284
ident   
Sbjct kr  247
DSSP  ll


No 9: Query=2yb1A Sbjct=3gg7A Z-score=7.3

back to top
DSSP  LLEELLLLLLlllLLLLHHHHHHHHHLLLLlEEEELLLLL--LLLHHHHHHHHhhllLLE
Query ANIDLHFHSRtsdGALTPTEVIDRAAARAPaLLALTDHDC--TGGLAEAAAAAarrgIPF   58
ident   || | |         |  |      |                |    ||         
Sbjct SLIDFHVHLD---LYPDPVAVARACEERQL-TVLSVTTTPaaWRGTLALAAGR----PHV   52
DSSP  LLEEEEELHH---HLLLHHHHHHHHHHLLL-EEEELLLLHhhHHHHHHHHLLL----LLE


DSSP  EEE----------------------------EEEEEEelleeeeeeeellllllhhhhhh
Query LNG----------------------------VEVSVSwgrhtvhivglgidpaepalaag   90
ident                                 ||                          
Sbjct WTAlgfhpevvseraadlpwfdrylpetrfvGEVGLD-----------------------   89
DSSP  EELllllhhhllllhhhlhhhhhhhhhlleeEEEELL-----------------------


DSSP  hhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhh
Query lksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmr  150
ident                                                             
Sbjct ------------------------------------------------------------   89
DSSP  ------------------------------------------------------------


DSSP  hhhhhlllllLLLLLLL----LLLLhhHHHHH--hhHLLL--------------------
Query tvfrkyltpgKPGYVSH----QWASleDAVGW--ivGAGG--------------------  184
ident                                     |                       
Sbjct --------gsPSLRGTWtqqfAVFQ--HILRRcedhGGRIlsihsrraesevlncleanp  139
DSSP  --------llHHHHHHHhhhhHHHH--HHHHHhhhlLLEEeeeellllhhhhhhhhhhlh


DSSP  ---EEEELLHHhllLLHHHHHHHHHHHhhlllLEEEeEELLL-LHHHHHHHHHHHhhHLL
Query ---MAVIAHPGrydMGRTLIERLILDFqaaggQGIEvASGSH-SLDDMHKFALHAdrHGL  240
ident                  |   | |                                    
Sbjct rsgTPILHWYS---GSVTELRRAISLG-----CWFS-VGPTMvRTQKGAALIRSM--PRD  188
DSSP  hheEEEEELLL---LLHHHHHHHHHLL-----LEEE-ELHHHhLLHHHHHHHHHL--LHH


DSSP  EEEEELLLL----lLLLL-LLLL---LLLLL------------llllHHHHLHHhlllll
Query YASSGSDFH----aPGED-VGHT---EDLPP------------icrpIWRELEArilrpa  280
ident       |                                            |        
Sbjct RVLTETDGPfleldGQAAlPWDVksvVEGLSkiwqipaseverivkeNVSRLLG------  242
DSSP  HEEELLLLLlleelLEELlHHHHhhhHHHHHhhhlllhhhhhhhhhhHHHHHHH------


DSSP  hhhl
Query daen  284
ident     
Sbjct ---t  243
DSSP  ---l


No 10: Query=2yb1A Sbjct=1k6wA Z-score=7.2

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------aNIDLHFH    8
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL


DSSP  LllLLLL---------------------------------lLHHHHHHHHHLLLLLEEEE
Query SrtSDGA---------------------------------lTPTEVIDRAAARAPALLAL   35
ident                                                    |        
Sbjct L--DTTQtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRT  118
DSSP  L--LLLLllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEE


DSSP  LLLL------lLLLHHHHHHHHHHlLLLEEEEEE--------------------------
Query TDHD------cTGGLAEAAAAAARrGIPFLNGVE--------------------------   63
ident                 |     |   |                                 
Sbjct HVDVsdatltaLKAMLEVKQEVAP-WIDLQIVAFpqegilsypngealleealrlgadvv  177
DSSP  EEELlllllhhHHHHHHHHHHHLL-LLEEEEEEEllllllllllhhhhhhhhhhllllee


DSSP  EEEEelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhl
Query VSVSwgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamr  123
ident                                                             
Sbjct GAIP--------------------------------------------------------  181
DSSP  EELH--------------------------------------------------------


DSSP  llllhhhllhhhhhhhhhhllllllhhhhhhhllllllllLLLLLL-lLHHHHHHHH-hH
Query wcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgYVSHQW-aSLEDAVGWI-vG  181
ident                                                 ||          
Sbjct -------------------------------------hfeFTREYGveSLHKTFALAqkY  204
DSSP  -------------------------------------hhlLLHHHHhhHHHHHHHHHhhH


DSSP  LLL------------------------------EEEELLHHHL----llLHHHHHHHHHH
Query AGG------------------------------MAVIAHPGRY----dmGRTLIERLILD  207
ident                                       |                ||   
Sbjct DRLidvhcdeiddeqsrfvetvaalahhegmgaRVTASHTTAMhsyngaYTSRLFRLLKM  264
DSSP  LLEeeeeelllllllllhhhhhhhhhhhhllhhHEEEEELHHHhhllhhHHHHHHHHHHH


DSSP  HHhlllLEEEEEELLLL------------HHHHhhHHHHHHHHLLEEEEELLLLLLLL--
Query FQaaggQGIEVASGSHS------------LDDMhkFALHADRHGLYASSGSDFHAPGE--  253
ident                                            |     | |        
Sbjct SG----INFVANPLVNIhlqgrfdtypkrRGIT--RVKEMLESGINVCFGHDDVFDPWyp  318
DSSP  HL----LEEEELHHHHHhhllllllllllLLLL--LHHHHHHLLLLEEELLLLLLLLLll


DSSP  --LLLL--LLLLL-----------------llllLHHH--HLHH----------------
Query --DVGH--TEDLP-----------------picrPIWR--ELEA----------------  274
ident                                      |   |                  
Sbjct lgTANMlqVLHMGlhvcqlmgygqindglnlithHSARtlNLQDygiaagnsanliilpa  378
DSSP  llLLLHhhHHHHHhhhlllllhhhhhhhhhhhlhHHHHhlLLLLlllllllllleeeell


DSSP  ------------hllllLHHH-----------------------l
Query ------------rilrpADAE-----------------------n  284
ident                                              
Sbjct engfdalrrqvpvrysvRGGKviastqpaqttvyleqpeaidykr  423
DSSP  llhhhhhhhllllleeeELLEeeeellllleeeellleeeellll


No 11: Query=2yb1A Sbjct=1v77A Z-score=7.2

back to top
DSSP  -lLEELLLLLllllllllhHHHHHHHHLLlLLEEEELLLL-------lLLLH-HHHHhhh
Query -aNIDLHFHSrtsdgaltpTEVIDRAAARaPALLALTDHD-------cTGGL-AEAAaaa   51
ident    |                |    |                            |     
Sbjct vkFIEMDIRD---------KEAYELAKEW-FDEVVVSIKFneevdkekLREArKEYG---   47
DSSP  llLEEEEELL---------HHHHHHHHHH-LLEEEEEEEElllllhhhHHHHhHHHL---


DSSP  hhlllleEEEEEEEEEelleeeeeeeellllllHHHHHHHhhhhllhhhhhhhhhhhhhh
Query arrgipfLNGVEVSVSwgrhtvhivglgidpaePALAAGLksiregrlerarqmgaslea  111
ident              |                                              
Sbjct -------KVAILLSNP------------kpslvRDTVQKF--------------------   68
DSSP  -------LEEEEEELL------------lhhhhHHHHHHL--------------------


DSSP  lllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllllll
Query agiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwas  171
ident                                                             
Sbjct ----------------------------------------------ksyliyvesndlrv   82
DSSP  ----------------------------------------------llleeeeelllhhh


DSSP  HHHHHHHHHhllleEEELLHHHLLLLhhhHHHHHHHHHHlLLLEEEeEELLL--------
Query LEDAVGWIVgaggmAVIAHPGRYDMGrtlIERLILDFQAaGGQGIEvASGSH--------  223
ident         |       |  |            |               |           
Sbjct IRYSIEKGV-----DAIISPWVNRKDpgiDHVLAKLMVK-KNVALG-FSLRPllysnpye  135
DSSP  HHHHHHLLL-----LEEELLLLLLLLlllLHHHHHHHHH-HLLEEE-EELHHhhhllhhh


DSSP  ---LHHHHHHHHHHHHHHLLEEEEELLLLLLlLLLL---lLLLLLL-----------lll
Query ---SLDDMHKFALHADRHGLYASSGSDFHAPgEDVG---hTEDLPP-----------icr  266
ident     |  | |               |       ||        |                
Sbjct ranLLRFMMKAWKLVEKYKVRRFLTSSAQEK-WDVRyprdLISLGVvigmeipqakasis  194
DSSP  hhhHHHHHHHHHHHHHHHLLLEEEELLLLLH-HHLLlhhhHHHHHHhllllhhhhhhlll


DSSP  LHHHHLHHhlllllhhhl
Query PIWRELEArilrpadaen  284
ident                   
Sbjct MYPEIILK----------  202
DSSP  HHHHHHHL----------


No 12: Query=2yb1A Sbjct=2ffiA Z-score=6.9

back to top
DSSP  ---lLEELLLLLLL------------lllLLLHHHHHHHHHLLLLLEEEELLLL----lL
Query ---aNIDLHFHSRT------------sdgALTPTEVIDRAAARAPALLALTDHD----cT   41
ident      || | |                              |       |          
Sbjct lhltAIDSHAHVFSrglnlasqrryapnyDAPLGDYLGQLRAHGFSHGVLVQPSflgtdN   60
DSSP  llllLEELLLLLLLhhhhhhlllllllllLLLHHHHHHHHHHLLLLEELLLLLHhhlllL


DSSP  LLHHHHHHHHHhllLLEEEEE----------------------EEEEeelleeeeeeeel
Query GGLAEAAAAAArrgIPFLNGV----------------------EVSVswgrhtvhivglg   79
ident   |  |              |                                       
Sbjct RYLLSALQTVP---GQLRGVVxlerdveqatlaexarlgvrgvRLNL-xgqdxpdltgaq  116
DSSP  HHHHHHHHHLL---LLLLLLLlllllllhhhhhhhhllllleeELLL-llllllllllll


DSSP  llllLHHHhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhh
Query idpaEPALaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarh  139
ident                                                             
Sbjct wrplLERI----------------------------------------------------  124
DSSP  lhhhHHHH----------------------------------------------------


DSSP  hhhllllllhhhhhhhlllllllllllllllLHHHHhhhhhhlllEEEELLHHHLL----
Query lvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDAvgwivgaggMAVIAHPGRYD----  195
ident                                                || | || |    
Sbjct -------------geqgwhvelhrqvadipvLVRAL----qpyglDIVIDHFGRPDarrg  167
DSSP  -------------hhhlleeeellllllhhhHHHHH----lllllLEEELHHHLLLllll


DSSP  lLHHHHHHHHHHHHHlLLLEEEEeELLL--------LHHHHHHHHHHHHHHLL--EEEEE
Query mGRTLIERLILDFQAaGGQGIEVaSGSH--------SLDDMHKFALHADRHGL--YASSG  245
ident  |      |       |     | ||           |            |        |
Sbjct lGQPGFAELLTLSGR-GKVWVKV-SGIYrlqgspeeNLAFARQALCALEAHYGaeRLXWG  225
DSSP  lLLLLHHHHLLLLLL-LLEEEEE-ELHHhllllhhhHHHHHHHHHHHHHHHLLhhHEEEE


DSSP  LLLL----llLLLL---lllLLLLLL--------llLHHHHLHHHlllllhhhl
Query SDFH----apGEDV---ghtEDLPPI--------crPIWRELEARilrpadaen  284
ident ||                                     | |            
Sbjct SDWPhtqhesEVSFgsaveqFEALGCsaqlrqalllDTARALFGF------ele  273
DSSP  LLLLllllllLLLHhhhhhhHHHHLLlhhhhhhhhlHHHHHHLLL------lll


No 13: Query=2yb1A Sbjct=3nqbA Z-score=6.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------lLEELLLLLLllLLLLLHHHHHHHHHLLLLLEEEELLLLL--
Query ------------------aNIDLHFHSRtsDGALTPTEVIDRAAARAPALLALTDHDC--   40
ident                     || | |        ||        ||         |    
Sbjct srrdaaqvidaggayvspgLIDTHXHIE--SSXITPAAYAAAVVARGVTTIVWDPHEFgn  118
DSSP  lllleeeeeelllleeeelEEEEEELHH--HHLLLHHHHHHHHHLLLEEEEEELLHHHhh


DSSP  -------lLLHHHhHHHHhhlLLLEEEEEEEEeeelleeeeeeeellllllhhhhhhhhh
Query -------tGGLAEaAAAAarrGIPFLNGVEVSvswgrhtvhivglgidpaepalaaglks   93
ident                                                             
Sbjct vhgvdgvrWAAKA-IENL---PLRAILLAPSC---------------------------v  147
DSSP  hhlhhhhhHHHHH-HLLL---LLEEEEEELLL---------------------------l


DSSP  HHLLHHHHhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhh
Query IREGRLERarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvf  153
ident      |||                                                    
Sbjct PSAPGLER----------------------------------------------------  155
DSSP  LLLLLLLL----------------------------------------------------


DSSP  hhlllllllllllLLLL------------------------------LHHHHHHHHHHLL
Query rkyltpgkpgyvsHQWA------------------------------SLEDAVGWIVGAG  183
ident                                                     |     | 
Sbjct -----------ggADFDaailadllswpeiggiaeixnxrgvierdpRXSGIVQAGLAAE  204
DSSP  -----------llLLLLhhhhhhhhlllleeeeeeellhhhhhlllhHHHHHHHHHHHHL


DSSP  LEEEeLLHHhllllhhhHHHHHHHHHHLLLLEEEEeellllhhHHHHHHHHHHHHLLEEE
Query GMAViAHPGrydmgrtlIERLILDFQAAGGQGIEVasgshsldDMHKFALHADRHGLYAS  243
ident       |                 | |||                        | ||   
Sbjct KLVC-GHAR------glKNADLNAFXAAGVSSDHE-------lVSGEDLXAKLRAGLTIE  250
DSSP  LEEE-ELLL------llLHHHHHHHHHLLLLEELL-------lLLHHHHHHHHHLLLEEE


DSSP  ---------------------------EELLLLLLLL----LLLL-------------ll
Query ---------------------------SGSDFHAPGE----DVGH-------------te  259
ident                               |   |                         
Sbjct lrgshdhllpefvaalntlghlpqtvtLCTDDVFPDDllqgGGLDdvvrrlvryglkpew  310
DSSP  eelllhhhhhhhhhhhhhhlllllleeEELLLLLHHHhhhlLLHHhhhhhhhhllllhhh


DSSP  lllllllLHHHHLHH-------------------------hlllLLHH------------
Query dlppicrPIWRELEA-------------------------rilrPADA------------  282
ident             |                                               
Sbjct alraatlNAAQRLGRsdlgliaagrradivvfedlngfsarhvlASGRavaeggrxlvdi  370
DSSP  hhhhhlhHHHHHHLLllllllllllllleeeellllllleeeeeELLEeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  282
ident                                                             
Sbjct ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  282
ident                                                             
Sbjct gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  282
ident                                                             
Sbjct vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh


DSSP  -----------------------------------hl
Query -----------------------------------en  284
ident                                      
Sbjct kacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhlllllllllleelllleeelllleeellleeel


No 14: Query=2yb1A Sbjct=2vunA Z-score=6.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  lLEELLLLLllllllllHHHH-------hhhHHLLL---LLEEEELL-----------ll
Query aNIDLHFHSrtsdgaltPTEV-------idrAAARA---PALLALTD-----------hd   39
ident    | | |                                                    
Sbjct gLLDTHVHV--------SGGDyaprqktmdfISSALhggVTTMISAGsphfpgrpkdaag  112
DSSP  lEEEEEELL--------LLLLeehhhleelhHHHHHlllEEEEEELLllllllllllhhh


DSSP  lllLHHHHHHHHHHLL---LLEE------------------------EEEEEEeeellee
Query ctgGLAEAAAAAARRG---IPFL------------------------NGVEVSvswgrht   72
ident                                                   ||        
Sbjct tkaLAITLSKSYYNARpagVKVHggavilekglteedfiemkkegvwIVGEVG-------  165
DSSP  hhhHHHHHHHHHHHLLhhhLEEElleelllllllhhhhhhhhhllllEEEEEL-------


DSSP  eeeeeellllllhhhhhhHHHHhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhll
Query vhivglgidpaepalaagLKSIregrlerarqmgasleaagiagcfdgamrwcdnpemis  132
ident                                                             
Sbjct -----------------lGTIK--------------------------------------  170
DSSP  -----------------lLLLL--------------------------------------


DSSP  hhhhhhhhhhllllllhhhhhhhllllllllllllLLLL---------------------
Query rthfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWAS---------------------  171
ident                                      |                      
Sbjct ---------------------------------npEDAApmvewahkhgfkvqmhtggts  197
DSSP  ---------------------------------lhHHHHhhhhhhhhllleeeeelllll


DSSP  -----------HHHHHhhhhhllleEEELLHH---HLLLlHHHHHHHHHHHHhlllLEEE
Query -----------LEDAVgwivgaggmAVIAHPG---RYDMgRTLIERLILDFQaaggQGIE  217
ident                           |  |               |             |
Sbjct ipgsstvtaddVIKTK--------pDVVSHINggpTAIS-VQEVDRIMDETD----FAME  244
DSSP  llllllllhhhHHHHL--------lLEEELLLlllLLLL-HHHHHHHHHHLL----LEEE


DSSP  EeELLLLHHHHHHHHHHHH-HHLL-EEEEELLLLLLLLL-llLLLL---LLLL-------
Query VaSGSHSLDDMHKFALHAD-RHGL-YASSGSDFHAPGED-vgHTED---LPPI-------  264
ident               |  |     |     | |                            
Sbjct I-VQCGNPKIADYVARRAAeKGQLgRVIFGNDAPSGTGLiplGILRnmcQIASmsdidpe  303
DSSP  E-ELLLLHHHHHHHHHHHHhHLLHhHEEEELLLLLLLLLlllHHHHhhhHHHHhllllhh


DSSP  ------llLHHHH-LHHH------------------------------------------
Query ------crPIWRE-LEAR------------------------------------------  275
ident                                                             
Sbjct vavcmatgNSTAVyGLNTgviapgkeadliimdtplgsvaedamgaiaagdipgisvvli  363
DSSP  hhhhhhlhHHHHHhLLLLlllllllllleeeeelllllllllhhhhhhhlllleeeeeee


DSSP  -------------lllllhhhl
Query -------------ilrpadaen  284
ident                       
Sbjct dgeavvtksrntppakraakil  385
DSSP  lleeeellllllllllllleel


No 15: Query=2yb1A Sbjct=2oofA Z-score=6.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --lLEELLLLLLL---------------------------------------lllllLHH
Query --aNIDLHFHSRT---------------------------------------sdgalTPT   19
ident     || | |                                                  
Sbjct tpgLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  eelEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHLLLLLEEEELLL------lllLLHHHHHHHHHHLLLLEEEEE-----------
Query EVIDRAAARAPALLALTDH------dctGGLAEAAAAAARRGIPFLNGV-----------   62
ident                               |  |        |                 
Sbjct PRVKSLIREGVTTVEIKSGygltledelKXLRVARRLGEALPIRVKTTLlaahavppeyr  180
DSSP  HHHHHHHHHLEEEEEEELLllllhhhhhHHHHHHHHHHHHLLLEEEEEEeeellllhhhl


DSSP  ---------------------------EEEE----EELLEEeeeeeellllllhHHHHHH
Query ---------------------------EVSV----SWGRHTvhivglgidpaepALAAGL   91
ident                             |           |             |     
Sbjct ddpdswveticqeiipaaaeagladavDVFCehigFSLAQT--------eqvylAADQYG  232
DSSP  llhhhhhhhhhhlhhhhhhhllllleeEEEEllllLLHHHH--------hhhhhHHHHLL


DSSP  hhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhh
Query ksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrt  151
ident                                                             
Sbjct ------------------------------------------------------------  232
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllllllllllllhHHHHhhhhhllleEEELLHHhllllhhhHHHHHHHHHHl
Query vfrkyltpgkpgyvshqwaslEDAVgwivgaggmAVIAHPGrydmgrtlIERLILDFQAa  211
ident                                       |              |      
Sbjct -lavkghxdqlsnlggstlaaNFGA---------LSVDHLE------ylDPEGIQALAH-  275
DSSP  -leeeeeelllllllhhhhhhHLLL---------LEEEELL------llLHHHHHHHHH-


DSSP  LLLEEEEEELLL----LHHHhhHHHHHHHHHLLEEEEELLLLLL-lLLLLL--LLLL---
Query GGQGIEVASGSH----SLDDmhKFALHADRHGLYASSGSDFHAP-gEDVGH--TEDL---  261
ident  |                             |      ||        |           
Sbjct RGVVATLLPTAFyflkETKL--PPVVALRKAGVPXAVSSDINPGtaPIVSLrxAXNXact  333
DSSP  HLLEEEELHHHHhhllLLLL--LLHHHHHHLLLLEEELLLLLLLllLLLLHhhHHHHhhh


DSSP  -LLLL--------lLHHHH---LHHH----------------------------------
Query -PPIC--------rPIWRE---LEAR----------------------------------  275
ident                                                             
Sbjct lFGLTpveaxagvtRHAARalgEQEQlgqlrvgxladflvwncghpaelsyligvdqlvs  393
DSSP  hHLLLhhhhhhhllHHHHHhllLLLLllllllllllleeeellllllhhhhlllllleee


DSSP  -lllllhhhl
Query -ilrpadaen  284
ident           
Sbjct rvvngeetlh  403
DSSP  eeelleelll


No 16: Query=2yb1A Sbjct=2pajA Z-score=6.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  -lLEELLLLLllllLLLL------------------HHHHHHHHHLLLLLEEEELLLLL-
Query -aNIDLHFHSrtsdGALT------------------PTEVIDRAAARAPALLALTDHDC-   40
ident       | |                                   |    |  |       
Sbjct paWVNTHHHL----FQSLlkgepfralfderrfrlaARIGLIELARSGCATVADHNYVYy  116
DSSP  elEELLLLLH----HHHHllllllhhhllhhhhhhhHHHHHHHHHLLLEEEEEELLLLLl


DSSP  ----lLLHHHHHHHHHHLLLLEEEEEEEEeeelleeeeeeeellllllhhhhhhhhhHHL
Query ----tGGLAEAAAAAARRGIPFLNGVEVSvswgrhtvhivglgidpaepalaaglksIRE   96
ident         |     |   |  |                                      
Sbjct pgmpfDSSAILFEEAEKLGLRFVLLRGGA----------------------------TQT  148
DSSP  lllllLHHHHHHHHHHHLLLEEEEEELLL----------------------------LLL


DSSP  LhhHHHHHHhhhhhhlllllhhhhhhlllllHHHLlhhhhhhhhhhllllllhhhhhhhl
Query GrlERARQMgasleaagiagcfdgamrwcdnPEMIsrthfarhlvdsgavkdmrtvfrky  156
ident                                                             
Sbjct R--QLEADL---------------------pTALR-------------------------  160
DSSP  L--LLLLLL---------------------lHHHL-------------------------


DSSP  llllllllllLLLL--------------------------------------LHHHHHHH
Query ltpgkpgyvsHQWA--------------------------------------SLEDAVGW  178
ident                                                             
Sbjct ---------pETLDayvadierlaaryhdaspramrrvvmapttvlysisprEMRETAAV  211
DSSP  ---------lLLHHhhhhhhhhhhhhllllllllleeeeellllllllllhhHHHHHHHH


DSSP  HHHLLLEEEeLLHHhlllLHHHHHHHHHHHHhlllLEEEeeelLLLHHhhHHHHHHHHHH
Query IVGAGGMAViAHPGrydmGRTLIERLILDFQaaggQGIEvasgSHSLDdmHKFALHADRH  238
ident     |      |      |                                         
Sbjct ARRLGLRMH-SHLS----GKSPVAFCGEHDW-lgsDVWY---aHLVKV-dADEIALLAQT  261
DSSP  HHHLLLEEE-EELL----LLLHHHHHHHLLL-lllLEEE---eLLLLL-lHHHHHHHHHH


DSSP  LLEEEE----------------------ELLLLLLlLLLLL-------------------
Query GLYASS----------------------GSDFHAPgEDVGH-------------------  257
ident |                           | |  |  |                       
Sbjct GTGVAHcpqsngrlpvremadagvpvsiGVDGAASnEAADMisevhmtwlaqrarlasia  321
DSSP  LLEEEElhhhhhllllllhhhhllleeeLLLHHHHlLLLLHhhhhhhhhhhhhhllllhh


DSSP  --lllllllllLHHHhLHHH----------------------------------------
Query --tedlppicrPIWReLEAR----------------------------------------  275
ident                 |                                           
Sbjct evihwgtaggaRVMG-LDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsv  380
DSSP  hhhhhhlhhhhHHHL-LLLLlllllllllleeeeelllhhhlllllhhhhhhhlllllee


DSSP  -lllLLHH-------------------------------hl
Query -ilrPADA-------------------------------en  284
ident      |                                   
Sbjct malfSAGKrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeeeELLEeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 17: Query=2yb1A Sbjct=1bf6A Z-score=6.5

back to top
DSSP  -----lLEELLLLLLLLL--------lLLLHH-HHHHHHHLLL---LLEEEELLL-lllL
Query -----aNIDLHFHSRTSD--------gALTPT-EVIDRAAARA---PALLALTDH-dctG   42
ident           | |               |                               
Sbjct sfdptgYTLAHEHLHIDLsgfknnvdcRLDQYaFICQEMNDLMtrgVRNVIEMTNrymgR   60
DSSP  llllllEEEEEELLLEELhhhhllhhhEELLHhHHHHHHHHHHhllEEEEEELLLhhhlL


DSSP  LHHHHHHHHHHLLLLEEEE-----------------------------------------
Query GLAEAAAAAARRGIPFLNG-----------------------------------------   61
ident             ||                                              
Sbjct NAQFMLDVMRETGINVVACtgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag  120
DSSP  LHHHHHHHHHHHLLEEEEEellllhhhlllhhhhllhhhhhhhhhhhhhlllllllllee


DSSP  --EEEEEEELLeeeeeeeellllllhHHHHHHHHhhllhhhhhhhhhhhhhhlllllhhh
Query --VEVSVSWGRhtvhivglgidpaepALAAGLKSiregrlerarqmgasleaagiagcfd  119
ident    |   | |                   |                              
Sbjct iiAEIGTSEGK--------itpleekVFIAAALA--------------------------  146
DSSP  eeEEEELLLLL--------llhhhhhHHHHHHHH--------------------------


DSSP  hhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllllllhhHHHHH-
Query gamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwasleDAVGW-  178
ident                                                             
Sbjct -----------------------------------hnqtgrpisthtsfstmglEQLALl  171
DSSP  -----------------------------------hhhhllleeeelhhhllhhHHHHHh


DSSP  --hhhlllEEEELLHHHLlllhhhHHHHHHHHHHLLlLEEEeEELL-----lLHHHHHHH
Query --ivgaggMAVIAHPGRYdmgrtlIERLILDFQAAGgQGIEvASGS-----hSLDDMHKF  231
ident              |              ||     |                        
Sbjct qahgvdlsRVTVGHCDLK-----dNLDNILKMIDLG-AYVQ-FDTIgknsyyPDEKRIAM  224
DSSP  hhllllhhHEEELLLLLL-----lLHHHHHHHHHLL-LEEE-ELLLllllllLHHHHHHH


DSSP  HHHHH-HHLL-EEEEELLLLLL-------LLLLlLLLL-------------llLLLLL--
Query ALHAD-RHGL-YASSGSDFHAP-------GEDVgHTED-------------lpPICRP--  267
ident       |  |       |           |                              
Sbjct LHALRdRGLLnRVMLSMDITRRshlkangGYGY-DYLLttfipqlrqsgfsqaDVDVMlr  283
DSSP  HHHHHhLLLHhHEEELLLLLLHhhlhhhlLLLL-LHHHhlhhhhhhhllllhhHHHHHhl


DSSP  -HHHHLHHhlllllhhhl
Query -IWRELEArilrpadaen  284
ident                   
Sbjct eNPSQFFQ----------  291
DSSP  hHHHHHLL----------


No 18: Query=2yb1A Sbjct=2y1hB Z-score=6.4

back to top
DSSP  --lLEELLLLLLllLLLL--lHHHHHHHHHLLLLLEEEELLL--llLLLHHHHHHHHHhl
Query --aNIDLHFHSRtsDGAL--tPTEVIDRAAARAPALLALTDH--dcTGGLAEAAAAAArr   54
ident      | | |              |   |       |                       
Sbjct gvgLVDCHCHLS--APDFdrdLDDVLEKAKKANVVALVAVAEhsgeFEKIMQLSERYN--   56
DSSP  lllEEEEEELLL--LHHHlllHHHHHHHHHHLLEEEEEELLLlhhhHHHHHHHHHHLL--


DSSP  lLLEEEE------------------------------------EEEEEEELL--eeeeee
Query gIPFLNG------------------------------------VEVSVSWGR--htvhiv   76
ident     |                                       ||              
Sbjct -GFVLPClgvhpvqgldqrsvtlkdldvalpiienykdrllaiGEVGLDFSPrfagtgeq  115
DSSP  -LLEEEEelllleelllleellhhhhhhhhhhhhhhllllleeEEEEEELLLlllllhhh


DSSP  eellllllhHHHHHHhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhh
Query glgidpaepALAAGLksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthf  136
ident                                                             
Sbjct keeqrqvliRQIQLA---------------------------------------------  130
DSSP  hhhhhhhhhHHHHHH---------------------------------------------


DSSP  hhhhhhllllllhhhhhhhlllllllllllllllLHHHHHhhhhhlllEEEELLHHhlll
Query arhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDAVgwivgaggMAVIAHPGrydm  196
ident                                                             
Sbjct -----------------krlnlpvnvhsrsagrpTINLLQ---eqgaeKVLLHAFD----  166
DSSP  -----------------hhhllleeeeeellhhhHHHHHH---hllllLEEEELLL----


DSSP  lhhhHHHHHHHHHHlLLLEEEeEELLLLHHhhHHHHHHHHHHL-lEEEEELLLL-----l
Query grtlIERLILDFQAaGGQGIEvASGSHSLDdmHKFALHADRHG-lYASSGSDFH-----a  250
ident                 |        |                         |        
Sbjct ---gRPSVAMEGVR-AGYFFS-IPPSIIRS--GQKQKLVKQLPltSICLETDSPalgpek  219
DSSP  ---lLHHHHHHHHH-LLLEEE-ELHHHHLL--HHHHHHHHHLLhhHEEELLLLLllllll


DSSP  LLLL-LLLL--LLLL-------------llllLHHH-HLHH-HLLLllhhhl
Query PGED-VGHT--EDLP-------------picrPIWR-ELEA-RILRpadaen  284
ident                                           | |       
Sbjct QVRNePWNIsiSAEYiaqvkgisveevievttQNALkLFPKlRHLL------  265
DSSP  LLLLlHHHHhhHHHHhhhhhlllhhhhhhhhhHHHHhHLLLhHHHL------


No 19: Query=2yb1A Sbjct=1yrrB Z-score=6.3

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------aNIDLHFH    8
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeelEEEEEEL


DSSP  ----llLLLL-LLLHHHHHHHHHLLL----LLEEEELLLL-----LLLLHHHHHHHHHHL
Query ----srTSDG-ALTPTEVIDRAAARA----PALLALTDHD-----CTGGLAEAAAAAARR   54
ident         |       |                   |           |        |  
Sbjct gcggvqFNDTaEAVSVETLEIMQKANeksgCTNYLPTLITtsdelMKQGVRVMREYLAKH  120
DSSP  eelleeLLLLlLLLLHHHHHHHHHHHhlllEEEEEEEELLllhhhHHHHHHHHHHHHHHL


DSSP  LLL-EEEEEEEEEeelleeeeeeeellllllHHHHHHhhhhhllhhhhhhhhhhhhhhll
Query GIP-FLNGVEVSVswgrhtvhivglgidpaePALAAGlksiregrlerarqmgasleaag  113
ident          |                                                  
Sbjct PNQaLGLHLEGPW---------------lnaALVDFL-----------------------  142
DSSP  LLLlLLEEEELLL---------------lllHHHHHH-----------------------


DSSP  lllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllllLHH
Query iagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLE  173
ident                                                             
Sbjct -----------------------------------------cenadvitkvtlapemVPA  161
DSSP  -----------------------------------------hhlhhheeeeeelhhhLLH


DSSP  HHHHHHHHLLLEEEELLHHhllllhhhHHHHHHHHHHLLLLEEEEE--ellllhhhhhhH
Query DAVGWIVGAGGMAVIAHPGrydmgrtlIERLILDFQAAGGQGIEVA--sgshslddmhkF  231
ident         ||      |                    ||                     
Sbjct EVISKLANAGIVVSAGHSN-------aTLKEAKAGFRAGITFATHLynampyitgrepgL  214
DSSP  HHHHHHHHHLLEEEELLLL-------lLHHHHHHHHHHLEEEELLLllllllllllllhH


DSSP  HHHHHHH-LLEEEeelllllllllllllllLLLL--LLLH--------------------
Query ALHADRH-GLYASsgsdfhapgedvghtedLPPI--CRPI--------------------  268
ident |         |                                                 
Sbjct AGAILDEaDIYCG--iiadglhvdyanirnAKRLkgDKLClvtdatsgssltmiegvrnl  272
DSSP  HHHHHHLlLLEEE--eelllllllhhhhhhHHHHhhHHEEeellllllllllhhhhhhhh


DSSP  -------------------HHHLHH--hlllllHHHL-----------------------
Query -------------------WRELEA--rilrpaDAEN-----------------------  284
ident                     |                                       
Sbjct vehcgialdevlrmatlypARAIGVekrlgtlaAGKVanltaftpdfkitktivngnevv  332
DSSP  hhhhlllhhhhhhhhlhhhHHHLLLllllllllLLLLlleeeellllleeeeeelleeee


DSSP  --
Query --  284
ident   
Sbjct tq  334
DSSP  el


No 20: Query=2yb1A Sbjct=4mupB Z-score=6.3

back to top
DSSP  ----------------lLEELLLLLL---------lllllllhhHHHHHHHLLL----LL
Query ----------------aNIDLHFHSR---------tsdgaltptEVIDRAAARA----PA   31
ident                    |   |                                    
Sbjct lvrklsgtapnpafprgAVDTQMHMYlpgypalpggpglppgalPGPEDYRRLMqwlgID   60
DSSP  lllllllllllllllllLEELLLLLLllllllllllllllllllLLHHHHHHHHhhhlLL


DSSP  EEEELLLL----lLLLHHHHHHHHHhllLLEEEEE----------------------EEE
Query LLALTDHD----cTGGLAEAAAAAArrgIPFLNGV----------------------EVS   65
ident     |         |      |            |                         
Sbjct RVIITQGNahqrdNGNTLACVAEMG---EAAHAVViidatttekdmekltaagtvgaRIM  117
DSSP  EEEEELLHhhlllLHHHHHHHHHHH---HHEEEEElllllllhhhhhhhhhlleeeeEEE


DSSP  Eeelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlll
Query Vswgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwc  125
ident                                                             
Sbjct D-----------------------------------------------------------  118
DSSP  L-----------------------------------------------------------


DSSP  llhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllLLLHHHHHHHHHHLLLE
Query dnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqWASLEDAVGWIVGAGGM  185
ident                                               |         |  |
Sbjct ------------------------------------lpggavnLSELDAVDERAHAADWM  142
DSSP  ------------------------------------lllllllHHHHHHHHHHHHHLLLE


DSSP  -----------------------EEELLHHHL--LLLH--HHHHHHHHHHHHllLLEEEe
Query -----------------------AVIAHPGRY--DMGR--TLIERLILDFQAagGQGIEv  218
ident                         |  | |               |              
Sbjct vavqfdgnglldhlprlqkirsrWVFDHHGKFfkGIRTdgPEMAALLKLIDR-gNLWFK-  200
DSSP  eeeellhhhhhhhhhhhhlllleEEELHHHHLllLLLLllHHHHHHHHHHHH-lLEEEE-


DSSP  EELL-----------lLHHHHHHHHHHHHhhlLEEEEELLLLLLLL----------llll
Query ASGS-----------hSLDDMHKFALHADrhgLYASSGSDFHAPGE----------dvgh  257
ident   |                     | ||         |                      
Sbjct FAGVyessrkswpyadVAAFSRVIAAHAP---ERIVWGTNWPHNSVretaaypddarlae  257
DSSP  ELLHhhllllllllhhHHHHHHHHHHHLH---HHEEELLLLLLLLLllhhhlllhhhhhh


DSSP  lLLLL---LLLL-----LHHHH--LHHHlllllhhhl
Query tEDLP---PICR-----PIWRE--LEARilrpadaen  284
ident            |                         
Sbjct lTLGWlpdEAARhralvENPEAlfKLSP--------v  286
DSSP  hHHLLlllHHHHhhhhlHHHHHhhLLLL--------l


No 21: Query=2yb1A Sbjct=3ls9A Z-score=6.2

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------ANI    3
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  ELLLLLlllLLLL------------------------------------LHHHHHHHHHL
Query DLHFHSrtsDGAL------------------------------------TPTEVIDRAAA   27
ident   | |                                                       
Sbjct NSHQHL---YEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdvIREVARAVLLE  117
DSSP  EEEELH---HHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHHHHHHHHH


DSSP  LL---LLEEEELLL-----lllLLHHHHHHHHHHLLLLEEEEEEeeeeelleeeeeeeel
Query RA---PALLALTDH-----dctGGLAEAAAAAARRGIPFLNGVEvsvswgrhtvhivglg   79
ident          |                    ||   || |                     
Sbjct SLlggITTVADQHLffpgatadSYIDATIEAATDLGIRFHAARS----------------  161
DSSP  HHhllEEEEEEEELllllllllLHHHHHHHHHHHHLLEEEEEEL----------------


DSSP  lllllhhhhhhhhhHHLL------HHHHHhhhhhhhhhlllllhhhhhhlllllhhhllh
Query idpaepalaaglksIREG------RLERArqmgasleaagiagcfdgamrwcdnpemisr  133
ident                  |                                          
Sbjct -------------sMTLGkseggfCDDLF--------------------------vepvd  182
DSSP  -------------lLLLLhhhlllLLHHH--------------------------lllhh


DSSP  hhhhhhhhhllllllhhhhhhhllllllllllllLLLLHHHHHHHHH-HLLLE-------
Query thfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWASLEDAVGWIV-GAGGM-------  185
ident                                        |                    
Sbjct rvvqhclglidqyhepepfgmvrialgpcgvpydKPELFEAFAQMAAdYDVRLhthfyep  242
DSSP  hhhhhhhhhhhhhlllllllleeeeellllllllLHHHHHHHHHHHHhHLLEEeeeelll


DSSP  ---------------------------EEELLHHhllLLHHHhHHHHHHHHhlllLEEEE
Query ---------------------------AVIAHPGrydMGRTLiERLILDFQaaggQGIEV  218
ident                               ||       |        |        |  
Sbjct ldagmsdhlygmtpwrflekhgwasdrVWLAHAV--vPPREE-IPEFADAG----VAIAH  295
DSSP  lhhhhhhhhhlllhhhhhhhlllllllEEEEELL--lLLHHH-HHHHHHHL----LEEEE


DSSP  EELLL----LHHHhhhHHHHHHHHLLEEEEELLLLLllLLLLL-----------------
Query ASGSH----SLDDmhkFALHADRHGLYASSGSDFHApgEDVGH-----------------  257
ident                         |     |    |                        
Sbjct LIAPDlrmgWGLA---PIREYLDAGITVGFGTTGSAsnDGGNLlgdlrlaalahrpadpn  352
DSSP  LHHHHhhllLLLL---LHHHHHHLLLEEEELLLLLLllLLLLHhhhhhhhhhhlhhhlll


DSSP  ---llllLLLL-----lLHHH--HLHH---------------------------------
Query ---tedlPPIC-----rPIWR--ELEA---------------------------------  274
ident                                                             
Sbjct epekwlsARELlrmatrGSAEclGRPDlgvleegraadiacwrldgvdrvgvhdpaigli  412
DSSP  lhhhlllHHHHhhhllhHHHHhlLLLLllllllllllleeeeelllhhhlllllhhhhhh


DSSP  --------hlllLLHH-----------------------hl
Query --------rilrPADA-----------------------en  284
ident                                          
Sbjct mtglsdraslvvVNGQvlvenerpvladlerivanttalip  453
DSSP  hlllllllleeeELLEeeeelleellllhhhhhhhhhhhll


No 22: Query=2yb1A Sbjct=3cjpA Z-score=6.2

back to top
DSSP  LLEELLLLLllllllllhHHHHHHHHL-LLLLEEEELLL---------------------
Query ANIDLHFHSrtsdgaltpTEVIDRAAA-RAPALLALTDH---------------------   38
ident   || | |           |               |                        
Sbjct LIIDGHTHV------ilpVEKHIKIMDeAGVDKTILFSTsihpetavnlrdvkkemkkln   54
DSSP  LLEEEEEEL------lllHHHHHHHHHhHLLLEEEEELLlllhhhlllhhhhhhhhhhhh


DSSP  ---------------lLLLLHHHHHHHHHhllLLEEEEEEEEEEelleeeeeeeelllll
Query ---------------dCTGGLAEAAAAAArrgIPFLNGVEVSVSwgrhtvhivglgidpa   83
ident                     |     |             | |                 
Sbjct dvvngktnsmidvrrnSIKELTNVIQAYP---SRYVGFGNVPVG----------lsendt  101
DSSP  hhhlllllllhhhhhhHHHHHHHHHHHLL---LLEEEEELLLLL----------llhhhh


DSSP  lHHHHHHHhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhl
Query ePALAAGLksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvds  143
ident                                                             
Sbjct nSYIEENI----------------------------------------------------  109
DSSP  hHHHHHHL----------------------------------------------------


DSSP  lllllhhhhhhhlllllllllllllllLHHHHHHHHHHLL-LEEEElLHHHLLLlHHHHH
Query gavkdmrtvfrkyltpgkpgyvshqwaSLEDAVGWIVGAG-GMAVIaHPGRYDMgRTLIE  202
ident                            ||          |     | |          | 
Sbjct --------vnnklvgigeltpasgqikSLKPIFKYSMDSGsLPIWI-HAFNPLV-LQDIK  159
DSSP  --------lllllleeeeellllllhhHHHHHHHHHHHLLlLLEEE-LLLLLLL-HHHHH


DSSP  HHHHHHHHL--LLLEEEEeellllhHHHHHHHHHHHHHL-LEEE----------------
Query RLILDFQAA--GGQGIEVasgshslDDMHKFALHADRHG-LYAS----------------  243
ident        |                          |     ||                  
Sbjct EIAELCKAFpkVPVILGH----mggSNWMTAVELAKEIQnLYLDtsayfstfvlkivine  215
DSSP  HHHHHHHHLllLLEEEHH----hhhHHHHHHHHHHHHLLlEEEEllllllhhhhhhhhhh


DSSP  ------EELLLLL----------llllllllllllllllLHHHHLHHhlllllhhhl
Query ------SGSDFHA----------pgedvghtedlppicrPIWRELEArilrpadaen  284
ident        | |                              | | |            
Sbjct lplkciFGTDMPFgdlqlsieaikkmsndsyvanavlgdNISRLLNI----------  262
DSSP  lllleeLLLLLLLllhhhhhhhhhhhlllhhhhhhhhlhHHHHHHLL----------


No 23: Query=2yb1A Sbjct=4cqbA Z-score=6.1

back to top
DSSP  -----------------------------------------------------lLEELLL
Query -----------------------------------------------------aNIDLHF    7
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE


DSSP  LLlllLLLL----------------------------------LHHHHHHHHHLLL---L
Query HSrtsDGAL----------------------------------TPTEVIDRAAARA---P   30
ident |                                              ||  |        
Sbjct HM--dKSFTstgerlpkfwsrpytrdaaiedglkyyknatheeIKRHVIEHAHMQVlhgT  118
DSSP  LH--hHLLLlllllllllllllllhhhhhhhhhhhhhhllhhhHHHHHHHHHHHHHhllE


DSSP  LEEEELLLL----lLLLHHHHHHHHHHLL--LLEEEEEEEE-------------------
Query ALLALTDHD----cTGGLAEAAAAAARRG--IPFLNGVEVS-------------------   65
ident               |        |       |                            
Sbjct LYTRTHVDVdsvakTKAVEAVLEAKEELKdlIDIQVVAFAQsgffvdleseslirksldm  178
DSSP  EEEEEEEELlllllLHHHHHHHHHHHHLLllLEEEEEEELLllllllllhhhhhhhhhhh


DSSP  -------eeELLEEeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhh
Query -------vsWGRHTvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcf  118
ident                                                             
Sbjct gcdlvggvdPATRE----------------------------------------------  192
DSSP  llleeelllLLLLL----------------------------------------------


DSSP  hhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllllLLHHHHHHH
Query dgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwASLEDAVGW  178
ident                                                     ||      
Sbjct -----------------------------------------------nnveGSLDLCFKL  205
DSSP  -----------------------------------------------llhhHHHHHHHHH


DSSP  HHHLLLEEEELlhhHLLLlhHHHHHHHHHHHHLL-------lLEEE--------------
Query IVGAGGMAVIAhpgRYDMgrTLIERLILDFQAAG-------gQGIE--------------  217
ident                     |     |                                 
Sbjct AKEYDVDIDYH--iHDIG--TVGVYSINRLAQKTiengykgrVTTShawcfadapsewld  261
DSSP  HHHLLLEEEEE--eLLLH--HHHHHHHHHHHHHHhhllllllEEEEellhhhhllhhhhh


DSSP  -------------EEEL-LLLHHHhhHHHHhhhhhllEEEEELLLLLL---LLLLLL---
Query -------------VASG-SHSLDDmhKFALhadrhglYASSGSDFHAP---GEDVGH---  257
ident              |    |                       ||           |    
Sbjct eaiplykdsgmkfVTCFsSTPPTM--PVIK-lleagiNLGCASDNIRDfwvPFGNGDmvq  318
DSSP  hhhhhhhhhlleeEEELlLLLLLL--LHHH-hhhlllEEEEELLLLLLlllLLLLLLhhh


DSSP  --------------------lllllllllLHHHH--------------------------
Query --------------------tedlppicrPIWRE--------------------------  271
ident                                                             
Sbjct galietqrlelktnrdlgliwkmitsegaRVLGIeknygievgkkadlvvlnslspqwai  378
DSSP  hhhhhhhhhllllhhhhhhhhhhhlhhhhHHHLLhhhlllllllllleeeellllhhhhh


DSSP  --lhhhllllLHHH---------l
Query --learilrpADAE---------n  284
ident                         
Sbjct idqakrlcviKNGRiivkdeviva  402
DSSP  hhllleeeeeELLEeeeelleell


No 24: Query=2yb1A Sbjct=3k2gB Z-score=6.1

back to top
DSSP  ---------------------------LLEELLLLlLLLL--------------------
Query ---------------------------ANIDLHFHsRTSD--------------------   13
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDCrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEELhhhllllllhhhhhhhhlll


DSSP  -------------------lLLLHHHHHHHHHLLL---LLEEEELLLL-LLLLHHHHHHH
Query -------------------gALTPTEVIDRAAARA---PALLALTDHD-CTGGLAEAAAA   50
ident                            |      |                         
Sbjct sieilselrqdpfvnkhniaLDDLDLAIAEVKQFAavgGRSIVDPTCRgIGRDPVKLRRI  120
DSSP  lhhhhhhhhllhhhllllleELLHHHHHHHHHHHHhllLLEEEELLLLlLLLLHHHHHHH


DSSP  HHHLLLLEEEeEEEEeeelleeeeeeeellllllhhhhhhhhhHHLLHHHhhhhhhhhhh
Query AARRGIPFLNgVEVSvswgrhtvhivglgidpaepalaaglksIREGRLErarqmgasle  110
ident  |  |                                        |              
Sbjct SAETGVQVVX-GAGY-----------------------ylassXPETAAR----------  146
DSSP  HHHHLLEEEE-LLLL-----------------------llhhhLLHHHHL----------


DSSP  hlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllLLLL
Query aagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvsHQWA  170
ident                                                             
Sbjct -------------------lsaddiadeivaealegtdgtdarigligeigvssdfTAEE  187
DSSP  -------------------llhhhhhhhhhhhhhlllllllllllleeeellllllLHHH


DSSP  --LHHHHHHHHHHLLLEEEELlHHHLLLlhhHHHHHHHHHHHLLL----LEEEeeellLL
Query --SLEDAVGWIVGAGGMAVIAhPGRYDMgrtLIERLILDFQAAGG----QGIEvasgsHS  224
ident   ||  |    |  |                |  |        |                
Sbjct ekSLRGAARAQVRTGLPLXVH-LPGWFR---LAHRVLDLVEEEGAdlrhTVLC---hxNP  240
DSSP  hhHHHHHHHHHHHHLLLEEEL-LLLLLL---LHHHHHHHHHHLLLlhhhEEEL---llHH


DSSP  HHhhHHHHHHHHHHLLEE----------------------------------------EE
Query LDdmHKFALHADRHGLYA----------------------------------------SS  244
ident               |                                             
Sbjct SHxdPVYQATLAQRGAFLefdxigxdffyadqgvqcpsddevarailgladhgyldriLL  300
DSSP  HLllHHHHHHHHHHLLEEeellllllleelllleelllhhhhhhhhhhhhhlllhhheEE


DSSP  ELLLLLL-------LLLL----------------lllllllllllLHHHHLHHhlllllh
Query GSDFHAP-------GEDV----------------ghtedlppicrPIWRELEArilrpad  281
ident   |           |                                 |   |       
Sbjct SHDVFVKxxltrygGNGYafvtkhflprlrrhglddaaletlxvtNPRRVFDA-----si  355
DSSP  LLLLLLHhhlhhhlLLLLlhhhhlhhhhhhhllllhhhhhhhhlhHHHHHHLL-----ll


DSSP  hhl
Query aen  284
ident    
Sbjct egh  358
DSSP  lll


No 25: Query=2yb1A Sbjct=4hk5D Z-score=6.0

back to top
DSSP  --lLEELLLLLLL-----------------------------------------------
Query --aNIDLHFHSRT-----------------------------------------------   11
ident      | | |                                                  
Sbjct tpvVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  lllLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  ------lllLLLHHHHHHHHHLLLLLEEEELLLL-----------------lLLLHHHHH
Query ------sdgALTPTEVIDRAAARAPALLALTDHD-----------------cTGGLAEAA   48
ident                                                             
Sbjct lpgrplsthFASLAQKMHFMDTNGIRVSVISLANpwfdflapdeapgiadavNAEFSDMC  120
DSSP  llleellhhHLLHHHHHHHHHHLLLLEEEEEELLllllllllllhhhhhhhhHHHHHHHH


DSSP  HHHHhllLLEEEEE---------------------------EEEEEelleeeeeeeelll
Query AAAArrgIPFLNGV---------------------------EVSVSwgrhtvhivglgid   81
ident |                                            |              
Sbjct AQHV---GRLFFFAalplsapvdavkasiervknlkycrgiILGTS--------------  163
DSSP  HLLL---LLEEEEEellllllhhhhhhhhhhhhlllleeeeEELLL--------------


DSSP  lllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhh
Query paepalaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlv  141
ident                                                             
Sbjct ------------------------------------------------------------  163
DSSP  ------------------------------------------------------------


DSSP  hllllllhhhhhhhlllllllllllLLLLL---hhhhHHHHHHLLLEE------------
Query dsgavkdmrtvfrkyltpgkpgyvsHQWAS---ledaVGWIVGAGGMA------------  186
ident                                            |                
Sbjct -----------------------glGKGLDdphllpvFEAVADAKLLVflhphyglpnev  200
DSSP  -----------------------llLLLLLlhhhhhhHHHHHHLLLEEeelllllllhhh


DSSP  -------------------------------------------EELL-HHHLlLLHH---
Query -------------------------------------------VIAH-PGRYdMGRT---  199
ident                                              ||  |          
Sbjct ygprseeyghvlplalgfpmettiavarmymagvfdhvrnlqmLLAHsGGTLpFLAGrie  260
DSSP  hlllhhhlllhhhhhlhhhhhhhhhhhhhhhllhhhhllllleEEHHhHLLHhHHHHhhh


DSSP  --------------------HHHHHHHHHhhlllLEEEeEELLlLHHHHHHHHHHHHhhl
Query --------------------LIERLILDFqaaggQGIEvASGShSLDDMHKFALHADrhg  239
ident                      |                 |    |               
Sbjct scivhdghlvktgkvpkdrrTIWTVLKEQ-----IYLD-AVIY-SEVGLQAAIASSG--a  311
DSSP  hhhhllhhhhhlllllllllLHHHHHHHL-----EEEE-LLLL-LHHHHHHHHHHHL--h


DSSP  LEEEEELLLLLLLL-----------llllLLLL------------lllllLHHHHLHH-h
Query LYASSGSDFHAPGE-----------dvghTEDL------------ppicrPIWRELEA-r  275
ident      | |                                             | |    
Sbjct DRLMFGTDHPFFPPieedvqgpwdssrlnAQAVikavgegssdaaavmglNAVRVLSLka  371
DSSP  HHEELLLLLLLLLLlllllllllhhhhhhHHHHhhhhllllhhhhhhhlhHHHHHLLLhh


DSSP  llllLHHHL
Query ilrpADAEN  284
ident          
Sbjct elehHHHHH  380
DSSP  hhhhHHHHL


No 26: Query=2yb1A Sbjct=2ob3A Z-score=6.0

back to top
DSSP  ---------------lLEELLLL-LLLL-----------lllllhHHHHHHHHLLL----
Query ---------------aNIDLHFH-SRTS-----------dgaltpTEVIDRAAARA----   29
ident                     | |    |                  |   |   ||    
Sbjct drintvrgpitiseagFTLTHEHiCGSSagflrawpeffgsrkalAEKAVRGLRRAraag   60
DSSP  lleeelleeelhhhhlLEEEEELlEELLllhhhhlhhhhllhhhhHHHHHHHHHHHhhll


DSSP  LLEEEELLL-lLLLLHHHHHHHHHHLLLLEEEE---------------------------
Query PALLALTDH-dCTGGLAEAAAAAARRGIPFLNG---------------------------   61
ident                    |                                        
Sbjct VRTIVDVSTfdIGRDVSLLAEVSRAADVHIVAAtglwfdpplsmrlrsveeltqfflrei  120
DSSP  LLEEEELLLhhHLLLHHHHHHHHHHHLLEEELEeellllllhhhhlllhhhhhhhhhhhh


DSSP  -------------eEEEEEELleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhh
Query -------------vEVSVSWGrhtvhivglgidpaepalaaglksiregrlerarqmgas  108
ident                |                                            
Sbjct qygiedtgiragiiXVATTGK---------------------------------------  141
DSSP  hllllllllllleeEEELLLL---------------------------------------


DSSP  hhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLL
Query leaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQ  168
ident                                                             
Sbjct --------------------------------------------------------aTPF  145
DSSP  --------------------------------------------------------lLHH


DSSP  L-llHHHHHHHH-hHLLL---------------------------EEEELLHHHLLlLHH
Query W-asLEDAVGWI-vGAGG---------------------------MAVIAHPGRYDmGRT  199
ident     |  |                                        | |    |    
Sbjct QelvLKAAARASlaTGVPvtthtaasqrdgeqqaaifeseglspsRVCIGHSDDTD-DLS  204
DSSP  HhhhHHHHHHHHhhHLLLeeeellhhhlhhhhhhhhhhhllllhhHEEELLHHHLL-LHH


DSSP  HHHHHHHHhhhlllLEEEeEELL--------------------lLHHHHHHHHHHHHHHL
Query LIERLILDfqaaggQGIEvASGS--------------------hSLDDMHKFALHADRHG  239
ident     |           |                                       |   
Sbjct YLTALAAR-----gYLIG-LDHIpysaiglednasasallgirsWQTRALLIKALIDQGY  258
DSSP  HHHHHHHL-----lLEEE-ELLLllllllllllhhhhhhhllllHHHHHHHHHHHHHLLL


DSSP  L-eEEEELLLL----------LLLL-----lLLLLLL-------------llLLLLL---
Query L-yASSGSDFH----------APGE-----dVGHTED-------------lpPICRP---  267
ident         |                                                   
Sbjct MkqILVSNDWTfgfssyvtniMDVMdrvnpdGMAFIPlrvipflrekgvpqeTLAGItvt  318
DSSP  HhhEEELLLLLleellllllhHHHHhhhlllHHHHHHhlhhhhhhhllllhhHHHHHhlh


DSSP  HHHHLHHhlllllhhhl
Query IWRELEArilrpadaen  284
ident                  
Sbjct NPARFLS------ptlr  329
DSSP  HHHHHHL------llll


No 27: Query=2yb1A Sbjct=1onxA Z-score=6.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --lLEELLLLLLLLL-------lLLLHhhHHHHHHLLLLLEEEELLL-----lLLLLHHH
Query --aNIDLHFHSRTSD-------gALTPteVIDRAAARAPALLALTDH-----dCTGGLAE   46
ident     || | |                      |                        |  
Sbjct cpgFIDQHVHLIGGGgeagpttrTPEV--ALSRLTEAGVTSVVGLLGtdsisrHPESLLA  118
DSSP  eelEEEEEELLLLLLllllhhhlLLLL--LHHHHHHLLEEEEEELLLllllllLHHHHHH


DSSP  HHHHHHHLLLLEEEEE-EEEEEelleeeeeeeelllLLLHhhhhhhhhhhllhhhhhhhh
Query AAAAAARRGIPFLNGV-EVSVSwgrhtvhivglgidPAEPalaaglksiregrlerarqm  105
ident    |    ||          |                                       
Sbjct KTRALNEEGISAWMLTgAYHVP----srtitgsvekDVAI--------------------  154
DSSP  HHHHHHHHLLEEEEEEeLLLLL----lllllllhhhHHHH--------------------


DSSP  hhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllll
Query gasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyv  165
ident                                                             
Sbjct -------------------------------------------idrvigvxcaisdhrsa  171
DSSP  -------------------------------------------llleeeeeeeellllll


DSSP  lllllLHHHHHHHHHHLL------LEEEELLhhHLLLlhhHHHHHHHHHHH-----llLL
Query shqwaSLEDAVGWIVGAG------GMAVIAHpgRYDMgrtLIERLILDFQA-----agGQ  214
ident       |          |      |  |                 | |            
Sbjct apdvyHLANMAAESRVGGllggkpGVTVFHM--GDSK---KALQPIYDLLEncdvpisKL  226
DSSP  lllhhHHHHHHHHHHHHHhhhlllLEEEEEE--LLLL---LLLHHHHHHHHlllllhhHE


DSSP  EEEEeellLLHHHHHHHHHHHHHHLLEEE-----------------------------EE
Query GIEVasgsHSLDDMHKFALHADRHGLYAS-----------------------------SG  245
ident                  ||   | |                                   
Sbjct LPTH---vNRNVPLFEQALEFARKGGTIDitssidepvapaegiaravqagiplarvtLS  283
DSSP  EEEL---hHHLHHHHHHHHHHHHLLLLEEeellllllllhhhhhhhhhhllllhhheeEE


DSSP  LLLL--------------lLLLLL----------------lllllllllllLHHHHLHH-
Query SDFH--------------aPGEDV----------------ghtedlppicrPIWRELEA-  274
ident ||                                                      |   
Sbjct SDGNgsqpffddegnlthiGVAGFetlletvqvlvkdydfsisdalrpltsSVAGFLNLt  343
DSSP  LLLLleeeeellllleeeeEELLLhhhhhhhhhhhhhhlllhhhhhhhhlhHHHHHLLLl


DSSP  -hlllllHHHL------------------------------------
Query -rilrpaDAEN------------------------------------  284
ident                                                
Sbjct gkgeilpGNDAdllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  lllllllLLLLleeeellllleeeeeelleeeeelleelllllllll


No 28: Query=2yb1A Sbjct=2uz9A Z-score=6.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------lLEELLLLLlllLLLL---------------------------------LH
Query ---------aNIDLHFHSrtsDGAL---------------------------------TP   18
ident             | | |                                           
Sbjct lshheffmpgLVDTHIHA---SQYSfagssidlpllewltkytfpaehrfqnidfaeeVY  117
DSSP  llllleeeelEEEEEEEH---HHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHH


DSSP  HHHHHHHHLLLLLEEEELLllllllHHHHHHHHHHLLLLEEEE-----------------
Query TEVIDRAAARAPALLALTDhdctggLAEAAAAAARRGIPFLNG-----------------   61
ident | |  |                       |      |     |                 
Sbjct TRVVRRTLKNGTTTACYFAtihtdsSLLLADITDKFGQRAFVGkvcmdlndtfpeykett  177
DSSP  HHHHHHHHHLLEEEEEEELlllhhhHHHHHHHHHHHLLEEEEEleelllllllllllllh


DSSP  --------------------------EEEEEEelleeeeeeeellllllHHHHHHHHHhh
Query --------------------------VEVSVSwgrhtvhivglgidpaePALAAGLKSir   95
ident                                                    |    |   
Sbjct eesiketerfvsemlqknysrvkpivTPRFSL----------scsetlmGELGNIAKT--  225
DSSP  hhhhhhhhhhhhhhhhhlllleeeeeEELLHH----------hllhhhhHHHHHHHHH--


DSSP  llhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhh
Query egrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrk  155
ident                                                             
Sbjct --------------------------------------------------rdlhiqshis  235
DSSP  --------------------------------------------------hlleeeeeel


DSSP  lllllllllLLLL------llLHHHhhHHHHhlllEEEELLHHHllllhhhHHHHHHHHH
Query yltpgkpgyVSHQ------waSLEDavGWIVgaggMAVIAHPGRydmgrtlIERLILDFQ  209
ident                                      | ||                 | 
Sbjct enrdeveavKNLYpsyknytsVYDK-nNLLT---nKTVMAHGCY------lSAEELNVFH  285
DSSP  llhhhhhhhHHHLlllllhhhHHHH-lLLLL---lLEEEEELLL------lLHHHHHHHH


DSSP  HlLLLEEEEeELLLLH----HHHHhhHHHHHHHLLEEEEELLLLllllLLLL--LLLLLL
Query AaGGQGIEVaSGSHSL----DDMHkfALHADRHGLYASSGSDFHapgeDVGH--TEDLPP  263
ident    |  |        |           |    |      | |                  
Sbjct E-RGASIAH-CPNSNLslssGFLN--VLEVLKHEVKIGLGTDVA-ggySYSMldAIRRAV  340
DSSP  H-HLLEEEE-LHHHHHhlllLLLL--HHHHHHLLLEEEELLLLL-lllLLLHhhHHHHHH


DSSP  ------------------------lllLHHH--HLHHH----------------------
Query ------------------------icrPIWR--ELEAR----------------------  275
ident                                   |                         
Sbjct mvsnillinkvneksltlkevfrlatlGGSQalGLDGEignfevgkefdailinpkasds  400
DSSP  hhhhhhhhlllllllllhhhhhhhhlhHHHHhlLLLLLllllllllllleeeelllllll


DSSP  -----------------------------------lllllhhhl
Query -----------------------------------ilrpadaen  284
ident                                             
Sbjct pidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  llllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 29: Query=2yb1A Sbjct=4dlfA Z-score=5.9

back to top
DSSP  -lLEELLLLLL-----------lllllllhhHHHHHHHLLL----LLEEEELLLL----l
Query -aNIDLHFHSR-----------tsdgaltptEVIDRAAARA----PALLALTDHD----c   40
ident    || | |                         |                         
Sbjct alRIDSHQHFWryraadypwigagmgvlardYLPDALHPLMhaqaLGASIAVQARagrde   60
DSSP  llLEEEEELLLlllhhhllllllllhhhlllLLHHHHHHHHhhllLLEEEEELLLllhhh


DSSP  LLLHHHHHHhhhHLLLlEEEE------------------------EEEEEEelleeeeee
Query TGGLAEAAAaaaRRGIpFLNG------------------------VEVSVSwgrhtvhiv   76
ident |  | | |                                                    
Sbjct TAFLLELAC---DEARiAAVVgwedlrapqlaervaewrgtklrgFRHQLQ---------  108
DSSP  HHHHHHHHL---LLLLeEEEEellllllllhhhhhhlllllleeeEEELHH---------


DSSP  eellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhh
Query glgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthf  136
ident                                                             
Sbjct ------------------------------------------------------------  108
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllhhhhhhhlllllllllllLLLL--------------------------
Query arhlvdsgavkdmrtvfrkyltpgkpgyvsHQWA--------------------------  170
ident                                                             
Sbjct ----------------------------deADVRafvddadfargvawlqandyvydvlv  140
DSSP  ----------------------------hlLLHHhhhhlhhhhhhhhhhhhllleeeell


DSSP  ------lhHHHHHhhHHLLlEEEELLHHHLL--------lLHHHHHHHHHHHHHLLLLEE
Query ------slEDAVGwiVGAGgMAVIAHPGRYD--------mGRTLIERLILDFQAAGGQGI  216
ident                  |    |  | |                         |      
Sbjct ferqlpdvQAFCA-rHDAH-WLVLDHAGKPAlaefdrddtALARWRAALRELAALPHVVC  198
DSSP  lhhhhhhhHHHHH-hLLLL-LEEEHHHHLLLhhhllllllHHHHHHHHHHHHHLLLLEEE


DSSP  EEeELLL------------LHHHHHHHHHHHHHHLL--EEEEELLLL-lLLLL----lll
Query EVaSGSH------------SLDDMHKFALHADRHGL--YASSGSDFH-aPGED----vgh  257
ident    ||               |         |           |||               
Sbjct KL-SGLVteadwrrglrasDLRHIEQCLDAALDAFGpqRLMFGSDWPvcLLAAsydevas  257
DSSP  EE-LLLLllllllllllhhHHHHHHHHHHHHHHHHLhhHEEELLLLLhhHHLLlhhhhhh


DSSP  lLLLLL-----------lllLHHHHLHHHLllllhhhl
Query tEDLPP-----------icrPIWRELEARIlrpadaen  284
ident                            |          
Sbjct lVERWAesrlsaaersalwgGTAARCYALP--------  287
DSSP  hHHHHHhhhllhhhhhhhllHHHHHHLLLL--------


No 30: Query=2yb1A Sbjct=2imrA Z-score=5.8

back to top
DSSP  -------------------------------------------------------LLEE-
Query -------------------------------------------------------ANID-    4
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNa   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEe


DSSP  LLLLLL--------------------llLLLL--LHHHHHHHHHLLLLLEEEELLLllLL
Query LHFHSR--------------------tsDGAL--TPTEVIDRAAARAPALLALTDHdcTG   42
ident                                         |                   
Sbjct HTHLDMsayefqalpyfqwipevvirgrHLRGvaAAQAGADTLTRLGAGGVGDIVW-aPE  119
DSSP  EEELLLlhhhhhhlhhhhllhhhhhhhlLLLHhhHHHHHHHHHHHLLLLLEEEEEL-lHH


DSSP  LHHHHHHHhhhLLLLEEEEEEEEEEelleeeeeeeellllllHHHHHHHHhhhllhhhhh
Query GLAEAAAAaarRGIPFLNGVEVSVSwgrhtvhivglgidpaePALAAGLKsiregrlera  102
ident       |             ||                       ||             
Sbjct VMDALLAR---EDLSGTLYFEVLNP-----------fpdkadEVFAAART----------  155
DSSP  HHHHHHLL---LLLLEEEEEEELLL-----------lhhhhhHHHHHHHH----------


DSSP  hhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllll
Query rqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkp  162
ident                                                             
Sbjct ----------------------------------------hlerwrrlerpglrlglsph  175
DSSP  ----------------------------------------hhhhhhlllllleeeeeeel


DSSP  llllllllLHHHHHHHHHHLLLEEEELLHHHLLLL-------------------------
Query gyvshqwaSLEDAVGWIVGAGGMAVIAHPGRYDMG-------------------------  197
ident                   | |    |                                  
Sbjct tpftvshrLMRLLSDYAAGEGLPLQIHVAEHPTELemfrtgggplwdnrmpalyphtlae  235
DSSP  llllllhhHHHHHHHHHHHHLLLLEEEELLLHHHHhhhhhlllllhhhllhhhllllhhh


DSSP  --------hHHHHHHHH--HHHHlLLLEEEEeellllhhhhhhhHHHHHHHLLEEE----
Query --------rTLIERLIL--DFQAaGGQGIEVasgshslddmhkfALHADRHGLYAS----  243
ident              |        |                          | |        
Sbjct vigrepgpdLTPVRYLDelGVLA-ARPTLVH-----mvnvtpddIARVARAGCAVVtcpr  289
DSSP  hhlllllllLLHHHHHHhhLLHH-HLLEEEE-----lllllhhhHHHHHHHLLLEEelhh


DSSP  -----------------------EELLLLLllLLLLL----------------------L
Query -----------------------SGSDFHApgEDVGH----------------------T  258
ident                         | |  |  |                           
Sbjct snhhlecgtfdwpafaaagvevaLGTDSVAsgETLNVreevtfarqlypgldprvlvraA  349
DSSP  hhhhlllllllhhhhhhlllleeELLLLHHhhLLLLLhhhhhhhhhhlllllhhhhhhhH


DSSP  LLLlllllLHHH--------hlhhhlllllhhhl
Query EDLppicrPIWR--------elearilrpadaen  284
ident                                   
Sbjct VKG---gqRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  HHH---hhHHHLlllllllllllhhhlhhhllll


No 31: Query=2yb1A Sbjct=1gkpA Z-score=5.7

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------aNIDLHFH    8
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeelEEEEEEL


DSSP  LLLL----lLLLLHHHHHHHHHLLLLLEEEELLLL---------LLLLHHHHHHHHhhlL
Query SRTS----dGALTPTEVIDRAAARAPALLALTDHD---------CTGGLAEAAAAAarrG   55
ident             |       |                              |        
Sbjct IYLPfmatfAKDTHETGSKAALMGGTTTYIEMCCPsrnddalegYQLWKSKAEGNS---Y  117
DSSP  LLLEelleeLLLLHHHHHHHHHHLLEEEEEEEELLlllllhhhhHHHHHHHHLLLL---L


DSSP  LLEEEEEEEEEeelleeeeeeeellllllHHHHHhhhhhhllhhhhhhhhhhhhhhllll
Query IPFLNGVEVSVswgrhtvhivglgidpaePALAAglksiregrlerarqmgasleaagia  115
ident         ||                     |                            
Sbjct CDYTFHMAVSK------------fdekteGQLRE--------------------------  139
DSSP  LEEEEEEELLL------------llllhhHHHHH--------------------------


DSSP  lhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLLL----lL
Query gcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQW----aS  171
ident                                                             
Sbjct -----------------------------------ivadgissfxiflsyKNFFgvddgE  164
DSSP  -----------------------------------hhhlllleeeeeellLLLLlllhhH


DSSP  HHHHHHHHHHLLLEEEELlHHHL----------------------------LLLHhhHHH
Query LEDAVGWIVGAGGMAVIAhPGRY----------------------------DMGRtlIER  203
ident            |                                               |
Sbjct MYQTLRLAKELGVIVTAH-CENAelvgrlqqkllsegktgpewhepsrpeaVEAE-gTAR  222
DSSP  HHHHHHHHHHHLLEEEEE-ELLHhhhhhhhhhhhhlllllhhhllllllhhHHHH-hHHH


DSSP  HHHHHHHL-LLLEEEeeelLLLHHHHHHHHHHHHH--HLLEEE-----------------
Query LILDFQAA-GGQGIEvasgSHSLDDMHKFALHADR--HGLYAS-----------------  243
ident                      |       |  |       |                   
Sbjct FATFLETTgATGYVV----HLSCKPALDAAMAAKArgVPIYIEsviphflldktyaergg  278
DSSP  HHHHHHHHlLEEEEL----LLLLHHHHHHHHHHHHllLLEEEEeehhhhhllhhhhhllh


DSSP  --------------------------------EELLLLLLL-----------------LL
Query --------------------------------SGSDFHAPG-----------------ED  254
ident                                  | |                        
Sbjct veamkyimspplrdkrnqkvlwdalaqgfidtVGTDHCPFDteqkllgkeaftaipngIP  338
DSSP  hhhhlllllllllllhhhhhhhhhhhllllleEELLLLLLLhhhhhhhlllhhhllllLL


DSSP  LL------------------llllllllllLHHHHLHH----------------------
Query VG------------------htedlppicrPIWRELEA----------------------  274
ident                                                             
Sbjct AIedrvnllytygvsrgrldihrfvdaastKAAKLFGLfprkgtiavgsdadlvvydpqy  398
DSSP  LLllhhhhhhhhhlllllllhhhhhhhhlhHHHHHLLLlllllllllllllleeeeelll


DSSP  ---------------------------hlllLLHH-----------------------hl
Query ---------------------------rilrPADA-----------------------en  284
ident                                                             
Sbjct rgtisvktqhvnndyngfegfeidgrpsvvtVRGKvavrdgqfvgekgwgkllrrepmyf  458
DSSP  leellhhhllllllllllllleelleeeeeeELLEeeeelleelllllllllllllllll


No 32: Query=2yb1A Sbjct=2vc5A Z-score=5.7

back to top
DSSP  ----------------lLEELLLLLLLL------------llllLHHHHHHHHHLLL---
Query ----------------aNIDLHFHSRTS------------dgalTPTEVIDRAAARA---   29
ident                      | | |                                  
Sbjct mriplvgkdsieskdigFTLIHEHLRVFseavrqqwphlynedeEFRNAVNEVKRAMqfg   60
DSSP  llllllllllllhhhllLEELLLLLLLLlhhhhhhlhhhllhhhHHHHHHHHHHHHHhll


DSSP  LLEEEELLLL-llLLHHHHHHHHHHLLLLEEEeEEEEeEELLeeeeeeeellllllHHHH
Query PALLALTDHD-ctGGLAEAAAAAARRGIPFLNgVEVSvSWGRhtvhivglgidpaePALA   88
ident                           ||                                
Sbjct VKTIVDPTVMglgRDIRFMEKVVKATGINLVA-GTGIyIYIDlpfyflnrsideiaDLFI  119
DSSP  LLEEEELLLLlllLLHHHHHHHHHLLLLEEEE-LEELlLLLLllhhhllllhhhhhHHHH


DSSP  HHHHhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllll
Query AGLKsiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkd  148
ident    |                                                        
Sbjct HDIK--------------------------------------------------egiqgt  129
DSSP  HHHH--------------------------------------------------llllll


DSSP  hhhhhhhllllllllllllllLLHHHHHHHHHHLLLEEEELlHHHLLLlhhHHHHHHHHH
Query mrtvfrkyltpgkpgyvshqwASLEDAVGWIVGAGGMAVIAhPGRYDMgrtLIERLILDF  208
ident                           |                                 
Sbjct lnkagfvxiaadepgitkdveKVIRAAAIANKETKVPIITH-SNAHNN---TGLEQQRIL  185
DSSP  lllllleeeelllllllhhhhHHHHHHHHHHHHHLLLEEEE-LLLLLL---HHHHHHHHH


DSSP  HHLLL----LEEEeeellLLHHHHHHHhHHHHHHLLEE----------------------
Query QAAGG----QGIEvasgsHSLDDMHKFaLHADRHGLYA----------------------  242
ident    |       |         |            |                         
Sbjct TEEGVdpgkILIG---hlGDTDNIDYI-KKIADKGSFIgldrygldlflpvdkrnettlr  241
DSSP  HHLLLlhhhEEEL---lhHHLLLHHHH-HHHHHLLLEEeellllllllllhhhhhhhhhh


DSSP  ----------EEELLLLL----------------lLLLL---------------llllll
Query ----------SSGSDFHA----------------pGEDV---------------ghtedl  261
ident               |                                             
Sbjct likdgysdkiMISHDYCCtidwgtakpeykpklapRWSItlifedtipflkrngvneevi  301
DSSP  hhhlllllleEELLLLLLllllllllhhhhhhhllLLLLlhhhhlhhhhhhlllllhhhh


DSSP  llllllHHHHLHHhlllllhhhl
Query ppicrpIWRELEArilrpadaen  284
ident                        
Sbjct atifkeNPKKFFS----------  314
DSSP  hhhhlhHHHHHLL----------


No 33: Query=2yb1A Sbjct=1a4mA Z-score=5.6

back to top
DSSP  ------lLEELLLLLlllLLLL--------------------------------------
Query ------aNIDLHFHSrtsDGAL--------------------------------------   16
ident           || |    |||                                       
Sbjct tpafnkpKVELHVHL---DGAIkpetilyfgkkrgialpadtveelrniigmdkplslpg   57
DSSP  lllllllEEEEEEEH---HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhh


DSSP  ---------------------LHHHHHHHHHLLLLLEEEELLLL----------------
Query ---------------------TPTEVIDRAAARAPALLALTDHD----------------   39
ident                         |     |                             
Sbjct flakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqt  117
DSSP  hhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhll


DSSP  ---------llLLHHHHHHHHHHLLLLEEEEEEEEEEelleeeeeeeellllllhhhhHH
Query ---------ctGGLAEAAAAAARRGIPFLNGVEVSVSwgrhtvhivglgidpaepalaAG   90
ident                         ||                                  
Sbjct egdvtpddvvdLVNQGLQEGEQAFGIKVRSILCCMRH----------------qpswsLE  161
DSSP  lllllhhhhhhHHHHHHHHHHHHHLLEEEEEEEEELL----------------lhhhhHH


DSSP  HHHHhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhh
Query LKSIregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmr  150
ident                                                             
Sbjct VLEL-------------------------------------------------ckkynqk  172
DSSP  HHHH-------------------------------------------------hhhllll


DSSP  hhhhhlllllllllllllllLHHHHHHHHHHLLLEEEELlHHHLLLlHHHHHHHHHHHHh
Query tvfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAhPGRYDMgRTLIERLILDFQa  210
ident                         |    |  |        |                  
Sbjct tvvamdlagdetiegsslfpGHVEAYEGAVKNGIHRTVH-AGEVGS-PEVVREAVDILK-  229
DSSP  leeeeeeelllllllhhhlhHHHHHHHHHHHHLLEEEEE-ELLLLL-HHHHHHHHHLLL-


DSSP  llLLEEE----------------------EEEL-LLLH---------HHHHhhhhhhhhh
Query agGQGIE----------------------VASG-SHSL---------DDMHkfalhadrh  238
ident                                   |  |                      
Sbjct --TERVGhgyhtiedealynrllkenmhfEVCPwSSYLtgawdpkttHAVV----rfknd  283
DSSP  --LLEEEelhhhhhlhhhhhhhhhllleeEELHhHHHHlllllllllLHHH----hhhhl


DSSP  llEEEEELLLLLL-LLLL------------lllllllllllLHHH-HLHH------hlll
Query glYASSGSDFHAP-GEDV------------ghtedlppicrPIWR-ELEA------rilr  278
ident     |   |                                                   
Sbjct kaNYSLNTDDPLIfKSTLdtdyqmtkkdmgfteeefkrlniNAAKsSFLPeeekkeller  343
DSSP  llLEEELLLLLLLlLLLHhhhhhhhhhlllllhhhhhhhhhHHHHlLLLLhhhhhhhhhh


DSSP  llhhhl
Query padaen  284
ident       
Sbjct lyreyq  349
DSSP  hhhhll


No 34: Query=2yb1A Sbjct=3mtwA Z-score=5.6

back to top
DSSP  ----------------------------------------------------------lL
Query ----------------------------------------------------------aN    2
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeelE


DSSP  EELLLLLL--------------llllllLHHHHHHHHHLLLLLEEEELLllllLLHHHHH
Query IDLHFHSR--------------tsdgalTPTEVIDRAAARAPALLALTDhdctGGLAEAA   48
ident || | |                        |                             
Sbjct IDMHVHLDslaevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-aadYDDVGLR  119
DSSP  EEEEELLLllllllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-lllLHHHHHH


DSSP  HHHHH---llLLEEEE--------------------------------------------
Query AAAAR---rgIPFLNG--------------------------------------------   61
ident  |                                                          
Sbjct EAIDAgyvpgPRIVTAaisfgatgghcdstffppsmdqknpfnsdspdearkavrtlkky  179
DSSP  HHHHLlllllLEEEELllleellllllllllllhhhllllllllllhhhhhhhhhhhhhl


DSSP  ----EEEEEeelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllh
Query ----VEVSVswgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagc  117
ident                                                             
Sbjct gaqvIXICA---------------------------------------------------  188
DSSP  llleEEEEL---------------------------------------------------


DSSP  hhhhhlllllhhhlLHHHhhhhhhhllllllhhhhhhhLLLLllllllLLLLL--LHHHH
Query fdgamrwcdnpemiSRTHfarhlvdsgavkdmrtvfrkYLTPgkpgyvSHQWA--SLEDA  175
ident                                                   |         
Sbjct ------------tgGVFS--------------------RGNE----pgQQQLTyeEMKAV  212
DSSP  ------------llLLLL--------------------LLLL----llLLLLLhhHHHHH


DSSP  HHHHHHLLLEE-------------------EELLHHHLllLHHHHHHHHHHHhhlllLEE
Query VGWIVGAGGMA-------------------VIAHPGRYdmGRTLIERLILDFqaaggQGI  216
ident |     ||                       | |          |               
Sbjct VDEAHMAGIKVaahahgasgireavragvdTIEHASLV--DDEGIKLAVQKG-----AYF  265
DSSP  HHHHHHLLLEEeeeellhhhhhhhhhllllEEEELLLL--LHHHHHHHHHHL-----LEE


DSSP  EeeELLL----------------------------LHHHHHHHHHHHhhhllEEEEELLL
Query EvaSGSH----------------------------SLDDMHKFALHAdrhglYASSGSDF  248
ident                                          |              | | 
Sbjct S--MDIYntdytqaegkkngvlednlrkdrdigelQRENFRKALKAG----vKMVYGTDA  319
DSSP  E--LLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHL----lEEELLLLL


DSSP  LLllLLLL--LLLL-------lLLLL------lLHHH--HLHHH----------------
Query HApgEDVG--HTED-------lPPIC------rPIWR--ELEAR----------------  275
ident        |               |                                    
Sbjct GI--YPHGdnAKQFavmvrygaTPLQaiqsatlTAAEalGRSKDvgqvavgrygdmiava  377
DSSP  LL--LLLLlhHHHHhhhhhlllLHHHhhhhllhHHHHhhLLLLLllllllllllleeeel


DSSP  --------------llllLHHH----l
Query --------------ilrpADAE----n  284
ident                     |      
Sbjct gdpladvttlekpvfvmkGGAVvkapx  404
DSSP  llllllhhhhhllleeeeLLEEeelll


No 35: Query=2yb1A Sbjct=1j6pA Z-score=5.6

back to top
DSSP  ---------------------------------------------------lLEELLLL-
Query ---------------------------------------------------aNIDLHFH-    8
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpaLFNTHTHa   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeelEEEEEELh


DSSP  ------------------------llllllllLHHHHHHHHHLLL----LLEEEELLlll
Query ------------------------srtsdgalTPTEVIDRAAARA----PALLALTDhdc   40
ident                                         |         |         
Sbjct pxtllrgvaedlsfeewlfskvlpiedrltekXAYYGTILAQXEXarhgIAGFVDXY---  117
DSSP  hhhhhllllllllhhhhhhllhhhhhllllhhHHHHHHHHHHHHHhlllEEEEEEEE---


DSSP  lLLHHHHHHHHHHLLLLEEEE-----------------------------------EEEE
Query tGGLAEAAAAAARRGIPFLNG-----------------------------------VEVS   65
ident        | |    |   |                                        |
Sbjct -FHEEWIAKAVRDFGXRALLTrglvdsngddggrleenlklynewngfegrifvgfGPHS  176
DSSP  -LLHHHHHHHHHHHLLEEEEEeeelllllllllhhhhhhhhhhhhllhhhleeeeeEELL


DSSP  EEelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlll
Query VSwgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwc  125
ident                                                             
Sbjct PY----------------------------------------------------------  178
DSSP  LL----------------------------------------------------------


DSSP  llhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllLLLL--HHHHHHHHH-HL
Query dnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWAS--LEDAVGWIV-GA  182
ident                                                 |           
Sbjct ------------------------------------------LCSEeyLKRVFDTAKsLN  196
DSSP  ------------------------------------------LLLHhhHHHHHHHHHhHL


DSSP  LL--------------------------EEEELLHHHllLLHHhHHHHHHhhhhllLLEE
Query GG--------------------------MAVIAHPGRydMGRTlIERLILdfqaagGQGI  216
ident                                 ||                          
Sbjct APvtihlyetskeeydledilniglkevKTIAAHCVH--LPER-YFGVLK----diPFFV  249
DSSP  LLeeeeellllllllllhhhhlllllllLEEEEELLL--LLHH-HHHHHL----llLEEE


DSSP  EEEeLLLL--hhhhHHHHHHHHHHLLeEEEELLLLLllLLLLL--LLLLL----------
Query EVAsGSHS--lddmHKFALHADRHGLyASSGSDFHApgEDVGH--TEDLP----------  262
ident      |                        | |  |            |           
Sbjct SHNpASNLklgngiAPVQRXIEHGXK-VTLGTDGAAsnNSLNLffEXRLAsllqkaqnpr  308
DSSP  EELhHHHHhlllllLLHHHHHHLLLE-EEELLLLLLllLLLLHhhHHHHHhhhhhlllll


DSSP  ---------llllLHHH-HLHH--------------------------------------
Query ---------picrPIWR-ELEA--------------------------------------  274
ident                                                             
Sbjct nldvntclkxvtyDGAQaXGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsg  368
DSSP  lllhhhhhhhhlhHHHHhHLLLllllllllllleeeeelllhhhllhhhhhhhhhhllll


DSSP  --hlllLLHH---------------------------hl
Query --rilrPADA---------------------------en  284
ident        |                               
Sbjct evfatxVAGKwiyfdgeyptidseevkrelariekelys  407
DSSP  llleeeELLEeeeellllllllhhhhhhhhhhhhhhhhl


No 36: Query=2yb1A Sbjct=3mkvA Z-score=5.4

back to top
DSSP  ---------------------------------------------------------lLE
Query ---------------------------------------------------------aNI    3
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE


DSSP  ELLLLllllLLLL----------------lhhHHHHHHHLLLLLEEEELLlllllLHHHH
Query DLHFHsrtsDGAL----------------tptEVIDRAAARAPALLALTDhdctgGLAEA   47
ident ||| |                                   |                   
Sbjct DLHVH---vVAIEfnlprvatlpnvlvtlravPIMRAMLRRGFTTVRDAG----gAGYPF  113
DSSP  EEEEL---lLLLLllhhhhllllhhhhhhhhhHHHHHHHHLLEEEEEELL----lLLHHH


DSSP  HHHHH---HLLLLEEEE-------------------------------------------
Query AAAAA---RRGIPFLNG-------------------------------------------   61
ident   |       |                                                 
Sbjct KQAVEsglVEGPRLFVSgralsqtgghadprarsdymppdspcgccvrvgalgrvadgvd  173
DSSP  HHHHHlllLLLLEEEELlleeelllllllllllllllllllllllllllllleeelllhh


DSSP  ----------------EEEEEE---------eLLEEeeeeeellllllHHHHHhhhhhhl
Query ----------------VEVSVS---------wGRHTvhivglgidpaePALAAglksire   96
ident                      |          |                           
Sbjct evrravreelqmgadqIXIMASggvasptdpvGVFG--ysedeiraivAEAQG-------  224
DSSP  hhhhhhhhhhhhllllEEEELLllllllllllLLLL--llhhhhhhhhHHHHL-------


DSSP  lhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhl
Query grlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrky  156
ident                                                             
Sbjct ------------------------------------------------------------  224
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllhhhhhhhhhHLLL------------------eEEELLHHhllllH
Query ltpgkpgyvshqwasledavgwivGAGG------------------mAVIAHPGrydmgR  198
ident                                                  | |        
Sbjct ------------------------RGTYvlahaytpaaiaravrcgvRTIEHGN---liD  257
DSSP  ------------------------LLLLeeeeellhhhhhhhhhlllLEEEELL---llL


DSSP  HHHHHHHHHHHhlllLEEEEEELLL-----------------------LHHHhHHHHHHH
Query TLIERLILDFQaaggQGIEVASGSH-----------------------SLDDmHKFALHA  235
ident     ||                                                      
Sbjct DETARLVAEHG----AYVVPTLVTYdalasegekyglppesiakiadvHGAG-LHSIEIM  312
DSSP  HHHHHHHHHHL----LEEELLHHHHhhhhhhlllllllhhhhllhhhhHLLH-HHHHHHH


DSSP  HHHLLEEEEELLLLlLLLL-llLLLL--LLLLL---------llHHHH-LHHH-------
Query DRHGLYASSGSDFHaPGED-vgHTED--LPPIC---------rpIWRE-LEAR-------  275
ident  | |     | |            |   |                  | |          
Sbjct KRAGVKMGFGTDLL-GEAQrlqSDEFriLAEVLspaeviasatiVSAEvLGMQdklgriv  371
DSSP  HHHLLLLLLLLLLL-HHHHhhlLHHHhhHHLLLlhhhhhhhllhHHHHhLLLLlllllll


DSSP  ----------------------------------lllllhhhl
Query ----------------------------------ilrpadaen  284
ident                                            
Sbjct pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  lllllleeeellllllllllllllllllleeeelleeeeelll


No 37: Query=2yb1A Sbjct=2dvtA Z-score=5.3

back to top
DSSP  --lLEELLLLLLL-------------------llLLLLHH-HHHHHHHLLLLLEEEELLL
Query --aNIDLHFHSRT-------------------sdGALTPT-EVIDRAAARAPALLALTDH   38
ident       |  |                          |           |       |   
Sbjct mqgKVALEEHFAIpetlqdsagfvpgdywkelqhRLLDIQdTRLKLMDAHGIETMILSLN   60
DSSP  lllEEEEEEEELLhhhhhhhlllllllhhhhhhhHHHLLLlHHHHHHHHLLEEEEEEEEL


DSSP  L------------------lLLLHHHHHHHHHhllLLEEEE-------------------
Query D------------------cTGGLAEAAAAAArrgIPFLNG-------------------   61
ident                        |||  |        ||                     
Sbjct ApavqaipdrrkaieiarraNDVLAEECAKRP---DRFLAFaalplqdpdaateelqrcv  117
DSSP  LlhhhhlllhhhhhhhhhhhHHHHHHHHHHLL---LLEEEEellllllhhhhhhhhhhhh


DSSP  -------EEEEEEelleeeeeeeellllllhhhhhhhhhhhllhhhHHHHHhhhhhhlll
Query -------VEVSVSwgrhtvhivglgidpaepalaaglksiregrleRARQMgasleaagi  114
ident          |                                                  
Sbjct ndlgfvgALVNGF--------------------------------sQEGDG---------  136
DSSP  hllllleEEEELL--------------------------------lLLLLL---------


DSSP  llhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllLLLLLL---l
Query agcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyVSHQWA---s  171
ident                                                             
Sbjct --------------------------------------------------QTPLYYdlpq  146
DSSP  --------------------------------------------------LLLLLLllhh


DSSP  hhhhhhHHHHLLLEE---------------------------------------------
Query ledavgWIVGAGGMA---------------------------------------------  186
ident                                                             
Sbjct yrpfwgEVEKLDVPFylhprnplpqdsriydghpwllgptwafaqetavhalrlmasglf  206
DSSP  hhhhhhHHHHHLLLEeeelllllhhhlhhhlllhhhlhhhlhhhhhhhhhhhhhhhllhh


DSSP  --------EELL-HHHLlLLHHH-------------------hHHHHHHHhhlllLEEEe
Query --------VIAH-PGRYdMGRTL-------------------iERLILDFqaaggQGIEv  218
ident            |                                             |  
Sbjct dehprlniILGHmGEGLpYMMWRidhrnawvklpprypakrrfMDYFNEN-----FHIT-  260
DSSP  hhllllleEELHhHLLHhHHHHHhhhllllllllllllllllhHHHHHHH-----EEEE-


DSSP  EELLLLHHHHHHHHHHHHhhlLEEEEELLLLLlllLLLL--------lllllLLLL----
Query ASGSHSLDDMHKFALHADrhgLYASSGSDFHApgeDVGH--------tedlpPICR----  266
ident  ||           |             |         |                     
Sbjct TSGNFRTQTLIDAILEIG--aDRILFSTDWPF--eNIDHasdwfnatsiaeaDRVKigrt  316
DSSP  LLLLLLHHHHHHHHLLLL--hHHEELLLLLLL--lLHHHhhhhhhhllllhhHHHHhhlh


DSSP  LHHHHLHHhlllllhhhl
Query PIWRELEArilrpadaen  284
ident    |              
Sbjct NARRLFKL---------d  325
DSSP  HHHHHLLL---------l


No 38: Query=2yb1A Sbjct=3irsA Z-score=5.1

back to top
DSSP  -LLEELLLL-----LLLLLLL-----------------------llhhhhhhhHHLLLLL
Query -ANIDLHFH-----SRTSDGA-----------------------ltptevidrAAARAPA   31
ident    ||                                                 ||    
Sbjct lKIIDFRLRppamgFLNARIYtrpdirnrftrqlgfepapsaeekslelmfeeMAAAGIE   60
DSSP  lLLEELLLLlllhhHHHLHHHhlhhhhhhhhhhhlllllhhhhhllhhhhhhhHHHLLLL


DSSP  EEEELLLL----llLLHHHHHHHHHHLLLLEEEEeeeeeeelleeeeeeeelllllLHHH
Query LLALTDHD----ctGGLAEAAAAAARRGIPFLNGvevsvswgrhtvhivglgidpaEPAL   87
ident                  |  || |      |                           | 
Sbjct QGVCVGRNssvlgsVSNADVAAVAKAYPDKFHPV------------gsieaatrkeAMAQ  108
DSSP  EEEEELLEellleeLLHHHHHHHHHHLLLLEEEE------------eelllllhhhHHHH


DSSP  HH-----------hhhhHHLLhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhh
Query AA-----------glksIREGrlerarqmgasleaagiagcfdgamrwcdnpemisrthf  136
ident                                                             
Sbjct MQeildlgirivnlepgVWAT---------------------------------------  129
DSSP  HHhhhhllllleeelhhHLLL---------------------------------------


DSSP  hhhhhhllllllhhhhhhhlllllllllllLLLLL--hhhhhHHHH--HLLL--------
Query arhlvdsgavkdmrtvfrkyltpgkpgyvsHQWAS--ledavGWIV--GAGG--------  184
ident                                                             
Sbjct ------------------------------PMHVDdrrlyplYAFCedNGIPvimmtggn  159
DSSP  ------------------------------LLLLLlhhhhhhHHHHhhLLLLeeeellll


DSSP  -----------------------EEEELLHHHLLllhHHHHHHHHHHHhllLLEEEeeEL
Query -----------------------MAVIAHPGRYDmgrTLIERLILDFQaagGQGIEvaSG  221
ident                          |  |          |                    
Sbjct agpditytnpehidrvlgdfpdlTVVSSHGNWPW--vQEIIHVAFRRP---NLYLS-pDM  213
DSSP  llllhhhhlhhhhhhhhhhllllLEEEEHHHLLL--hHHHHHHHHHLL---LEEEE-lHH


DSSP  LLLHH-HHHHHHHHHHHH-LLEEEEELLLLlllLLLL-------lllllLLLL-----lL
Query SHSLD-DMHKFALHADRH-GLYASSGSDFHapgEDVG-------htedlPPIC-----rP  267
ident           |   |          |                        |         
Sbjct YLYNLpGHADFIQAANSFlADRMLFGTAYP---MCPLkeytewfltlpiKPDAmekilhG  270
DSSP  HHLLLlLHHHHHHHHLLHhHHLLLLLLLLL---LLLHhhhhhhhhllllLHHHhhhhhlH


DSSP  HHHH-LHHHlllllhhhl
Query IWRE-LEARilrpadaen  284
ident      |            
Sbjct NAERlLAQA-------gr  281
DSSP  HHHHhHHHL-------ll


No 39: Query=2yb1A Sbjct=3icjA Z-score=5.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  lLEELLLLLllllLLLL-------------------------------------------
Query aNIDLHFHSrtsdGALT-------------------------------------------   17
ident    | | |                                                    
Sbjct aFFDSHLHL---dELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
DSSP  lEEEEEELH---hHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   17
ident                                                             
Sbjct redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiine  177
DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhh


DSSP  -----------hhHHHHHHHLLLLLEEEELLllLLLLHHHHHHH--hhHLLLLEEEEE--
Query -----------ptEVIDRAAARAPALLALTDhdCTGGLAEAAAA--aaRRGIPFLNGV--   62
ident                                      |          |           
Sbjct kiltvkdykhyieSAQEHLLSLGVHSVGFMS-vGEKALKALFELeregRLKMNVFAYLsp  236
DSSP  llllhhhhhhhhhHHHHHHHHLLEEEEEEEE-eLHHHHHHHHHHhhllLLLLEEEEEElh


DSSP  ------------------------EEEEEelleeeeeeeellllllhhhhhhhhhhhllh
Query ------------------------EVSVSwgrhtvhivglgidpaepalaaglksiregr   98
ident                            |                                
Sbjct elldkleelnlgkfegrrlriwgvXLFVD-------------------------------  265
DSSP  hhhhhhhhhlllleellleeeeeeEEELL-------------------------------


DSSP  hhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllL
Query lerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkylT  158
ident                                                             
Sbjct ----------------------------------------------gslgartallsepY  279
DSSP  ----------------------------------------------lllllllllllllL


DSSP  LLLLLLLLLLLL---LHHHHHHHHHHLLLEE------------------------EELLH
Query PGKPGYVSHQWA---SLEDAVGWIVGAGGMA------------------------VIAHP  191
ident    |                       |                            | | 
Sbjct TDNPTTSGELVMnkdEIVEVIERAKPLGLDVavhaigdkavdvaldafeeaefsgRIEHA  339
DSSP  LLLLLLLLLLLLlhhHHHHHHHHHLLLLLEEeeeellhhhhhhhhhhhhhhllllEEEEL


DSSP  hHLLLLhHHHHHHHHHhhhlllLEEEeEELLLL-----------------hhHHHHHHHH
Query gRYDMGrTLIERLILDfqaaggQGIEvASGSHS-----------------ldDMHKFALH  234
ident           ||            |  |                                
Sbjct -SLVRD-DQLERIKEL-----kVRIS-AQPHFIvsdwwivnrvgeerakwayRLKTLSSI  391
DSSP  -LLLLH-HHHHHHHHH-----lLEEE-ELLLHHhhlllhhhhhhhhhhhhllLHHHHHHH


DSSP  HhhhllEEEEELLLLLlllLLLL----------------------lLLLL--llllLHHH
Query AdrhglYASSGSDFHApgeDVGH----------------------tEDLP--picrPIWR  270
ident             |                                               
Sbjct T-----KLGFSTDSPI--ePADPwvsidaavnryvvdpgervsreeALHLythgsaQVTL  444
DSSP  L-----LEEELLLLLL--lLLLHhhhhhhhhhlllllhhhlllhhhHHHHllhhhhHHLL


DSSP  hLHHH-----------lllllhhhl
Query eLEAR-----------ilrpadaen  284
ident   |                      
Sbjct -AEDLgklergfraeyiildrdplk  468
DSSP  -LLLLlllllllllleeeellllll


No 40: Query=2yb1A Sbjct=3e74A Z-score=5.0

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------aNIDLHFH    8
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeelEEEEEEL


DSSP  LlllllllLHHHHHHHHHLLLLLEEEELLL-----LLLL--lhhhhhhhhhHLLLLEEEE
Query SrtsdgalTPTEVIDRAAARAPALLALTDH-----DCTG--glaeaaaaaaRRGIPFLNG   61
ident                 ||                                    |     
Sbjct I-------GYETGTRAAAKGGITTXIEXPLnqlpaTVDRasielkfdaakgKLTIDAAQL  113
DSSP  L-------LHHHHHHHHHHLLEEEEEELLLlllllLLLHhhhhhhhhhhllLLLLEEEEL


DSSP  EEE------------------------EEEElleeeeeeeellllllhhhhhhhhhhhll
Query VEV------------------------SVSWgrhtvhivglgidpaepalaaglksireg   97
ident                             |                               
Sbjct GGLvsynidrlheldevgvvgfxcfvrDVND-----------------------------  144
DSSP  EELlllllllhhhhhhhlllleeeellLLLH-----------------------------


DSSP  hhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhll
Query rlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyl  157
ident                                                             
Sbjct ------------------------------------------------------------  144
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllLHHHHHHHHHHLLLEEEELlHHHLL----------------------
Query tpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAhPGRYD----------------------  195
ident                          |                                  
Sbjct ------------wQFFKGAQKLGELGQPVLVH-CENALicdelgeeakregrvtahdyva  191
DSSP  ------------hHHHHHHHHHHHHLLLEEEE-LLLHHhhhhhhhhhhhhllllhhhhhh


DSSP  -----LLHHHHHHHHHHHHHL-LLLEEEEeellllhhHHHHHHHHHHHHL-----LEEE-
Query -----MGRTLIERLILDFQAA-GGQGIEVasgshsldDMHKFALHADRHG-----LYAS-  243
ident           | |       |                          |            
Sbjct srpvfTEVEAIRRVLYLAKVAgCRLHVCH-------vSSPEGVEEVTRARqegqdITCEs  244
DSSP  lllhhHHHHHHHHHHHHHHHHlLLEEELL-------lLLHHHHHHHHHHHhllllEEEEe


DSSP  ---------------------------------------------EELLLLLL-------
Query ---------------------------------------------SGSDFHAP-------  251
ident                                                ||           
Sbjct cphyfvldtdqfeeigtlakcsppirdlenqkgxweklfngeidcLVSDHSPCppexkag  304
DSSP  llhhhhllhhhhhhhlhhhllllllllhhhhhhhhhhhhllllleELLLLLLLlllllll


DSSP  --------LLLL-----------------lllllllllllLHHHHLHH------------
Query --------GEDV-----------------ghtedlppicrPIWRELEA------------  274
ident                                                             
Sbjct nixkawggIAGLqscxdvxfdeavqkrgxslpxfgklxatNAADIFGLqqkgriapgkda  364
DSSP  llllllllLLLHhhhhhhhhhhhlllllllhhhhhhhhlhHHHHHLLLllllllllllll


DSSP  -------------------------------------------------------hllll
Query -------------------------------------------------------rilrp  279
ident                                                             
Sbjct dfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgq  424
DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllllll


DSSP  lhhhl
Query adaen  284
ident      
Sbjct filkh  429
DSSP  eelll


No 41: Query=2yb1A Sbjct=4ofcA Z-score=4.8

back to top
DSSP  LLEELLLLLLL--------------------------------------lllLLLHHHHH
Query ANIDLHFHSRT--------------------------------------sdgALTPTEVI   22
ident   || | |                                               |   |
Sbjct MKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
DSSP  LLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH


DSSP  HHHHLLLLLEEEELLL------------------lLLLLHHHHHHHHHhllLLEEEEE--
Query DRAAARAPALLALTDH------------------dCTGGLAEAAAAAArrgIPFLNGV--   62
ident            ||                          ||            |      
Sbjct REMDQKGVTVQALSTVpvmfsywakpedtlnlcqlLNNDLASTVVSYP---RRFVGLGtl  117
DSSP  HHHHHHLLLEEEEELLhhhhlllllhhhhhhhhhhHHHHHHHHHHHLL---LLEEEEEll


DSSP  ------------------------EEEEEELLEeeeeeeellllllhhhhhhhhhhhllh
Query ------------------------EVSVSWGRHtvhivglgidpaepalaaglksiregr   98
ident                                                             
Sbjct pmqapelavkemercvkelgfpgvQIGTHVNEW---------------------------  150
DSSP  llllhhhhhhhhhhhhhllllleeEEELEELLE---------------------------


DSSP  hhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlll
Query lerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkylt  158
ident                                                             
Sbjct ------------------------------------------------------------  150
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllhhhHHHHHHHLLLEEEEL-----------------lhhHLLLlhhHH
Query pgkpgyvshqwasledAVGWIVGAGGMAVIA-----------------hpgRYDMgrtLI  201
ident                                                             
Sbjct -------dlnaqelfpVYAAAERLKCSLFVHpwdmqmdgrmakywlpwlvgMPAE-ttIA  202
DSSP  -------elllhhhhhHHHHHHHHLLEEEEElllllllhhhhlllhhhhlhHHHH-hhHH


DSSP  HHHHH-----hhhHLLLL------------------------------------------
Query ERLIL-----dfqAAGGQ------------------------------------------  214
ident                                                             
Sbjct ICSMImggvfekfPKLKVcfahgggafpftvgrishgfsmrpdlcaqdnpmnpkkylgsf  262
DSSP  HHHHHlllhhhhlLLLLEeelhhhllhhhhhhhhhhhhhhlhhhhlllllllhhhhllll


DSSP  EEEEEelLLLHHHHHHHHHHHHhhllEEEEELLLLLLlllllLLLLL--------lLLLL
Query GIEVAsgSHSLDDMHKFALHADrhglYASSGSDFHAPgedvgHTEDL--------pPICR  266
ident         |                     | |   |                       
Sbjct YTDAL--VHDPLSLKLLTDVIG--kdKVILGTDYPFPlgelePGKLIesmeefdeeTKNK  318
DSSP  EEELL--LLLHHHHHHHHHHHL--llLEELLLLLLLLlllllLLHHHhhlllllhhHHHH


DSSP  ---LHHHH-LHHHlllllhhhl
Query ---PIWRE-LEARilrpadaen  284
ident          |            
Sbjct lkaGNALAfLGLE-----rkqf  335
DSSP  hhlHHHHHhHLLL-----hhhl


No 42: Query=2yb1A Sbjct=2qpxA Z-score=4.7

back to top
DSSP  ------------LLEELLLLL---------------------------------------
Query ------------ANIDLHFHS---------------------------------------    9
ident                | | |                                        
Sbjct gxddlsefvdqvPLLDHHCHFlidgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
DSSP  lllllhhhhhhlLEEEEEELLllllllllhhhhhhhhlllllllllhhhhlllhhhhhhh


DSSP  --------------llllllllhhhhhhhhHLLLLLEEEELLL-lllllhHHHHHHHHHL
Query --------------rtsdgaltptevidraAARAPALLALTDH-dctgglAEAAAAAARR   54
ident                                      |                  |   
Sbjct alakefaldannplaaxndpgyatynhrifGHFHFKELLIDTGfvpddpiLDLDQTAELV  120
DSSP  hhhhhhllllllllllllhhhhhhhhhhhhHHLLEEEEEEELLlllllllLLHHHHHHHH


DSSP  LLLEEEEEEEEeeelleeeeeeeellllllhhhhhhHHHHHLL-----------------
Query GIPFLNGVEVSvswgrhtvhivglgidpaepalaagLKSIREG-----------------   97
ident |||                                                         
Sbjct GIPVKAIYRLE-------------------------THAEDFXlehdnfaawwqafsndv  155
DSSP  LLLEEEEEEHH-------------------------HHHHHHHlllllhhhhhhhhhhhh


DSSP  ----------------------------------hHHHHHHHHhhhhhlllllhhhhhhl
Query ----------------------------------rLERARQMGasleaagiagcfdgamr  123
ident                                                             
Sbjct kqakahgfvgfxsiaayrvglhlepvnvieaaagfDTWKHSGE-----------------  198
DSSP  hllllllllleeelhhhhlllllllllhhhhhhhhHHHHHHLL-----------------


DSSP  llllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLLL-lLHHHHHHHHHHL
Query wcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQW-aSLEDAVGWIVGA  182
ident                                                  |      |   
Sbjct -------------------------------------krltsKPLIdyXLYHVAPFIIAQ  221
DSSP  -------------------------------------lllllHHHHhhHHHHHHHHHHHH


DSSP  LLEEEeLLHHH------LLLL-hhHHHHHHHHHHHLLLLEEEEeelLLLHhHHHHHHHHH
Query GGMAViAHPGR------YDMG-rtLIERLILDFQAAGGQGIEVasgSHSLdDMHKFALHA  235
ident        | |          |   |       |   |                      |
Sbjct DXPLQ-FHVGYgdadtdXYLGnplLXRDYLKAFTKKGLKVVLL---HCYP-YHREAGYLA  276
DSSP  LLLEE-EEELLllllllHHHLlhhHHHHHHHHHHHHLLLEEEE---ELLL-LHHHHHHHH


DSSP  HHHL-LEEE-----------------------------eELLLLLLlLLLL---------
Query DRHG-LYAS-----------------------------sGSDFHAPgEDVG---------  256
ident      ||                                 ||     |  |         
Sbjct SVFPnLYFDislldnlgpsgasrvfneavelapytrilfASDASTYpEXYGlaarqfkqa  336
DSSP  HHLLlEEEElllhhhhlhhhhhhhhhhhlllllhhheelLLLLLLLhHHHHhhhhhhhhh


DSSP  ----------------llllllllllLHHHHLHHhlllllhhhl
Query ----------------htedlppicrPIWRELEArilrpadaen  284
ident                                             
Sbjct lvahfnqlpfvdlaqkkawinaicwqTSAKLYHQ----erelrv  376
DSSP  hhhhhhllllllhhhhhhhhhhhhlhHHHHHLLL----hhhhll


No 43: Query=2yb1A Sbjct=1itqA Z-score=4.6

back to top
DSSP  --------------LLEELLLLLLlllLLLL------------------hhhhhHHHHL-
Query --------------ANIDLHFHSRtsdGALT------------------pteviDRAAA-   27
ident                 || |         |                              
Sbjct dffrdeaerimrdsPVIDGHNDLP---WQLLdmfnnrlqderanlttlagthtnIPKLRa   57
DSSP  lhhhhhhhhhhlllLEEEEEELHH---HHHHhhhllllllhhhlllllllllllHHHHHh


DSSP  LLLLEEEELLLL---------------lLLLHHHHHHhHHHL-----------------L
Query RAPALLALTDHD---------------cTGGLAEAAAaAARR-----------------G   55
ident                                                             
Sbjct GFVGGQFWSVYTpcdtqnkdavrrtleqMDVVHRMCRmYPETflyvtssagirqafregK  117
DSSP  LLEEEEEEEELLlhhhllllhhhhhhhhHHHHHHHHHhLLLLeeelllhhhhhhhhhllL


DSSP  LLEEEEEEEEEeelleeeeeeeellllllHHHHHhhhhhhllhhhhhhhhhhhhhhllll
Query IPFLNGVEVSVswgrhtvhivglgidpaePALAAglksiregrlerarqmgasleaagia  115
ident    | |||                       | |                          
Sbjct VASLIGVEGGH------------sidsslGVLRA--------------------------  139
DSSP  EEEEEEEELHH------------hllllhHHHHH--------------------------


DSSP  lhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllLLLL----
Query gcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWAS----  171
ident                                                             
Sbjct -------------------------------------lyqlgmryltlthscNTPWadnw  162
DSSP  -------------------------------------hhhlleeeeelllllLLLLlllh


DSSP  -----------------HHHHHHHHHHLLLEEEELLhhhllllhhhHHHHHHHHHHLL--
Query -----------------LEDAVGWIVGAGGMAVIAHpgrydmgrtlIERLILDFQAAG--  212
ident                      |      |     ||                        
Sbjct lvdtgdsepqsqglspfGQRVVKELNRLGVLIDLAH---------vSVATMKATLQLSra  213
DSSP  hhlllllllllllllhhHHHHHHHHHHHLLEEELLL---------lLHHHHHHHHHHLll


DSSP  lLEEEeeellLLHH------HHHH-HHHHHHHHLLEEE----------------------
Query gQGIEvasgsHSLD------DMHK-FALHADRHGLYAS----------------------  243
ident                                                             
Sbjct pVIFS---hsSAYSvcasrrNVPDdVLRLVKQTDSLVMvnfynnyisctnkanlsqvadh  270
DSSP  lLEEL---llLLLLllllllLLLHhHHHHHHHHLLEEEelllhhhhlllllllhhhhhhh


DSSP  --------------EELLLL-LLLL-----LLLL---------------lllllllllLH
Query --------------SGSDFH-APGE-----DVGH---------------tedlppicrPI  268
ident                | ||   |       ||                            
Sbjct ldhikevagaravgFGGDFDgVPRVpegleDVSKypdliaellrrnwteaevkgaladNL  330
DSSP  hhhhhhhllhhheeELLLLLlLLLLlllllLLLLhhhhhhhhhhllllhhhhhhhhlhHH


DSSP  HHHLH-----------------------hhlllllhhhl
Query WRELE-----------------------arilrpadaen  284
ident  |  |                                  
Sbjct LRVFEaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHHHHhhhhllllllllllllllhhhlllllllllllll


No 44: Query=2yb1A Sbjct=4qrnA Z-score=4.6

back to top
DSSP  --------------LLEELLLLLLL-----------------------------------
Query --------------ANIDLHFHSRT-----------------------------------   11
ident                 |       |                                   
Sbjct smtqdlktggeqgyLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllllLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  -llLLLLhhHHHH-HHHLLL----LLEEEEL-LLLL--------------llLHHHHHHH
Query -sdGALTptEVID-RAAARA----PALLALT-DHDC--------------tgGLAEAAAA   50
ident               |  |           |                           | |
Sbjct tqiLERL--LDLGeRRIADMdatgIDKAILAlTSPGvqplhdldeartlatrANDTLADA  118
DSSP  hhhHHHH--HLLLhHHHHHHhhllLLEEEEEeLLLLllllllhhhhhhhhhhHHHHHHHH


DSSP  HHHLL-LLEEEE------eeeeeeelleeeeeeeeLLLLllhhhhhhhhhHHLLhhhhhh
Query AARRG-IPFLNG------vevsvswgrhtvhivglGIDPaepalaaglksIREGrlerar  103
ident            |                                         |      
Sbjct CQKYPdRFIGMGtvapqdpewsareihrgarelgfKGIQ--------insHTQG------  164
DSSP  HHHLLlLEEELLllllllhhhhhhhhhhhhhllllLLEE--------ellLLLL------


DSSP  hhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllll
Query qmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpg  163
ident                                                             
Sbjct ------------------------------------------------------------  164
DSSP  ------------------------------------------------------------


DSSP  llllLLLL---hHHHHHHHHHLLLE-----------------------------------
Query yvshQWAS---lEDAVGWIVGAGGM-----------------------------------  185
ident                    |                                        
Sbjct ----RYLDeeffDPIFRALVEVDQPlyihpatspdsmidpmleagldgaifgfgvetgmh  220
DSSP  ----LLLLlhhhHHHHHHHHHHLLLeeellllllllllhhhhhhlllllllhhhhhhhhh


DSSP  -----------------EEELL-HHHLlLLHH------------------------HHHH
Query -----------------AVIAH-PGRYdMGRT------------------------LIER  203
ident                      |                                      
Sbjct llrlitigifdkypslqIMVGHmGEALpYWLYrldymhqagvrsqryermkplkktIEGY  280
DSSP  hhhhhhhlhhhhlllllEEELHhHHLHhHHHHhhhhhhhhhhhlllllllllllllHHHH


DSSP  hhhhhhhllLLEEEeEELLLLHHHHHHHHHHHHhhlLEEEEELLLLL------lllllll
Query lildfqaagGQGIEvASGSHSLDDMHKFALHADrhgLYASSGSDFHA------pgedvgh  257
ident                 ||                         |                
Sbjct ------lksNVLVT-NSGVAWEPAIKFCQQVMG--eDRVMYAMDYPYqyvadevramdam  331
DSSP  ------hhhLEEEE-LLLLLLHHHHHHHHHHHL--hHHEELLLLLLLlllhhhhhhhhll


DSSP  lllllLLLL----LHHHHLHHhlllllhhhl
Query tedlpPICR----PIWRELEArilrpadaen  284
ident                                
Sbjct dmsaqTKKKffqtNAEKWFKL----------  352
DSSP  lllhhHHHHhhlhHHHHHLLL----------


No 45: Query=2yb1A Sbjct=3griA Z-score=4.5

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------aNIDLHFH    8
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeelEEEEEEL


DSSP  -LLLLL-lLLLHHHHHHHHHLLLLLEEEELLL---------llllLHHHHHHHHHhllLL
Query -SRTSD-gALTPTEVIDRAAARAPALLALTDH---------dctgGLAEAAAAAArrgIP   57
ident           |       ||                                 |      
Sbjct lREPGGeyKETIETGTKAAARGGFTTVCPXPNtrpvpdsvehfeaLQKLIDDNAQ---VR  117
DSSP  lLLLLLllLLLHHHHHHHHHHLLEEEEEELLLlllllllhhhhhhHHHHHHHHLL---LE


DSSP  EEEEeeeeeeelleeeeeeeellllllhhhhhHHHHHHLLhhhhhhhhhhhhhhlllllh
Query FLNGvevsvswgrhtvhivglgidpaepalaaGLKSIREGrlerarqmgasleaagiagc  117
ident  |                                                          
Sbjct VLPY--------------------------asITTRQLGK--------------------  131
DSSP  ELLL--------------------------eeLLHHHLLL--------------------


DSSP  hhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLLLLLhhhhhh
Query fdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQWASledavg  177
ident                                                             
Sbjct ------------------------elvdfpalvkegafaftddgvgvqTASXXY-egxie  166
DSSP  ------------------------llllhhhhhlllllleeellllllLHHHHH-hhhhh


DSSP  hhhHLLL---------------------------------------------------eE
Query wivGAGG---------------------------------------------------mA  186
ident                                                             
Sbjct aakVNKAivahcednsliyggaxhegkrskelgipgipnicesvqiardvllaeaagchY  226
DSSP  hhhHLLLeeellllhhhllllleellhhhhhhllleellhhhhhhhhhhhhhhhhhlllE


DSSP  EELLHHhllllHHHHHHHHHHHH-HLLLlEEEEeELLLLHH-------------------
Query VIAHPGrydmgRTLIERLILDFQ-AAGGqGIEVaSGSHSLD-------------------  226
ident    |                           ||    | |                    
Sbjct HVCHVS----tKESVRVIRDAKRaGIHV-TAEV-TPHHLLLteddipgnnaiykxnpplr  280
DSSP  EELLLL----lHHHHHHHHHHHHlLLLE-EEEE-LHHHHHLlhhhlllllhhhlllllll


DSSP  ---hHHHHHHHHHHHLLEEeEELLLLLLL---------------LLLL------------
Query ---dMHKFALHADRHGLYAsSGSDFHAPG---------------EDVG------------  256
ident                        |                                    
Sbjct stedREALLEGLLDGTIDC-IATDHAPHArdekaqpxekapfgiVGSEtafpllythfvk  339
DSSP  lhhhHHHHHHHHHLLLLLE-ELLLLLLLLhhhhlllllllllllLLLLlhhhhhhhhhll


DSSP  -----llllllllllLHHH--HLHH-----------------------------------
Query -----htedlppicrPIWR--ELEA-----------------------------------  274
ident                       ||                                    
Sbjct ngdwtlqqlvdyltiKPCEtfNLEYgtlkengyadltiidldseqeikgedflskadntp  399
DSSP  lllllhhhhhhhhlhHHHHhlLLLLlllllllllleeeeelllleellhhhlllllllll


DSSP  -----------hllLLLH--hhl
Query -----------rilRPAD--aen  284
ident                        
Sbjct figykvygnpiltxVEGEvkfeg  422
DSSP  lllleelleeeeeeELLEeeeel


No 46: Query=2yb1A Sbjct=4b3zD Z-score=4.5

back to top
DSSP  -----------------------------------------------------lLEELLL
Query -----------------------------------------------------aNIDLHF    7
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipgGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeelEEEEEE


DSSP  LllllLLLLlhhHHHHHHHLLL----LLEEEELL-----llllLLHHHHHHHHHH-LLLL
Query HsrtsDGALtptEVIDRAAARA----PALLALTD-----hdctGGLAEAAAAAAR-RGIP   57
ident                      |                             ||       
Sbjct Y---lQKTA--aDDFFQGTRAAlvggTTMIIDHVvpepgssllTSFEKWHEAADTkSCCD  115
DSSP  L---lLLLL--lLLHHHHHHHHhhllEEEEEEEElllllllhhHHHHHHHHHHHLlLLLE


DSSP  EEEEEEEE---------------------------------EEELleeeeeeeellllll
Query FLNGVEVS---------------------------------VSWGrhtvhivglgidpae   84
ident     |                                     |                 
Sbjct YSLHVDITswydgvreelevlvqdkgvnsfqvymaykdvyqMSDS---------------  160
DSSP  EEEEEELLlllllhhhhhhhhhhllllleeeeellllllllLLHH---------------


DSSP  hhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhll
Query palaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsg  144
ident                                                             
Sbjct ------------------------------------------------------------  160
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhlllllllllllllllLHHHHHHHHHHLLLEEEELlHHHLL---------
Query avkdmrtvfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAhPGRYD---------  195
ident                            |  |     | |           |         
Sbjct --------------------------QLYEAFTFLKGLGAVILVH-AENGDliaqeqkri  193
DSSP  --------------------------HHHHHHHHHHHHLLEEEEE-LLLHHhhhhhhhhh


DSSP  ------------------llhHHHHHHHHHHHHL-LLLEEEEEellllhhHHHHHHHHHH
Query ------------------mgrTLIERLILDFQAA-GGQGIEVAsgshsldDMHKFALHAD  236
ident                          | |           |               |    
Sbjct lemgitgpeghalsrpeeleaEAVFRAITIAGRInCPVYITKV-------MSKSAADIIA  246
DSSP  hhllllllhhhhhhllhhhhhHHHHHHHHHHHHHlLLEEEEEE-------LLHHHHHHHH


DSSP  HHL-----LEEE------------------------------------------------
Query RHG-----LYAS------------------------------------------------  243
ident                                                             
Sbjct LARkkgplVFGEpiaaslgtdgthywsknwakaaafvtspplspdpttpdyltsllacgd  306
DSSP  HHHhhlllEEEEelhhhhhlllhhhhlllhhhhhhllllllllllllhhhhhhhhhhhll


DSSP  ---EELLLLLLL-----------------LLLL------------------lllllllll
Query ---SGSDFHAPG-----------------EDVG------------------htedlppic  265
ident     ||                                                      
Sbjct lqvTGSGHCPYStaqkavgkdnftlipegVNGIeermtvvwdkavatgkmdenqfvavts  366
DSSP  lllLLLLLLLLLhhhhhhhlllhhhllllLLLLllhhhhhhhhhlllllllhhhhhhhhl


DSSP  llhHHHLHH---------------------------------------------------
Query rpiWRELEA---------------------------------------------------  274
ident                                                             
Sbjct tnaAKIFNLyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplv  426
DSSP  hhhHHHHLLlllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeee


DSSP  -----------------------------------------hlllllhhhl
Query -----------------------------------------rilrpadaen  284
ident                                                    
Sbjct visqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  eeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll


No 47: Query=2yb1A Sbjct=4c5yA Z-score=4.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -lLEELLLLL-------------lllllllLHHHHHHHHHLLL---LLEEEELLlllllL
Query -aNIDLHFHS-------------rtsdgalTPTEVIDRAAARA---PALLALTDhdctgG   43
ident     | | |                                                   
Sbjct pgLWDCHMHFggdddyyndytsglathpasSGARLARGCWEALqngYTSYRDLA----gY  116
DSSP  elEEEEEELLllllllllllhhhhhllhhhHHHHHHHHHHHHHhllEEEEEELL----lL


DSSP  HHHHHHHHH---HLLLLEEEEeeeeeeelleeeeeeeellllllhhhhhhhhhhhllHHH
Query LAEAAAAAA---RRGIPFLNGvevsvswgrhtvhivglgidpaepalaaglksiregRLE  100
ident   | | |       |                                             
Sbjct GCEVAKAINdgtIVGPNVYSS--------------------------------gaalSQT  144
DSSP  HHHHHHHHHlllLLLLEEEEL--------------------------------lleeELL


DSSP  HhhhhhhhhhhllllLHHHHHHLLL-----------llhHHLL-------------hhhh
Query RarqmgasleaagiaGCFDGAMRWC-----------dnpEMIS-------------rthf  136
ident                                          |                  
Sbjct A-------ghgdifaLPAGEVLGSYgvmnprpgywgagpLCIAdgveevrravrlqirrg  197
DSSP  L-------lllllllLLHHHHHHHHllllllllllllllEEELllhhhhhhhhhhhhhhl


DSSP  hhhhhhllllllhhHHHHhlllllllllllLLLL-------------------------L
Query arhlvdsgavkdmrTVFRkyltpgkpgyvsHQWA-------------------------S  171
ident                                                             
Sbjct akvixvmasggvmsRDDN----pnfaqfspEELKviveeaarqnrivsahvhgkagimaA  253
DSSP  llleeeelllllllLLLL----lllllllhHHHHhhhhhhhhlllleeeeellhhhhhhH


DSSP  HHHHHhhhhhllleEEELLHHhllllhhhHHHHHHHHHHlLLLEEEEEELLLL-------
Query LEDAVgwivgaggmAVIAHPGrydmgrtlIERLILDFQAaGGQGIEVASGSHS-------  224
ident                   |           |          |                  
Sbjct IKAGC---------KSLEHVS------yaDEEVWELMKE-KGILYVATRSVIEiflasng  297
DSSP  HHHLL---------LEEEELL------llLHHHHHHHHH-HLLEEELLHHHHHhhhhhll


DSSP  --------------hhhhHHHHHHHHHHLLEEEEELLLLlllllllLLLL--LLLLL---
Query --------------lddmHKFALHADRHGLYASSGSDFHapgedvgHTED--LPPIC---  265
ident                    |    |   |     | |           |           
Sbjct eglvkeswaklqaladshLKAYQGAIKAGVTIALGTDTA--pggptALELqfAVERGgmt  355
DSSP  llllllhhhlllhhhhhhHHHHHHHHHLLLLEELLLLLL--lllllHHHHhhHHHLLlll


DSSP  --------llHHHH-LHHHL-----------------------------------lllLH
Query --------rpIWRE-LEARI-----------------------------------lrpAD  281
ident                                                             
Sbjct pleaikaataNAPLsVGPQApltgqlregyeadvialeenpledikvfqepkavthvwKG  415
DSSP  hhhhhhhhllLHHHhHHHHLllllllllllllleeeelllllllhhhhhlhhheeeeeEL


DSSP  HH------------------l
Query AE------------------n  284
ident                      
Sbjct GKlfkgpgigpwgedarnpfl  436
DSSP  LEeeellllllllllllllll


No 48: Query=2yb1A Sbjct=2ogjA Z-score=4.5

back to top
DSSP  --------------------------------------------------------lLEE
Query --------------------------------------------------------aNID    4
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE


DSSP  LLLLL---lLLLLLllhhhHHHHH-HLLLLLEEEELLllllllHHHHHH-HHHHLLLLEE
Query LHFHS---rTSDGAltpteVIDRA-AARAPALLALTDhdctggLAEAAA-AAARRGIPFL   59
ident || |     |               | |    |                           
Sbjct LHVHIwhggTDISI-----RPSECgAERGVTTLVDAGsageanFHGFREyIIEPSRERIK  115
DSSP  EEELLllllLLLLL-----LHHHLlHHHLEEEEEEELllllllHHHHHHhLLLLLLLEEE


DSSP  EE-----------------------------------------EEEEEEelleeeeeeee
Query NG-----------------------------------------VEVSVSwgrhtvhivgl   78
ident                                              |  |           
Sbjct AFlnlgsiglvacnrvpelrdikdidldrilecyaensehivgLXVRAS--hvitgswgv  173
DSSP  EEeelllllllllllllllllhhhllhhhhhhhhhllllleeeEEEEEL--hhhhlllll


DSSP  llllllhHHHHhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhh
Query gidpaepALAAglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfar  138
ident          |                                                  
Sbjct tpvklgkKIAK-------------------------------------------------  184
DSSP  hhhhhhhHHHH-------------------------------------------------


DSSP  hhhhllllllhhhhhhhllllllllllLLLL---lLHHHHHhhhhhlllEEEELLHHHLL
Query hlvdsgavkdmrtvfrkyltpgkpgyvSHQW---aSLEDAVgwivgaggMAVIAHPGRYD  195
ident                                     ||             |  |     
Sbjct ----------------ilkvpxxvhvgEPPAlydeVLEILG-------pGDVVTHCFNGK  221
DSSP  ----------------hhllleeeeelLLLLlhhhHHHHLL-------lLLEEELLLLLL


DSSP  -----LLHHHHHHHHHHHHhllLLEEEeEELL---LLHHHHHHHH-HHHHhhlleEEEEL
Query -----MGRTLIERLILDFQaagGQGIEvASGS---HSLDDMHKFA-LHADrhglyASSGS  246
ident              |        |             |                   |   
Sbjct sgssiXEDEDLFNLAERCE---GIRLD-IGHGgasFSFKVAEAAIaRGLL----pFSIST  273
DSSP  lllllLLLHHHHHHHHHLL---LLEEE-LLLLlllLLHHHHHHHHhLLLL----lLLLLL


DSSP  LLLL---LLLL--lllLLLLL------LLLL-----lHHHH--LHHH-------------
Query DFHA---PGED--vghTEDLP------PICR-----pIWRE--LEAR-------------  275
ident | |             |                                           
Sbjct DLHGhsxNFPVwdlatTXSKLlsvdxpFENVveavtrNPASviRLDXenrldvgqradft  333
DSSP  LLLLlllLLLLllhhhHHHHHhhllllHHHHhhlllhHHHHhlLLLLlllllllllleee


DSSP  -------------------------------------lllllhhhl
Query -------------------------------------ilrpadaen  284
ident                                               
Sbjct vfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 49: Query=2yb1A Sbjct=4rdvB Z-score=4.3

back to top
DSSP  -------------------------------------------------lLEELLLLLL-
Query -------------------------------------------------aNIDLHFHSR-   10
ident                                                      || |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpgMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeelEEEEEELHHh


DSSP  ----------------------------llllllLHHHHHHHH-HLLL---LLEEEELLL
Query ----------------------------tsdgalTPTEVIDRA-AARA---PALLALTDH   38
ident                                                        |    
Sbjct ramaglaevagnpndsfwtwrelmyrmvarlspeQIEVIACQLyIEMLkagYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhHHHHHHHHHhHHHHhhlEEEEEEEEL


DSSP  -----------lllLLHHHHHHHHHHLLLLEEEEEEEE-eeELLEeeeeeeellllllhh
Query -----------dctGGLAEAAAAAARRGIPFLNGVEVS-vsWGRHtvhivglgidpaepa   86
ident                       ||   ||                               
Sbjct vhhdldgrsyadpaELSLRISRAASAAGIGLTLLPVLYshaGFGG---------------  165
DSSP  llllllllllllllHHHHHHHHHHHHHLLEEEEEELLLleeELLL---------------


DSSP  hhhhhhhhhLLHHhhhhhhhhhhhhlllllhhhhhhlllllhHHLL-hhhhhhhhhhlll
Query laaglksirEGRLerarqmgasleaagiagcfdgamrwcdnpEMIS-rthfarhlvdsga  145
ident                                                             
Sbjct --------qPASE-----------------------------GQRRfingseaylellqr  188
DSSP  --------eELLH-----------------------------HHLLllllhhhhhhhhhh


DSSP  lllhhhhhhhllllllllllllllLLHHHHHHHhhHLLLEEEeLLHHH--LLLL------
Query vkdmrtvfrkyltpgkpgyvshqwASLEDAVGWivGAGGMAViAHPGR--YDMG------  197
ident                                             |               
Sbjct lrapleaaghslglcfhslravtpQQIATVLAA-gHDDLPVH-IHIAEqqKEVDdcqaws  246
DSSP  hhhhhhhhlleeleeelllllllhHHHHHHHLL-lLLLLLEE-EEELLlhHHHHhhhhhh


DSSP  -HHHHHHHHHHHHhlllLEEEEeellllhhHHHH---hHHHHHHHLLEEE----------
Query -RTLIERLILDFQaaggQGIEVasgshsldDMHK---fALHADRHGLYAS----------  243
ident  |     |                        |          | |  |           
Sbjct gRRPLQWLYENVAvdqrWCLVH--------ATHAdpaeVAAMARSGAVAGlclsteanlg  298
DSSP  lLLHHHHHHHHLLllllEEEEE--------LLLLlhhhHHHHHHHLLEEEelhhhhhhll


DSSP  -----------------EELLLLLL--------------------------lllllllll
Query -----------------SGSDFHAP--------------------------gedvghted  260
ident                   ||| |                                     
Sbjct dgifpatdflaqggrlgIGSDSHVSlsvveelrwleygqrlrdrkrnrlyrddqpmigrt  358
DSSP  lllllhhhhhhllleeeELLLLLLLllhhhhhhhhhhhhhhhhlllllllllllllhhhh


DSSP  llllllLHHHH--LHHH-------------------------------------------
Query lppicrPIWRE--LEAR-------------------------------------------  275
ident                                                             
Sbjct lydaalAGGAQalGQPIgslavgrradllvldgndpylasaegdallnrwlfaggdrqvr  418
DSSP  hhhhhhHHHHHhhLLLLlllllllllleeeellllhhhhllllhhhhhhhhhhllhhhee


DSSP  lllLLHH------------------------hl
Query ilrPADA------------------------en  284
ident     |                            
Sbjct dvmVAGRwvvrdgrhageersarafvqvlgell  451
DSSP  eeeELLEeeelllllllhhhhhhhhhhhhhhhl


No 50: Query=2yb1A Sbjct=3giqA Z-score=4.3

back to top
DSSP  --------------------------------------------------------lLEE
Query --------------------------------------------------------aNID    4
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapgFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeelEEE


DSSP  LLLLLlllllllLHHH---hHHHHHLLLLLEEEEL-lLLLLL------------------
Query LHFHSrtsdgalTPTE---vIDRAAARAPALLALT-dHDCTG------------------   42
ident  | |                                                        
Sbjct VHGHD------dLMFVekpdLRWKTSQGITTVVVGncGVSAApaplpgntaaalallget  114
DSSP  LLLLL------lLHHHhlllLHHHHLLLEEEEEELllLLLLLlllllllllhhhhhhlll


DSSP  --------LHHH-hhHHHHhllLLEEEEEEEEeeelleeeeeeeellllllhhhhhhhhH
Query --------GLAE-aaAAAArrgIPFLNGVEVSvswgrhtvhivglgidpaepalaaglkS   93
ident           |           |     |                               
Sbjct plfadvpaYFAAldaQRPM---INVAALVGHA--------------------------nL  145
DSSP  lllllhhhHHHHhhhLLLL---LEEEEEEEHH--------------------------hH


DSSP  HHLLHHHhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhh
Query IREGRLErarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvf  153
ident                                                             
Sbjct RLAAMRD-----------------------------------------------------  152
DSSP  HHHHLLL-----------------------------------------------------


DSSP  hhlllllllllLLLL------------------------------------llLHHHHHH
Query rkyltpgkpgyVSHQ------------------------------------waSLEDAVG  177
ident                                                       ||    
Sbjct ----------pQAAPtaaeqqamqdmlqaaleagavgfstglayqpgavaqaaELEGLAR  202
DSSP  ----------lLLLLlhhhhhhhhhhhhhhhhhllleeeeelllllhhhllhhHHHHHHH


DSSP  HHHHLLLEEEELlHHHLL-LLHHHHHHHHHHHHHL-LLLEEE--eeellllhHHHHHHHH
Query WIVGAGGMAVIAhPGRYD-MGRTLIERLILDFQAA-GGQGIE--vasgshslDDMHKFAL  233
ident                          |                                  
Sbjct VAAERRRLHTSH-IRNEAdGVEAAVEEVLAIGRGTgCATVVShhkcmmpqnwGRSRATLA  261
DSSP  HHHHLLLEEEEE-LLLLLlLHHHHHHHHHHHHHHHlLEEEELllllllhhhlLLHHHHHH


DSSP  HHHHHL-----LEEE---------------------------------------------
Query HADRHG-----LYAS---------------------------------------------  243
ident   ||                                                        
Sbjct NIDRAReqgveVALDiypypgsstiliperaetiddiritwstphpecsgeyladiaarw  321
DSSP  HHHHHHhllllEEEEelllleeeeellhhhllllllleeeeelllhhhllllhhhhhhhh


DSSP  ------------------------------------EELLLLL----LLLLL--------
Query ------------------------------------SGSDFHA----PGEDV--------  255
ident                                      |||       |            
Sbjct gcdkttaarrlapagaiyfamdedevkrifqhpccmVGSDGLPndarPHPRLwgsftrvl  381
DSSP  lllhhhhhhhhlleeeeeelllhhhhhhhhhllleeELLLLLLllllLLLHHhhhhhhhh


DSSP  ----------lllllllllllLHHH-HLHH------------------------------
Query ----------ghtedlppicrPIWR-ELEA------------------------------  274
ident                         |    |                              
Sbjct gryvrearlmtleqavarmtaLPARvFGFAergvlqpgawadvvvfdpdtvadratwdep  441
DSSP  hhhhhhlllllhhhhhhhhlhHHHHhHLLLlllllllllllleeeellllllllllllll


DSSP  -------hlllLLHH-----------------hl
Query -------rilrPADA-----------------en  284
ident               |                   
Sbjct tlasvgiagvlVNGAevfpqppadgrpgqvlrax  475
DSSP  lllllleeeeeELLEeeellllllllllllllll


No 51: Query=2yb1A Sbjct=1a5kC Z-score=4.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------lLEELLLLlllllLLLLhhHHHHHHHLLLLLEEEEL-----------LLLL--
Query -------aNIDLHFHsrtsdGALTptEVIDRAAARAPALLALT-----------DHDC--   40
ident          || | |                |                            
Sbjct egkivtagGIDTHIH-----WICP--QQAEEALVSGVTTMVGGgtgpaagthatTCTPgp  173
DSSP  llleeeelEEEEEEE-----LLLL--LHHHHHHHHLEEEEEEElllllhhhhhlLLLLhh


DSSP  ---lLLHHHhHHHHhhlLLLEEEEE---------------------EEEE--EELLeeee
Query ---tGGLAEaAAAAarrGIPFLNGV---------------------EVSV--SWGRhtvh   74
ident       |   |                                   |             
Sbjct wyisRMLQA-ADSL---PVNIGLLGkgnvsqpdalreqvaagviglEIHEdwGATP----  225
DSSP  hhhhHHHHH-HLLL---LLEEEEEEelllllhhhhhhhhhhllleeEEEHhhLLLH----


DSSP  eeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhh
Query ivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrt  134
ident                                                             
Sbjct ------------------------------------------------------------  225
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllhhhhhhhlllllllllllllllLHHHHHHHHHHLLLEE--------
Query hfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMA--------  186
ident                                         |                   
Sbjct -----------------------------------aAIDCALTVADEMDIQValhsdtln  250
DSSP  -----------------------------------hHHHHHHHHHHHHLLEEeeelllll


DSSP  -----------------EELLHHH---LLLLHhhhhhHHHHhhhlllLEEEeEELLLLH-
Query -----------------VIAHPGR---YDMGRtlierLILDfqaaggQGIEvASGSHSL-  225
ident                     |                                       
Sbjct esgfvedtlaaiggrtiHTFHTEGaggGHAPDiitacAHPN------ILPS-STNPTLPy  303
DSSP  llllhhhhhhhhlllleEELLLLLlllLLLLLhhhhhHLLL------EEEE-EEHHHLLl


DSSP  ---------------------------------------HHHHHHHHHHhhhlleEEEEL
Query ---------------------------------------DDMHKFALHAdrhglyASSGS  246
ident                                               | |          |
Sbjct tlntidehldmlmvchhldpdiaedvafaesrirretiaAEDVLHDLGA-----fSLTSS  358
DSSP  lllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhhHHHHHHHLLL-----lLEEEL


DSSP  LLLLlllLLLLLL--------------------------llLLLL-----lLHHH--HLH
Query DFHApgeDVGHTE--------------------------dlPPIC-----rPIWR--ELE  273
ident |  |    ||                                                  
Sbjct DSQA-mgRVGEVIlrtwqvahrmkvqrgalaeetgdndnfrVKRYiakytiNPALthGIA  417
DSSP  LLLL-llLLLLHHhhhhhhhhhhhhhhlllllllllllhhhHHHHhhlllhHHHHhlLLL


DSSP  HHL-------------------------llLLHH--------------------------
Query ARI-------------------------lrPADA--------------------------  282
ident                                                             
Sbjct HEVgsievgkladlvvwspaffgvkpatviKGGMiaiapmgdinasiptpqpvhyrpmfg  477
DSSP  LLLlllllllllleeeelhhhlllllleeeELLEeeeeeellllllllllllleeeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  282
ident                                                             
Sbjct algsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvda  537
DSSP  hlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeell


DSSP  ---------------------------hl
Query ---------------------------en  284
ident                              
Sbjct qtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllleeelleellllllllllllllllll


No 52: Query=2yb1A Sbjct=3ooqA Z-score=4.2

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------aNIDLHFH    8
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL


DSSP  ------------lLLLL----------llLLHHH---hhhhHHLLLLLEEEELLL----L
Query ------------sRTSD----------gaLTPTE---vidrAAARAPALLALTDH----D   39
ident                                          | |                
Sbjct iglfeegvgyyysDGNEatdpvtphvkalDGFNPqdpaierALAGGVTSVXIVPGsanpV  120
DSSP  lllllllllhhhlLLLLllllllllllhhHHLLLllhhhhhHHLLLEEEEEELLLllllE


DSSP  LLLlhhhhhhhHHHL-----llleeEEEEEEEEelleeeeeeeellllllhhhhhhhhhH
Query CTGglaeaaaaAARR-----gipflNGVEVSVSwgrhtvhivglgidpaepalaaglksI   94
ident                           |                                 
Sbjct GGQ---gsvikFRSIiveecivkdpAGLKXAFG-------------------------eN  152
DSSP  EEE---eeeeeLLLLlhhhheeeeeEEEEEELL-------------------------hH


DSSP  HLLHHHHHHHhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhh
Query REGRLERARQmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfr  154
ident          |                                                  
Sbjct PKRVYGERKQ--------------------------------------------------  162
DSSP  HHHHHHHLLL--------------------------------------------------


DSSP  hlllllllllLLLL----------------------------------------------
Query kyltpgkpgyVSHQ----------------------------------------------  168
ident            |                                                
Sbjct ---------tPSTRxgtagvirdyftkvknyxkkkelaqkegkeftetdlkxevgexvlr  213
DSSP  ---------lLLLHhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllhhhhhhhhhhl


DSSP  -----------llLHHHHHHHH--hHLLLeeEELLHHhllllhhhHHHHHHHHHHlLLLE
Query -----------waSLEDAVGWI--vGAGGmaVIAHPGrydmgrtlIERLILDFQAaGGQG  215
ident                  |       |     || |                         
Sbjct kkiparxhahradDILTAIRIAeefGFNL--VIEHGT-------eAYKISKVLAE-KKIP  263
DSSP  lllleeeeellhhHHHHHHHHHhhhLLLE--EEEELL-------lHHHHHHHHHH-HLLL


DSSP  EEEeELLLL--------hHHHHhHHHHHHHHLLEEEEELLLLllllLLLLLL--------
Query IEVaSGSHS--------lDDMHkFALHADRHGLYASSGSDFHapgeDVGHTE--------  259
ident   |                            |       |                    
Sbjct VVV-GPLLTfrtklelkdLTXE-TIAKLLKDGVLIALXCDHP--viPLEFATvqaataxr  319
DSSP  EEE-LLLLLllllhhhllLLLL-HHHHHHHLLLLEEELLLLL--llLHHHHHhhhhhhhh


DSSP  --llLLLL-----lLHHH--HLHHHL----------------------------lLLLH-
Query --dlPPIC-----rPIWR--ELEARI----------------------------lRPAD-  281
ident                      || ||                                  
Sbjct ygakEEDLlkiltvNPAKilGLEDRIgsiepgkdadlvvwsghpfdxksvvervyIDGVe  379
DSSP  hlllHHHHhhlllhHHHHhlLLLLLLlllllllllleeeelllllllllleeeeeELLEe


DSSP  --hhl
Query --aen  284
ident      
Sbjct vfrre  384
DSSP  eeell


No 53: Query=2yb1A Sbjct=3pnuA Z-score=4.2

back to top
DSSP  -------------LLEELLLLLLLlllllLHHHHHHHHHLlLLLEEEELLL---------
Query -------------ANIDLHFHSRTsdgalTPTEVIDRAAArAPALLALTDH---------   38
ident                 | | | |               |                     
Sbjct enlyfqsnamklkNPLDMHLHLRD---nqMLELIAPLSAR-DFCAAVIMPNlipplcnle   56
DSSP  llllllllleeeeLLEEEEELLLL---hhHHHHHHHHHHL-LLLEEEELLLlllllllhh


DSSP  llllLHHHHHHHHHHLLLLEEEEE--------------------EEEEEelleeeeeeee
Query dctgGLAEAAAAAARRGIPFLNGV--------------------EVSVSwgrhtvhivgl   78
ident            |        |                                       
Sbjct dlkaYKMRILKACKDENFTPLMTLffknydekflysakdeifgiXLYPA-----------  105
DSSP  hhhhHHHHHHHHHLLLLLEEEEEEelllllhhhhhhhllllleeEELLL-----------


DSSP  llllllhhhhhhHHHHhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhh
Query gidpaepalaagLKSIregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfar  138
ident                                                             
Sbjct -------gittnSNGG--------------------------------------------  114
DSSP  -------lllllLLLL--------------------------------------------


DSSP  hhhhllllllhhhhhhhlllllllllllllLLLH-----hhhHHHHHHLLLEEEEL---l
Query hlvdsgavkdmrtvfrkyltpgkpgyvshqWASL-----edaVGWIVGAGGMAVIA---h  190
ident                                 |                           
Sbjct ------------------------------VSSFdieylkptLEAMSDLNIPLLVHgetn  144
DSSP  ------------------------------LLLLlhhhhhhhHHHHHHLLLLEEELllll


DSSP  hhhlLLLHhHHHHHHHHHHHLL---LLEE-------------------EEEELLLL----
Query pgryDMGRtLIERLILDFQAAG---GQGI-------------------EVASGSHS----  224
ident     |                                                 |     
Sbjct dfvmDRES-NFAKIYEKLAKHFprlKIVMehittktlcellkdyenlyATITLHHLiitl  203
DSSP  llhhHLLH-HHHHHHHHHHHHLlllLEEElllllhhhhhhhhhllleeEEELLHHHlllh


DSSP  -----------------------HHHHHHHHhhhhhhllEEEEELLLLLLL------LLL
Query -----------------------LDDMHKFAlhadrhglYASSGSDFHAPG------EDV  255
ident                               |            |||              
Sbjct ddviggkmnphlfckpiakryedKEALCELA---fsgyeKVMFGSDSAPHPkgcaagVFS  260
DSSP  hhhhlllllhhhllllllllhhhHHHHHHHH---hllllLEEELLLLLLLLllllllLLL


DSSP  L----------------llllllllllLHHHHLHH-------------------------
Query G----------------htedlppicrPIWRELEA-------------------------  274
ident                                                             
Sbjct ApvilpvlaelfkqnsseenlqkflsdNTCKIYDLkfkedkiltleekewqvpnvyedky  320
DSSP  HhhhhhhhhhhhhhhllhhhhhhhhlhHHHHHHLLlllllleeeeellleelllleelll


DSSP  --------hlllllhhhl
Query --------rilrpadaen  284
ident                   
Sbjct nqvvpymageilkfqlkh  338
DSSP  leellllllleelleell


No 54: Query=2yb1A Sbjct=1bksA Z-score=4.0

back to top
DSSP  ----------------LLEEllLLLLL-lllllLHHHHHHHHHLLlllEEEELLL-----
Query ----------------ANIDlhFHSRT-sdgalTPTEVIDRAAARapaLLALTDH-----   38
ident                       |                    |                
Sbjct meryenlfaqlndrreGAFV-pFVTLGdpgieqSLKIIDTLIDAG--aDALELGVpfsdp   57
DSSP  lhhhhhhhhhhhhlllLEEE-eEEELLlllhhhHHHHHHHHHHLL--lLLEEEELlllll


DSSP  ----------------------lllLLHHHHHHHHHhlllLEEEEEE-------------
Query ----------------------dctGGLAEAAAAAArrgiPFLNGVE-------------   63
ident                            ||               |               
Sbjct ladgptiqnanlrafaagvtpaqcfEMLALIREKHP----TIPIGLLmyanlvfnngida  113
DSSP  llllhhhhhhhhhhhhhlllhhhhhHHHHHHHHHLL----LLLEEEEelhhhhhlllhhh


DSSP  --------------EEEEElleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhh
Query --------------VSVSWgrhtvhivglgidpaepalaaglksiregrlerarqmgasl  109
ident               |                                             
Sbjct fyarceqvgvdsvlVADVP-----------------------------------------  132
DSSP  hhhhhhhhllleeeELLLL-----------------------------------------


DSSP  hhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllll
Query eaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqw  169
ident                                                             
Sbjct -----------------------------------------------------------v  133
DSSP  -----------------------------------------------------------h


DSSP  lLHHHHHHHHHHLLLEEEElLHHHlLLLHhHHHHHHHHHHhllLLEEEEeellllhHHHH
Query aSLEDAVGWIVGAGGMAVIaHPGRyDMGRtLIERLILDFQaagGQGIEVasgshslDDMH  229
ident                                  |                         |
Sbjct eESAPFRQAALRHNIAPIF-ICPP-NADD-DLLRQVASYG---RGYTYL-----laLPLH  182
DSSP  hHLHHHHHHHHHLLLEEEE-EELL-LLLH-HHHHHHHHHL---LLLEEE-----llLLHH


DSSP  HHHHHHHHHL-LEEEE---------------------ELLL-LLLLLlllllllllllll
Query KFALHADRHG-LYASS---------------------GSDF-HAPGEdvghtedlppicr  266
ident              |                        |                     
Sbjct HLIEKLKEYHaAPALQgfgisspeqvsaavragaagaISGSaIVKII-----eknlaspk  237
DSSP  HHHHHHHHHLlLLEEEllllllhhhhhhhhhhllleeEELLhHHHHH-----hhllllhh


DSSP  lhhhhlhhhlllllhhhl
Query piwrelearilrpadaen  284
ident                   
Sbjct qmlaelrsfvsamkaasr  255
DSSP  hhhhhhhhhhhhhhhlll


No 55: Query=2yb1A Sbjct=1j5sA Z-score=3.8

back to top
DSSP  -------------------------lLEELLLLLlllllllLHHHH--------------
Query -------------------------aNIDLHFHSrtsdgalTPTEV--------------   21
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdlpIVDPHNHL-------DAKDIvenkpwndiweveg   53
DSSP  llllllllllllhhhhhhhhhhllllEEELLLLL-------LHHHHhhllllllhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   21
ident                                                             
Sbjct atdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnik  113
DSSP  lllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllll


DSSP  ------------------------hhhhhllllleeeELLLLLLLlHHHHHHHHHHLL-L
Query ------------------------idraaarapallaLTDHDCTGgLAEAAAAAARRG-I   56
ident                                       ||      |     |       
Sbjct kviseetaeeiweetkkklpemtpqkllrdmkveilcTTDDPVST-LEHHRKAKEAVEgV  172
DSSP  llllhhhhhhhhhhhhhhlllllhhhhhhhlleeeeeLLLLLLLL-LHHHHHHHHHLLlL


DSSP  LEEEEEEEEeeelleeeeeeeellllllhhhhhhhhhhhlLHHHhhhhhhhhhhhlllll
Query PFLNGVEVSvswgrhtvhivglgidpaepalaaglksireGRLErarqmgasleaagiag  116
ident   |                                     |  |                
Sbjct TILPTWRPD-----------------------ramnvdkeGWRE----------------  193
DSSP  EEELLLLLH-----------------------hhhlllllLHHH----------------


DSSP  hhhhhhlllllHHHL-----------------------------lhhhhhhhhhhlllll
Query cfdgamrwcdnPEMI-----------------------------srthfarhlvdsgavk  147
ident              |                                              
Sbjct ---------yvEKMGerygedtstldgflnalwkshehfkehgcvasdhallepsvyyvd  244
DSSP  ---------hhHHHHhhhllllllhhhhhhhhhhhhhhhhllllleeeeeelllllllll


DSSP  lhhhhhhhllllllLLLL---LLLL--LLHHHHHHHHHHLLLEEEElLHHH---------
Query dmrtvfrkyltpgkPGYV---SHQW--ASLEDAVGWIVGAGGMAVIaHPGR---------  193
ident                                                | |          
Sbjct enraravhekafsgEKLTqdeINDYkaFMMVQFGKMNQETNWVTQL-HIGAlrdyrdslf  303
DSSP  hhhhhhhhhhhlllLLLLhhhHHHHhhHHHHHHHHHHHHHLLEEEE-EELEellllhhhh


DSSP  --------------lLLLHHHHHHHHHHHHHLLLLEEEeeellLLHHHHHHHHHHHHHHL
Query --------------yDMGRTLIERLILDFQAAGGQGIEvasgsHSLDDMHKFALHADRHG  239
ident                             |                          |    
Sbjct ktlgpdsggdistnfLRIAEGLRYFLNEFDGKLKIVLY----vLDPTHLPTISTIARAFP  359
DSSP  hhlllllllleelllLLHHHHHHHHHHHLLLLLLEEEE----eLLHHHHHHHHHHHHHLL


DSSP  -LEEEE-elllllllllllllllLLLLL---LLHH-------------------------
Query -LYASS-gsdfhapgedvghtedLPPIC---RPIW-------------------------  269
ident   |                    |                                    
Sbjct nVYVGApwwfndspfgmemhlkyLASVDllyNLAGmvtdsrkllsfgsrtemfrrvlsnv  419
DSSP  lEEELLlllllllhhhhhhhhhhHHLLLlhhHLLLlllllllllhhhhhhhhhhhhhhhh


DSSP  ----------------------------HHLHhhlllllhhhl
Query ----------------------------RELEarilrpadaen  284
ident                                            
Sbjct vgemvekgqipikearelvkhvsydgpkALFF-----------  451
DSSP  hhhhhhlllllhhhhhhhhhhhhlhhhhHHHL-----------


No 56: Query=2yb1A Sbjct=3iacA Z-score=3.8

back to top
DSSP  --------------------------LLEELLLLLlllllllLHHHH-------------
Query --------------------------ANIDLHFHSrtsdgalTPTEV-------------   21
ident                              | | |         | |              
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHL-------SPQEIaddrrfdnlgqiw   53
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLL-------LHHHHhhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   21
ident                                                             
Sbjct legdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfg  113
DSSP  hllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllll


DSSP  -----------------------------hhHHHLLLLLEEEELLllllllhHHHHHHHH
Query -----------------------------idRAAARAPALLALTDhdctgglAEAAAAAA   52
ident                                            ||        |     |
Sbjct itgtlfgpdtaesiwtqcneklatpafsargIXQQXNVRXVGTTD--dpidsLEYHRQIA  171
DSSP  lllllllhhhhhhhhhhhhhhhllhhhlhhhHHHHLLEEEEELLL--lllllLHHHHHHH


DSSP  H---LLLLEEEE------------------------------------------------
Query R---RGIPFLNG------------------------------------------------   61
ident       |                                                     
Sbjct AddsIDIEVAPSwrpdkvfkieldgfvdylrkleaaadvsitrfddlrqaltrrldhfaa  231
DSSP  HlllLLLEEELLlllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhh


DSSP  -----EEEEE-EELL----------------------------eeeeeeeellllllhhh
Query -----VEVSV-SWGR----------------------------htvhivglgidpaepal   87
ident                                                             
Sbjct cgcraSDHGIeTLRFapvpddaqldailgkrlagetlseleiaqfttavlvwlgrqyaar  291
DSSP  lllleEEEEElLLLLlllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhhh


DSSP  hhhhhhhhllhhhHHHHHHhhhhhlllllhHHHHhlllllhhhllHHHHHhhhhhlllll
Query aaglksiregrleRARQMGasleaagiagcFDGAmrwcdnpemisRTHFArhlvdsgavk  147
ident                                                             
Sbjct gwvxqlhigairnNNTRXF-----------RLLG-----------PDTGF----------  319
DSSP  lleeeeeeleellLLHHHH-----------HHHL-----------LLLLL----------


DSSP  lhhhhhhhlllllllllllllllLHHHHHH--hhhHLLLEEEELlhhHLLLlhhHHHHHH
Query dmrtvfrkyltpgkpgyvshqwaSLEDAVG--wivGAGGMAVIAhpgRYDMgrtLIERLI  205
ident                         |                               | | 
Sbjct -------------dsigdnniswALSRLLDsxdvtNELPKTILY--cLNPR---DNEVLA  361
DSSP  -------------leelllllhhHHHHHHHhhhllLLLLEEEEE--eLLHH---HHHHHH


DSSP  HHHHHLL------lLEEEE-eellLLHHHHHHHHHHHH-HHLL--EEEEELLLLLLllll
Query LDFQAAG------gQGIEV-asgsHSLDDMHKFALHAD-RHGL--YASSGSDFHAPgedv  255
ident                            |              |        |        
Sbjct TXIGNFQgpgiagkVQFGSgwwfnDQKDGXLRQLEQLSqXGLLsqFVGXLTDSRSF-lsy  420
DSSP  HHHHHLLlllllllEEELLllhhhLLHHHHHHHHHHHHhHLLHhhLLLLLLLLLLL-lll


DSSP  llLLLLL-----------------------------llllLHHHHLHHhlllllhhhl
Query ghTEDLP-----------------------------picrPIWRELEArilrpadaen  284
ident    |                                       |              
Sbjct trHEYFRrilcnllgqwaqdgeipddeaxlsrxvqdicfnNAQRYFTI---------k  469
DSSP  hhHHHHHhhhhhhhhhhhhlllllllhhhhhhhhhhhhlhHHHHHLLL---------l


No 57: Query=2yb1A Sbjct=4dziC Z-score=3.2

back to top
DSSP  ----lLEELLLLLLL---------------------------------------------
Query ----aNIDLHFHSRT---------------------------------------------   11
ident       ||   |                                                
Sbjct alnyrVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  lllllEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  --------------------------------llllLLHH-HHHHHHHLLLLLEEEELLL
Query --------------------------------sdgaLTPT-EVIDRAAARAPALLALTDH   38
ident                                            |                
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdARIAVMDEQDIETAFMLPT  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHhHHHHHHHHHLEEEEEEELL


DSSP  LL----------------------lLLHHHHHHhHHHLlLLEEEE---------------
Query DC----------------------tGGLAEAAAaAARRgIPFLNG---------------   61
ident                                                             
Sbjct FGcgveealkhdieatmasvhafnlWLDEDWGF-DRPD-HRIIAApivsladptraveev  178
DSSP  HHhhhhhhllllhhhhhhhhhhhhhHHHHHLLL-LLLL-LLEEELlllllllhhhhhhhh


DSSP  ----------eEEEEE--------------------------------------------
Query ----------vEVSVS--------------------------------------------   67
ident             |                                               
Sbjct dfvlargaklvLVRPApvpglvkprslgdrshdpvwarlaeagvpvgfhlsdsgylhiaa  238
DSSP  hhhhhllllleELLLLlllllllllllllhhhhhhhhhhhhhllleeeellllllhhhhh


DSSP  -----------eLLEEeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllll
Query -----------wGRHTvhivglgidpaepalaaglksiregrlerarqmgasleaagiag  116
ident                                                             
Sbjct awggakdpldqvLLDD--------------------------------------------  254
DSSP  hllllllhhhhhHHLL--------------------------------------------


DSSP  hhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllllLHHHH-
Query cfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDA-  175
ident                                                             
Sbjct -------------------------------------------------raihdTMASMi  265
DSSP  -------------------------------------------------hhhhhHHHHHh


DSSP  ---hhhhhHLLLeEEELLHHhllllhhhhhhHHHHHHH---------------------l
Query ---vgwivGAGGmAVIAHPGrydmgrtlierLILDFQA---------------------a  211
ident              ||    |                                        
Sbjct vhgvftrhPKLK-AVSIENG---------syFVHRLIKrlkkaantqpqyfpedpveqlr  315
DSSP  hllhhhhlLLLL-EEEELLL---------llHHHHHHHhhhhhhhhlhhhllllhhhhhh


DSSP  llLEEEEeellllhhhHHHHHHHHHHHL--lEEEEELLLLlllllllLLLL--LLLL---
Query ggQGIEVasgshslddMHKFALHADRHG--lYASSGSDFHapgedvgHTED--LPPI---  264
ident     |                    |         |||                      
Sbjct nnVWIAP--------yYEDDLPELARVIgvdKILFGSDWPhgeglasPVSFtaELKGfse  367
DSSP  hhEEELL--------lLLLLHHHHHHHHlhhHLLLLLLLLlllllllHHHHhhHHLLllh


DSSP  -------llLHHHHLHHhlllllhhhl
Query -------crPIWRELEArilrpadaen  284
ident               |            
Sbjct sdirkimrdNALDLLGV------qvgs  388
DSSP  hhhhhhhlhHHHHHHLL------llll


No 58: Query=2yb1A Sbjct=2gwgA Z-score=2.6

back to top
DSSP  LLEELLLLLllllLLLL---------------------------------hhhhhhHHHL
Query ANIDLHFHSrtsdGALT---------------------------------ptevidRAAA   27
ident   || | |                                                    
Sbjct XIIDIHGHY----TTAPkaledwrnrqiagikdpsvxpkvselkisddelqasiieNQLK   56
DSSP  LLEEEEEEL----LLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHH


DSSP  LL----LLEEEELLL---------lllLLHHHHHHHHHHLLLLEEEEE------------
Query RA----PALLALTDH---------dctGGLAEAAAAAARRGIPFLNGV------------   62
ident         |                                  |                
Sbjct KXqergSDLTVFSPRagdfnvsstwaaICNELCYRVSQLFPDNFIGAAxlpqspgvdpkt  116
DSSP  HHhhhlLLEEEEELLlllhhhhhhhhhHHHHHHHHHHHHLLLLEEEEEellllllllhhh


DSSP  -----------------EEEEE-----ELLEeeeeeeellllllhhhhhhhhhhhllhhh
Query -----------------EVSVS-----WGRHtvhivglgidpaepalaaglksiregrle  100
ident                            |                                
Sbjct cipelekcvkeygfvaiNLNPDpsgghWTSP-----------------------------  147
DSSP  hhhhhhhhhhllllleeEELLLlllllLLLL-----------------------------


DSSP  hhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllll
Query rarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpg  160
ident                                                             
Sbjct ------------------------------------------------------------  147
DSSP  ------------------------------------------------------------


DSSP  lllllllllllhhhhhhhhHHLLLEEEEL-----lHHHLlllhhhHHHHHHH-----hhh
Query kpgyvshqwasledavgwiVGAGGMAVIA-----hPGRYdmgrtlIERLILD-----fqa  210
ident                    |     | |                                
Sbjct -----pltdriwypiyekxVELEIPAXIHvstgahYLNA---dttAFXQCVAgdlfkdfp  199
DSSP  -----llllhhhhhhhhhhHHHLLLEEELlllllhHHHH---hhhHHHHHHHllhhhhll


DSSP  lLLLEEEEEellllhhHHHH-------------hhhhhHHHL--LEEE------------
Query aGGQGIEVAsgshsldDMHK-------------falhaDRHG--LYAS------------  243
ident      |                                |                     
Sbjct eLKFVIPHG-----ggAVPYhwgrfrglaqexkkplleDHVLnnIFFDtcvyhqpgidll  254
DSSP  lLLEEELHH-----hlLLHHhhhhhhhhhhhlllllhhHHLLllEEEElllllhhhhhhh


DSSP  ----------EELLL-LLLLL-------------------llllllllllllllHHHH-L
Query ----------SGSDF-HAPGE-------------------dvghtedlppicrpIWRE-L  272
ident             |    |                                      |   
Sbjct ntvipvdnvlFASEXiGAVRGidprtgfyyddtkryieastiltpeekqqiyegNARRvY  314
DSSP  hhhllhhheeLLLLLlLLLLLeelllleellllhhhhhhlllllhhhhhhhhlhHHHHhL


DSSP  HHH--llllLHHH-l
Query EAR--ilrpADAE-n  284
ident                
Sbjct PRLdaalkaKGKLeh  329
DSSP  HHHhhhhhhHHHHll


No 59: Query=2yb1A Sbjct=2a3lA Z-score=2.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------lLEEL-LLLL--------
Query ------------------------------------------aNIDL-HFHS--------    9
ident                                              |    ||        
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrKVDThVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllEEEEeEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    9
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -----------------------lllllllLHHHHHHHHHLLLLLEEEELLLL-------
Query -----------------------rtsdgalTPTEVIDRAAARAPALLALTDHD-------   39
ident                                   |     |                   
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRISIygrkmse  300
DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEELllllllh


DSSP  ---llllhhhhhHHHHhlllLEEEEEEEEEeelleeeeeeeellllllhhhhhhhhhHHL
Query ---ctgglaeaaAAAArrgiPFLNGVEVSVswgrhtvhivglgidpaepalaaglksIRE   96
ident                                                             
Sbjct wdqlaswivnndLYSE----NVVWLIQLPR---------------------------LYN  329
DSSP  hhhhhhhhhlllLLLL----LEEEEEEEEL---------------------------LHH


DSSP  LHHHHHHHH-hhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhh
Query GRLERARQM-gasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrk  155
ident                                                             
Sbjct IYKDMGIVTsfqnildnifiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptk  389
DSSP  HHLLLLLLLllhhhhhhhllhhhhhhhlhhhllllhhhhlleeeeeeellllllllllll


DSSP  llllllllLLLLLL---lLHHHHHHHHHHL----------LLEEEELlHHHLLLlhhhhH
Query yltpgkpgYVSHQW---aSLEDAVGWIVGA----------GGMAVIAhPGRYDMgrtliE  202
ident                                                  |          
Sbjct hmptpaqwTNAFNPafsyYVYYCYANLYVLnklreskgmtTITLRPH-SGEAGD-----I  443
DSSP  llllllllLLLLLLlhhhHHHHHHHHHHHHhhhhllllllLLEELLL-LLLLLL-----L


DSSP  HHHHHHHHlLLLEEEEeellllhhhhhhhhhHHHHHLLEEE-------------------
Query RLILDFQAaGGQGIEVasgshslddmhkfalHADRHGLYAS-------------------  243
ident              |                                              
Sbjct DHLAATFL-TCHSIAH---ginlrkspvlqyLYYLAQIGLAmsplsnnslfldyhrnpfp  499
DSSP  HHHHHHHH-HLLLLLL---lhhhhhlhhhhhHHHHHLLLEEelhhhhlllllllllllhh


DSSP  ----------eELLL-llllllllLLLL---------------llllllLHHH-HLHH--
Query ----------sGSDF-hapgedvgHTED---------------lppicrPIWR-ELEA--  274
ident              |                                              
Sbjct vfflrglnvslSTDDplqihltkePLVEeysiaasvwklsacdlceiarNSVYqSGFSha  559
DSSP  hhhhlllleeeLLLLhhhhlllllHHHHhhhhhhhhhlllhhhhhhhhhHHHHhLLLLhh


DSSP  -----------------------------------------------hlllllhhhl
Query -----------------------------------------------rilrpadaen  284
ident                                                          
Sbjct lkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll