Results: dupa

Query: 2y1hB

MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2y1h-B 52.9  0.0  265   265  100 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   2:  3gg7-A 30.5  2.2  239   243   23 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
   3:  1bf6-A 21.0  2.9  232   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   4:  2ob3-A 19.3  3.2  232   329   17 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   5:  3k2g-B 19.2  2.9  230   358   17 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   6:  2oof-A 19.2  3.3  235   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   7:  3cjp-A 18.6  3.0  215   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   8:  2vc5-A 18.5  3.0  226   314   16 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
   9:  2vun-A 18.5  2.8  216   385   15 PDB  MOLECULE: ENAMIDASE;                                                 
  10:  1k6w-A 18.1  3.4  235   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  11:  3mtw-A 18.0  3.1  224   404   12 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  12:  3irs-A 17.8  3.1  216   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  13:  3mkv-A 17.4  3.0  224   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  14:  4dlf-A 17.4  3.2  225   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  15:  4c5y-A 17.3  3.0  221   436   17 PDB  MOLECULE: OCHRATOXINASE;                                             
  16:  2paj-A 17.3  2.9  219   421   15 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  17:  4mup-B 17.1  3.1  215   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  18:  3ls9-A 17.0  3.2  232   453   13 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  19:  4cqb-A 16.8  3.4  227   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  20:  2gwg-A 16.8  3.4  225   329   15 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  21:  1gkp-A 16.7  2.9  226   458   14 PDB  MOLECULE: HYDANTOINASE;                                              
  22:  3nqb-A 16.7  3.1  221   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  23:  1onx-A 16.6  2.8  223   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  24:  3icj-A 16.6  2.9  215   468   17 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  25:  2imr-A 16.6  3.0  222   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  26:  2ffi-A 16.5  3.1  217   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  27:  1j6p-A 16.5  3.0  220   407   15 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  28:  2ogj-A 16.4  2.9  221   379   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  29:  4b3z-D 16.3  3.1  229   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  30:  1yrr-B 16.2  3.2  219   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  31:  2uz9-A 16.0  3.3  231   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  32:  4hk5-D 15.9  3.1  221   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  33:  4ofc-A 15.8  3.2  214   335   16 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  34:  2dvt-A 15.7  3.4  216   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  35:  4rdv-B 15.5  3.0  224   451   10 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  36:  2qpx-A 15.2  3.3  217   376   14 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  37:  1a4m-A 15.0  3.4  233   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  38:  3giq-A 14.9  3.4  227   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  39:  1itq-A 14.6  3.4  228   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  40:  4qrn-A 14.5  3.3  212   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  41:  3pnu-A 14.4  3.4  217   338   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  42:  3gri-A 14.3  3.2  220   422   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  43:  1a5k-C 14.2  3.1  210   566   13 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  44:  3e74-A 14.0  3.1  213   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  45:  3qy6-A 13.9  3.0  187   247   16 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  46:  3iac-A 13.6  3.6  225   469   15 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  47:  1j5s-A 13.4  3.5  222   451   15 PDB  MOLECULE: URONATE ISOMERASE;                                         
  48:  3ooq-A 13.3  3.3  200   384   17 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  4dzi-C 12.9  3.8  207   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  50:  2a3l-A 12.4  3.5  232   616   13 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  1v77-A 12.0  3.3  172   202   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  52:  3au2-A 10.0  3.6  177   575   16 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3dcp-A 10.0  3.1  167   277   11 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  9.8  3.4  166   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  8.2  3.4  167   994   12 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.4  3.6  165   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.4  4.3  149   284    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  2anu-A  6.3  3.5  140   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  5.4  3.3  136   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2y1hB Sbjct=2y1hB Z-score=52.9

back to top
DSSP  LLLEEEEEELLLLHHHLLLHHHHHHHHHHLLEEEEEELLLLHHHHHHHHHHHHHLLLLEE
Query GVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVL   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVL   60
DSSP  LLLEEEEEELLLLHHHLLLHHHHHHHHHHLLEEEEEELLLLHHHHHHHHHHHHHLLLLEE


DSSP  EEELLLLEELLLLEELLHHHHHHHHHHHHHHLLLLLEEEEEEEELLLLLLLLHHHHHHHH
Query PCLGVHPVQGLDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQR  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PCLGVHPVQGLDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQR  120
DSSP  EEELLLLEELLLLEELLHHHHHHHHHHHHHHLLLLLEEEEEEEELLLLLLLLHHHHHHHH


DSSP  HHHHHHHHHHHHHLLLEEEEEELLHHHHHHHHHHLLLLLEEEELLLLLHHHHHHHHHLLL
Query QVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGY  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGY  180
DSSP  HHHHHHHHHHHHHLLLEEEEEELLHHHHHHHHHHLLLLLEEEELLLLLHHHHHHHHHLLL


DSSP  EEEELHHHHLLHHHHHHHHHLLHHHEEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHL
Query FFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKG  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKG  240
DSSP  EEEELHHHHLLHHHHHHHHHLLHHHEEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHL


DSSP  LLHHHHHHHHHHHHHHHLLLHHHHL
Query ISVEEVIEVTTQNALKLFPKLRHLL  265
ident |||||||||||||||||||||||||
Sbjct ISVEEVIEVTTQNALKLFPKLRHLL  265
DSSP  LLHHHHHHHHHHHHHHHLLLHHHHL


No 2: Query=2y1hB Sbjct=3gg7A Z-score=30.5

back to top
DSSP  llLEEEEEELLLLHHhllLHHHHHHHHHHLLEeEEEELLLLHHHHHHHHHHHHHLlLLEE
Query gvGLVDCHCHLSAPDfdrDLDDVLEKAKKANVvALVAVAEHSGEFEKIMQLSERYnGFVL   60
ident    | | | ||       |   |              |            |       | 
Sbjct --SLIDFHVHLDLYP---DPVAVARACEERQL-TVLSVTTTPAAWRGTLALAAGR-PHVW   53
DSSP  --LLEEEEELHHHLL---LHHHHHHHHHHLLL-EEEELLLLHHHHHHHHHHHLLL-LLEE


DSSP  EEELLLLEElllleeLLHHH--HHHHHHHHHhhllLLLEEEEEEEELLLLLLLlhhHHHH
Query PCLGVHPVQgldqrsVTLKD--LDVALPIIEnykdRLLAIGEVGLDFSPRFAGtgeQKEE  118
ident   || ||        |      |                 |||||| ||   |       
Sbjct TALGFHPEV------VSERAadLPWFDRYLP----ETRFVGEVGLDGSPSLRG---TWTQ  100
DSSP  ELLLLLHHH------LLLLHhhLHHHHHHHH----HLLEEEEEELLLLHHHHH---HHHH


DSSP  HHHHHHHHHHHHHHH-LLLEEEEEELLHHHHHHHHHHLL-LLLEEEELLLLLHHHHHHHH
Query QRQVLIRQIQLAKRL-NLPVNVHSRSAGRPTINLLQEQG-AEKVLLHAFDGRPSVAMEGV  176
ident |  |                  ||| |     | |          ||   |         
Sbjct QFAVFQHILRRCEDHgGRILSIHSRRAESEVLNCLEANPrSGTPILHWYSGSVTELRRAI  160
DSSP  HHHHHHHHHHHHHHLlLEEEEEELLLLHHHHHHHHHHLHhHEEEEEELLLLLHHHHHHHH


DSSP  HLLLEEEELHHHHLLHHHHHHHHHLLHHHEEELLLLLLLLlLLLLLLLHHHHHHHHHHHH
Query RAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGpEKQVRNEPWNISISAEYIA  236
ident   |  ||  |   |      |    |      ||| | |         ||      |   
Sbjct SLGCWFSVGPTMVRTQKGAALIRSMPRDRVLTETDGPFLE-LDGQAALPWDVKSVVEGLS  219
DSSP  HLLLEEEELHHHHLLHHHHHHHHHLLHHHEEELLLLLLLE-ELLEELLHHHHHHHHHHHH


DSSP  HHHLLLHHHHHHHHHHHHHHHLLLhhhhl
Query QVKGISVEEVIEVTTQNALKLFPKlrhll  265
ident     |   ||      |   |        
Sbjct KIWQIPASEVERIVKENVSRLLGT-----  243
DSSP  HHHLLLHHHHHHHHHHHHHHHHHL-----


No 3: Query=2y1hB Sbjct=1bf6A Z-score=21.0

back to top
DSSP  ---lLLEEEEEELLLL-----------HHHL-LLHHHHHHHHHHLLEEEEEELLLLHHHH
Query ---gVGLVDCHCHLSA-----------PDFD-RDLDDVLEKAKKANVVALVAVAEHSGEF   45
ident      |    | ||                                |             
Sbjct sfdpTGYTLAHEHLHIdlsgfknnvdcRLDQyAFICQEMNDLMTRGVRNVIEMTNRYMGR   60
DSSP  llllLLEEEEEELLLEelhhhhllhhhEELLhHHHHHHHHHHHHLLEEEEEELLLHHHLL


DSSP  hhHHHHHHHLL----LLEEEEELLLLEellllEELLHHH----hHHHHHHHHHHLL----
Query ekIMQLSERYN----GFVLPCLGVHPVqgldqRSVTLKD----lDVALPIIENYKD----   93
ident     |            |  | |                                     
Sbjct --NAQFMLDVMretgINVVACTGYYQD-----AFFPEHVatrsvQELAQEMVDEIEqgid  113
DSSP  --LHHHHHHHHhhhlLEEEEEELLLLH-----HHLLLHHhhllhHHHHHHHHHHHHllll


DSSP  ----LLLEEEEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEE--LLHHH
Query ----RLLAIGEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSR--SAGRP  147
ident         | | |                   | |           |   |      |  
Sbjct gtelKAGIIAEIGTSEG-------kiTPLEEKVFIAAALAHNQTGRPISTHTSfsTMGLE  166
DSSP  llllLEEEEEEEELLLL-------llLHHHHHHHHHHHHHHHHHLLLEEEELHhhLLHHH


DSSP  HHHHHHHLLLL--LEEEELLL--lLHHHHHHHHHLLLEEEEL-HHHH---LLHHHHHHHH
Query TINLLQEQGAE--KVLLHAFD--gRPSVAMEGVRAGYFFSIP-PSII---RSGQKQKLVK  199
ident    |||  |     |     |              |                        
Sbjct QLALLQAHGVDlsRVTVGHCDlkdNLDNILKMIDLGAYVQFDtIGKNsyyPDEKRIAMLH  226
DSSP  HHHHHHHLLLLhhHEEELLLLlllLHHHHHHHHHLLLEEEELlLLLLlllLHHHHHHHHH


DSSP  HL----LHHHEEELLLLLllllllLLLL------LHHHHH-HHHHHHHHHhLLLHHHHhH
Query QL----PLTSICLETDSPalgpekQVRN------EPWNIS-ISAEYIAQVkGISVEEViE  248
ident  |     |    |  |                                |  | |   |  
Sbjct ALrdrgLLNRVMLSMDIT-----rRSHLkanggyGYDYLLtTFIPQLRQS-GFSQADV-D  279
DSSP  HHhhllLHHHEEELLLLL-----lHHHLhhhlllLLLHHHhLHHHHHHHL-LLLHHHH-H


DSSP  HHH-HHHHHHLLlhhhhl
Query VTT-QNALKLFPklrhll  265
ident |    |    |       
Sbjct VMLrENPSQFFQ------  291
DSSP  HHHlHHHHHHLL------


No 4: Query=2y1hB Sbjct=2ob3A Z-score=19.3

back to top
DSSP  -------------llLEEEEEELLLLH----------------hHLLLHHHHHHHHHHLL
Query -------------gvGLVDCHCHLSAP----------------dFDRDLDDVLEKAKKAN   31
ident                |    | |                             |  |  | 
Sbjct drintvrgpitiseaGFTLTHEHICGSsagflrawpeffgsrkaLAEKAVRGLRRARAAG   60
DSSP  lleeelleeelhhhhLLEEEEELLEELlllhhhhlhhhhllhhhHHHHHHHHHHHHHHLL


DSSP  EEEEEELLLLHHHHhHHHHHHHHLL---LLEEEEELLLLEELllleeLLHH---hHHHHH
Query VVALVAVAEHSGEFeKIMQLSERYN---GFVLPCLGVHPVQGldqrsVTLK---dLDVAL   85
ident |   | |            | |             |             |     |    
Sbjct VRTIVDVSTFDIGR-DVSLLAEVSRaadVHIVAATGLWFDPP---lsMRLRsveeLTQFF  116
DSSP  LLEEEELLLHHHLL-LHHHHHHHHHhhlLEEELEEELLLLLL---hhHHLLlhhhHHHHH


DSSP  HHH-HHHL----LLLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEE
Query PII-ENYK----DRLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVH  140
ident              |   |  |                 |  ||            ||  |
Sbjct LREiQYGIedtgIRAGII-XVATTGK--------aTPFQELVLKAAARASLATGVPVTTH  167
DSSP  HHHhHLLLllllLLLLEE-EEELLLL--------lLHHHHHHHHHHHHHHHHHLLLEEEE


DSSP  EE---LLHHHHHHHHHHLLLL--LEEEELL-LLLH-HHHHHHHHLLLEEEE-LHHHH---
Query SR---SAGRPTINLLQEQGAE--KVLLHAF-DGRP-SVAMEGVRAGYFFSI-PPSII---  189
ident        |          |     |      |    |        ||             
Sbjct TAasqRDGEQQAAIFESEGLSpsRVCIGHSdDTDDlSYLTALAARGYLIGLdHIPYSaig  227
DSSP  LLhhhLHHHHHHHHHHHLLLLhhHEEELLHhHLLLhHHHHHHHHLLLEEEElLLLLLlll


DSSP  --------------LLHHHHHHHHHL----LHHHEEELLLLL------lllllLLLL---
Query --------------RSGQKQKLVKQL----PLTSICLETDSP------algpeKQVR---  222
ident                      | | |        |    |                    
Sbjct lednasasallgirSWQTRALLIKALidqgYMKQILVSNDWTfgfssyvtnimDVMDrvn  287
DSSP  llllhhhhhhhlllLHHHHHHHHHHHhhllLHHHEEELLLLLleellllllhhHHHHhhl


DSSP  -lLHHHHH-HHHHHHHHHhLLLHHHHhHHHH-HHHHHHLLLhhhhl
Query -nEPWNIS-ISAEYIAQVkGISVEEViEVTT-QNALKLFPKlrhll  265
ident       |            |   |      |  |            
Sbjct pdGMAFIPlRVIPFLREK-GVPQETL-AGITvTNPARFLSP--tlr  329
DSSP  llHHHHHHhLHHHHHHHL-LLLHHHH-HHHHlHHHHHHHLL--lll


No 5: Query=2y1hB Sbjct=3k2gB Z-score=19.2

back to top
DSSP  -------------------------llLEEEEEELLLL----------------------
Query -------------------------gvGLVDCHCHLSA----------------------   13
ident                            |    | ||                        
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhlll


DSSP  -------------------HHHL-LLHHHHHHHHHHLLEEEEEELLLLHHHHhhHHHHHH
Query -------------------PDFD-RDLDDVLEKAKKANVVALVAVAEHSGEFekIMQLSE   53
ident                       |                   |                 
Sbjct sieilselrqdpfvnkhniALDDlDLAIAEVKQFAAVGGRSIVDPTCRGIGR--DPVKLR  118
DSSP  lhhhhhhhhllhhhlllllEELLhHHHHHHHHHHHHLLLLEEEELLLLLLLL--LHHHHH


DSSP  HLL----LLEEEEELLLLEELllleeLLHHH----hhhHHHHHHHHLL--------LLLE
Query RYN----GFVLPCLGVHPVQGldqrsVTLKD----ldvALPIIENYKD--------RLLA   97
ident |        |    |                           |             |   
Sbjct RISaetgVQVVXGAGYYLASS-----XPETAarlsaddIADEIVAEALegtdgtdaRIGL  173
DSSP  HHHhhhlLEEEELLLLLLHHH-----LLHHHhlllhhhHHHHHHHHHHllllllllLLLL


DSSP  EEEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEE---LLHHHHHHHHHH
Query IGEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSR---SAGRPTINLLQE  154
ident ||| |               |    |        |  ||  ||             |  |
Sbjct IGEIGVSSD--------fTAEEEKSLRGAARAQVRTGLPLXVHLPgwfRLAHRVLDLVEE  225
DSSP  EEEELLLLL--------lLHHHHHHHHHHHHHHHHHLLLEEELLLlllLLHHHHHHHHHH


DSSP  LLLL--LEEEELLLL---LHHHHHHHHHLLLEEEE-LHHH-----------HLLHHHHHH
Query QGAE--KVLLHAFDG---RPSVAMEGVRAGYFFSI-PPSI-----------IRSGQKQKL  197
ident  ||      |         |         | |                            
Sbjct EGADlrHTVLCHXNPshxDPVYQATLAQRGAFLEFdXIGXdffyadqgvqcPSDDEVARA  285
DSSP  LLLLhhHEEELLLHHhllLHHHHHHHHHHLLEEEElLLLLlleelllleelLLHHHHHHH


DSSP  HHHL----LHHHEEELLLLLllllllLLLL------LHHHHH-HHHHHHHHHhLLLHHHH
Query VKQL----PLTSICLETDSPalgpekQVRN------EPWNIS-ISAEYIAQVkGISVEEV  246
ident    |     |  | |  |                                   |      
Sbjct ILGLadhgYLDRILLSHDVF-----vKXXLtryggnGYAFVTkHFLPRLRRH-GLDDAAL  339
DSSP  HHHHhhllLHHHEEELLLLL-----lHHHLhhhlllLLLHHHhLHHHHHHHL-LLLHHHH


DSSP  hHHHH-HHHHHHLLlhhhhl
Query iEVTT-QNALKLFPklrhll  265
ident  |     |    |       
Sbjct -ETLXvTNPRRVFDasiegh  358
DSSP  -HHHHlHHHHHHHLllllll


No 6: Query=2y1hB Sbjct=2oofA Z-score=19.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLEEEEEELLLLHH---------------------------------------HLLLHH
Query GVGLVDCHCHLSAPD---------------------------------------FDRDLD   21
ident   || ||| ||                                                 
Sbjct TPGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkgggiistvratraasedqLFELAL  120
DSSP  EELEEEEEELLLLLLllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhHHHHHH


DSSP  HHHHHHHHLLEEEEEELLLLH----HHHHHHHHHHHHLL---LLEEEEELLLLEELLLLE
Query DVLEKAKKANVVALVAVAEHS----GEFEKIMQLSERYN---GFVLPCLGVHPVQGLDQR   74
ident           |               |                 |   |          |
Sbjct PRVKSLIREGVTTVEIKSGYGltleDELKXLRVARRLGEalpIRVKTTLLAAHAVPPEYR  180
DSSP  HHHHHHHHHLEEEEEEELLLLllhhHHHHHHHHHHHHHHhllLEEEEEEEEELLLLHHHL


DSSP  elLHHHHHHHH-HHHHHHL--LLLLEEeEEEEELLllllllhhhhhhHHHHHHHHHHHHH
Query svTLKDLDVAL-PIIENYK--DRLLAIgEVGLDFSprfagtgeqkeeQRQVLIRQIQLAK  131
ident              ||          |   |                            | 
Sbjct ddPDSWVETICqEIIPAAAeaGLADAV-DVFCEHI----------gfSLAQTEQVYLAAD  229
DSSP  llHHHHHHHHHhLHHHHHHhlLLLLEE-EEEELLL----------llLHHHHHHHHHHHH


DSSP  HHLLLEEEEE-ELLHHHHHHHHHhlLLLLEEEELLLLLHH-HHHHHHHLLLEEEEL-HHH
Query RLNLPVNVHS-RSAGRPTINLLQeqGAEKVLLHAFDGRPS-VAMEGVRAGYFFSIP-PSI  188
ident    | |  |           |                            |          
Sbjct QYGLAVKGHXdQLSNLGGSTLAA--NFGALSVDHLEYLDPeGIQALAHRGVVATLLpTAF  287
DSSP  HLLLEEEEEElLLLLLLHHHHHH--HLLLLEEEELLLLLHhHHHHHHHHLLEEEELhHHH


DSSP  H--LLHHhHHHHHHLL--hHHEEELLLL-LLLLllllllLLHHhHHHHHHHHHH-HHLLl
Query I--RSGQkQKLVKQLP--lTSICLETDS-PALGpekqvrNEPWnISISAEYIAQ-VKGIs  242
ident            |  |           |  |                              
Sbjct YflKETK-LPPVVALRkagVPXAVSSDInPGTA------PIVS-LRXAXNXACTlFGLT-  338
DSSP  HhlLLLL-LLLHHHHHhllLLEEELLLLlLLLL------LLLL-HHHHHHHHHHhHLLL-


DSSP  hHHHHHHH-HHHHHHHLLlHHHH-------------------------------------
Query vEEVIEVT-TQNALKLFPkLRHL-------------------------------------  264
ident          |  |                                               
Sbjct -PVEAXAGvTRHAARALG-EQEQlgqlrvgxladflvwncghpaelsyligvdqlvsrvv  396
DSSP  -HHHHHHHlLHHHHHHLL-LLLLllllllllllleeeellllllhhhhlllllleeeeee


DSSP  ------l
Query ------l  265
ident        
Sbjct ngeetlh  403
DSSP  lleelll


No 7: Query=2y1hB Sbjct=3cjpA Z-score=18.6

back to top
DSSP  llLEEEEEELLLlhhhllLHHHHHHHHHHLLEEEEEELLL--------------------
Query gvGLVDCHCHLSapdfdrDLDDVLEKAKKANVVALVAVAE--------------------   40
ident      | | |                   | |                            
Sbjct --LIIDGHTHVI-----lPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkkl   53
DSSP  --LLEEEEEELL-----lLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhh


DSSP  --------------LHHHHHHHHHHHHHLLLLEEEEELLLLeelllleeLLHH-HHHHHH
Query --------------HSGEFEKIMQLSERYNGFVLPCLGVHPvqgldqrsVTLK-DLDVAL   85
ident                             |         |               |     
Sbjct ndvvngktnsmidvRRNSIKELTNVIQAYPSRYVGFGNVPV--------GLSEnDTNSYI  105
DSSP  hhhhlllllllhhhHHHHHHHHHHHHHHLLLLEEEEELLLL--------LLLHhHHHHHH


DSSP  -HHHHHHllLLLEEEEEEEELlllllllhhhhHHHHHhHHHHHHHHH-HHLLLEEEEEEL
Query -PIIENYkdRLLAIGEVGLDFsprfagtgeqkEEQRQvLIRQIQLAK-RLNLPVNVHSRS  143
ident    | |    |  |||                      |            ||   |   
Sbjct eENIVNN--KLVGIGELTPAS-----------GQIKS-LKPIFKYSMdSGSLPIWIHAFN  151
DSSP  hHHLLLL--LLLEEEEELLLL-----------LLHHH-HHHHHHHHHhLLLLLEEELLLL


DSSP  -----LHHHHHHHHHHLLLLLEEEEL-LLLLHHHH-HHHHHLL-LEEEELhHHHLLHHHH
Query -----AGRPTINLLQEQGAEKVLLHA-FDGRPSVA-MEGVRAG-YFFSIPpSIIRSGQKQ  195
ident             |        | |          |                         
Sbjct plvlqDIKEIAELCKAFPKVPVILGHmGGSNWMTAvELAKEIQnLYLDTS-AYFSTFVLK  210
DSSP  lllhhHHHHHHHHHHHLLLLLEEEHHhHHHHHHHHhHHHHHLLlEEEELL-LLLLHHHHH


DSSP  HHHHHlLHHHEEELLLLLLllllllllLLHHHHHHHHHHHHHhhlllHHHHHHHH-HHHH
Query KLVKQlPLTSICLETDSPAlgpekqvrNEPWNISISAEYIAQvkgisVEEVIEVT-TQNA  254
ident               || |                                |       | 
Sbjct IVINE-LPLKCIFGTDMPF--------GDLQLSIEAIKKMSN-----DSYVANAVlGDNI  256
DSSP  HHHHH-LLLLEELLLLLLL--------LLHHHHHHHHHHHLL-----LHHHHHHHhLHHH


DSSP  HHHLLLhhhhl
Query LKLFPKlrhll  265
ident   |        
Sbjct SRLLNI-----  262
DSSP  HHHHLL-----


No 8: Query=2y1hB Sbjct=2vc5A Z-score=18.5

back to top
DSSP  --------------llLEEEEEELLLLH---------------hHLLLHHHHHHHHHHLL
Query --------------gvGLVDCHCHLSAP---------------dFDRDLDDVLEKAKKAN   31
ident                 |    | ||                     |        |    
Sbjct mriplvgkdsieskdiGFTLIHEHLRVFseavrqqwphlynedeEFRNAVNEVKRAMQFG   60
DSSP  llllllllllllhhhlLLEELLLLLLLLlhhhhhhlhhhllhhhHHHHHHHHHHHHHHLL


DSSP  EEEEEELLLLHHHHHhhHHHHHHLL----LLEEEEELLLLEelllleELLHH-----hhh
Query VVALVAVAEHSGEFEkiMQLSERYN----GFVLPCLGVHPVqgldqrSVTLK-----dld   82
ident |   |                |              |                       
Sbjct VKTIVDPTVMGLGRD--IRFMEKVVkatgINLVAGTGIYIY------IDLPFyflnrsid  112
DSSP  LLEEEELLLLLLLLL--HHHHHHHHhlllLEEEELEELLLL------LLLLHhhllllhh


DSSP  hHHHHHHHHLL--------LLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHL
Query vALPIIENYKD--------RLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLN  134
ident                              |                 |        |   
Sbjct eIADLFIHDIKegiqgtlnKAGFV-XIAADEP-------giTKDVEKVIRAAAIANKETK  164
DSSP  hHHHHHHHHHHllllllllLLLLE-EEELLLL-------llLHHHHHHHHHHHHHHHHHL


DSSP  LLEEEEEE---LLHHHHHHHHHHLLLL--LEEEELL-LLLH-HHHHHHHHLLLEEE-ELH
Query LPVNVHSR---SAGRPTINLLQEQGAE--KVLLHAF-DGRP-SVAMEGVRAGYFFS-IPP  186
ident  |   ||      |      | | |    | |     |             | |      
Sbjct VPIITHSNahnNTGLEQQRILTEEGVDpgKILIGHLgDTDNiDYIKKIADKGSFIGlDRY  224
DSSP  LLEEEELLlllLHHHHHHHHHHHLLLLhhHEEELLHhHLLLhHHHHHHHHLLLEEEeLLL


DSSP  H---hHLLHHHHHHHHHL----LHHHEEELLLLL-----------llllLLLLlLLHHHH
Query S---iIRSGQKQKLVKQL----PLTSICLETDSP-----------algpEKQVrNEPWNI  228
ident                  |        |    |                           |
Sbjct GldlfLPVDKRNETTLRLikdgYSDKIMISHDYCctidwgtakpeykpkLAPR-WSITLI  283
DSSP  LllllLLHHHHHHHHHHHhhllLLLLEEELLLLLlllllllllhhhhhhHLLL-LLLLHH


DSSP  H-HHHHHHHHhHLLLhHHHHHHHH-HHHHHHLLlhhhhl
Query S-ISAEYIAQvKGISvEEVIEVTT-QNALKLFPklrhll  265
ident             |   ||||      |  | |       
Sbjct FeDTIPFLKR-NGVN-EEVIATIFkENPKKFFS------  314
DSSP  HhLHHHHHHL-LLLL-HHHHHHHHlHHHHHHLL------


No 9: Query=2y1hB Sbjct=2vunA Z-score=18.5

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------GV    2
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LEEEEEELLL----LHHHLLLhhHHHHHHHHLLEEEEEELLL------------LHHHH-
Query GLVDCHCHLS----APDFDRDldDVLEKAKKANVVALVAVAE------------HSGEF-   45
ident || | | | |    ||       |    |    |                          
Sbjct GLLDTHVHVSggdyAPRQKTM--DFISSALHGGVTTMISAGSphfpgrpkdaagTKALAi  118
DSSP  LEEEEEELLLllleEHHHLEE--LHHHHHHLLLEEEEEELLLlllllllllhhhHHHHHh


DSSP  HHHHHHHHHL--lLLEEE-EELLlleelllleellhhhHHHHH-HHHHHHLL-LLLEEEE
Query EKIMQLSERY--nGFVLP-CLGVhpvqgldqrsvtlkdLDVAL-PIIENYKD-RLLAIGE  100
ident                |                                  |       ||
Sbjct TLSKSYYNARpagVKVHGgAVIL---------------EKGLTeEDFIEMKKeGVWIVGE  163
DSSP  HHHHHHHHLLhhhLEEELlEELL---------------LLLLLhHHHHHHHHlLLLEEEE


DSSP  EEeellllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE--------LLHHHHHHHH
Query VGldfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR--------SAGRPTINLL  152
ident ||                           |      |  |                    
Sbjct VG-----------lgtikNPEDAAPMVEWAHKHGFKVQMHTGgtsipgssTVTADDVIKT  212
DSSP  EL-----------lllllLHHHHHHHHHHHHHLLLEEEEELLllllllllLLLHHHHHHH


DSSP  HhlllllEEEELL-----LLLHHHHHHHHH-LLLEEEELHHHhLLHHHHHHHHHL----L
Query QeqgaekVLLHAF-----DGRPSVAMEGVR-AGYFFSIPPSIiRSGQKQKLVKQL----P  202
ident                                      |                      
Sbjct K-----pDVVSHInggptAISVQEVDRIMDeTDFAMEIVQCG-NPKIADYVARRAaekgQ  266
DSSP  L-----lLEEELLlllllLLLHHHHHHHHHhLLLEEEEELLL-LHHHHHHHHHHHhhhlL


DSSP  HHHEEELLLLLLlllllLLLLLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHLlLHH
Query LTSICLETDSPAlgpekQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFpKLR  262
ident |       | |           |  |      ||    |  |      | |       | 
Sbjct LGRVIFGNDAPS-----GTGLIPLGILRNMCQIASMSDIDPEVAVCMATGNSTAVY-GLN  320
DSSP  HHHEEEELLLLL-----LLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHH-LLL


DSSP  H-----------------------------------------------------------
Query H-----------------------------------------------------------  263
ident                                                             
Sbjct Tgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakr  380
DSSP  Llllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllll


DSSP  ---hl
Query ---ll  265
ident      
Sbjct aakil  385
DSSP  lleel


No 10: Query=2y1hB Sbjct=1k6wA Z-score=18.1

back to top
DSSP  --------------------------------------------------LLLEEEEEEL
Query --------------------------------------------------GVGLVDCHCH   10
ident                                                       |  | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  LLLhHHLL--------------------------------LHHHHHHHHHHLLEEEEEEL
Query LSApDFDR--------------------------------DLDDVLEKAKKANVVALVAV   38
ident |                                            |              
Sbjct LDT-TQTAgqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRTH  119
DSSP  LLL-LLLLllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEEE


DSSP  LLL----HHHHHHHHHHHHHLL--LLEEEEELLLLEelllleELLHHHHHHHHHHHHHHl
Query AEH----SGEFEKIMQLSERYN--GFVLPCLGVHPVqgldqrSVTLKDLDVALPIIENYk   92
ident                                                             
Sbjct VDVsdatLTALKAMLEVKQEVApwIDLQIVAFPQEG-----iLSYPNGEALLEEALRLG-  173
DSSP  EELllllLHHHHHHHHHHHHHLllLEEEEEEELLLL-----lLLLLLHHHHHHHHHHLL-


DSSP  llLLEEeEEEEELlllllllhHHHHHHHHHHHHHHHHHHHHLLLEEEEEE-------LLH
Query drLLAIgEVGLDFsprfagtgEQKEEQRQVLIRQIQLAKRLNLPVNVHSR-------SAG  145
ident             |           |     |     ||        ||            
Sbjct --ADVV-GAIPHF-------eFTREYGVESLHKTFALAQKYDRLIDVHCDeiddeqsRFV  223
DSSP  --LLEE-EELHHH-------lLLHHHHHHHHHHHHHHHHHHLLEEEEEELlllllllLHH


DSSP  HHHHHHHHHLLLL-LEEEELLLLL--------hHHHHHHHHLLLEEEEL-HHHHLL----
Query RPTINLLQEQGAE-KVLLHAFDGR--------pSVAMEGVRAGYFFSIP-PSIIRS----  191
ident      |    |    |                          |  |       |      
Sbjct ETVAALAHHEGMGaRVTASHTTAMhsyngaytsRLFRLLKMSGINFVANpLVNIHLqgrf  283
DSSP  HHHHHHHHHHLLHhHEEEEELHHHhhllhhhhhHHHHHHHHHLLEEEELhHHHHHHllll


DSSP  ------HHHHhHHHHLL--hHHEEELLLLLlllllLLLLLLHHhHHHHHHHHHH--HHLL
Query ------GQKQkLVKQLP--lTSICLETDSPalgpeKQVRNEPWnISISAEYIAQ--VKGI  241
ident             ||         |   |                                
Sbjct dtypkrRGIT-RVKEMLesgINVCFGHDDV--fdpWYPLGTAN-MLQVLHMGLHvcQLMG  339
DSSP  llllllLLLL-LHHHHHhllLLEEELLLLL--lllLLLLLLLL-HHHHHHHHHHhlLLLL


DSSP  --LHHHHHHHHHHHHHHHLLlHHHH-----------------------------------
Query --SVEEVIEVTTQNALKLFPkLRHL-----------------------------------  264
ident            |         |                                      
Sbjct ygQINDGLNLITHHSARTLN-LQDYgiaagnsanliilpaengfdalrrqvpvrysvrgg  398
DSSP  hhHHHHHHHHHLHHHHHHLL-LLLLllllllllleeeellllhhhhhhhllllleeeell


DSSP  ------------------------l
Query ------------------------l  265
ident                          
Sbjct kviastqpaqttvyleqpeaidykr  423
DSSP  eeeeellllleeeellleeeellll


No 11: Query=2y1hB Sbjct=3mtwA Z-score=18.0

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------GVGL    4
ident                                                           ||
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEELLLLHH--------------HLLLHHHHHHHHHHLLEEEEEELLllhhHHHHHHH
Query VDCHCHLSAPD--------------FDRDLDDVLEKAKKANVVALVAVAehsgEFEKIMQ   50
ident  | | ||                            |   |       |            
Sbjct IDMHVHLDSLAevggynsleysdrfWSVVQTANAKKTLEAGFTTVRNVG---aADYDDVG  117
DSSP  EEEEELLLLLLlllhhhhhhllhhhHHHHHHHHHHHHHHLLEEEEEELL---lLLLHHHH


DSSP  HHHHLL------lLEEEE-ELLLL----EELLL---------leELLH-HHHHHHHHHHH
Query LSERYN------gFVLPC-LGVHP----VQGLD---------qrSVTL-KDLDVALPIIE   89
ident | |                                                   |     
Sbjct LREAIDagyvpgpRIVTAaISFGAtgghCDSTFfppsmdqknpfNSDSpDEARKAVRTLK  177
DSSP  HHHHHHlllllllEEEELlLLEELllllLLLLLllhhhllllllLLLLhHHHHHHHHHHH


DSSP  HHllLLLEEeEEEEEL---lLLLLllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEEL--L
Query NYkdRLLAIgEVGLDF---sPRFAgtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSRS--A  144
ident  |      |                                  |      |  |      
Sbjct KY--GAQVI-XICATGgvfsRGNE--pgqqqlTYEEMKAVVDEAHMAGIKVAAHAHGasG  232
DSSP  HL--LLLEE-EEELLLllllLLLL--llllllLHHHHHHHHHHHHHLLLEEEEEELLhhH


DSSP  HHHHHHHHhhlllllEEEELLL-LLHHHHHHHHHLLLEEEEL-HHHH-------------
Query GRPTINLLqeqgaekVLLHAFD-GRPSVAMEGVRAGYFFSIP-PSII-------------  189
ident  |                              |  |  ||                    
Sbjct IREAVRAG------vDTIEHASlVDDEGIKLAVQKGAYFSMDiYNTDytqaegkkngvle  286
DSSP  HHHHHHLL------lLEEEELLlLLHHHHHHHHHHLLEEELLlLLHHhhhhhhhhhlllh


DSSP  --------lLHHHHHHHHHLL--hhHEEELLLLLLllllllllLLHHHHHHHHHHHHHHH
Query --------rSGQKQKLVKQLP--ltSICLETDSPAlgpekqvrNEPWNISISAEYIAQVK  239
ident                               ||                            
Sbjct dnlrkdrdiGELQRENFRKALkagvKMVYGTDAGI--------YPHGDNAKQFAVMVRYG  338
DSSP  hhhhhhhhhHHHHHHHHHHHHhhllEEELLLLLLL--------LLLLLHHHHHHHHHHLL


DSSP  lllHHHHHHHH-HHHHHHHLLlHHHHL---------------------------------
Query gisVEEVIEVT-TQNALKLFPkLRHLL---------------------------------  265
ident             |  |                                            
Sbjct --aTPLQAIQSaTLTAAEALG-RSKDVgqvavgrygdmiavagdpladvttlekpvfvmk  395
DSSP  --lLHHHHHHHlLHHHHHHHL-LLLLLlllllllllleeeelllllllhhhhhllleeee


DSSP  ---------
Query ---------  265
ident          
Sbjct ggavvkapx  404
DSSP  lleeeelll


No 12: Query=2y1hB Sbjct=3irsA Z-score=17.8

back to top
DSSP  lLLEEEEEELL---LLHH-------------------------hlLLHHHHHHHHHHLLE
Query gVGLVDCHCHL---SAPD-------------------------fdRDLDDVLEKAKKANV   32
ident      |                                         |    |    |  
Sbjct -LKIIDFRLRPpamGFLNariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGI   59
DSSP  -LLLEELLLLLllhHHHHlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLL


DSSP  EEEEELLLL-----hhHHHHHHHHHHHLLLLEEEEELLlleelllleeLLHHHHHHHHHH
Query VALVAVAEH-----sgEFEKIMQLSERYNGFVLPCLGVhpvqgldqrsVTLKDLDVALPI   87
ident    | |                     |     |               | |        
Sbjct EQGVCVGRNssvlgsvSNADVAAVAKAYPDKFHPVGSI--------eaATRKEAMAQMQE  111
DSSP  LEEEEELLEellleelLHHHHHHHHHHLLLLEEEEEEL--------llLLHHHHHHHHHH


DSSP  HHHHllLLLEEeEEEEEllllllllhHHHH-hhHHHHHHHHHHHHHHLLLEEEEEE----
Query IENYkdRLLAIgEVGLDfsprfagtgEQKE-eqRQVLIRQIQLAKRLNLPVNVHSR----  142
ident |                                   |            ||         
Sbjct ILDL--GIRIV-NLEPG-------vwATPMhvdDRRLYPLYAFCEDNGIPVIMMTGgnag  161
DSSP  HHHL--LLLLE-EELHH-------hlLLLLlllLHHHHHHHHHHHHLLLLEEEELLllll


DSSP  ----LLHHHHHHHHHHLLL-LLEEEELL-LLLHHHHHHHHH--LLLEEEELHHHHLLHHh
Query ----SAGRPTINLLQEQGA-EKVLLHAF-DGRPSVAMEGVR--AGYFFSIPPSIIRSGQk  194
ident           |           |                         |           
Sbjct pditYTNPEHIDRVLGDFPdLTVVSSHGnWPWVQEIIHVAFrrPNLYLSPDMYLYNLPG-  220
DSSP  llhhHHLHHHHHHHHHHLLlLLEEEEHHhLLLHHHHHHHHHhlLLEEEELHHHHLLLLL-


DSSP  HHHHHHL----LHHHEEELLLLLLllllllllLLHH-HHHHHHHhhHHHHlllhHHHHHH
Query QKLVKQL----PLTSICLETDSPAlgpekqvrNEPW-NISISAEyiAQVKgisvEEVIEV  249
ident      |             |  |                          |        | 
Sbjct HADFIQAansfLADRMLFGTAYPM--------CPLKeYTEWFLT--LPIK----PDAMEK  266
DSSP  HHHHHHHhllhHHHLLLLLLLLLL--------LLHHhHHHHHHL--LLLL----HHHHHH


DSSP  H-HHHHHHHLLLhhhhl
Query T-TQNALKLFPKlrhll  265
ident     ||  |        
Sbjct IlHGNAERLLAQ--agr  281
DSSP  HhLHHHHHHHHH--lll


No 13: Query=2y1hB Sbjct=3mkvA Z-score=17.4

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------GVGLV    5
ident                                                          || 
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEELLLLHH-------------HLLLHHHHHHHHHHLLEEEEEELLllhhhhhHHHHHH
Query DCHCHLSAPD-------------FDRDLDDVLEKAKKANVVALVAVAehsgefeKIMQLS   52
ident | | |  |                                                    
Sbjct DLHVHVVAIEfnlprvatlpnvlVTLRAVPIMRAMLRRGFTTVRDAG------gAGYPFK  114
DSSP  EEEELLLLLLllhhhhllllhhhHHHHHHHHHHHHHHLLEEEEEELL------lLLHHHH


DSSP  HHLL------lLEEEEE-LLLL----EELLL--------------------leELLH-HH
Query ERYN------gFVLPCL-GVHP----VQGLD--------------------qrSVTL-KD   80
ident                                                             
Sbjct QAVEsglvegpRLFVSGrALSQtgghADPRArsdymppdspcgccvrvgalgrVADGvDE  174
DSSP  HHHHlllllllEEEELLlEEELllllLLLLLlllllllllllllllllllleeELLLhHH


DSSP  HHHHHHHHHHHllLLLEEeEEEEEL---lLLLLllhhhhhHHHHHHHHHHHHHHHHLLLE
Query LDVALPIIENYkdRLLAIgEVGLDF---sPRFAgtgeqkeEQRQVLIRQIQLAKRLNLPV  137
ident    |             |           |                      |      |
Sbjct VRRAVREELQM--GADQI-XIMASGgvasPTDP--vgvfgYSEDEIRAIVAEAQGRGTYV  229
DSSP  HHHHHHHHHHH--LLLLE-EEELLLllllLLLL--lllllLLHHHHHHHHHHHHLLLLLE


DSSP  EEEEEL--LHHHHHHHHhhlllllEEEELLL-LLHHHHHHHHHLLLEEEEL-HHHHL---
Query NVHSRS--AGRPTINLLqeqgaekVLLHAFD-GRPSVAMEGVRAGYFFSIP-PSIIR---  190
ident   |     |                            |      |               
Sbjct LAHAYTpaAIARAVRCG------vRTIEHGNlIDDETARLVAEHGAYVVPTlVTYDAlas  283
DSSP  EEEELLhhHHHHHHHLL------lLEEEELLlLLHHHHHHHHHHLLEEELLhHHHHHhhh


DSSP  ------------------LHHHHHHHHHLL--hhHEEELLLLLlllllllLLLLhHHHHH
Query ------------------SGQKQKLVKQLP--ltSICLETDSPalgpekqVRNEpWNISI  230
ident                    |                   ||                 | 
Sbjct egekyglppesiakiadvHGAGLHSIEIMKragvKMGFGTDLL-------GEAQ-RLQSD  335
DSSP  hlllllllhhhhllhhhhHLLHHHHHHHHHhhllLLLLLLLLL-------HHHH-HHLLH


DSSP  HHHHHHHHHllLHHHHHHHHHHHHHHHLLlHHHHL-------------------------
Query SAEYIAQVKgiSVEEVIEVTTQNALKLFPkLRHLL-------------------------  265
ident      | |   |  |||   |             |                         
Sbjct EFRILAEVL--SPAEVIASATIVSAEVLG-MQDKLgrivpgahadvlvvdgnplksvdcl  392
DSSP  HHHHHHLLL--LHHHHHHHLLHHHHHHLL-LLLLLlllllllllleeeelllllllllll


DSSP  ----------------------
Query ----------------------  265
ident                       
Sbjct lgqgehiplvmkdgrlfvnele  414
DSSP  lllllllleeeelleeeeelll


No 14: Query=2y1hB Sbjct=4dlfA Z-score=17.4

back to top
DSSP  lLLEEEEEELlLLHH----------------hLLLHHHHHHHHHHLLEEEEEELLL--LH
Query gVGLVDCHCHlSAPD----------------fDRDLDDVLEKAKKANVVALVAVAE--HS   42
ident      | | |                      |   |            |  ||      
Sbjct -ALRIDSHQH-FWRYraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQAraGR   58
DSSP  -LLLEEEEEL-LLLLlhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELLllLH


DSSP  HHHHHHHHHHHHlLLLE-EEEELLlleelllleellhhHHHHHHHHHHHHLLL-LLEEeE
Query GEFEKIMQLSERyNGFV-LPCLGVhpvqgldqrsvtlkDLDVALPIIENYKDR-LLAIgE  100
ident  |      |                                             |     
Sbjct DETAFLLELACD-EARIaAVVGWE------------dlRAPQLAERVAEWRGTkLRGF-R  104
DSSP  HHHHHHHHHHLL-LLLEeEEEELL------------llLLLLHHHHHHLLLLLlEEEE-E


DSSP  EEEELLLlllllhhHHHHHHH--hHHHHHHHHHHHLLLEEEEEE-LLHHHHHHHHHHLLL
Query VGLDFSPrfagtgeQKEEQRQ--vLIRQIQLAKRLNLPVNVHSR-SAGRPTINLLQEQGA  157
ident   |                       |             |                  |
Sbjct HQLQDEA-------DVRAFVDdadFARGVAWLQANDYVYDVLVFeRQLPDVQAFCARHDA  157
DSSP  ELHHHLL-------LHHHHHHlhhHHHHHHHHHHLLLEEEELLLhHHHHHHHHHHHHLLL


DSSP  LLEEEE-LLLL--------------LHHHHHHHHHLL-LEEEELHHH-----------hL
Query EKVLLH-AFDG--------------RPSVAMEGVRAG-YFFSIPPSI-----------iR  190
ident     |  |                       |                            
Sbjct HWLVLDhAGKPalaefdrddtalarWRAALRELAALPhVVCKLSGLVteadwrrglrasD  217
DSSP  LLEEEHhHHLLlhhhllllllhhhhHHHHHHHHHLLLlEEEEELLLLllllllllllhhH


DSSP  LHHHHHHHHHL----LHHHEEELLLLLLLLlllLLLLLhhHHHHHHHHHHHhHLLLhhHH
Query SGQKQKLVKQL----PLTSICLETDSPALGpekQVRNEpwNISISAEYIAQvKGISveEV  246
ident                         | |               |                 
Sbjct LRHIEQCLDAAldafGPQRLMFGSDWPVCL---LAASYdeVASLVERWAES-RLSA--AE  271
DSSP  HHHHHHHHHHHhhhhLHHHEEELLLLLHHH---HLLLHhhHHHHHHHHHHH-HLLH--HH


DSSP  HHHH-HHHHHHHlLLHHhhl
Query IEVT-TQNALKLfPKLRhll  265
ident         |      |    
Sbjct RSALwGGTAARC-YALP---  287
DSSP  HHHHlLHHHHHH-LLLL---


No 15: Query=2y1hB Sbjct=4c5yA Z-score=17.3

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------G    1
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  LLEEEEEELLLLHH----------------HLLLHHHHHHHHHHLLEEEEEELLllhhhh
Query VGLVDCHCHLSAPD----------------FDRDLDDVLEKAKKANVVALVAVAehsgef   45
ident  || ||| |    |                    |      |           |      
Sbjct PGLWDCHMHFGGDDdyyndytsglathpasSGARLARGCWEALQNGYTSYRDLA------  114
DSSP  ELEEEEEELLLLLLllllllhhhhhllhhhHHHHHHHHHHHHHHLLEEEEEELL------


DSSP  hHHHHHHHHLL------lLEEEE-ELLLL----EELLL----------------------
Query eKIMQLSERYN------gFVLPC-LGVHP----VQGLD----------------------   72
ident           |        |                                        
Sbjct gYGCEVAKAINdgtivgpNVYSSgAALSQtaghGDIFAlpagevlgsygvmnprpgywga  174
DSSP  lLHHHHHHHHHlllllllEEEELlLEEELllllLLLLLllhhhhhhhhllllllllllll


DSSP  ---leeLLHHHHHHHHHHHHHHllLLLEEeEEEEEL---lLLLLllhhhhhHHHHHHHHH
Query ---qrsVTLKDLDVALPIIENYkdRLLAIgEVGLDF---sPRFAgtgeqkeEQRQVLIRQ  126
ident               |             |  |                        |   
Sbjct gplciaDGVEEVRRAVRLQIRR--GAKVI-XVMASGgvmsRDDN--pnfaqFSPEELKVI  229
DSSP  lleeelLLHHHHHHHHHHHHHH--LLLLE-EEELLLllllLLLL--lllllLLHHHHHHH


DSSP  HHHHHHHLLLEEEEEEL--LHHHHHHHHhhlllllEEEELLLLLHH-HHHHHHHLLLEEE
Query IQLAKRLNLPVNVHSRS--AGRPTINLLqeqgaekVLLHAFDGRPS-VAMEGVRAGYFFS  183
ident    | | |  |  |          |            |         |       |    
Sbjct VEEAARQNRIVSAHVHGkaGIMAAIKAG------cKSLEHVSYADEeVWELMKEKGILYV  283
DSSP  HHHHHHLLLLEEEEELLhhHHHHHHHHL------lLEEEELLLLLHhHHHHHHHHLLEEE


DSSP  EL-HHHHL--------------------LHHHHHHHHHLL--hhHEEELLLLLlllllll
Query IP-PSIIR--------------------SGQKQKLVKQLP--ltSICLETDSPalgpekq  220
ident      |                           |           | | ||         
Sbjct ATrSVIEIflasngeglvkeswaklqalADSHLKAYQGAIkagvTIALGTDTA-------  336
DSSP  LLhHHHHHhhhhllllllllhhhlllhhHHHHHHHHHHHHhlllLEELLLLLL-------


DSSP  lllLHHHHHHHHHHHHHH-HLLLhHHHHHHHHHHHHHHL-LLHHH---------------
Query vrnEPWNISISAEYIAQV-KGISvEEVIEVTTQNALKLF-PKLRH---------------  263
ident                          | |   | ||     |                   
Sbjct ---PGGPTALELQFAVERgGMTP-LEAIKAATANAPLSVgPQAPLtgqlregyeadvial  392
DSSP  ---LLLLLHHHHHHHHHLlLLLH-HHHHHHHLLLHHHHHhHHLLLllllllllllleeee


DSSP  ------------------------------------------hl
Query ------------------------------------------ll  265
ident                                             
Sbjct eenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 16: Query=2y1hB Sbjct=2pajA Z-score=17.3

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------G    1
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLEEEEEELLlLHHH--------------LLLH-HHHHHHHHHLLEEEEEELLLLHH---
Query VGLVDCHCHLsAPDF--------------DRDL-DDVLEKAKKANVVALVAVAEHSG---   43
ident    |  | ||                    |      |                      
Sbjct PAWVNTHHHL-FQSLlkgepfralfderrFRLAaRIGLIELARSGCATVADHNYVYYpgm  119
DSSP  ELEELLLLLH-HHHHllllllhhhllhhhHHHHhHHHHHHHHLLLEEEEEELLLLLLlll


DSSP  hhHHHHHHHHHLL---LLEEEEELLLleELLL-----leellhHHHHHHHHHHHHHLL--
Query efEKIMQLSERYN---GFVLPCLGVHpvQGLD-----qrsvtlKDLDVALPIIENYKD--   93
ident        | |             |    |                ||     ||      
Sbjct pfDSSAILFEEAEklgLRFVLLRGGA-tQTRQleadlptalrpETLDAYVADIERLAAry  178
DSSP  llLHHHHHHHHHHhllLEEEEEELLL-lLLLLllllllhhhllLLHHHHHHHHHHHHHhl


DSSP  --------LLLEEEEE-EEELlllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE--
Query --------RLLAIGEV-GLDFsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR--  142
ident         |         |                          | || |    |    
Sbjct hdaspramRRVVMAPTtVLYS------------iSPREMRETAAVARRLGLRMHSHLSgk  226
DSSP  llllllllEEEEELLLlLLLL------------lLHHHHHHHHHHHHHLLLEEEEELLll


DSSP  lLHHHHHHHHhhllLLLEEEELLLLLHH-HHHHHHHLLLEEEEL-HHHHLLhhhhhHHHH
Query sAGRPTINLLqeqgAEKVLLHAFDGRPS-VAMEGVRAGYFFSIP-PSIIRSgqkqkLVKQ  200
ident                  |                   |        |  |       |  
Sbjct sPVAFCGEHD--wlGSDVWYAHLVKVDAdEIALLAQTGTGVAHCpQSNGRL-----PVRE  279
DSSP  lHHHHHHHLL--llLLLEEEELLLLLLHhHHHHHHHHLLEEEELhHHHHLL-----LLLL


DSSP  LL--hhHEEELLLLLLLLllllllLLHHhHHHHHHHHHHHHL---LLHHHhHHHH-HHHH
Query LP--ltSICLETDSPALGpekqvrNEPWnISISAEYIAQVKG---ISVEEvIEVT-TQNA  254
ident             |  |                              |  |      |   
Sbjct MAdagvPVSIGVDGAASN------EAAD-MISEVHMTWLAQRarlASIAE-VIHWgTAGG  331
DSSP  HHhhllLEEELLLHHHHL------LLLL-HHHHHHHHHHHHHhllLLHHH-HHHHhLHHH


DSSP  HHHLLlHHHH--------------------------------------------------
Query LKLFPkLRHL--------------------------------------------------  264
ident       |                                                     
Sbjct ARVMG-LDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrv  390
DSSP  HHHHL-LLLLlllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleee


DSSP  ------------------------------l
Query ------------------------------l  265
ident                                
Sbjct vvddliegvdikelggearrvvrellrevvv  421
DSSP  eellllllllhhhhhhhhhhhhhhhhhhhhl


No 17: Query=2y1hB Sbjct=4mupB Z-score=17.1

back to top
DSSP  --------------LLLEEEEEELLL----------lHHHL--LLHHHHHHHHHH-LLEE
Query --------------GVGLVDCHCHLS----------aPDFD--RDLDDVLEKAKK-ANVV   33
ident                 | ||   |                                    
Sbjct lvrklsgtapnpafPRGAVDTQMHMYlpgypalpggpGLPPgaLPGPEDYRRLMQwLGID   60
DSSP  llllllllllllllLLLLEELLLLLLlllllllllllLLLLllLLLHHHHHHHHHhHLLL


DSSP  EEEELL---LLHHhHHHHHHHHHHLLLLEEEEELLlleelllleellhhhHHHHH-HHHH
Query ALVAVA---EHSGeFEKIMQLSERYNGFVLPCLGVhpvqgldqrsvtlkdLDVAL-PIIE   89
ident                                                            |
Sbjct RVIITQgnaHQRD-NGNTLACVAEMGEAAHAVVII---------------DATTTeKDME  104
DSSP  EEEEELlhhHLLL-LHHHHHHHHHHHHHEEEEELL---------------LLLLLhHHHH


DSSP  HHLL-LLLEEeEEEEELLllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE-LLHHH
Query NYKD-RLLAIgEVGLDFSprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR-SAGRP  147
ident                                   |      |      | |         
Sbjct KLTAaGTVGA-RIMDLPG---------gavNLSELDAVDERAHAADWMVAVQFDgNGLLD  154
DSSP  HHHHlLEEEE-EEELLLL---------lllLHHHHHHHHHHHHHLLLEEEEELLhHHHHH


DSSP  HHHHHHHlLLLLEEEE-LLLL---------LHHHHHHHHHLL-LEEEELHH-------hH
Query TINLLQEqGAEKVLLH-AFDG---------RPSVAMEGVRAG-YFFSIPPS-------iI  189
ident     ||                                   |   |              
Sbjct HLPRLQK-IRSRWVFDhHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAGVyessrkswP  213
DSSP  HHHHHHL-LLLEEEELhHHHLllllllllhHHHHHHHHHHHLlEEEEELLHhhllllllL


DSSP  LLHhHHHHHHHL---LHHHEEELLLLLL--lllllLLLLlhhHHHHHHHHHHhhhlllHH
Query RSGqKQKLVKQL---PLTSICLETDSPA--lgpekQVRNepwNISISAEYIAqvkgisVE  244
ident                    |   |  |                                |
Sbjct YAD-VAAFSRVIaahAPERIVWGTNWPHnsvretaAYPDdarLAELTLGWLP------DE  266
DSSP  LHH-HHHHHHHHhhhLHHHEEELLLLLLlllllhhHLLLhhhHHHHHHLLLL------LH


DSSP  HHHHHH-HHHHHHHLlLHHHhl
Query EVIEVT-TQNALKLFpKLRHll  265
ident          |   || ||    
Sbjct AARHRAlVENPEALF-KLSP-v  286
DSSP  HHHHHHhLHHHHHHH-LLLL-l


No 18: Query=2y1hB Sbjct=3ls9A Z-score=17.0

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------GVGLV    5
ident                                                          || 
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  EEEELLLLHHH------------------------------------lLLHHHHHHHHHH
Query DCHCHLSAPDF------------------------------------dRDLDDVLEKAKK   29
ident   | ||                                               ||     
Sbjct NSHQHLYEGAMraipqlervtmaswlegvltrsagwwrdgkfgpdvirEVARAVLLESLL  120
DSSP  EEEELHHHHHHlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhHHHHHHHHHHHH


DSSP  LLEEEEEELLLLH------HHHHHHHHHHHHLLLLEEEEElLLLE-------eLLLLEEL
Query ANVVALVAVAEHS------GEFEKIMQLSERYNGFVLPCLgVHPV-------qGLDQRSV   76
ident                                                        |    
Sbjct GGITTVADQHLFFpgatadSYIDATIEAATDLGIRFHAAR-SSMTlgkseggfCDDLFVE  179
DSSP  LLEEEEEEEELLLllllllLHHHHHHHHHHHHLLEEEEEE-LLLLllhhhlllLLHHHLL


DSSP  LHHHHHHH-HHHHHHHLL------LLLEEeEEEEELLllllllhhhhhhHHHHHHHHHHH
Query TLKDLDVA-LPIIENYKD------RLLAIgEVGLDFSprfagtgeqkeeQRQVLIRQIQL  129
ident          |  |  |           |                              | 
Sbjct PVDRVVQHcLGLIDQYHEpepfgmVRIAL-GPCGVPY-----------dKPELFEAFAQM  227
DSSP  LHHHHHHHhHHHHHHHLLllllllEEEEE-LLLLLLL-----------lLHHHHHHHHHH


DSSP  HHHHLLLEEEEEE--------------lLHHHHH-HHHHhllLLLEEEELLLLLHH-HHH
Query AKRLNLPVNVHSR--------------sAGRPTI-NLLQeqgAEKVLLHAFDGRPS-VAM  173
ident |         |                   |              | |      |     
Sbjct AADYDVRLHTHFYepldagmsdhlygmtPWRFLEkHGWA---SDRVWLAHAVVPPReEIP  284
DSSP  HHHHLLEEEEEELlllhhhhhhhhhlllHHHHHHhLLLL---LLLEEEEELLLLLHhHHH


DSSP  HHHHLLLEEEEL-HHHH--LLHHHhhHHHHLL--hHHEEELLLLLLLLllllllLLHHhH
Query EGVRAGYFFSIP-PSII--RSGQKqkLVKQLP--lTSICLETDSPALGpekqvrNEPWnI  228
ident |   ||               |                   |   |              
Sbjct EFADAGVAIAHLiAPDLrmGWGLA--PIREYLdagITVGFGTTGSASN------DGGN-L  335
DSSP  HHHHHLLEEEELhHHHHhlLLLLL--LHHHHHhllLEEEELLLLLLLL------LLLL-H


DSSP  HHHHHHHHHHHL----------LLHHHHHHHHHHHHHHHLlLHHH---------------
Query SISAEYIAQVKG----------ISVEEVIEVTTQNALKLFpKLRH---------------  263
ident        |               |  |     |                           
Sbjct LGDLRLAALAHRpadpnepekwLSARELLRMATRGSAECL-GRPDlgvleegraadiacw  394
DSSP  HHHHHHHHHHLHhhllllhhhlLLHHHHHHHLLHHHHHHL-LLLLllllllllllleeee


DSSP  ---------------------------------------------------------hl
Query ---------------------------------------------------------ll  265
ident                                                            
Sbjct rldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  elllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 19: Query=2y1hB Sbjct=4cqbA Z-score=16.8

back to top
DSSP  ---------------------------------------------------LLLEEEEEE
Query ---------------------------------------------------GVGLVDCHC    9
ident                                                      | || | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  LLLLhHHLL------------------------------------LHHHHHHHHHHLLEE
Query HLSApDFDR------------------------------------DLDDVLEKAKKANVV   33
ident |     |                                                     
Sbjct HMDK-SFTStgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGTL  119
DSSP  LHHH-LLLLllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLEE


DSSP  EEEELLLL-----HHHHHHHHHHHHHLL--LLEEEEELLLLEelllleELLHHHHHHHHH
Query ALVAVAEH-----SGEFEKIMQLSERYN--GFVLPCLGVHPVqgldqrSVTLKDLDVALP   86
ident                  |      |                        | |        
Sbjct YTRTHVDVdsvakTKAVEAVLEAKEELKdlIDIQVVAFAQSG-----fFVDLESESLIRK  174
DSSP  EEEEEEELlllllLHHHHHHHHHHHHLLllLEEEEEEELLLL-----lLLLLLHHHHHHH


DSSP  HHHHHlllLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEEL---
Query IIENYkdrLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSRS---  143
ident                                     |     |||        |      
Sbjct SLDMG---CDLV-GGVDPAT--------rENNVEGSLDLCFKLAKEYDVDIDYHIHDigt  222
DSSP  HHHHL---LLEE-ELLLLLL--------lLLLHHHHHHHHHHHHHHLLLEEEEEELLlhh


DSSP  ----LHHHHHHHHHHLLLL-LEEEELLLL--------LHHHHHHHHHLLLEEEELHHHhl
Query ----AGRPTINLLQEQGAE-KVLLHAFDG--------RPSVAMEGVRAGYFFSIPPSIir  190
ident               | |    |                          |  |    |   
Sbjct vgvySINRLAQKTIENGYKgRVTTSHAWCfadapsewLDEAIPLYKDSGMKFVTCFSS-t  281
DSSP  hhhhHHHHHHHHHHHLLLLlLEEEEELLHhhhllhhhHHHHHHHHHHHLLEEEEELLL-l


DSSP  LHHHhhHHHHLL--hHHEEELLLLLlllllllLLLLHHhHHHHHHHHH--HHHL--LLHH
Query SGQKqkLVKQLP--lTSICLETDSPalgpekqVRNEPWnISISAEYIA--QVKG--ISVE  244
ident        |  |           |                    |                
Sbjct PPTM--PVIKLLeagINLGCASDNI--rdfwvPFGNGD-MVQGALIETqrLELKtnRDLG  336
DSSP  LLLL--LHHHHHhllLEEEEELLLL--lllllLLLLLL-HHHHHHHHHhhHLLLlhHHHH


DSSP  HHHH---HHHHHHHHhlllHHHH-------------------------------------
Query EVIE---VTTQNALKlfpkLRHL-------------------------------------  264
ident              |                                              
Sbjct LIWKmitSEGARVLG----IEKNygievgkkadlvvlnslspqwaiidqakrlcvikngr  392
DSSP  HHHHhhlHHHHHHHL----LHHHlllllllllleeeellllhhhhhhhllleeeeeelle


DSSP  ---------l
Query ---------l  265
ident           
Sbjct iivkdeviva  402
DSSP  eeeelleell


No 20: Query=2y1hB Sbjct=2gwgA Z-score=16.8

back to top
DSSP  llLEEEEEELlLLHH---------------------------------hlLLHHHH-HHH
Query gvGLVDCHCHlSAPD---------------------------------fdRDLDDV-LEK   26
ident      | | |                                               | |
Sbjct --XIIDIHGH-YTTApkaledwrnrqiagikdpsvxpkvselkisddelqASIIENqLKK   57
DSSP  --LLEEEEEE-LLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHLLhHHH


DSSP  HHHLLEEEEEELLL----------LHHHHHHHHHHHHHLLLLEEEEELLlleelllleeL
Query AKKANVVALVAVAE----------HSGEFEKIMQLSERYNGFVLPCLGVhpvqgldqrsV   76
ident          |                   |     |                        
Sbjct XQERGSDLTVFSPRagdfnvsstwAAICNELCYRVSQLFPDNFIGAAXL--------pqS  109
DSSP  HHHHLLLEEEEELLlllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEEEL--------llL


DSSP  LHHHHHHHHHHHHHHLL--LLLEEeEEEEEllllLLLLhHHHH-hhHHHHHHHHHHHHHH
Query TLKDLDVALPIIENYKD--RLLAIgEVGLDfsprFAGTgEQKE-eqRQVLIRQIQLAKRL  133
ident    |     |  |         ||     |      |                      |
Sbjct PGVDPKTCIPELEKCVKeyGFVAI-NLNPD---pSGGH-WTSPpltDRIWYPIYEKXVEL  164
DSSP  LLLLHHHHHHHHHHHHHllLLLEE-EELLL---lLLLL-LLLLlllLHHHHHHHHHHHHH


DSSP  LLLEEEE----------EELLHHHHHH-hHHHLL-LLLEEEEL-LLLLHH----------
Query NLPVNVH----------SRSAGRPTIN-lLQEQG-AEKVLLHA-FDGRPS----------  170
ident   |   |             |        |       |          |           
Sbjct EIPAXIHvstgahylnaDTTAFXQCVAgdLFKDFpELKFVIPHgGGAVPYhwgrfrglaq  224
DSSP  LLLEEELlllllhhhhhHHHHHHHHHHllHHHHLlLLLEEELHhHLLLHHhhhhhhhhhh


DSSP  ------hhHHHHhLLLEEEELHHHHllHHHHHHHHHLLHHHEEELLLLLLLLLLL--lll
Query ------vaMEGVrAGYFFSIPPSIIrsGQKQKLVKQLPLTSICLETDSPALGPEK--qvr  222
ident                 ||              |    |                      
Sbjct exkkplleDHVL-NNIFFDTCVYHQ--PGIDLLNTVIPVDNVLFASEXIGAVRGIdprtg  281
DSSP  hlllllhhHHLL-LLEEEELLLLLH--HHHHHHHHHLLHHHEELLLLLLLLLLLEellll


DSSP  llhhHHHHHHHHhHHHHlllHHHHHHHH-HHHHHHHLLLHHHHL--------
Query nepwNISISAEYiAQVKgisVEEVIEVT-TQNALKLFPKLRHLL--------  265
ident           |           |        ||    | |   |        
Sbjct fyydDTKRYIEA-STIL---TPEEKQQIyEGNARRVYPRLDAALkakgkleh  329
DSSP  eellLLHHHHHH-LLLL---LHHHHHHHhLHHHHHHLHHHHHHHhhhhhhll


No 21: Query=2y1hB Sbjct=1gkpA Z-score=16.7

back to top
DSSP  --------------------------------------------------LLLEEEEEEL
Query --------------------------------------------------GVGLVDCHCH   10
ident                                                     |  | | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  LLL-----HHHLlLHHHHHHHHHHLLEEEEEELLLL------HHHHHHHHHHHHHLL-lL
Query LSA-----PDFDrDLDDVLEKAKKANVVALVAVAEH------SGEFEKIMQLSERYN-gF   58
ident            |         |                               |      
Sbjct IYLpfmatFAKD-THETGSKAALMGGTTTYIEMCCPsrnddaLEGYQLWKSKAEGNSycD  119
DSSP  LLLeelleELLL-LHHHHHHHHHHLLEEEEEEEELLlllllhHHHHHHHHHHHLLLLllE


DSSP  EEEEELLLleelllleellhhHHHH-HHHHHHHHL-LLLLEEeEEEEELLllllllhhhh
Query VLPCLGVHpvqgldqrsvtlkDLDV-ALPIIENYK-DRLLAIgEVGLDFSprfagtgeqk  116
ident       |                |            |         |             
Sbjct YTFHMAVS-------------KFDEkTEGQLREIVaDGISSF-XIFLSYK-------nff  158
DSSP  EEEEEELL-------------LLLLlHHHHHHHHHhLLLLEE-EEEELLL-------lll


DSSP  hhHHHHHHHHHHHHHHHLLLEEEEEEL---------------------------------
Query eeQRQVLIRQIQLAKRLNLPVNVHSRS---------------------------------  143
ident             ||| |   |  |                                    
Sbjct gvDDGEMYQTLRLAKELGVIVTAHCENaelvgrlqqkllsegktgpewhepsrpeaveae  218
DSSP  llLHHHHHHHHHHHHHHLLEEEEEELLhhhhhhhhhhhhhlllllhhhllllllhhhhhh


DSSP  LHHHHHHHHHHLLLLlEEEELLLLL--HHHHHHHHH--LLLEEEELHH-HHLL-------
Query AGRPTINLLQEQGAEkVLLHAFDGR--PSVAMEGVR--AGYFFSIPPS-IIRS-------  191
ident         |   ||                ||                            
Sbjct GTARFATFLETTGAT-GYVVHLSCKpaLDAAMAAKArgVPIYIESVIPhFLLDktyaerg  277
DSSP  HHHHHHHHHHHHLLE-EEELLLLLHhhHHHHHHHHHllLLEEEEEEHHhHHLLhhhhhll


DSSP  ----------------HHHHHHHHHL-LHHHEEELLLLL------------llllllLLL
Query ----------------GQKQKLVKQL-PLTSICLETDSP------------algpekQVR  222
ident                      |   |         ||                       
Sbjct gveamkyimspplrdkRNQKVLWDALaQGFIDTVGTDHCpfdteqkllgkeaftaipNGI  337
DSSP  hhhhhlllllllllllHHHHHHHHHHhLLLLLEEELLLLlllhhhhhhhlllhhhllLLL


DSSP  LLHHHHH-HHHHHHH--HHHLllhHHHHHHH-HHHHHHHLLlHHHHL-------------
Query NEPWNIS-ISAEYIA--QVKGisvEEVIEVT-TQNALKLFPkLRHLL-------------  265
ident             |                      | |||  |                 
Sbjct PAIEDRVnLLYTYGVsrGRLD---IHRFVDAaSTKAAKLFG-LFPRKgtiavgsdadlvv  393
DSSP  LLLLLHHhHHHHHHLllLLLL---HHHHHHHhLHHHHHHLL-LLLLLlllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct ydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrr  453
DSSP  eelllleellhhhllllllllllllleelleeeeeeelleeeeelleellllllllllll


DSSP  -----
Query -----  265
ident      
Sbjct epmyf  458
DSSP  lllll


No 22: Query=2y1hB Sbjct=3nqbA Z-score=16.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ----------------LLLEEEEEELLLLhhHLLLHHHHHHHHHHLLEEEEEELLL----
Query ----------------GVGLVDCHCHLSApdFDRDLDDVLEKAKKANVVALVAVAE----   40
ident                   || | | |                     |   |        
Sbjct srrdaaqvidaggayvSPGLIDTHXHIES--SXITPAAYAAAVVARGVTTIVWDPHefgn  118
DSSP  lllleeeeeelllleeEELEEEEEELHHH--HLLLHHHHHHHHHLLLEEEEEELLHhhhh


DSSP  --LHHHHHHHHHHHHHLlLLEEEEELLLleelllleELLH-------HHHHHHHHHHHHH
Query --HSGEFEKIMQLSERYnGFVLPCLGVHpvqgldqrSVTL-------KDLDVALPIIENY   91
ident               |                                      |      
Sbjct vhGVDGVRWAAKAIENLpLRAILLAPSC-------vPSAPglerggaDFDAAILADLLSW  171
DSSP  hhLHHHHHHHHHHHLLLlLEEEEEELLL-------lLLLLlllllllLLLHHHHHHHHLL


DSSP  lLLLLEEEEEEEELlllllllhhhhhhhHHHHHHHHHHHHHHLLLEEEEEElLHHH-hHH
Query kDRLLAIGEVGLDFsprfagtgeqkeeqRQVLIRQIQLAKRLNLPVNVHSRsAGRP-tIN  150
ident       | |                           |        |  | |        |
Sbjct -PEIGGIAEIXNXR---------gvierDPRXSGIVQAGLAAEKLVCGHAR-GLKNadLN  220
DSSP  -LLEEEEEEELLHH---------hhhllLHHHHHHHHHHHHHLLEEEELLL-LLLHhhHH


DSSP  HHHHLLLllEEEElLLLLHHHHHHHHHLLLEEEELHHHHllHHHHHHHHHL-----LHHH
Query LLQEQGAekVLLHaFDGRPSVAMEGVRAGYFFSIPPSIIrsGQKQKLVKQL-----PLTS  205
ident      |      |             |||       |          |  |         
Sbjct AFXAAGV--SSDH-ELVSGEDLXAKLRAGLTIELRGSHD--HLLPEFVAALntlghLPQT  275
DSSP  HHHHLLL--LEEL-LLLLHHHHHHHHHLLLEEEEELLLH--HHHHHHHHHHhhhllLLLL


DSSP  EEELLLLLLllllllLLLL--hHHHHHHHHHHHHHHlLLHHHHHHHHHHHHHHHLlLHHH
Query ICLETDSPAlgpekqVRNE--pWNISISAEYIAQVKgISVEEVIEVTTQNALKLFpKLRH  263
ident   | ||                                  |      | ||         
Sbjct VTLCTDDVF------PDDLlqgGGLDDVVRRLVRYG-LKPEWALRAATLNAAQRL-GRSD  327
DSSP  EEEELLLLL------HHHHhhlLLHHHHHHHHHHLL-LLHHHHHHHHLHHHHHHH-LLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct lgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplr  387
DSSP  llllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct xandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaept  447
DSSP  lhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct tktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvt  507
DSSP  eeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  263
ident                                                             
Sbjct ailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqt  567
DSSP  eeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleel


DSSP  ------------------hl
Query ------------------ll  265
ident                     
Sbjct dxgiadvltgkvxespviev  587
DSSP  llleeelllleeellleeel


No 23: Query=2y1hB Sbjct=1onxA Z-score=16.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  LLLEEEEEELLLL---------HHHLllhhhHHHHHHHLLEEEEEELLL---lhHHHHHH
Query GVGLVDCHCHLSA---------PDFDrdlddVLEKAKKANVVALVAVAE---hsGEFEKI   48
ident   |  | | ||                     |     | |   |            |  
Sbjct CPGFIDQHVHLIGgggeagpttRTPE----vALSRLTEAGVTSVVGLLGtdsisRHPESL  116
DSSP  EELEEEEEELLLLllllllhhhLLLL----lLHHHHHHLLEEEEEELLLlllllLLHHHH


DSSP  HHHHHHLL---LLEEEEELLLLEelllleellhhhhhhHHHH-----HHHHlLLLLEEeE
Query MQLSERYN---GFVLPCLGVHPVqgldqrsvtlkdldvALPI-----IENYkDRLLAIgE  100
ident        |          |   |                             ||      
Sbjct LAKTRALNeegISAWMLTGAYHV------------psrTITGsvekdVAII-DRVIGV-X  162
DSSP  HHHHHHHHhhlLEEEEEEELLLL------------lllLLLLlhhhhHHHL-LLEEEE-E


DSSP  EEEELLllllllhhHHHHhHHHHHHHHHHHHHHL------LLEEEEEELL--HHHHHHHH
Query VGLDFSprfagtgeQKEEqRQVLIRQIQLAKRLN------LPVNVHSRSA--GRPTINLL  152
ident                       |                      |          |  |
Sbjct CAISDH------rsAAPD-VYHLANMAAESRVGGllggkpGVTVFHMGDSkkALQPIYDL  215
DSSP  EEELLL------llLLLL-HHHHHHHHHHHHHHHhhhlllLEEEEEELLLllLLHHHHHH


DSSP  HH---LLLLLEEEELL-LLLH--HHHHHHHHLLLEEEELHHHhLLHHH-hHHHHHL----
Query QE---QGAEKVLLHAF-DGRP--SVAMEGVRAGYFFSIPPSIiRSGQK-qKLVKQL----  201
ident  |       | |        |    | |  | |    |  ||                  
Sbjct LEncdVPISKLLPTHVnRNVPlfEQALEFARKGGTIDITSSI-DEPVApaEGIARAvqag  274
DSSP  HHlllLLHHHEEEELHhHLHHhhHHHHHHHHLLLLEEEELLL-LLLLLhhHHHHHHhhll


DSSP  -LHHHEEELLLLLL--------llllLLLLLLHHHHHHHHHHHHHHHLLLHHHHhHHHH-
Query -PLTSICLETDSPA--------lgpeKQVRNEPWNISISAEYIAQVKGISVEEViEVTT-  251
ident  ||    |  |                                      |          
Sbjct iPLARVTLSSDGNGsqpffddegnltHIGVAGFETLLETVQVLVKDYDFSISDA-LRPLt  333
DSSP  lLHHHEEEELLLLLeeeeellllleeEEEELLLHHHHHHHHHHHHHHLLLHHHH-HHHHl


DSSP  HHHHHHLLlHHHH--------------------------------------------l
Query QNALKLFPkLRHL--------------------------------------------l  265
ident          |                                                
Sbjct SSVAGFLN-LTGKgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  HHHHHHLL-LLLLlllllllllleeeellllleeeeeelleeeeelleelllllllll


No 24: Query=2y1hB Sbjct=3icjA Z-score=16.6

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------GV    2
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LEEEEEELLLLhHHLLL-------------------------------------------
Query GLVDCHCHLSApDFDRD-------------------------------------------   19
ident    | | ||                                                   
Sbjct AFFDSHLHLDE-LGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  LEEEEEELHHH-HHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   19
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll


DSSP  ---------HHHHHHHHHHLLEEEEEELLllhhhHHHHHHHHHHLL------LLEEEEEL
Query ---------LDDVLEKAKKANVVALVAVAehsgeFEKIMQLSERYN------GFVLPCLG   64
ident               |      |             ||                 |   | 
Sbjct ltvkdykhyIESAQEHLLSLGVHSVGFMS----vGEKALKALFELEregrlkMNVFAYLS  235
DSSP  llhhhhhhhHHHHHHHHHHLLEEEEEEEE----eLHHHHHHHHHHHhlllllLEEEEEEL


DSSP  LlleelllleellhhhhhHHHHHHH---HHLLL-----LLEEeEEEEEL-----------
Query VhpvqgldqrsvtlkdldVALPIIE---NYKDR-----LLAIgEVGLDF-----------  105
ident                     |   |     |                |            
Sbjct P-----------------ELLDKLEelnLGKFEgrrlrIWGV-XLFVDGslgartallse  277
DSSP  H-----------------HHHHHHHhhlLLLEEllleeEEEE-EEELLLlllllllllll


DSSP  -------lLLLLllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEEL--LHHHHHHHHHHLL
Query -------sPRFAgtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSRS--AGRPTINLLQEQG  156
ident                             |  || | | | ||     |         |  
Sbjct pytdnpttSGEL------vmNKDEIVEVIERAKPLGLDVAVHAIGdkAVDVALDAFEEAE  331
DSSP  llllllllLLLL------llLHHHHHHHHHHHLLLLLEEEEEELLhhHHHHHHHHHHHHL


DSSP  LLlEEEELLLLLHH-HHHHHHHLLLEEEEL-HHHHLL------------HHHHhHHHHLL
Query AEkVLLHAFDGRPS-VAMEGVRAGYFFSIP-PSIIRS------------GQKQkLVKQLP  202
ident                            |     |                      | | 
Sbjct FS-GRIEHASLVRDdQLERIKELKVRISAQpHFIVSDwwivnrvgeeraKWAY-RLKTLS  389
DSSP  LL-LEEEELLLLLHhHHHHHHHHLLEEEELlLHHHHLllhhhhhhhhhhHHLL-LHHHHH


DSSP  H-hHEEELLLLLLllllllllLLHHhHHHHHHHHHH--------HHLLlhHHHHHHHHHH
Query L-tSICLETDSPAlgpekqvrNEPWnISISAEYIAQ--------VKGIsvEEVIEVTTQN  253
ident         ||||                 |                    ||     |  
Sbjct SitKLGFSTDSPI--------EPAD-PWVSIDAAVNryvvdpgeRVSR--EEALHLYTHG  438
DSSP  HhlLEEELLLLLL--------LLLL-HHHHHHHHHHlllllhhhLLLH--HHHHHHLLHH


DSSP  HHHHLlLHHH-------------------hl
Query ALKLFpKLRH-------------------ll  265
ident                                
Sbjct SAQVT-LAEDlgklergfraeyiildrdplk  468
DSSP  HHHHL-LLLLllllllllllleeeellllll


No 25: Query=2y1hB Sbjct=2imrA Z-score=16.6

back to top
DSSP  -----------------------------------------------------LLLEEEE
Query -----------------------------------------------------GVGLVDC    7
ident                                                          |  
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleeLLLLLEE


DSSP  EELLLL---------------------HHHL--LLHHHHHHHHHHLLEEEEEELLLlhhH
Query HCHLSA---------------------PDFD--RDLDDVLEKAKKANVVALVAVAEhsgE   44
ident | ||                                                        
Sbjct HTHLDMsayefqalpyfqwipevvirgRHLRgvAAAQAGADTLTRLGAGGVGDIVW---A  117
DSSP  EEELLLlhhhhhhlhhhhllhhhhhhhLLLLhhHHHHHHHHHHHHLLLLLEEEEEL---L


DSSP  HHHHHHHHHHLLLLEEEEELLLLEelllleeLLHHHHHHHHHHHHHHLLL-----LLEEe
Query FEKIMQLSERYNGFVLPCLGVHPVqgldqrsVTLKDLDVALPIIENYKDR-----LLAIg   99
ident  |    |  |          |                  |    |           |   
Sbjct PEVMDALLAREDLSGTLYFEVLNP----fpdKADEVFAAARTHLERWRRLerpglRLGL-  172
DSSP  HHHHHHHHLLLLLLEEEEEEELLL----lhhHHHHHHHHHHHHHHHHHLLlllleEEEE-


DSSP  EEEEELlllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE-----------------
Query EVGLDFsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR-----------------  142
ident      |                        |    ||   |                   
Sbjct SPHTPF-----------tvSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplw  221
DSSP  EELLLL-----------llLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllh


DSSP  ------------------------LLHHHHHH-HHHHlllLLEEEELLLLLHH-HHHHHH
Query ------------------------SAGRPTIN-LLQEqgaEKVLLHAFDGRPS-VAMEGV  176
ident                            |                |               
Sbjct dnrmpalyphtlaevigrepgpdlTPVRYLDElGVLA---ARPTLVHMVNVTPdDIARVA  278
DSSP  hhllhhhllllhhhhhllllllllLHHHHHHHhLLHH---HLLEEEELLLLLHhHHHHHH


DSSP  HLLLEEEEL-HHHH--LLHHHhhHHHHLL--hHHEEELLLLLLLLllllllLLHHhHHHH
Query RAGYFFSIP-PSII--RSGQKqkLVKQLP--lTSICLETDSPALGpekqvrNEPWnISIS  231
ident |||        |      |                 | ||| | |               
Sbjct RAGCAVVTCpRSNHhlECGTF--DWPAFAaagVEVALGTDSVASG------ETLN-VREE  329
DSSP  HHLLLEEELhHHHHhlLLLLL--LHHHHHhllLLEEELLLLHHHH------LLLL-LHHH


DSSP  HHHHHHHHL-LLHHHHHHHHHHHHHHHLL----------------lhhhhl
Query AEYIAQVKG-ISVEEVIEVTTQNALKLFP----------------klrhll  265
ident      |                                             
Sbjct VTFARQLYPgLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  HHHHHHHLLlLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 26: Query=2y1hB Sbjct=2ffiA Z-score=16.5

back to top
DSSP  -llLEEEEEELLL--------------lHHHLllHHHHHHHHHHLLEEEEEELLL---LH
Query -gvGLVDCHCHLS--------------aPDFDrdLDDVLEKAKKANVVALVAVAE---HS   42
ident       | | |                  |    | | |           | |       
Sbjct lhlTAIDSHAHVFsrglnlasqrryapnYDAP--LGDYLGQLRAHGFSHGVLVQPsflGT   58
DSSP  lllLLEELLLLLLlhhhhhhllllllllLLLL--HHHHHHHHHHLLLLEELLLLLhhhLL


DSSP  HHhHHHHHHHHHLLLLEEEEELLlleelllleellhhHHHHhHHHHHHHLLL-LLEEeEE
Query GEfEKIMQLSERYNGFVLPCLGVhpvqgldqrsvtlkDLDVaLPIIENYKDR-LLAIgEV  101
ident               |                        ||                   
Sbjct DN-RYLLSALQTVPGQLRGVVXL--------------ERDVeQATLAEXARLgVRGV-RL  102
DSSP  LL-HHHHHHHHHLLLLLLLLLLL--------------LLLLlHHHHHHHHLLlLLEE-EL


DSSP  EEELLllllllhhHHHHHHH-hHHHHHHHHHHHLLLEEEEEE-LLHHHHHHHHHHLLLlL
Query GLDFSprfagtgeQKEEQRQ-vLIRQIQLAKRLNLPVNVHSR-SAGRPTINLLQEQGAeK  159
ident  |                                  |  |            ||  |   
Sbjct NLXGQ--------DXPDLTGaqWRPLLERIGEQGWHVELHRQvADIPVLVRALQPYGL-D  153
DSSP  LLLLL--------LLLLLLLllLHHHHHHHHHHLLEEEELLLlLLHHHHHHHHLLLLL-L


DSSP  EEEE-LLLL----------LHHHHHHhHHLLLEEEELHHH-------hLLHHHHHHHHHL
Query VLLH-AFDG----------RPSVAMEgVRAGYFFSIPPSI-------iRSGQKQKLVKQL  201
ident                             |                              |
Sbjct IVIDhFGRPdarrglgqpgFAELLTLsGRGKVWVKVSGIYrlqgspeeNLAFARQALCAL  213
DSSP  EEELhHHLLllllllllllHHHHLLLlLLLLEEEEEELHHhllllhhhHHHHHHHHHHHH


DSSP  L----HHHEEELLLLLLlllLLLLLLLhhHHHHHHHHHHhhhlllHHHHHHHH-HHHHHH
Query P----LTSICLETDSPAlgpEKQVRNEpwNISISAEYIAqvkgisVEEVIEVT-TQNALK  256
ident              | |                                         |  
Sbjct EahygAERLXWGSDWPH-tqHESEVSFgsAVEQFEALGC------SAQLRQALlLDTARA  266
DSSP  HhhllHHHEEEELLLLL-llLLLLLLHhhHHHHHHHHLL------LHHHHHHHhLHHHHH


DSSP  HLlLHHHhl
Query LFpKLRHll  265
ident ||       
Sbjct LF-GFEL-e  273
DSSP  HL-LLLL-l


No 27: Query=2y1hB Sbjct=1j6pA Z-score=16.5

back to top
DSSP  -------------------------------------------------LLLEEEEEELL
Query -------------------------------------------------GVGLVDCHCHL   11
ident                                                     |   | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  LLHHH-----------------------------lLLHHHHHHHHHHLLEEEEEELLllh
Query SAPDF-----------------------------dRDLDDVLEKAKKANVVALVAVAehs   42
ident                                                      |      
Sbjct PXTLLrgvaedlsfeewlfskvlpiedrltekxayYGTILAQXEXARHGIAGFVDXY---  117
DSSP  HHHHHllllllllhhhhhhllhhhhhllllhhhhhHHHHHHHHHHHLLLEEEEEEEE---


DSSP  hhhHHHHHHHHHLL---LLEEEEELLLleelllleeLLHHHHHHHHHHHHHHLLL-----
Query gefEKIMQLSERYN---GFVLPCLGVHpvqgldqrsVTLKDLDVALPIIENYKDR-----   94
ident                     |   |               |    |              
Sbjct ---FHEEWIAKAVRdfgXRALLTRGLV---------DSNGDDGGRLEENLKLYNEwngfe  165
DSSP  ---LLHHHHHHHHHhhlLEEEEEEEEL---------LLLLLLLLHHHHHHHHHHHhllhh


DSSP  ---LLEEEEEEEEllllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE---LLHHHh
Query ---LLAIGEVGLDfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR---SAGRPt  148
ident        |                       | |    || || ||  |           
Sbjct griFVGFGPHSPY------------lcSEEYLKRVFDTAKSLNAPVTIHLYetsKEEYD-  212
DSSP  hleEEEEEELLLL------------llLHHHHHHHHHHHHHHLLLEEEEELlllLLLLL-


DSSP  HHHHHHLLL--LLEEEELLL-LLHHHHHHHHHLLLEEEEL-HHHH--LLHHHhhHHHHLL
Query INLLQEQGA--EKVLLHAFD-GRPSVAMEGVRAGYFFSIP-PSII--RSGQKqkLVKQLP  202
ident        |    |                      | |    |      |     |    
Sbjct LEDILNIGLkeVKTIAAHCVhLPERYFGVLKDIPFFVSHNpASNLklGNGIA--PVQRXI  270
DSSP  LHHHHLLLLllLLEEEEELLlLLHHHHHHHLLLLEEEEELhHHHHhlLLLLL--LHHHHH


DSSP  --hHHEEELLLLLLLLllllllLLHHhHHHHHHHHHHHHL------LLHHHHHHHHHHHH
Query --lTSICLETDSPALGpekqvrNEPWnISISAEYIAQVKG------ISVEEVIEVTTQNA  254
ident        | ||  |        |                         |       |   
Sbjct ehgXKVTLGTDGAASN------NSLN-LFFEXRLASLLQKaqnprnLDVNTCLKXVTYDG  323
DSSP  hllLEEEELLLLLLLL------LLLL-HHHHHHHHHHHHHllllllLLHHHHHHHHLHHH


DSSP  HHHlLLHH----------------------------------------------------
Query LKLfPKLR----------------------------------------------------  262
ident                                                             
Sbjct AQA-XGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyf  382
DSSP  HHH-HLLLllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeee


DSSP  ----------------------hhl
Query ----------------------hll  265
ident                          
Sbjct dgeyptidseevkrelariekelys  407
DSSP  llllllllhhhhhhhhhhhhhhhhl


No 28: Query=2y1hB Sbjct=2ogjA Z-score=16.4

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------GVGLVD    6
ident                                                         | ||
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE


DSSP  EEELLL---LHHHlllhhhHHHH-HHHLLEEEEEELL-LLHHHHHHHHH-HHHHLLLLEE
Query CHCHLS---APDFdrdlddVLEK-AKKANVVALVAVA-EHSGEFEKIMQ-LSERYNGFVL   60
ident  | |                         |  ||         |        |       
Sbjct LHVHIWhggTDIS-----iRPSEcGAERGVTTLVDAGsAGEANFHGFREyIIEPSRERIK  115
DSSP  EEELLLlllLLLL-----lLHHHlLHHHLEEEEEEELlLLLLLHHHHHHhLLLLLLLEEE


DSSP  EEELLL---leellLLEEL-LHHHHH--HHHHHHHHHLLLLLEEeEEEEELLLlllllhh
Query PCLGVH---pvqglDQRSV-TLKDLD--VALPIIENYKDRLLAIgEVGLDFSPrfagtge  114
ident   |                   || |    |               |             
Sbjct AFLNLGsiglvacnRVPELrDIKDIDldRILECYAENSEHIVGL-XVRASHVI------t  168
DSSP  EEEELLllllllllLLLLLlLHHHLLhhHHHHHHHLLLLLEEEE-EEEELHHH------h


DSSP  HHHHhHHHHHHHHHHHHHHLLLEEEEEEL---LHHHHHHHHhhllLLLEEEELL------
Query QKEEqRQVLIRQIQLAKRLNLPVNVHSRS---AGRPTINLLqeqgAEKVLLHAF------  165
ident                || |  |  ||              |                   
Sbjct GSWG-VTPVKLGKKIAKILKVPXXVHVGEppaLYDEVLEIL----GPGDVVTHCfngksg  223
DSSP  LLLL-LHHHHHHHHHHHHHLLLEEEEELLlllLHHHHHHHL----LLLLEEELLllllll


DSSP  LLLHH---HHHHHHHL-LLEEEE-LHHHhllhhHHHHHHHLL---hHHEEELLLLLllll
Query DGRPS---VAMEGVRA-GYFFSI-PPSIirsgqKQKLVKQLP---lTSICLETDSPalgp  217
ident               |  |    |            |                ||      
Sbjct SSIXEdedLFNLAERCeGIRLDIgHGGA---sfSFKVAEAAIarglLPFSISTDLH----  276
DSSP  LLLLLlhhHHHHHHHLlLLEEELlLLLL---llLHHHHHHHHhlllLLLLLLLLLL----


DSSP  lllLLLL---hHHHHHHHHHHHHHHLLLhhHHHHHH-HHHHHHhLLLHH-----------
Query ekqVRNE---pWNISISAEYIAQVKGISveEVIEVT-TQNALKlFPKLR-----------  262
ident            |           |      |      | |       |            
Sbjct ---GHSXnfpvWDLATTXSKLLSVDXPF--ENVVEAvTRNPAS-VIRLDxenrldvgqra  330
DSSP  ---LLLLllllLLHHHHHHHHHHLLLLH--HHHHHLlLHHHHH-HLLLLlllllllllll


DSSP  ----------------------------------------------hhl
Query ----------------------------------------------hll  265
ident                                                  
Sbjct dftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 29: Query=2y1hB Sbjct=4b3zD Z-score=16.3

back to top
DSSP  ---------------------------------------------------LLLEEEEEE
Query ---------------------------------------------------GVGLVDCHC    9
ident                                                      |  |   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE


DSSP  LLLLhhhLLLH-HHHHHHHHHLLEEEEEELLLL------HHHHHHHHHHHHHLL-lLEEE
Query HLSApdfDRDL-DDVLEKAKKANVVALVAVAEH------SGEFEKIMQLSERYN-gFVLP   61
ident  |       |        |                       |||               
Sbjct YLQK--tAADDfFQGTRAALVGGTTMIIDHVVPepgsslLTSFEKWHEAADTKSccDYSL  118
DSSP  LLLL--lLLLLhHHHHHHHHHLLEEEEEEEELLlllllhHHHHHHHHHHHHLLLllEEEE


DSSP  EELLLleelllleellhhHHHH-HHHHHHHHL--LLLLEEeEEEEElLLLLlllhhhhhH
Query CLGVHpvqgldqrsvtlkDLDV-ALPIIENYK--DRLLAIgEVGLDfSPRFagtgeqkeE  118
ident                             |             |                 
Sbjct HVDIT-------------SWYDgVREELEVLVqdKGVNSF-QVYMA-YKDV------yqM  157
DSSP  EEELL-------------LLLLlHHHHHHHHHhlLLLLEE-EEELL-LLLL------llL


DSSP  HHHHHHHHHHHHHHHLLLEEEEEEL---------------------------------LH
Query QRQVLIRQIQLAKRLNLPVNVHSRS---------------------------------AG  145
ident     |       | |     ||                                    | 
Sbjct SDSQLYEAFTFLKGLGAVILVHAENgdliaqeqkrilemgitgpeghalsrpeeleaeAV  217
DSSP  LHHHHHHHHHHHHHHLLEEEEELLLhhhhhhhhhhhhhllllllhhhhhhllhhhhhhHH


DSSP  HHHHHHHHHLLLLlEEEELLLLL--HHHHHHHHH--LLLEEEELHH-HHLL---------
Query RPTINLLQEQGAEkVLLHAFDGR--PSVAMEGVR--AGYFFSIPPS-IIRS---------  191
ident    |          |                        |                    
Sbjct FRAITIAGRINCP-VYITKVMSKsaADIIALARKkgPLVFGEPIAAsLGTDgthywsknw  276
DSSP  HHHHHHHHHHLLL-EEEEEELLHhhHHHHHHHHHhlLLEEEEELHHhHHLLlhhhhlllh


DSSP  ----------------HHHHHHHHHL-LHHHEEELLLLL------------llllllLLL
Query ----------------GQKQKLVKQL-PLTSICLETDSP------------algpekQVR  222
ident                      |   |                                  
Sbjct akaaafvtspplspdpTTPDYLTSLLaCGDLQVTGSGHCpystaqkavgkdnftlipEGV  336
DSSP  hhhhhlllllllllllLHHHHHHHHHhHLLLLLLLLLLLlllhhhhhhhlllhhhllLLL


DSSP  LLHHHHHHHHH-HHHHHHLLLhHHHHHHH-HHHHHHHLLlHHHHL---------------
Query NEPWNISISAE-YIAQVKGISvEEVIEVT-TQNALKLFPkLRHLL---------------  265
ident |                     |         || | |  |                   
Sbjct NGIEERMTVVWdKAVATGKMD-ENQFVAVtSTNAAKIFN-LYPRKgriavgsdadvviwd  394
DSSP  LLLLLHHHHHHhHHLLLLLLL-HHHHHHHhLHHHHHHHL-LLLLLlllllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct pdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprka  454
DSSP  eeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllll


DSSP  -----------------------
Query -----------------------  265
ident                        
Sbjct fpehlyqrvkirnkvfglqgvsr  477
DSSP  llhhhhhhhhhhhhhllllllll


No 30: Query=2y1hB Sbjct=1yrrB Z-score=16.2

back to top
DSSP  --------------------------------------------------LLLEEEEEEL
Query --------------------------------------------------GVGLVDCHCH   10
ident                                                     |  |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  L-----LLHH----hlLLHHHHHHHHHHLLEEEEEELLLLHH--HHHHHHHHHHHL----
Query L-----SAPD----fdRDLDDVLEKAKKANVVALVAVAEHSG--EFEKIMQLSERY----   55
ident                   |        |                           |    
Sbjct GcggvqFNDTaeavsvETLEIMQKANEKSGCTNYLPTLITTSdeLMKQGVRVMREYlakh  120
DSSP  EelleeLLLLlllllhHHHHHHHHHHHLLLEEEEEEEELLLLhhHHHHHHHHHHHHhhhl


DSSP  LLLE-EEEELLLLEelllleellhhhhHHHHHHHHHHLLLLLEEeEEEEellllllllhh
Query NGFV-LPCLGVHPVqgldqrsvtlkdlDVALPIIENYKDRLLAIgEVGLdfsprfagtge  114
ident         |                             |                     
Sbjct PNQAlGLHLEGPWL------------nAALVDFLCENADVITKV-TLAP-----------  156
DSSP  LLLLlLEEEELLLL------------lLHHHHHHHHLHHHEEEE-EELH-----------


DSSP  hhhhHHHHhHHHHHHHHHHLLLEEEEEELLHHHHHHHHHHLLLllEEEELLL--LLHH--
Query qkeeQRQVlIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAekVLLHAFD--GRPS--  170
ident             |         |      |           |                  
Sbjct ----EMVP-AEVISKLANAGIVVSAGHSNATLKEAKAGFRAGI--TFATHLYnaMPYItg  209
DSSP  ----HHLL-HHHHHHHHHHLLEEEELLLLLLHHHHHHHHHHLE--EEELLLLllLLLLll


DSSP  ----HHHHHHHL-LLEEEELHhHHLLhHHHHHHHHLL---HHHEEELLLLL-LLLLllll
Query ----VAMEGVRA-GYFFSIPPsIIRSgQKQKLVKQLP---LTSICLETDSP-ALGPekqv  221
ident      |            |                         || ||           
Sbjct repgLAGAILDEaDIYCGIIA-DGLH-VDYANIRNAKrlkGDKLCLVTDATsGSSL----  263
DSSP  lllhHHHHHHHLlLLEEEEEL-LLLL-LLHHHHHHHHhhhHHHEEEELLLLlLLLL----


DSSP  lllhhHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHLLlHHHHL----------------
Query rnepwNISISAEYIAQVKGISVEEVIEVTTQNALKLFPkLRHLL----------------  265
ident                   ||   ||    |             |                
Sbjct -----TMIEGVRNLVEHCGIALDEVLRMATLYPARAIG-VEKRLgtlaagkvanltaftp  317
DSSP  -----LHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLL-LLLLLlllllllllleeeell


DSSP  -----------------
Query -----------------  265
ident                  
Sbjct dfkitktivngnevvtq  334
DSSP  llleeeeeelleeeeel


No 31: Query=2y1hB Sbjct=2uz9A Z-score=16.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  -------LLLEEEEEELLLLHHH------------------------------lLLHHHH
Query -------GVGLVDCHCHLSAPDF------------------------------dRDLDDV   23
ident          |||| | | |   |                                    |
Sbjct lshheffMPGLVDTHIHASQYSFagssidlpllewltkytfpaehrfqnidfaeEVYTRV  120
DSSP  llllleeEELEEEEEEEHHHHHHllllllllhhhhhhhlhhhhhhhhhlhhhhhHHHHHH


DSSP  HHHHHHLLEEEEEELLLLH-HHHHHHHHHHHHLLLLEEEEELLlLEEL-LLLE-ELLHHH
Query LEKAKKANVVALVAVAEHS-GEFEKIMQLSERYNGFVLPCLGVhPVQG-LDQR-SVTLKD   80
ident      |         |                                        |   
Sbjct VRRTLKNGTTTACYFATIHtDSSLLLADITDKFGQRAFVGKVC-MDLNdTFPEyKETTEE  179
DSSP  HHHHHHLLEEEEEEELLLLhHHHHHHHHHHHHHLLEEEEELEE-LLLLlLLLLlLLLHHH


DSSP  H-HHHHHHHHHHL-----lLLLEEeEEEEELlllllllhhhhhhHHHHHHHHHHHHHHHL
Query L-DVALPIIENYK-----dRLLAIgEVGLDFsprfagtgeqkeeQRQVLIRQIQLAKRLN  134
ident                                                        ||   
Sbjct SiKETERFVSEMLqknysrVKPIV-TPRFSL-----------scSETLMGELGNIAKTRD  227
DSSP  HhHHHHHHHHHHHhhllllEEEEE-EELLHH-----------hlLHHHHHHHHHHHHHHL


DSSP  LLEEEEEE-------------llhhHHHHHHHHLL--LLLEEEELLL-LLHHHHHHHHHL
Query LPVNVHSR-------------sagrPTINLLQEQG--AEKVLLHAFD-GRPSVAMEGVRA  178
ident |    |                                 |                    
Sbjct LHIQSHISenrdeveavknlypsykNYTSVYDKNNllTNKTVMAHGCyLSAEELNVFHER  287
DSSP  LEEEEEELllhhhhhhhhhhlllllLHHHHHHHLLllLLLEEEEELLlLLHHHHHHHHHH


DSSP  LLEEEEL-HHHH--LLHHHhhHHHHLL--hhHEEELLLLLLLlllllllLLHHhHHHHHH
Query GYFFSIP-PSII--RSGQKqkLVKQLP--ltSICLETDSPALgpekqvrNEPWnISISAE  233
ident |        |     ||     |         | | ||                      
Sbjct GASIAHCpNSNLslSSGFL--NVLEVLkhevKIGLGTDVAGG-------YSYS-MLDAIR  337
DSSP  LLEEEELhHHHHhlLLLLL--LHHHHHhlllEEEELLLLLLL-------LLLL-HHHHHH


DSSP  HHHHHH-----------LLLHHHHHHHHHHHHHHHLLlHHHHL-----------------
Query YIAQVK-----------GISVEEVIEVTTQNALKLFPkLRHLL-----------------  265
ident     |                 ||    |         |                     
Sbjct RAVMVSnillinkvnekSLTLKEVFRLATLGGSQALG-LDGEIgnfevgkefdailinpk  396
DSSP  HHHHHHhhhhhllllllLLLHHHHHHHHLHHHHHHLL-LLLLLlllllllllleeeelll


DSSP  ------------------------------------------------
Query ------------------------------------------------  265
ident                                                 
Sbjct asdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  llllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 32: Query=2y1hB Sbjct=4hk5D Z-score=15.9

back to top
DSSP  LLLEEEEEELLLL-----------------------------------------------
Query GVGLVDCHCHLSA-----------------------------------------------   13
ident     || | |                                                  
Sbjct TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  LLLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  -------HHHLlLHHHHHHHHHHLLEEEEEELL---------------lLHHHHHHHHHH
Query -------PDFDrDLDDVLEKAKKANVVALVAVA---------------eHSGEFEKIMQL   51
ident          |   |               |                              
Sbjct lpgrplsTHFA-SLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVNAEFSDM  119
DSSP  llleellHHHL-LHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHHHHHHHH


DSSP  HHHLLLLEEEEELLlleelllleeLLHHhHHHHHHHHHHHLLL--LLEEeEEEEElllll
Query SERYNGFVLPCLGVhpvqgldqrsVTLKdLDVALPIIENYKDR--LLAIgEVGLDfsprf  109
ident      |                        |     ||  |       |   |       
Sbjct CAQHVGRLFFFAAL---------pLSAP-VDAVKASIERVKNLkyCRGI-ILGTS-----  163
DSSP  HHLLLLLEEEEEEL---------lLLLL-HHHHHHHHHHHHLLllEEEE-EELLL-----


DSSP  lllhhhhHHHH--HHHHHHHHHHHHHLLLEEEE---------------------------
Query agtgeqkEEQR--QVLIRQIQLAKRLNLPVNVH---------------------------  140
ident                |           | |  |                           
Sbjct -----glGKGLddPHLLPVFEAVADAKLLVFLHphyglpnevygprseeyghvlplalgf  218
DSSP  -----llLLLLllHHHHHHHHHHHHLLLEEEELllllllhhhhlllhhhlllhhhhhlhh


DSSP  ---EELLHHHHH--HHHHHLLLLLEEEEL-LLLLHHH-----------------------
Query ---SRSAGRPTI--NLLQEQGAEKVLLHA-FDGRPSV-----------------------  171
ident       |                  ||       |                         
Sbjct pmeTTIAVARMYmaGVFDHVRNLQMLLAHsGGTLPFLagriescivhdghlvktgkvpkd  278
DSSP  hhhHHHHHHHHHhlLHHHHLLLLLEEEHHhHLLHHHHhhhhhhhhhllhhhhhlllllll


DSSP  ---hHHHHHLLLEEEELHHHhllhhhHHHHHHL----LHHHEEELLLLLLlLLLL--lll
Query ---aMEGVRAGYFFSIPPSIirsgqkQKLVKQL----PLTSICLETDSPAlGPEK--qvr  222
ident                                              || |   |       
Sbjct rrtiWTVLKEQIYLDAVIYS------EVGLQAAiassGADRLMFGTDHPF-FPPIeedvq  331
DSSP  lllhHHHHHHLEEEELLLLL------HHHHHHHhhhhLHHHEELLLLLLL-LLLLlllll


DSSP  llhhhHHHHHHHHHHHHlLLHHHHHHHH-HHHHHHHLLlHHHHL-------
Query nepwnISISAEYIAQVKgISVEEVIEVT-TQNALKLFPkLRHLL-------  265
ident          |                     ||      |   |       
Sbjct gpwdsSRLNAQAVIKAV-GEGSSDAAAVmGLNAVRVLS-LKAELehhhhhh  380
DSSP  lllhhHHHHHHHHHHHH-LLLLHHHHHHhLHHHHHHLL-LHHHHhhhhhhl


No 33: Query=2y1hB Sbjct=4ofcA Z-score=15.8

back to top
DSSP  llLEEEEEELLLL---------------------------------------HHHLlLHH
Query gvGLVDCHCHLSA---------------------------------------PDFDrDLD   21
ident      | | |                                               |  
Sbjct --MKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrENCW-DPE   57
DSSP  --LLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeeHHHL-LHH


DSSP  HHHHHHHHLLEEEEEELLL----------------LHHHHHHHHHHHHHLLLLEEEEELL
Query DVLEKAKKANVVALVAVAE----------------HSGEFEKIMQLSERYNGFVLPCLGV   65
ident           |                                      |          
Sbjct VRIREMDQKGVTVQALSTVpvmfsywakpedtlnlCQLLNNDLASTVVSYPRRFVGLGTL  117
DSSP  HHHHHHHHHLLLEEEEELLhhhhlllllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELL


DSSP  lleelllleellhHHHHHHHHHHHHHLL--LLLEEeEEEEEllllllllhhhHHHH--HH
Query hpvqgldqrsvtlKDLDVALPIIENYKD--RLLAIgEVGLDfsprfagtgeqKEEQ--RQ  121
ident                   |    |              |              |     |
Sbjct -----------pmQAPELAVKEMERCVKelGFPGV-QIGTH----------vNEWDlnAQ  155
DSSP  -----------llLLHHHHHHHHHHHHHllLLLEE-EEELE----------eLLEEllLH


DSSP  HHHHHHHHHHHHLLLEEEEE-----------------------ELLH-HHHHH-HHHHLL
Query VLIRQIQLAKRLNLPVNVHS-----------------------RSAG-RPTIN-LLQEQG  156
ident  |      | ||     ||                                |     |  
Sbjct ELFPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgmpaeTTIAiCSMIMgGVFEKF  215
DSSP  HHHHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhhhhhHHHHhHHHHLlLHHHHL


DSSP  -LLLEEEEL-LLLLHH-----------------------hhHHHHhlLLEEEELhHHHLl
Query -AEKVLLHA-FDGRPS-----------------------vaMEGVraGYFFSIPpSIIRs  191
ident    ||         |                                             
Sbjct pKLKVCFAHgGGAFPFtvgrishgfsmrpdlcaqdnpmnpkKYLG--SFYTDAL-VHDP-  271
DSSP  lLLLEEELHhHLLHHHhhhhhhhhhhhlhhhhlllllllhhHHLL--LLEEELL-LLLH-


DSSP  hhhhHHHHHL----LHHHEEELLLLL--LLLLlllllllhhHHHHHHHHhHHHHLllhHH
Query gqkqKLVKQL----PLTSICLETDSP--ALGPekqvrnepwNISISAEYiAQVKGisvEE  245
ident        | |          | || |                     |          ||
Sbjct ----LSLKLLtdviGKDKVILGTDYPfpLGEL---------EPGKLIES-MEEFD---EE  314
DSSP  ----HHHHHHhhhhLLLLEELLLLLLllLLLL---------LLLHHHHH-LLLLL---HH


DSSP  HHHHH-HHHHHHHLLLHHHHL
Query VIEVT-TQNALKLFPKLRHLL  265
ident         |||      |   
Sbjct TKNKLkAGNALAFLGLERKQF  335
DSSP  HHHHHhLHHHHHHHLLLHHHL


No 34: Query=2y1hB Sbjct=2dvtA Z-score=15.7

back to top
DSSP  lLLEEEEEELLLL--------------------HHHLllHHHHHHHHHHLLEEEEEELLL
Query gVGLVDCHCHLSA--------------------PDFDrdLDDVLEKAKKANVVALVAVAE   40
ident   | |    |                              |  |                
Sbjct mQGKVALEEHFAIpetlqdsagfvpgdywkelqHRLLdiQDTRLKLMDAHGIETMILSLN   60
DSSP  lLLEEEEEEEELLhhhhhhhlllllllhhhhhhHHHHllLLHHHHHHHHLLEEEEEEEEL


DSSP  ----------------LHHHHHHHHHHHHHLLLLEEEEELLlleelllleeLLHHhhHHH
Query ----------------HSGEFEKIMQLSERYNGFVLPCLGVhpvqgldqrsVTLKdlDVA   84
ident                                    |                     | |
Sbjct apavqaipdrrkaieiARRANDVLAEECAKRPDRFLAFAAL---------pLQDP--DAA  109
DSSP  llhhhhlllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELL---------lLLLH--HHH


DSSP  HHHHHHHLL--LLLEEeEEEEEllllllLLHHhhHHHHH--hhHHHHHHHHHHLLLEEEE
Query LPIIENYKD--RLLAIgEVGLDfsprfaGTGEqkEEQRQ--vlIRQIQLAKRLNLPVNVH  140
ident                   |                                 |  |   |
Sbjct TEELQRCVNdlGFVGA-LVNGF--sqegDGQT--PLYYDlpqyRPFWGEVEKLDVPFYLH  164
DSSP  HHHHHHHHHllLLLEE-EEELL--llllLLLL--LLLLLlhhhHHHHHHHHHHLLLEEEE


DSSP  E------------------------ELLHHHHHHHHHH------LLLLLEEEEL-LLLLH
Query S------------------------RSAGRPTINLLQE------QGAEKVLLHA-FDGRP  169
ident                                    |               |     | |
Sbjct PrnplpqdsriydghpwllgptwafAQETAVHALRLMAsglfdeHPRLNIILGHmGEGLP  224
DSSP  LllllhhhlhhhlllhhhlhhhlhhHHHHHHHHHHHHHllhhhhLLLLLEEELHhHLLHH


DSSP  HH----------------------hHHHHHLLLEEEELHHHHllhhhHHHHHHL----LH
Query SV----------------------aMEGVRAGYFFSIPPSIIrsgqkQKLVKQL----PL  203
ident                          |                                  
Sbjct YMmwridhrnawvklpprypakrrfMDYFNENFHITTSGNFR-----TQTLIDAileiGA  279
DSSP  HHhhhhhhllllllllllllllllhHHHHHHHEEEELLLLLL-----HHHHHHHhlllLH


DSSP  HHEEELLLLLLllllllllLLHHHHHHHHHHHhhHHLLlhhHHHHHH-HHHHHHHlLLHH
Query TSICLETDSPAlgpekqvrNEPWNISISAEYIaqVKGIsveEVIEVT-TQNALKLfPKLR  262
ident   |   || |               |                        ||  |  || 
Sbjct DRILFSTDWPF--------ENIDHASDWFNAT--SIAE---ADRVKIgRTNARRL-FKLD  325
DSSP  HHEELLLLLLL--------LLHHHHHHHHHHL--LLLH---HHHHHHhLHHHHHH-LLLL


DSSP  hhl
Query hll  265
ident    
Sbjct ---  325
DSSP  ---


No 35: Query=2y1hB Sbjct=4rdvB Z-score=15.5

back to top
DSSP  -----------------------------------------------LLLEEEEEELLlL
Query -----------------------------------------------GVGLVDCHCHLsA   13
ident                                                  |    | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHA-F   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELH-H


DSSP  HHHL----------------------------------LLHHHHHHHHHHLLEEEEEELL
Query PDFD----------------------------------RDLDDVLEKAKKANVVALVAVA   39
ident                                                  ||   |     
Sbjct QRAMaglaevagnpndsfwtwrelmyrmvarlspeqieVIACQLYIEMLKAGYTAVAEFH  119
DSSP  HHHHlllllllllllllhhhhhhhhhhhhllllhhhhhHHHHHHHHHHHHHLEEEEEEEE


DSSP  LLHH---------hHHHHHHHHHHLL---LLEEEEELLLLEE------LLLLEellhhHH
Query EHSG---------eFEKIMQLSERYN---GFVLPCLGVHPVQ------GLDQRsvtlkDL   81
ident                |     |                                      
Sbjct YVHHdldgrsyadpAELSLRISRAASaagIGLTLLPVLYSHAgfggqpASEGQrrfinGS  179
DSSP  LLLLllllllllllLHHHHHHHHHHHhhlLEEEEEELLLLEEellleeLLHHHlllllLH


DSSP  HHHHHHHHHHLL------LLLEEEEEEEEllllllllhhhhhhHHHHHHHHHHHhHHHLL
Query DVALPIIENYKD------RLLAIGEVGLDfsprfagtgeqkeeQRQVLIRQIQLaKRLNL  135
ident    |                |      |                 |             |
Sbjct EAYLELLQRLRApleaagHSLGLCFHSLR------------avTPQQIATVLAA-GHDDL  226
DSSP  HHHHHHHHHHHHhhhhhlLEELEEELLLL------------llLHHHHHHHHLL-LLLLL


DSSP  LEEEEEE---------------LLHHHHHHHhhhLLLL-LEEEELLLLLHH-HHHHHHHL
Query PVNVHSR---------------SAGRPTINLlqeQGAE-KVLLHAFDGRPS-VAMEGVRA  178
ident ||  |                                     |               | 
Sbjct PVHIHIAeqqkevddcqawsgrRPLQWLYEN---VAVDqRWCLVHATHADPaEVAAMARS  283
DSSP  LEEEEELllhhhhhhhhhhhllLHHHHHHHH---LLLLlLEEEEELLLLLHhHHHHHHHH


DSSP  LLEEEEL-HHHH--LLHHHhhHHHHLL--hHHEEELLLLLlllllllllLLHHhHHHHHH
Query GYFFSIP-PSII--RSGQKqkLVKQLP--lTSICLETDSPalgpekqvrNEPWnISISAE  233
ident |               |                    ||                     
Sbjct GAVAGLClSTEAnlGDGIF--PATDFLaqgGRLGIGSDSH---------VSLS-VVEELR  331
DSSP  LLEEEELhHHHHhlLLLLL--LHHHHHhllLEEEELLLLL---------LLLL-HHHHHH


DSSP  HHHHHHL---------------LLHHHHHHHHHHHHHHHLLLHH----------------
Query YIAQVKG---------------ISVEEVIEVTTQNALKLFPKLR----------------  262
ident                                                             
Sbjct WLEYGQRlrdrkrnrlyrddqpMIGRTLYDAALAGGAQALGQPIgslavgrradllvldg  391
DSSP  HHHHHHHhhhllllllllllllLHHHHHHHHHHHHHHHHHLLLLlllllllllleeeell


DSSP  ---------------------------------------------------------hhl
Query ---------------------------------------------------------hll  265
ident                                                             
Sbjct ndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 36: Query=2y1hB Sbjct=2qpxA Z-score=15.2

back to top
DSSP  ----------LLLEEEEEELLllhHHLL--------------------------------
Query ----------GVGLVDCHCHLsapDFDR--------------------------------   18
ident            | | | |||      |                                 
Sbjct gxddlsefvdQVPLLDHHCHF---LIDGkvpnrddrlaqvsteadkdypladtknrlayh   57
DSSP  lllllhhhhhHLLEEEEEELL---LLLLllllhhhhhhhhlllllllllhhhhlllhhhh


DSSP  ------------------------lhHHHHHHHHHLLEEEEEELLLlhhhhhhhhHHHHH
Query ------------------------dlDDVLEKAKKANVVALVAVAEhsgefekimQLSER   54
ident                                         |                   
Sbjct gflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTG--fvpddpiLDLDQ  115
DSSP  hhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELL--lllllllLLHHH


DSSP  LL----LLEEEEELLLleelllleellhhHHHH-------------HHHHHHHHLL-LLL
Query YN----GFVLPCLGVHpvqgldqrsvtlkDLDV-------------ALPIIENYKD-RLL   96
ident         |                      |                      |     
Sbjct TAelvgIPVKAIYRLE-----------thAEDFxlehdnfaawwqaFSNDVKQAKAhGFV  164
DSSP  HHhhhlLLEEEEEEHH-----------hhHHHHhlllllhhhhhhhHHHHHHLLLLlLLL


DSSP  EEeEEEEEL---------------------lllllllhHHHHHHHHHHHHHHHHHHHHLL
Query AIgEVGLDF---------------------sprfagtgEQKEEQRQVLIRQIQLAKRLNL  135
ident                                         |      |            
Sbjct GF-XSIAAYrvglhlepvnvieaaagfdtwkhsgekrlTSKPLIDYXLYHVAPFIIAQDX  223
DSSP  LE-EELHHHhlllllllllhhhhhhhhhhhhhhlllllLLHHHHHHHHHHHHHHHHHHLL


DSSP  LEEEEEE----------LLHHHhHHHHHHLLL---LLEEEELLL-LLHHHHHHHHHL-LL
Query PVNVHSR----------SAGRPtINLLQEQGA---EKVLLHAFD-GRPSVAMEGVRA-GY  180
ident |   |                               || |                    
Sbjct PLQFHVGygdadtdxylGNPLL-XRDYLKAFTkkgLKVVLLHCYpYHREAGYLASVFpNL  282
DSSP  LEEEEELlllllllhhhLLHHH-HHHHHHHHHhhlLLEEEEELLlLHHHHHHHHHHLlLE


DSSP  EEEEL---HHHHLL--HHHHHHHHHLLHHHEEELLLLLlllllllllLLHH-HHHHHHHH
Query FFSIP---PSIIRS--GQKQKLVKQLPLTSICLETDSPalgpekqvrNEPW-NISISAEY  234
ident  | |                  |   | | |    |                        
Sbjct YFDISlldNLGPSGasRVFNEAVELAPYTRILFASDAS------typEXYGlAARQFKQA  336
DSSP  EEELLlhhHHLHHHhhHHHHHHLLLLLHHHEELLLLLL------llhHHHHhHHHHHHHH


DSSP  HHHHHL-------lLHHHHHHHH-HHHHHHHLLlHHHHL--
Query IAQVKG-------iSVEEVIEVT-TQNALKLFPkLRHLL--  265
ident                    |     |   ||       |  
Sbjct LVAHFNqlpfvdlaQKKAWINAIcWQTSAKLYH-QERELrv  376
DSSP  HHHHHHllllllhhHHHHHHHHHhLHHHHHHLL-LHHHHll


No 37: Query=2y1hB Sbjct=1a4mA Z-score=15.0

back to top
DSSP  ----LLLEEEEEELLLLhHHLL--------------------------------------
Query ----GVGLVDCHCHLSApDFDR--------------------------------------   18
ident         |  | ||                                             
Sbjct tpafNKPKVELHVHLDG-AIKPetilyfgkkrgialpadtveelrniigmdkplslpgfl   59
DSSP  llllLLLEEEEEEEHHH-LLLHhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhh


DSSP  -------------------LHHHHHHHHHHLLEEEEEELLLLHH----------------
Query -------------------DLDDVLEKAKKANVVALVAVAEHSG----------------   43
ident                          |   |  ||                          
Sbjct akfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqteg  119
DSSP  llhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhllll


DSSP  ------HHHHHHHHHHHLL----LLEEEEELLLLeelllleELLHhHHHHHHHHHHHHLL
Query ------EFEKIMQLSERYN----GFVLPCLGVHPvqgldqrSVTLkDLDVALPIIENYKD   93
ident             |            |   |                     |     |  
Sbjct dvtpddVVDLVNQGLQEGEqafgIKVRSILCCMR-------HQPS-WSLEVLELCKKYNQ  171
DSSP  lllhhhHHHHHHHHHHHHHhhhlLEEEEEEEEEL-------LLHH-HHHHHHHHHHHLLL


DSSP  L-LLEEeEEEE-ELLLlllllhhhhHHHHH-HHHHHHHHHHHHLLLEEEEE-ELLHHHHH
Query R-LLAIgEVGL-DFSPrfagtgeqkEEQRQ-VLIRQIQLAKRLNLPVNVHS-RSAGRPTI  149
ident     |                                  |        ||          
Sbjct KtVVAM-DLAGdETIE---------GSSLFpGHVEAYEGAVKNGIHRTVHAgEVGSPEVV  221
DSSP  LlEEEE-EEELlLLLL---------LHHHLhHHHHHHHHHHHHLLEEEEEElLLLLHHHH


DSSP  HHHHHLLLllEEEELLLLLHH---HHHHHHHLLLEEEEL-HHHH--LLHH--hHHHHHHL
Query NLLQEQGAekVLLHAFDGRPS---VAMEGVRAGYFFSIP-PSII--RSGQ--kQKLVKQL  201
ident                                    |     |              |   
Sbjct REAVDILK-tERVGHGYHTIEdeaLYNRLLKENMHFEVCpWSSYltGAWDpktTHAVVRF  280
DSSP  HHHHHLLL-lLEEEELHHHHHlhhHHHHHHHLLLEEEELhHHHHhlLLLLlllLLHHHHH


DSSP  L--HHHEEELLLLLLllllllLLLLhhHHHHHHHHHHHHHLLLhHHHHHHHHHHHHHHLl
Query P--LTSICLETDSPAlgpekqVRNEpwNISISAEYIAQVKGISvEEVIEVTTQNALKLFp  259
ident         | || |                          |   ||       || |   
Sbjct KndKANYSLNTDDPL------IFKS--TLDTDYQMTKKDMGFT-EEEFKRLNINAAKSS-  330
DSSP  HhlLLLEEELLLLLL------LLLL--LHHHHHHHHHHLLLLL-HHHHHHHHHHHHHLL-


DSSP  LHHHHL-------------
Query KLRHLL-------------  265
ident  |                 
Sbjct FLPEEEkkellerlyreyq  349
DSSP  LLLHHHhhhhhhhhhhhll


No 38: Query=2y1hB Sbjct=3giqA Z-score=14.9

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------GVGLVD    6
ident                                                         |  |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  EEELLLLhhHLLLHHHhHHHHHHLLEEEEEEL----LLLHH-------------------
Query CHCHLSApdFDRDLDDvLEKAKKANVVALVAV----AEHSG-------------------   43
ident  | |           | |           |                              
Sbjct VHGHDDL--MFVEKPD-LRWKTSQGITTVVVGncgvSAAPAplpgntaaalallgetplf  117
DSSP  LLLLLLL--HHHHLLL-LHHHHLLLEEEEEELllllLLLLLlllllllhhhhhhllllll


DSSP  -HHHHHHHHHH--HLLLLEEEEELLLleelllleellhhHHHH---------------HH
Query -EFEKIMQLSE--RYNGFVLPCLGVHpvqgldqrsvtlkDLDV---------------AL   85
ident              |    |    |                |                   
Sbjct aDVPAYFAALDaqRPMINVAALVGHA-----------nlRLAAmrdpqaaptaaeqqaMQ  166
DSSP  lLHHHHHHHHHhlLLLLEEEEEEEHH-----------hhHHHHlllllllllhhhhhhHH


DSSP  HHHHHHLL-LLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEEL-
Query PIIENYKD-RLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSRS-  143
ident                  ||               |   |      |         | |  
Sbjct DMLQAALEaGAVGF-STGLAYQ-------pgAVAQAAELEGLARVAAERRRLHTSHIRNe  218
DSSP  HHHHHHHHhLLLEE-EEELLLL-------lhHHLLHHHHHHHHHHHHHLLLEEEEELLLl


DSSP  ------LHHHHHHHHHHLLLlLEEEELLLL--------LHHHHHHHHHLL-----LEEEE
Query ------AGRPTINLLQEQGAeKVLLHAFDG--------RPSVAMEGVRAG-----YFFSI  184
ident       |           |                            ||          |
Sbjct adgveaAVEEVLAIGRGTGC-ATVVSHHKCmmpqnwgrSRATLANIDRAReqgveVALDI  277
DSSP  lllhhhHHHHHHHHHHHHLL-EEEELLLLLllhhhlllHHHHHHHHHHHHhllllEEEEE


DSSP  LHHHH-------------------------------------------------------
Query PPSII-------------------------------------------------------  189
ident  |                                                          
Sbjct YPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapaga  337
DSSP  LLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleee


DSSP  -----LLHHHHHHHhhlLHHHEEELLLLLllllllLLLL-LHHHHHHHHHHHHH-HHLLL
Query -----RSGQKQKLVkqlPLTSICLETDSPalgpekQVRN-EPWNISISAEYIAQ-VKGIS  242
ident                           |                                 
Sbjct iyfamDEDEVKRIF---QHPCCMVGSDGL--pndaRPHPrLWGSFTRVLGRYVReARLMT  392
DSSP  eeellLHHHHHHHH---HLLLEEELLLLL--llllLLLLhHHHHHHHHHHHHHHhLLLLL


DSSP  HHHHHHHHHHHHHHHLLlHHHH--------------------------------------
Query VEEVIEVTTQNALKLFPkLRHL--------------------------------------  264
ident  |      |      |                                            
Sbjct LEQAVARMTALPARVFG-FAERgvlqpgawadvvvfdpdtvadratwdeptlasvgiagv  451
DSSP  HHHHHHHHLHHHHHHHL-LLLLlllllllllleeeelllllllllllllllllllleeee


DSSP  -----------------------l
Query -----------------------l  265
ident                         
Sbjct lvngaevfpqppadgrpgqvlrax  475
DSSP  eelleeeellllllllllllllll


No 39: Query=2y1hB Sbjct=1itqA Z-score=14.6

back to top
DSSP  ------------LLLEEEEEELLLLHH----------hlLLHHH------HHHHHHHLLE
Query ------------GVGLVDCHCHLSAPD----------fdRDLDD------VLEKAKKANV   32
ident                  | |  |                  |           |     |
Sbjct dffrdeaerimrDSPVIDGHNDLPWQLldmfnnrlqderANLTTlagthtNIPKLRAGFV   60
DSSP  lhhhhhhhhhhlLLLEEEEEELHHHHHhhhhllllllhhHLLLLllllllLHHHHHHLLE


DSSP  EEEEELLLL---------HHHHHHHHHHHHH--------LLLL----------------E
Query VALVAVAEH---------SGEFEKIMQLSER--------YNGF----------------V   59
ident                          |    |                             
Sbjct GGQFWSVYTpcdtqnkdaVRRTLEQMDVVHRmcrmypetFLYVtssagirqafregkvaS  120
DSSP  EEEEEEELLlhhhllllhHHHHHHHHHHHHHhhhhllllEEELllhhhhhhhhhllleeE


DSSP  EEEELLLleelllleellhhhHHHHHHHHHHHLL-LLLEeEEEE---------EELL-LL
Query LPCLGVHpvqgldqrsvtlkdLDVALPIIENYKD-RLLAiGEVG---------LDFS-PR  108
ident |                     |  |                                  
Sbjct LIGVEGG------------hsIDSSLGVLRALYQlGMRY-LTLThscntpwadNWLVdTG  167
DSSP  EEEEELH------------hhLLLLHHHHHHHHHlLEEE-EELLlllllllllLHHHlLL


DSSP  LLLlhhHHHH-hHHHHHHHHHHHHHHLLLEEEEEELlhHHHHHHHHHLLLLLEEE-ELLL
Query FAGtgeQKEE-qRQVLIRQIQLAKRLNLPVNVHSRSagRPTINLLQEQGAEKVLL-HAFD  166
ident                  |      ||         |    |           |   |   
Sbjct DSE---PQSQglSPFGQRVVKELNRLGVLIDLAHVS--VATMKATLQLSRAPVIFsHSSA  222
DSSP  LLL---LLLLllLHHHHHHHHHHHHHLLEEELLLLL--HHHHHHHHHHLLLLLEElLLLL


DSSP  ---------LLHHHHHHHHHLLLEEEELHHhHLLH---------hHHHHHHHLL----HH
Query ---------GRPSVAMEGVRAGYFFSIPPSiIRSG---------qKQKLVKQLP----LT  204
ident              |                                              
Sbjct ysvcasrrnVPDDVLRLVKQTDSLVMVNFY-NNYIsctnkanlsqVADHLDHIKevagAR  281
DSSP  lllllllllLLHHHHHHHHHHLLEEEELLL-HHHHlllllllhhhHHHHHHHHHhhllHH


DSSP  HEEELLLLLLL--LLLLllllLHHHHHHHHHHHHHhHLLLhHHHHHHH-HHHHHHHLL--
Query SICLETDSPAL--GPEKqvrnEPWNISISAEYIAQvKGISvEEVIEVT-TQNALKLFP--  259
ident       |       ||                         |         | |  |   
Sbjct AVGFGGDFDGVprVPEG--leDVSKYPDLIAELLR-RNWT-EAEVKGAlADNLLRVFEav  337
DSSP  HEEELLLLLLLllLLLL--llLLLLHHHHHHHHHH-LLLL-HHHHHHHhLHHHHHHHHhh


DSSP  --------------------------lhhhhl
Query --------------------------klrhll  265
ident                                 
Sbjct eqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhllllllllllllllhhhlllllllllllll


No 40: Query=2y1hB Sbjct=4qrnA Z-score=14.5

back to top
DSSP  ------------LLLEEEEEELLLL-----------------------------------
Query ------------GVGLVDCHCHLSA-----------------------------------   13
ident             |                                               
Sbjct smtqdlktggeqGYLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllLLLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  ----HHHLllHHHHHHHHHHLLEEEEEELLL----------------lHHHHHHHHHHHH
Query ----PDFDrdLDDVLEKAKKANVVALVAVAE----------------hSGEFEKIMQLSE   53
ident                                                             
Sbjct tqilERLLdlGERRIADMDATGIDKAILALTspgvqplhdldeartlaTRANDTLADACQ  120
DSSP  hhhhHHHHllLHHHHHHHHHLLLLEEEEEELlllllllllhhhhhhhhHHHHHHHHHHHH


DSSP  HLLLLEEEEELLlleelllleellHHHHHHHHHHHHHHLL--LLLEEeEEEEElllllll
Query RYNGFVLPCLGVhpvqgldqrsvtLKDLDVALPIIENYKD--RLLAIgEVGLDfsprfag  111
ident  |         |              |       |           |             
Sbjct KYPDRFIGMGTV-----------aPQDPEWSAREIHRGARelGFKGI-QINSH-------  161
DSSP  HLLLLEEELLLL-----------lLLLHHHHHHHHHHHHHllLLLLE-EELLL-------


DSSP  lhhHHHHHHH-hhHHHHHHHHHHLLLEEEE---------------------------EEL
Query tgeQKEEQRQ-vlIRQIQLAKRLNLPVNVH---------------------------SRS  143
ident    |                     |   |                              
Sbjct --tQGRYLDEeffDPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgfgveTGM  219
DSSP  --lLLLLLLLhhhHHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhhhhhHHH


DSSP  LHHHHH--HHHHHLLLLLEEEEL-LLLLHHH--------------------------hHH
Query AGRPTI--NLLQEQGAEKVLLHA-FDGRPSV--------------------------aME  174
ident      |                      |                               
Sbjct HLLRLItiGIFDKYPSLQIMVGHmGEALPYWlyrldymhqagvrsqryermkplkktiEG  279
DSSP  HHHHHHhhLHHHHLLLLLEEELHhHHLHHHHhhhhhhhhhhhhhlllllllllllllhHH


DSSP  HHHLLLEEEELHHHHllhHHHHHHHHLLHHHEEELLLLLLllllllllLLHHhhHHHHHh
Query GVRAGYFFSIPPSIIrsgQKQKLVKQLPLTSICLETDSPAlgpekqvrNEPWniSISAEy  234
ident                                     | |                     
Sbjct YLKSNVLVTNSGVAW-epAIKFCQQVMGEDRVMYAMDYPY--------QYVAdeVRAMD-  329
DSSP  HHHHLEEEELLLLLL-hhHHHHHHHHHLHHHEELLLLLLL--------LLLHhhHHHHH-


DSSP  hhhhHLLLhHHHHHHH-HHHHHHHLLLhhhhl
Query iaqvKGISvEEVIEVT-TQNALKLFPKlrhll  265
ident        |           || | |       
Sbjct ---aMDMS-AQTKKKFfQTNAEKWFKL-----  352
DSSP  ---lLLLL-HHHHHHHhLHHHHHHLLL-----


No 41: Query=2y1hB Sbjct=3pnuA Z-score=14.4

back to top
DSSP  -----------LLLEEEEEELLLlhhHLLLHHHHHHHHHHlLEEEEEELLL---LHHHHH
Query -----------GVGLVDCHCHLSapdFDRDLDDVLEKAKKaNVVALVAVAE---HSGEFE   46
ident                 | | ||        |             | |            |
Sbjct enlyfqsnamkLKNPLDMHLHLR---DNQMLELIAPLSAR-DFCAAVIMPNlipPLCNLE   56
DSSP  llllllllleeEELLEEEEELLL---LHHHHHHHHHHHHL-LLLEEEELLLlllLLLLHH


DSSP  HHHHHHHHLL-------lLEEEEELLLleelllleellhhhhhhhHHHHHHHLLLLLEEe
Query KIMQLSERYN-------gFVLPCLGVHpvqgldqrsvtlkdldvaLPIIENYKDRLLAIg   99
ident        |            |  |                            ||    | 
Sbjct DLKAYKMRILkackdenfTPLMTLFFK---------------nydEKFLYSAKDEIFGI-  100
DSSP  HHHHHHHHHHhhhlllllEEEEEEELL---------------lllHHHHHHHLLLLLEE-


DSSP  EEEEELLllllllhhhhhHHHH--hHHHHHHHHHHHLLLEEEEEEL---------LHHHH
Query EVGLDFSprfagtgeqkeEQRQ--vLIRQIQLAKRLNLPVNVHSRS---------AGRPT  148
ident                          |         || |  ||                 
Sbjct XLYPAGI---ttnsnggvSSFDieyLKPTLEAMSDLNIPLLVHGETndfvmdresNFAKI  157
DSSP  EELLLLL---llllllllLLLLhhhHHHHHHHHHHLLLLEEELLLLlllhhhllhHHHHH


DSSP  HHHHHHLLL-LLEEEELLLlLHHHHHHHHHLL-LEEEELHH-HHLL--------------
Query INLLQEQGA-EKVLLHAFDgRPSVAMEGVRAG-YFFSIPPS-IIRS--------------  191
ident    |       |                         |     |                
Sbjct YEKLAKHFPrLKIVMEHIT-TKTLCELLKDYEnLYATITLHhLIITlddviggkmnphlf  216
DSSP  HHHHHHHLLlLLEEELLLL-LHHHHHHHHHLLlEEEEELLHhHLLLhhhhhlllllhhhl


DSSP  -------HHHHHHHHHL---lHHHEEELLLLL-lllllLLLLLLHHHHHHHHHHHHHhHL
Query -------GQKQKLVKQL---pLTSICLETDSP-algpeKQVRNEPWNISISAEYIAQvKG  240
ident                 |            ||                |            
Sbjct ckpiakrYEDKEALCELafsgYEKVMFGSDSAphpkgcAAGVFSAPVILPVLAELFK-QN  275
DSSP  lllllllHHHHHHHHHHhhllLLLEEELLLLLllllllLLLLLLHHHHHHHHHHHHH-HH


DSSP  LLhHHHHHHH-HHHHHHHlLLHHH------------------------------------
Query ISvEEVIEVT-TQNALKLfPKLRH------------------------------------  263
ident  | ||        |  |    |                                      
Sbjct SS-EENLQKFlSDNTCKI-YDLKFkedkiltleekewqvpnvyedkynqvvpymageilk  333
DSSP  LL-HHHHHHHhLHHHHHH-HLLLLlllleeeeellleelllleelllleellllllleel


DSSP  ---hl
Query ---ll  265
ident      
Sbjct fqlkh  338
DSSP  leell


No 42: Query=2y1hB Sbjct=3griA Z-score=14.3

back to top
DSSP  --------------------------------------------------LLLEEEEEEL
Query --------------------------------------------------GVGLVDCHCH   10
ident                                                     | || | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  LLLHHHLL--LHHHHHHHHHHLLEEEEEELLL-lhHHHH--hHHHHHHHLL----lLEEE
Query LSAPDFDR--DLDDVLEKAKKANVVALVAVAE-hsGEFE--kIMQLSERYN----gFVLP   61
ident |  |              |                          |           |||
Sbjct LREPGGEYkeTIETGTKAAARGGFTTVCPXPNtrpVPDSvehFEALQKLIDdnaqvRVLP  120
DSSP  LLLLLLLLllLHHHHHHHHHHLLEEEEEELLLlllLLLLhhhHHHHHHHHHhhlllEELL


DSSP  EELLlleelllleellhhHHHHHHhHHHHHLL-LLLEEEEEeeellllllllhhhhhHHH
Query CLGVhpvqgldqrsvtlkDLDVALpIIENYKD-RLLAIGEVgldfsprfagtgeqkeEQR  120
ident                                     |                       
Sbjct YASI----------ttrqLGKELV-DFPALVKeGAFAFTDD------------gvgvQTA  157
DSSP  LEEL----------lhhhLLLLLL-LHHHHHLlLLLLEEEL------------llllLLH


DSSP  HHHHHHHHHHHHHLLLEEEEEE------------------------------LLHHHHHH
Query QVLIRQIQLAKRLNLPVNVHSR------------------------------SAGRPTIN  150
ident          |   |     |                                        
Sbjct SXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnicesVQIARDVL  217
DSSP  HHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellhhhhHHHHHHHH


DSSP  HHHHLLLlLEEEELLLL--LHHHHHHHHH--LLLEEEELHH-HHLL--------------
Query LLQEQGAeKVLLHAFDG--RPSVAMEGVR--AGYFFSIPPS-IIRS--------------  191
ident |    |                |     |          |                    
Sbjct LAEAAGC-HYHVCHVSTkeSVRVIRDAKRagIHVTAEVTPHhLLLTeddipgnnaiykxn  276
DSSP  HHHHHLL-LEEELLLLLhhHHHHHHHHHHllLLEEEEELHHhHHLLhhhlllllhhhlll


DSSP  ------HHHHHHHHHLLHH-HEEELLLLL---------lllllLLLLLLHHHHHHHHH-H
Query ------GQKQKLVKQLPLT-SICLETDSP---------algpeKQVRNEPWNISISAE-Y  234
ident            |   |      |  ||                                 
Sbjct pplrstEDREALLEGLLDGtIDCIATDHAphardekaqpxekaPFGIVGSETAFPLLYtH  336
DSSP  lllllhHHHHHHHHHHHLLlLLEELLLLLlllhhhhlllllllLLLLLLLLLHHHHHHhH


DSSP  HHHhHLLLHHHHHHHHHHHHHHHLlLHHH-------------------------------
Query IAQvKGISVEEVIEVTTQNALKLFpKLRH-------------------------------  263
ident                 |      |  |                                 
Sbjct FVKnGDWTLQQLVDYLTIKPCETF-NLEYgtlkengyadltiidldseqeikgedflska  395
DSSP  HLLlLLLLHHHHHHHHLHHHHHHL-LLLLlllllllllleeeeelllleellhhhlllll


DSSP  -------------------------hl
Query -------------------------ll  265
ident                            
Sbjct dntpfigykvygnpiltxvegevkfeg  422
DSSP  lllllllleelleeeeeeelleeeeel


No 43: Query=2y1hB Sbjct=1a5kC Z-score=14.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -----LLLEEEEEELLLlhhhlllHHHHHHHHHHLLEEEEEEL------------LLLHH
Query -----GVGLVDCHCHLSapdfdrdLDDVLEKAKKANVVALVAV------------AEHSG   43
ident        |  | | |              | |    |   |                   
Sbjct egkivTAGGIDTHIHWI-------CPQQAEEALVSGVTTMVGGgtgpaagthattCTPGP  173
DSSP  llleeEELEEEEEEELL-------LLLHHHHHHHHLEEEEEEElllllhhhhhllLLLHH


DSSP  -HHHHHHHHHHHLlLLEEEEELLLleelllleellhhHHHHHHHHHHHHlllLLEEeEEE
Query -EFEKIMQLSERYnGFVLPCLGVHpvqgldqrsvtlkDLDVALPIIENYkdrLLAIgEVG  102
ident        |                               |                 |  
Sbjct wYISRMLQAADSLpVNIGLLGKGN-----------vsQPDALREQVAAG---VIGL-EIH  218
DSSP  hHHHHHHHHHLLLlLEEEEEEELL-----------llLHHHHHHHHHHL---LLEE-EEE


DSSP  EEllllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEEL-----LHHHHHHHHhhLLL
Query LDfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSRS-----AGRPTINLLqeQGA  157
ident  |                         |      |  ||           |       | 
Sbjct ED-----------wgaTPAAIDCALTVADEMDIQVALHSDTlnesgFVEDTLAAI--GGR  265
DSSP  HH-----------hllLHHHHHHHHHHHHHHLLEEEEELLLlllllLHHHHHHHH--LLL


DSSP  LlEEEELLLL-----lhHHHHhHHHLL-LEEEELH-HHHL--------------------
Query EkVLLHAFDG-----rpSVAMeGVRAG-YFFSIPP-SIIR--------------------  190
ident          |                     |                            
Sbjct T-IHTFHTEGaggghapDIIT-ACAHPnILPSSTNpTLPYtlntidehldmlmvchhldp  323
DSSP  L-EEELLLLLlllllllLHHH-HHHLLlEEEEEEHhHLLLlllhhhhhhhhhhhhhllll


DSSP  --------------lHHHHHHHHHL-LHHHEEELLLLLLLlllllllLLHHHHHHHHHHH
Query --------------sGQKQKLVKQL-PLTSICLETDSPALgpekqvrNEPWNISISAEYI  235
ident                                    || |                     
Sbjct diaedvafaesrirrETIAAEDVLHdLGAFSLTSSDSQAM-------GRVGEVILRTWQV  376
DSSP  llhhhhhlllllllhHHHHHHHHHHhLLLLLEEELLLLLL-------LLLLLHHHHHHHH


DSSP  HHHHL--------------lLHHHHHHHH-HHHHHHHLLlHHHHL---------------
Query AQVKG--------------iSVEEVIEVT-TQNALKLFPkLRHLL---------------  265
ident |                             | |         |                 
Sbjct AHRMKvqrgalaeetgdndnFRVKRYIAKyTINPALTHG-IAHEVgsievgkladlvvws  435
DSSP  HHHHHhhhlllllllllllhHHHHHHHHLlLHHHHHHLL-LLLLLlllllllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct paffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaa  495
DSSP  hhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  265
ident                                                             
Sbjct aangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepad  555
DSSP  hhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelllllll


DSSP  -----------
Query -----------  265
ident            
Sbjct vlpmaqryflf  566
DSSP  lllllllllll


No 44: Query=2y1hB Sbjct=3e74A Z-score=14.0

back to top
DSSP  --------------------------------------------------LLLEEEEEEL
Query --------------------------------------------------GVGLVDCHCH   10
ident                                                     | || | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL


DSSP  LllhhhllLHHHHHHHHHHLLEEEEEELLLLhHHHH----HHHHHHHHL----llLEEEE
Query LsapdfdrDLDDVLEKAKKANVVALVAVAEHsGEFE----KIMQLSERY----ngFVLPC   62
ident                 | |                      |                  
Sbjct I-------GYETGTRAAAKGGITTXIEXPLNqLPATvdraSIELKFDAAkgkltiDAAQL  113
DSSP  L-------LHHHHHHHHHHLLEEEEEELLLLlLLLLllhhHHHHHHHHHllllllEEEEL


DSSP  ELLlleelllleellhhhHHHHHHHHHHHL-LLLLEEeEEEEellllllllhhhhhhHHH
Query LGVhpvqgldqrsvtlkdLDVALPIIENYK-DRLLAIgEVGLdfsprfagtgeqkeeQRQ  121
ident  |                                                          
Sbjct GGL---------------VSYNIDRLHELDeVGVVGF-XCFV------------rdvNDW  145
DSSP  EEL---------------LLLLLLLHHHHHhHLLLLE-EEEL------------lllLHH


DSSP  HHHHHHHHHHHHLLLEEEEEEL---------------------------------LHHHH
Query VLIRQIQLAKRLNLPVNVHSRS---------------------------------AGRPT  148
ident       |    |  || ||                                    | |  
Sbjct QFFKGAQKLGELGQPVLVHCENalicdelgeeakregrvtahdyvasrpvfteveAIRRV  205
DSSP  HHHHHHHHHHHHLLLEEEELLLhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHH


DSSP  HHHHHHLLLLlEEEELLLLLH--HHHHHHHH--LLLEEEELH-HHHL-------------
Query INLLQEQGAEkVLLHAFDGRP--SVAMEGVR--AGYFFSIPP-SIIR-------------  190
ident   |    |                                 |                  
Sbjct LYLAKVAGCR-LHVCHVSSPEgvEEVTRARQegQDITCESCPhYFVLdtdqfeeigtlak  264
DSSP  HHHHHHHLLL-EEELLLLLHHhhHHHHHHHHllLLEEEEELLhHHHLlhhhhhhhlhhhl


DSSP  ----------LHHHHHHHHHLLhhHEEELLLLL---------lllllLLLLLLHHHHH-H
Query ----------SGQKQKLVKQLPltSICLETDSP---------algpeKQVRNEPWNIS-I  230
ident                           ||  |                             
Sbjct csppirdlenQKGXWEKLFNGE--IDCLVSDHSpcppexkagnixkaWGGIAGLQSCXdV  322
DSSP  lllllllhhhHHHHHHHHHLLL--LLEELLLLLllllllllllllllLLLLLLHHHHHhH


DSSP  HHHHHHHHHLLLhHHHHHHH-HHHHHHHLLlHHHH-------------------------
Query SAEYIAQVKGISvEEVIEVT-TQNALKLFPkLRHL-------------------------  264
ident       |  | |           ||   |  |                            
Sbjct XFDEAVQKRGXS-LPXFGKLxATNAADIFG-LQQKgriapgkdadfvfiqpnssyvltnd  380
DSSP  HHHHHLLLLLLL-HHHHHHHhLHHHHHHLL-LLLLlllllllllleeeeelllleellhh


DSSP  ------------------------------------------------l
Query ------------------------------------------------l  265
ident                                                  
Sbjct dleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  hllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 45: Query=2y1hB Sbjct=3qy6A Z-score=13.9

back to top
DSSP  lllEEEEEELLLLH---HHLL--LHHHHHHHHHHLLEEEEEELLL--------LHHHH-H
Query gvgLVDCHCHLSAP---DFDR--DLDDVLEKAKKANVVALVAVAE--------HSGEF-E   46
ident      | |||             |       |         |                 |
Sbjct ---MIDIHCHILPAmddGAGDsaDSIEMARAAVRQGIRTIIATPHhnngvyknEPAAVrE   57
DSSP  ---LEELLLLLLLLlllLLLLhhHHHHHHHHHHHLLLLEEELLLEelllllllLHHHHhH


DSSP  HHHHHHHHLL-----LLEEEEelllleelllleellhhhhhhhhhhhhhhllllleeEEE
Query KIMQLSERYN-----GFVLPClgvhpvqgldqrsvtlkdldvalpiienykdrllaiGEV  101
ident    ||  |         |||                                      | 
Sbjct AADQLNKRLIkedipLHVLPG------------------------------------QEI   81
DSSP  HHHHHHHHHHhllllLEEELL------------------------------------LEE


DSSP  EEellllllllhhhhhhhHHHHHHHHHH----hhhhLLLEEEEEE-LLHH-HHHHHHHHL
Query GLdfsprfagtgeqkeeqRQVLIRQIQL----akrlNLPVNVHSR-SAGR-PTINLLQEQ  155
ident                                                        |    
Sbjct RI----------------YGEVEQDLAKrqllslndTKYILIEFPfDHVPrYAEQLFYDL  125
DSSP  EL----------------LLLHHHHHHLlllllhhhLLEEEEELLlLLLLlLHHHHHHHH


DSSP  L--LLLEEEELLL------lLHHHHHHHHHLLLEEEELH-HHHL------LHHHHHHHHH
Query G--AEKVLLHAFD------gRPSVAMEGVRAGYFFSIPP-SIIR------SGQKQKLVKQ  200
ident                      ||     |  |    |   |               ||  
Sbjct QlkGYIPVIAHPErnreireNPSLLYHLVEKGAASQITSgSLAGifgkqlKAFSLRLVEA  185
DSSP  HhlLLEEEEELHHhlhhhhhLLHHHHHHHHLLLEEEEEHhHHLLlllhhhHHHHHHHHHL


DSSP  LLhhHEEELLLLLlllllllLLLLHhHHHHHHHHHHHHHllLHHHHhHHHHHHHHHHLLL
Query LPltSICLETDSPalgpekqVRNEPwNISISAEYIAQVKgiSVEEViEVTTQNALKLFPK  260
ident           |                                |      | ||  |   
Sbjct NL--IHFVASDAH-----nvKTRNF-HTQEALYVLEKEF--GSELP-YMLTENAELLLRN  234
DSSP  LL--LLEEELLLL-----llLLLLL-LHHHHHHHHHHHH--LLHHH-HHHHHHHHHHHLL


DSSP  --------hhhhl
Query --------lrhll  265
ident              
Sbjct qtifrqppqpvkr  247
DSSP  lllllllllllll


No 46: Query=2y1hB Sbjct=3iacA Z-score=13.6

back to top
DSSP  ------------------------LLLEEEEEELLLlhhhLLLH----------------
Query ------------------------GVGLVDCHCHLSapdfDRDL----------------   20
ident                              | |||||      |                 
Sbjct atfxtedfllkndiartlyhkyaaPXPIYDFHCHLSpqeiADDRrfdnlgqiwlegdhyk   60
DSSP  llllllllllllhhhhhhhhhlllLLLEEELLLLLLhhhhHHLLllllhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   20
ident                                                             
Sbjct wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll


DSSP  -------------------hHHHHHHHHLLEEEEEELLlLHHHhhhhHHHHHHLL-----
Query -------------------dDVLEKAKKANVVALVAVAeHSGEfekiMQLSERYN-----   56
ident                              ||                             
Sbjct pdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTD-DPID---sLEYHRQIAaddsi  176
DSSP  hhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLL-LLLL---lLHHHHHHHhllll


DSSP  -LLEEEEELLL--LEELLLLE---------------ellhHHHHHHHHHHHHHLL-LLLE
Query -GFVLPCLGVH--PVQGLDQR---------------svtlKDLDVALPIIENYKD-RLLA   97
ident    | |           ||                                        |
Sbjct dIEVAPSWRPDkvFKIELDGFvdylrkleaaadvsitrfdDLRQALTRRLDHFAAcGCRA  236
DSSP  lLEEELLLLLHhhHLLLLLLHhhhhhhhhhhhllllllhhHHHHHHHHHHHHHHHlLLLE


DSSP  EeEEEEEL--------------------lllllLLHHHHHHHHHHHHHHHHHHHHHLLLE
Query IgEVGLDF--------------------sprfaGTGEQKEEQRQVLIRQIQLAKRLNLPV  137
ident     |                               |       ||              
Sbjct S-DHGIETlrfapvpddaqldailgkrlagetlSELEIAQFTTAVLVWLGRQYAARGWVX  295
DSSP  E-EEEELLllllllllhhhhhhhhhhhhlllllLHHHHHHHHHHHHHHHHHHHHHHLLEE


DSSP  EEEEEL-------------------------LHHHHHHHHHHLL----LLLEEeELLL--
Query NVHSRS-------------------------AGRPTINLLQEQG----AEKVLlHAFD--  166
ident   |                                   ||          |         
Sbjct QLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDSXDvtneLPKTI-LYCLnp  354
DSSP  EEEELEellllhhhhhhhllllllleellllLHHHHHHHHHHHHllllLLEEE-EEELlh


DSSP  -LLHHHHHHHHHLL-------LEEEE---lhHHHLLhhHHHHHHHL-----LHHHEEELL
Query -GRPSVAMEGVRAG-------YFFSI---ppSIIRSgqKQKLVKQL-----PLTSICLET  210
ident       |                |                    ||             |
Sbjct rDNEVLATXIGNFQgpgiagkVQFGSgwwfnDQKDG--XLRQLEQLsqxglLSQFVGXLT  412
DSSP  hHHHHHHHHHHHLLlllllllEEELLllhhhLLHHH--HHHHHHHHhhhllHHHLLLLLL


DSSP  LLLlllllllllLLHHHHHHHHHHHHHHHL-------------lLHHHHHHHHHHHHHHH
Query DSPalgpekqvrNEPWNISISAEYIAQVKG-------------iSVEEVIEVTTQNALKL  257
ident ||                           |                  |      ||   
Sbjct DSR-------sfLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRY  465
DSSP  LLL-------llLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHH


DSSP  LLLhhhhl
Query FPKlrhll  265
ident |       
Sbjct FTI----k  469
DSSP  LLL----l


No 47: Query=2y1hB Sbjct=1j5sA Z-score=13.4

back to top
DSSP  -----------------------LLLEEEEEELLLlhhhllLHHH---------------
Query -----------------------GVGLVDCHCHLSapdfdrDLDD---------------   22
ident                            || | ||       |                  
Sbjct hmflgedylltnraavrlfnevkDLPIVDPHNHLD----akDIVEnkpwndiwevegatd   56
DSSP  llllllllllllhhhhhhhhhhlLLLEEELLLLLL----hhHHHHllllllhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   22
ident                                                             
Sbjct hyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvi  116
DSSP  hhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhlllllll


DSSP  --------------------HHHHHHHLLEEEEEELLlLHHHhhhhHHHHHHLL-----L
Query --------------------VLEKAKKANVVALVAVAeHSGEfekiMQLSERYN-----G   57
ident                              |  |                           
Sbjct seetaeeiweetkkklpemtPQKLLRDMKVEILCTTD-DPVS---tLEHHRKAKeavegV  172
DSSP  lhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL-LLLL---lLHHHHHHHhhlllL


DSSP  LEEEEELLL--LEELLLLE---------------ellhHHHHHHHHHHHHHLL-LLLEEe
Query FVLPCLGVH--PVQGLDQR---------------svtlKDLDVALPIIENYKD-RLLAIg   99
ident   ||                                    |       |  |     |  
Sbjct TILPTWRPDraMNVDKEGWreyvekmgerygedtstldGFLNALWKSHEHFKEhGCVAS-  231
DSSP  EEELLLLLHhhHLLLLLLHhhhhhhhhhhhllllllhhHHHHHHHHHHHHHHLlLLLEE-


DSSP  EEEEELL-------------------lllllLHHHHHHHHHHHHHHHHHHHHHLLLEEEE
Query EVGLDFS-------------------prfagTGEQKEEQRQVLIRQIQLAKRLNLPVNVH  140
ident    |                             |                   |     |
Sbjct DHALLEPsvyyvdenraravhekafsgekltQDEINDYKAFMMVQFGKMNQETNWVTQLH  291
DSSP  EEEELLLllllllhhhhhhhhhhhlllllllHHHHHHHHHHHHHHHHHHHHHHLLEEEEE


DSSP  EEL-------------------------lHHHHHHHHHHLL--LLLEEEeLLLL--LHHH
Query SRS-------------------------aGRPTINLLQEQG--AEKVLLhAFDG--RPSV  171
ident                                              |  |           
Sbjct IGAlrdyrdslfktlgpdsggdistnflrIAEGLRYFLNEFdgKLKIVL-YVLDptHLPT  350
DSSP  ELEellllhhhhhhlllllllleelllllHHHHHHHHHHHLllLLLEEE-EELLhhHHHH


DSSP  HHHHHH--LLLEEEE---lhHHHLLhhHHHHHHHL----LHHHE-EELLLLLllllllll
Query AMEGVR--AGYFFSI---ppSIIRSgqKQKLVKQL----PLTSI-CLETDSPalgpekqv  221
ident      |                          | |     |       |||         
Sbjct ISTIARafPNVYVGApwwfnDSPFG--MEMHLKYLasvdLLYNLaGMVTDSR-------k  401
DSSP  HHHHHHhlLLEEELLlllllLLHHH--HHHHHHHHhlllLHHHLlLLLLLLL-------l


DSSP  lLLHH-HHHHHHHHHHHHHL-----------lLHHHHHHHHHHHHHHHLLlhhhhl
Query rNEPW-NISISAEYIAQVKG-----------iSVEEVIEVTTQNALKLFPklrhll  265
ident                  | |              | |  |       ||       
Sbjct lLSFGsRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF------  451
DSSP  lLHHHhHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL------


No 48: Query=2y1hB Sbjct=3ooqA Z-score=13.3

back to top
DSSP  --------------------------------------------------LLLEEEEEEL
Query --------------------------------------------------GVGLVDCHCH   10
ident                                                     | || | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  -LLLHhHLLL-------------------------HHHHHHHHHHLLEEEEEELLL----
Query -LSAPdFDRD-------------------------LDDVLEKAKKANVVALVAVAE----   40
ident                                     |   | |    |     |      
Sbjct iGLFE-EGVGyyysdgneatdpvtphvkaldgfnpQDPAIERALAGGVTSVXIVPGsanp  119
DSSP  lLLLL-LLLLhhhlllllllllllllllhhhhlllLLHHHHHHHLLLEEEEEELLLllll


DSSP  ---lhhhhhhhhhhHHHLLLleeeeelllleelllleellhhhhhhhhhhhhhhllLLLE
Query ---hsgefekimqlSERYNGfvlpclgvhpvqgldqrsvtlkdldvalpiienykdRLLA   97
ident                |                                            
Sbjct vggqgsvikfrsiiVEECIV-----------------------------------kDPAG  144
DSSP  eeeeeeeeelllllHHHHEE-----------------------------------eEEEE


DSSP  EeEEEEELL-lLLLL----LHHHHHHHHHHHHH---------------------------
Query IgEVGLDFS-pRFAG----TGEQKEEQRQVLIR---------------------------  125
ident            |  |    |         |                              
Sbjct L-KXAFGENpkRVYGerkqTPSTRXGTAGVIRDyftkvknyxkkkelaqkegkeftetdl  203
DSSP  E-EEELLHHhhHHHHhlllLLLLHHHHHHHHHHhhhhhhhhhhhhhhhhhlllllllllh


DSSP  ---hhHHHHHHLLLEEEEEEL--LHHHHHHHHHHLLLLlEEEELLLLLHHHHHHHHHLLL
Query ---qiQLAKRLNLPVNVHSRS--AGRPTINLLQEQGAEkVLLHAFDGRPSVAMEGVRAGY  180
ident          |   |   |          |    | |                        
Sbjct kxevgEXVLRKKIPARXHAHRadDILTAIRIAEEFGFN-LVIEHGTEAYKISKVLAEKKI  262
DSSP  hhhhhHHHHLLLLLEEEEELLhhHHHHHHHHHHHHLLL-EEEEELLLHHHHHHHHHHHLL


DSSP  EEEELHHHHLL------HHHHHHHHHLL--hhHEEELLLLLLllllllllLLHHHHHHHH
Query FFSIPPSIIRS------GQKQKLVKQLP--ltSICLETDSPAlgpekqvrNEPWNISISA  232
ident      |                    |      | |  | |                  |
Sbjct PVVVGPLLTFRtklelkDLTXETIAKLLkdgvLIALXCDHPV--------IPLEFATVQA  314
DSSP  LEEELLLLLLLllhhhlLLLLLHHHHHHhlllLEEELLLLLL--------LLHHHHHHHH


DSSP  HHHHHHHlLLHHHHHHHHHHHHHHHLLlHHHHL---------------------------
Query EYIAQVKgISVEEVIEVTTQNALKLFPkLRHLL---------------------------  265
ident            |      | |  |    |                               
Sbjct ATAXRYG-AKEEDLLKILTVNPAKILG-LEDRIgsiepgkdadlvvwsghpfdxksvver  372
DSSP  HHHHHHL-LLHHHHHHLLLHHHHHHLL-LLLLLlllllllllleeeelllllllllleee


DSSP  ------------
Query ------------  265
ident             
Sbjct vyidgvevfrre  384
DSSP  eeelleeeeell


No 49: Query=2y1hB Sbjct=4dziC Z-score=12.9

back to top
DSSP  --LLLEEEEEELLLLH--------------------------------------------
Query --GVGLVDCHCHLSAP--------------------------------------------   14
ident        |   |   |                                            
Sbjct alNYRVIDVDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  llLLLEEEEEEELLLLlllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  ------------------------------hhLLLH----HHHHHHHHHLLEEEEEELL-
Query ------------------------------dfDRDL----DDVLEKAKKANVVALVAVA-   39
ident                                 |       |                   
Sbjct piivpgcldllfrgeipdgvdpaslmkverlaDHPEyqnrDARIAVMDEQDIETAFMLPt  120
DSSP  leelllllhhhhhllllllllhhhllleelhhHLHHhllhHHHHHHHHHHLEEEEEEELl


DSSP  ------------------lLHHHHHHHHHH---HHHLlLLEEEEELLLleelllleeLLH
Query ------------------eHSGEFEKIMQL---SERYnGFVLPCLGVHpvqgldqrsVTL   78
ident                                               |             
Sbjct fgcgveealkhdieatmasVHAFNLWLDEDwgfDRPD-HRIIAAPIVS--------lADP  171
DSSP  hhhhhhhhllllhhhhhhhHHHHHHHHHHHlllLLLL-LLEEELLLLL--------lLLH


DSSP  HHHHHHHHHHHHHllLLLEEeEEEEElllllllLHHHhhHHHH--hhhHHHHHHHHHLLL
Query KDLDVALPIIENYkdRLLAIgEVGLDfsprfagTGEQkeEQRQ--vliRQIQLAKRLNLP  136
ident                       |                                    |
Sbjct TRAVEEVDFVLAR--GAKLV-LVRPA---pvpgLVKP--RSLGdrshdPVWARLAEAGVP  223
DSSP  HHHHHHHHHHHHL--LLLLE-ELLLL---llllLLLL--LLLLlhhhhHHHHHHHHHLLL


DSSP  EEEEE-------------------------ELLHHHHHHHHH-HLLL-----LLEEEELL
Query VNVHS-------------------------RSAGRPTINLLQ-EQGA-----EKVLLHAF  165
ident |  |                            |   |                |      
Sbjct VGFHLsdsgylhiaaawggakdpldqvlldDRAIHDTMASMIvHGVFtrhpkLKAVSIEN  283
DSSP  EEEELlllllhhhhhhllllllhhhhhhhlLHHHHHHHHHHHhLLHHhhlllLLEEEELL


DSSP  LLLhhHHHH----------------------hHHLLLEEEElhhhhllhhHHHHHHHLL-
Query DGRpsVAME----------------------gVRAGYFFSIppsiirsgqKQKLVKQLP-  202
ident                                  |                       |  
Sbjct GSY--FVHRlikrlkkaantqpqyfpedpveqLRNNVWIAP--------yYEDDLPELAr  333
DSSP  LLL--HHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEELL--------lLLLLHHHHHh


DSSP  ---HHHEEELLLLL--LLLLlllllllhhHHHHHHHHHhHHHLLlhhHHHHHH-HHHHHH
Query ---LTSICLETDSP--ALGPekqvrnepwNISISAEYIaQVKGIsveEVIEVT-TQNALK  256
ident       |    | |                                   |      ||| 
Sbjct vigVDKILFGSDWPhgEGLA---------SPVSFTAEL-KGFSE---SDIRKImRDNALD  380
DSSP  hhlHHHLLLLLLLLllLLLL---------LHHHHHHHH-LLLLH---HHHHHHhLHHHHH


DSSP  HLLLhhhhl
Query LFPKlrhll  265
ident |        
Sbjct LLGV-qvgs  388
DSSP  HHLL-llll


No 50: Query=2y1hB Sbjct=2a3lA Z-score=12.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------------------LLLEEEEEELLLL-------
Query ----------------------------------------GVGLVDCHCHLSA-------   13
ident                                          |  || | | ||       
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfyNVRKVDTHVHHSAcmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllLLLEEEEEEELLLlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   13
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -------------------------hhHLLLHHHHHHHHHHLLEEEEEELLLLH----hH
Query -------------------------pdFDRDLDDVLEKAKKANVVALVAVAEHS----gE   44
ident                                   |                        |
Sbjct nlkynpcgqsrlreiflkqdnliqgrfLGEITKQVFSDLEASKYQMAEYRISIYgrkmsE  300
DSSP  hhhhllllllhhhhhhlllllllllllHHHHHHHHHHHHLLLLLEEEEEEEELLlllllH


DSSP  HHHHH---hhhhHLLLLEEEEELLLLEE----lllleelLHHHHHHHHHHHHH-------
Query FEKIM---qlseRYNGFVLPCLGVHPVQ----gldqrsvTLKDLDVALPIIEN-------   90
ident              |   |                         ||               
Sbjct WDQLAswivnndLYSENVVWLIQLPRLYniykdmgivtsFQNILDNIFIPLFEatvdpds  360
DSSP  HHHHHhhhhlllLLLLLEEEEEEEELLHhhhllllllllLHHHHHHHLLHHHHhhhlhhh


DSSP  ------HLLLLLEeEEEE-eELLLllLLLH-------------HHHHhHHHHHHHHHHHH
Query ------YKDRLLAiGEVG-lDFSPrfAGTG-------------EQKEeQRQVLIRQIQLA  130
ident                        |                                    
Sbjct hpqlhvFLKQVVG-FDLVddESKP--ERRPtkhmptpaqwtnaFNPA-FSYYVYYCYANL  416
DSSP  llllhhHHLLEEE-EEEEllLLLL--LLLLlllllllllllllLLLL-HHHHHHHHHHHH


DSSP  HHHL----------LLEEEEE-ELLHHHHHHHHHhlLLLLeEEELLLLLHH---HHHHHH
Query KRLN----------LPVNVHS-RSAGRPTINLLQeqGAEKvLLHAFDGRPS---VAMEGV  176
ident   ||               ||                                       
Sbjct YVLNklreskgmttITLRPHSgEAGDIDHLAATF--LTCH-SIAHGINLRKspvLQYLYY  473
DSSP  HHHHhhhlllllllLEELLLLlLLLLLHHHHHHH--HHLL-LLLLLHHHHHlhhHHHHHH


DSSP  HLLLEEEEL-HHHHL----LHHHhhHHHHLL--HHHEEELLLLLLLLLLllllllhHHHH
Query RAGYFFSIP-PSIIR----SGQKqkLVKQLP--LTSICLETDSPALGPEkqvrnepWNIS  229
ident  |         |                          | || |                
Sbjct LAQIGLAMSpLSNNSlfldYHRN--PFPVFFlrGLNVSLSTDDPLQIHL-----tkEPLV  526
DSSP  HHLLLEEELhHHHLLllllLLLL--LHHHHHhlLLLEEELLLLHHHHLL-----llLHHH


DSSP  HHHHHHHHHHLLLHHHHhHHHHHHHHHHLlLHHHHL------------------------
Query ISAEYIAQVKGISVEEViEVTTQNALKLFpKLRHLL------------------------  265
ident       | |   |          |         | |                        
Sbjct EEYSIAASVWKLSACDL-CEIARNSVYQS-GFSHALkshwigkdyykrgpdgndihktnv  584
DSSP  HHHHHHHHHHLLLHHHH-HHHHHHHHHHL-LLLHHHhhhhlllllllllhhhllhhhhll


DSSP  --------------------------------
Query --------------------------------  265
ident                                 
Sbjct phirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lhhhhhhhhhhhhhhhhhhlllllllllllll


No 51: Query=2y1hB Sbjct=1v77A Z-score=12.0

back to top
DSSP  lLLEEEEEELLLLhhhlllhhhhhhHHHHLlEEEEEELLLlhhhhhhhhhhhhhllllee
Query gVGLVDCHCHLSApdfdrdlddvleKAKKAnVVALVAVAEhsgefekimqlseryngfvl   60
ident  |                        ||       |                        
Sbjct -VKFIEMDIRDKE---------ayeLAKEW-FDEVVVSIK--------------------   29
DSSP  -LLLEEEEELLHH---------hhhHHHHH-LLEEEEEEE--------------------


DSSP  eeellLLEElllleellhhhhhhHHHHHHHHLL--LLLEeEEEEEEllllllllhhhhhh
Query pclgvHPVQgldqrsvtlkdldvALPIIENYKD--RLLAiGEVGLDfsprfagtgeqkee  118
ident                                       |                     
Sbjct -----FNEE-------------vDKEKLREARKeyGKVA-ILLSNP--------------   56
DSSP  -----ELLL-------------lLHHHHHHHHHhhLLEE-EEEELL--------------


DSSP  HHHHHHHHHHHHHhhLLLEEEEEELlhHHHHHHHHHLLLllEEEELLL------LLHH-H
Query QRQVLIRQIQLAKrlNLPVNVHSRSagRPTINLLQEQGAekVLLHAFD------GRPS-V  171
ident          |  |       | |       |    | |                |     
Sbjct KPSLVRDTVQKFK--SYLIYVESND--LRVIRYSIEKGV--DAIISPWvnrkdpGIDHvL  110
DSSP  LHHHHHHHHHHLL--LLEEEEELLL--HHHHHHHHHLLL--LEEELLLllllllLLLHhH


DSSP  HHHHHHLLLEEEELHHHH----------LLHHHHHHHHHLL--hhHEEELLLLLLlllll
Query AMEGVRAGYFFSIPPSII----------RSGQKQKLVKQLP--ltSICLETDSPAlgpek  219
ident |   |                             |  |          |           
Sbjct AKLMVKKNVALGFSLRPLlysnpyeranLLRFMMKAWKLVEkykvRRFLTSSAQE-----  165
DSSP  HHHHHHHLLEEEEELHHHhhllhhhhhhHHHHHHHHHHHHHhhllLEEEELLLLL-----


DSSP  llLLLHHhHHHHHHHHHHHHlllHHHHHHHH-HHHHHHHLLlhhhhl
Query qvRNEPWnISISAEYIAQVKgisVEEVIEVT-TQNALKLFPklrhll  265
ident                                                
Sbjct -kWDVRY-PRDLISLGVVIG--mEIPQAKASiSMYPEIILK------  202
DSSP  -hHHLLL-HHHHHHHHHHLL--lLHHHHHHLlLHHHHHHHL------


No 52: Query=2y1hB Sbjct=3au2A Z-score=10.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------------------LLLEEEEEELLLL--HHHLllHHHHH
Query ----------------------------------GVGLVDCHCHLSA--PDFDrdLDDVL   24
ident                                        |   |           |    
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYsdGQNT--LEELW  358
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLllLLLL--HHHHH


DSSP  HHHHHLLEEEEEELLL--------------LHHHHHHHHHHHHHLLL-LEEEEellllee
Query EKAKKANVVALVAVAE--------------HSGEFEKIMQLSERYNG-FVLPClgvhpvq   69
ident | ||      |                          |    |       |         
Sbjct EAAKTMGYRYLAVTDHspavrvaggpspeeALKRVGEIRRFNETHGPpYLLAG-------  411
DSSP  HHHHHHLLLEEEEEEElhhhhllllllhhhHHHHHHHHHHHHHHHLLlEEEEE-------


DSSP  lllleellhhhhhhhhhhhhhhllllleeEEEEEELlllllllhhhhhhhHHHHhhHHHH
Query gldqrsvtlkdldvalpiienykdrllaiGEVGLDFsprfagtgeqkeeqRQVLirQIQL  129
ident                               ||                            
Sbjct -----------------------------AEVDIHP-------------dGTLD--YPDW  427
DSSP  -----------------------------EEEELLL-------------lLLLL--LLHH


DSSP  HhhhlllEEEEEEL--------lhHHHHHHHHhlLLLLEEEELLL------------lLH
Query AkrlnlpVNVHSRS--------agRPTINLLQeqGAEKVLLHAFD------------gRP  169
ident        | |   |                |         |                   
Sbjct VlreldlVLVSVHSrfnlpkadqtKRLLKALE--NPFVHVLAHPTarllgrrapieadWE  485
DSSP  HhlllleEEEELLLlllllhhhhhHHHHHHHL--LLLLLEELLLLlllllllllllllHH


DSSP  HHHHHHHHLLLEEEELHHHHLLhhHHHHHHHLL--hHHEEELLLLLllllllllLLLHHH
Query SVAMEGVRAGYFFSIPPSIIRSgqKQKLVKQLP--lTSICLETDSPalgpekqvRNEPWN  227
ident  |       |    |     |      |          | | ||                
Sbjct AVFQKAKEKGVAVEIDGYYDRMdlPDDLARMAYgmgLWISLSTDAH-------qTDHLRF  538
DSSP  HHHHHHHHHLLEEEEELLLLLLllLHHHHHHHHhllLLEEEELLLL-------lHHHHHH


DSSP  HHHHHHHHHHHHlllHHHHhhHHHH----hHHHHLLlhhhhl
Query ISISAEYIAQVKgisVEEVieVTTQ----nALKLFPklrhll  265
ident                  |   |         |          
Sbjct MELAVGTAQRAW--iGPER--VLNTldyedLLSWLK-arrgv  575
DSSP  HHHHHHHHHHLL--lLLLL--LHHHllhhhHHHHHH-lllll


No 53: Query=2y1hB Sbjct=3dcpA Z-score=10.0

back to top
DSSP  llLEEEEEELLLL----HHHLllHHHHHHHHHHLLEEEEEELLL----------------
Query gvGLVDCHCHLSA----PDFDrdLDDVLEKAKKANVVALVAVAE----------------   40
ident      | | |          |        ||          |                  
Sbjct --XKRDGHTHTEFcphgTHDD--VEEXVLKAIELDFDEYSIVEHaplssefxkntagdke   56
DSSP  --LLEEEEELLLLllllLLLL--HHHHHHHHHHLLLLEEEEEEEllllhhhhhllllllh


DSSP  -----------LHHHHHHHHHHHHHLL--LLEEEEelllleelllleellhhhhhhhhhh
Query -----------HSGEFEKIMQLSERYN--GFVLPClgvhpvqgldqrsvtlkdldvalpi   87
ident                | |       |                                  
Sbjct avttasxaxsdLPYYFKKXNHIKKKYAsdLLIHIG-------------------------   91
DSSP  hhhlllllhhhHHHHHHHHHHHHHHLLllLEEEEE-------------------------


DSSP  hhhhllllleeEEEEEELlllllllhhhhhHHHHHHHHHHHHHHHhlllEEEEEEL----
Query ienykdrllaiGEVGLDFsprfagtgeqkeEQRQVLIRQIQLAKRlnlpVNVHSRS----  143
ident             ||                                              
Sbjct -----------FEVDYLI------------GYEDFTRDFLNEYGPqtddGVLSLHFlegq  128
DSSP  -----------EEEELLL------------LLHHHHHHHHHHHHHhlleEEEELLEeeel


DSSP  ---------------------------------LHHHHHHHhhHLLL-lLEEEELLL---
Query ---------------------------------AGRPTINLlqEQGA-eKVLLHAFD---  166
ident                                       |      |              
Sbjct ggfrsidfsaedynegivqfyggfeqaqlayleGVKQSIEA--DLGLfkPRRXGHISlcq  186
DSSP  leeeellllhhhhhhhlhhhhllhhhhhhhhhhHHHHHHHL--LLLLllLLEELLLLhhh


DSSP  -------------------lLHHHHHHHHHLLLEEEELHHH-----HLLH-hHHHHHHHL
Query -------------------gRPSVAMEGVRAGYFFSIPPSI-----IRSG-qKQKLVKQL  201
ident                                 |                     | |   
Sbjct kfqqffgedtsdfseevxekFRVILALVKKRDYELDFNTAGlfkplCGETypPKKIVTLA  246
DSSP  llhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEELHHhhlllLLLLllLHHHHHHH


DSSP  L--HHHEEELLLLLllllllllLLLHhHHHHHHHHHHHhhlllhhhhhhhhhhhhhhhll
Query P--LTSICLETDSPalgpekqvRNEPwNISISAEYIAQvkgisveevievttqnalklfp  259
ident            ||                                               
Sbjct SelQIPFVYGSDSH------gvQDIG-RGYSTYCQKLE----------------------  277
DSSP  HhlLLLEEEELLLL------lhHHLL-LLHHHHHHHLL----------------------


DSSP  lhhhhl
Query klrhll  265
ident       
Sbjct ------  277
DSSP  ------


No 54: Query=2y1hB Sbjct=1m65A Z-score=9.8

back to top
DSSP  llLEEEEEELLL----LHHHlllHHHHHHHHHHLLEEEEEELL-------LLHH-HHHHH
Query gvGLVDCHCHLS----APDFdrdLDDVLEKAKKANVVALVAVA-------EHSG-EFEKI   48
ident     || | |      |      | |    ||                        |   
Sbjct --YPVDLHMHTVasthAYST---LSDYIAQAKQKGIKLFAITDhgpdmedAPHHwHFINM   55
DSSP  --LLEELLLLLLllllLLLL---HHHHHHHHHHHLLLEEEEEEellllllLLLLhHHHHH


DSSP  HHhhHHLL---lLEEEEelllleelllleellhhhhhhhhhhhhhhllllleeEEEEEEL
Query MQlsERYN---gFVLPClgvhpvqgldqrsvtlkdldvalpiienykdrllaiGEVGLDF  105
ident               |                                       |     
Sbjct RI--WPRVvdgvGILRG------------------------------------IEANIKN   77
DSSP  HH--LLLEelleEEEEE------------------------------------EEEELLL


DSSP  lllllllhhhhhhhhhhhhhHHHH-hhhhlllEEEEEE----------lLHHHHHHHHHh
Query sprfagtgeqkeeqrqvlirQIQL-akrlnlpVNVHSR----------sAGRPTINLLQe  154
ident                                                       |     
Sbjct ---------------vdgeiDCSGkmfdsldlIIAGFHepvfaphdkatNTQAMIATIA-  121
DSSP  ---------------lllllLLLHhhhhhlleEEEELLllllllllhhhHHHHHHHHHH-


DSSP  lLLLLEEEELLL-----LLHH-HHHHHHHLLLEEEELHHHhllhHHHHHHHHLL--hHHE
Query qGAEKVLLHAFD-----GRPS-VAMEGVRAGYFFSIPPSIirsgQKQKLVKQLP--lTSI  206
ident                       ||           |  |                     
Sbjct -SGNVHIISHPGnpkyeIDVKaVAEAAAKHQVALEINNSS----NCREVAAAVRdagGWV  176
DSSP  -LLLLLEELLLLlllllLLHHhHHHHHHHHLLEEEEELLL----LHHHHHHHHHhhlLLE


DSSP  EELLLLLLlllllllllLHHHHHHHHHHHHHHHlllhhhhhhHHHH---HHHHHLL----
Query CLETDSPAlgpekqvrnEPWNISISAEYIAQVKgisveevieVTTQ---NALKLFP----  259
ident  |  ||                         |                   |        
Sbjct ALGSDSHT-------afTMGEFEECLKILDAVD----fpperILNVsprRLLNFLEsrgm  225
DSSP  EEELLLLL-------hhHLLLLHHHHHHHHHLL----llhhhLHHHlhhHHHHHHHhlll


DSSP  lhHHHL---
Query klRHLL---  265
ident          
Sbjct apIAEFadl  234
DSSP  llLHHHlll


No 55: Query=2y1hB Sbjct=3f2bA Z-score=8.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ----------------------------------------------LLLEEEEEELLL--
Query ----------------------------------------------GVGLVDCHCHLS--   12
ident                                               |   |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLll


DSSP  --LHHHllLHHHHHHHHHHLLEEEEEELLLLhhHHHHHHHHHHHLL---LLEEEEellll
Query --APDFdrDLDDVLEKAKKANVVALVAVAEHsgEFEKIMQLSERYN---GFVLPClgvhp   67
ident               | |||    |                           |        
Sbjct qmDAVT--SVTKLIEQAKKWGHPAIAVTDHA--VVQSFPEAYSAAKkhgMKVIYG-----  171
DSSP  llLLLL--LHHHHHHHHHHLLLLLEEELLLL--LLLLHHHHHHHHHhhlLLEEEE-----


DSSP  eelllleellhhhhhhhhhhhhhhllllleeEEEEEellllllllhhhhhhHHHH-----
Query vqgldqrsvtlkdldvalpiienykdrllaiGEVGLdfsprfagtgeqkeeQRQV-----  122
ident                                 |                           
Sbjct -------------------------------LEANI---------------VDDPfhvtl  185
DSSP  -------------------------------EEEEE---------------ELLLeeeee


DSSP  ------------------------------HHHHHHHHhhhLLLEeeeeellhhhhhhhh
Query ------------------------------LIRQIQLAkrlNLPVnvhsrsagrptinll  152
ident                                                             
Sbjct laqnetglknlfklvslshiqyfhrvpripRSVLVKHR---DGLL---------------  227
DSSP  eellhhhhhhhhhhhhhhhllllllllleeHHHHHHLL---LLEE---------------


DSSP  hhlllllEEEEL----LLLLhhhHHHHHHLLLEEEELHH-----------hhLLHHHHHH
Query qeqgaekVLLHA----FDGRpsvAMEGVRAGYFFSIPPS-----------iiRSGQKQKL  197
ident        |                    |   |    |                      
Sbjct -------VGSGCdkgeLFDN---VEDIARFYDFLEVHPPdvykplyvkdeemIKNIIRSI  277
DSSP  -------EELLLllllLLLL---LLLLHHHLLLEEELLHhhhlllllllhhhHHHHHHHH


DSSP  HHHLL--hHHEEELLLLL---------------------lllllLLLLLLhHHHH-HHHH
Query VKQLP--lTSICLETDSP---------------------algpeKQVRNEpWNIS-ISAE  233
ident |                                                           
Sbjct VALGEkldIPVVATGNVHylnpedkiyrkilihsqgganplnrhELPDVY-FRTTnEMLD  336
DSSP  HHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllllLLLLLL-LLLHhHHHH


DSSP  HHhHHHLLL-HHHH-HHHHHHHHHHhlllHHHH---------------------------
Query YIaQVKGIS-VEEV-IEVTTQNALKlfpkLRHL---------------------------  264
ident       |     |     |   |                                     
Sbjct CF-SFLGPEkAKEIvVDNTQKIASL----IGDVkpikdelytpriegadeeiremsyrra  391
DSSP  HH-HHHHHHhHHHHhLHHHHHHHHL----LLLLllllllllllllllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct keiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfv  451
DSSP  hhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct atmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfe  511
DSSP  hhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct tflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkaya  571
DSSP  hhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct sdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewr  631
DSSP  hhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct tthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgv  691
DSSP  eeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct tpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqn  751
DSSP  lhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct gtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyi  811
DSSP  llllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct dsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaai  871
DSSP  hhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct rkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslip  931
DSSP  hhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  264
ident                                                             
Sbjct pfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnql  991
DSSP  lhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllllll


DSSP  --l
Query --l  265
ident    
Sbjct slf  994
DSSP  lll


No 56: Query=2y1hB Sbjct=1bksA Z-score=6.4

back to top
DSSP  -------------llleeeeeELLLLHHHLLLHHHHHHHHHHLLEEEEEEL---------
Query -------------gvglvdchCHLSAPDFDRDLDDVLEKAKKANVVALVAV---------   38
ident                                           |   ||            
Sbjct meryenlfaqlndrregafvpFVTLGDPGIEQSLKIIDTLIDAGADALELGvpfsdplad   60
DSSP  lhhhhhhhhhhhhlllleeeeEEELLLLLHHHHHHHHHHHHHLLLLLEEEElllllllll


DSSP  -----------lllhhhHHHHHHHHHHLLL----LEEEEELLLleelllleellhhhHHH
Query -----------aehsgeFEKIMQLSERYNG----FVLPCLGVHpvqgldqrsvtlkdLDV   83
ident                                        |                    
Sbjct gptiqnanlrafaagvtPAQCFEMLALIREkhptIPIGLLMYA-----------nlvFNN  109
DSSP  lhhhhhhhhhhhhhlllHHHHHHHHHHHHHhlllLLEEEEELH-----------hhhHLL


DSSP  HH-HHHHHHLL-LLLEEEEEeeellllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEE
Query AL-PIIENYKD-RLLAIGEVgldfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHS  141
ident                                               | | | |       
Sbjct GIdAFYARCEQvGVDSVLVA---------------dvPVEESAPFRQAALRHNIAPIFIC  154
DSSP  LHhHHHHHHHHhLLLEEEEL---------------llLHHHLHHHHHHHHHLLLEEEEEE


DSSP  ELLH-HHHHHHHHhlLLLLEEEELL-llLHHHHHHHHH-LLLEEEE--lHHHHLLhhhhh
Query RSAG-RPTINLLQeqGAEKVLLHAF-dgRPSVAMEGVR-AGYFFSI--pPSIIRSgqkqk  196
ident                                                   |         
Sbjct PPNAdDDLLRQVA--SYGRGYTYLLalpLHHLIEKLKEyHAAPALQgfgISSPEQ--vsa  210
DSSP  LLLLlHHHHHHHH--HHLLLLEEELlllHHHHHHHHHHhLLLLEEElllLLLHHH--hhh


DSSP  HHHHLlhhhEEELLLLLL--------llllllllllhhHHHHHHHHHHhhhlllhhhhhh
Query LVKQLpltsICLETDSPA--------lgpekqvrnepwNISISAEYIAqvkgisveevie  248
ident  |             |                        |                   
Sbjct AVRAG---aAGAISGSAIvkiieknlaspkqmlaelrsFVSAMKAASR------------  255
DSSP  HHHHL---lLEEEELLHHhhhhhhllllhhhhhhhhhhHHHHHHHLLL------------


DSSP  hhhhhhhhhlllhhhhl
Query vttqnalklfpklrhll  265
ident                  
Sbjct -----------------  255
DSSP  -----------------


No 57: Query=2y1hB Sbjct=2yb1A Z-score=6.4

back to top
DSSP  lllEEEEEELLL--LHHHlllHHHHHHHHHHLLEEEEEELLLlhhhHHHHHHHHHHLL--
Query gvgLVDCHCHLS--APDFdrdLDDVLEKAKKANVVALVAVAEhsgeFEKIMQLSERYN--   56
ident      | | |              |   |       |                       
Sbjct --aNIDLHFHSRtsDGAL--tPTEVIDRAAARAPALLALTDH--dcTGGLAEAAAAAArr   54
DSSP  --lLEELLLLLLllLLLL--lHHHHHHHHHLLLLLEEEELLL--llLLLHHHHHHHHHhl


DSSP  -LLEEEEelllleelllleellhhhhhhhhhhhhhhllllleeEEEEEELLLlllllhhh
Query -GFVLPClgvhpvqgldqrsvtlkdldvalpiienykdrllaiGEVGLDFSPrfagtgeq  115
ident     |                                       ||              
Sbjct gIPFLNG------------------------------------VEVSVSWGR--htvhiv   76
DSSP  lLLEEEE------------------------------------EEEEEEELL--eeeeee


DSSP  hhhhhhhhhHHHHHH---------------------------------------------
Query keeqrqvliRQIQLA---------------------------------------------  130
ident                                                             
Sbjct glgidpaepALAAGLksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthf  136
DSSP  eellllllhHHHHHHhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhh


DSSP  -----------------hhhllleeeeeellhhhHHHHHH---hllllLEEEELLL----
Query -----------------krlnlpvnvhsrsagrpTINLLQ---eqgaeKVLLHAFD----  166
ident                                                             
Sbjct arhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDAVgwivgaggMAVIAHPGrydm  196
DSSP  hhhhhhllllllhhhhhhhlllllllllllllllLHHHHHhhhhhlllEEEELLHHhlll


DSSP  ---lLHHHHHHHHH-LLLEEE-ELHHHHLL--HHHHHHHHHLLhhHEEELLLLLllllll
Query ---gRPSVAMEGVR-AGYFFS-IPPSIIRS--GQKQKLVKQLPltSICLETDSPalgpek  219
ident                 |        |                         |        
Sbjct grtlIERLILDFQAaGGQGIEvASGSHSLDdmHKFALHADRHG-lYASSGSDFH-----a  250
DSSP  lhhhHHHHHHHHHHlLLLEEEeEELLLLHHhhHHHHHHHHHHL-lEEEEELLLL-----l


DSSP  LLLLlHHHHhhHHHHhhhhhlllhhhhhhhhhHHHHhHLLLhHHHL------
Query QVRNePWNIsiSAEYiaqvkgisveevievttQNALkLFPKlRHLL------  265
ident                                           | |       
Sbjct PGED-VGHT--EDLP-------------picrPIWR-ELEA-RILRpadaen  284
DSSP  LLLL-LLLL--LLLL-------------llllLHHH-HLHH-HLLLllhhhl


No 58: Query=2y1hB Sbjct=2anuA Z-score=6.3

back to top
DSSP  -LLLEEEEEELL---lLHHHLlLHHHHHHHHHhllEEEEEELLL----------------
Query -GVGLVDCHCHL---sAPDFDrDLDDVLEKAKkanVVALVAVAE----------------   40
ident     | | | |              |   |     |                        
Sbjct tEWLLCDFHVHTnxsdGHLPLgEVVDLFGKHG---VDVVSITDHivdrrtleqrkrngep   57
DSSP  lEEEEEEEEELLllllLLLLHhHHHHHHHHLL---LLEEEEEEEeelhhhhhhhhhllll


DSSP  --------LHHHHHHHHHHHHHLL----LLEEEEelllleelllleellhhhhhhhhhhh
Query --------HSGEFEKIMQLSERYN----GFVLPClgvhpvqgldqrsvtlkdldvalpii   88
ident                      |          |                           
Sbjct lgaitedkFQDYLKRLWREQKRAWeeygXILIPG--------------------------   91
DSSP  llllllllHHHHHHHHHHHHHHHHhhhlLEEEEE--------------------------


DSSP  hhhllllleeEEEEEELL--llllllhhhhhhHHHHHHHHHHHHHHHLLLeeeeeellhh
Query enykdrllaiGEVGLDFS--prfagtgeqkeeQRQVLIRQIQLAKRLNLPvnvhsrsagr  146
ident            |                                |  |            
Sbjct ----------VEITNNTDlyhivavdvkeyvdPSLPVEEIVEKLKEQNAL----------  131
DSSP  ----------EEEEELLLleeeeeelllllllLLLLHHHHHHHHHHLLLE----------


DSSP  hhhhhhhhlllllEEEELL------lllhHHHHHHHHLlLEEE-ELHHHHllhhHHHHHH
Query ptinllqeqgaekVLLHAF------dgrpSVAMEGVRAgYFFS-IPPSIIrsgqKQKLVK  199
ident              |                                              
Sbjct -------------VIAAHPdrkklswylwANXERFKDTfDAWEiANRDDL----FNSVGV  174
DSSP  -------------EEELLLlllllllhhhHLLLLLLLLlLEEEeEELLEE----LHHHHH


DSSP  HLLhhHEEELLLLLLlllllllLLLHHHHHhhhhhhhhhhlllhhhhhhhhhhhhhhhll
Query QLPltSICLETDSPAlgpekqvRNEPWNISisaeyiaqvkgisveevievttqnalklfp  259
ident            |                                                
Sbjct KKY--RYVANSDFHE-------LWHVYSWK-----------------------tlvksek  202
DSSP  LLL--LEEEELLLLL-------HHHHLLEE-----------------------eeeeell


DSSP  LHHHH----------------l
Query KLRHL----------------l  265
ident                       
Sbjct NIEAIkeairkntdvaiylxrk  224
DSSP  LHHHHhhhhhhllleeeeelll


No 59: Query=2y1hB Sbjct=3e38A Z-score=5.4

back to top
DSSP  ---------------LLLEEEEEELLL--LHHHLllHHHHHHHHHHLLEEEEEELLLL--
Query ---------------GVGLVDCHCHLS--APDFDrdLDDVLEKAKKANVVALVAVAEH--   41
ident                     | | |                  |      |         
Sbjct aqrrneiqvpdldgyTTLKCDFHXHSVfsDGLVW--PTVRVDEAYRDGLDAISLTEHIey   58
DSSP  lllllllllllllllEEEEEELLLLLLllLLLLL--HHHHHHHHHHLLLLEELLEEELll


DSSP  --------HHHHHHHHHHHHHLL---LLEEEEelllleelllleellhhhhhhhhhhhhh
Query --------SGEFEKIMQLSERYN---GFVLPClgvhpvqgldqrsvtlkdldvalpiien   90
ident         |          |                                        
Sbjct rphkqdvvSDHNRSFDLCREQAEklgILLIKG----------------------------   90
DSSP  llllllllLLLLHHHHHHHHHHHhhlLEELLE----------------------------


DSSP  hllllleeEEEEEEL---lllllllhhhhhhhhHHHHHHHHHHHhHLLLeeeeeellhhh
Query ykdrllaiGEVGLDF---sprfagtgeqkeeqrQVLIRQIQLAKrLNLPvnvhsrsagrp  147
ident          |                                ||                
Sbjct --------SEITRAXapghfnaiflsdsnpleqKDYKDAFREAK-KQGA-----------  130
DSSP  --------EEEELLLllleeeeelllllhhhllLLHHHHHHHHH-HLLL-----------


DSSP  hhhhhhhllllLEEEELLLL------LHHH-----hhhhhhllLEEE-ELHHHhllhhHH
Query tinllqeqgaeKVLLHAFDG------RPSV-----amegvragYFFS-IPPSIirsgqKQ  195
ident                                                             
Sbjct -----------FXFWNHPGWdsqqpdTTKWwpehtalyqegcxHGIEvANGHL-----YX  174
DSSP  -----------EEEELLLLLllllllLLLLlhhhhhhhhllllLEEEeEELLE-----EL


DSSP  HHHHHLLH---HHEEELLLLLllllllLLLL-----------------------------
Query KLVKQLPL---TSICLETDSPalgpekQVRN-----------------------------  223
ident     |  |          |        |                                
Sbjct PEAIQWCLdknLTXIGTSDIH---qpiQTDYdfekgehrtxtfvfakerslqgirealdn  231
DSSP  LHHHHHHHhhlLEEEEELLLL---llhHHHLlhhhllllleeeeeellllhhhhhhhhhl


DSSP  lhhhhhhhhHHHH-----------------------------------------------
Query epwnisisaEYIA-----------------------------------------------  236
ident            |                                                
Sbjct rrtaayfheLLIGredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtl  291
DSSP  lleeeeellEEELlhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeellllll


DSSP  ------------------------------------HHHLllhhhhhhhhhhhhhhhlll
Query ------------------------------------QVKGisveevievttqnalklfpk  260
ident                                                             
Sbjct lvyfrdxtlkphtrytvrigfkqgikggdvnfevtnFIVA--------------pdkglk  337
DSSP  eellleeeellleeeeeeeeellllllleeeeeeeeEEEE--------------lleeee


DSSP  hhhhl
Query lrhll  265
ident      
Sbjct ytisl  342
DSSP  eeeel