Results: dupa

Query: 2vunA

MOLECULE: ENAMIDASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2vun-A 75.7  0.0  385   385  100 PDB  MOLECULE: ENAMIDASE;                                                 
   2:  2paj-A 32.6  3.3  328   421   17 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   3:  1onx-A 31.4  2.6  321   390   17 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   4:  3nqb-A 30.5  2.8  309   587   18 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   5:  3mtw-A 30.3  2.7  307   404   19 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   6:  3mkv-A 29.7  3.0  311   414   22 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   7:  3giq-A 28.8  3.0  317   475   20 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   8:  1yrr-B 28.7  2.7  301   334   16 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
   9:  2oof-A 28.4  3.2  318   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  10:  3ls9-A 28.4  3.4  336   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  11:  4cqb-A 27.9  3.4  319   402   15 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  12:  1gkp-A 27.8  2.7  324   458   21 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  4c5y-A 27.7  3.1  303   436   19 PDB  MOLECULE: OCHRATOXINASE;                                             
  14:  3gri-A 27.4  3.0  317   422   19 PDB  MOLECULE: DIHYDROOROTASE;                                            
  15:  1j6p-A 27.3  3.3  316   407   17 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  16:  3e74-A 27.1  2.9  314   429   19 PDB  MOLECULE: ALLANTOINASE;                                              
  17:  2uz9-A 26.7  3.9  326   444   16 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  18:  2ogj-A 26.5  3.4  315   379   21 PDB  MOLECULE: DIHYDROOROTASE;                                            
  19:  4b3z-D 26.3  2.9  326   477   18 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  20:  1k6w-A 26.0  3.7  312   423   16 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  21:  4rdv-B 24.1  3.3  317   451   15 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  22:  3icj-A 23.7  3.0  284   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  23:  3ooq-A 22.9  3.0  271   384   18 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  24:  1a5k-C 21.2  2.8  313   566   19 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  25:  3cjp-A 18.9  2.5  214   262   16 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  26:  2imr-A 18.9  5.9  291   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  27:  2y1h-B 18.5  2.8  216   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  28:  3irs-A 18.1  2.9  225   281   15 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  29:  1bf6-A 17.6  2.9  217   291   14 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  4dlf-A 17.4  2.8  216   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  31:  3pnu-A 17.0  3.3  249   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  32:  3k2g-B 16.9  3.0  220   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  33:  3gg7-A 16.7  3.0  208   243   17 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  34:  2ffi-A 16.2  3.0  216   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  2ob3-A 16.2  3.0  215   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  36:  4mup-B 15.9  3.1  226   286   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  37:  4ofc-A 15.8  3.1  224   335   17 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  38:  2dvt-A 15.6  3.1  221   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  39:  2vc5-A 15.4  3.1  212   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  40:  4hk5-D 15.3  3.4  229   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  41:  4qrn-A 14.6  3.1  213   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  42:  1itq-A 14.6  3.3  223   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  43:  1a4m-A 14.3  3.5  224   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  44:  2gwg-A 14.3  3.7  221   329   14 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  45:  1v77-A 14.2  2.6  178   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  46:  2qpx-A 14.2  3.3  222   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  47:  3qy6-A 14.1  2.9  189   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  4dzi-C 13.5  3.5  214   388   14 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  1j5s-A 12.4  3.4  218   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  50:  3iac-A 12.2  3.5  217   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  1m65-A 11.1  3.5  183   234   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  52:  3au2-A 10.6  8.4  197   575   14 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  2a3l-A 10.5  3.9  227   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  54:  3dcp-A 10.1  3.3  175   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  8.5  6.0  166   994   13 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  8.1  3.8  168   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.8  3.6  141   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  6.2  4.6  177   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  6.0  4.0  150   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2vunA Sbjct=2vunA Z-score=75.7

back to top
DSSP  LEEEEELLLEEELLLLLLLEELLLEEEEELLEEEEEELHHHHLLLLLLEEEELLLLEEEE
Query SKTIIKNIGKIVSGDIKSPVLQADTIVVEDGLIAAIGGEELMKDAGDATIIDAAGSTVTP   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SKTIIKNIGKIVSGDIKSPVLQADTIVVEDGLIAAIGGEELMKDAGDATIIDAAGSTVTP   60
DSSP  LEEEEELLLEEELLLLLLLEELLLEEEEELLEEEEEELHHHHLLLLLLEEEELLLLEEEE


DSSP  LEEEEEELLLLLLEEHHHLEELHHHHHHLLLEEEEEELLLLLLLLLLLLHHHHHHHHHHH
Query GLLDTHVHVSGGDYAPRQKTMDFISSALHGGVTTMISAGSPHFPGRPKDAAGTKALAITL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GLLDTHVHVSGGDYAPRQKTMDFISSALHGGVTTMISAGSPHFPGRPKDAAGTKALAITL  120
DSSP  LEEEEEELLLLLLEEHHHLEELHHHHHHLLLEEEEEELLLLLLLLLLLLHHHHHHHHHHH


DSSP  HHHHHHLLHHHLEEELLEELLLLLLLHHHHHHHHHLLLLEEEEELLLLLLLHHHHHHHHH
Query SKSYYNARPAGVKVHGGAVILEKGLTEEDFIEMKKEGVWIVGEVGLGTIKNPEDAAPMVE  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SKSYYNARPAGVKVHGGAVILEKGLTEEDFIEMKKEGVWIVGEVGLGTIKNPEDAAPMVE  180
DSSP  HHHHHHLLHHHLEEELLEELLLLLLLHHHHHHHHHLLLLEEEEELLLLLLLHHHHHHHHH


DSSP  HHHHLLLEEEEELLLLLLLLLLLLLHHHHHHHLLLEEELLLLLLLLLLHHHHHHHHHHLL
Query WAHKHGFKVQMHTGGTSIPGSSTVTADDVIKTKPDVVSHINGGPTAISVQEVDRIMDETD  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct WAHKHGFKVQMHTGGTSIPGSSTVTADDVIKTKPDVVSHINGGPTAISVQEVDRIMDETD  240
DSSP  HHHHLLLEEEEELLLLLLLLLLLLLHHHHHHHLLLEEELLLLLLLLLLHHHHHHHHHHLL


DSSP  LEEEEELLLLHHHHHHHHHHHHHHLLHHHEEEELLLLLLLLLLLLHHHHHHHHHHHHLLL
Query FAMEIVQCGNPKIADYVARRAAEKGQLGRVIFGNDAPSGTGLIPLGILRNMCQIASMSDI  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FAMEIVQCGNPKIADYVARRAAEKGQLGRVIFGNDAPSGTGLIPLGILRNMCQIASMSDI  300
DSSP  LEEEEELLLLHHHHHHHHHHHHHHLLHHHEEEELLLLLLLLLLLLHHHHHHHHHHHHLLL


DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLLLLLLLHHHHHHHLLLLEEEE
Query DPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMDTPLGSVAEDAMGAIAAGDIPGISV  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMDTPLGSVAEDAMGAIAAGDIPGISV  360
DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLLLLLLLHHHHHHHLLLLEEEE


DSSP  EEELLEEEELLLLLLLLLLLLLEEL
Query VLIDGEAVVTKSRNTPPAKRAAKIL  385
ident |||||||||||||||||||||||||
Sbjct VLIDGEAVVTKSRNTPPAKRAAKIL  385
DSSP  EEELLEEEELLLLLLLLLLLLLEEL


No 2: Query=2vunA Sbjct=2pajA Z-score=32.6

back to top
DSSP  LEEEEELLLEEELLLLL----LLEELLLEEEEELLEEEEEELhhHHLLlLLLEEEELLLL
Query SKTIIKNIGKIVSGDIK----SPVLQADTIVVEDGLIAAIGGeeLMKDaGDATIIDAAGS   56
ident   | | |   |  |               |      | |||   |       || ||   
Sbjct PSTLIRNAAAIMTGGRGtaddPSRVPGPDIRIVGDTIDAIGA--LAPR-PGETIVDATDC   57
DSSP  LEEEEELLLEELLLLLLllllLLLLLLLLEEEELLEEEEELL--LLLL-LLLEEEELLLL


DSSP  EEEELEEEEEELLLllleEHHHL---------------eeLHHHHHHLLLEEEEEELLLL
Query TVTPGLLDTHVHVSggdyAPRQK---------------tmDFISSALHGGVTTMISAGSP  101
ident    |    || |                                     |  |       
Sbjct VIYPAWVNTHHHLF---qSLLKGepfralfderrfrlaarIGLIELARSGCATVADHNYV  114
DSSP  EEEELEELLLLLHH---hHHLLLlllhhhllhhhhhhhhhHHHHHHHLLLEEEEEELLLL


DSSP  llllLLLLhhhhhhhhhHHHHHHHHLLH-HHLEEELlEELLL----------------LL
Query hfpgRPKDaagtkalaiTLSKSYYNARP-AGVKVHGgAVILE----------------KG  144
ident                    |          |                             
Sbjct ----YYPG------mpfDSSAILFEEAEkLGLRFVL-LRGGAtqtrqleadlptalrpET  163
DSSP  ----LLLL------lllLHHHHHHHHHHhLLLEEEE-EELLLlllllllllllhhhllLL


DSSP  LL--HHHHHHHHHLLL---------LEEEEELLlLLLLHHHHHHHHHHHHHLLLEEEEEL
Query LT--EEDFIEMKKEGV---------WIVGEVGLgTIKNPEDAAPMVEWAHKHGFKVQMHT  193
ident |     |                               |         |   |     | 
Sbjct LDayVADIERLAARYHdaspramrrVVMAPTTVlYSISPREMRETAAVARRLGLRMHSHL  223
DSSP  HHhhHHHHHHHHHHLLllllllleeEEELLLLLlLLLLHHHHHHHHHHHHHLLLEEEEEL


DSSP  LllllllLLLLLHHHHHHHL---LLEEELLLllllLLLHHHHHHHHHhLLLEEEEE-LLL
Query GgtsipgSSTVTADDVIKTK---PDVVSHINggptAISVQEVDRIMDeTDFAMEIV-QCG  249
ident             |               |           |       |        |  
Sbjct S------GKSPVAFCGEHDWlgsDVWYAHLV----KVDADEIALLAQ-TGTGVAHCpQSN  272
DSSP  L------LLLHHHHHHHLLLlllLEEEELLL----LLLHHHHHHHHH-HLLEEEELhHHH


DSSP  LhhhhhhHHHHHHHHLLhhHEEEELLLLLlLLLLLlHHHHHHHHHHHHLL---LLHHHHH
Query NpkiadyVARRAAEKGQlgRVIFGNDAPSgTGLIPlGILRNMCQIASMSD---IDPEVAV  306
ident          |  |  |    |  | |                                  
Sbjct G----rlPVREMADAGV--PVSIGVDGAA-SNEAA-DMISEVHMTWLAQRarlASIAEVI  324
DSSP  H----llLLLLHHHHLL--LEEELLLHHH-HLLLL-LHHHHHHHHHHHHHhllLLHHHHH


DSSP  HHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELLLL-LLLL--LHHHHHHHLLLLEEEEEE
Query CMATGNSTAVYGL-NTGVIAPGKEADLIIMDTPLG-SVAE--DAMGAIAAGDIPGISVVL  362
ident    |     | ||   |  | |  ||                 | |  | |  |      
Sbjct HWGTAGGARVMGLdEVGKVAVGYAADIAVYRLDDPrYFGLhdPAIGPVASGGRPSVMALF  384
DSSP  HHHLHHHHHHHLLlLLLLLLLLLLLLEEEEELLLHhHLLLllHHHHHHHLLLLLEEEEEE


DSSP  ELLEEEELLLL--------------llllllllleel
Query IDGEAVVTKSR--------------ntppakraakil  385
ident   |  ||                              
Sbjct SAGKRVVVDDLiegvdikelggearrvvrellrevvv  421
DSSP  ELLEEEEELLLlllllhhhhhhhhhhhhhhhhhhhhl


No 3: Query=2vunA Sbjct=1onxA Z-score=31.4

back to top
DSSP  -------LEEEEELLlEEELLllllLEELLLEEEEELLEEEEEELHhHHLL-LLLLEEEE
Query -------SKTIIKNIgKIVSGdiksPVLQADTIVVEDGLIAAIGGEeLMKD-AGDATIID   52
ident          |                        |  | | |        |     |  |
Sbjct midytaaGFTLLQGA-HLYAP----EDRGICDVLVANGKIIAVASN-IPSDiVPNCTVVD   54
DSSP  llllhhhLLEEEEEE-EEELL----LEEEEEEEEEELLEEEEEELL-LLLLlLLLLEEEE


DSSP  LLLLEEEELEEEEEELLllllEEHH-------HLEELHHHHHHLLLEEEEEElLLLL-LL
Query AAGSTVTPGLLDTHVHVsggdYAPR-------QKTMDFISSALHGGVTTMISaGSPH-FP  104
ident   |    ||  | |||                       |     |||            
Sbjct LSGQILCPGFIDQHVHL----IGGGgeagpttRTPEVALSRLTEAGVTSVVG-LLGTdSI  109
DSSP  LLLLEEEELEEEEEELL----LLLLllllhhhLLLLLLHHHHHHLLEEEEEE-LLLLlLL


DSSP  LLlllhhhhhhHHHHHHHHHHHLLHHHLEEElLEEL-lLLLL--lhHHHHHH-HHLL-LL
Query GRpkdaagtkaLAITLSKSYYNARPAGVKVHgGAVI-lEKGL--teEDFIEM-KKEG-VW  159
ident  |             |          |                               | 
Sbjct SR---------HPESLLAKTRALNEEGISAW-MLTGayHVPSrtitGSVEKDvAIIDrVI  159
DSSP  LL---------LHHHHHHHHHHHHHHLLEEE-EEEEllLLLLllllLLHHHHhHHLLlEE


DSSP  EEEEEL---lLLLLLHHHHHHHHHHHHHLL------LEEEEELLLLlllllLLLLhHHHH
Query IVGEVG---lGTIKNPEDAAPMVEWAHKHG------FKVQMHTGGTsipgsSTVTaDDVI  210
ident  |                 | |       |           | |                
Sbjct GVXCAIsdhrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDS-----KKAL-QPIY  213
DSSP  EEEEEEllllLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLL-----LLLL-HHHH


DSSP  HHL--------LLEEELLLlllLLLL-HHHHHHHHHHlLLEEEEELLLLHHH-HHHHHHH
Query KTK--------PDVVSHINggpTAIS-VQEVDRIMDEtDFAMEIVQCGNPKI-ADYVARR  260
ident                 | |                        |               |
Sbjct DLLencdvpisKLLPTHVN---RNVPlFEQALEFARK-GGTIDITSSIDEPVaPAEGIAR  269
DSSP  HHHhlllllhhHEEEELHH---HLHHhHHHHHHHHHL-LLLEEEELLLLLLLlHHHHHHH


DSSP  HHHHL-LHHHEEEELLLLLLL-------------LLLLLHHHHHHHHHHHHLLLLHHHHH
Query AAEKG-QLGRVIFGNDAPSGT-------------GLIPLGILRNMCQIASMSDIDPEVAV  306
ident |   |  | ||    |                         |          |     | 
Sbjct AVQAGiPLARVTLSSDGNGSQpffddegnlthigVAGFETLLETVQVLVKDYDFSISDAL  329
DSSP  HHHLLlLHHHEEEELLLLLEEeeellllleeeeeELLLHHHHHHHHHHHHHHLLLHHHHH


DSSP  HHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELLlllllllhhhhhhhlllLEEEEEEELL
Query CMATGNSTAVYGL-NTGVIAPGKEADLIIMDTPlgsvaedamgaiaagdiPGISVVLIDG  365
ident    |        |   | | ||  |||  |                      |  |   |
Sbjct RPLTSSVAGFLNLtGKGEILPGNDADLLVMTPE-----------------LRIEQVYARG  372
DSSP  HHHLHHHHHHLLLlLLLLLLLLLLLLEEEELLL-----------------LLEEEEEELL


DSSP  EEEELLLLllllllllleel
Query EAVVTKSRntppakraakil  385
ident    |                
Sbjct KLMVKDGK--acvkgtfetd  390
DSSP  EEEEELLE--elllllllll


No 4: Query=2vunA Sbjct=3nqbA Z-score=30.5

back to top
DSSP  -----------------------LEEEEELLlEEELLLllLLEELLLEEEEELLEEEEEE
Query -----------------------SKTIIKNIgKIVSGDikSPVLQADTIVVEDGLIAAIG   37
ident                            |      |        |    |     |||   
Sbjct epadlnddtlraravaaargdqrFDVLITGG-TLVDVV--TGELRPADIGIVGALIASVH   57
DSSP  llhhhllhhhhhhhhhhhhllllEEEEEELL-EEELLL--LLLEEELEEEEELLEEEEEE


DSSP  L-HHHHLllllLEEEELLLLEEEELEEEEEELLL---LLLEehhhleeLHHHHHHLLLEE
Query G-EELMKdagdATIIDAAGSTVTPGLLDTHVHVS---GGDYaprqktmDFISSALHGGVT   93
ident            |  ||| |  | ||| ||| |                         |||
Sbjct EpASRRD---aAQVIDAGGAYVSPGLIDTHXHIEssxITPA-------AYAAAVVARGVT  107
DSSP  LlLLLLL---eEEEEELLLLEEEELEEEEEELHHhhlLLHH-------HHHHHHHLLLEE


DSSP  EEEElLLLLLllLLLLhhhhHHHHHHHHHHhHHLLhhHLEEELlEELLLL----------
Query TMISaGSPHFpgRPKDaagtKALAITLSKSyYNARpaGVKVHGgAVILEK----------  143
ident |        |                  |                               
Sbjct TIVW-DPHEF-gNVHG----VDGVRWAAKA-IENL--PLRAIL-LAPSCVpsapglergg  157
DSSP  EEEE-LLHHH-hHHHL----HHHHHHHHHH-HLLL--LLEEEE-EELLLLllllllllll


DSSP  -LLLHHHHHHHHHLL-LLEEEEELllllLLHHH------HHHHHHHHHHLLLEEEEELLl
Query -GLTEEDFIEMKKEG-VWIVGEVGlgtiKNPED------AAPMVEWAHKHGFKVQMHTGg  195
ident                      |                     |         |  |   
Sbjct aDFDAAILADLLSWPeIGGIAEIX----NXRGVierdprXSGIVQAGLAAEKLVCGHAR-  212
DSSP  lLLLHHHHHHHHLLLlEEEEEEEL----LHHHHhlllhhHHHHHHHHHHHLLEEEELLL-


DSSP  llllllllLLHH-HHHHHL---LLEEELLllllllLLHHHHHHHHHhLLLEEEEELLlLH
Query tsipgsstVTAD-DVIKTK---PDVVSHInggptaISVQEVDRIMDeTDFAMEIVQCgNP  251
ident              |                      |               |       
Sbjct --------GLKNaDLNAFXaagVSSDHEL------VSGEDLXAKLR-AGLTIELRGS-HD  256
DSSP  --------LLLHhHHHHHHhllLLEELLL------LLHHHHHHHHH-LLLEEEEELL-LH


DSSP  HHHHHHHHHHHHH-LLHHHEEEELLLLLlLLLL--lLHHHHHHHHHHHHlLLLHHHHHHH
Query KIADYVARRAAEK-GQLGRVIFGNDAPSgTGLI--pLGILRNMCQIASMsDIDPEVAVCM  308
ident                    |    |            |               || |   
Sbjct HLLPEFVAALNTLgHLPQTVTLCTDDVF-PDDLlqgGGLDDVVRRLVRY-GLKPEWALRA  314
DSSP  HHHHHHHHHHHHHlLLLLLEEEELLLLL-HHHHhhlLLHHHHHHHHHHL-LLLHHHHHHH


DSSP  HLHHHHHHHLL-LLLLLLLLLLLLEEEEellllllllLHHHhhhhllLLEEEEEEELLEE
Query ATGNSTAVYGL-NTGVIAPGKEADLIIMdtplgsvaeDAMGaiaagdIPGISVVLIDGEA  367
ident || |     |    | || |  ||                             ||  | |
Sbjct ATLNAAQRLGRsDLGLIAAGRRADIVVF---------EDLN------GFSARHVLASGRA  359
DSSP  HLHHHHHHHLLlLLLLLLLLLLLLEEEE---------LLLL------LLLEEEEEELLEE


DSSP  EELLLL------------------------------------------------------
Query VVTKSR------------------------------------------------------  373
ident |    |                                                      
Sbjct VAEGGRxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetea  419
DSSP  EEELLEelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  373
ident                                                             
Sbjct dvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfgg  479
DSSP  eeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  373
ident                                                             
Sbjct nagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgk  539
DSSP  lhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------llllllllleel
Query ------------------------------------ntppakraakil  385
ident                                                 
Sbjct vvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 5: Query=2vunA Sbjct=3mtwA Z-score=30.3

back to top
DSSP  -LEEEEElLLEEELLLllLLEELL-LEEEEELLEEEEEELHHHhLLLLLLEEEELLLLEE
Query -SKTIIKnIGKIVSGDikSPVLQA-DTIVVEDGLIAAIGGEELmKDAGDATIIDAAGSTV   58
ident                   |          | || |  ||          ||  |  | | 
Sbjct aEIKAVS-AARLLDVA--SGKYVDnPLVIVTDGRITSIGKKGD-AVPAGATAVDLPGVTL   56
DSSP  lLEEEEE-EEEEEELL--LLEEEElEEEEEELLEEEEEEELLL-LLLLLLEEEEEEEEEE


DSSP  EELEEEEEELLLllleEHHHLE----------------eLHHHHHHLLLEEEEEELLLll
Query TPGLLDTHVHVSggdyAPRQKT----------------mDFISSALHGGVTTMISAGSph  102
ident  ||| | |||                                   |  | ||    |   
Sbjct LPGLIDMHVHLD----SLAEVGgynsleysdrfwsvvqtANAKKTLEAGFTTVRNVGA--  110
DSSP  EELEEEEEELLL----LLLLLLhhhhhhllhhhhhhhhhHHHHHHHHLLEEEEEELLL--


DSSP  lllllllhhhhhhhHHHHHHHHHHLL----HHHLEEELLEELL-----------------
Query fpgrpkdaagtkalAITLSKSYYNAR----PAGVKVHGGAVIL-----------------  141
ident               |         |       |      |                    
Sbjct --------------ADYDDVGLREAIdagyVPGPRIVTAAISFgatgghcdstffppsmd  156
DSSP  --------------LLLHHHHHHHHHhlllLLLLEEEELLLLEellllllllllllhhhl


DSSP  -----LLLL---LHHHHHHHHHLLLLEEEEEL-----------lllLLLHHHHHHHHHHH
Query -----EKGL---TEEDFIEMKKEGVWIVGEVG-----------lgtIKNPEDAAPMVEWA  182
ident                     || |                          |     |  |
Sbjct qknpfNSDSpdeARKAVRTLKKYGAQVIXICAtggvfsrgnepgqqQLTYEEMKAVVDEA  216
DSSP  lllllLLLLhhhHHHHHHHHHHLLLLEEEEELllllllllllllllLLLHHHHHHHHHHH


DSSP  HHLLLEEEEELLLlllllllLLLHhHHHHHLLLEEELLLllllLLLHHHHHHHHHhLLLE
Query HKHGFKVQMHTGGtsipgssTVTAdDVIKTKPDVVSHINggptAISVQEVDRIMDeTDFA  242
ident |  | ||  |  |                   |   |                       
Sbjct HMAGIKVAAHAHG------aSGIR-EAVRAGVDTIEHAS----LVDDEGIKLAVQ-KGAY  264
DSSP  HHLLLEEEEEELL------hHHHH-HHHHLLLLEEEELL----LLLHHHHHHHHH-HLLE


DSSP  EEEELL---------------------------lLHHHHHHHHHHHhhhllhhHEEEELL
Query MEIVQC---------------------------gNPKIADYVARRAaekgqlgRVIFGND  275
ident                                                          | |
Sbjct FSMDIYntdytqaegkkngvlednlrkdrdigelQRENFRKALKAG------vKMVYGTD  318
DSSP  EELLLLlhhhhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHL------lEEELLLL


DSSP  LLLllLLLLLHhHHHHHHHHhHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEE
Query APSgtGLIPLGiLRNMCQIAsMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADLI  333
ident |                         |  |   ||       |     |  | |   | |
Sbjct AGI--YPHGDN-AKQFAVMV-RYGATPLQAIQSATLTAAEALGRskDVGQVAVGRYGDMI  374
DSSP  LLL--LLLLLH-HHHHHHHH-HLLLLHHHHHHHLLHHHHHHHLLllLLLLLLLLLLLLEE


DSSP  EEELlllllllLHHHhhhhLLLL--EEEEEEELLEEEELLllllllllllleel
Query IMDTplgsvaeDAMGaiaaGDIP--GISVVLIDGEAVVTKsrntppakraakil  385
ident            |                 |   |  |                 
Sbjct AVAG-------DPLA----DVTTleKPVFVMKGGAVVKAP-------------x  404
DSSP  EELL-------LLLL----LHHHhhLLLEEEELLEEEELL-------------l


No 6: Query=2vunA Sbjct=3mkvA Z-score=29.7

back to top
DSSP  -LEEEEELLlEEELlLLLLLEELLLEEEEELLEEEEEELHHHHllLLLLEEEELLLLEEE
Query -SKTIIKNIgKIVSgDIKSPVLQADTIVVEDGLIAAIGGEELMkdAGDATIIDAAGSTVT   59
ident        |             ||   |  ||| |              |  ||  | |  
Sbjct lTTFLFRNG-ALLD-PDHPDLLQGFEILIEDGFIREVSDKPIK--SSNAHVIDVKGKTIM   56
DSSP  lLEEEEEEE-EELL-LLLLLLEEEEEEEEELLEEEEEELLLLL--LLLLEEEELLLLEEE


DSSP  ELEEEEEELLLllleEHHH---------------LEELHHHHHHLLLEEEEEELLLllll
Query PGLLDTHVHVSggdyAPRQ---------------KTMDFISSALHGGVTTMISAGSphfp  104
ident ||| | ||||     |                           |  | ||   ||     
Sbjct PGLIDLHVHVV----AIEFnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG----  108
DSSP  ELEEEEEELLL----LLLLlhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELLL----


DSSP  lllllhhhhhhhhhhHHHHHHHLL----HHHLEEEL-LEELLL-----------------
Query grpkdaagtkalaitLSKSYYNAR----PAGVKVHG-GAVILE-----------------  142
ident                       |       |      |                      
Sbjct ---------------AGYPFKQAVesglVEGPRLFVsGRALSQtgghadprarsdymppd  153
DSSP  ---------------LLHHHHHHHhlllLLLLEEEElLLEEELlllllllllllllllll


DSSP  ----------------LLLL--HHHHHHHHHLLLLEEEEEL-----------lllLLLHH
Query ----------------KGLT--EEDFIEMKKEGVWIVGEVG-----------lgtIKNPE  173
ident                  |         |    |                           
Sbjct spcgccvrvgalgrvaDGVDevRRAVREELQMGADQIXIMAsggvasptdpvgvfGYSED  213
DSSP  lllllllllllleeelLLHHhhHHHHHHHHHHLLLLEEEELllllllllllllllLLLHH


DSSP  HHHHHHHHHHHLLLEEEEELLLlllllllLLLHhHHHHHLLLEEELLLllllLLLHHHHH
Query DAAPMVEWAHKHGFKVQMHTGGtsipgssTVTAdDVIKTKPDVVSHINggptAISVQEVD  233
ident      |  |   |  |  |             |            | |     |      
Sbjct EIRAIVAEAQGRGTYVLAHAYT------pAAIA-RAVRCGVRTIEHGN----LIDDETAR  262
DSSP  HHHHHHHHHHLLLLLEEEEELL------hHHHH-HHHHLLLLEEEELL----LLLHHHHH


DSSP  HHHHhLLLEEEEE-LLLL----------------------HHHHHHHHHHHHHHLLhhHE
Query RIMDeTDFAMEIV-QCGN----------------------PKIADYVARRAAEKGQlgRV  270
ident                                                       |     
Sbjct LVAE-HGAYVVPTlVTYDalasegekyglppesiakiadvHGAGLHSIEIMKRAGV--KM  319
DSSP  HHHH-HLLEEELLhHHHHhhhhhlllllllhhhhllhhhhHLLHHHHHHHHHHHLL--LL


DSSP  EEELLLLLllLLLLLHhHHHHHHHHHhlLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLL
Query IFGNDAPSgtGLIPLGiLRNMCQIASmsDIDPEVAVCMATGNSTAVYGL--NTGVIAPGK  328
ident  || |         |         |      |      ||  |  | |     | | || 
Sbjct GFGTDLLG--EAQRLQ-SDEFRILAE--VLSPAEVIASATIVSAEVLGMqdKLGRIVPGA  374
DSSP  LLLLLLLH--HHHHHL-LHHHHHHHL--LLLHHHHHHHLLHHHHHHLLLllLLLLLLLLL


DSSP  LLLEEEEELlllllllLHHHHhhhLLLL-----EEEEEEELLEEEELLllllllllllle
Query EADLIIMDTplgsvaeDAMGAiaaGDIP-----GISVVLIDGEAVVTKsrntppakraak  383
ident  ||    |                 |        |  |  ||   |              
Sbjct HADVLVVDG-------NPLKS---VDCLlgqgeHIPLVMKDGRLFVNE------------  412
DSSP  LLLEEEELL-------LLLLL---LLLLlllllLLLEEEELLEEEEEL------------


DSSP  el
Query il  385
ident   
Sbjct le  414
DSSP  ll


No 7: Query=2vunA Sbjct=3giqA Z-score=28.8

back to top
DSSP  --LEEEEELLlEEELLLLlLLEElLLEEEEELLEEEEEELhhHHLLLllLEEEELLLLEE
Query --SKTIIKNIgKIVSGDIkSPVLqADTIVVEDGLIAAIGGeeLMKDAgdATIIDAAGSTV   58
ident       |     |  |    |        | || |||||   |          || |  |
Sbjct ekLDFKITGG-WIIDGTG-APRR-RADLGVRDGRIAAIGE--LGAHP-aRHAWDASGKIV   54
DSSP  llEEEEEELL-EELLLLL-LLLE-ELEEEEELLEEEEEEL--LLLLL-eEEEEELLLLEE


DSSP  EELEEEEEELLLLLLEEhhhleELHHHHHHLLLEEEEEELL------------------l
Query TPGLLDTHVHVSGGDYAprqktMDFISSALHGGVTTMISAG------------------s  100
ident  ||  | | |                      | ||                        
Sbjct APGFIDVHGHDDLMFVE-----KPDLRWKTSQGITTVVVGNcgvsaapaplpgntaaala  109
DSSP  EELEEELLLLLLLHHHH-----LLLLHHHHLLLEEEEEELLlllllllllllllllhhhh


DSSP  LLLLLLLllhhhhhHHHHHHHHHHHHLLHhHLEEElLEELL--LLLL-------------
Query PHFPGRPkdaagtkALAITLSKSYYNARPaGVKVHgGAVIL--EKGL-------------  145
ident               |            ||    |    |                     
Sbjct LLGETPL------fADVPAYFAALDAQRP-MINVA-ALVGHanLRLAamrdpqaaptaae  161
DSSP  HHLLLLL------lLLHHHHHHHHHHLLL-LLEEE-EEEEHhhHHHHhlllllllllhhh


DSSP  ---LHHHHHHHHHLLLLEEEEEL-lLLLL--LHHHHHHHHHHHHHLLLEEEEELLLLlll
Query ---TEEDFIEMKKEGVWIVGEVG-lGTIK--NPEDAAPMVEWAHKHGFKVQMHTGGTsip  199
ident               |                           |         |       
Sbjct qqaMQDMLQAALEAGAVGFSTGLayQPGAvaQAAELEGLARVAAERRRLHTSHIRNE---  218
DSSP  hhhHHHHHHHHHHHLLLEEEEELllLLHHhlLHHHHHHHHHHHHHLLLEEEEELLLL---


DSSP  lLLLL-LHHHHHHHL-----LLEEELLL---lllllLLHHHHHHHHHHL----LLEEEEE
Query gSSTV-TADDVIKTK-----PDVVSHIN---ggptaISVQEVDRIMDET----DFAMEIV  246
ident           |           ||||           |      |          |  | 
Sbjct aDGVEaAVEEVLAIGrgtgcATVVSHHKcmmpqnwgRSRATLANIDRAReqgvEVALDIY  278
DSSP  lLLHHhHHHHHHHHHhhhllEEEELLLLlllhhhllLHHHHHHHHHHHHhlllLEEEEEL


DSSP  LLLL--------------------------------------------------------
Query QCGN--------------------------------------------------------  250
ident                                                             
Sbjct PYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
DSSP  LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee


DSSP  -----HHHHHHHHHhhhhhllHHHEEEELLLL----lLLLLLLLHHHHHHHHHH-HHLLL
Query -----PKIADYVARraaekgqLGRVIFGNDAP----sGTGLIPLGILRNMCQIA-SMSDI  300
ident                            | |                 |            
Sbjct yfamdEDEVKRIFQ-------HPCCMVGSDGLpndarPHPRLWGSFTRVLGRYVrEARLM  391
DSSP  eelllHHHHHHHHH-------LLLEEELLLLLlllllLLLHHHHHHHHHHHHHHhHLLLL


DSSP  LHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEElllllllllhHHHH--------h
Query DPEVAVCMATGNSTAVYGL-NTGVIAPGKEADLIIMDtplgsvaedaMGAI--------a  351
ident   | ||   |     | |    ||  ||  ||    |                       
Sbjct TLEQAVARMTALPARVFGFaERGVLQPGAWADVVVFD----------PDTVadratwdep  441
DSSP  LHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEEEEL----------LLLLlllllllll


DSSP  hllLLEEEEEEELLEEEELLllllllllllleel
Query agdIPGISVVLIDGEAVVTKsrntppakraakil  385
ident      ||  ||  |  |                 
Sbjct tlaSVGIAGVLVNGAEVFPQppadgrpgqvlrax  475
DSSP  lllLLLEEEEEELLEEEELLllllllllllllll


No 8: Query=2vunA Sbjct=1yrrB Z-score=28.7

back to top
DSSP  leEEEELLlEEELLllllLEELL-LEEEEELLEEEEEELHHHHllLLLLEEEELLLLEEE
Query skTIIKNIgKIVSGdiksPVLQA-DTIVVEDGLIAAIGGEELMkdAGDATIIDAAGSTVT   59
ident           |  |             |  ||||                     |    
Sbjct --YALTQG-RIFTG----HEFLDdHAVVIADGLIKSVCPVAEL--PPEIEQRSLNGAILS   51
DSSP  --LEEELL-EEELL----LLEELlEEEEEELLEEEEEEEHHHL--LLLLLEEELLLLEEE


DSSP  ELEEEEEELL------------LLLLEehhhleeLHHHHHHLLLEEEEEElLLLLlllll
Query PGLLDTHVHV------------SGGDYaprqktmDFISSALHGGVTTMISaGSPHfpgrp  107
ident ||  |                                      | |              
Sbjct PGFIDVQLNGcggvqfndtaeaVSVET-----leIMQKANEKSGCTNYLP-TLIT-----  100
DSSP  ELEEEEEELEelleelllllllLLHHH-----hhHHHHHHHLLLEEEEEE-EELL-----


DSSP  LLHHHHhHHHHHHHHHHHHLLhhHLEEELLEELLL--lLLLHHHHHHHHhlLLLEEEEEL
Query KDAAGTkALAITLSKSYYNARpaGVKVHGGAVILE--kGLTEEDFIEMKkeGVWIVGEVG  165
ident                 |           |                 |     |       
Sbjct TSDELM-KQGVRVMREYLAKH--PNQALGLHLEGPwlnAALVDFLCENA--DVITKVTLA  155
DSSP  LLHHHH-HHHHHHHHHHHHHL--LLLLLLEEEELLlllLHHHHHHHHLH--HHEEEEEEL


DSSP  llllLLHHhhHHHHHHHHHLLLEEEEELLllllllllLLLHHHHHHHL---LLEEELLLL
Query lgtiKNPEdaAPMVEWAHKHGFKVQMHTGgtsipgssTVTADDVIKTK---PDVVSHING  222
ident           |         |  |               |                |   
Sbjct ---pEMVP--AEVISKLANAGIVVSAGHS--------NATLKEAKAGFragITFATHLYN  202
DSSP  ---hHHLL--HHHHHHHHHHLLEEEELLL--------LLLHHHHHHHHhhlEEEELLLLL


DSSP  lllLLLHH------HHHHHHHHLLLEEEEELL--LLHH-HHHHHHHHhhhhlLHHHEEEE
Query gptAISVQ------EVDRIMDETDFAMEIVQC--GNPK-IADYVARRaaekgQLGRVIFG  273
ident    |              | || |    |                |              
Sbjct ---AMPYItgrepgLAGAILDEADIYCGIIADglHVDYaNIRNAKRL-----KGDKLCLV  254
DSSP  ---LLLLLlllllhHHHHHHHLLLLEEEEELLllLLLHhHHHHHHHH-----HHHHEEEE


DSSP  LLLLlLLLLLllHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLL
Query NDAPsGTGLIplGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEAD  331
ident  ||                       |       |||       |     |  | || | 
Sbjct TDAT-SGSSL--TMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVekRLGTLAAGKVAN  311
DSSP  LLLL-LLLLL--LHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLL


DSSP  EEEEELLlllllllhhhhhhhlllLEEEEEEELLEEEELLllllllllllleel
Query LIIMDTPlgsvaedamgaiaagdiPGISVVLIDGEAVVTKsrntppakraakil  385
ident |                         |      |  |||               
Sbjct LTAFTPD-----------------FKITKTIVNGNEVVTQ--------------  334
DSSP  EEEELLL-----------------LLEEEEEELLEEEEEL--------------


No 9: Query=2vunA Sbjct=2oofA Z-score=28.4

back to top
DSSP  --LEEEEELLlEEELLLLLL--LEELL-LEEEEELLEEEEEELHHHHLlLLLLeEEELLL
Query --SKTIIKNIgKIVSGDIKS--PVLQA-DTIVVEDGLIAAIGGEELMKdAGDAtIIDAAG   55
ident         |               |       |  | | |       |        |  |
Sbjct lnCERVWLNV-TPATLRSDLadYGLLEpHALGVHEGRIHALVPXQDLK-YPAH-WQDXKG   57
DSSP  llLLEEEEEE-EELLLLLLLllLLLLLlEEEEEELLEEEEEEEHHHLL-LLLL-LEELLL


DSSP  LEEEELEEEEEELLL-------------------------------------------LL
Query STVTPGLLDTHVHVS-------------------------------------------GG   72
ident   ||||| | | |                                               
Sbjct KLVTPGLIDCHTHLIfagsraeefelrqkgvpyaeiarkgggiistvratraasedqlFE  117
DSSP  LEEEELEEEEEELLLlllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhHH


DSSP  LEehhhleELHHHHHHLLLEEEEEElLLLLllllLLLHHHHHHHHhHHHHHHHHLLhhHL
Query DYaprqktMDFISSALHGGVTTMISaGSPHfpgrPKDAAGTKALAiTLSKSYYNARpaGV  132
ident              |    ||||     |                          |     
Sbjct LA------LPRVKSLIREGVTTVEI-KSGY----GLTLEDELKXL-RVARRLGEAL--PI  163
DSSP  HH------HHHHHHHHHHLEEEEEE-ELLL----LLLHHHHHHHH-HHHHHHHHHL--LL


DSSP  EEElLEELLL--------------LLLL-HHHHHHHHHLL-LLEEeEELL-lllLLHHHH
Query KVHgGAVILE--------------KGLT-EEDFIEMKKEG-VWIVgEVGL-gtiKNPEDA  175
ident  |                            |        |    |  |            
Sbjct RVK-TTLLAAhavppeyrddpdswVETIcQEIIPAAAEAGlADAV-DVFCehigFSLAQT  221
DSSP  EEE-EEEEEEllllhhhlllhhhhHHHHhHLHHHHHHHLLlLLEE-EEEEllllLLHHHH


DSSP  HHHHHHHHHLLLEEEEELLLLllllllLLLHhHHHHHL---LLEEELLlllllLLLHhhh
Query APMVEWAHKHGFKVQMHTGGTsipgssTVTAdDVIKTK---PDVVSHInggptAISVqev  232
ident       |   |  |  |                           | |             
Sbjct EQVYLAADQYGLAVKGHXDQL------SNLG-GSTLAAnfgALSVDHL-----EYLD---  266
DSSP  HHHHHHHHHLLLEEEEEELLL------LLLL-HHHHHHhllLLEEEEL-----LLLL---


DSSP  HHHHHHL---LLEEEEELLLL-----HHHHhhHHHHHHHHLLhhHEEEELLLLLL-LLLL
Query DRIMDET---DFAMEIVQCGN-----PKIAdyVARRAAEKGQlgRVIFGNDAPSG-TGLI  283
ident                            |            |         |   |     
Sbjct PEGIQALahrGVVATLLPTAFyflkeTKLP--PVVALRKAGV--PXAVSSDINPGtAPIV  322
DSSP  HHHHHHHhhhLLEEEELHHHHhhlllLLLL--LHHHHHHLLL--LEEELLLLLLLlLLLL


DSSP  llHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELllll
Query plGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADLIIMDTplgs  341
ident                   |  |    |       |     |    |  ||          
Sbjct --SLRXAXNXACTLFGLTPVEAXAGVTRHAARALGEqeQLGQLRVGXLADFLVWNC----  376
DSSP  --LHHHHHHHHHHHHLLLHHHHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELL----


DSSP  lllLHHHHHhhLLLL--EEEEEEELLEEEELlllllllllllleel
Query vaeDAMGAIaaGDIP--GISVVLIDGEAVVTksrntppakraakil  385
ident              |           ||                   
Sbjct ---GHPAEL-sYLIGvdQLVSRVVNGEETLH---------------  403
DSSP  ---LLLLHH-hHLLLllLEEEEEELLEELLL---------------


No 10: Query=2vunA Sbjct=3ls9A Z-score=28.4

back to top
DSSP  lEEEEELLLEEELLLlLLLEELL-LEEEEELLEEEEEELhHHHLlLLLLEEEELLLLEEE
Query sKTIIKNIGKIVSGDiKSPVLQA-DTIVVEDGLIAAIGGeELMKdAGDATIIDAAGSTVT   59
ident     |         |           |      | | |   |         ||  |    
Sbjct -MILIRGLTRVITFD-DQERELEdADILIDGPKIVAVGK-DLSD-RSVSRTIDGRGMIAL   56
DSSP  -LEEEEEEEEEELLL-LLLLEEEeEEEEEELLEEEEEEL-LLLL-LLLLEEEELLLEEEE


DSSP  ELEEEEEELLLllleEHHHL-------------------------------------eeL
Query PGLLDTHVHVSggdyAPRQK-------------------------------------tmD   82
ident |||   | |                                                   
Sbjct PGLINSHQHLY---eGAMRAipqlervtmaswlegvltrsagwwrdgkfgpdvirevarA  113
DSSP  ELEEEEEELHH---hHHHLLlhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhH


DSSP  HHHHHHLLLEEEEEELLLLllllLLLLHHHhhhhhhHHHHHHHHLLH-HHLEEELlEELL
Query FISSALHGGVTTMISAGSPhfpgRPKDAAGtkalaiTLSKSYYNARP-AGVKVHGgAVIL  141
ident      | || ||            |   |               |    |   |  |   
Sbjct VLLESLLGGITTVADQHLF----FPGATAD------SYIDATIEAATdLGIRFHA-ARSS  162
DSSP  HHHHHHHLLEEEEEEEELL----LLLLLLL------LHHHHHHHHHHhHLLEEEE-EELL


DSSP  L---------------LLLL--HHHHHHHHHLLL---------LEEEEELlllLLLHHHH
Query E---------------KGLT--EEDFIEMKKEGV---------WIVGEVGlgtIKNPEDA  175
ident                                               |  |      ||  
Sbjct MtlgkseggfcddlfvEPVDrvVQHCLGLIDQYHepepfgmvrIALGPCG-vpYDKPELF  221
DSSP  LlllhhhlllllhhhlLLHHhhHHHHHHHHHHHLllllllleeEEELLLL-llLLLHHHH


DSSP  HHHHHHHHHLLLEEEEELLLLL-lLLLL----lLLHHHHH-HHLL---LEEELLLllllL
Query APMVEWAHKHGFKVQMHTGGTS-iPGSS----tVTADDVI-KTKP---DVVSHINggptA  226
ident       |         |         |                         |       
Sbjct EAFAQMAADYDVRLHTHFYEPLdaGMSDhlygmTPWRFLEkHGWAsdrVWLAHAV----V  277
DSSP  HHHHHHHHHHLLEEEEEELLLLhhHHHHhhhllLHHHHHHhLLLLlllEEEEELL----L


DSSP  LLHHHHHHHHhHLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLLlLLL
Query ISVQEVDRIMdETDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPSgTGL  282
ident     |          |               |    |     |    | ||         
Sbjct PPREEIPEFA-DAGVAIAHLiAPDLrmgWGLA--PIREYLDAGI--TVGFGTTGSA-SND  331
DSSP  LLHHHHHHHH-HHLLEEEELhHHHHhllLLLL--LHHHHHHLLL--EEEELLLLLL-LLL


DSSP  LLLhHHHHHHHHHHHL----------LLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLL
Query IPLgILRNMCQIASMS----------DIDPEVAVCMATGNSTAVYGL-NTGVIAPGKEAD  331
ident      |      |                      |||  |    |    ||   |  ||
Sbjct GGN-LLGDLRLAALAHrpadpnepekWLSARELLRMATRGSAECLGRpDLGVLEEGRAAD  390
DSSP  LLL-HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLL


DSSP  EEEEELLLL--LLLL-LHHHHHHHLLLLEEEEEEELLEEEELLLL------lllllllll
Query LIIMDTPLG--SVAE-DAMGAIAAGDIPGISVVLIDGEAVVTKSR------ntppakraa  382
ident                  | | |  |     | |   |   |   |               
Sbjct IACWRLDGVdrVGVHdPAIGLIMTGLSDRASLVVVNGQVLVENERpvladlerivantta  450
DSSP  EEEEELLLHhhLLLLlHHHHHHHLLLLLLLLEEEELLEEEEELLEellllhhhhhhhhhh


DSSP  eel
Query kil  385
ident    
Sbjct lip  453
DSSP  hll


No 11: Query=2vunA Sbjct=4cqbA Z-score=27.9

back to top
DSSP  ---LEEEEELLlEEELllllllEELLLEEEEELLEEEEEELhhHHLLlLLLEEEELLLLE
Query ---SKTIIKNIgKIVSgdikspVLQADTIVVEDGLIAAIGGeeLMKDaGDATIIDAAGST   57
ident       || |                  |      |  |              ||| |  
Sbjct skdFDLIIRNA-YLSE------KDSVYDIGIVGDRIIKIEA--KIEG-TVKDEIDAKGNL   50
DSSP  lllEEEEEEEE-EELL------LLEEEEEEEELLEEEEEEL--LLLL-LEEEEEELLLLL


DSSP  EEELEEEEEELLLLlleEHHHL------------------------------------ee
Query VTPGLLDTHVHVSGgdyAPRQK------------------------------------tm   81
ident | ||  | | |                                                 
Sbjct VSPGFVDAHTHMDK---SFTSTgerlpkfwsrpytrdaaiedglkyyknatheeikrhvi  107
DSSP  EEELEEEEEELHHH---LLLLLlllllllllllllhhhhhhhhhhhhhhllhhhhhhhhh


DSSP  LHHHHHHLLLEEEEEELLLlllllllllHHHHHHHHHHHHHHHHHLLHHHLEEElLEELL
Query DFISSALHGGVTTMISAGSphfpgrpkdAAGTKALAITLSKSYYNARPAGVKVHgGAVIL  141
ident          |                      |  |                        
Sbjct EHAHMQVLHGTLYTRTHVD--------vDSVAKTKAVEAVLEAKEELKDLIDIQ-VVAFA  158
DSSP  HHHHHHHHLLEEEEEEEEE--------lLLLLLLHHHHHHHHHHHHLLLLLEEE-EEEEL


DSSP  ------lLLLLhHHHHHHHHLLLLEEeEELL--lLLLLHHHHHHHHHHHHH-LLLEEEEE
Query ------eKGLTeEDFIEMKKEGVWIVgEVGL--gTIKNPEDAAPMVEWAHK-HGFKVQMH  192
ident                      |   |           | |          |        |
Sbjct qsgffvdLESE-SLIRKSLDMGCDLV-GGVDpatRENNVEGSLDLCFKLAKeYDVDIDYH  216
DSSP  lllllllLLHH-HHHHHHHHHLLLEE-ELLLlllLLLLHHHHHHHHHHHHHhLLLEEEEE


DSSP  LLLlllllllLLLHHHHHHHL----------lLEEELLLllllLLLHH---HHHHHHHHL
Query TGGtsipgssTVTADDVIKTK----------pDVVSHINggptAISVQ---EVDRIMDET  239
ident           ||                       ||                |      
Sbjct IHD-----igTVGVYSINRLAqktiengykgrVTTSHAW----CFADApseWLDEAIPLY  267
DSSP  ELL-----lhHHHHHHHHHHHhhhhhllllllEEEEELL----HHHHLlhhHHHHHHHHH


DSSP  ---LLEEEEELLLLHHHhhHHHHHHHHHLLhhHEEEELLLL---LLLLLLLLhHHHHHHH
Query ---DFAMEIVQCGNPKIadYVARRAAEKGQlgRVIFGNDAP---SGTGLIPLgILRNMCQ  293
ident               |           | |         |                     
Sbjct kdsGMKFVTCFSSTPPT--MPVIKLLEAGI--NLGCASDNIrdfWVPFGNGD-MVQGALI  322
DSSP  hhhLLEEEEELLLLLLL--LLHHHHHHLLL--EEEEELLLLlllLLLLLLLL-HHHHHHH


DSSP  HHHHLLL----LHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELlllllllLHHH
Query IASMSDI----DPEVAVCMATGNSTAVYGL-NTGVIAPGKEADLIIMDTplgsvaeDAMG  348
ident            |      | |     | |      |  || |||                
Sbjct ETQRLELktnrDLGLIWKMITSEGARVLGIeKNYGIEVGKKADLVVLNS-------LSPQ  375
DSSP  HHHHHLLllhhHHHHHHHHHLHHHHHHHLLhHHLLLLLLLLLLEEEELL-------LLHH


DSSP  HHHhLLLLEEEEEEELLEEEELLLLllllllllleel
Query AIAaGDIPGISVVLIDGEAVVTKSRntppakraakil  385
ident      |      |   |   |                
Sbjct WAI-IDQAKRLCVIKNGRIIVKDEV---------iva  402
DSSP  HHH-HHLLLEEEEEELLEEEEELLE---------ell


No 12: Query=2vunA Sbjct=1gkpA Z-score=27.8

back to top
DSSP  lEEEEELLlEEELLllllLEELLLEEEEELLEEEEEElHHHHllLLLLEEEELLLLEEEE
Query sKTIIKNIgKIVSGdiksPVLQADTIVVEDGLIAAIGgEELMkdAGDATIIDAAGSTVTP   60
ident     |||   |              |  |   |  ||   |         ||| |  | |
Sbjct -PLLIKNG-EIITA----DSRYKADIYAEGETITRIG-QNLE-aPPGTEVIDATGKYVFP   52
DSSP  -LEEEELL-EEEEL----LEEEELEEEELLLLLLEEE-LLLL-lLLLLEEEELLLLEEEE


DSSP  LEEEEEELLLllleehHHLEE--LHHHHHHLLLEEEEEELLLlllllLLLLhHHHHHHHH
Query GLLDTHVHVSggdyapRQKTM--DFISSALHGGVTTMISAGSphfpgRPKDaAGTKALAI  118
ident |  | |||          |         || || || |                      
Sbjct GFIDPHVHIYlpfmatFAKDTheTGSKAALMGGTTTYIEMCC-----PSRN-DDALEGYQ  106
DSSP  LEEEEEELLLleelleELLLLhhHHHHHHHHLLEEEEEEEEL-----LLLL-LLHHHHHH


DSSP  HHHHHHhHLLHHhLEEELlEELLLLLL--LHHHHHHHHHLLLLEEeEELL-----LLLLL
Query TLSKSYyNARPAgVKVHGgAVILEKGL--TEEDFIEMKKEGVWIVgEVGL-----GTIKN  171
ident                         |    ||    |    |        |          
Sbjct LWKSKA-EGNSY-CDYTF-HMAVSKFDekTEGQLREIVADGISSF-XIFLsyknfFGVDD  162
DSSP  HHHHHH-LLLLL-LEEEE-EEELLLLLllHHHHHHHHHHLLLLEE-EEEElllllLLLLH


DSSP  hHHHHHHHHHHHHLLLEEEEELlLLLLLLL-----------------------lLLLH--
Query pEDAAPMVEWAHKHGFKVQMHTgGTSIPGS-----------------------sTVTA--  206
ident           |   |  |  |                                       
Sbjct -GEMYQTLRLAKELGVIVTAHC-ENAELVGrlqqkllsegktgpewhepsrpeaVEAEgt  220
DSSP  -HHHHHHHHHHHHHLLEEEEEE-LLHHHHHhhhhhhhhlllllhhhllllllhhHHHHhh


DSSP  HHHHHHL-----LLEEELLLllllllLHHHHHHHHHHL----LLEEEEELLLLH------
Query DDVIKTK-----PDVVSHINggptaiSVQEVDRIMDET----DFAMEIVQCGNP------  251
ident                | |             |  |           | |           
Sbjct ARFATFLettgaTGYVVHLS------CKPALDAAMAAKargvPIYIESVIPHFLldktya  274
DSSP  HHHHHHHhhhllEEEELLLL------LHHHHHHHHHHHhlllLEEEEEEHHHHHllhhhh


DSSP  -------------------HHHHHHHHHHHhhlLHHHEEEELLLLL--------------
Query -------------------KIADYVARRAAekgQLGRVIFGNDAPS--------------  278
ident                              |   |      | |                 
Sbjct erggveamkyimspplrdkRNQKVLWDALA---QGFIDTVGTDHCPfdteqkllgkeaft  331
DSSP  hllhhhhhlllllllllllHHHHHHHHHHH---LLLLLEEELLLLLllhhhhhhhlllhh


DSSP  ---LLLLL-LLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLE
Query ---GTGLI-PLGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADL  332
ident                      |    |    |  |        ||    | || |  |||
Sbjct aipNGIPAiEDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLfpRKGTIAVGSDADL  391
DSSP  hllLLLLLlLLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLLE


DSSP  EEEE-LLLL-------lllllhhhhhhhLLLLEEEEEEELLEEEELLLL------lllll
Query IIMD-TPLG-------svaedamgaiaaGDIPGISVVLIDGEAVVTKSR------ntppa  378
ident    |    |                         |||   |   |               
Sbjct VVYDpQYRGtisvktqhvnndyngfegfEIDGRPSVVTVRGKVAVRDGQfvgekgwgkll  451
DSSP  EEEElLLLEellhhhlllllllllllllEELLEEEEEEELLEEEEELLEellllllllll


DSSP  lllleel
Query kraakil  385
ident        
Sbjct rrepmyf  458
DSSP  lllllll


No 13: Query=2vunA Sbjct=4c5yA Z-score=27.7

back to top
DSSP  ---LEEEEElLLEEELLLllLLEELLLEEEEELLEEEEEE-LHHHHLL-LLLL-EEEELl
Query ---SKTIIKnIGKIVSGDikSPVLQADTIVVEDGLIAAIG-GEELMKD-AGDA-TIIDAa   54
ident      |||   |    ||     |     |  |  ||  |      |             
Sbjct deaKVTIIY-AGLLIPGD--GEPLRNAALVISDKIIAFVGsEADIPKKyLRSTqSTHRV-   56
DSSP  lllLEEEEE-EEEELLLL--LLLEEEEEEEEELLEEEEEEeHHHLLHHhHHHLlLEEEE-


DSSP  lLEEEELEEEEEELLLL-------------------LLEEhhhleELHHHHHHLLLEEEE
Query gSTVTPGLLDTHVHVSG-------------------GDYAprqktMDFISSALHGGVTTM   95
ident      ||| | | |  |                   |              ||  | |  
Sbjct -PVLMPGLWDCHMHFGGdddyyndytsglathpassGARL-----ARGCWEALQNGYTSY  110
DSSP  -EEEEELEEEEEELLLLllllllllhhhhhllhhhhHHHH-----HHHHHHHHHLLEEEE


DSSP  EELLLlllllllllhhhhhhhhhhHHHHHHHLL----HHHLEEELLEELLLL--------
Query ISAGSphfpgrpkdaagtkalaitLSKSYYNAR----PAGVKVHGGAVILEK--------  143
ident                                |       |  |      |          
Sbjct RDLAG-------------------YGCEVAKAIndgtIVGPNVYSSGAALSQtaghgdif  151
DSSP  EELLL-------------------LHHHHHHHHhlllLLLLEEEELLLEEELllllllll


DSSP  --------------------------------LLLHHHHHHHHHLLLLEEEEEL------
Query --------------------------------GLTEEDFIEMKKEGVWIVGEVG------  165
ident                                              |              
Sbjct alpagevlgsygvmnprpgywgagplciadgvEEVRRAVRLQIRRGAKVIXVMAsggvms  211
DSSP  lllhhhhhhhhlllllllllllllleeelllhHHHHHHHHHHHHHLLLLEEEELllllll


DSSP  -----lllLLLHHHHHHHHHHHHHLLLEEEEELLLlllllllLLLHhHHHHHLLLEEELL
Query -----lgtIKNPEDAAPMVEWAHKHGFKVQMHTGGtsipgssTVTAdDVIKTKPDVVSHI  220
ident            ||     || |      |  |  |              ||       | 
Sbjct rddnpnfaQFSPEELKVIVEEAARQNRIVSAHVHG------kAGIM-AAIKAGCKSLEHV  264
DSSP  llllllllLLLHHHHHHHHHHHHHLLLLEEEEELL------hHHHH-HHHHHLLLEEEEL


DSSP  LllllLLLHHHHHHHHHhLLLEEEEELLL--------------------------LHHHH
Query NggptAISVQEVDRIMDeTDFAMEIVQCG--------------------------NPKIA  254
ident                                                          |  
Sbjct S----YADEEVWELMKE-KGILYVATRSVieiflasngeglvkeswaklqaladsHLKAY  319
DSSP  L----LLLHHHHHHHHH-HLLEEELLHHHhhhhhhhllllllllhhhlllhhhhhHHHHH


DSSP  HHHHHHHhhhllhhHEEEELLLLlllllLLLHhHHHHHHHHHHLLLLHHHHHHHHLHHHH
Query DYVARRAaekgqlgRVIFGNDAPsgtglIPLGiLRNMCQIASMSDIDPEVAVCMATGNST  314
ident                   | |                          |  |   || |  
Sbjct QGAIKAG------vTIALGTDTA----pGGPT-ALELQFAVERGGMTPLEAIKAATANAP  368
DSSP  HHHHHLL------lLEELLLLLL----lLLLL-HHHHHHHHHLLLLLHHHHHHHHLLLHH


DSSP  HHH---LLLLLLLLLLLLLLEEEEELlllllllLHHHHhhhLLLL----EEEEEEELLEE
Query AVY---GLNTGVIAPGKEADLIIMDTplgsvaeDAMGAiaaGDIP----GISVVLIDGEA  367
ident          ||    | ||| |                               |   |  
Sbjct LSVgpqAPLTGQLREGYEADVIALEE-------NPLED---IKVFqepkAVTHVWKGGKL  418
DSSP  HHHhhhLLLLLLLLLLLLLLEEEELL-------LLLLL---HHHHhlhhHEEEEEELLEE


DSSP  EELLllllllllllleel
Query VVTKsrntppakraakil  385
ident                   
Sbjct FKGPgigpwgedarnpfl  436
DSSP  EELLllllllllllllll


No 14: Query=2vunA Sbjct=3griA Z-score=27.4

back to top
DSSP  lEEEEELlLEEElllllLLEELLLEEEEELLEEEEEELhHHHLlLLLLEEEELLLLEEEE
Query sKTIIKNiGKIVsgdikSPVLQADTIVVEDGLIAAIGGeELMKdAGDATIIDAAGSTVTP   60
ident     ||| ||          ||   |      |  |             |||| |  | |
Sbjct -XKLIKN-GKVL----qNGELQQADILIDGKVIKQIAP-AIEP-SNGVDIIDAKGHFVSP   52
DSSP  -LEEEEL-LEEE----eLLEEEELEEEEELLEEEEEEL-LLLL-LLLLEEEELLLLEEEE


DSSP  LEEEEEELLLLlleeHHHLEE---LHHHHHHLLLEEEEEElLLLLLLlllllhhhHHHHH
Query GLLDTHVHVSGgdyaPRQKTM---DFISSALHGGVTTMISaGSPHFPgrpkdaagTKALA  117
ident |  | |||                     |  || ||         |             
Sbjct GFVDVHVHLRE---pGGEYKEtieTGTKAAARGGFTTVCP-XPNTRP------vpDSVEH  102
DSSP  LEEEEEELLLL---lLLLLLLlhhHHHHHHHHLLEEEEEE-LLLLLL------llLLHHH


DSSP  HHHHHHHHHLLHhHLEEELlEELLL-----LLLLhhHHHHHHHLLLLEEEeELLLLLLLH
Query ITLSKSYYNARPaGVKVHGgAVILE-----KGLTeeDFIEMKKEGVWIVGeVGLGTIKNP  172
ident               | |             | |   ||    |||               
Sbjct FEALQKLIDDNA-QVRVLP-YASITtrqlgKELV--DFPALVKEGAFAFT-DDGVGVQTA  157
DSSP  HHHHHHHHHHHL-LLEELL-LEELLhhhllLLLL--LHHHHHLLLLLLEE-ELLLLLLLH


DSSP  HHHHHHHHHHHHLLLEEEEELllLLLLLL---------------------LLLL--HHHH
Query EDAAPMVEWAHKHGFKVQMHTggTSIPGS---------------------STVT--ADDV  209
ident          | |       |                                        
Sbjct SXXYEGXIEAAKVNKAIVAHC--EDNSLIyggaxhegkrskelgipgipnICESvqIARD  215
DSSP  HHHHHHHHHHHHHLLLEEELL--LLHHHLlllleellhhhhhhllleellHHHHhhHHHH


DSSP  HHHL-----LLEEELLlllllLLLHhHHHHHHHHL----LLEEEEELLLLH---------
Query IKTK-----PDVVSHInggptAISVqEVDRIMDET----DFAMEIVQCGNP---------  251
ident             | |            |  | |          |                
Sbjct VLLAeaagcHYHVCHV-----STKE-SVRVIRDAKragiHVTAEVTPHHLLlteddipgn  269
DSSP  HHHHhhhllLEEELLL-----LLHH-HHHHHHHHHhlllLEEEEELHHHHHllhhhllll


DSSP  ----------------HHHHHHHHHHhhhllhhHEEEELLLLL--------------LLL
Query ----------------KIADYVARRAaekgqlgRVIFGNDAPS--------------GTG  281
ident                                        |                    
Sbjct naiykxnpplrstedrEALLEGLLDG------tIDCIATDHAPhardekaqpxekapFGI  323
DSSP  lhhhllllllllhhhhHHHHHHHHLL------lLLEELLLLLLllhhhhllllllllLLL


DSSP  LLLLHHH-HHHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEE-LLL
Query LIPLGIL-RNMCQIASMSDIDPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMD-TPL  339
ident                   |      |   |        |  |       ||| | |    
Sbjct VGSETAFpLLYTHFVKNGDWTLQQLVDYLTIKPCETFNLEYGTLKENGYADLTIIDlDSE  383
DSSP  LLLLLHHhHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLEEEEElLLL


DSSP  LL-------llllhhhhhhhlLLLEEEEEEELLEEEELLllllllllllleel
Query GS-------vaedamgaiaagDIPGISVVLIDGEAVVTKsrntppakraakil  385
ident                                 ||                   
Sbjct QEikgedflskadntpfigykVYGNPILTXVEGEVKFEG--------------  422
DSSP  EEllhhhllllllllllllleELLEEEEEEELLEEEEEL--------------


No 15: Query=2vunA Sbjct=1j6pA Z-score=27.3

back to top
DSSP  LEEEEELLlEEELLLllLLEELLLEEEEELLEEEEEELHHHHlllllleEEELLLLEEEE
Query SKTIIKNIgKIVSGDikSPVLQADTIVVEDGLIAAIGGEELMkdagdatIIDAAGSTVTP   60
ident    || |   |      |          | | |      |           |  |  | |
Sbjct HHXIIGNC-LILKDF--SSEPFWGAVEIENGTIKRVLQGEVK------vDLDLSGKLVXP   51
DSSP  LEEEEEEE-EELLLL--LLLLEEEEEEEELLEEEEEEELLLL------lLEELLLEEEEE


DSSP  LEEEEEELLLllleEHHHL------------------------------eeLHHHHHHLL
Query GLLDTHVHVSggdyAPRQK------------------------------tmDFISSALHG   90
ident  |  || |                                                    
Sbjct ALFNTHTHAP---xTLLRGvaedlsfeewlfskvlpiedrltekxayygtiLAQXEXARH  108
DSSP  LEEEEEELHH---hHHHLLllllllhhhhhhllhhhhhllllhhhhhhhhhHHHHHHHLL


DSSP  LEEEEEELLLlllllllllhhhhhhHHHHHHHHHHHllhHHLEEELlEELLL-----LLL
Query GVTTMISAGSphfpgrpkdaagtkaLAITLSKSYYNarpAGVKVHGgAVILE-----KGL  145
ident |                              |        |         |       | 
Sbjct GIAGFVDXYF---------------HEEWIAKAVRD---FGXRALL-TRGLVdsngdDGG  149
DSSP  LEEEEEEEEL---------------LHHHHHHHHHH---HLLEEEE-EEEELlllllLLL


DSSP  LHHHHHHHHHLLL-------LEEEEELlllLLLHHHHHHHHHHHHHLLLEEEEEL-LLLL
Query TEEDFIEMKKEGV-------WIVGEVGlgtIKNPEDAAPMVEWAHKHGFKVQMHT-GGTS  197
ident   |       |            |          |        |      |  |      
Sbjct RLEENLKLYNEWNgfegrifVGFGPHS-pyLCSEEYLKRVFDTAKSLNAPVTIHLyETSK  208
DSSP  HHHHHHHHHHHHLlhhhleeEEEEELL-llLLLHHHHHHHHHHHHHHLLLEEEEElLLLL


DSSP  llllLLLLHHHHHHHLL----LEEELLlllllLLLHhhhHHHHHHLL---LEEEEE-LLL
Query ipgsSTVTADDVIKTKP----DVVSHInggptAISVqevDRIMDETD---FAMEIV-QCG  249
ident           |              |              |         |         
Sbjct ----EEYDLEDILNIGLkevkTIAAHC-----VHLP---ERYFGVLKdipFFVSHNpASN  256
DSSP  ----LLLLLHHHHLLLLllllEEEEEL-----LLLL---HHHHHHHLlllEEEEELhHHH


DSSP  L---HHHHhhHHHHHHHHLLhhHEEEELLLLLlLLLLLLhHHHHHHHHHHHL------LL
Query N---PKIAdyVARRAAEKGQlgRVIFGNDAPSgTGLIPLgILRNMCQIASMS------DI  300
ident       ||     |  | |    |  | |                               
Sbjct LklgNGIA--PVQRXIEHGX--KVTLGTDGAA-SNNSLN-LFFEXRLASLLQkaqnprNL  310
DSSP  HhllLLLL--LHHHHHHLLL--EEEELLLLLL-LLLLLL-HHHHHHHHHHHHhlllllLL


DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLLLLLL--LHHHHHHhLLLL-E
Query DPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMDTPLGSVAE--DAMGAIAaGDIP-G  357
ident |        |       |   | |  |  |||   |  |                     
Sbjct DVNTCLKXVTYDGAQAXGFKSGKIEEGWNADLVVIDLDLPEXFPvqNIKNHLV-HAFSgE  369
DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLHHHLLhhHHHHHHH-HLLLlL


DSSP  EEEEEELLEEEELLLL----------llllllllleel
Query ISVVLIDGEAVVTKSR----------ntppakraakil  385
ident        |                              
Sbjct VFATXVAGKWIYFDGEyptidseevkrelariekelys  407
DSSP  LLEEEELLEEEEELLLlllllhhhhhhhhhhhhhhhhl


No 16: Query=2vunA Sbjct=3e74A Z-score=27.1

back to top
DSSP  -LEEEEELLlEEELlllLLLEELLlEEEEELLEEEEEELhHHHLllllLEEEELLLLEEE
Query -SKTIIKNIgKIVSgdiKSPVLQAdTIVVEDGLIAAIGGeELMKdagdATIIDAAGSTVT   59
ident     ||||                  | |  | |||||   |          || |  | 
Sbjct sFDLIIKNG-TVIL---ENEARVV-DIAVKGGKIAAIGQ-DLGD---aKEVXDASGLVVS   51
DSSP  lEEEEEELL-EEEL---LLLEEEL-EEEEELLEEEEEEL-LLLL---eEEEEELLLLEEE


DSSP  ELEEEEEELlLLLLeehhhleeLHHHHHHLLLEEEEEELLLLlLLLLlllhhHHHH-HHH
Query PGLLDTHVHvSGGDyaprqktmDFISSALHGGVTTMISAGSPhFPGRpkdaaGTKA-LAI  118
ident ||  | | |  |               |  || || |                       
Sbjct PGXVDAHTH-IGYE--------TGTRAAAKGGITTXIEXPLN-QLPA-----TVDRaSIE   96
DSSP  ELEEEEEEL-LLHH--------HHHHHHHHLLEEEEEELLLL-LLLL-----LLLHhHHH


DSSP  HHHHHHhHLLHHhLEEELlEELLLLLLLHhHHHHHHHLLLLEEEeELLLLLlLHHHHHHH
Query TLSKSYyNARPAgVKVHGgAVILEKGLTEeDFIEMKKEGVWIVGeVGLGTIkNPEDAAPM  178
ident                       |          |    ||            |       
Sbjct LKFDAA-KGKLT-IDAAQ-LGGLVSYNID-RLHELDEVGVVGFX-CFVRDV-NDWQFFKG  150
DSSP  HHHHHH-LLLLL-LEEEE-LEELLLLLLL-LHHHHHHHLLLLEE-EELLLL-LHHHHHHH


DSSP  HHHHHHLLLEEEEELlLLLLLLL-----------------------LLLL--HHHHHHHL
Query VEWAHKHGFKVQMHTgGTSIPGS-----------------------STVT--ADDVIKTK  213
ident        |  |  |                                 |       |    
Sbjct AQKLGELGQPVLVHC-ENALICDelgeeakregrvtahdyvasrpvFTEVeaIRRVLYLA  209
DSSP  HHHHHHHLLLEEEEL-LLHHHHHhhhhhhhhhllllhhhhhhlllhHHHHhhHHHHHHHH


DSSP  -----LLEEELLLllllllLHHHHHHHHHHL----LLEEEEELLLL--------------
Query -----PDVVSHINggptaiSVQEVDRIMDET----DFAMEIVQCGN--------------  250
ident         | |        |   |           |   |                    
Sbjct kvagcRLHVCHVS------SPEGVEEVTRARqegqDITCESCPHYFvldtdqfeeigtla  263
DSSP  hhhllLEEELLLL------LHHHHHHHHHHHhlllLEEEEELLHHHhllhhhhhhhlhhh


DSSP  -----------HHHHHHHHHHHhhhllhhHEEEELLLLL--------------LLLLL-L
Query -----------PKIADYVARRAaekgqlgRVIFGNDAPS--------------GTGLI-P  284
ident             |                      |                 |      
Sbjct kcsppirdlenQKGXWEKLFNG------eIDCLVSDHSPcppexkagnixkawGGIAGlQ  317
DSSP  llllllllhhhHHHHHHHHHLL------lLLEELLLLLLllllllllllllllLLLLLhH


DSSP  LHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEEL-LLLL-
Query LGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL-NTGVIAPGKEADLIIMDT-PLGS-  341
ident                            |     ||   | ||||| ||            
Sbjct SCXDVXFDEAVQKRGXSLPXFGKLXATNAADIFGLqQKGRIAPGKDADFVFIQPnSSYVl  377
DSSP  HHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEEELlLLEEl


DSSP  ------llllhhhhhhhlLLLEEEEEEELLEEEELL--llllllllllleel
Query ------vaedamgaiaagDIPGISVVLIDGEAVVTK--srntppakraakil  385
ident                       |      |                      
Sbjct tnddleyrhkvspyvgrtIGARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
DSSP  lhhhllllllllllllleELLEEEEEEELLEEEEELllllllllllleelll


No 17: Query=2vunA Sbjct=2uz9A Z-score=26.7

back to top
DSSP  -LEEEEELLleEELLLLLL-LEELL-LEEEEEL-LEEEEEELHHHHL----LLLL--lEE
Query -SKTIIKNIgkIVSGDIKS-PVLQA-DTIVVED-GLIAAIGGEELMK----DAGD--aTI   50
ident     |       |                 | | | |                      |
Sbjct pLAHIFRGT--FVHSTWTCpMEVLRdHLLGVSDsGKIVFLEEASQQEklakEWCFkpcEI   58
DSSP  lLLEEEEEE--EEELLLLLlLEEEEeEEEEELLlLLEEEEEEHHHHHhhhhHHLLlhhHE


DSSP  EELLL-LEEEELEEEEEELLLllleEHHHLE-----------------------------
Query IDAAG-STVTPGLLDTHVHVSggdyAPRQKT-----------------------------   80
ident           ||| ||| | |                                       
Sbjct RELSHhEFFMPGLVDTHIHAS---qYSFAGSsidlpllewltkytfpaehrfqnidfaee  115
DSSP  EELLLlLEEEELEEEEEEEHH---hHHHLLLlllllhhhhhhhlhhhhhhhhhlhhhhhh


DSSP  --eLHHHHHHLLLEEEEEELLLlllllllllhhhHHHHHHHHHHHHHHllhHHLEEELlE
Query --mDFISSALHGGVTTMISAGSphfpgrpkdaagTKALAITLSKSYYNarpAGVKVHGgA  138
ident          |  | ||                         |          |       
Sbjct vytRVVRRTLKNGTTTACYFAT-----------iHTDSSLLLADITDK---FGQRAFV-G  160
DSSP  hhhHHHHHHHHLLEEEEEEELL-----------lLHHHHHHHHHHHHH---HLLEEEE-E


DSSP  ELLLL-------------LLLHhHHHHHHHLL--------lLEEEEELllLLLLHHHHHH
Query VILEK-------------GLTEeDFIEMKKEG--------vWIVGEVGlgTIKNPEDAAP  177
ident                               |           ||                
Sbjct KVCMDlndtfpeyketteESIK-ETERFVSEMlqknysrvkPIVTPRF-sLSCSETLMGE  218
DSSP  LEELLlllllllllllhhHHHH-HHHHHHHHHhhhlllleeEEEEELL-hHHLLHHHHHH


DSSP  HHHHHHHLLLEEEEELL-LLLL-LLLL------lLLHHHHHHHLL----LEEELLLllll
Query MVEWAHKHGFKVQMHTG-GTSI-PGSS------tVTADDVIKTKP----DVVSHINggpt  225
ident     |       | |                          |        |  |      
Sbjct LGNIAKTRDLHIQSHISeNRDEvEAVKnlypsykNYTSVYDKNNLltnkTVMAHGC----  274
DSSP  HHHHHHHHLLEEEEEELlLHHHhHHHHhhlllllLHHHHHHHLLLllllEEEEELL----


DSSP  LLLHHHHHHHHHhLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLLlll
Query AISVQEVDRIMDeTDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPSgtg  281
ident   |  |                                             | |      
Sbjct YLSAEELNVFHE-RGASIAHCpNSNLslsSGFL--NVLEVLKHEV--KIGLGTDVAG--g  327
DSSP  LLLHHHHHHHHH-HLLEEEELhHHHHhllLLLL--LHHHHHHLLL--EEEELLLLLL--l


DSSP  LLLLhHHHHHHHHHHHL-----------LLLHHHHHHHHLHHHHHHHLL--LLLLLLLLL
Query LIPLgILRNMCQIASMS-----------DIDPEVAVCMATGNSTAVYGL--NTGVIAPGK  328
ident       |         |                     ||       ||    |    ||
Sbjct YSYS-MLDAIRRAVMVSnillinkvnekSLTLKEVFRLATLGGSQALGLdgEIGNFEVGK  386
DSSP  LLLL-HHHHHHHHHHHHhhhhhllllllLLLHHHHHHHHLHHHHHHLLLllLLLLLLLLL


DSSP  LLLEEEEELL---LLLLL-----------LLHHHHHhhLLLL--EEEEEEELLEEEELll
Query EADLIIMDTP---LGSVA-----------EDAMGAIaaGDIP--GISVVLIDGEAVVTks  372
ident | | |                                        |  |   |  ||   
Sbjct EFDAILINPKasdSPIDLfygdffgdiseAVIQKFL--YLGDdrNIEEVYVGGKQVVP--  442
DSSP  LLLEEEELLLlllLLLLLllhhhhlllllHHHHHHH--HHLLhhHEEEEEELLEEEEL--


DSSP  lllllllllleel
Query rntppakraakil  385
ident              
Sbjct -----------fs  444
DSSP  -----------ll


No 18: Query=2vunA Sbjct=2ogjA Z-score=26.5

back to top
DSSP  -LEEEEELLlEEELLLlLLLEELLLEEEEE-LLEEEEEElHHHHllLLLLEEEELlLLEE
Query -SKTIIKNIgKIVSGDiKSPVLQADTIVVE-DGLIAAIGgEELMkdAGDATIIDAaGSTV   58
ident        |  | |    |        |    || ||| |   |   |   |         
Sbjct qAPILLTNV-KPVGFG-KGASQSSTDILIGgDGKIAAVG-SALQ--APADTQRID-AAFI   54
DSSP  lLLEEEEEE-EELLLL-LLLLLLLEEEEELlLLLEEEEE-LLLL--LLLLEEELL-LLEE


DSSP  EELEEEEEELLLLLlEEHHhleelHHHHH-HLLLEEEEEELLLlllllllllhhhHHHHH
Query TPGLLDTHVHVSGGdYAPRqktmdFISSA-LHGGVTTMISAGSphfpgrpkdaagTKALA  117
ident  ||  | |||   |            |      ||||   |||              |  
Sbjct SPGWVDLHVHIWHG-GTDI---siRPSECgAERGVTTLVDAGS-----------aGEANF   99
DSSP  EELEEEEEELLLLL-LLLL---llLHHHLlHHHLEEEEEEELL-----------lLLLLH


DSSP  HHHHHHHHHLLhhHLEEELlEELLL----------------LLLLHHHHHHHHHLL---L
Query ITLSKSYYNARpaGVKVHGgAVILE----------------KGLTEEDFIEMKKEG---V  158
ident                        |                 |        |   |     
Sbjct HGFREYIIEPS--RERIKA-FLNLGsiglvacnrvpelrdiKDIDLDRILECYAENsehI  156
DSSP  HHHHHHLLLLL--LLEEEE-EEELLlllllllllllllllhHHLLHHHHHHHHHLLlllE


DSSP  LEEEEEL---lllllLHHHHHHHHHHHHHLLLEEEEELLLLlllllLLLLHHHHHHHL-l
Query WIVGEVG---lgtikNPEDAAPMVEWAHKHGFKVQMHTGGTsipgsSTVTADDVIKTK-p  214
ident                           |         | |                     
Sbjct VGLXVRAshvitgswGVTPVKLGKKIAKILKVPXXVHVGEP-----PALYDEVLEILGpg  211
DSSP  EEEEEEElhhhhlllLLHHHHHHHHHHHHHLLLEEEEELLL-----LLLHHHHHHHLLll


DSSP  LEEELLLL--llLLLLHH--HHHHHHHHLLLEEEEELL---LLHHHHHHHHHhhhhHLLH
Query DVVSHING--gpTAISVQ--EVDRIMDETDFAMEIVQC---GNPKIADYVARraaeKGQL  267
ident ||| |         |                   |         | |          | |
Sbjct DVVTHCFNgksgSSIXEDedLFNLAERCEGIRLDIGHGgasFSFKVAEAAIA----RGLL  267
DSSP  LEEELLLLllllLLLLLLhhHHHHHHHLLLLEEELLLLlllLLHHHHHHHHH----LLLL


DSSP  hHEEEELLLLlLLLL---LLLHhHHHHHHHHHhLLLLHHHHHHHHLHHHHHHHLLLL-lL
Query gRVIFGNDAPsGTGL---IPLGiLRNMCQIASmSDIDPEVAVCMATGNSTAVYGLNT-gV  323
ident        |   |                   |  |   |  |   | |   |  |     
Sbjct -PFSISTDLH-GHSXnfpVWDL-ATTXSKLLS-VDXPFENVVEAVTRNPASVIRLDXenR  323
DSSP  -LLLLLLLLL-LLLLlllLLLH-HHHHHHHHH-LLLLHHHHHHLLLHHHHHHLLLLLllL


DSSP  LLLLLLLLEEEEELLlLLLL---llhhhhhhHLLLLEEEEEEELLEEeELLLLLllllll
Query IAPGKEADLIIMDTPlGSVA---edamgaiaAGDIPGISVVLIDGEAvVTKSRNtppakr  380
ident    |  ||    |                             |  ||    ||       
Sbjct LDVGQRADFTVFDLV-DADLeatdsngdvsrLKRLFEPRYAVIGAEA-IAASRY------  375
DSSP  LLLLLLLEEEEEEEE-EEEEeeellllleeeEEEEEEEEEEEELLEE-EELLLL------


DSSP  lleel
Query aakil  385
ident      
Sbjct -ipra  379
DSSP  -llll


No 19: Query=2vunA Sbjct=4b3zD Z-score=26.3

back to top
DSSP  LEEEEELLlEEELLlllLLEElLLEEEEELLEEEEEELhHHHLlLLLLEEEELLLLEEEE
Query SKTIIKNIgKIVSGdikSPVLqADTIVVEDGLIAAIGGeELMKdAGDATIIDAAGSTVTP   60
ident     ||    |         |       |||||  ||   |    |    | | |  | |
Sbjct DRLLIKGG-RIIND---DQSL-YADVYLEDGLIKQIGE-NLIV-PGGVKTIEANGRMVIP   53
DSSP  LEEEEEEE-EEELL---LLEE-EEEEEEELLEEEEEEL-LLLL-LLLLEEEELLLLEEEE


DSSP  LEEEEEELLLllleeHHHLEE--LHHHHHHLLLEEEEEELLLlllllLLLLhHHHHHHHH
Query GLLDTHVHVSggdyaPRQKTM--DFISSALHGGVTTMISAGSphfpgRPKDaAGTKALAI  118
ident |  |                        || || |  |                      
Sbjct GGIDVNTYLQ-----KTAADDffQGTRAALVGGTTMIIDHVV-----PEPG-SSLLTSFE  102
DSSP  LEEEEEELLL-----LLLLLLhhHHHHHHHHLLEEEEEEEEL-----LLLL-LLHHHHHH


DSSP  HHHHHHhHLLHHhLEEELlEELL-LLLL-LHHHHHHHHH-LLLLEeEEEL----llLLLL
Query TLSKSYyNARPAgVKVHGgAVIL-EKGL-TEEDFIEMKK-EGVWIvGEVG----lgTIKN  171
ident                     |          |         ||     |           
Sbjct KWHEAA-DTKSC-CDYSL-HVDItSWYDgVREELEVLVQdKGVNS-FQVYmaykdvYQMS  158
DSSP  HHHHHH-HLLLL-LEEEE-EEELlLLLLlHHHHHHHHHHlLLLLE-EEEEllllllLLLL


DSSP  HHHHHHHHHHHHHLLLEEEEELlLLLLLLL--------------------------lLLL
Query PEDAAPMVEWAHKHGFKVQMHTgGTSIPGS--------------------------sTVT  205
ident               |     |                                       
Sbjct DSQLYEAFTFLKGLGAVILVHA-ENGDLIAqeqkrilemgitgpeghalsrpeeleaEAV  217
DSSP  HHHHHHHHHHHHHHLLEEEEEL-LLHHHHHhhhhhhhhllllllhhhhhhllhhhhhHHH


DSSP  HHHHHHH----LLLEEELLlllllLLLHhHHHHHHHHL----LLEEEEELLLLH------
Query ADDVIKT----KPDVVSHInggptAISVqEVDRIMDET----DFAMEIVQCGNP------  251
ident             |                  | |            |             
Sbjct FRAITIAgrinCPVYITKV-----MSKS-AADIIALARkkgpLVFGEPIAASLGtdgthy  271
DSSP  HHHHHHHhhhlLLEEEEEE-----LLHH-HHHHHHHHHhhllLEEEEELHHHHHlllhhh


DSSP  ---------------------HHHHHHHHHHHhhlLHHHEEEELLLLL------------
Query ---------------------KIADYVARRAAekgQLGRVIFGNDAPS------------  278
ident                         ||     |          |                 
Sbjct wsknwakaaafvtspplspdpTTPDYLTSLLA---CGDLQVTGSGHCPystaqkavgkdn  328
DSSP  hlllhhhhhhlllllllllllLHHHHHHHHHH---HLLLLLLLLLLLLllhhhhhhhlll


DSSP  -----LLLLL-LLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLL
Query -----GTGLI-PLGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEA  330
ident                             |    |     |      |    | || |  |
Sbjct ftlipEGVNGiEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLypRKGRIAVGSDA  388
DSSP  hhhllLLLLLlLLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHHLLllLLLLLLLLLLL


DSSP  LEEEEE-LLLL-------lllllhhhhhhhLLLLEEEEEEELLEEEELLLL---------
Query DLIIMD-TPLG-------svaedamgaiaaGDIPGISVVLIDGEAVVTKSR---------  373
ident |  | |   |                           ||   |  |              
Sbjct DVVIWDpDKLKtitakshksaveynifegmECHGSPLVVISQGKIVFEDGNinvnkgmgr  448
DSSP  LEEEEEeEEEEellllllllllllllllllEEEEEEEEEEELLEEEEELLEellllllll


DSSP  -----------------llllllllleel
Query -----------------ntppakraakil  385
ident                              
Sbjct fiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  llllllllhhhhhhhhhhhhhllllllll


No 20: Query=2vunA Sbjct=1k6wA Z-score=26.0

back to top
DSSP  LEEEEELlLEEElllllllEELL-LEEEEELLEEEEEELHHhhllllLLEEEELLLLEEE
Query SKTIIKNiGKIVsgdikspVLQA-DTIVVEDGLIAAIGGEElmkdagDATIIDAAGSTVT   59
ident     | |                   |   || | ||               ||    | 
Sbjct ALQTIIN-ARLP-------GEEGlWQIHLQDGKISAIDAQS-gvmpiTENSLDAEQGLVI   51
DSSP  LLLEEEE-ELLL-------LLLLeEEEEEELLEEEEEEEEL-lllllLLLEEELLLLEEE


DSSP  ELEEEEEELLLllleEHHHL--------------------------------eeLHHHHH
Query PGLLDTHVHVSggdyAPRQK--------------------------------tmDFISSA   87
ident |     | |                                                   
Sbjct PPFVEPHIHLD---tTQTAGqpnwnqsgtlfegierwaerkallthddvkqrawQTLKWQ  108
DSSP  LLEEEEEELLL---lLLLLLlllllllllhhhhhhhhhllhhhllhhhhhhhhhHHHHHH


DSSP  HLLLEEEEEELLLllllllllLHHHhHHHHHHHhHHHHHLLHHHLEEElLEELL-----l
Query LHGGVTTMISAGSphfpgrpkDAAGtKALAITLsKSYYNARPAGVKVHgGAVIL-----e  142
ident    |                   |                                    
Sbjct IANGIQHVRTHVD-------vSDAT-LTALKAM-LEVKQEVAPWIDLQ-IVAFPqegils  158
DSSP  HHLLEEEEEEEEE-------lLLLL-LHHHHHH-HHHHHHHLLLLEEE-EEEELllllll


DSSP  LLLLHHHHHHHHHLLLLEEeEELL----llllLHHHHHHHHHHHHHLLLEEEEELLLLll
Query KGLTEEDFIEMKKEGVWIVgEVGL----gtikNPEDAAPMVEWAHKHGFKVQMHTGGTsi  198
ident     |    |    |   |               |        | |       |      
Sbjct YPNGEALLEEALRLGADVV-GAIPhfeftreyGVESLHKTFALAQKYDRLIDVHCDEI--  215
DSSP  LLLHHHHHHHHHHLLLLEE-EELHhhlllhhhHHHHHHHHHHHHHHHLLEEEEEELLL--


DSSP  lllLLLLHHHHHHHL-------lLEEELLlllllLLLHH-------hhHHHHHHLLLEEE
Query pgsSTVTADDVIKTK-------pDVVSHInggptAISVQ-------evDRIMDETDFAME  244
ident           |               ||                     |          
Sbjct ddeQSRFVETVAALAhhegmgarVTASHT-----TAMHSyngaytsrlFRLLKMSGINFV  270
DSSP  lllLLLHHHHHHHHHhhhllhhhEEEEEL-----HHHHHllhhhhhhhHHHHHHHLLEEE


DSSP  EE-LLLL------------HHHHhhHHHHHHHHLLhhHEEEELLLL---LLLLLLLLhHH
Query IV-QCGN------------PKIAdyVARRAAEKGQlgRVIFGNDAP---SGTGLIPLgIL  288
ident                      |         | |    | || |               |
Sbjct ANpLVNIhlqgrfdtypkrRGIT--RVKEMLESGI--NVCFGHDDVfdpWYPLGTAN-ML  325
DSSP  ELhHHHHhhllllllllllLLLL--LHHHHHHLLL--LEEELLLLLlllLLLLLLLL-HH


DSSP  HHHHHHHHHLLL----LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELlllllll
Query RNMCQIASMSDI----DPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMDTplgsvae  344
ident                          |  |     |    || |  | |||          
Sbjct QVLHMGLHVCQLmgygQINDGLNLITHHSARTLNLQDYGIAAGNSANLIILPA-------  378
DSSP  HHHHHHHHHLLLllhhHHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLEEEELL-------


DSSP  LHHHHHHHlLLLEEEEEEELLEEEELLllllLLLL---------llleel
Query DAMGAIAAgDIPGISVVLIDGEAVVTKsrntPPAK---------raakil  385
ident                     |           ||                
Sbjct ENGFDALR-RQVPVRYSVRGGKVIAST----QPAQttvyleqpeaidykr  423
DSSP  LLHHHHHH-HLLLLLEEEELLEEEEEL----LLLLeeeellleeeellll


No 21: Query=2vunA Sbjct=4rdvB Z-score=24.1

back to top
DSSP  leEEEElLLEEELllllLLEELL-LEEEEE-LLEEEEEE-LHHHHlllllleEEELLlLE
Query skTIIKnIGKIVSgdikSPVLQA-DTIVVE-DGLIAAIG-GEELMkdagdatIIDAAgST   57
ident     |                          ||  | |                      
Sbjct --SAIF-AERALL----PEGWARnVRFEISaDGVLAEIRpDANAD------gAERLG-GA   46
DSSP  --LEEE-EEEEEE----LLEEEEeEEEEELlLLLEEEEElLLLLL------lLEELL-LL


DSSP  EEELEEEEEELLL------------------------------------LLLEEhhhlee
Query VTPGLLDTHVHVS------------------------------------GGDYAprqktm   81
ident | ||    | |                                          |      
Sbjct VLPGMPNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeqIEVIA-----c  101
DSSP  EEELEEEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhhHHHHH-----h


DSSP  LHHHHHHLLLEEEEEELLLlLLLLllllhhhhhhhhHHHHHHHHHL-LHHHLEEELlEEL
Query DFISSALHGGVTTMISAGSpHFPGrpkdaagtkalaITLSKSYYNA-RPAGVKVHGgAVI  140
ident       |  | |                          ||     |   ||         
Sbjct QLYIEMLKAGYTAVAEFHY-VHHD---ldgrsyadpAELSLRISRAaSAAGIGLTL-LPV  156
DSSP  HHHHHHHHHLEEEEEEEEL-LLLL---lllllllllLHHHHHHHHHhHHHLLEEEE-EEL


DSSP  LLL-----------------LLLHHHHHHHHHLL--------lLEEEEELLLLLlLHHHH
Query LEK-----------------GLTEEDFIEMKKEG--------vWIVGEVGLGTIkNPEDA  175
ident |                      |                          |     |   
Sbjct LYShagfggqpasegqrrfiNGSEAYLELLQRLRapleaaghsLGLCFHSLRAV-TPQQI  215
DSSP  LLLeeellleellhhhllllLLHHHHHHHHHHHHhhhhhhlleELEEELLLLLL-LHHHH


DSSP  HHHHHHhHHLLLEEEEELL-LLLL-LLLL-----LLLHHHH-HHHL--lLEEELLLllll
Query APMVEWaHKHGFKVQMHTG-GTSI-PGSS-----TVTADDV-IKTK--pDVVSHINggpt  225
ident |            |  |                                    |      
Sbjct ATVLAA-GHDDLPVHIHIAeQQKEvDDCQawsgrRPLQWLYeNVAVdqrWCLVHAT----  270
DSSP  HHHHLL-LLLLLLEEEEELlLHHHhHHHHhhhllLHHHHHHhHLLLlllEEEEELL----


DSSP  LLLHHHHHHHHHhLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLllll
Query AISVQEVDRIMDeTDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPsgtg  281
ident      ||                        |    |      |   |   | |      
Sbjct HADPAEVAAMAR-SGAVAGLClSTEAnlgDGIF--PATDFLAQGG--RLGIGSDSH----  321
DSSP  LLLHHHHHHHHH-HLLEEEELhHHHHhllLLLL--LHHHHHHLLL--EEEELLLLL----


DSSP  LLLLhHHHHHHHHHH---------HLLL------LHHHHHHHHLHHHHHHHLLLLLLLLL
Query LIPLgILRNMCQIAS---------MSDI------DPEVAVCMATGNSTAVYGLNTGVIAP  326
ident                                           |        |   |  | 
Sbjct VSLS-VVEELRWLEYgqrlrdrkrNRLYrddqpmIGRTLYDAALAGGAQALGQPIGSLAV  380
DSSP  LLLL-HHHHHHHHHHhhhhhhlllLLLLllllllHHHHHHHHHHHHHHHHHLLLLLLLLL


DSSP  LLLLLEEEEELLLLL-----llLLHHHHHHhLLLL-EEEEEEELLEEEELLLL-------
Query GKEADLIIMDTPLGS-----vaEDAMGAIAaGDIP-GISVVLIDGEAVVTKSR-------  373
ident |  |||   |                              |   |  ||   |       
Sbjct GRRADLLVLDGNDPYlasaegdALLNRWLF-AGGDrQVRDVMVAGRWVVRDGRhageers  439
DSSP  LLLLLEEEELLLLHHhhllllhHHHHHHHH-HLLHhHEEEEEELLEEEELLLLlllhhhh


DSSP  llllllllleel
Query ntppakraakil  385
ident             
Sbjct arafvqvlgell  451
DSSP  hhhhhhhhhhhl


No 22: Query=2vunA Sbjct=3icjA Z-score=23.7

back to top
DSSP  LEEEEELLlEEELLLLlLLEElLLEEEEELLEEEEEEL-HHHHL--LLLLLEEEELLLLE
Query SKTIIKNIgKIVSGDIkSPVLqADTIVVEDGLIAAIGG-EELMK--DAGDATIIDAAGST   57
ident       |   |               |         |               |||  |  
Sbjct CMKALING-TIYTSFS-PVKK-VSGLVISNERVLYAGDsSTALRiaELAGGEIIDLKGKF   57
DSSP  LEEEEELL-EEEEEEL-LEEE-ELEEEEELLEEEEEELhHHHHHhhHHHLLEEEELLLLE


DSSP  EEELEEEEEELLLllleEHHHL--------------------------------------
Query VTPGLLDTHVHVSggdyAPRQK--------------------------------------   79
ident | |   | | |                                                 
Sbjct VMPAFFDSHLHLD--elGMSLEmvdlrgvksmeelvervkkgrgriifgfgwdqdelgrw  115
DSSP  EEELEEEEEELHH--hhHHHHHleellllllhhhhhhhhhlllllleeeeeelhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   79
ident                                                             
Sbjct ptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkii  175
DSSP  llhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhh


DSSP  -------------eeLHHHHHHLLLEEEEEELLLlllllllllhhhhHHHHHHHHHHHH-
Query -------------tmDFISSALHGGVTTMISAGSphfpgrpkdaagtKALAITLSKSYY-  125
ident                      |  ||                        |         
Sbjct nekiltvkdykhyieSAQEHLLSLGVHSVGFMSV-------------GEKALKALFELEr  222
DSSP  hhllllhhhhhhhhhHHHHHHHHLLEEEEEEEEE-------------LHHHHHHHHHHHh


DSSP  -HLLHhhLEEElLEELLLllllHHHHH---HHHH----llLLEEEEEL------------
Query -NARPagVKVHgGAVILEkgltEEDFI---EMKK----egVWIVGEVG------------  165
ident          |       |              |        | |                
Sbjct eGRLK--MNVF-AYLSPE---lLDKLEelnLGKFegrrlrIWGVXLFVdgslgartalls  276
DSSP  lLLLL--LEEE-EEELHH---hHHHHHhhlLLLEellleeEEEEEEELllllllllllll


DSSP  ----------lllLLLHHHHHHHHHHHHHLLLEEEEELLLlllllllLLLHhHHHHHL--
Query ----------lgtIKNPEDAAPMVEWAHKHGFKVQMHTGGtsipgssTVTAdDVIKTK--  213
ident                |        | |   |  |  |  |                    
Sbjct epytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAIG------dKAVD-VALDAFee  329
DSSP  lllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEELL------hHHHH-HHHHHHhh


DSSP  ---LLEEELLLllllLLLHHHhHHHHHHLLLEEEEELLLL---------------HHHHh
Query ---PDVVSHINggptAISVQEvDRIMDETDFAMEIVQCGN---------------PKIAd  255
ident         |                  |                                
Sbjct aefSGRIEHAS----LVRDDQ-LERIKELKVRISAQPHFIvsdwwivnrvgeeraKWAY-  383
DSSP  hllLLEEEELL----LLLHHH-HHHHHHHLLEEEELLLHHhhlllhhhhhhhhhhHHLL-


DSSP  hHHHHHhhhlLHHHEEEELLLLLlllLLLLhHHHHHHHHHHH------LLLLHHHHHHHH
Query yVARRAaekgQLGRVIFGNDAPSgtgLIPLgILRNMCQIASM------SDIDPEVAVCMA  309
ident                 |  | |                               | |    
Sbjct -RLKTL---sSITKLGFSTDSPI---EPAD-PWVSIDAAVNRyvvdpgERVSREEALHLY  435
DSSP  -LHHHH---hHHLLEEELLLLLL---LLLL-HHHHHHHHHHLllllhhHLLLHHHHHHHL


DSSP  LHHHHHHHLL-LLLLLLLLLLLLEEEEELlllllllLHHHhhhhlllleeeeeeelleee
Query TGNSTAVYGL-NTGVIAPGKEADLIIMDTplgsvaeDAMGaiaagdipgisvvlidgeav  368
ident |  |  |      |    |  |  || |        |                       
Sbjct THGSAQVTLAeDLGKLERGFRAEYIILDR-------DPLK--------------------  468
DSSP  LHHHHHHLLLlLLLLLLLLLLLLEEEELL-------LLLL--------------------


DSSP  ellllllllllllleel
Query vtksrntppakraakil  385
ident                  
Sbjct -----------------  468
DSSP  -----------------


No 23: Query=2vunA Sbjct=3ooqA Z-score=22.9

back to top
DSSP  lEEEEELLlEEELLLlllLEELLLEEEEELLEEEEEELhHHHLllLLLEEEELLLLEEEE
Query sKTIIKNIgKIVSGDiksPVLQADTIVVEDGLIAAIGGeELMKdaGDATIIDAAGSTVTP   60
ident  |   ||                    |  |     |         || | |  |    |
Sbjct -KILFKNA-TVFPIT---SRPFKGDVLVSNGKVEKVGE-NIED--PDAEIVDLTGKFLFP   52
DSSP  -LEEEEEE-EELLLL---LLLEEEEEEEELLEEEEEEL-LLLL--LLLEEEELLLLEEEE


DSSP  LEEEEEELLL-----------------------------LLLEehhhleELHHHHHHLLL
Query GLLDTHVHVS-----------------------------GGDYaprqktMDFISSALHGG   91
ident |  | | |                                            |  || ||
Sbjct GFVDAHSHIGlfeegvgyyysdgneatdpvtphvkaldgFNPQ------DPAIERALAGG  106
DSSP  LEEEEEELLLlllllllhhhlllllllllllllllhhhhLLLL------LHHHHHHHLLL


DSSP  EEEEEELLLLllllllllhhhhhhhhhhhhhhHHHLLhhhleeelleelllllllhhhhh
Query VTTMISAGSPhfpgrpkdaagtkalaitlsksYYNARpagvkvhggavilekglteedfi  151
ident ||                                                          
Sbjct VTSVXIVPGS------anpvggqgsvikfrsiIVEEC-----------------------  137
DSSP  EEEEEELLLL------llleeeeeeeeellllLHHHH-----------------------


DSSP  hhhhlLLLEEEEEL--LLLL-------------lLHHHHHHH------------------
Query emkkeGVWIVGEVG--LGTI-------------kNPEDAAPM------------------  178
ident                                                             
Sbjct --ivkDPAGLKXAFgeNPKRvygerkqtpstrxgTAGVIRDYftkvknyxkkkelaqkeg  195
DSSP  --eeeEEEEEEEELlhHHHHhhhhlllllllhhhHHHHHHHHhhhhhhhhhhhhhhhhll


DSSP  -----------hHHHHHL-LLEEEEELLLlllllllLLLHhHHHHHL-----LLEEELLL
Query -----------vEWAHKH-GFKVQMHTGGtsipgssTVTAdDVIKTK-----PDVVSHIN  221
ident                          |                 |          |  |  
Sbjct keftetdlkxevGEXVLRkKIPARXHAHR------aDDIL-TAIRIAeefgfNLVIEHGT  248
DSSP  lllllllhhhhhHHHHHLlLLLEEEEELL------hHHHH-HHHHHHhhhllLEEEEELL


DSSP  llllLLLHhHHHHHHHhLLLEEEEELLLL--------hHHHHhHHHHHHHHLLhhHEEEE
Query ggptAISVqEVDRIMDeTDFAMEIVQCGN--------pKIADyVARRAAEKGQlgRVIFG  273
ident                                                    |        
Sbjct ----EAYK-ISKVLAE-KKIPVVVGPLLTfrtklelkdLTXE-TIAKLLKDGV--LIALX  299
DSSP  ----LHHH-HHHHHHH-HLLLEEELLLLLllllhhhllLLLL-HHHHHHHLLL--LEEEL


DSSP  LLLLLlllLLLLHHHHHHHHHhHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLL
Query NDAPSgtgLIPLGILRNMCQIaSMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEAD  331
ident  | |                         |      | |     ||    | | ||| ||
Sbjct CDHPV---IPLEFATVQAATA-XRYGAKEEDLLKILTVNPAKILGLedRIGSIEPGKDAD  355
DSSP  LLLLL---LLHHHHHHHHHHH-HHHLLLHHHHHHLLLHHHHHHLLLllLLLLLLLLLLLL


DSSP  EEEEELllllllllHHHHhhhlLLLEEEEEEELLEEEELLllllllllllleel
Query LIIMDTplgsvaedAMGAiaagDIPGISVVLIDGEAVVTKsrntppakraakil  385
ident |                            | |||  |                 
Sbjct LVVWSG--------HPFD----XKSVVERVYIDGVEVFRR-------------e  384
DSSP  EEEELL--------LLLL----LLLLEEEEEELLEEEEEL-------------l


No 24: Query=2vunA Sbjct=1a5kC Z-score=21.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----lEEEEELLlEEELLllllLEELLLEEEEELLEEEEEELHH---------HHLLlLL
Query ----sKTIIKNIgKIVSGdiksPVLQADTIVVEDGLIAAIGGEE---------LMKDaGD   47
ident           |   ||             | | || | |||                   
Sbjct aadcvDLVLTNA-LIVDH----WGIVKADIGVKDGRIFAIGKAGnpdiqpnvtIPIG-AA  114
DSSP  hhhllLEEEEEE-EEEEL----LEEEEEEEEEELLEEEEEELEElllllllllEELL-LL


DSSP  LEEEELLLLEEEELEEEEEELLLLLLeehhhleelHHHHHHLLLEEEEEElLLLLLLLL-
Query ATIIDAAGSTVTPGLLDTHVHVSGGDyaprqktmdFISSALHGGVTTMISaGSPHFPGR-  106
ident    | | |  || |  ||| |                  ||  |||||   |        
Sbjct TEVIAAEGKIVTAGGIDTHIHWICPQ---------QAEEALVSGVTTMVG-GGTGPAAGt  164
DSSP  LEEEELLLLEEEELEEEEEEELLLLL---------HHHHHHHHLEEEEEE-ELLLLLHHh


DSSP  lllhhhHHHHHHHHHHHHHHLLhhHLEEElLEELLLLlLLHHHHHHHHHLLLLEEEeELL
Query pkdaagTKALAITLSKSYYNARpaGVKVHgGAVILEKgLTEEDFIEMKKEGVWIVGeVGL  166
ident            |             |                   |    ||        
Sbjct hattctPGPWYISRMLQAADSL--PVNIG-LLGKGNV-SQPDALREQVAAGVIGLE-IHE  219
DSSP  hhllllLHHHHHHHHHHHHLLL--LLEEE-EEEELLL-LLHHHHHHHHHHLLLEEE-EEH


DSSP  LLLLLHHHHHHHHHHHHHLLLEEEEELllLLLLlLLLLLhHHHHHH--LLLEEELLLLLL
Query GTIKNPEDAAPMVEWAHKHGFKVQMHTggTSIPgSSTVTaDDVIKT--KPDVVSHINGGP  224
ident      |         |      |  |   |    |  |  |             |  |  
Sbjct DWGATPAAIDCALTVADEMDIQVALHS-dTLNE-SGFVE-DTLAAIggRTIHTFHTEGAG  276
DSSP  HHLLLHHHHHHHHHHHHHHLLEEEEEL-lLLLL-LLLHH-HHHHHHllLLEEELLLLLLL


DSSP  LLLLHHHHHhHHHHLLLEEEEELLL-----------------------------------
Query TAISVQEVDrIMDETDFAMEIVQCG-----------------------------------  249
ident                                                             
Sbjct GGHAPDIIT-ACAHPNILPSSTNPTlpytlntidehldmlmvchhldpdiaedvafaesr  335
DSSP  LLLLLLHHH-HHHLLLEEEEEEHHHllllllhhhhhhhhhhhhhllllllhhhhhlllll


DSSP  ----LHHHHHHHHHHHHhhllhhHEEEELLLLLllLLLLLHHHHHHHHHHHHLL------
Query ----NPKIADYVARRAAekgqlgRVIFGNDAPSgtGLIPLGILRNMCQIASMSD------  299
ident          |      |            |                 | |          
Sbjct irreTIAAEDVLHDLGA------FSLTSSDSQA--MGRVGEVILRTWQVAHRMKvqrgal  387
DSSP  llhhHHHHHHHHHHLLL------LLEEELLLLL--LLLLLLHHHHHHHHHHHHHhhhlll


DSSP  ---------lLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELLlllllllhhh
Query ---------iDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADLIIMDTPlgsvaedamg  348
ident                    | |     |     | |  || |||                
Sbjct aeetgdndnfRVKRYIAKYTINPALTHGIahEVGSIEVGKLADLVVWSPA----------  437
DSSP  llllllllhhHHHHHHHLLLHHHHHHLLLllLLLLLLLLLLLLEEEELHH----------


DSSP  hhhhllLLEEEEEEELLEEEELL-------------------------------------
Query aiaagdIPGISVVLIDGEAVVTK-------------------------------------  371
ident             |   |                                           
Sbjct ----ffGVKPATVIKGGMIAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsq  493
DSSP  ----hlLLLLLEEEELLEEEEEEellllllllllllleeeelhhhlhhhhhhhleeeelh


DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------s  372
ident                                                             
Sbjct aaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsep  553
DSSP  hhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelllll


DSSP  lllllllllleel
Query rntppakraakil  385
ident              
Sbjct advlpmaqryflf  566
DSSP  lllllllllllll


No 25: Query=2vunA Sbjct=3cjpA Z-score=18.9

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELLLLLLEehhhleeLHHHHHHLLLEEEEEElLLLLLL----------------
Query GLLDTHVHVSGGDYaprqktmDFISSALHGGVTTMISaGSPHFP----------------  104
ident    | | ||              |      ||   |   |                    
Sbjct LIIDGHTHVILPVE-------KHIKIMDEAGVDKTIL-FSTSIHpetavnlrdvkkemkk   52
DSSP  LLEEEEEELLLLHH-------HHHHHHHHHLLLEEEE-ELLLLLhhhlllhhhhhhhhhh


DSSP  -------lllLLHHHHHHHHHHHhHHHHHLLhhhLEEELlEELLLLLL----LHHHHHHH
Query -------grpKDAAGTKALAITLsKSYYNARpagVKVHGgAVILEKGL----TEEDFIEM  153
ident                       |      |        |       ||    |     | 
Sbjct lndvvngktnSMIDVRRNSIKEL-TNVIQAY--pSRYVG-FGNVPVGLsendTNSYIEEN  108
DSSP  hhhhhlllllLLHHHHHHHHHHH-HHHHHHL--lLLEEE-EELLLLLLlhhhHHHHHHHH


DSSP  -HHLLLLEEEEELlllllLHHHHHHHHHHHHHLL-LEEEEELLLllllllLLLL--HHHH
Query -KKEGVWIVGEVGlgtikNPEDAAPMVEWAHKHG-FKVQMHTGGtsipgsSTVT--ADDV  209
ident          ||             |        |      |           |       
Sbjct iVNNKLVGIGELT-pasgQIKSLKPIFKYSMDSGsLPIWIHAFN------PLVLqdIKEI  161
DSSP  lLLLLLLEEEEEL-llllLHHHHHHHHHHHHHLLlLLEEELLLL------LLLHhhHHHH


DSSP  HHHL------LLEEELLlllllLLLHHHHHHHHHHLL-LEEEEElLLLH-HHHHHHHHHH
Query IKTK------PDVVSHInggptAISVQEVDRIMDETD-FAMEIVqCGNP-KIADYVARRA  261
ident           |    |                  |                    |    
Sbjct AELCkafpkvPVILGHM----gGSNWMTAVELAKEIQnLYLDTS-AYFStFVLKIVINEL  216
DSSP  HHHHhhllllLEEEHHH----hHHHHHHHHHHHHHLLlEEEELL-LLLLhHHHHHHHHHL


DSSP  hhhllHHHEEEELLLLLlllLLLLHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHLLll
Query aekgqLGRVIFGNDAPSgtgLIPLGILRNMCQIAsmsdIDPEVAVCMATGNSTAVYGLnt  321
ident          ||| | |                       |  ||      |         
Sbjct -----PLKCIFGTDMPF---GDLQLSIEAIKKMS----NDSYVANAVLGDNISRLLNI--  262
DSSP  -----LLLEELLLLLLL---LLHHHHHHHHHHHL----LLHHHHHHHHLHHHHHHHLL--


DSSP  lllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllll
Query gviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakra  381
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  leel
Query akil  385
ident     
Sbjct ----  262
DSSP  ----


No 26: Query=2vunA Sbjct=2imrA Z-score=18.9

back to top
DSSP  -LEEEEElLLEEELllllLLEElLLEEEEELLEEEEEEL-HHHHLLLLLLEEEELlLLEE
Query -SKTIIKnIGKIVSgdikSPVLqADTIVVEDGLIAAIGG-EELMKDAGDATIIDAaGSTV   58
ident                            ||     || |   ||      |    | |   
Sbjct hTPRLLT-CDVLYT----GAQS-PGGVVVVGETVAAAGHpDELRRQYPHAAEERA-GAVI   53
DSSP  lLEEEEE-ELEEEL----LEEL-LEEEEEELLEEEEEELhHHHHHHLLLLEEEEL-LLEE


DSSP  EELEEEEEELLL---------------llleeHHHLE------eLHHHHHHLLLEEEEEE
Query TPGLLDTHVHVS---------------ggdyaPRQKT------mDFISSALHGGVTTMIS   97
ident  |     | |                                           |      
Sbjct APPPVNAHTHLDmsayefqalpyfqwipevviRGRHLrgvaaaqAGADTLTRLGAGGVGD  113
DSSP  LLLLLEEEEELLllhhhhhhlhhhhllhhhhhHHLLLlhhhhhhHHHHHHHHLLLLLEEE


DSSP  LLLlllllllllhhhhhhhHHHHHHHHHHLLhhHLEEELlEELLL--------LLLL--H
Query AGSphfpgrpkdaagtkalAITLSKSYYNARpaGVKVHGgAVILE--------KGLT--E  147
ident                    |                                        
Sbjct IVW----------------APEVMDALLARE--DLSGTL-YFEVLnpfpdkadEVFAaaR  154
DSSP  EEL----------------LHHHHHHHHLLL--LLLEEE-EEEELlllhhhhhHHHHhhH


DSSP  HHHHHHHHLL----lLEEEEELlllLLLHHHHHHHHHHHHHLLLEEEEELL-LLLL-LLL
Query EDFIEMKKEG----vWIVGEVGlgtIKNPEDAAPMVEWAHKHGFKVQMHTG-GTSI-PGS  201
ident                                       |   |   | |           
Sbjct THLERWRRLErpglrLGLSPHT-pfTVSHRLMRLLSDYAAGEGLPLQIHVAeHPTElEMF  213
DSSP  HHHHHHHLLLllleeEEEEELL-llLLLHHHHHHHHHHHHHHLLLLEEEELlLHHHhHHH


DSSP  L-------------------------------LLLHHHH-HHHL--LLEEELLLllllLL
Query S-------------------------------TVTADDV-IKTK--PDVVSHINggptAI  227
ident                                 |                  |        
Sbjct RtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLGVLaaRPTLVHMV----NV  269
DSSP  HhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHLLHhhLLEEEELL----LL


DSSP  LHHHHHHHHhHLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLLlLLLL
Query SVQEVDRIMdETDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPSgTGLI  283
ident       |       |                       |  |    |  | |     |  
Sbjct TPDDIARVA-RAGCAVVTCpRSNHhleCGTF--DWPAFAAAGV--EVALGTDSVA-SGET  323
DSSP  LHHHHHHHH-HHLLLEEELhHHHHhllLLLL--LHHHHHHLLL--LEEELLLLHH-HHLL


DSSP  LLhHHHHHHHHHHHLL-LLHHHHHHHHLHHHHHHHLllLLLLLLLLLL-lEEEEElllll
Query PLgILRNMCQIASMSD-IDPEVAVCMATGNSTAVYGlnTGVIAPGKEA-dLIIMDtplgs  341
ident                   || | |  |      | |  |     |               
Sbjct LN-VREEVTFARQLYPgLDPRVLVRAAVKGGQRVVG--TPFLRRGETWqeGFRWE-----  375
DSSP  LL-LHHHHHHHHHHLLlLLHHHHHHHHHHHHHHHHL--LLLLLLLLLLlhHHLHH-----


DSSP  llllhhhhhhhlllleeeeeeelleeeelLLLLLllllllleel
Query vaedamgaiaagdipgisvvlidgeavvtKSRNTppakraakil  385
ident                               ||            
Sbjct -----------------------------LSRDL----------  380
DSSP  -----------------------------HLLLL----------


No 27: Query=2vunA Sbjct=2y1hB Z-score=18.5

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                             
Sbjct ----------------------------------------------------------GV    2
DSSP  ----------------------------------------------------------LL


DSSP  LEEEEEELLLllleEHHHLEE--LHHHHHHLLLEEEEEELLLlllllllllhhhHHHHHh
Query GLLDTHVHVSggdyAPRQKTM--DFISSALHGGVTTMISAGSphfpgrpkdaagTKALAi  118
ident || | | | |    ||       |    |    |                          
Sbjct GLVDCHCHLS----APDFDRDldDVLEKAKKANVVALVAVAE------------HSGEF-   45
DSSP  LEEEEEELLL----LHHHLLLhhHHHHHHHHLLEEEEEELLL------------LHHHH-


DSSP  HHHHHHHHLLhhhLEEELlEELL---------------LLLLLhHHHHHHHHlLLLEEEE
Query TLSKSYYNARpagVKVHGgAVIL---------------EKGLTeEDFIEMKKeGVWIVGE  163
ident                |                                  |       ||
Sbjct EKIMQLSERY--nGFVLP-CLGVhpvqgldqrsvtlkdLDVAL-PIIENYKD-RLLAIGE  100
DSSP  HHHHHHHHHL--lLLEEE-EELLlleelllleellhhhHHHHH-HHHHHHLL-LLLEEEE


DSSP  EL-----------lllllLHHHHHHHHHHHHHLLLEEEEELLllllllllLLLHHHHHHH
Query VG-----------lgtikNPEDAAPMVEWAHKHGFKVQMHTGgtsipgssTVTADDVIKT  212
ident ||                           |      |  |                    
Sbjct VGldfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR--------SAGRPTINLL  152
DSSP  EEeellllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE--------LLHHHHHHHH


DSSP  L-----lLEEELLlllllLLLHHHHHHHHHhLLLEEEEELLL-LHHHHHHHHHHHhhhlL
Query K-----pDVVSHInggptAISVQEVDRIMDeTDFAMEIVQCG-NPKIADYVARRAaekgQ  266
ident                                      |                      
Sbjct QeqgaekVLLHAF-----DGRPSVAMEGVR-AGYFFSIPPSIiRSGQKQKLVKQL----P  202
DSSP  HhlllllEEEELL-----LLLHHHHHHHHH-LLLEEEELHHHhLLHHHHHHHHHL----L


DSSP  HHHEEEELLLLL-----LLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHH-LLL
Query LGRVIFGNDAPS-----GTGLIPLGILRNMCQIASMSDIDPEVAVCMATGNSTAVY-GLN  320
ident |       | |           |  |      ||    |  |      | |       | 
Sbjct LTSICLETDSPAlgpekQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFpKLR  262
DSSP  HHHEEELLLLLLlllllLLLLLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHLlLHH


DSSP  Llllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllll
Query Tgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakr  380
ident                                                             
Sbjct H-----------------------------------------------------------  263
DSSP  H-----------------------------------------------------------


DSSP  lleel
Query aakil  385
ident      
Sbjct ---ll  265
DSSP  ---hl


No 28: Query=2vunA Sbjct=3irsA Z-score=18.1

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
ident                                                             
Sbjct -----------------------------------------------------------L    1
DSSP  -----------------------------------------------------------L


DSSP  LEEEEEELLLLL------------------------leehHHLEE--LHHHHHHLLLEEE
Query GLLDTHVHVSGG------------------------dyapRQKTM--DFISSALHGGVTT   94
ident    |                                                    |   
Sbjct KIIDFRLRPPAMgflnariytrpdirnrftrqlgfepapsAEEKSleLMFEEMAAAGIEQ   61
DSSP  LLEELLLLLLLHhhhhlhhhhlhhhhhhhhhhhlllllhhHHHLLhhHHHHHHHHLLLLE


DSSP  EEELLLLlllLLLLlhhhhhhHHHHHHHHHHHLLhhhLEEELlEELLLLL---LLHHHHH
Query MISAGSPhfpGRPKdaagtkaLAITLSKSYYNARpagVKVHGgAVILEKG---LTEEDFI  151
ident     |                                 | |      |            
Sbjct GVCVGRN-ssVLGS------vSNADVAAVAKAYP---DKFHP-VGSIEAAtrkEAMAQMQ  110
DSSP  EEEELLE-elLLEE------lLHHHHHHHHHHLL---LLEEE-EEELLLLlhhHHHHHHH


DSSP  HHHHLLLLEEEeELLLLL----LLHH-HHHHHHHHHHHLLLEEEEELLL-LLLLlLLLLL
Query EMKKEGVWIVGeVGLGTI----KNPE-DAAPMVEWAHKHGFKVQMHTGG-TSIPgSSTVT  205
ident |    |  ||     |              |        |  | | |||           
Sbjct EILDLGIRIVN-LEPGVWatpmHVDDrRLYPLYAFCEDNGIPVIMMTGGnAGPD-ITYTN  168
DSSP  HHHHLLLLLEE-ELHHHLllllLLLLhHHHHHHHHHHHLLLLEEEELLLlLLLL-HHHHL


DSSP  HHHHHHHL------LLEEELLlllllLLLHHHHHHHHHHLL-LEEEEElLLLH--HHHHH
Query ADDVIKTK------PDVVSHInggptAISVQEVDRIMDETD-FAMEIVqCGNP--KIADY  256
ident                 | ||         |||                            
Sbjct PEHIDRVLgdfpdlTVVSSHG----nWPWVQEIIHVAFRRPnLYLSPD-MYLYnlPGHAD  223
DSSP  HHHHHHHHhhllllLEEEEHH----hLLLHHHHHHHHHHLLlEEEELH-HHHLllLLHHH


DSSP  HHHHHHHhLLHHHEEEELLLLLlllLLLL-HHHHHHHHhhhhlLLLHHHHHHHHLHHHHH
Query VARRAAEkGQLGRVIFGNDAPSgtgLIPL-GILRNMCQiasmsDIDPEVAVCMATGNSTA  315
ident     |       |  ||   |                       | |        ||   
Sbjct FIQAANS-FLADRMLFGTAYPM---CPLKeYTEWFLTL-----PIKPDAMEKILHGNAER  274
DSSP  HHHHHLL-HHHHLLLLLLLLLL---LLHHhHHHHHHLL-----LLLHHHHHHHHLHHHHH


DSSP  HHLLlllllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllll
Query VYGLntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrnt  375
ident                                                             
Sbjct LLAQ--------------------------------------------------------  278
DSSP  HHHH--------------------------------------------------------


DSSP  llllllleel
Query ppakraakil  385
ident           
Sbjct -------agr  281
DSSP  -------lll


No 29: Query=2vunA Sbjct=1bf6A Z-score=17.6

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
ident                                                             
Sbjct -------------------------------------------------------sfdpT    5
DSSP  -------------------------------------------------------llllL


DSSP  LEEEEEELLL-------llleeHHHLE---eLHHHHHHLLLEEEEEELL--LLLLlllll
Query GLLDTHVHVS-------ggdyaPRQKT---mDFISSALHGGVTTMISAG--SPHFpgrpk  108
ident |    | |                                ||   |              
Sbjct GYTLAHEHLHidlsgfknnvdcRLDQYaficQEMNDLMTRGVRNVIEMTnrYMGR-----   60
DSSP  LEEEEEELLLeelhhhhllhhhEELLHhhhhHHHHHHHHLLEEEEEELLlhHHLL-----


DSSP  lhhhhhhhhhhHHHHHHHLL-HHHLEEElLEELL-------------lLLLLHHHHHHHH
Query daagtkalaitLSKSYYNAR-PAGVKVHgGAVIL-------------eKGLTEEDFIEMK  154
ident                        |  |                                 
Sbjct -----------NAQFMLDVMrETGINVV-ACTGYyqdaffpehvatrsVQELAQEMVDEI  108
DSSP  -----------LHHHHHHHHhHHLLEEE-EEELLllhhhlllhhhhllHHHHHHHHHHHH


DSSP  HL-------LLLEEEEEL---lllllLHHHHHHHHHHHHH-LLLEEEEELLLlllllllL
Query KE-------GVWIVGEVG---lgtikNPEDAAPMVEWAHK-HGFKVQMHTGGtsipgssT  203
ident             |  | |          |        ||   |     ||         |
Sbjct EQgidgtelKAGIIAEIGtsegkitpLEEKVFIAAALAHNqTGRPISTHTSF------sT  162
DSSP  HLlllllllLEEEEEEEElllllllhHHHHHHHHHHHHHHhHLLLEEEELHH------hL


DSSP  LLHHHHHHHL-------lLEEELLLLlllLLLHHHHHHHHHhLLLEEEE-ELLL----LH
Query VTADDVIKTK-------pDVVSHINGgptAISVQEVDRIMDeTDFAMEI-VQCG----NP  251
ident                     | |                 |                   
Sbjct MGLEQLALLQahgvdlsrVTVGHCDL---KDNLDNILKMID-LGAYVQFdTIGKnsyyPD  218
DSSP  LHHHHHHHHHhllllhhhEEELLLLL---LLLHHHHHHHHH-LLLEEEElLLLLllllLH


DSSP  HHHHHHHHHHHHHLLHHHEEEELLLLLLLL------LLLLHHH-HHHHHHHHHlLLLHHH
Query KIADYVARRAAEKGQLGRVIFGNDAPSGTG------LIPLGIL-RNMCQIASMsDIDPEV  304
ident              | | ||    |                  |     |           
Sbjct EKRIAMLHALRDRGLLNRVMLSMDITRRSHlkanggYGYDYLLtTFIPQLRQS-GFSQAD  277
DSSP  HHHHHHHHHHHHLLLHHHEEELLLLLLHHHlhhhllLLLLHHHhLHHHHHHHL-LLLHHH


DSSP  HHHHHLHHHHHHHLllllllllllllleeeeelllllllllhhhhhhhlllleeeeeeel
Query AVCMATGNSTAVYGlntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlid  364
ident    |   |                                                    
Sbjct VDVMLRENPSQFFQ----------------------------------------------  291
DSSP  HHHHHLHHHHHHLL----------------------------------------------


DSSP  leeeellllllllllllleel
Query geavvtksrntppakraakil  385
ident                      
Sbjct ---------------------  291
DSSP  ---------------------


No 30: Query=2vunA Sbjct=4dlfA Z-score=17.4

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
ident                                                             
Sbjct -----------------------------------------------------------A    1
DSSP  -----------------------------------------------------------L


DSSP  LEEEEEELLL--------------------LLLEehhhleeLHHHHHHLLLEEEEEELLL
Query GLLDTHVHVS--------------------GGDYaprqktmDFISSALHGGVTTMISAGS  100
ident    | | |                                               |    
Sbjct LRIDSHQHFWryraadypwigagmgvlardYLPD-------ALHPLMHAQALGASIAVQA   54
DSSP  LLEEEEELLLlllhhhllllllllhhhlllLLHH-------HHHHHHHHLLLLEEEEELL


DSSP  LllllllllhhhHHHHHHHHHHHHHHLLhhhLEEELlEELLL--LLLLHHHHHHhHHLL-
Query PhfpgrpkdaagTKALAITLSKSYYNARpagVKVHGgAVILE--KGLTEEDFIEmKKEG-  157
ident                    |                             |   |      
Sbjct R----------aGRDETAFLLELACDEA---RIAAV-VGWEDlrAPQLAERVAE-WRGTk   99
DSSP  L----------lLHHHHHHHHHHHLLLL---LEEEE-EELLLllLLLHHHHHHL-LLLLl


DSSP  LLEEEEEL---lllllLHHH--HHHHHHHHHHLLLEEEEELLLllllllLLLL--HHHHH
Query VWIVGEVG---lgtikNPED--AAPMVEWAHKHGFKVQMHTGGtsipgsSTVT--ADDVI  210
ident                    |   |  | |                               
Sbjct LRGFRHQLqdeadvraFVDDadFARGVAWLQANDYVYDVLVFE------RQLPdvQAFCA  153
DSSP  EEEEEELHhhlllhhhHHHLhhHHHHHHHHHHLLLEEEELLLH------HHHHhhHHHHH


DSSP  HHL--lLEEELLlLLLL-----------llLHHHHHHHHHHLLLEEEEELL---------
Query KTK--pDVVSHInGGPT-----------aiSVQEVDRIMDETDFAMEIVQC---------  248
ident        |  |  | |                                            
Sbjct RHDahwLVLDHA-GKPAlaefdrddtalarWRAALRELAALPHVVCKLSGLvteadwrrg  212
DSSP  HLLlllEEEHHH-HLLLhhhllllllhhhhHHHHHHHHHLLLLEEEEELLLlllllllll


DSSP  -------lLHHHHHHHHHHHhhhlLHHHEEEELLLLL--LLLLLLLHHHHHHHHHHHHll
Query -------gNPKIADYVARRAaekgQLGRVIFGNDAPS--GTGLIPLGILRNMCQIASMsd  299
ident              |             |  || | |                    |   
Sbjct lrasdlrhIEQCLDAALDAF----GPQRLMFGSDWPVclLAASYDEVASLVERWAESR--  266
DSSP  llhhhhhhHHHHHHHHHHHH----LHHHEEELLLLLHhhHLLLHHHHHHHHHHHHHHH--


DSSP  LLHHHHHHHHLHHHHHHHLLLllllllllllleeeeelllllllllhhhhhhhlllleee
Query IDPEVAVCMATGNSTAVYGLNtgviapgkeadliimdtplgsvaedamgaiaagdipgis  359
ident            |     | |                                        
Sbjct LSAAERSALWGGTAARCYALP---------------------------------------  287
DSSP  LLHHHHHHHLLHHHHHHLLLL---------------------------------------


DSSP  eeeelleeeellllllllllllleel
Query vvlidgeavvtksrntppakraakil  385
ident                           
Sbjct --------------------------  287
DSSP  --------------------------


No 31: Query=2vunA Sbjct=3pnuA Z-score=17.0

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllLEEEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagSTVTP   60
ident                                                             
Sbjct -----------------------------------------------enlyfqsnAMKLK   13
DSSP  -----------------------------------------------llllllllLEEEE


DSSP  LEEEEEELLLLLLEEhhhleELHHHHHHLlLEEEEEElLLLLlLLLLllhhhHHHHhhHH
Query GLLDTHVHVSGGDYAprqktMDFISSALHgGVTTMISaGSPHfPGRPkdaagTKALaiTL  120
ident   || | |                                                   |
Sbjct NPLDMHLHLRDNQML-----ELIAPLSAR-DFCAAVI-MPNL-IPPL-----CNLE--DL   58
DSSP  LLEEEEELLLLHHHH-----HHHHHHHHL-LLLEEEE-LLLL-LLLL-----LLHH--HH


DSSP  HHHHHH-LLHH---HLEEElLEELLLLlLLHHHHHHHHhLLLLEEEEEL--------lLL
Query SKSYYN-ARPA---GVKVHgGAVILEKgLTEEDFIEMKkEGVWIVGEVG--------lGT  168
ident                               |      |                    | 
Sbjct KAYKMRiLKACkdeNFTPL-MTLFFKN-YDEKFLYSAK-DEIFGIXLYPagittnsngGV  115
DSSP  HHHHHHhHHHHlllLLEEE-EEEELLL-LLHHHHHHHL-LLLLEEEELLlllllllllLL


DSSP  LLLHH-HHHHHHHHHHHLLLEEEEELlLLLLLLLLLL--LHHHHHHHL------LLEEEL
Query IKNPE-DAAPMVEWAHKHGFKVQMHTgGTSIPGSSTV--TADDVIKTK------PDVVSH  219
ident          |  |           |   |           |    |          |  |
Sbjct SSFDIeYLKPTLEAMSDLNIPLLVHG-ETNDFVMDREsnFAKIYEKLAkhfprlKIVMEH  174
DSSP  LLLLHhHHHHHHHHHHHLLLLEEELL-LLLLLHHHLLhhHHHHHHHHHhhllllLEEELL


DSSP  LLllllllLHHHHHhHHHHLL-LEEEEELLLLH---------------------------
Query INggptaiSVQEVDrIMDETD-FAMEIVQCGNP---------------------------  251
ident |                         |                                 
Sbjct IT------TKTLCE-LLKDYEnLYATITLHHLIitlddviggkmnphlfckpiakryedk  227
DSSP  LL------LHHHHH-HHHHLLlEEEEELLHHHLllhhhhhlllllhhhllllllllhhhh


DSSP  HHHHHHHHhhhhhllHHHEEEELLLLL------LLLLLLLHHHHhHHHHHHHlLLLHHHH
Query KIADYVARraaekgqLGRVIFGNDAPS------GTGLIPLGILRnMCQIASMsDIDPEVA  305
ident       |           | || |                 ||              |  
Sbjct EALCELAF-----sgYEKVMFGSDSAPhpkgcaAGVFSAPVILPvLAELFKQ-NSSEENL  281
DSSP  HHHHHHHH-----llLLLEEELLLLLLllllllLLLLLHHHHHHhHHHHHHH-HLLHHHH


DSSP  HHHHLHHHHHHHLLLLllllllLLLLEEEEELLL--------llllllhhhhhhhlLLLE
Query VCMATGNSTAVYGLNTgviapgKEADLIIMDTPL--------gsvaedamgaiaagDIPG  357
ident       |    | |        ||                                    
Sbjct QKFLSDNTCKIYDLKF------KEDKILTLEEKEwqvpnvyedkynqvvpymageiLKFQ  335
DSSP  HHHHLHHHHHHHLLLL------LLLLEEEEELLLeelllleelllleellllllleELLE


DSSP  EEEeeelleeeellllllllllllleel
Query ISVvlidgeavvtksrntppakraakil  385
ident                             
Sbjct LKH-------------------------  338
DSSP  ELL-------------------------


No 32: Query=2vunA Sbjct=3k2gB Z-score=16.9

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ---------------------------------slselspchvrsgrixtvdgpipssal   27
DSSP  ---------------------------------llllllllllllleeeelleeeehhhl


DSSP  LEEEEEELLL-------------------------------------llleeHHHLEE--
Query GLLDTHVHVS-------------------------------------ggdyaPRQKTM--   81
ident |    | |                                                    
Sbjct GHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDLDla   87
DSSP  LLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLHHhh


DSSP  -LHHHHHHLLLEEEEEELLL--LLLLlllllhhhhhhhhhhhHHHHHHLLH-HHLEEElL
Query -DFISSALHGGVTTMISAGS--PHFPgrpkdaagtkalaitlSKSYYNARP-AGVKVHgG  137
ident           |                                          || |   
Sbjct iAEVKQFAAVGGRSIVDPTCrgIGRD----------------PVKLRRISAeTGVQVV-X  130
DSSP  hHHHHHHHHLLLLEEEELLLllLLLL----------------HHHHHHHHHhHLLEEE-E


DSSP  EELL-----------lLLLL--HHHHHHHHHL-------LLLEEEEEL----llLLLLhh
Query AVIL-----------eKGLT--EEDFIEMKKE-------GVWIVGEVG----lgTIKNpe  173
ident                                |            || |            
Sbjct GAGYylassxpetaarLSADdiADEIVAEALEgtdgtdaRIGLIGEIGvssdftAEEE--  188
DSSP  LLLLllhhhllhhhhlLLHHhhHHHHHHHHHLlllllllLLLLEEEELllllllHHHH--


DSSP  HHHHHHHHHHH-LLLEEEEELLLLllllllLLLHHHHHHHL--------lLEEELLLlll
Query DAAPMVEWAHK-HGFKVQMHTGGTsipgssTVTADDVIKTK--------pDVVSHINggp  224
ident         |    |     |  |          |  |              |  | |   
Sbjct KSLRGAARAQVrTGLPLXVHLPGW------FRLAHRVLDLVeeegadlrhTVLCHXN---  239
DSSP  HHHHHHHHHHHhHLLLEEELLLLL------LLLHHHHHHHHhhllllhhhEEELLLH---


DSSP  lLLLH--HHHHHHHHhLLLEEEE-ELLL------------LHHHHHHHHHHHHHHLLHHH
Query tAISV--QEVDRIMDeTDFAMEI-VQCG------------NPKIADYVARRAAEKGQLGR  269
ident                      |                              |  | | |
Sbjct -PSHXdpVYQATLAQ-RGAFLEFdXIGXdffyadqgvqcpSDDEVARAILGLADHGYLDR  297
DSSP  -HHLLlhHHHHHHHH-HLLEEEElLLLLlleelllleellLHHHHHHHHHHHHHLLLHHH


DSSP  EEEELLLLLLLLL------LLLHHH-HHHHHHHHHlLLLHHHHHHHHLHHHHHHHLLLll
Query VIFGNDAPSGTGL------IPLGIL-RNMCQIASMsDIDPEVAVCMATGNSTAVYGLNtg  322
ident      |      |                         |          |   |      
Sbjct ILLSHDVFVKXXLtryggnGYAFVTkHFLPRLRRH-GLDDAALETLXVTNPRRVFDAS--  354
DSSP  EEELLLLLLHHHLhhhlllLLLHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHHLLL--


DSSP  llllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllllll
Query viapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraa  382
ident                                                             
Sbjct -----------------------------------------------------------i  355
DSSP  -----------------------------------------------------------l


DSSP  eel
Query kil  385
ident    
Sbjct egh  358
DSSP  lll


No 33: Query=2vunA Sbjct=3gg7A Z-score=16.7

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELLLLLLEEhhhleeLHHHHHHLLLEeEEEELLLlllllllllhhhHHHHHHHH
Query GLLDTHVHVSGGDYAprqktmDFISSALHGGVtTMISAGSphfpgrpkdaagTKALAITL  120
ident  | | |||                         |  |               | |     
Sbjct SLIDFHVHLDLYPDP-----vAVARACEERQL-TVLSVTT------------TPAAWRGT   42
DSSP  LLEEEEELHHHLLLH-----hHHHHHHHHLLL-EEEELLL------------LHHHHHHH


DSSP  HhHHHHLLhhhLEEELlEELL-------LLLLLhHHHHHHHHlLLLEEEEEL--------
Query SkSYYNARpagVKVHGgAVIL-------EKGLTeEDFIEMKKeGVWIVGEVG--------  165
ident        |     |   |                  |          |||||        
Sbjct L-ALAAGR---PHVWT-ALGFhpevvseRAADL-PWFDRYLP-ETRFVGEVGldgspslr   95
DSSP  H-HHHLLL---LLEEE-LLLLlhhhlllLHHHL-HHHHHHHH-HLLEEEEEEllllhhhh


DSSP  lllllLHHHHHHHHHHHHHL-LLEEEEELLllllllllLLLHhHHHHHL-------LLEE
Query lgtikNPEDAAPMVEWAHKH-GFKVQMHTGgtsipgssTVTAdDVIKTK-------PDVV  217
ident                    | |     |                |               
Sbjct gtwtqQFAVFQHILRRCEDHgGRILSIHSR--------RAES-EVLNCLeanprsgTPIL  146
DSSP  hhhhhHHHHHHHHHHHHHHLlLEEEEEELL--------LLHH-HHHHHHhhlhhheEEEE


DSSP  ELLlllllLLLHHHHHHHHhHLLLEEEEELLL-LHHHHHHHHHHHhhhlLHHHEEEELLL
Query SHInggptAISVQEVDRIMdETDFAMEIVQCG-NPKIADYVARRAaekgQLGRVIFGNDA  276
ident           || |  |                         |         ||    | 
Sbjct HWY-----SGSVTELRRAI-SLGCWFSVGPTMvRTQKGAALIRSM----PRDRVLTETDG  196
DSSP  ELL-----LLLHHHHHHHH-HLLLEEEELHHHhLLHHHHHHHHHL----LHHHEEELLLL


DSSP  LLLL----LLLLLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLllllllllllllle
Query PSGT----GLIPLGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGlntgviapgkeadl  332
ident |          |               |           |     |              
Sbjct PFLEldgqAALPWDVKSVVEGLSKIWQIPASEVERIVKENVSRLLG--------------  242
DSSP  LLLEelleELLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHH--------------


DSSP  eeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query iimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                      
Sbjct ----------------------------------------------------t  243
DSSP  ----------------------------------------------------l


No 34: Query=2vunA Sbjct=2ffiA Z-score=16.2

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
ident                                                             
Sbjct ---------------------------------------------------------lhL    3
DSSP  ---------------------------------------------------------llL


DSSP  LEEEEEELLL-----------------LLLEehhhleeLHHHHHHLLLEEEEEELLLLLL
Query GLLDTHVHVS-----------------GGDYaprqktmDFISSALHGGVTTMISAGSPHF  103
ident    | | ||                             |        |            
Sbjct TAIDSHAHVFsrglnlasqrryapnydAPLG-------DYLGQLRAHGFSHGVLVQPSFL   56
DSSP  LLEELLLLLLlhhhhhhllllllllllLLHH-------HHHHHHHHLLLLEELLLLLHHH


DSSP  llllllhhhHHHHhhHHHHHHHHLLhhhlEEELlEELLLLLLLHHHHHHHHHLlLLEEEE
Query pgrpkdaagTKALaiTLSKSYYNARpagvKVHGgAVILEKGLTEEDFIEMKKEgVWIVGE  163
ident                    |            |  | ||         |     |  |  
Sbjct ---------GTDN--RYLLSALQTV--pgQLRG-VVXLERDVEQATLAEXARLgVRGVRL  102
DSSP  ---------LLLL--HHHHHHHHHL--llLLLL-LLLLLLLLLHHHHHHHHLLlLLEEEL


DSSP  EL-llllLLHH--HHHHHHHHHHHLLLEEEEELLllllllllLLLHHHHHHHL----LLE
Query VG-lgtiKNPE--DAAPMVEWAHKHGFKVQMHTGgtsipgssTVTADDVIKTK----PDV  216
ident                 |  |     |  |  |                |          |
Sbjct NLxgqdxPDLTgaQWRPLLERIGEQGWHVELHRQ-------vADIPVLVRALQpyglDIV  155
DSSP  LLlllllLLLLllLLHHHHHHHHHHLLEEEELLL-------lLLHHHHHHHHLllllLEE


DSSP  EELLllllLLLL------HHHHHHHHHHLL---LEEEEELLL--------LHHHHHHHHH
Query VSHInggpTAIS------VQEVDRIMDETD---FAMEIVQCG--------NPKIADYVAR  259
ident   |                                               |   |     
Sbjct IDHF----GRPDarrglgQPGFAELLTLSGrgkVWVKVSGIYrlqgspeeNLAFARQALC  211
DSSP  ELHH----HLLLllllllLLLHHHHLLLLLlllEEEEEELHHhllllhhhHHHHHHHHHH


DSSP  HHHhHLLH-HHEEEELLLL-LLLL--LLLL-HHHHHhHHHHhhllLLHHHHHHHHLHHHH
Query RAAeKGQL-GRVIFGNDAP-SGTG--LIPL-GILRNmCQIAsmsdIDPEVAVCMATGNST  314
ident           |   | | |                                         
Sbjct ALE-AHYGaERLXWGSDWPhTQHEseVSFGsAVEQF-EALG----CSAQLRQALLLDTAR  265
DSSP  HHH-HHLLhHHEEEELLLLlLLLLllLLHHhHHHHH-HHHL----LLHHHHHHHHLHHHH


DSSP  HHHLLLLlllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllll
Query AVYGLNTgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrn  374
ident |  |                                                        
Sbjct ALFGFEL-----------------------------------------------------  272
DSSP  HHLLLLL-----------------------------------------------------


DSSP  lllllllleel
Query tppakraakil  385
ident            
Sbjct ----------e  273
DSSP  ----------l


No 35: Query=2vunA Sbjct=2ob3A Z-score=16.2

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ---------------------------------------------drintvrgpitisea   15
DSSP  ---------------------------------------------lleeelleeelhhhh


DSSP  LEEEEEELLL-------------------lLLEEhhhleeLHHHHHHLLLEEEEEELL-L
Query GLLDTHVHVS-------------------gGDYAprqktmDFISSALHGGVTTMISAG-S  100
ident |   || |                         |           |   || |       
Sbjct GFTLTHEHICgssagflrawpeffgsrkalAEKA-----vRGLRRARAAGVRTIVDVStF   70
DSSP  LLEEEEELLEellllhhhhlhhhhllhhhhHHHH-----hHHHHHHHHLLLLEEEELLlH


DSSP  LLLllllllhhhhhhhhhhHHHHHHHLLH-HHLEEElLEELL-----------lLLLLHH
Query PHFpgrpkdaagtkalaitLSKSYYNARP-AGVKVHgGAVIL-----------eKGLTEE  148
ident                               | |     |  |                  
Sbjct DIG---------------rDVSLLAEVSRaADVHIV-AATGLwfdpplsmrlrsVEELTQ  114
DSSP  HHL---------------lLHHHHHHHHHhHLLEEE-LEEELlllllhhhhlllHHHHHH


DSSP  HHHH-HHHL------LLLEEEEEL---llLLLLhhHHHHH-HHHHHHLLLEEEEELLLll
Query DFIE-MKKE------GVWIVGEVG---lgTIKNpeDAAPM-VEWAHKHGFKVQMHTGGts  197
ident  |                |                             |  |  ||    
Sbjct FFLReIQYGiedtgiRAGIIXVATtgkatPFQE--LVLKAaARASLATGVPVTTHTAA--  170
DSSP  HHHHhHHLLllllllLLLEEEEELlllllHHHH--HHHHHhHHHHHHHLLLEEEELLH--


DSSP  lllllLLLHHHHHHHL--------LLEEELLLLlllLLLHHHHHHHHHhLLLEEEE-ELL
Query ipgssTVTADDVIKTK--------PDVVSHINGgptAISVQEVDRIMDeTDFAMEI-VQC  248
ident                              |                              
Sbjct ----sQRDGEQQAAIFeseglspsRVCIGHSDD---TDDLSYLTALAA-RGYLIGLdHIP  222
DSSP  ----hHLHHHHHHHHHhhllllhhHEEELLHHH---LLLHHHHHHHHH-LLLEEEElLLL


DSSP  L-------------------LHHHHHhHHHHHHHHLLHHHEEEELLLL------------
Query G-------------------NPKIADyVARRAAEKGQLGRVIFGNDAP------------  277
ident                         |          |        ||              
Sbjct YsaiglednasasallgirsWQTRAL-LIKALIDQGYMKQILVSNDWTfgfssyvtnimd  281
DSSP  LllllllllhhhhhhhllllHHHHHH-HHHHHHHLLLHHHEEELLLLLleellllllhhh


DSSP  ---lLLLLLLLHHH-HHHHHHHHHlLLLHHHHHHHHLHHHHHHHLlllllllllllllee
Query ---sGTGLIPLGIL-RNMCQIASMsDIDPEVAVCMATGNSTAVYGlntgviapgkeadli  333
ident             |  |             |        |                     
Sbjct vmdrVNPDGMAFIPlRVIPFLREK-GVPQETLAGITVTNPARFLS---------------  325
DSSP  hhhhHLLLHHHHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHHL---------------


DSSP  eeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query imdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                     
Sbjct ------------------------------------------------ptlr  329
DSSP  ------------------------------------------------llll


No 36: Query=2vunA Sbjct=4mupB Z-score=15.9

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                             
Sbjct --------------------------------------------lvrklsgtapnpafPR   16
DSSP  --------------------------------------------llllllllllllllLL


DSSP  LEEEEEELLLL-------lleeHHHLE----ELHHHHHHLLLEEEEEELLLLlllLLLLl
Query GLLDTHVHVSG-------gdyaPRQKT----MDFISSALHGGVTTMISAGSPhfpGRPKd  109
ident |  ||  |                        |        |    |             
Sbjct GAVDTQMHMYLpgypalpggpgLPPGAlpgpEDYRRLMQWLGIDRVIITQGN---AHQR-   72
DSSP  LLEELLLLLLLlllllllllllLLLLLlllhHHHHHHHHHHLLLEEEEELLH---HHLL-


DSSP  hhhHHHHHHHHHHHHHhllhhhlEEELlEELLLLLLLHHHHHHHHHLLLLEEEEEL--lL
Query aagTKALAITLSKSYYnarpagvKVHGgAVILEKGLTEEDFIEMKKEGVWIVGEVG--lG  167
ident                          |   ||     || |       |           |
Sbjct ---DNGNTLACVAEMG------eAAHA-VVIIDATTTEKDMEKLTAAGTVGARIMDlpgG  122
DSSP  ---LLHHHHHHHHHHH------hHEEE-EELLLLLLLHHHHHHHHHLLEEEEEEELlllL


DSSP  LLLLhHHHHHHHHHHHHLLLEEEEELLLllllllLLLL--HHHHHHHL-LLEEELLLLll
Query TIKNpEDAAPMVEWAHKHGFKVQMHTGGtsipgsSTVT--ADDVIKTK-PDVVSHINGgp  224
ident             | ||     |     |                 |     |  |     
Sbjct AVNL-SELDAVDERAHAADWMVAVQFDG------NGLLdhLPRLQKIRsRWVFDHHGK--  173
DSSP  LLLH-HHHHHHHHHHHHLLLEEEEELLH------HHHHhhHHHHHLLLlEEEELHHHH--


DSSP  lLLLH-----HHHHHHhHHLL----LEEEEEL-LLLH-------HHHHHHHHHHHhhLLH
Query tAISV-----QEVDRImDETD----FAMEIVQ-CGNP-------KIADYVARRAAekGQL  267
ident            |                                  |      ||     
Sbjct -FFKGirtdgPEMAAL-LKLIdrgnLWFKFAGvYESSrkswpyaDVAAFSRVIAA--HAP  229
DSSP  -LLLLlllllHHHHHH-HHHHhhllEEEEELLhHHLLllllllhHHHHHHHHHHH--HLH


DSSP  HHEEEELLLLLLLL------LLLL-HHHHHHHHHhhhllLLHHHHHHHHLHHHHHHHLLL
Query GRVIFGNDAPSGTG------LIPL-GILRNMCQIasmsdIDPEVAVCMATGNSTAVYGLN  320
ident  |   |   |                              |          |  |   | 
Sbjct ERIVWGTNWPHNSVretaayPDDArLAELTLGWL-----PDEAARHRALVENPEALFKLS  284
DSSP  HHEEELLLLLLLLLllhhhlLLHHhHHHHHHLLL-----LLHHHHHHHHLHHHHHHHLLL


DSSP  LLllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllll
Query TGviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakr  380
ident                                                             
Sbjct PV----------------------------------------------------------  286
DSSP  LL----------------------------------------------------------


DSSP  lleel
Query aakil  385
ident      
Sbjct -----  286
DSSP  -----


No 37: Query=2vunA Sbjct=4ofcA Z-score=15.8

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELLLL-------------------------------lleehhHLEE-----LHH
Query gLLDTHVHVSG-------------------------------gdyaprQKTM-----DFI   84
ident    | | |                                                   |
Sbjct mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvVRENcwdpeVRI   60
DSSP  lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeEEHHhllhhHHH


DSSP  HHHHLLLEEEEEElLLLLllLLLL-------LHHHHHHHHHHHHHHHHHLLhhhLEEELl
Query SSALHGGVTTMISaGSPHfpGRPK-------DAAGTKALAITLSKSYYNARpagVKVHGg  137
ident       |||                             |   |               | 
Sbjct REMDQKGVTVQAL-STVP--VMFSywakpedTLNLCQLLNNDLASTVVSYP---RRFVG-  113
DSSP  HHHHHHLLLEEEE-ELLH--HHHLllllhhhHHHHHHHHHHHHHHHHHHLL---LLEEE-


DSSP  EELLL-LLLL--HHHHHHHHHLL-LLEEEeELLLL--lLLHH-HHHHHHHHHHHLLLEEE
Query AVILE-KGLT--EEDFIEMKKEG-VWIVGeVGLGT--iKNPE-DAAPMVEWAHKHGFKVQ  190
ident    |                ||     |   |              |    |        
Sbjct LGTLPmQAPElaVKEMERCVKELgFPGVQ-IGTHVnewDLNAqELFPVYAAAERLKCSLF  172
DSSP  EELLLlLLHHhhHHHHHHHHHLLlLLEEE-EELEElleELLLhHHHHHHHHHHHHLLEEE


DSSP  EElllLLLL--------------llLLLL--HHHHHH--------hlLLEEELLLLlllL
Query MHtggTSIP--------------gsSTVT--ADDVIK--------tkPDVVSHINGgptA  226
ident  |                          |      |                |  |   |
Sbjct VH-pwDMQMdgrmakywlpwlvgmpAETTiaICSMIMggvfekfpklKVCFAHGGG---A  228
DSSP  EE-llLLLLlhhhhlllhhhhlhhhHHHHhhHHHHHLllhhhhllllLEEELHHHL---L


DSSP  LLHHH---------------------hHHHHhhLLLEEEEEllLLHHHHHHHHHHHhhhl
Query ISVQE---------------------vDRIMdeTDFAMEIVqcGNPKIADYVARRAaekg  265
ident                                    |         |              
Sbjct FPFTVgrishgfsmrpdlcaqdnpmnpKKYL--GSFYTDAL-vHDPLSLKLLTDVI----  281
DSSP  HHHHHhhhhhhhhhlhhhhlllllllhHHHL--LLLEEELL-lLLHHHHHHHHHHH----


DSSP  LHHHEEEELLLLLLLLlLLLHHhHHHHHHhhhLLLLHHHHHHHHLHHHHHHHLLLlllll
Query QLGRVIFGNDAPSGTGlIPLGIlRNMCQIasmSDIDPEVAVCMATGNSTAVYGLNtgvia  325
ident     || | | |   |                   | |       ||  |  ||      
Sbjct GKDKVILGTDYPFPLG-ELEPG-KLIESM---EEFDEETKNKLKAGNALAFLGLE-----  331
DSSP  LLLLEELLLLLLLLLL-LLLLL-HHHHHL---LLLLHHHHHHHHLHHHHHHHLLL-----


DSSP  llLLLLeeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query pgKEADliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                             
Sbjct --RKQF------------------------------------------------------  335
DSSP  --HHHL------------------------------------------------------


No 38: Query=2vunA Sbjct=2dvtA Z-score=15.6

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                             
Sbjct ----------------------------------------------------------MQ    2
DSSP  ----------------------------------------------------------LL


DSSP  LEEEEEELLL-------------llleeHHHLE-----ELHHHHHHLLLEEEEEElLLLL
Query GLLDTHVHVS-------------ggdyaPRQKT-----MDFISSALHGGVTTMISaGSPH  102
ident |      |                      |                 |  |||      
Sbjct GKVALEEHFAipetlqdsagfvpgdywkELQHRlldiqDTRLKLMDAHGIETMIL-SLNA   61
DSSP  LEEEEEEEELlhhhhhhhlllllllhhhHHHHHhhlllLHHHHHHHHLLEEEEEE-EELL


DSSP  -----llllllLHHHHHHHHHHHHHHHHHLLhhhLEEELlEELLL-LLLL--HHHHHHHH
Query -----fpgrpkDAAGTKALAITLSKSYYNARpagVKVHGgAVILE-KGLT--EEDFIEMK  154
ident                       |                    |         |      
Sbjct pavqaipdrrkAIEIARRANDVLAEECAKRP---DRFLA-FAALPlQDPDaaTEELQRCV  117
DSSP  lhhhhlllhhhHHHHHHHHHHHHHHHHHHLL---LLEEE-EELLLlLLHHhhHHHHHHHH


DSSP  HLL-LLEEEeELLLL-------lLLHHH--HHHHHHHHHHLLLEEEEElllLLLLL----
Query KEG-VWIVGeVGLGT-------iKNPED--AAPMVEWAHKHGFKVQMHtggTSIPG----  200
ident           |                     |      |       |            
Sbjct NDLgFVGAL-VNGFSqegdgqtpLYYDLpqYRPFWGEVEKLDVPFYLH--pRNPLPqdsr  174
DSSP  HLLlLLEEE-EELLLllllllllLLLLLhhHHHHHHHHHHHLLLEEEE--lLLLLHhhlh


DSSP  --------------llLLLHHHHHHH-----------LLLEEELLLLlllLLLHHHH---
Query --------------ssTVTADDVIKT-----------KPDVVSHINGgptAISVQEV---  232
ident                   ||                       |                
Sbjct iydghpwllgptwafaQETAVHALRLmasglfdehprLNIILGHMGE---GLPYMMWrid  231
DSSP  hhlllhhhlhhhlhhhHHHHHHHHHHhhllhhhhlllLLEEELHHHL---LHHHHHHhhh


DSSP  ---------------hhhHHHL--LLEEEEElLLLH-HHHHHHHHHHhhhlLHHHEEEEL
Query ---------------driMDET--DFAMEIVqCGNP-KIADYVARRAaekgQLGRVIFGN  274
ident                   ||     |                            |  |  
Sbjct hrnawvklpprypakrrfMDYFneNFHITTS-GNFRtQTLIDAILEI----GADRILFST  286
DSSP  hllllllllllllllllhHHHHhhHEEEELL-LLLLhHHHHHHHLLL----LHHHEELLL


DSSP  LLLLllLLLLLHHHHHHHHhhhhlLLLHHHHHHHHLHHHHHHHLLLllllllllllleee
Query DAPSgtGLIPLGILRNMCQiasmsDIDPEVAVCMATGNSTAVYGLNtgviapgkeadlii  334
ident | |     |                |     |     |      |               
Sbjct DWPF--ENIDHASDWFNAT-----SIAEADRVKIGRTNARRLFKLD--------------  325
DSSP  LLLL--LLHHHHHHHHHHL-----LLLHHHHHHHHLHHHHHHLLLL--------------


DSSP  eelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query mdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                    
Sbjct ---------------------------------------------------  325
DSSP  ---------------------------------------------------


No 39: Query=2vunA Sbjct=2vc5A Z-score=15.4

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct --------------------------------------------mriplvgkdsieskdi   16
DSSP  --------------------------------------------llllllllllllhhhl


DSSP  LEEEEEELLL------------------lLLEEhhhleELHHHHHHLLLEEEEEELL-LL
Query GLLDTHVHVS------------------gGDYAprqktMDFISSALHGGVTTMISAG-SP  101
ident |    | |                        |           |   || |        
Sbjct GFTLIHEHLRvfseavrqqwphlynedeeFRNA-----VNEVKRAMQFGVKTIVDPTvMG   71
DSSP  LLEELLLLLLlllhhhhhhlhhhllhhhhHHHH-----HHHHHHHHHLLLLEEEELLlLL


DSSP  LLllllllhhhhhhhhhHHHHHHHHLL-hHHLEEElLEELL-------------lLLLLH
Query HFpgrpkdaagtkalaiTLSKSYYNAR-pAGVKVHgGAVIL-------------eKGLTE  147
ident                               |                             
Sbjct LG---------------RDIRFMEKVVkaTGINLV-AGTGIyiyidlpfyflnrsIDEIA  115
DSSP  LL---------------LLHHHHHHHHhlLLLEEE-ELEELlllllllhhhllllHHHHH


DSSP  HHHHHHHHL-------LLLEEEEEL----llLLLLhhHHHHHHHHHHH-LLLEEEEELLL
Query EDFIEMKKE-------GVWIVGEVG----lgTIKNpeDAAPMVEWAHK-HGFKVQMHTGG  195
ident   ||   ||           |                        | |        |   
Sbjct DLFIHDIKEgiqgtlnKAGFVXIAAdepgitKDVE--KVIRAAAIANKeTKVPIITHSNA  173
DSSP  HHHHHHHHLlllllllLLLLEEEELllllllHHHH--HHHHHHHHHHHhHLLLEEEELLL


DSSP  LlllllLLLLHHHHHHHL-------lLEEELLLLlllLLLHHHHHHHHHhLLLEEEEELL
Query TsipgsSTVTADDVIKTK-------pDVVSHINGgptAISVQEVDRIMDeTDFAMEIVQC  248
ident                               |               | |           
Sbjct H-----NNTGLEQQRILTeegvdpgkILIGHLGD---TDNIDYIKKIAD-KGSFIGLDRY  224
DSSP  L-----LLHHHHHHHHHHhllllhhhEEELLHHH---LLLHHHHHHHHH-LLLEEEELLL


DSSP  ---------lLHHHHHHHHHHHhhhlLHHHEEEELLLL----------------lLLLLL
Query ---------gNPKIADYVARRAaekgQLGRVIFGNDAP----------------sGTGLI  283
ident                                    |                       |
Sbjct gldlflpvdkRNETTLRLIKDG----YSDKIMISHDYCctidwgtakpeykpklaPRWSI  280
DSSP  lllllllhhhHHHHHHHHHHLL----LLLLEEELLLLLlllllllllhhhhhhhlLLLLL


DSSP  lLHHH-HHHHHHHHHlLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeellllll
Query pLGIL-RNMCQIASMsDIDPEVAVCMATGNSTAVYGlntgviapgkeadliimdtplgsv  342
ident    |                ||       |                              
Sbjct -TLIFeDTIPFLKRN-GVNEEVIATIFKENPKKFFS------------------------  314
DSSP  -LHHHhLHHHHHHLL-LLLHHHHHHHHLHHHHHHLL------------------------


DSSP  lllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query aedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                            
Sbjct -------------------------------------------  314
DSSP  -------------------------------------------


No 40: Query=2vunA Sbjct=4hk5D Z-score=15.3

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                           ||
Sbjct ----------------------------------------------------------TP    2
DSSP  ----------------------------------------------------------LL


DSSP  LEEEEEELLLL-----------------------------------------------ll
Query GLLDTHVHVSG-----------------------------------------------gd   73
ident    | | |                                                    
Sbjct VVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklp   62
DSSP  LLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllll


DSSP  eehHHLE----ELHHHHHHLLLEEEEEElLLLL----llllllLHHHHHHHHHHHHHHHH
Query yapRQKT----MDFISSALHGGVTTMISaGSPH----fpgrpkDAAGTKALAITLSKSYY  125
ident                      |                           |     |    
Sbjct grpLSTHfaslAQKMHFMDTNGIRVSVI-SLANpwfdflapdeAPGIADAVNAEFSDMCA  121
DSSP  leeLLHHhllhHHHHHHHHHLLLLEEEE-EELLllllllllllHHHHHHHHHHHHHHHHH


DSSP  HLLhhhLEEELlEELLLLL----LLHHHHHHHHHLL-LLEEEEELlllllLHHH--HHHH
Query NARpagVKVHGgAVILEKG----LTEEDFIEMKKEG-VWIVGEVGlgtikNPED--AAPM  178
ident                |                |                    |    | 
Sbjct QHV---GRLFF-FAALPLSapvdAVKASIERVKNLKyCRGIILGTsglgkGLDDphLLPV  177
DSSP  LLL---LLEEE-EEELLLLllhhHHHHHHHHHHLLLlEEEEEELLlllllLLLLhhHHHH


DSSP  HHHHHHLLLEEEEELllLLLLL-------------------llLLLHHHHHHH-------
Query VEWAHKHGFKVQMHTggTSIPG-------------------ssTVTADDVIKT-------  212
ident  |        |  |      |                        |   |          
Sbjct FEAVADAKLLVFLHP-hYGLPNevygprseeyghvlplalgfpMETTIAVARMymagvfd  236
DSSP  HHHHHHLLLEEEELL-lLLLLHhhhlllhhhlllhhhhhlhhhHHHHHHHHHHhhllhhh


DSSP  ----LLLEEELLLLlllLLLHHHH---------------------hhhhHHLL---LEEE
Query ----KPDVVSHINGgptAISVQEV---------------------drimDETD---FAME  244
ident           |  |                                              
Sbjct hvrnLQMLLAHSGG---TLPFLAGriescivhdghlvktgkvpkdrrtiWTVLkeqIYLD  293
DSSP  hlllLLEEEHHHHL---LHHHHHHhhhhhhhllhhhhhllllllllllhHHHHhhlEEEE


DSSP  EEllLLHHHHHHHHHHHhhhlLHHHEEEELLLLLLL------llLLLHHHHHHHHHHHHl
Query IVqcGNPKIADYVARRAaekgQLGRVIFGNDAPSGT------glIPLGILRNMCQIASMs  298
ident  |                      |  || | |                  |        
Sbjct AV-iYSEVGLQAAIASS----GADRLMFGTDHPFFPpieedvqgPWDSSRLNAQAVIKA-  347
DSSP  LL-lLLHHHHHHHHHHH----LHHHEELLLLLLLLLllllllllLLHHHHHHHHHHHHH-


DSSP  lLLHH--HHHHHHLHHHHHHHLLLllllllLLLLleeeeelllllllllhhhhhhhllll
Query dIDPE--VAVCMATGNSTAVYGLNtgviapGKEAdliimdtplgsvaedamgaiaagdip  356
ident         |      |   |  |                                     
Sbjct -VGEGssDAAAVMGLNAVRVLSLK------AELE--------------------------  374
DSSP  -HLLLlhHHHHHHLHHHHHHLLLH------HHHH--------------------------


DSSP  eeeeeeELLEEeellllllllllllleel
Query gisvvlIDGEAvvtksrntppakraakil  385
ident                              
Sbjct -----hHHHHH------------------  380
DSSP  -----hHHHHL------------------


No 41: Query=2vunA Sbjct=4qrnA Z-score=14.6

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeellllEEEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagsTVTP   60
ident                                                             
Sbjct ----------------------------------------------smtqdlktggEQGY   14
DSSP  ----------------------------------------------llllllllllLLLL


DSSP  LEEEEEELLL---------------------------------------------LLLEe
Query GLLDTHVHVS---------------------------------------------GGDYa   75
ident     |                                                   |   
Sbjct LRIATEEAFAtreiidvylrmirdgtadkgmvslwgfyaqspseratqilerlldLGER-   73
DSSP  LLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhhlLLHH-


DSSP  hhhleelHHHHHHLLLEEEEEElLLLL-----llllllLHHHHHHHHHHHHHHHHHLLhh
Query prqktmdFISSALHGGVTTMISaGSPH-----fpgrpkDAAGTKALAITLSKSYYNARpa  130
ident         |      |    |                           ||          
Sbjct -------RIADMDATGIDKAIL-ALTSpgvqplhdldeARTLATRANDTLADACQKYP--  123
DSSP  -------HHHHHHHLLLLEEEE-EELLllllllllhhhHHHHHHHHHHHHHHHHHHLL--


DSSP  hLEEELlEELLL-LLLL--HHHHHHHHHLL-LLEEEEELlllllLHHH--HHHHHHHHHH
Query gVKVHGgAVILE-KGLT--EEDFIEMKKEG-VWIVGEVGlgtikNPED--AAPMVEWAHK  184
ident      |                      |                       |       
Sbjct -DRFIG-MGTVApQDPEwsAREIHRGARELgFKGIQINShtqgrYLDEefFDPIFRALVE  181
DSSP  -LLEEE-LLLLLlLLHHhhHHHHHHHHHLLlLLLEEELLlllllLLLLhhHHHHHHHHHH


DSSP  LLLEEEEELllLLLLLLL----------------LLLHHHHHHH-----------lLLEE
Query HGFKVQMHTggTSIPGSS----------------TVTADDVIKT-----------kPDVV  217
ident        |   ||                       |                      |
Sbjct VDQPLYIHP-aTSPDSMIdpmleagldgaifgfgVETGMHLLRLitigifdkypslQIMV  240
DSSP  HLLLEEELL-lLLLLLLLhhhhhhlllllllhhhHHHHHHHHHHhhhlhhhhllllLEEE


DSSP  ELLllllllllhHHHHH-------------------------hhHHLL---LEEEEElLL
Query SHInggptaisvQEVDR-------------------------imDETD---FAMEIVqCG  249
ident  |                                                          
Sbjct GHM-------geALPYWlyrldymhqagvrsqryermkplkktiEGYLksnVLVTNS-GV  292
DSSP  LHH-------hhLHHHHhhhhhhhhhhhhhlllllllllllllhHHHHhhlEEEELL-LL


DSSP  LH-HHHHHHHHHHhhhlLHHHEEEELLLLLllLLLLLHHHHHHHHhhhhlLLLHHHHHHH
Query NP-KIADYVARRAaekgQLGRVIFGNDAPSgtGLIPLGILRNMCQiasmsDIDPEVAVCM  308
ident                     ||    | |                     |         
Sbjct AWePAIKFCQQVM----GEDRVMYAMDYPY--QYVADEVRAMDAM-----DMSAQTKKKF  341
DSSP  LLhHHHHHHHHHH----LHHHEELLLLLLL--LLLHHHHHHHHLL-----LLLHHHHHHH


DSSP  HLHHHHHHHLLlllllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleee
Query ATGNSTAVYGLntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeav  368
ident    |      |                                                 
Sbjct FQTNAEKWFKL-------------------------------------------------  352
DSSP  HLHHHHHHLLL-------------------------------------------------


DSSP  ellllllllllllleel
Query vtksrntppakraakil  385
ident                  
Sbjct -----------------  352
DSSP  -----------------


No 42: Query=2vunA Sbjct=1itqA Z-score=14.6

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleEEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstVTP   60
ident                                                             
Sbjct ----------------------------------------------dffrdeaerimRDS   14
DSSP  ----------------------------------------------lhhhhhhhhhhLLL


DSSP  LEEEEEEL-LLLL-----------leehhhLEEL-HHHH-HHLLLEEEEEELLLLLlllL
Query GLLDTHVH-VSGG-----------dyaprqKTMD-FISS-ALHGGVTTMISAGSPHfpgR  106
ident    | |                                     | |              
Sbjct PVIDGHNDlPWQLldmfnnrlqderanlttLAGThTNIPkLRAGFVGGQFWSVYTP--cD   72
DSSP  LEEEEEELhHHHHhhhhllllllhhhllllLLLLlLLHHhHHHLLEEEEEEEELLL--hH


DSSP  LLLhhHHHHHHHHHHHHHHHLL---------------------hhHLEEELlEELLL-lL
Query PKDaaGTKALAITLSKSYYNAR---------------------paGVKVHGgAVILE-kG  144
ident                                               |             
Sbjct TQN-kDAVRRTLEQMDVVHRMCrmypetflyvtssagirqafregKVASLIgVEGGHsiD  131
DSSP  HLL-lLHHHHHHHHHHHHHHHHhhlllleeelllhhhhhhhhhllLEEEEEeEELHHhlL


DSSP  LLHHHHHHHHHLLLLEEeEELL---LLLL---------------LHHH-HHHHHHHHHHL
Query LTEEDFIEMKKEGVWIVgEVGL---GTIK---------------NPED-AAPMVEWAHKH  185
ident             |                                        |      
Sbjct SSLGVLRALYQLGMRYL-TLTHscnTPWAdnwlvdtgdsepqsqGLSPfGQRVVKELNRL  190
DSSP  LLHHHHHHHHHLLEEEE-ELLLlllLLLLllhhhllllllllllLLLHhHHHHHHHHHHH


DSSP  LLEEEEELllllllllllLLHHHHHHHL-----lLEEELLLllllLLLHH-----hHHHH
Query GFKVQMHTggtsipgsstVTADDVIKTK-----pDVVSHINggptAISVQ-----eVDRI  235
ident |                 |       |          ||      | ||        |  
Sbjct GVLIDLAH----------VSVATMKATLqlsrapVIFSHSS----AYSVCasrrnvPDDV  236
DSSP  LLEEELLL----------LLHHHHHHHHhhllllLEELLLL----LLLLLllllllLHHH


DSSP  HHH---LLLEEEEELL-------------lLHHHHHHHHHHHhhhlLHHHEEEELLLL-L
Query MDE---TDFAMEIVQC-------------gNPKIADYVARRAaekgQLGRVIFGNDAP-S  278
ident       ||                           |     |        | || |    
Sbjct LRLvkqTDSLVMVNFYnnyisctnkanlsqVADHLDHIKEVA----GARAVGFGGDFDgV  292
DSSP  HHHhhhHLLEEEELLLhhhhlllllllhhhHHHHHHHHHHHL----LHHHEEELLLLLlL


DSSP  LLL----LLLLHHHHHHHHHHHHlLLLHHHHHHHHLHHHHHHHLllllllllllllleee
Query GTG----LIPLGILRNMCQIASMsDIDPEVAVCMATGNSTAVYGlntgviapgkeadlii  334
ident                                      |   |                  
Sbjct PRVpeglEDVSKYPDLIAELLRR-NWTEAEVKGALADNLLRVFE----------------  335
DSSP  LLLllllLLLLLHHHHHHHHHHL-LLLHHHHHHHHLHHHHHHHH----------------


DSSP  eelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query mdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                    
Sbjct -----------------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  -----------------hhhhllllllllllllllhhhlllllllllllll


No 43: Query=2vunA Sbjct=1a4mA Z-score=14.3

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                             
Sbjct ------------------------------------------------------tpafNK    6
DSSP  ------------------------------------------------------llllLL


DSSP  LEEEEEELLL--------------------------------------------------
Query GLLDTHVHVS--------------------------------------------------   70
ident      |||                                                    
Sbjct PKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyym   66
DSSP  LEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhh


DSSP  -------------LLLEehhhleelhHHHHHLLLEEEEEELLLllllLLLL---------
Query -------------GGDYaprqktmdfISSALHGGVTTMISAGSphfpGRPK---------  108
ident                                  ||       |                 
Sbjct pviagcreaikriAYEF---------VEMKAKEGVVYVEVRYS--phLLANskvdpmpwn  115
DSSP  hhhlllhhhhhhhHHHH---------HHHHHHLLEEEEEEEEL--lhHHLLllllllhhh


DSSP  ---lhhHHHHHHHHHHHHHHHLLH-HHLEEELlEELL---LLLLLHHHHHHHHHLL---L
Query ---daaGTKALAITLSKSYYNARP-AGVKVHGgAVIL---EKGLTEEDFIEMKKEG---V  158
ident                           | ||                |     ||     |
Sbjct qtegdvTPDDVVDLVNQGLQEGEQaFGIKVRS-ILCCmrhQPSWSLEVLELCKKYNqktV  174
DSSP  llllllLHHHHHHHHHHHHHHHHHhHLLEEEE-EEEEellLHHHHHHHHHHHHHLLlllE


DSSP  LEEeEELL--llllLHHH--HHHHHHHHHHLLLEEEEELLLLlllllLLLL-HHHHHH-H
Query WIVgEVGL--gtikNPED--AAPMVEWAHKHGFKVQMHTGGTsipgsSTVT-ADDVIK-T  212
ident                          | | | |     | |                    
Sbjct VAM-DLAGdetiegSSLFpgHVEAYEGAVKNGIHRTVHAGEV-----GSPEvVREAVDiL  228
DSSP  EEE-EEELllllllHHHLhhHHHHHHHHHHHLLEEEEEELLL-----LLHHhHHHHHHlL


DSSP  LLLEEELLLllllLLLHH--HHHHHHHhLLLEEEEE-LLLL---------hHHHHHHHHH
Query KPDVVSHINggptAISVQ--EVDRIMDeTDFAMEIV-QCGN---------pKIADYVARR  260
ident |   | |                |         |                          
Sbjct KTERVGHGY----HTIEDeaLYNRLLK-ENMHFEVCpWSSYltgawdpkttHAVVRFKND  283
DSSP  LLLEEEELH----HHHHLhhHHHHHHH-LLLEEEELhHHHHhlllllllllLHHHHHHHL


DSSP  HhhhllhhHEEEELLLLLLLLLLllhHHHHHHHHHHHLLLLHHHHHHHhLHHHHHHH---
Query AaekgqlgRVIFGNDAPSGTGLIplgILRNMCQIASMSDIDPEVAVCMaTGNSTAVY---  317
ident               | |                         |        |        
Sbjct K------aNYSLNTDDPLIFKST---LDTDYQMTKKDMGFTEEEFKRL-NINAAKSSflp  333
DSSP  L------lLEEELLLLLLLLLLL---HHHHHHHHHHLLLLLHHHHHHH-HHHHHHLLlll


DSSP  ---LLLLL--LLLLllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelll
Query ---GLNTG--VIAPgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtks  372
ident                                                             
Sbjct eeeKKELLerLYRE----------------------------------------------  347
DSSP  hhhHHHHHhhHHHH----------------------------------------------


DSSP  lllllllllleel
Query rntppakraakil  385
ident              
Sbjct -----------yq  349
DSSP  -----------ll


No 44: Query=2vunA Sbjct=2gwgA Z-score=14.3

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELLL-------------------------------------LLLEehhhleELH
Query GLLDTHVHVS-------------------------------------GGDYaprqktMDF   83
ident    | | |                                                    
Sbjct XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkisddelqASII------ENQ   54
DSSP  LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHH------LLH


DSSP  HHHHHLLLEEEEEElLLLLllllllLHHHHHHHHHHHHHHHHHLLhhhLEEELlEELLLL
Query ISSALHGGVTTMISaGSPHfpgrpkDAAGTKALAITLSKSYYNARpagVKVHGgAVILEK  143
ident        |                                            | |  |  
Sbjct LKKXQERGSDLTVF-SPRA-gdfnvSSTWAAICNELCYRVSQLFP---DNFIG-AAXLPQ  108
DSSP  HHHHHHHLLLEEEE-ELLL-llhhhHHHHHHHHHHHHHHHHHHLL---LLEEE-EEELLL


DSSP  L------LLHHHHHHHHHLL-LLEEEEeLLLL-------lLLHH-HHHHHHHHHHHLLLE
Query G------LTEEDFIEMKKEG-VWIVGEvGLGT-------iKNPE-DAAPMVEWAHKHGFK  188
ident                  ||                             |  |        
Sbjct SpgvdpkTCIPELEKCVKEYgFVAINL-NPDPsgghwtspPLTDrIWYPIYEKXVELEIP  167
DSSP  LllllhhHHHHHHHHHHHLLlLLEEEE-LLLLllllllllLLLLhHHHHHHHHHHHHLLL


DSSP  EEEE-----lLLLLlllllLLLHHH-------hhhhLLLEEELLLLlllLLLHHH-----
Query VQMH-----tGGTSipgssTVTADD-------viktKPDVVSHINGgptAISVQE-----  231
ident    |               |                   |  |  |   |          
Sbjct AXIHvstgahYLNA---dtTAFXQCvagdlfkdfpeLKFVIPHGGG---AVPYHWgrfrg  221
DSSP  EEELlllllhHHHH---hhHHHHHHhhllhhhhlllLLEEELHHHL---LLHHHHhhhhh


DSSP  ------hhhhHHHLL--LEEEEELlLLHHHHHHHHHHHhhhlLHHHEEEELLLLLLLL--
Query ------vdriMDETD--FAMEIVQcGNPKIADYVARRAaekgQLGRVIFGNDAPSGTG--  281
ident            |                   |              | |           
Sbjct laqexkkpllEDHVLnnIFFDTCV-YHQPGIDLLNTVI----PVDNVLFASEXIGAVRgi  276
DSSP  hhhhlllllhHHHLLllEEEELLL-LLHHHHHHHHHHL----LHHHEELLLLLLLLLLle


DSSP  -----llllHHHHHHHHHhhhLLLLHHHHHHHHLHHHHHHH--LLLLllllllLLLLeee
Query -----liplGILRNMCQIasmSDIDPEVAVCMATGNSTAVY--GLNTgviapgKEADlii  334
ident             |            ||       ||   ||            |      
Sbjct dprtgfyydDTKRYIEAS---TILTPEEKQQIYEGNARRVYprLDAA-----lKAKG---  325
DSSP  elllleellLLHHHHHHL---LLLLHHHHHHHHLHHHHHHLhhHHHH-----hHHHH---


DSSP  eelllllllllhhhhhhhlllleeeeeeeLLEEeellllllllllllleel
Query mdtplgsvaedamgaiaagdipgisvvliDGEAvvtksrntppakraakil  385
ident                                |                   
Sbjct -----------------------------KLEH------------------  329
DSSP  -----------------------------HHLL------------------


No 45: Query=2vunA Sbjct=1v77A Z-score=14.2

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
ident                                                             
Sbjct -----------------------------------------------------------V    1
DSSP  -----------------------------------------------------------L


DSSP  LEEEEEELLLllleehhhleeLHHHHHHLLlEEEEEELLLlllllllllhhhHHHHHHHH
Query GLLDTHVHVSggdyaprqktmDFISSALHGgVTTMISAGSphfpgrpkdaagTKALAITL  120
ident                           |                          |      
Sbjct KFIEMDIRDK-----------EAYELAKEW-FDEVVVSIK-------fneevDKEKLREA   42
DSSP  LLEEEEELLH-----------HHHHHHHHH-LLEEEEEEE-------ellllLHHHHHHH


DSSP  HHHHhhllhhhleeELLEelllllllhhhhhhhhhlllleeEEELllllLLHHHHHHHHH
Query SKSYynarpagvkvHGGAvilekglteedfiemkkegvwivGEVGlgtiKNPEDAAPMVE  180
ident  | |             |                                 |      | 
Sbjct RKEY----------GKVA-----------------------ILLS---nPKPSLVRDTVQ   66
DSSP  HHHH----------LLEE-----------------------EEEE---lLLHHHHHHHHH


DSSP  HHHhlLLEEEEELLllllllllllLHHHHHHH---LLLEEELLLLlllLLLHHHHH-HHH
Query WAHkhGFKVQMHTGgtsipgsstvTADDVIKT---KPDVVSHINGgptAISVQEVD-RIM  236
ident                                      |                 |    
Sbjct KFK--SYLIYVESN----------DLRVIRYSiekGVDAIISPWV---NRKDPGIDhVLA  111
DSSP  HLL--LLEEEEELL----------LHHHHHHHhhlLLLEEELLLL---LLLLLLLLhHHH


DSSP  HHL---LLEEEEELLL-----------LHHHHHHHHHHHHHHLLhhHEEEELLLLLllLL
Query DET---DFAMEIVQCG-----------NPKIADYVARRAAEKGQlgRVIFGNDAPSgtGL  282
ident         |                                     |      |      
Sbjct KLMvkkNVALGFSLRPllysnpyeranLLRFMMKAWKLVEKYKV--RRFLTSSAQE--KW  167
DSSP  HHHhhhLLEEEEELHHhhhllhhhhhhHHHHHHHHHHHHHHHLL--LEEEELLLLL--HH


DSSP  LLLHHHHHHHHHHhHLLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeellllll
Query IPLGILRNMCQIAsMSDIDPEVAVCMATGNSTAVYGlntgviapgkeadliimdtplgsv  342
ident                       |                                     
Sbjct DVRYPRDLISLGV-VIGMEIPQAKASISMYPEIILK------------------------  202
DSSP  HLLLHHHHHHHHH-HLLLLHHHHHHLLLHHHHHHHL------------------------


DSSP  lllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query aedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                            
Sbjct -------------------------------------------  202
DSSP  -------------------------------------------


No 46: Query=2vunA Sbjct=2qpxA Z-score=14.2

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                             
Sbjct ------------------------------------------------gxddlsefvdQV   12
DSSP  ------------------------------------------------lllllhhhhhHL


DSSP  LEEEEEELLLL-----lleeHHHL------------------------------------
Query GLLDTHVHVSG-----gdyaPRQK------------------------------------   79
ident  ||| | |                                                    
Sbjct PLLDHHCHFLIdgkvpnrddRLAQvsteadkdypladtknrlayhgflalakefaldann   72
DSSP  LEEEEEELLLLllllllhhhHHHHhlllllllllhhhhlllhhhhhhhhhhhhhllllll


DSSP  ----------eeLHHHHHHLLLEEEEEELLLLLLLLllllhhhhhhhhhhhhhHHHHLL-
Query ----------tmDFISSALHGGVTTMISAGSPHFPGrpkdaagtkalaitlskSYYNAR-  128
ident                    |                                        
Sbjct plaaxndpgyatYNHRIFGHFHFKELLIDTGFVPDD--------------pilDLDQTAe  118
DSSP  llllllhhhhhhHHHHHHHHLLEEEEEEELLLLLLL--------------lllLHHHHHh


DSSP  HHHLEEElLEELL---LLLL-------------LHHHHHHHHHLLLLEEeEELL------
Query PAGVKVHgGAVIL---EKGL-------------TEEDFIEMKKEGVWIVgEVGL------  166
ident   |  |      |                       |    |  |               
Sbjct LVGIPVK-AIYRLethAEDFxlehdnfaawwqaFSNDVKQAKAHGFVGF-XSIAayrvgl  176
DSSP  HHLLLEE-EEEEHhhhHHHHhlllllhhhhhhhHHHHHHLLLLLLLLLE-EELHhhhlll


DSSP  --------------------------llllLHHHHHHHHHHHHHLLLEEEEELLLLLLLL
Query --------------------------gtikNPEDAAPMVEWAHKHGFKVQMHTGGTSIPG  200
ident                                                  | | |      
Sbjct hlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGDADT  236
DSSP  llllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLLLLL


DSSP  LL--LLLHHHhHHHL--------LLEEELLLllllLLLHhHHHHHHHHLL-LEEEEE--L
Query SS--TVTADDvIKTK--------PDVVSHINggptAISVqEVDRIMDETD-FAMEIV--Q  247
ident                          |  |           |              |    
Sbjct DXylGNPLLX-RDYLkaftkkglKVVLLHCY----PYHR-EAGYLASVFPnLYFDISllD  290
DSSP  LHhhLLHHHH-HHHHhhhhhhllLEEEEELL----LLHH-HHHHHHHHLLlEEEELLlhH


DSSP  LLL----HHHHHHHHHHHhhhlLHHHEEEELLLLlllLLLLLHHHHHHHHHhHHLL----
Query CGN----PKIADYVARRAaekgQLGRVIFGNDAPsgtGLIPLGILRNMCQIaSMSD----  299
ident                  |       |  |  ||        |                  
Sbjct NLGpsgaSRVFNEAVELA----PYTRILFASDAStypEXYGLAARQFKQAL-VAHFnqlp  345
DSSP  HHLhhhhHHHHHHHLLLL----LHHHEELLLLLLllhHHHHHHHHHHHHHH-HHHHhlll


DSSP  -----lLHHHHHHHHLHHHHHHHLL-LLLLLllllllleeeeelllllllllhhhhhhhl
Query -----iDPEVAVCMATGNSTAVYGL-NTGVIapgkeadliimdtplgsvaedamgaiaag  353
ident                   |   |                                     
Sbjct fvdlaqKKAWINAICWQTSAKLYHQeRELRV-----------------------------  376
DSSP  lllhhhHHHHHHHHHLHHHHHHLLLhHHHLL-----------------------------


DSSP  llleeeeeeelleeeellllllllllllleel
Query dipgisvvlidgeavvtksrntppakraakil  385
ident                                 
Sbjct --------------------------------  376
DSSP  --------------------------------


No 47: Query=2vunA Sbjct=3qy6A Z-score=14.1

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELLLL--------LLEEhhhleeLHHHHHHLLLEEEEEELLLllllLLLLlhhh
Query gLLDTHVHVSG--------GDYAprqktmDFISSALHGGVTTMISAGSphfpGRPKdaag  112
ident    | | |                          |   |  | |        |  |    
Sbjct -MIDIHCHILPamddgagdSADS-----iEMARAAVRQGIRTIIATPH-hnnGVYK---n   50
DSSP  -LEELLLLLLLllllllllHHHH-----hHHHHHHHHLLLLEEELLLE-ellLLLL---l


DSSP  HHHHHHHHHHHHHHLL---hHHLEeELLEelllllllhhhhhhhhhlllleeEEELllll
Query TKALAITLSKSYYNAR---pAGVKvHGGAvilekglteedfiemkkegvwivGEVGlgti  169
ident   |                                                  |      
Sbjct EPAAVREAADQLNKRLikedIPLH-VLPG-----------------------QEIR----   82
DSSP  LHHHHHHHHHHHHHHHhhllLLLE-EELL-----------------------LEEE----


DSSP  LLHHhHHHHHHHH----hhlLLEEEEELLLllllllLLLLhHHHHHHL--------LLEE
Query KNPEdAAPMVEWA----hkhGFKVQMHTGGtsipgsSTVTaDDVIKTK--------PDVV  217
ident    |                                  |                   | 
Sbjct IYGE-VEQDLAKRqllslndTKYILIEFPF------DHVP-RYAEQLFydlqlkgyIPVI  134
DSSP  LLLL-HHHHHHLLllllhhhLLEEEEELLL------LLLL-LLHHHHHhhhhhlllEEEE


DSSP  ELLLLllLLLL---HHHHHHHHHHLlLEEEEELLL--------LHHHHHHHHHHHhhhll
Query SHINGgpTAIS---VQEVDRIMDETdFAMEIVQCG--------NPKIADYVARRAaekgq  266
ident  |                         |  |                             
Sbjct AHPER--NREIrenPSLLYHLVEKG-AASQITSGSlagifgkqLKAFSLRLVEAN-----  186
DSSP  ELHHH--LHHHhhlLHHHHHHHHLL-LEEEEEHHHhlllllhhHHHHHHHHHHLL-----


DSSP  hhHEEEELLLLL-lLLLLllHHHHHHHHHHHHllLLHHHHHHHhLHHHHHHHLLLlllll
Query lgRVIFGNDAPS-gTGLIplGILRNMCQIASMsdIDPEVAVCMaTGNSTAVYGLNtgvia  325
ident         ||    |                      |      | |             
Sbjct -lIHFVASDAHNvkTRNF--HTQEALYVLEKE--FGSELPYML-TENAELLLRNQ-----  235
DSSP  -lLLEEELLLLLllLLLL--LHHHHHHHHHHH--HLLHHHHHH-HHHHHHHHLLL-----


DSSP  lllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query pgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                             
Sbjct ------------------------------------------------tifrqppqpvkr  247
DSSP  ------------------------------------------------llllllllllll


No 48: Query=2vunA Sbjct=4dziC Z-score=13.5

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeellllEEEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagsTVTP   60
ident                                                             
Sbjct --------------------------------------------------------ALNY    4
DSSP  --------------------------------------------------------LLLL


DSSP  LEEEEEELLLL-------------------------------------------------
Query GLLDTHVHVSG-------------------------------------------------   71
ident    |   |                                                    
Sbjct RVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiiv   64
DSSP  LEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllllleel


DSSP  ---------------------lleehhhLEEL------HHHHHHLLLEEEEEELlLLLLL
Query ---------------------gdyaprqKTMD------FISSALHGGVTTMISAgSPHFP  104
ident                                        |         |          
Sbjct pgcldllfrgeipdgvdpaslmkverlaDHPEyqnrdaRIAVMDEQDIETAFML-PTFGC  123
DSSP  llllhhhhhllllllllhhhllleelhhHLHHhllhhhHHHHHHHHLEEEEEEE-LLHHH


DSSP  LL--------llLHHHHHHHHHHHHHHHHhllhhHLEEELlEELL-LLLL--LHHHHHHH
Query GR--------pkDAAGTKALAITLSKSYYnarpaGVKVHGgAVIL-EKGL--TEEDFIEM  153
ident |             |   |    |                 | |          |     
Sbjct GVeealkhdieaTMASVHAFNLWLDEDWG-fdrpDHRIIA-APIVsLADPtrAVEEVDFV  181
DSSP  HHhhhllllhhhHHHHHHHHHHHHHHHLL-llllLLLEEE-LLLLlLLLHhhHHHHHHHH


DSSP  HHLLLLEEeEELL------llllLHHH--hHHHHHHHHHLLLEEEEELllLLLLL-----
Query KKEGVWIVgEVGL------gtikNPED--aAPMVEWAHKHGFKVQMHTggTSIPG-----  200
ident    |   |  |               |    |        |  |  |             
Sbjct LARGAKLV-LVRPapvpglvkprSLGDrshDPVWARLAEAGVPVGFHLsdSGYLHiaaaw  240
DSSP  HHLLLLLE-ELLLllllllllllLLLLhhhHHHHHHHHHHLLLEEEELllLLLHHhhhhl


DSSP  ------------llLLLHHHHHHH-----------lLLEEELLLlllllllhhHHHHH--
Query ------------ssTVTADDVIKT-----------kPDVVSHINggptaisvqEVDRI--  235
ident                   |                   |               | |   
Sbjct ggakdpldqvllddRAIHDTMASMivhgvftrhpklKAVSIENG-------syFVHRLik  293
DSSP  lllllhhhhhhhllHHHHHHHHHHhhllhhhhllllLEEEELLL-------llHHHHHhh


DSSP  -----------------hHHLL--LEEEEellLLHHhhhhHHHHHHHHLLHHHEEEELLL
Query -----------------mDETD--FAMEIvqcGNPKiadyVARRAAEKGQLGRVIFGNDA  276
ident                                              |         || | 
Sbjct rlkkaantqpqyfpedpvEQLRnnVWIAP---YYED----DLPELARVIGVDKILFGSDW  346
DSSP  hhhhhhhhlhhhllllhhHHHHhhEEELL---LLLL----LHHHHHHHHLHHHLLLLLLL


DSSP  LLLLllLLLHhHHHHHHHHhhlLLLHHHHHHHHLHHHHHHHLLLllllllllllleeeee
Query PSGTglIPLGiLRNMCQIAsmsDIDPEVAVCMATGNSTAVYGLNtgviapgkeadliimd  336
ident | |                                |     |                  
Sbjct PHGE-gLASP-VSFTAELK---GFSESDIRKIMRDNALDLLGVQ----------------  385
DSSP  LLLL-lLLLH-HHHHHHHL---LLLHHHHHHHHLHHHHHHHLLL----------------


DSSP  lllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query tplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                  
Sbjct ----------------------------------------------vgs  388
DSSP  ----------------------------------------------lll


No 49: Query=2vunA Sbjct=1j5sA Z-score=12.4

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
ident                                                             
Sbjct -----------------------------------hmflgedylltnraavrlfnevkDL   25
DSSP  -----------------------------------llllllllllllhhhhhhhhhhlLL


DSSP  LEEEEEELLLLLLE-------------eHHHL----------------------------
Query GLLDTHVHVSGGDY-------------aPRQK----------------------------   79
ident    | | |    |                                               
Sbjct PIVDPHNHLDAKDIvenkpwndiwevegATDHyvwelmrrcgvseeyitgsrsnkekwla   85
DSSP  LEEELLLLLLHHHHhhllllllhhhhhlLLLHhhhhhhhhllllhhhllllllhhhhhhh


DSSP  ------------------------------------------------eeLHHHHHHLLL
Query ------------------------------------------------tmDFISSALHGG   91
ident                                                             
Sbjct lakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMK  145
DSSP  hhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLL


DSSP  EEEEEELLllllllllllhhhHHHHhHHHHHHHHHLLhHHLEEElLEELLLLL-------
Query VTTMISAGsphfpgrpkdaagTKALaITLSKSYYNARpAGVKVHgGAVILEKG-------  144
ident |                                  |   ||                   
Sbjct VEILCTTD-------------DPVStLEHHRKAKEAV-EGVTIL-PTWRPDRAmnvdkeg  190
DSSP  EEEEELLL-------------LLLLlLHHHHHHHHHL-LLLEEE-LLLLLHHHhllllll


DSSP  ------------------------LLHHHHHHHHHLLLLEEEEEL---------------
Query ------------------------LTEEDFIEMKKEGVWIVGEVG---------------  165
ident                                  |  |                       
Sbjct wreyvekmgerygedtstldgflnALWKSHEHFKEHGCVASDHALlepsvyyvdenrara  250
DSSP  hhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHLLLLLEEEEEElllllllllhhhhhh


DSSP  --------------lllllLHHHHHHHHHHHHHLLLEEEEELLLLLLL------------
Query --------------lgtikNPEDAAPMVEWAHKHGFKVQMHTGGTSIP------------  199
ident                                       | | |                 
Sbjct vhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGALRDYrdslfktlgpds  310
DSSP  hhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEELLLlhhhhhhlllll


DSSP  -LLLL----lLHHHHHHHL-------lLEEElllllllLLLHhHHHHHHHHL----LLEE
Query -GSST----vTADDVIKTK-------pDVVShinggptAISVqEVDRIMDET----DFAM  243
ident  |         |                |                  |            
Sbjct gGDIStnflrIAEGLRYFLnefdgklkIVLY------vLDPT-HLPTISTIArafpNVYV  363
DSSP  lLLEElllllHHHHHHHHHhhllllllEEEE------eLLHH-HHHHHHHHHhhllLEEE


DSSP  EE--ellLLHHHHHHHHHHHHHHLLHHHE-EEELLLLLlllLLLL-HHHHHHHHHhHHLL
Query EI--vqcGNPKIADYVARRAAEKGQLGRV-IFGNDAPSgtgLIPL-GILRNMCQIaSMSD  299
ident          |          |    |        |      |              |   
Sbjct GApwwfnDSPFGMEMHLKYLASVDLLYNLaGMVTDSRK--lLSFGsRTEMFRRVL-SNVV  420
DSSP  LLlllllLLHHHHHHHHHHHHLLLLHHHLlLLLLLLLL--lLHHHhHHHHHHHHH-HHHH


DSSP  ------------lLHHHHHHHHLHHHHHHHLllllllllllllleeeeelllllllllhh
Query ------------iDPEVAVCMATGNSTAVYGlntgviapgkeadliimdtplgsvaedam  347
ident                |           |                                
Sbjct gemvekgqipikeARELVKHVSYDGPKALFF-----------------------------  451
DSSP  hhhhhlllllhhhHHHHHHHHHLHHHHHHHL-----------------------------


DSSP  hhhhhlllleeeeeeelleeeellllllllllllleel
Query gaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                       
Sbjct --------------------------------------  451
DSSP  --------------------------------------


No 50: Query=2vunA Sbjct=3iacA Z-score=12.2

back to top
DSSP  ----------leeeeelllEEELlllllleellleeeeelleeeeeelhhhhllllllee
Query ----------sktiiknigKIVSgdikspvlqadtivvedgliaaiggeelmkdagdati   50
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eelllleeEELEEEEEELL-LLLL--------eehHHLE---------------------
Query idaagstvTPGLLDTHVHV-SGGD--------yapRQKT---------------------   80
ident              | | |                                          
Sbjct -------aPXPIYDFHCHLsPQEIaddrrfdnlgqIWLEgdhykwralrsagvdeslitg   76
DSSP  -------lLLLEEELLLLLlHHHHhhllllllhhhHHHLlllhhhhhhhhllllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   80
ident                                                             
Sbjct ketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekla  136
DSSP  llllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhl


DSSP  ---eLHHHHHHLLLEEEEEELLllllllllllhhhHHHHhHHHHHHHHHLlhHHLEEElL
Query ---mDFISSALHGGVTTMISAGsphfpgrpkdaagTKALaITLSKSYYNArpAGVKVHgG  137
ident               |                                         |   
Sbjct tpafSARGIXQQXNVRXVGTTD-------------DPIDsLEYHRQIAADdsIDIEVA-P  182
DSSP  lhhhLHHHHHHHLLEEEEELLL-------------LLLLlLHHHHHHHHLllLLLEEE-L


DSSP  EELLLLL-------------------------------lLHHHHHHHHHLLLLEEeEELL
Query AVILEKG-------------------------------lTEEDFIEMKKEGVWIVgEVGL  166
ident      |                                            |       | 
Sbjct SWRPDKVfkieldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAACGCRAS-DHGI  241
DSSP  LLLLHHHhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHLLLLEE-EEEE


DSSP  -------------------------------lllllhHHHHHHHHHHHHLLLEEEEELLl
Query -------------------------------gtiknpEDAAPMVEWAHKHGFKVQMHTGg  195
ident                                                   |   | | | 
Sbjct etlrfapvpddaqldailgkrlagetlseleiaqfttAVLVWLGRQYAARGWVXQLHIG-  300
DSSP  llllllllllhhhhhhhhhhhhllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEEL-


DSSP  LLLL--------------LLLL---lLHHHHHHHL----------lLEEElllllllLLL
Query TSIP--------------GSST---vTADDVIKTK----------pDVVShinggptAIS  228
ident                     |                                       
Sbjct AIRNnntrxfrllgpdtgFDSIgdnnISWALSRLLdsxdvtnelpkTILY------cLNP  354
DSSP  EELLllhhhhhhhlllllLLEEllllLHHHHHHHHhhhhlllllleEEEE------eLLH


DSSP  HhHHHHHHHHLL----------LEEEE--ellLLHHHHHHHHHHHHHHLLH-HHEEEELL
Query VqEVDRIMDETD----------FAMEI--vqcGNPKIADYVARRAAEKGQL-GRVIFGND  275
ident                                                 | |   |    |
Sbjct R-DNEVLATXIGnfqgpgiagkVQFGSgwwfnDQKDGXLRQLEQLSQXGLLsQFVGXLTD  413
DSSP  H-HHHHHHHHHHhlllllllllEEELLllhhhLLHHHHHHHHHHHHHHLLHhHLLLLLLL


DSSP  LLLlllLLLLHHHHHHHHHHHHLL-------------lLHHHHHHHHLHHHHHHHLllll
Query APSgtgLIPLGILRNMCQIASMSD-------------iDPEVAVCMATGNSTAVYGlntg  322
ident   |   |                                          |          
Sbjct SRS--fLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT----  467
DSSP  LLL--lLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL----


DSSP  llllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllllll
Query viapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraa  382
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  eel
Query kil  385
ident    
Sbjct -ik  469
DSSP  -ll


No 51: Query=2vunA Sbjct=1m65A Z-score=11.1

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELLLllleeHHHLEE--LHHHHHHLLLEEEEEELLLlllllllllhhhHHHHHH
Query gLLDTHVHVSggdyaPRQKTM--DFISSALHGGVTTMISAGSphfpgrpkdaagTKALAI  118
ident    | | |               | |  |   |                          |
Sbjct yPVDLHMHTV---asTHAYSTlsDYIAQAKQKGIKLFAITDH----gpdmedapHHWHFI   53
DSSP  lLEELLLLLL---llLLLLLLhhHHHHHHHHHLLLEEEEEEE----llllllllLLHHHH


DSSP  HhHHHHHhLLHHHLEEELleelllllllhhhhhhhhhlllleeEEELllllLLHHhhhhh
Query TlSKSYYnARPAGVKVHGgavilekglteedfiemkkegvwivGEVGlgtiKNPEdaapm  178
ident             ||                              |      ||       
Sbjct N-MRIWP-RVVDGVGILR------------------------gIEAN---iKNVD----g   80
DSSP  H-HHHLL-LEELLEEEEE------------------------eEEEE---lLLLL----l


DSSP  hhhHHHLLL----EEEEELlLLLL--llllllLHHHHHHHL----LLEEELLLLlllLLL
Query vewAHKHGF----KVQMHTgGTSI--pgsstvTADDVIKTK----PDVVSHINGgptAIS  228
ident         |                            | |         ||         
Sbjct eidCSGKMFdsldLIIAGF-HEPVfaphdkatNTQAMIATIasgnVHIISHPGN--pKYE  137
DSSP  lllLLHHHHhhllEEEEEL-LLLLlllllhhhHHHHHHHHHhlllLLEELLLLL--lLLL


DSSP  HhHHHHHHHH---LLLEEEEELLLlhhHHHHHHHHHHHHLLhhHEEEELLLLLlllLLLL
Query VqEVDRIMDE---TDFAMEIVQCGnpkIADYVARRAAEKGQlgRVIFGNDAPSgtgLIPL  285
ident    |            | ||           ||      |    |  | |          
Sbjct I-DVKAVAEAaakHQVALEINNSS---NCREVAAAVRDAGG--WVALGSDSHT--aFTMG  189
DSSP  L-LHHHHHHHhhhHLLEEEEELLL---LHHHHHHHHHHHLL--LEEEELLLLL--hHHLL


DSSP  HHHHHHHHHHhHLLLLHHHhhHHHLH--HHHHHHLlllllllllLLLLeeeeelllllll
Query GILRNMCQIAsMSDIDPEVavCMATG--NSTAVYGlntgviapgKEADliimdtplgsva  343
ident              |  ||                                          
Sbjct EFEECLKILD-AVDFPPER--ILNVSprRLLNFLEsrgmapiaeFADL------------  234
DSSP  LLHHHHHHHH-HLLLLHHH--LHHHLhhHHHHHHHhllllllhhHLLL------------


DSSP  llhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query edamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                           
Sbjct ------------------------------------------  234
DSSP  ------------------------------------------


No 52: Query=2vunA Sbjct=3au2A Z-score=10.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  --------------leeeeellleeellllllleellleeeeelleeeeeelhHHHLLL-
Query --------------sktiiknigkivsgdikspvlqadtivvedgliaaiggeELMKDA-   45
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   45
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   45
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------llleeeelllleeEELEEEEEELLL------LLLEehhh
Query ---------------------gdatiidaagstvTPGLLDTHVHVS------GGDYaprq   78
ident                                        |  ||                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysdgqnTLEE----  356
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllllllLHHH----


DSSP  leelHHHHHHLLLEEEEEELLLllllllLLLHhhHHHHHHHHHHHHHHLL--HHHLEEEL
Query ktmdFISSALHGGVTTMISAGSphfpgrPKDAagTKALAITLSKSYYNAR--PAGVKVHG  136
ident         |   |                         |                     
Sbjct ----LWEAAKTMGYRYLAVTDH-spavrVAGG-pSPEEALKRVGEIRRFNetHGPPYLLA  410
DSSP  ----HHHHHHHHLLLEEEEEEE-lhhhhLLLL-lLHHHHHHHHHHHHHHHhhHLLLEEEE


DSSP  LEelllllllhhhhhhhhhlllleeEEELlllLLLHHhhhhhhhhHHHLLL----EEEEE
Query GAvilekglteedfiemkkegvwivGEVGlgtIKNPEdaapmvewAHKHGF----KVQMH  192
ident ||                                                      |   
Sbjct GA-----------------------EVDI---HPDGT------ldYPDWVLreldLVLVS  438
DSSP  EE-----------------------EEEL---LLLLL------llLLHHHHllllEEEEE


DSSP  LlLLLLllllllLHHHHHHHL----LLEEELLlLLLL-----LLLHhHHHHHHHHL---L
Query TgGTSIpgsstvTADDVIKTK----PDVVSHInGGPT-----AISVqEVDRIMDET---D  240
ident                   |        |  |            |                
Sbjct V-HSRFnlpkadQTKRLLKALenpfVHVLAHP-TARLlgrraPIEA-DWEAVFQKAkekG  495
DSSP  L-LLLLlllhhhHHHHHHHHHllllLLEELLL-LLLLlllllLLLL-LHHHHHHHHhhhL


DSSP  LEEEEEL---LLLHhhHHHHHHHHHHHLLhhHEEEELLLLLlllLLLLHHHHHHHHHHhH
Query FAMEIVQ---CGNPkiADYVARRAAEKGQlgRVIFGNDAPSgtgLIPLGILRNMCQIAsM  297
ident  | ||            |  || |   |         ||                     
Sbjct VAVEIDGyydRMDL--PDDLARMAYGMGL--WISLSTDAHQ--tDHLRFMELAVGTAQ-R  548
DSSP  LEEEEELlllLLLL--LHHHHHHHHHLLL--LEEEELLLLL--hHHHHHHHHHHHHHH-H


DSSP  LLLLHHHhhHHHLHH---HHHHHLllllllllllllleeeeelllllllllhhhhhhhll
Query SDIDPEVavCMATGN---STAVYGlntgviapgkeadliimdtplgsvaedamgaiaagd  354
ident   | ||      |                                               
Sbjct AWIGPER--VLNTLDyedLLSWLK------------------------------------  570
DSSP  LLLLLLL--LHHHLLhhhHHHHHH------------------------------------


DSSP  lleeeeeeelleeeellllllllllllleel
Query ipgisvvlidgeavvtksrntppakraakil  385
ident                                
Sbjct --------------------------arrgv  575
DSSP  --------------------------lllll


No 53: Query=2vunA Sbjct=2a3lA Z-score=10.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------------------leeeeeLLLEeellllllleellleeeeelleeee
Query -------------------------sktiikNIGKivsgdikspvlqadtivvedgliaa   35
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqKSAP-------------------------  155
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHLL-------------------------


DSSP  eelhhhhlllllleeeelllLEEE--ELEEEEEELLLllleehHHLEE------------
Query iggeelmkdagdatiidaagSTVT--PGLLDTHVHVSggdyapRQKTM------------   81
ident                               ||||| |       ||              
Sbjct --------------------HRDFynVRKVDTHVHHS---acmNQKHLlrfiksklrkep  192
DSSP  --------------------LLLLllLLEEEEEEELL---lllLHHHHhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   81
ident                                                             
Sbjct devvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrl  252
DSSP  lllleeelleeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhh


DSSP  ---------------------LHHHHHH-LLLEeEEEELLLllllllLLLHHHHHHHHHH
Query ---------------------DFISSAL-HGGVtTMISAGSphfpgrPKDAAGTKALAIT  119
ident                         |               |                   
Sbjct reiflkqdnliqgrflgeitkQVFSDLEaSKYQ-MAEYRIS-----iYGRKMSEWDQLAS  306
DSSP  hhhhlllllllllllhhhhhhHHHHHHLlLLLE-EEEEEEE-----lLLLLLLHHHHHHH


DSSP  HHHhhhHLLHhhLEEELlEELL------------------lLLLLHHHHHH---------
Query LSKsyyNARPagVKVHGgAVIL------------------eKGLTEEDFIE---------  152
ident               |      |                            |         
Sbjct WIV-nnDLYS--ENVVW-LIQLprlyniykdmgivtsfqniLDNIFIPLFEatvdpdshp  362
DSSP  HHH-llLLLL--LLEEE-EEEEellhhhhlllllllllhhhHHHHLLHHHHhhhlhhhll


DSSP  -hHHLL--LLEEeEELL----------------------llllLHHHHHHHHHHHHHL--
Query -mKKEG--VWIVgEVGL----------------------gtikNPEDAAPMVEWAHKH--  185
ident         |                                                   
Sbjct qlHVFLkqVVGF-DLVDdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLnk  421
DSSP  llHHHHllEEEE-EEELllllllllllllllllllllllllllHHHHHHHHHHHHHHHhh


DSSP  --------LLEEEEELLLLllllLLLLLHHHHHHhLLLEEELLlllllLLLH---HHHHH
Query --------GFKVQMHTGGTsipgSSTVTADDVIKtKPDVVSHInggptAISV---QEVDR  234
ident               | |                        |                  
Sbjct lreskgmtTITLRPHSGEA----GDIDHLAATFL-TCHSIAHG-----INLRkspVLQYL  471
DSSP  hhllllllLLEELLLLLLL----LLLHHHHHHHH-HLLLLLLL-----HHHHhlhHHHHH


DSSP  HHHhLLLEEEEE-LLLL-------hHHHHHHHHHHhhhllhhHEEEELLLLLLLLlllLH
Query IMDeTDFAMEIV-QCGN-------pKIADYVARRAaekgqlgRVIFGNDAPSGTGlipLG  286
ident                 |                |         |    | |         
Sbjct YYL-AQIGLAMSpLSNNslfldyhrNPFPVFFLRG------lNVSLSTDDPLQIHltkEP  524
DSSP  HHH-HLLLEEELhHHHLllllllllLLHHHHHHLL------lLEEELLLLHHHHLlllLH


DSSP  HHHHHHHHHHHLLLLHHHHHHHhLHHHHHHHLLLL----lLLLLLLllleeeeellllll
Query ILRNMCQIASMSDIDPEVAVCMaTGNSTAVYGLNT----gVIAPGKeadliimdtplgsv  342
ident         ||               ||    |         |                  
Sbjct LVEEYSIAASVWKLSACDLCEI-ARNSVYQSGFSHalkshWIGKDY----------ykrg  573
DSSP  HHHHHHHHHHHHLLLHHHHHHH-HHHHHHHLLLLHhhhhhHLLLLL----------llll


DSSP  lllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query aedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                            
Sbjct pdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 54: Query=2vunA Sbjct=3dcpA Z-score=10.1

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LEEEEEELLLllleeHHHLE--eLHHHHHHLLLEEEEEELL-----------------ll
Query GLLDTHVHVSggdyaPRQKT--mDFISSALHGGVTTMISAG-----------------sp  101
ident    | | |                    |                               
Sbjct XKRDGHTHTE--fcpHGTHDdveEXVLKAIELDFDEYSIVEhaplssefxkntagdkeav   58
DSSP  LLEEEEELLL--lllLLLLLlhhHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhh


DSSP  llllLLLLhhHHHHHHHHHHHHHHHLLHhHLEEELleelllllllhhhhhhhhhllllee
Query hfpgRPKDaaGTKALAITLSKSYYNARPaGVKVHGgavilekglteedfiemkkegvwiv  161
ident                                  |                          
Sbjct ttasXAXS--DLPYYFKKXNHIKKKYAS-DLLIHI------------------------g   91
DSSP  hlllLLHH--HHHHHHHHHHHHHHHLLL-LLEEEE------------------------e


DSSP  EEELlllllLHHHHHHHHHHHHhLLLE-EEEELlLLLLL---LLLL--------------
Query GEVGlgtikNPEDAAPMVEWAHkHGFK-VQMHTgGTSIP---GSST--------------  203
ident  ||                                         |               
Sbjct FEVD-yligYEDFTRDFLNEYG-PQTDdGVLSL-HFLEGqggFRSIdfsaedynegivqf  148
DSSP  EEEE-llllLHHHHHHHHHHHH-HHLLeEEEEL-LEEEElleEEELlllhhhhhhhlhhh


DSSP  -------------LLHHHHHH----hLLLEEELLLL-------------lllllLHHHHH
Query -------------VTADDVIK----tKPDVVSHING-------------gptaiSVQEVD  233
ident                           ||    ||                          
Sbjct yggfeqaqlayleGVKQSIEAdlglfKPRRXGHISLcqkfqqffgedtsdfseeVXEKFR  208
DSSP  hllhhhhhhhhhhHHHHHHHLlllllLLLEELLLLHhhllhhhhlllhhhllhhHHHHHH


DSSP  HHHHHL---LLEEEEELLL-------lhhHHHHHHHHHHHHLLhhHEEEELLLLLllLLL
Query RIMDET---DFAMEIVQCG-------npkIADYVARRAAEKGQlgRVIFGNDAPSgtGLI  283
ident  |       |        |                  | |         | |       |
Sbjct VILALVkkrDYELDFNTAGlfkplcgetyPPKKIVTLASELQI--PFVYGSDSHG-vQDI  265
DSSP  HHHHHHhhhLLEEEEELHHhhllllllllLLHHHHHHHHHLLL--LEEEELLLLL-hHHL


DSSP  LLHHHHHHHHHHhhllllhhhhhhhhlhhhhhhhlllllllllllllleeeeelllllll
Query PLGILRNMCQIAsmsdidpevavcmatgnstavyglntgviapgkeadliimdtplgsva  343
ident   |                                                         
Sbjct GRGYSTYCQKLE------------------------------------------------  277
DSSP  LLLHHHHHHHLL------------------------------------------------


DSSP  llhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query edamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                           
Sbjct ------------------------------------------  277
DSSP  ------------------------------------------


No 55: Query=2vunA Sbjct=3f2bA Z-score=8.5

back to top
DSSP  -----------------------------------------------leeeeellleeel
Query -----------------------------------------------sktiiknigkivs   13
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  lllllleellleeeeelleeeeeelhhhhlllLLLE-eeellllEEEELEEEEEELLL--
Query gdikspvlqadtivvedgliaaiggeelmkdaGDAT-iidaagsTVTPGLLDTHVHVS--   70
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlNEIAanerqdtaPEGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeEEELllllllllLLLLLLLLLLLLLLll


DSSP  ------LLLEehhhleelHHHHHHLLLEEEEEELLLLllllllllhhhhhhhhhHHHHHH
Query ------GGDYaprqktmdFISSALHGGVTTMISAGSPhfpgrpkdaagtkalaiTLSKSY  124
ident                    |  |   |                                 
Sbjct qmdavtSVTK--------LIEQAKKWGHPAIAVTDHA---------------vvQSFPEA  157
DSSP  llllllLHHH--------HHHHHHHLLLLLEEELLLL---------------llLLHHHH


DSSP  HHLL-hHHLEEELleelllllllhhhhhhhhhlllleeEEELllllLLHH----------
Query YNAR-pAGVKVHGgavilekglteedfiemkkegvwivGEVGlgtiKNPE----------  173
ident | |    | ||                            |                    
Sbjct YSAAkkHGMKVIY------------------------gLEAN----IVDDpfhvtllaqn  189
DSSP  HHHHhhHLLLEEE------------------------eEEEE----EELLleeeeeeell


DSSP  ------------------------hHHHHHHHHHhLLLEeeeelllllllllllllhhhh
Query ------------------------dAAPMVEWAHkHGFKvqmhtggtsipgsstvtaddv  209
ident                                     |                       
Sbjct etglknlfklvslshiqyfhrvpriPRSVLVKHR-DGLL---------------------  227
DSSP  hhhhhhhhhhhhhhhllllllllleEHHHHHHLL-LLEE---------------------


DSSP  hhhllLEEELLlllllLLLHhhhHHHHHhLLLEEEEEL------------llLHHHHHHH
Query iktkpDVVSHInggptAISVqevDRIMDeTDFAMEIVQ------------cgNPKIADYV  257
ident                    |     |        |                    |    
Sbjct -----VGSGCD-kgelFDNV---EDIAR-FYDFLEVHPpdvykplyvkdeemIKNIIRSI  277
DSSP  -----EELLLL-llllLLLL---LLLHH-HLLLEEELLhhhhlllllllhhhHHHHHHHH


DSSP  HHHHHHHLLhhHEEEELLLL---------------------------lLLLLLLLhhHHH
Query ARRAAEKGQlgRVIFGNDAP---------------------------sGTGLIPLgiLRN  290
ident             |                                               
Sbjct VALGEKLDI--PVVATGNVHylnpedkiyrkilihsqgganplnrhelPDVYFRT-tNEM  334
DSSP  HHHHHHLLL--LEEELLLLLlllhhhhhhhhhhhhllhhhllllllllLLLLLLL-hHHH


DSSP  HHHHHHHlllLHHHHHHHHLHHHHHH-HLLL-----------------------------
Query MCQIASMsdiDPEVAVCMATGNSTAV-YGLN-----------------------------  320
ident            || |      |                                      
Sbjct LDCFSFL---GPEKAKEIVVDNTQKIaSLIGdvkpikdelytpriegadeeiremsyrra  391
DSSP  HHHHHHH---HHHHHHHHHLHHHHHHhHLLLllllllllllllllllhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct keiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfv  451
DSSP  hhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct atmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfe  511
DSSP  hhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct tflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkaya  571
DSSP  hhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct sdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewr  631
DSSP  hhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct tthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgv  691
DSSP  eeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct tpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqn  751
DSSP  lhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct gtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyi  811
DSSP  llllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct dsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaai  871
DSSP  hhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhh


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------tg  322
ident                                                             
Sbjct rkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslip  931
DSSP  hhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeel


DSSP  llllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllllllllllll
Query viapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraa  382
ident                                                             
Sbjct pfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnql  991
DSSP  lhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllllll


DSSP  eel
Query kil  385
ident    
Sbjct slf  994
DSSP  lll


No 56: Query=2vunA Sbjct=1bksA Z-score=8.1

back to top
DSSP  leeeeellleeeLLLLllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivSGDIkspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct -meryenlfaqlNDRR--------------------------------------------   15
DSSP  -lhhhhhhhhhhHHLL--------------------------------------------


DSSP  leEEEEELLL-------LLLEehhhleeLHHHHHhllleeEEEElLLLL-----------
Query glLDTHVHVS-------GGDYaprqktmDFISSAlhggvtTMISaGSPH-----------  102
ident                               |                             
Sbjct egAFVPFVTLgdpgieqSLKI-----idTLIDAG-----aDALE-LGVPfsdpladgpti   64
DSSP  llEEEEEEELllllhhhHHHH-----hhHHHHLL-----lLLEE-EELLllllllllhhh


DSSP  --------lLLLLllhhhhhhhhHHHHHHHHHLLhhhlEEELlEELLLLLL----LHHHH
Query --------fPGRPkdaagtkalaITLSKSYYNARpagvKVHGgAVILEKGL----TEEDF  150
ident           |                                                 
Sbjct qnanlrafaAGVT------paqcFEMLALIREKH---pTIPIgLLMYANLVfnngIDAFY  115
DSSP  hhhhhhhhhHLLL------hhhhHHHHHHHHHHL---lLLLEeEEELHHHHhlllHHHHH


DSSP  HHHHHLLLLEEEeellLLLLlHHHHHHHHHHHHHLLLEEEEELLLllllllLLLL--HHH
Query IEMKKEGVWIVGevglGTIKnPEDAAPMVEWAHKHGFKVQMHTGGtsipgsSTVT--ADD  208
ident       ||  |           |  ||    |  |                         
Sbjct ARCEQVGVDSVL---vADVP-VEESAPFRQAALRHNIAPIFICPP------NADDdlLRQ  165
DSSP  HHHHHHLLLEEE---eLLLL-HHHLHHHHHHHHHLLLEEEEEELL------LLLHhhHHH


DSSP  HHHHLLLEEELLlllllllLHHHHHHHHHHLLLEEEEELLL-----lhhHHHHHhhhhhh
Query VIKTKPDVVSHInggptaiSVQEVDRIMDETDFAMEIVQCG-----npkIADYVarraae  263
ident |                                                           
Sbjct VASYGRGYTYLL----alpLHHLIEKLKEYHAAPALQGFGIsspeqvsaAVRAG------  215
DSSP  HHHHLLLLEEEL----lllHHHHHHHHHHHLLLLEEELLLLllhhhhhhHHHHL------


DSSP  hllhhhEEEELLL-LLLL----------------llLLLHHHHHHhhhhhhllllhhhhh
Query kgqlgrVIFGNDA-PSGT----------------glIPLGILRNMcqiasmsdidpevav  306
ident                                                             
Sbjct -----aAGAISGSaIVKIieknlaspkqmlaelrsfVSAMKAASR---------------  255
DSSP  -----lLEEEELLhHHHHhhhllllhhhhhhhhhhhHHHHHHLLL---------------


DSSP  hhhlhhhhhhhlllllllllllllleeeeelllllllllhhhhhhhlllleeeeeeelle
Query cmatgnstavyglntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidge  366
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  eeellllllllllllleel
Query avvtksrntppakraakil  385
ident                    
Sbjct -------------------  255
DSSP  -------------------


No 57: Query=2vunA Sbjct=2yb1A Z-score=6.8

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lEEEEEELL--------LLLLeehhhleelhHHHHHlllEEEEEELLllllllllllhhh
Query gLLDTHVHV--------SGGDyaprqktmdfISSALhggVTTMISAGsphfpgrpkdaag  112
ident    | | |                                                    
Sbjct aNIDLHFHSrtsdgaltPTEV-------idrAAARA---PALLALTD-----------hd   39
DSSP  lLEELLLLLllllllllHHHH-------hhhHHLLL---LLEEEELL-----------ll


DSSP  hhhHHHHHHHHHHHLLhhhLEEElleelllllllhhhhhhhhhllllEEEEEL-------
Query tkaLAITLSKSYYNARpagVKVHggavilekglteedfiemkkegvwIVGEVG-------  165
ident                                                   ||        
Sbjct ctgGLAEAAAAAARRG---IPFL------------------------NGVEVSvswgrht   72
DSSP  lllLHHHHHHHHHHLL---LLEE------------------------EEEEEEeeellee


DSSP  -----------------lLLLL--------------------------------------
Query -----------------lGTIK--------------------------------------  170
ident                                                             
Sbjct vhivglgidpaepalaagLKSIregrlerarqmgasleaagiagcfdgamrwcdnpemis  132
DSSP  eeeeeellllllhhhhhhHHHHhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhll


DSSP  ---------------------------------lhHHHHhhhhhhhhllleeeeelllll
Query ---------------------------------npEDAApmvewahkhgfkvqmhtggts  197
ident                                      |                      
Sbjct rthfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWAS---------------------  171
DSSP  hhhhhhhhhhllllllhhhhhhhllllllllllllLLLL---------------------


DSSP  llllllllhhhHHHHL--------lLEEELLLlllLLLL-HHHHHHHHHHLL----LEEE
Query ipgsstvtaddVIKTK--------pDVVSHINggpTAIS-VQEVDRIMDETD----FAME  244
ident                           |  |               |             |
Sbjct -----------LEDAVgwivgaggmAVIAHPG---RYDMgRTLIERLILDFQaaggQGIE  217
DSSP  -----------HHHHHhhhhhllleEEELLHH---HLLLlHHHHHHHHHHHHhlllLEEE


DSSP  E-ELLLLHHHHHHHHHHHHhHLLHhHEEEELLLLLLLLLlllHHHHhhhHHHHhllllhh
Query I-VQCGNPKIADYVARRAAeKGQLgRVIFGNDAPSGTGLiplGILRnmcQIASmsdidpe  303
ident               |  |     |     | |                            
Sbjct VaSGSHSLDDMHKFALHAD-RHGL-YASSGSDFHAPGED-vgHTED---LPPI-------  264
DSSP  EeELLLLHHHHHHHHHHHH-HHLL-EEEEELLLLLLLLL-llLLLL---LLLL-------


DSSP  hhhhhhlhHHHHHhLLLLlllllllllleeeeelllllllllhhhhhhhlllleeeeeee
Query vavcmatgNSTAVyGLNTgviapgkeadliimdtplgsvaedamgaiaagdipgisvvli  363
ident                                                             
Sbjct ------crPIWRE-LEAR------------------------------------------  275
DSSP  ------llLHHHH-LHHH------------------------------------------


DSSP  lleeeellllllllllllleel
Query dgeavvtksrntppakraakil  385
ident                       
Sbjct -------------ilrpadaen  284
DSSP  -------------lllllhhhl


No 58: Query=2vunA Sbjct=3e38A Z-score=6.2

back to top
DSSP  --leeeeellleEELLllllleellleeeeelleeeeeelhhhhlllllleeeellllee
Query --sktiiknigkIVSGdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstv   58
ident                                                             
Sbjct aqrrneiqvpdlDGYT--------------------------------------------   16
DSSP  llllllllllllLLLE--------------------------------------------


DSSP  eELEEEEEELLL------LLLEehhhleelHHHHHHLLLEEEEEELLLL-LLLLLlllhh
Query tPGLLDTHVHVS------GGDYaprqktmdFISSALHGGVTTMISAGSP-HFPGRpkdaa  111
ident      | | |                        |   |             |       
Sbjct -TLKCDFHXHSVfsdglvWPTV--------RVDEAYRDGLDAISLTEHIeYRPHK----q   63
DSSP  -EEEEELLLLLLllllllLHHH--------HHHHHHHLLLLEELLEEELlLLLLL----l


DSSP  hhhHHHHHHHHHHHHLLH-HHLEEELlEELLlllllhhhhhhhhhlllleeeeellLLLL
Query gtkALAITLSKSYYNARP-AGVKVHGgAVILekglteedfiemkkegvwivgevglGTIK  170
ident                     |                                       
Sbjct dvvSDHNRSFDLCREQAEkLGILLIK-GSEI-------------------------TRAX   97
DSSP  lllLLLLHHHHHHHHHHHhHLLEELL-EEEE-------------------------ELLL


DSSP  LH----------------hHHHHHHHHHHHLLLEEEEELLLLL--LLLLlLLLHHHHHHH
Query NP----------------eDAAPMVEWAHKHGFKVQMHTGGTS--IPGSsTVTADDVIKT  212
ident  |                 |       | | |        |     |   |         
Sbjct APghfnaiflsdsnpleqkDYKDAFREAKKQGAFXFWNHPGWDsqQPDT-TKWWPEHTAL  156
DSSP  LLleeeeelllllhhhlllLHHHHHHHHHHLLLEEEELLLLLLllLLLL-LLLLHHHHHH


DSSP  L----LLEEeLLLLLLLLLLhhHHHHHHHHLLLEEEEellllhhhhhhhhhhhhhhllhh
Query K----PDVVsHINGGPTAISvqEVDRIMDETDFAMEIvqcgnpkiadyvarraaekgqlg  268
ident               |       |                                     
Sbjct YqegcXHGI-EVANGHLYXP--EAIQWCLDKNLTXIG-----------------------  190
DSSP  HhlllLLEE-EEEELLEELL--HHHHHHHHHLLEEEE-----------------------


DSSP  heeeELLLLlllLLLLlhhhhhhhhhhhhllllhhhhhhHHLH-------HHHHHH----
Query rvifGNDAPsgtGLIPlgilrnmcqiasmsdidpevavcMATG-------NSTAVY----  317
ident       |       |                                      |      
Sbjct ----TSDIH---QPIQ---------tdydfekgehrtxtFVFAkerslqgIREALDnrrt  234
DSSP  ----ELLLL---LLHH---------hhllhhhllllleeEEEEllllhhhHHHHHHllle


DSSP  --lllllllllllllleeeeELLLL------------lLLLLHHhhHHHL----------
Query --glntgviapgkeadliimDTPLG------------sVAEDAMgaIAAG----------  353
ident                                                             
Sbjct aayfhelligredllrpffeKCVKIeevsrneqgvtlsITNVTD--LVLKlkktahdtll  292
DSSP  eeeelleeellhhhhhhhhhHHEEEeeeeeelleeeeeEEELLL--LLEEeeelllllle


DSSP  ------------------llleeeeeeelleeeellllllllllllleel
Query ------------------dipgisvvlidgeavvtksrntppakraakil  385
ident                                                   
Sbjct vyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  ellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=2vunA Sbjct=2anuA Z-score=6.0

back to top
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleEEE
Query sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstVTP   60
ident                                                             
Sbjct ---------------------------------------------------------TEW    3
DSSP  ---------------------------------------------------------LEE


DSSP  LEEEEEELLLLlleeHHHLE-eLHHHHHHLLLEEEEEELLLL--------llllllllhh
Query GLLDTHVHVSGgdyaPRQKT-mDFISSALHGGVTTMISAGSP--------hfpgrpkdaa  111
ident  | | |||                       ||                           
Sbjct LLCDFHVHTNX---sDGHLPlgEVVDLFGKHGVDVVSITDHIvdrrtleqrkrngeplga   60
DSSP  EEEEEEELLLL---lLLLLLhhHHHHHHHHLLLLEEEEEEEEelhhhhhhhhhlllllll


DSSP  hHHHHHHHHHHHHHH--LLHH---HLEEELLEelllllllhhhhhhhhhlllleeEEEL-
Query gTKALAITLSKSYYN--ARPA---GVKVHGGAvilekglteedfiemkkegvwivGEVG-  165
ident  |        |       |     |     |                             
Sbjct iTEDKFQDYLKRLWReqKRAWeeyGXILIPGV-----------------------EITNn   97
DSSP  lLLLLHHHHHHHHHHhhHHHHhhhLLEEEEEE-----------------------EEEEl


DSSP  ---------------lLLLLLHhHHHHHHHHHhhlLLEEeeelllllllllllllhhhhh
Query ---------------lGTIKNPeDAAPMVEWAhkhGFKVqmhtggtsipgsstvtaddvi  210
ident                                       |                     
Sbjct tdlyhivavdvkeyvdPSLPVE-EIVEKLKEQ---NALV---------------------  132
DSSP  llleeeeeelllllllLLLLHH-HHHHHHHHL---LLEE---------------------


DSSP  hhlllEEELllLLLLLLLhhhHHHHhHHLL---LEEE-EELLLLhhhHHHHHHHHhhhll
Query ktkpdVVSHinGGPTAISvqeVDRImDETD---FAME-IVQCGNpkiADYVARRAaekgq  266
ident         |        |                | |             |         
Sbjct -----IAAH--PDRKKLSwylWANX-ERFKdtfDAWEiANRDDL---FNSVGVKK-----  176
DSSP  -----EELL--LLLLLLLlhhHHLL-LLLLlllLEEEeEELLEE---LHHHHHLL-----


DSSP  hhHEEEELLLLLllLLLLLHHhhhhhhhhhhllllhhhhhhHHLHhhhhhhLLLLlllll
Query lgRVIFGNDAPSgtGLIPLGIlrnmcqiasmsdidpevavcMATGnstavyGLNTgviap  326
ident   |     |                                                   
Sbjct -yRYVANSDFHE--LWHVYSW--------------------KTLV-kseknIEAI-----  207
DSSP  -lLEEEELLLLL--HHHHLLE--------------------EEEE-eelllHHHH-----


DSSP  llllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel
Query gkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
ident                                                            
Sbjct ------------------------------------------keairkntdvaiylxrk  224
DSSP  ------------------------------------------hhhhhhllleeeeelll