Results: dupa

Query: 2vc5A

MOLECULE: ARYLDIALKYLPHOSPHATASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2vc5-A 60.0  0.0  314   314  100 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
   2:  2ob3-A 42.9  1.8  306   329   33 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   3:  3k2g-B 37.0  2.8  293   358   29 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   4:  1bf6-A 36.6  2.3  279   291   33 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   5:  2y1h-B 18.5  3.0  226   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   6:  1onx-A 18.3  3.2  238   390   18 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   7:  3mkv-A 17.6  3.6  232   414   15 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   8:  1k6w-A 17.3  4.4  251   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   9:  1gkp-A 17.3  2.9  230   458   12 PDB  MOLECULE: HYDANTOINASE;                                              
  10:  4cqb-A 17.1  4.1  247   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  11:  4b3z-D 16.7  3.0  237   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  12:  3cjp-A 16.7  2.7  213   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  13:  4dlf-A 16.6  3.2  231   287    6 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  14:  3ls9-A 16.6  4.3  247   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  15:  3mtw-A 16.5  4.1  234   404   16 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  16:  3giq-A 16.3  3.1  234   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  17:  4mup-B 16.2  3.1  218   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  18:  3gg7-A 16.2  3.3  217   243   12 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  19:  2oof-A 16.2  4.5  238   403   17 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  20:  2paj-A 16.1  3.9  233   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  21:  3irs-A 16.0  3.3  221   281    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  22:  2qpx-A 15.8  3.0  232   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  23:  4c5y-A 15.6  3.9  224   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  24:  2vun-A 15.4  3.1  212   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  25:  3e74-A 15.4  3.0  224   429   11 PDB  MOLECULE: ALLANTOINASE;                                              
  26:  2ffi-A 15.4  3.4  232   273   10 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  27:  1itq-A 15.3  3.0  228   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  28:  3nqb-A 15.2  3.4  219   587   11 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  29:  3gri-A 15.1  3.1  223   422   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  3pnu-A 14.6  3.3  225   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  31:  2ogj-A 14.5  3.2  222   379   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  32:  2dvt-A 14.4  3.2  217   325   16 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  33:  4rdv-B 14.3  4.0  238   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  34:  1j6p-A 14.3  4.1  227   407   11 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  35:  1a4m-A 14.3  3.8  227   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  36:  2gwg-A 14.2  3.8  229   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  37:  3icj-A 13.7  4.0  222   468   14 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  38:  4ofc-A 13.7  3.6  220   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  39:  2uz9-A 13.7  4.5  232   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  40:  4qrn-A 13.6  3.4  215   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  41:  2imr-A 13.6  4.0  224   380   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  42:  1a5k-C 13.5  3.1  205   566   15 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  43:  3iac-A 13.3  3.5  238   469    8 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  44:  3qy6-A 13.2  3.0  196   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  45:  1j5s-A 13.0  3.4  232   451   15 PDB  MOLECULE: URONATE ISOMERASE;                                         
  46:  1yrr-B 12.9  3.7  209   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  47:  4hk5-D 12.8  4.1  224   380   10 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  48:  4dzi-C 12.3  3.6  213   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3ooq-A 11.7  3.5  188   384   23 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  2a3l-A 11.5  4.2  242   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  1v77-A 10.9  3.6  174   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  52:  3dcp-A  8.9  3.7  171   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3au2-A  8.5  4.2  176   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  1m65-A  7.7  4.0  167   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  7.2  4.0  175   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2anu-A  5.7  3.4  140   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  57:  2yb1-A  5.7  4.2  151   284    8 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.7  3.7  153   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  1bks-A  5.2  3.6  148   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2vc5A Sbjct=2vc5A Z-score=60.0

back to top
DSSP  LLLLLLLLLLLLHHHLLLEELLLLLLLLLHHHHHHLHHHLLHHHHHHHHHHHHHHHHHLL
Query MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFG   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFG   60
DSSP  LLLLLLLLLLLLHHHLLLEELLLLLLLLLHHHHHHLHHHLLHHHHHHHHHHHHHHHHHLL


DSSP  LLEEEELLLLLLLLLHHHHHHHHHLLLLEEEELEELLLLLLLLHHHLLLLHHHHHHHHHH
Query VKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIH  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIH  120
DSSP  LLEEEELLLLLLLLLHHHHHHHHHLLLLEEEELEELLLLLLLLHHHLLLLHHHHHHHHHH


DSSP  HHHLLLLLLLLLLLLEEEELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELLLLLLHHHH
Query DIKEGIQGTLNKAGFVXIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLE  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DIKEGIQGTLNKAGFVXIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLE  180
DSSP  HHHLLLLLLLLLLLLEEEELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELLLLLLHHHH


DSSP  HHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHHH
Query QQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTL  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTL  240
DSSP  HHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHHH


DSSP  HHHHLLLLLLEEELLLLLLLLLLLLLLHHHHHHHLLLLLLLHHHHLHHHHHHLLLLLHHH
Query RLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEV  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEV  300
DSSP  HHHHLLLLLLEEELLLLLLLLLLLLLLHHHHHHHLLLLLLLHHHHLHHHHHHLLLLLHHH


DSSP  HHHHHLHHHHHHLL
Query IATIFKENPKKFFS  314
ident ||||||||||||||
Sbjct IATIFKENPKKFFS  314
DSSP  HHHHHLHHHHHHLL


No 2: Query=2vc5A Sbjct=2ob3A Z-score=42.9

back to top
DSSP  LLLLLLLLlLLLHHHLLLEELLLLLLLLLHHHHHHLHHHL-LHHHHHHHHHHHHHHHHHL
Query MRIPLVGKdSIESKDIGFTLIHEHLRVFSEAVRQQWPHLY-NEDEEFRNAVNEVKRAMQF   59
ident  ||  |    |     |||| |||    |      ||            ||    ||   
Sbjct DRINTVRG-PITISEAGFTLTHEHICGSSAGFLRAWPEFFgSRKALAEKAVRGLRRARAA   59
DSSP  LLEEELLE-EELHHHHLLEEEEELLEELLLLHHHHLHHHHlLHHHHHHHHHHHHHHHHHL


DSSP  LLLEEEELLLLLLLLLHHHHHHHHHLLLLEEEELEELLLlllLLHHHLLLLHHHHHHHHH
Query GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIyidLPFYFLNRSIDEIADLFI  119
ident || ||||      |||      |  |     || ||       |     ||  |    | 
Sbjct GVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWF--dPPLSMRLRSVEELTQFFL  117
DSSP  LLLEEEELLLHHHLLLHHHHHHHHHHHLLEEELEEELLL--lLLHHHHLLLHHHHHHHHH


DSSP  HHHHLLLLLLLLLLLLEEEELLLlLLLHHHHHHHHHHHHHHHHHLLLEEEELLLLLLHHH
Query HDIKEGIQGTLNKAGFVXIAADEpGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGL  179
ident   |  ||  |   ||  | |      |   | |  ||| |   | ||  ||  |    | 
Sbjct REIQYGIEDTGIRAGIIXVATTG-KATPFQELVLKAAARASLATGVPVTTHTAASQRDGE  176
DSSP  HHHHLLLLLLLLLLLEEEEELLL-LLLHHHHHHHHHHHHHHHHHLLLEEEELLHHHLHHH


DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLL------------
Query EQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLD------------  227
ident  |  |   ||  |    |||  |||   |    |  |  ||||                 
Sbjct QQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPYSaiglednasasa  236
DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLlllllllhhhhh


DSSP  --LLLLHHHHHHHHHHHHHLLLLLLEEELLLLLLLLL-LLLLLHHHHhhhLLLL-LLLHH
Query --LFLPVDKRNETTLRLIKDGYSDKIMISHDYCCTID-WGTAKPEYKpklAPRW-SITLI  283
ident          |      ||  ||   |  | |         |                  |
Sbjct llGIRSWQTRALLIKALIDQGYMKQILVSNDWTFGFSsYVTNIMDVM--dRVNPdGMAFI  294
DSSP  hhLLLLHHHHHHHHHHHHHLLLHHHEEELLLLLLEELlLLLLHHHHH--hHHLLlHHHHH


DSSP  HHLHHHHHHLLLLLHHHHHHHHLHHHHHHLL----
Query FEDTIPFLKRNGVNEEVIATIFKENPKKFFS----  314
ident     ||||   ||  |  | |   ||  | |    
Sbjct PLRVIPFLREKGVPQETLAGITVTNPARFLSptlr  329
DSSP  HHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLllll


No 3: Query=2vc5A Sbjct=3k2gB Z-score=37.0

back to top
DSSP  ------------LLLLLLLlLLLLHHHLLLEELLLLLLLLLHHHH---------------
Query ------------MRIPLVGkDSIESKDIGFTLIHEHLRVFSEAVR---------------   33
ident              ||  |    | |   | || ||||                       
Sbjct slselspchvrsGRIXTVD-GPIPSSALGHTLXHEHLQNDCRCWWnppqeperqylaeap   59
DSSP  llllllllllllLEEEELL-EEEEHHHLLLEELLLLLLEELHHHLlllllhhhhhhhhll


DSSP  -----------hhlHHHL-lhhHHHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHH
Query -----------qqwPHLY-nedEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEK   81
ident                            |  |||     |   |||||  | |||      
Sbjct isieilselrqdpfVNKHnialDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRR  119
DSSP  llhhhhhhhhllhhHLLLlleeLLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHH


DSSP  HHHLLLLEEEELEELLLLLLLLHHHLLLLHHHHHHHHHHHHHLLLLLLLLLLLLEE-EEL
Query VVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVX-IAA  140
ident     ||   | | | |     |      | | |||       ||  ||    |    |  
Sbjct ISAETGVQVVXGAGYYLASSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGeIGV  179
DSSP  HHHHHLLEEEELLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEeELL


DSSP  LLLlLLHHHHHHHHHHHHHHHHHLLLEEEELLLLLLHHHHHHHHHHHLLLLHHHEEELLH
Query DEPgITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHL  200
ident      |   ||  | || |   |  |   |                ||| |       | 
Sbjct SSD-FTAEEEKSLRGAARAQVRTGLPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHX  238
DSSP  LLL-LLHHHHHHHHHHHHHHHHHLLLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLL


DSSP  HHL-LLHHHHHHHHHLLLEEEELLLLLLL--------LLLHHHHHHHHHHHHHLLLLLLE
Query GDT-DNIDYIKKIADKGSFIGLDRYGLDL--------FLPVDKRNETTLRLIKDGYSDKI  251
ident         |    |  | |   |  | |             |      | |   || | |
Sbjct NPShXDPVYQATLAQRGAFLEFDXIGXDFfyadqgvqCPSDDEVARAILGLADHGYLDRI  298
DSSP  HHHlLLHHHHHHHHHHLLEEEELLLLLLLeelllleeLLLHHHHHHHHHHHHHLLLHHHE


DSSP  EELLLLLLLlllllllHHHHhhhlllLLLLHHHHLHHHHHHLLLLLHHHHHHHHLHHHHH
Query MISHDYCCTidwgtakPEYKpklaprWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKK  311
ident   |||                                | | | |       |    ||  
Sbjct LLSHDVFVK---xxltRYGG------NGYAFVTKHFLPRLRRHGLDDAALETLXVTNPRR  349
DSSP  EELLLLLLH---hhlhHHLL------LLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHH


DSSP  HLL------
Query FFS------  314
ident  |       
Sbjct VFDasiegh  358
DSSP  HHLllllll


No 4: Query=2vc5A Sbjct=1bf6A Z-score=36.6

back to top
DSSP  llllllllllLLHHHlLLEELLLLLLLLLHHHHHhlhhhllhhhHHHHHHHHHHHHHHLL
Query mriplvgkdsIESKDiGFTLIHEHLRVFSEAVRQqwphlynedeEFRNAVNEVKRAMQFG   60
ident                 | || ||||                          |    |  |
Sbjct ----------SFDPT-GYTLAHEHLHIDLSGFKN---nvdcrldQYAFICQEMNDLMTRG   46
DSSP  ----------LLLLL-LEEEEEELLLEELHHHHL---lhhheelLHHHHHHHHHHHHHLL


DSSP  LLEEEELLLLLLLLLHHHHHHHHHLLLLEEEELEELLLLLLLLHHHLLLLHHHHHHHHHH
Query VKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIH  120
ident |      |    ||   ||  |   |||| || || |     |     ||  | |     
Sbjct VRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVD  106
DSSP  EEEEEELLLHHHLLLHHHHHHHHHHHLLEEEEEELLLLHHHLLLHHHHLLHHHHHHHHHH


DSSP  HHHLLLLLLLLLLLLEE-EELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELLLLlLHHH
Query DIKEGIQGTLNKAGFVX-IAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHnNTGL  179
ident  |  || ||  |||    |   |  ||   |||  ||| |   |  || ||       ||
Sbjct EIEQGIDGTELKAGIIAeIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFS-TMGL  165
DSSP  HHHLLLLLLLLLEEEEEeEELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH-LLHH


DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHH
Query EQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETT  239
ident ||   |   |||      ||    || | | |  | |     |  |     |  ||    
Sbjct EQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAML  225
DSSP  HHHHHHHHLLLLHHHEEELLLLLLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHH


DSSP  HHHHHLLLLLLEEELLLLLLLlllllllHHHHhhhlllLLLLHHHHLHHHHHHLLLLLHH
Query LRLIKDGYSDKIMISHDYCCTidwgtakPEYKpklaprWSITLIFEDTIPFLKRNGVNEE  299
ident   |   |     | | |                               || |   |    
Sbjct HALRDRGLLNRVMLSMDITRR---shlkANGG------YGYDYLLTTFIPQLRQSGFSQA  276
DSSP  HHHHHLLLHHHEEELLLLLLH---hhlhHHLL------LLLLHHHHLHHHHHHHLLLLHH


DSSP  HHHHHHLHHHHHHLL
Query VIATIFKENPKKFFS  314
ident        |||  || 
Sbjct DVDVMLRENPSQFFQ  291
DSSP  HHHHHHLHHHHHHLL


No 5: Query=2vc5A Sbjct=2y1hB Z-score=18.5

back to top
DSSP  llllllllllllhhhlLLEELLLLLLLLlhhhhhhlhhhllhhhHHHHHHHHHHHHHHLL
Query mriplvgkdsieskdiGFTLIHEHLRVFseavrqqwphlynedeEFRNAVNEVKRAMQFG   60
ident                 |    | ||                     |        |    
Sbjct --------------gvGLVDCHCHLSAP---------------dFDRDLDDVLEKAKKAN   31
DSSP  --------------llLEEEEEELLLLH---------------hHLLLHHHHHHHHHHLL


DSSP  LLEEEELLLLLLLLL--HHHHHHHHhlllLEEEELEELLLL------LLLLHhhllllhh
Query VKTIVDPTVMGLGRD--IRFMEKVVkatgINLVAGTGIYIY------IDLPFyflnrsid  112
ident |   |                |              |                       
Sbjct VVALVAVAEHSGEFEkiMQLSERYN----GFVLPCLGVHPVqgldqrSVTLK-----dld   82
DSSP  EEEEEELLLLHHHHHhhHHHHHHLL----LLEEEEELLLLEelllleELLHH-----hhh


DSSP  hHHHHHHHHHHllllllllLLLLE-EEELLLL-------llLHHHHHHHHHHHHHHHHHL
Query eIADLFIHDIKegiqgtlnKAGFV-XIAADEP-------giTKDVEKVIRAAAIANKETK  164
ident                              |                 |        |   
Sbjct vALPIIENYKD--------RLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLN  134
DSSP  hHHHHHHHHLL--------LLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHL


DSSP  LLEEEELLlllLHHHHHHHHHHHLLLLhhHEEELLHhHLLLhHHHHHHHHLLLEEEeLLL
Query VPIITHSNahnNTGLEQQRILTEEGVDpgKILIGHLgDTDNiDYIKKIADKGSFIGlDRY  224
ident  |   ||      |      | | |    | |     |             | |      
Sbjct LPVNVHSR---SAGRPTINLLQEQGAE--KVLLHAF-DGRP-SVAMEGVRAGYFFS-IPP  186
DSSP  LLEEEEEE---LLHHHHHHHHHHLLLL--LEEEELL-LLLH-HHHHHHHHLLLEEE-ELH


DSSP  LllllLLHHHHHHHHHHHhhllLLLLEEELLLLLlllllllllhhhhhhHLLL-LLLLHH
Query GldlfLPVDKRNETTLRLikdgYSDKIMISHDYCctidwgtakpeykpkLAPR-WSITLI  283
ident                  |        |    |                           |
Sbjct S---iIRSGQKQKLVKQL----PLTSICLETDSP-----------algpEKQVrNEPWNI  228
DSSP  H---hHLLHHHHHHHHHL----LHHHEEELLLLL-----------llllLLLLlLLHHHH


DSSP  HhLHHHHHHL-LLLL-HHHHHHHHlHHHHHHLL------
Query FeDTIPFLKR-NGVN-EEVIATIFkENPKKFFS------  314
ident             |   ||||      |  | |       
Sbjct S-ISAEYIAQvKGISvEEVIEVTT-QNALKLFPklrhll  265
DSSP  H-HHHHHHHHhHLLLhHHHHHHHH-HHHHHHLLlhhhhl


No 6: Query=2vc5A Sbjct=1onxA Z-score=18.3

back to top
DSSP  ----------------------------------------------llllllllllllhh
Query ----------------------------------------------mriplvgkdsiesk   14
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  hlLLEELLLLL-LLLLhHHHHhlhhhllhhhhhHHHHhhHHHHHHLLLLEEEELLLLL--
Query diGFTLIHEHL-RVFSeAVRQqwphlynedeefRNAVneVKRAMQFGVKTIVDPTVMG--   71
ident   ||   | ||      |                       |    ||   |        
Sbjct cpGFIDQHVHLiGGGGeAGPT---------trtPEVA--LSRLTEAGVTSVVGLLGTDsi  109
DSSP  eeLEEEEEELLlLLLLlLLHH---------hllLLLL--HHHHHHLLEEEEEELLLLLll


DSSP  -LLLL--HHHHHHHHHLlLLEEEELEELLLlllllhhhllllhhhhhHHHHHHHHLLlll
Query -LGRD--IRFMEKVVKAtGINLVAGTGIYIyidlpfyflnrsideiaDLFIHDIKEGiqg  128
ident                   ||     || |                       |       
Sbjct sRHPEslLAKTRALNEE-GISAWMLTGAYH----------vpsrtitGSVEKDVAII---  155
DSSP  lLLHHhhHHHHHHHHHH-LLEEEEEEELLL----------lllllllLLHHHHHHHL---


DSSP  llLLLLLEEEEL-LLLLLLhHHHHHHHHHHHHHHHHL------LLEEEELLLLLLHhHHH
Query tlNKAGFVXIAA-DEPGITkDVEKVIRAAAIANKETK------VPIITHSNAHNNTgLEQ  181
ident        || |  |               |                  |        |  
Sbjct --DRVIGVXCAIsDHRSAA-PDVYHLANMAAESRVGGllggkpGVTVFHMGDSKKA-LQP  211
DSSP  --LLEEEEEEEElLLLLLL-LLHHHHHHHHHHHHHHHhhhlllLEEEEEELLLLLL-LHH


DSSP  HHHHHH-LLLLHHHEEELLHHHLLL-HHHHHHHHHLLLEEEELlLLLLlLLLHhhHHHHH
Query QRILTE-EGVDPGKILIGHLGDTDN-IDYIKKIADKGSFIGLDrYGLDlFLPVdkRNETT  239
ident    | |   |   | |  |              | ||  |       |         |  
Sbjct IYDLLEnCDVPISKLLPTHVNRNVPlFEQALEFARKGGTIDIT-SSID-EPVA--PAEGI  267
DSSP  HHHHHHlLLLLHHHEEEELHHHLHHhHHHHHHHHHLLLLEEEE-LLLL-LLLL--HHHHH


DSSP  HHHHHLLL-LLLEEELLLLL-------lllllLLLLhhhhhhhlllLLLLHHHhLHHHHH
Query LRLIKDGY-SDKIMISHDYC-------ctidwGTAKpeykpklaprWSITLIFeDTIPFL  291
ident  |    |        | |                                     |   |
Sbjct ARAVQAGIpLARVTLSSDGNgsqpffddegnlTHIG---------vAGFETLL-ETVQVL  317
DSSP  HHHHHLLLlHHHEEEELLLLleeeeellllleEEEE---------eLLLHHHH-HHHHHH


DSSP  HL-LLLLHHHHHHHHLHHHHHHLL------------------------------------
Query KR-NGVNEEVIATIFKENPKKFFS------------------------------------  314
ident                      |                                      
Sbjct VKdYDFSISDALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyargklmvk  377
DSSP  HHhHLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeelleeeee


DSSP  -------------
Query -------------  314
ident              
Sbjct dgkacvkgtfetd  390
DSSP  lleelllllllll


No 7: Query=2vc5A Sbjct=3mkvA Z-score=17.6

back to top
DSSP  -----------------------------------------llllllllllllhhhlLLE
Query -----------------------------------------mriplvgkdsieskdiGFT   19
ident                                                          |  
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  ELLLLLLL---LLHHHHHhlhhhLLHHHHHHHHHHHHHHHHHLLLLEEEELLLllllLLH
Query LIHEHLRV---FSEAVRQqwphlYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVmglgRDI   76
ident   | |          |                ||         |  |  |          
Sbjct DLHVHVVAiefNLPRVAT-----LPNVLVTLRAVPIMRAMLRRGFTTVRDAGG----AGY  111
DSSP  EEEELLLLlllLHHHHLL-----LLHHHHHHHHHHHHHHHHHLLEEEEEELLL----LLH


DSSP  HHHHHHH--HLLLLEEEEL-EELLlLLLL------------------------lhhhlll
Query RFMEKVV--KATGINLVAG-TGIYiYIDL------------------------pfyflnr  109
ident  |   |      |  |                                            
Sbjct PFKQAVEsgLVEGPRLFVSgRALS-QTGGhadprarsdymppdspcgccvrvgalgrvad  170
DSSP  HHHHHHHllLLLLLEEEELlLEEE-LLLLlllllllllllllllllllllllllleeell


DSSP  LHHHHHHHHHHHHHlllllllLLLLLEEEELL----------LLLLlhHHHHHHHHHHHH
Query SIDEIADLFIHDIKegiqgtlNKAGFVXIAAD----------EPGItkDVEKVIRAAAIA  159
ident   ||                   |   || |                   |  |||    
Sbjct GVDEVRRAVREELQ-------MGADQIXIMASggvasptdpvGVFG--YSEDEIRAIVAE  221
DSSP  LHHHHHHHHHHHHH-------HLLLLEEEELLllllllllllLLLL--LLHHHHHHHHHH


DSSP  HHHHLLLEEEELLLLlLHHHHHHHHHhhllllhhhEEELLHHHllLHHHHHHHHHLLLEE
Query NKETKVPIITHSNAHnNTGLEQQRILteegvdpgkILIGHLGDtdNIDYIKKIADKGSFI  219
ident           |            |             | |             |  |   
Sbjct AQGRGTYVLAHAYTP-AAIARAVRCG--------vRTIEHGNL-iDDETARLVAEHGAYV  271
DSSP  HHLLLLLEEEEELLH-HHHHHHHHLL--------lLEEEELLL-lLHHHHHHHHHHLLEE


DSSP  EELLLLLL--------------------LLLLhhHHHHHHHHHHHLLLllLEEELLLLLL
Query GLDRYGLD--------------------LFLPvdKRNETTLRLIKDGYsdKIMISHDYCC  259
ident        |                                      |   |     |   
Sbjct VPTLVTYDalasegekyglppesiakiaDVHG--AGLHSIEIMKRAGV--KMGFGTDLLG  327
DSSP  ELLHHHHHhhhhhlllllllhhhhllhhHHHL--LHHHHHHHHHHHLL--LLLLLLLLLH


DSSP  llllllllhhhhhhhllllLLLHHHhLHHHHHhlllLLHHHHHHHHLHHHHHHLL-----
Query tidwgtakpeykpklaprwSITLIFeDTIPFLkrngVNEEVIATIFKENPKKFFS-----  314
ident                         |                                   
Sbjct ---------------eaqrLQSDEF-RILAEV----LSPAEVIASATIVSAEVLGmqdkl  367
DSSP  ---------------hhhhHLLHHH-HHHHLL----LLHHHHHHHLLHHHHHHLLlllll


DSSP  -----------------------------------------------
Query -----------------------------------------------  314
ident                                                
Sbjct grivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  lllllllllleeeellllllllllllllllllleeeelleeeeelll


No 8: Query=2vc5A Sbjct=1k6wA Z-score=17.3

back to top
DSSP  ------------------------------------llllllllllllhhhLLLEELLLL
Query ------------------------------------mriplvgkdsieskdIGFTLIHEH   24
ident                                                      |   | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LLL----------------llhHHHHhLHHHLLH-HHHHHHHHHHHHHHHHLLLLEEEEL
Query LRV----------------fseAVRQqWPHLYNE-DEEFRNAVNEVKRAMQFGVKTIVDP   67
ident |                                  |     |    |     |       
Sbjct LDTtqtagqpnwnqsgtlfegiERWA-ERKALLThDDVKQRAWQTLKWQIANGIQHVRTH  119
DSSP  LLLllllllllllllllhhhhhHHHH-LLHHHLLhHHHHHHHHHHHHHHHHLLEEEEEEE


DSSP  LLLL--lllLHHHHHHHHHLLL--LEEEELEELLLL-LLLLhhhllllhhhhHHHHHHHH
Query TVMG--lgrDIRFMEKVVKATG--INLVAGTGIYIY-IDLPfyflnrsideiADLFIHDI  122
ident              |  |       | |             |             |     
Sbjct VDVSdatltALKAMLEVKQEVApwIDLQIVAFPQEGiLSYP---------ngEALLEEAL  170
DSSP  EELLllllhHHHHHHHHHHHHLllLEEEEEEELLLLlLLLL---------lhHHHHHHHH


DSSP  HlllllllLLLLLEEEELLLLlLLHHHHHHHHHHHHHHHHHLLLEEEELLL----LLLHH
Query KegiqgtlNKAGFVXIAADEPgITKDVEKVIRAAAIANKETKVPIITHSNA----HNNTG  178
ident           |  |                              |  |            
Sbjct R-------LGADVVGAIPHFEfTREYGVESLHKTFALAQKYDRLIDVHCDEiddeQSRFV  223
DSSP  H-------LLLLEEEELHHHLlLHHHHHHHHHHHHHHHHHHLLEEEEEELLllllLLLHH


DSSP  HHHHHHHHHlLLLHHHEEELLHHHLL------LHHHHHHHHHLLLEEEElLLLL-LLLL-
Query LEQQRILTEeGVDPGKILIGHLGDTD------NIDYIKKIADKGSFIGLdRYGL-DLFL-  230
ident                     |                      |                
Sbjct ETVAALAHH-EGMGARVTASHTTAMHsyngayTSRLFRLLKMSGINFVA-NPLVnIHLQg  281
DSSP  HHHHHHHHH-HLLHHHEEEEELHHHHhllhhhHHHHHHHHHHHLLEEEE-LHHHhHHHLl


DSSP  ------lHHHHhhHHHHHHHLLLllLEEELLLLLlLLLLllllhhhhhhhllLLLLL--H
Query ------pVDKRneTTLRLIKDGYsdKIMISHDYCcTIDWgtakpeykpklapRWSIT--L  282
ident                      |        ||      |                     
Sbjct rfdtypkRRGI-tRVKEMLESGI--NVCFGHDDV-FDPW-----------ypLGTANmlQ  326
DSSP  lllllllLLLL-lLHHHHHHLLL--LEEELLLLL-LLLL-----------llLLLLLhhH


DSSP  HHHLHHH--HHHLLLLLHhHHHHHHLHHHHHHLL--------------------------
Query IFEDTIP--FLKRNGVNEeVIATIFKENPKKFFS--------------------------  314
ident           |   |                                             
Sbjct VLHMGLHvcQLMGYGQIN-DGLNLITHHSARTLNlqdygiaagnsanliilpaengfdal  385
DSSP  HHHHHHHhlLLLLHHHHH-HHHHHHLHHHHHHLLllllllllllllleeeellllhhhhh


DSSP  --------------------------------------
Query --------------------------------------  314
ident                                       
Sbjct rrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  hhllllleeeelleeeeellllleeeellleeeellll


No 9: Query=2vc5A Sbjct=1gkpA Z-score=17.3

back to top
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL
Query ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
ident                                                     ||   | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLLLLHHHhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLLLL--------lllLH
Query LRVFSEAVrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTVMG--------lgrDI   76
ident       |                      | |   |  |                     
Sbjct IYLPFMAT-----------fakdTHETGSKAALMGGTTTYIEMCCPSrnddalegyqlWK  109
DSSP  LLLEELLE-----------elllLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhHH


DSSP  HHHHHHHhllLLEEEELEELLLlllllhhhllllHHHHHHHHHHHHHLlllllllLLLLE
Query RFMEKVVkatGINLVAGTGIYIyidlpfyflnrsIDEIADLFIHDIKEgiqgtlnKAGFV  136
ident    |                                                        
Sbjct SKAEGNS---YCDYTFHMAVSK-----------fDEKTEGQLREIVAD-------GISSF  148
DSSP  HHHLLLL---LLEEEEEEELLL-----------lLLLHHHHHHHHHHL-------LLLEE


DSSP  EEELLLLlllhHHHHHHHHHHHHHHHHLLLEEEELL------------------------
Query XIAADEPgitkDVEKVIRAAAIANKETKVPIITHSN------------------------  172
ident ||                      ||  |    |                          
Sbjct XIFLSYKnffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhe  208
DSSP  EEEELLLllllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhll


DSSP  ------LLLLHHHHHHHHHHHLLLlhhHEEELLHhHLLLhhHHHHHHHLL-----LEEEE
Query ------AHNNTGLEQQRILTEEGVdpgKILIGHLgDTDNidYIKKIADKG-----SFIGL  221
ident                   |   |         ||                       |  
Sbjct psrpeaVEAEGTARFATFLETTGA---TGYVVHL-SCKP--ALDAAMAAKargvpIYIES  262
DSSP  llllhhHHHHHHHHHHHHHHHHLL---EEEELLL-LLHH--HHHHHHHHHhllllEEEEE


DSSP  lLLLL---------------------lLLLLhHHHHHHHHHHHHLLLllLEEELLLLLLL
Query dRYGL---------------------dLFLPvDKRNETTLRLIKDGYsdKIMISHDYCCT  260
ident                                              |         | |  
Sbjct -VIPHflldktyaerggveamkyimspPLRD-KRNQKVLWDALAQGF--IDTVGTDHCPF  318
DSSP  -EHHHhhllhhhhhllhhhhhllllllLLLL-LHHHHHHHHHHHLLL--LLEEELLLLLL


DSSP  ----------llLLLLlhhhhhhhlllLLLLHHHHLHHHHHH-LLLLLHHHHHHHHLHHH
Query ----------idWGTAkpeykpklaprWSITLIFEDTIPFLK-RNGVNEEVIATIFKENP  309
ident                              |             |                
Sbjct dteqkllgkeafTAIP--------ngiPAIEDRVNLLYTYGVsRGRLDIHRFVDAASTKA  370
DSSP  lhhhhhhhlllhHHLL--------lllLLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHH


DSSP  HHHLL-------------------------------------------------------
Query KKFFS-------------------------------------------------------  314
ident  | |                                                        
Sbjct AKLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtv  430
DSSP  HHHLLllllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeee


DSSP  ----------------------------
Query ----------------------------  314
ident                             
Sbjct rgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lleeeeelleelllllllllllllllll


No 10: Query=2vc5A Sbjct=4cqbA Z-score=17.1

back to top
DSSP  -------------------------------------llllllllllllhhhlLLEELLL
Query -------------------------------------mriplvgkdsieskdiGFTLIHE   23
ident                                                      ||   | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  LLLL------------------------LLHHHHHhlhhHLLHHHHHHHHHHHHHHHHHL
Query HLRV------------------------FSEAVRQqwphLYNEDEEFRNAVNEVKRAMQF   59
ident |                                           |  |            
Sbjct HMDKsftstgerlpkfwsrpytrdaaieDGLKYYK----NATHEEIKRHVIEHAHMQVLH  116
DSSP  LHHHllllllllllllllllllhhhhhhHHHHHHH----HLLHHHHHHHHHHHHHHHHHL


DSSP  LLLEEEELLLLL---lllLHHHHHHHHHLLL--LEEEELEELLLL-LLLLHhhllllhhh
Query GVKTIVDPTVMG---lgrDIRFMEKVVKATG--INLVAGTGIYIY-IDLPFyflnrside  113
ident |                                |                          
Sbjct GTLYTRTHVDVDsvaktkAVEAVLEAKEELKdlIDIQVVAFAQSGfFVDLE---------  167
DSSP  LEEEEEEEEELLlllllhHHHHHHHHHHHLLllLEEEEEEELLLLlLLLLL---------


DSSP  hHHHHHHHHHlllllllLLLLLEEEELLLLLLLHhHHHHHHHHHHHHHHHLLLEEEEL-L
Query iADLFIHDIKegiqgtlNKAGFVXIAADEPGITKdVEKVIRAAAIANKETKVPIITHS-N  172
ident    |                  |            ||          ||  | |  |   
Sbjct sESLIRKSLD-------MGCDLVGGVDPATRENN-VEGSLDLCFKLAKEYDVDIDYHIhD  219
DSSP  hHHHHHHHHH-------HLLLEEELLLLLLLLLL-HHHHHHHHHHHHHHLLLEEEEEElL


DSSP  LLL---LHHHHHHHHHHHLLlLHHHEEELLHHHLL-----LHHHHHHHHHL-LLEEEElL
Query AHN---NTGLEQQRILTEEGvDPGKILIGHLGDTD-----NIDYIKKIADK-GSFIGLdR  223
ident                  | |   |     |            |         |       
Sbjct IGTvgvYSINRLAQKTIENG-YKGRVTTSHAWCFAdapseWLDEAIPLYKDsGMKFVT-C  277
DSSP  LHHhhhHHHHHHHHHHHHLL-LLLLEEEEELLHHHhllhhHHHHHHHHHHHhLLEEEE-E


DSSP  LLLlllllHHHHhhHHHHHHHLLLllLEEELLLLLlLLLLllllhhhhhhhllLLLLL--
Query YGLdlflpVDKRneTTLRLIKDGYsdKIMISHDYCcTIDWgtakpeykpklapRWSIT--  281
ident                   |   |         |      |                    
Sbjct FSS----tPPTM--PVIKLLEAGI--NLGCASDNI-RDFW-----------vpFGNGDmv  317
DSSP  LLL----lLLLL--LHHHHHHLLL--EEEEELLLL-LLLL-----------llLLLLLhh


DSSP  HHHHLHHHH-hHLLLLLHHHHHHHHLHH-HHHHLL-------------------------
Query LIFEDTIPF-lKRNGVNEEVIATIFKEN-PKKFFS-------------------------  314
ident                     |                                       
Sbjct QGALIETQRleLKTNRDLGLIWKMITSEgARVLGIeknygievgkkadlvvlnslspqwa  377
DSSP  HHHHHHHHHhlLLLHHHHHHHHHHHLHHhHHHHLLhhhlllllllllleeeellllhhhh


DSSP  -------------------------
Query -------------------------  314
ident                          
Sbjct iidqakrlcvikngriivkdeviva  402
DSSP  hhhllleeeeeelleeeeelleell


No 11: Query=2vc5A Sbjct=4b3zD Z-score=16.7

back to top
DSSP  -------------------------------------llllllllllllhhhlLLEELLL
Query -------------------------------------mriplvgkdsieskdiGFTLIHE   23
ident                                                      |      
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  LLLLllhhhhhhlhhhllhhHHHHHHHHHHHHHHHLLLLEEEELLLLL-----llLLHHH
Query HLRVfseavrqqwphlynedEEFRNAVNEVKRAMQFGVKTIVDPTVMG-----lgRDIRF   78
ident  |                              |   |   | |  |              
Sbjct YLQK----------------TAADDFFQGTRAALVGGTTMIIDHVVPEpgsslltSFEKW  104
DSSP  LLLL----------------LLLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhHHHHH


DSSP  HHHHHHLLLLEEEELEELLlllLLLHhhllllhhHHHHHHHHHHHLLllllllLLLLEEE
Query MEKVVKATGINLVAGTGIYiyiDLPFyflnrsidEIADLFIHDIKEGiqgtlnKAGFVXI  138
ident  |               |                                          
Sbjct HEAADTKSCCDYSLHVDIT---SWYD--------GVREELEVLVQDK------GVNSFQV  147
DSSP  HHHHHLLLLLEEEEEEELL---LLLL--------LHHHHHHHHHHLL------LLLEEEE


DSSP  ELLLLlllhHHHHHHHHHHHHHHHHLLLEEEELL--------------------------
Query AADEPgitkDVEKVIRAAAIANKETKVPIITHSN--------------------------  172
ident                  |    |     |  |                            
Sbjct YMAYKdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghals  207
DSSP  ELLLLllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhh


DSSP  ----LLLLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEELLL-
Query ----AHNNTGLEQQRILTEEGVdpgKILIGHLgDTDN-IDYIKKIAD--KGSFIGLDRY-  224
ident                |            |          | |          |       
Sbjct rpeeLEAEAVFRAITIAGRINC---PVYITKV-MSKSaADIIALARKkgPLVFGEPIAAs  263
DSSP  llhhHHHHHHHHHHHHHHHHLL---LEEEEEE-LLHHhHHHHHHHHHhlLLEEEEELHHh


DSSP  --------------------lllLLLLhHHHHHHHHHHHHLLLllLEEELLLLLLL----
Query --------------------gldLFLPvDKRNETTLRLIKDGYsdKIMISHDYCCT----  260
ident                           |          |   |           |      
Sbjct lgtdgthywsknwakaaafvtspPLSPdPTTPDYLTSLLACGD--LQVTGSGHCPYstaq  321
DSSP  hhlllhhhhlllhhhhhhlllllLLLLlLLHHHHHHHHHHHLL--LLLLLLLLLLLlhhh


DSSP  ------llLLLLLhhhhhhhlllLLLLHHHHLHHHHHHLLL-LLHHHHHHHHLHHHHHHL
Query ------idWGTAKpeykpklaprWSITLIFEDTIPFLKRNG-VNEEVIATIFKENPKKFF  313
ident                          |              |   |         |  | |
Sbjct kavgkdnfTLIPE--------gvNGIEERMTVVWDKAVATGkMDENQFVAVTSTNAAKIF  373
DSSP  hhhhlllhHHLLL--------llLLLLLHHHHHHHHHLLLLlLLHHHHHHHHLHHHHHHH


DSSP  L-----------------------------------------------------------
Query S-----------------------------------------------------------  314
ident                                                             
Sbjct Nlyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgki  433
DSSP  Lllllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeellee


DSSP  --------------------------------------------
Query --------------------------------------------  314
ident                                             
Sbjct vfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  eeelleellllllllllllllllhhhhhhhhhhhhhllllllll


No 12: Query=2vc5A Sbjct=3cjpA Z-score=16.7

back to top
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhHHHHHHHHHHHHLL
Query mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeefRNAVNEVKRAMQFG   60
ident                      | |                             |     |
Sbjct ----------------LIIDGHTHVI--------------------LPVEKHIKIMDEAG   24
DSSP  ----------------LLEEEEEELL--------------------LLHHHHHHHHHHHL


DSSP  LLEEEELL----------------------------------lLLLLLL--HHHHHHHHh
Query VKTIVDPT----------------------------------vMGLGRD--IRFMEKVVk   84
ident |                                                           
Sbjct VDKTILFStsihpetavnlrdvkkemkklndvvngktnsmidvRRNSIKelTNVIQAYP-   83
DSSP  LLEEEEELllllhhhlllhhhhhhhhhhhhhhhlllllllhhhHHHHHHhhHHHHHHLL-


DSSP  lllLEEEELEELLLlllllhhhlllLHHHHHHHHHHHHHLLllllllLLLLEE-EELLLL
Query atgINLVAGTGIYIyidlpfyflnrSIDEIADLFIHDIKEGiqgtlnKAGFVX-IAADEP  143
ident       |                  |           |         |            
Sbjct ---SRYVGFGNVPV---------glSENDTNSYIEENIVNN------KLVGIGeLTPASG  125
DSSP  ---LLEEEEELLLL---------llLHHHHHHHHHHHLLLL------LLLEEEeELLLLL


DSSP  LllhhHHHHhHHHHHHHH-HHLLLEEEELLL--LLLHHHHHHHHHHHLLLLhhHEEELLH
Query GitkdVEKViRAAAIANK-ETKVPIITHSNA--HNNTGLEQQRILTEEGVDpgKILIGHL  200
ident                        ||  |           |                 || 
Sbjct Q----IKSL-KPIFKYSMdSGSLPIWIHAFNplVLQDIKEIAELCKAFPKV--PVILGHM  178
DSSP  L----HHHH-HHHHHHHHhLLLLLEEELLLLllLHHHHHHHHHHHHHLLLL--LEEEHHH


DSSP  hhLLLHHHHHHHHHLL--LEEEELLLlllllllhhHHHHHHHHHHHlLLLLLEEELLLLL
Query gdTDNIDYIKKIADKG--SFIGLDRYgldlflpvdKRNETTLRLIKdGYSDKIMISHDYC  258
ident     |       |            |                  |      |     |  
Sbjct -gGSNWMTAVELAKEIqnLYLDTSAY---------FSTFVLKIVIN-ELPLKCIFGTDMP  227
DSSP  -hHHHHHHHHHHHHHLllEEEELLLL---------LLHHHHHHHHH-HLLLLEELLLLLL


DSSP  lllllllllhhhhhhhlllLLLLHHHhLHHHHHhlllLLHHHHHHHHLHHHHHHLL-
Query ctidwgtakpeykpklaprWSITLIFeDTIPFLkrngVNEEVIATIFKENPKKFFS-  314
ident                        |     |           |       |       
Sbjct ------------------fGDLQLSI-EAIKKM---sNDSYVANAVLGDNISRLLNi  262
DSSP  ------------------lLLHHHHH-HHHHHH---lLLHHHHHHHHLHHHHHHHLl


No 13: Query=2vc5A Sbjct=4dlfA Z-score=16.6

back to top
DSSP  llllllllllllhhhlLLEELLLLLlLLLHHHH-hhlhhhllhhhhhhHHHHHHHHHHHL
Query mriplvgkdsieskdiGFTLIHEHLrVFSEAVR-qqwphlynedeefrNAVNEVKRAMQF   59
ident                      | |      |                             
Sbjct ---------------aLRIDSHQHF-WRYRAADypwigagmgvlardyLPDALHPLMHAQ   44
DSSP  ---------------lLLEEEEELL-LLLLHHHllllllllhhhllllLHHHHHHHHHHL


DSSP  LLLEEEELLLLL--lLLLH--HHHHHHHhlllLEEEELEELlllllllhhhllllHHHHH
Query GVKTIVDPTVMG--lGRDI--RFMEKVVkatgINLVAGTGIyiyidlpfyflnrsIDEIA  115
ident                                                             
Sbjct ALGASIAVQARAgrdETAFllELACDEA----RIAAVVGWE------------dlRAPQL   88
DSSP  LLLEEEEELLLLlhhHHHHhhHHHLLLL----LEEEEEELL------------llLLLLH


DSSP  HHhhhhHHLLLlllLLLLLLEEEELL--LLLLlHHHH--HHHHHHHHHHHhHLLLEEEEL
Query DLfihdIKEGIqgtLNKAGFVXIAAD--EPGItKDVE--KVIRAAAIANKeTKVPIITHS  171
ident         |       |                  |      |  |              
Sbjct AE---rVAEWR---GTKLRGFRHQLQdeADVR-AFVDdaDFARGVAWLQA-NDYVYDVLV  140
DSSP  HH---hHHLLL---LLLEEEEEELHHhlLLHH-HHHHlhHHHHHHHHHHH-LLLEEEELL


DSSP  LLLLL-HHHHHHHHhhhLLLLhhHEEELLHHHLL-------------LHHHHHHHHHLL-
Query NAHNN-TGLEQQRIlteEGVDpgKILIGHLGDTD-------------NIDYIKKIADKG-  216
ident                             | |                        |    
Sbjct FERQLpDVQAFCAR---HDAH--WLVLDHAGKPAlaefdrddtalarWRAALRELAALPh  195
DSSP  LHHHHhHHHHHHHH---LLLL--LEEEHHHHLLLhhhllllllhhhhHHHHHHHHHLLLl


DSSP  LEEEELLLLLLL-------llLHHHHHHHHHHHHHLLLLLLEEELLLLLlllllllllhh
Query SFIGLDRYGLDL-------flPVDKRNETTLRLIKDGYSDKIMISHDYCctidwgtakpe  269
ident     |                                     |   |             
Sbjct VVCKLSGLVTEAdwrrglrasDLRHIEQCLDAALDAFGPQRLMFGSDWP-----------  244
DSSP  EEEEELLLLLLLlllllllhhHHHHHHHHHHHHHHHHLHHHEEELLLLL-----------


DSSP  hhhhhLLLLLLLHHHHLHHHHHHLLlLLHHHHHHHHLHHHHHHLL--
Query ykpklAPRWSITLIFEDTIPFLKRNgVNEEVIATIFKENPKKFFS--  314
ident          |                                     
Sbjct ---vcLLAASYDEVASLVERWAESR-LSAAERSALWGGTAARCYAlp  287
DSSP  ---hhHHLLLHHHHHHHHHHHHHHH-LLHHHHHHHLLHHHHHHLLll


No 14: Query=2vc5A Sbjct=3ls9A Z-score=16.6

back to top
DSSP  -----------------------------------------llllllllllllhhhLLLE
Query -----------------------------------------mriplvgkdsieskdIGFT   19
ident                                                          |  
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE


DSSP  ELLLLLLL----------------------lLHHHHHHLHhHLLHHHHHHHHHHHHHHHH
Query LIHEHLRV----------------------fSEAVRQQWPhLYNEDEEFRNAVNEVKRAM   57
ident   | ||                           |           |     |        
Sbjct NSHQHLYEgamraipqlervtmaswlegvltRSAGWWRDG-KFGPDVIREVARAVLLESL  119
DSSP  EEEELHHHhhhlllhhhllllhhhhhhhhhhHHHHHHHLL-LLLHHHHHHHHHHHHHHHH


DSSP  HLLLLEEEELLLLL----lllLHHHHHHHHHLLLLEEEELEELLLL-----LLLLHHhll
Query QFGVKTIVDPTVMG----lgrDIRFMEKVVKATGINLVAGTGIYIY-----IDLPFYfln  108
ident   |  |  |             |          ||   |                     
Sbjct LGGITTVADQHLFFpgatadsYIDATIEAATDLGIRFHAARSSMTLgksegGFCDDL-fv  178
DSSP  HLLEEEEEEEELLLlllllllHHHHHHHHHHHHLLEEEEEELLLLLlhhhlLLLLHH-hl


DSSP  lLHHHHHHHHHHHHhlllllLLLL--------LLLEE-EELLlllllhhHHHHHHHHHHH
Query rSIDEIADLFIHDIkegiqgTLNK--------AGFVX-IAADepgitkdVEKVIRAAAIA  159
ident    |         |                                         | |  
Sbjct ePVDRVVQHCLGLI------DQYHepepfgmvRIALGpCGVP-----ydKPELFEAFAQM  227
DSSP  lLHHHHHHHHHHHH------HHHLllllllleEEEELlLLLL-----llLHHHHHHHHHH


DSSP  HHHHLLLEEEELLLLL-----------LHHHHHHHHHHhllllHHHEEELLHhHLLLHHH
Query NKETKVPIITHSNAHN-----------NTGLEQQRILTeegvdPGKILIGHLgDTDNIDY  208
ident      |   ||                                       |         
Sbjct AADYDVRLHTHFYEPLdagmsdhlygmTPWRFLEKHGW----aSDRVWLAHA-VVPPREE  282
DSSP  HHHHLLEEEEEELLLLhhhhhhhhhllLHHHHHHHLLL----lLLLEEEEEL-LLLLHHH


DSSP  HHHHHHLLLEEEELLLL-LLLLLLhhhhHHHHHHHHHLLLllLEEELLLLLlllllllll
Query IKKIADKGSFIGLDRYG-LDLFLPvdkrNETTLRLIKDGYsdKIMISHDYCctidwgtak  267
ident |   || |  |       |                   |                     
Sbjct IPEFADAGVAIAHLIAPdLRMGWG----LAPIREYLDAGI--TVGFGTTGS---------  327
DSSP  HHHHHHHLLEEEELHHHhHHLLLL----LLLHHHHHHLLL--EEEELLLLL---------


DSSP  hhhhhhhllLLLLL--HHHHLHHHHHH-------LLLLLHHHHHHHHLHH-HHHHLL---
Query peykpklapRWSIT--LIFEDTIPFLK-------RNGVNEEVIATIFKEN-PKKFFS---  314
ident                                                             
Sbjct -------asNDGGNllGDLRLAALAHRpadpnepEKWLSARELLRMATRGsAECLGRpdl  380
DSSP  -------llLLLLLhhHHHHHHHHHLHhhllllhHHLLLHHHHHHHLLHHhHHHLLLlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct gvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvlad  440
DSSP  lllllllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellll


DSSP  -------------
Query -------------  314
ident              
Sbjct lerivanttalip  453
DSSP  hhhhhhhhhhhll


No 15: Query=2vc5A Sbjct=3mtwA Z-score=16.5

back to top
DSSP  ------------------------------------------llllllllllllhhhlLL
Query ------------------------------------------mriplvgkdsieskdiGF   18
ident                                                           | 
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EELLLLLLL---llhHHHHhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEEELLlllllLL
Query TLIHEHLRV---fseAVRQqwphLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTvmglgRD   75
ident    | ||                 |             |     |  |            
Sbjct IDMHVHLDSlaevggYNSL----EYSDRFWSVVQTANAKKTLEAGFTTVRNVG-----AA  111
DSSP  EEEEELLLLlllllhHHHH----HLLHHHHHHHHHHHHHHHHHLLEEEEEELL-----LL


DSSP  HHHHHHHHHLLL------LEEEEL-EELLlLLLL-------------lhhhlllLHHHHH
Query IRFMEKVVKATG------INLVAG-TGIYiYIDL-------------pfyflnrSIDEIA  115
ident          |           |                                | ||  
Sbjct DYDDVGLREAIDagyvpgPRIVTAaISFG-ATGGhcdstffppsmdqknpfnsdSPDEAR  170
DSSP  LLHHHHHHHHHHllllllLEEEELlLLEE-LLLLllllllllhhhlllllllllLHHHHH


DSSP  HHHHHHHHlllllllLLLLLEEEELL----------LLLLlhhHHHHHHHHHHHHHHHLL
Query DLFIHDIKegiqgtlNKAGFVXIAAD----------EPGItkdVEKVIRAAAIANKETKV  165
ident        |         |   || |                        |          
Sbjct KAVRTLKK-------YGAQVIXICATggvfsrgnepGQQQ--lTYEEMKAVVDEAHMAGI  221
DSSP  HHHHHHHH-------LLLLEEEEELLllllllllllLLLL--lLHHHHHHHHHHHHHLLL


DSSP  LEEEELLLlLLHHHHHHHHHhhllllhhhEEELLHhHLLLHHHHHHHHHLLLEEEELLLL
Query PIITHSNAhNNTGLEQQRILteegvdpgkILIGHLgDTDNIDYIKKIADKGSFIGLDRYG  225
ident     |         |  |             | |         ||    ||     | | 
Sbjct KVAAHAHG-ASGIREAVRAG--------vDTIEHA-SLVDDEGIKLAVQKGAYFSMDIYN  271
DSSP  EEEEEELL-HHHHHHHHHLL--------lLEEEEL-LLLLHHHHHHHHHHLLEEELLLLL


DSSP  LL-------------------LLLLhHHHHHHHHHHHHLLLllLEEELLLLLllllllll
Query LD-------------------LFLPvDKRNETTLRLIKDGYsdKIMISHDYCctidwgta  266
ident  |                            |      | |   |     |          
Sbjct TDytqaegkkngvlednlrkdRDIG-ELQRENFRKALKAGV--KMVYGTDAG--------  320
DSSP  HHhhhhhhhhhlllhhhhhhhHHHH-HHHHHHHHHHHHHLL--EEELLLLLL--------


DSSP  lhhhhhhhllLLLL-LHHHhlHHHHHHLLLLLHHHHHHHHLHHHHHHLL-----------
Query kpeykpklapRWSI-TLIFedTIPFLKRNGVNEEVIATIFKENPKKFFS-----------  314
ident                            | |                              
Sbjct ----------IYPHgDNAK--QFAVMVRYGATPLQAIQSATLTAAEALGrskdvgqvavg  368
DSSP  ----------LLLLlLHHH--HHHHHHHLLLLHHHHHHHLLHHHHHHHLlllllllllll


DSSP  ------------------------------------
Query ------------------------------------  314
ident                                     
Sbjct rygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  lllleeeelllllllhhhhhllleeeelleeeelll


No 16: Query=2vc5A Sbjct=3giqA Z-score=16.3

back to top
DSSP  ----------------------------------------llllllllllllhhhlLLEE
Query ----------------------------------------mriplvgkdsieskdiGFTL   20
ident                                                         ||  
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  LLLLLLLllhhhhhhlhhhllhhhhHHHHHhhHHHHHHLLLLEEEELLllLLLL------
Query IHEHLRVfseavrqqwphlynedeeFRNAVneVKRAMQFGVKTIVDPTvmGLGR------   74
ident  | |                                   |  | |               
Sbjct VHGHDDL----------------mfVEKPD--LRWKTSQGITTVVVGNcgVSAApaplpg  102
DSSP  LLLLLLL----------------hhHHLLL--LHHHHLLLEEEEEELLllLLLLllllll


DSSP  --------------------LHHHH-HHHHhllLLEEEELEELL-----llllLLHHHLL
Query --------------------DIRFM-EKVVkatGINLVAGTGIY-----iyidLPFYFLN  108
ident                                   ||  |  |                  
Sbjct ntaaalallgetplfadvpaYFAALdAQRP---MINVAALVGHAnlrlaamrdPQAAPTA  159
DSSP  lllhhhhhhllllllllhhhHHHHHhHLLL---LLEEEEEEEHHhhhhhhlllLLLLLLH


DSSP  LLHHHHHHHHHHHHHLlllllllLLLLEEEELLllllLHHHHHHHHHHHHHHHHHLLLEE
Query RSIDEIADLFIHDIKEgiqgtlnKAGFVXIAADepgiTKDVEKVIRAAAIANKETKVPII  168
ident        |                |                       |    |      
Sbjct AEQQAMQDMLQAALEA-------GAVGFSTGLAyqpgAVAQAAELEGLARVAAERRRLHT  212
DSSP  HHHHHHHHHHHHHHHH-------LLLEEEEELLlllhHHLLHHHHHHHHHHHHHLLLEEE


DSSP  EE-LLLL---LLHHHHHHHHHHHLLLlhhHEEELLhHHLL-------LHHHHHHHHHLL-
Query TH-SNAH---NNTGLEQQRILTEEGVdpgKILIGHlGDTD-------NIDYIKKIADKG-  216
ident  |  |          |   |    |         |                   |     
Sbjct SHiRNEAdgvEAAVEEVLAIGRGTGC---ATVVSH-HKCMmpqnwgrSRATLANIDRARe  268
DSSP  EElLLLLllhHHHHHHHHHHHHHHLL---EEEELL-LLLLlhhhlllHHHHHHHHHHHHh


DSSP  ----LEEEElLLLLL---------------------------------------------
Query ----SFIGLdRYGLD---------------------------------------------  227
ident                                                             
Sbjct qgveVALDI-YPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdktt  327
DSSP  llllEEEEE-LLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhh


DSSP  ------------LLLLHHHHHHHHHhhhhlllLLLEEELLLLLLLlllllllHHHHhhhl
Query ------------LFLPVDKRNETTLrlikdgySDKIMISHDYCCTidwgtakPEYKpkla  275
ident                  |                  |   |                   
Sbjct aarrlapagaiyFAMDEDEVKRIFQ-------HPCCMVGSDGLPN-------DARP----  369
DSSP  hhhhhlleeeeeELLLHHHHHHHHH-------LLLEEELLLLLLL-------LLLL----


DSSP  lLLLLLHHHHLHHHHH-HLLL-LLHHHHHHHHLHHHHHHLL-------------------
Query pRWSITLIFEDTIPFL-KRNG-VNEEVIATIFKENPKKFFS-------------------  314
ident         |                |         |   |                    
Sbjct -HPRLWGSFTRVLGRYvREARlMTLEQAVARMTALPARVFGfaergvlqpgawadvvvfd  428
DSSP  -LLHHHHHHHHHHHHHhHHLLlLLHHHHHHHHLHHHHHHHLlllllllllllllleeeel


DSSP  -----------------------------------------------
Query -----------------------------------------------  314
ident                                                
Sbjct pdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  llllllllllllllllllleeeeeelleeeellllllllllllllll


No 17: Query=2vc5A Sbjct=4mupB Z-score=16.2

back to top
DSSP  llllllllllllhhhlLLEELLLLLL---lLLHHhhhhlhhhllhHHHHhHHHHHHHHHH
Query mriplvgkdsieskdiGFTLIHEHLR---vFSEAvrqqwphlyneDEEFrNAVNEVKRAM   57
ident                 |      |                                    
Sbjct lvrklsgtapnpafprGAVDTQMHMYlpgyPALP----ggpglppGALP-GPEDYRRLMQ   55
DSSP  llllllllllllllllLLEELLLLLLllllLLLL----lllllllLLLL-LHHHHHHHHH


DSSP  HLLLLEEEELLlLLLL-----LLHHHHHHHHhlllLEEEELEEllllllllhhhllllhh
Query QFGVKTIVDPTvMGLG-----RDIRFMEKVVkatgINLVAGTGiyiyidlpfyflnrsid  112
ident   |                                    |                    
Sbjct WLGIDRVIITQ-GNAHqrdngNTLACVAEMG----EAAHAVVI-----------------   93
DSSP  HHLLLEEEEEL-LHHHllllhHHHHHHHHHH----HHEEEEEL-----------------


DSSP  hHHHHhHHHHHLLllllLLLLLLEEEELLLllllhhHHHHHHHHHHHHHHHLLLEEEELL
Query eIADLfIHDIKEGiqgtLNKAGFVXIAADEpgitkdVEKVIRAAAIANKETKVPIITHSN  172
ident   |     |                |                |                 
Sbjct iDATTtEKDMEKL---tAAGTVGARIMDLP--ggavNLSELDAVDERAHAADWMVAVQFD  148
DSSP  lLLLLlHHHHHHH---hHLLEEEEEEELLL--llllLHHHHHHHHHHHHHLLLEEEEELL


DSSP  LLLL-hhHHHHHHHHhllllhhHEEELLHHHL--------llHHHHHHHHHLL-LEEEEL
Query AHNN-tgLEQQRILTeegvdpgKILIGHLGDT--------dnIDYIKKIADKG-SFIGLD  222
ident        |                   | |                 |  | |       
Sbjct GNGLldhLPRLQKIR------sRWVFDHHGKFfkgirtdgpeMAALLKLIDRGnLWFKFA  202
DSSP  HHHHhhhHHHHHLLL------lEEEELHHHHLllllllllhhHHHHHHHHHHLlEEEEEL


DSSP  LLllLLLLL----HHHHHHHHHHHHHlLLLLLEEELLLLLlllllllLLHHHHhhhlLLL
Query RYglDLFLP----VDKRNETTLRLIKdGYSDKIMISHDYCctidwgtAKPEYKpklaPRW  278
ident                                 |                           
Sbjct GV--YESSRkswpYADVAAFSRVIAA-HAPERIVWGTNWP----hnsVRETAA----YPD  251
DSSP  LH--HHLLLllllLHHHHHHHHHHHH-HLHHHEEELLLLL----lllLLLHHH----LLL


DSSP  LlLHHHhLHHHhhhlllLLHHHHHHHHLHHHHHHLL----
Query SiTLIFeDTIPflkrngVNEEVIATIFKENPKKFFS----  314
ident    |    |          |        |||   |     
Sbjct DaRLAE-LTLG----wlPDEAARHRALVENPEALFKlspv  286
DSSP  HhHHHH-HHHL----llLLHHHHHHHHLHHHHHHHLllll


No 18: Query=2vc5A Sbjct=3gg7A Z-score=16.2

back to top
DSSP  llllllllllllhhhlLLEELLLLLLLllhhhhhhlhhhllhhhhhHHHHHHHHHHHHLL
Query mriplvgkdsieskdiGFTLIHEHLRVfseavrqqwphlynedeefRNAVNEVKRAMQFG   60
ident                      | ||                        |          
Sbjct ----------------SLIDFHVHLDL------------------yPDPVAVARACEERQ   26
DSSP  ----------------LLEEEEELHHH------------------lLLHHHHHHHHHHLL


DSSP  LlEEEELLLLllLLLHHHHhHHHHlLLLEEEELEELLLLLLLLhhhllllhhhhhHHHHH
Query VkTIVDPTVMglGRDIRFMeKVVKaTGINLVAGTGIYIYIDLPfyflnrsideiaDLFIH  120
ident   |    |                          |                      |  
Sbjct L-TVLSVTTT-pAAWRGTL-ALAA-GRPHVWTALGFHPEVVSE-------raadlPWFDR   75
DSSP  L-EEEELLLL-hHHHHHHH-HHHL-LLLLEEELLLLLHHHLLL-------lhhhlHHHHH


DSSP  HHHllllllllLLLLEE-EELLLL----llLHHHHHHHHHHHHHHHHH-LLLEEEELLll
Query DIKegiqgtlnKAGFVX-IAADEP----giTKDVEKVIRAAAIANKET-KVPIITHSNah  174
ident               ||     |              |                  ||   
Sbjct YLP--------ETRFVGeVGLDGSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR--  125
DSSP  HHH--------HLLEEEeEELLLLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL--


DSSP  lLHHHHHHHHHHHLLLlhhHEEELLHhhLLLHHHHHHHHHLLLEEEELLLllllllLHHH
Query nNTGLEQQRILTEEGVdpgKILIGHLgdTDNIDYIKKIADKGSFIGLDRYgldlflPVDK  234
ident      |    |                              |                 |
Sbjct -RAESEVLNCLEANPR-sgTPILHWY--SGSVTELRRAISLGCWFSVGPT----mvRTQK  177
DSSP  -LLHHHHHHHHHHLHH-heEEEEELL--LLLHHHHHHHHHLLLEEEELHH----hhLLHH


DSSP  HHHHHHHHhhllLLLLEEELLLLLlllllllllhhhhhhHLLLLLLLHHHhLHHHHHHL-
Query RNETTLRLikdgYSDKIMISHDYCctidwgtakpeykpkLAPRWSITLIFeDTIPFLKR-  293
ident               |      |                                  |   
Sbjct GAALIRSM----PRDRVLTETDGP-----------flelDGQAALPWDVK-SVVEGLSKi  221
DSSP  HHHHHHHL----LHHHEEELLLLL-----------lleeLLEELLHHHHH-HHHHHHHHh


DSSP  LLLL-HHHHHHHhLHHHHHHLL-
Query NGVN-EEVIATIfKENPKKFFS-  314
ident       ||     |||       
Sbjct WQIPaSEVERIV-KENVSRLLGt  243
DSSP  HLLLhHHHHHHH-HHHHHHHHHl


No 19: Query=2vc5A Sbjct=2oofA Z-score=16.2

back to top
DSSP  ----------------------------------------------llllllllllllhh
Query ----------------------------------------------mriplvgkdsiesk   14
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  hlLLEELLLLLLLL----------------------------LHHHhhhlhhHLLHHHHH
Query diGFTLIHEHLRVF----------------------------SEAVrqqwphLYNEDEEF   46
ident   |    | ||                                            ||  |
Sbjct tpGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiisTVRA----trAASEDQLF  116
DSSP  eeLEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhHHHH----hhHLLHHHHH


DSSP  HHHHHHHHHHHHLLLLEEEELLLLL-----lllLHHHHHHHHHLLLLEEEELE-ELLLll
Query RNAVNEVKRAMQFGVKTIVDPTVMG-----lgrDIRFMEKVVKATGINLVAGT-GIYIyi  100
ident   |   ||     || |       |          |       |  |             
Sbjct ELALPRVKSLIREGVTTVEIKSGYGltledelkXLRVARRLGEALPIRVKTTLlAAHA--  174
DSSP  HHHHHHHHHHHHHLEEEEEEELLLLllhhhhhhHHHHHHHHHHHLLLEEEEEEeEELL--


DSSP  LLLHHH-LLLL-hHHHHH-HHHHHHHLLllllllLLLLEEEELLLLlllhhHHHHHHHHH
Query DLPFYF-LNRS-iDEIAD-LFIHDIKEGiqgtlnKAGFVXIAADEPgitkdVEKVIRAAA  157
ident   | |     |    |           |       |  |                     
Sbjct VPPEYRdDPDSwvETICQeIIPAAAEAG------LADAVDVFCEHI---gfSLAQTEQVY  225
DSSP  LLHHHLlLHHHhhHHHHHlHHHHHHHLL------LLLEEEEEELLL---llLHHHHHHHH


DSSP  HHHHHHLLLEEEELLL--LLLHHHHHHHHhhhllllhHHEEELLHhHLLLHHHHHHHHHL
Query IANKETKVPIITHSNA--HNNTGLEQQRIlteegvdpGKILIGHLgDTDNIDYIKKIADK  215
ident  |          |                        |     ||        |   |  
Sbjct LAADQYGLAVKGHXDQlsNLGGSTLAANF--------GALSVDHL-EYLDPEGIQALAHR  276
DSSP  HHHHHLLLEEEEEELLllLLLHHHHHHHL--------LLLEEEEL-LLLLHHHHHHHHHH


DSSP  LLEEEElLLLL--LLLLlhHHHHhHHHHHHHLLLllLEEELLLLLlllllllllhhhhhh
Query GSFIGLdRYGL--DLFLpvDKRNeTTLRLIKDGYsdKIMISHDYCctidwgtakpeykpk  273
ident |    |        |     |       | | |       | |                 
Sbjct GVVATL-LPTAfyFLKE--TKLP-PVVALRKAGV--PXAVSSDIN---------------  315
DSSP  LLEEEE-LHHHhhHLLL--LLLL-LHHHHHHLLL--LEEELLLLL---------------


DSSP  hlllLLLL--HHHHLHHHHHHlllLLHHHHHHHHLHHHHHHLL-----------------
Query laprWSIT--LIFEDTIPFLKrngVNEEVIATIFKENPKKFFS-----------------  314
ident                                                             
Sbjct pgtaPIVSlrXAXNXACTLFG---LTPVEAXAGVTRHAARALGeqeqlgqlrvgxladfl  372
DSSP  llllLLLLhhHHHHHHHHHHL---LLHHHHHHHLLHHHHHHLLlllllllllllllllee


DSSP  -------------------------------
Query -------------------------------  314
ident                                
Sbjct vwncghpaelsyligvdqlvsrvvngeetlh  403
DSSP  eellllllhhhhlllllleeeeeelleelll


No 20: Query=2vc5A Sbjct=2pajA Z-score=16.1

back to top
DSSP  ---------------------------------------------llllllllllllhhh
Query ---------------------------------------------mriplvgkdsieskd   15
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  lLLEELLLLLLL------lLHHHHhhlhhhlLHHHHHHHHHHHHHHHHHLLLLEEEELLL
Query iGFTLIHEHLRV------fSEAVRqqwphlyNEDEEFRNAVNEVKRAMQFGVKTIVDPTV   69
ident       | ||           |          |      |          |  |  |   
Sbjct pAWVNTHHHLFQsllkgepFRALF-------DERRFRLAARIGLIELARSGCATVADHNY  113
DSSP  eLEELLLLLHHHhhlllllLHHHL-------LHHHHHHHHHHHHHHHHLLLEEEEEELLL


DSSP  LL----lllLHHHHHHHHHLLLLEEEELEElLLLLlLLHH-------hlllLHHHHHHHH
Query MG----lgrDIRFMEKVVKATGINLVAGTGiYIYIdLPFY-------flnrSIDEIADLF  118
ident                      |   |   |                       |      
Sbjct VYypgmpfdSSAILFEEAEKLGLRFVLLRG-GATQ-TRQLeadlptalrpeTLDAYVADI  171
DSSP  LLlllllllHHHHHHHHHHHLLLEEEEEEL-LLLL-LLLLlllllhhhlllLHHHHHHHH


DSSP  HHHHhlllllLLLL--------LLLEEE-ELLLllllhHHHHHHHHHHHHHHHHLLLEEE
Query IHDIkegiqgTLNK--------AGFVXI-AADEpgitkDVEKVIRAAAIANKETKVPIIT  169
ident                                             |  |            
Sbjct ERLA------ARYHdaspramrRVVMAPtTVLY----sISPREMRETAAVARRLGLRMHS  221
DSSP  HHHH------HHLLllllllleEEEELLlLLLL----lLLHHHHHHHHHHHHHLLLEEEE


DSSP  ELLllLLHHHHHHHHHHhllllHHHEEELLHhHLLLHHHHHHHHHLLLEEEELLLLLLLL
Query HSNahNNTGLEQQRILTeegvdPGKILIGHLgDTDNIDYIKKIADKGSFIGLDRYGLDLF  229
ident |                            ||      | |   |  |             
Sbjct HLS-gKSPVAFCGEHDW----lGSDVWYAHL-VKVDADEIALLAQTGTGVAHCPQSNGRL  275
DSSP  ELL-lLLHHHHHHHLLL----lLLLEEEELL-LLLLHHHHHHHHHHLLEEEELHHHHHLL


DSSP  llhhhhhhHHHHHHHLLLllLEEELLLLLlllllllllhhhhhhhlllLLLL--HHHHLH
Query lpvdkrneTTLRLIKDGYsdKIMISHDYCctidwgtakpeykpklaprWSIT--LIFEDT  287
ident                 |      |  |                                |
Sbjct --------PVREMADAGV--PVSIGVDGA----------------asnEAADmiSEVHMT  309
DSSP  --------LLLLHHHHLL--LEEELLLHH----------------hhlLLLLhhHHHHHH


DSSP  HHHHHLLLLLHHHHHHHHLHHHHHHLL---------------------------------
Query IPFLKRNGVNEEVIATIFKENPKKFFS---------------------------------  314
ident                                                             
Sbjct WLAQRARLASIAEVIHWGTAGGARVMGldevgkvavgyaadiavyrlddpryfglhdpai  369
DSSP  HHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleeeeelllhhhlllllhhh


DSSP  ----------------------------------------------------
Query ----------------------------------------------------  314
ident                                                     
Sbjct gpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  hhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 21: Query=2vc5A Sbjct=3irsA Z-score=16.0

back to top
DSSP  llllllllllllhhhlLLEELLLLLL---LLLH----------hhhhhlhhhllhhhHHH
Query mriplvgkdsieskdiGFTLIHEHLR---VFSE----------avrqqwphlynedeEFR   47
ident                                                          |  
Sbjct ---------------lKIIDFRLRPPamgFLNAriytrpdirnrftrqlgfepapsaEEK   45
DSSP  ---------------lLLEELLLLLLlhhHHHLhhhhlhhhhhhhhhhhlllllhhhHHL


DSSP  HHHHHHHHHHHLLLLEEEELLLL-----LLLL--LHHHHHHHHhlllLEEEELEELllll
Query NAVNEVKRAMQFGVKTIVDPTVM-----GLGR--DIRFMEKVVkatgINLVAGTGIyiyi  100
ident             |    |                                     |    
Sbjct SLELMFEEMAAAGIEQGVCVGRNssvlgSVSNadVAAVAKAYP----DKFHPVGSI----   97
DSSP  LHHHHHHHHHHLLLLEEEEELLEellleELLHhhHHHHHHHLL----LLEEEEEEL----


DSSP  lllhhhllLLHHHHHHHHHHHHHlllllllLLLLLEEEELL----LLLLlhhHHHHHHHH
Query dlpfyflnRSIDEIADLFIHDIKegiqgtlNKAGFVXIAAD----EPGItkdVEKVIRAA  156
ident             |                      |                        
Sbjct ------eaATRKEAMAQMQEILD-------LGIRIVNLEPGvwatPMHV--dDRRLYPLY  142
DSSP  ------llLLHHHHHHHHHHHHH-------LLLLLEEELHHhlllLLLL--lLHHHHHHH


DSSP  HHhHHHHLLLEEEEL---------LLLLLHHHHHHHHHHhllllHHHEEELLHhHLLLHH
Query AIaNKETKVPIITHS---------NAHNNTGLEQQRILTeegvdPGKILIGHLgDTDNID  207
ident |        | |                                       |        
Sbjct AF-CEDNGIPVIMMTggnagpditYTNPEHIDRVLGDFP-----DLTVVSSHG-NWPWVQ  195
DSSP  HH-HHHLLLLEEEELlllllllhhHHLHHHHHHHHHHLL-----LLLEEEEHH-HLLLHH


DSSP  HHHHHHH--LLLEEEELLLllllllLHHHHHHHHHHHHHLLLLLLEEELLLLLlllllll
Query YIKKIAD--KGSFIGLDRYgldlflPVDKRNETTLRLIKDGYSDKIMISHDYCctidwgt  265
ident  |   |          | |                        |       |        
Sbjct EIIHVAFrrPNLYLSPDMY-----lYNLPGHADFIQAANSFLADRMLFGTAYP-------  243
DSSP  HHHHHHHhlLLEEEELHHH-----hLLLLLHHHHHHHHLLHHHHLLLLLLLLL-------


DSSP  llhhhhhhhlllLLLL-HHHHlHHHHHhlllLLHHHHHHHHLHHHHHHLL----
Query akpeykpklaprWSIT-LIFEdTIPFLkrngVNEEVIATIFKENPKKFFS----  314
ident                                        |   |          
Sbjct -----------mCPLKeYTEW-FLTLP----IKPDAMEKILHGNAERLLAqagr  281
DSSP  -----------lLLHHhHHHH-HHLLL----LLHHHHHHHHLHHHHHHHHhlll


No 22: Query=2vc5A Sbjct=2qpxA Z-score=15.8

back to top
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhlLHHH----------------
Query mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlyNEDE----------------   44
ident                      | |                                    
Sbjct ----gxddlsefvdqvPLLDHHCHFL-------------iDGKVpnrddrlaqvsteadk   43
DSSP  ----lllllhhhhhhlLEEEEEELLL-------------lLLLLllhhhhhhhhllllll


DSSP  -----------------------------------hhhhhHHHHHHHHHLLLLEEEELLL
Query -----------------------------------efrnaVNEVKRAMQFGVKTIVDPTV   69
ident                                                  |  |     | 
Sbjct dypladtknrlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTG  103
DSSP  lllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELL


DSSP  llllllhHHHHHHHHLLLLEEEELEELLL-llllLHHH--LLLLHHHHHHHHHHHHHLll
Query mglgrdiRFMEKVVKATGINLVAGTGIYI-yidlPFYF--LNRSIDEIADLFIHDIKEgi  126
ident                  ||   |                                     
Sbjct fvpddpiLDLDQTAELVGIPVKAIYRLEThaedfXLEHdnFAAWWQAFSNDVKQAKAH--  161
DSSP  lllllllLLHHHHHHHHLLLEEEEEEHHHhhhhhHLLLllHHHHHHHHHHHHHLLLLL--


DSSP  lllllLLLLEEEELLLLLL----------------------------LHHHHHHHHHHHH
Query qgtlnKAGFVXIAADEPGI----------------------------TKDVEKVIRAAAI  158
ident           |  |                                            | 
Sbjct -----GFVGFXSIAAYRVGlhlepvnvieaaagfdtwkhsgekrltsKPLIDYXLYHVAP  216
DSSP  -----LLLLEEELHHHHLLlllllllhhhhhhhhhhhhhhlllllllHHHHHHHHHHHHH


DSSP  HHHHHLLLEEEELLL------LLLH-HHHHhHHHHHLLLL-hhHEEELLHHHLllhHHHH
Query ANKETKVPIITHSNA------HNNT-GLEQqRILTEEGVD-pgKILIGHLGDTdniDYIK  210
ident        |   |               |   |           |    |           
Sbjct FIIAQDXPLQFHVGYgdadtdXYLGnPLLX-RDYLKAFTKkglKVVLLHCYPY--hREAG  273
DSSP  HHHHHLLLEEEEELLllllllHHHLlHHHH-HHHHHHHHHhllLEEEEELLLL--hHHHH


DSSP  HHHHLL--LEEEEL-LLLLllllLHHHHHHHHHHHHHLLLLLLEEELLLLLLLlllllll
Query KIADKG--SFIGLD-RYGLdlflPVDKRNETTLRLIKDGYSDKIMISHDYCCTidwgtak  267
ident   |               |                        |    |           
Sbjct YLASVFpnLYFDISlLDNL----GPSGASRVFNEAVELAPYTRILFASDASTY-------  322
DSSP  HHHHHLllEEEELLlHHHH----LHHHHHHHHHHHLLLLLHHHEELLLLLLLL-------


DSSP  hhhhhhhllllLLLHHHHLHHHHHHlLLLL----------HHHHHHHHLHHHHHHLL---
Query peykpklaprwSITLIFEDTIPFLKrNGVN----------EEVIATIFKENPKKFFS---  314
ident               |        |     |             |  |      |      
Sbjct ---------peXYGLAARQFKQALV-AHFNqlpfvdlaqkKAWINAICWQTSAKLYHqer  372
DSSP  ---------hhHHHHHHHHHHHHHH-HHHHllllllhhhhHHHHHHHHLHHHHHHLLlhh


DSSP  ----
Query ----  314
ident     
Sbjct elrv  376
DSSP  hhll


No 23: Query=2vc5A Sbjct=4c5yA Z-score=15.6

back to top
DSSP  ---------------------------------------------llllllllllllhhh
Query ---------------------------------------------mriplvgkdsieskd   15
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  lLLEELLLLLL------lLLHHhhhhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEEELLl
Query iGFTLIHEHLR------vFSEAvrqqwphLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTv   69
ident  |    | |                                     | | |     |   
Sbjct pGLWDCHMHFGgdddyynDYTS-----glATHPASSGARLARGCWEALQNGYTSYRDLA-  114
DSSP  eLEEEEEELLLlllllllLLHH-----hhHLLHHHHHHHHHHHHHHHHHLLEEEEEELL-


DSSP  llllllHHHHHHHH--HLLLLEEEEL-EELLLLL----------llLHHH----------
Query mglgrdIRFMEKVV--KATGINLVAG-TGIYIYI----------dlPFYF----------  106
ident                    | |                                      
Sbjct ---gygCEVAKAINdgTIVGPNVYSSgAALSQTAghgdifalpageVLGSygvmnprpgy  171
DSSP  ---llhHHHHHHHHllLLLLLEEEELlLEEELLLlllllllllhhhHHHHhlllllllll


DSSP  -------lllLHHHHHHHHHHHHHlllllllLLLLLEEEELL----------LLLLlhHH
Query -------lnrSIDEIADLFIHDIKegiqgtlNKAGFVXIAAD----------EPGItkDV  149
ident              |        |          |   |  |                   
Sbjct wgagplciadGVEEVRRAVRLQIR-------RGAKVIXVMASggvmsrddnpNFAQ--FS  222
DSSP  llllleeellLHHHHHHHHHHHHH-------HLLLLEEEELLllllllllllLLLL--LL


DSSP  HHHHHHHHHHHHHHLLLEEEELLLlLLHHHHHHHHHhhllllhhhEEELLHhhllLHHHH
Query EKVIRAAAIANKETKVPIITHSNAhNNTGLEQQRILteegvdpgkILIGHLgdtdNIDYI  209
ident                     |                            |          
Sbjct PEELKVIVEEAARQNRIVSAHVHG-KAGIMAAIKAG--------cKSLEHV-syaDEEVW  272
DSSP  HHHHHHHHHHHHHLLLLEEEEELL-HHHHHHHHHHL--------lLEEEEL-lllLHHHH


DSSP  HHHHHLLLEEEELLLLLL-------------------LLLLhhhhHHHHHHHHHLLLllL
Query KKIADKGSFIGLDRYGLD-------------------LFLPvdkrNETTLRLIKDGYsdK  250
ident      ||      |                                      || |    
Sbjct ELMKEKGILYVATRSVIEiflasngeglvkeswaklqALAD--shLKAYQGAIKAGV--T  328
DSSP  HHHHHHLLEEELLHHHHHhhhhhllllllllhhhlllHHHH--hhHHHHHHHHHLLL--L


DSSP  EEELLLLLlllllllllhhhhhhhllllLLLHHHhLHHHHHhlllLLHHHHHHHHLHHHH
Query IMISHDYCctidwgtakpeykpklaprwSITLIFeDTIPFLkrngVNEEVIATIFKENPK  310
ident |    |                         |                         |  
Sbjct IALGTDTA-----------------pggPTALEL-QFAVER--ggMTPLEAIKAATANAP  368
DSSP  EELLLLLL-----------------lllLLHHHH-HHHHHL--llLLHHHHHHHHLLLHH


DSSP  HHLL--------------------------------------------------------
Query KFFS--------------------------------------------------------  314
ident                                                             
Sbjct LSVGpqapltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwg  428
DSSP  HHHHhhlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllll


DSSP  --------
Query --------  314
ident         
Sbjct edarnpfl  436
DSSP  llllllll


No 24: Query=2vc5A Sbjct=2vunA Z-score=15.4

back to top
DSSP  --------------------------------------------llllllllllllhhhl
Query --------------------------------------------mriplvgkdsieskdi   16
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEELLLLLLlllhhhhhhlhhhllhhhhHHHH-----HHHHHHHHHLLLLEEEELLlLL
Query GFTLIHEHLRvfseavrqqwphlynedeeFRNA-----VNEVKRAMQFGVKTIVDPTvMG   71
ident |    | |                        |           |   || |        
Sbjct GLLDTHVHVS------------------gGDYAprqktMDFISSALHGGVTTMISAG-SP  101
DSSP  LEEEEEELLL------------------lLLEEhhhleELHHHHHHLLLEEEEEELL-LL


DSSP  LL---------------LLHHHHHHHHhlLLLEEE-ELEELlllllllhhhllllHHHHH
Query LG---------------RDIRFMEKVVkaTGINLV-AGTGIyiyidlpfyflnrsIDEIA  115
ident                               |                             
Sbjct HFpgrpkdaagtkalaiTLSKSYYNAR-pAGVKVHgGAVIL-------------eKGLTE  147
DSSP  LLllllllhhhhhhhhhHHHHHHHHLL-hHHLEEElLEELL-------------lLLLLH


DSSP  HHHHHHHHLlllllllLLLLEEEELllllllHHHH--HHHHHHHHHHHhHLLLEEEELLL
Query DLFIHDIKEgiqgtlnKAGFVXIAAdepgitKDVE--KVIRAAAIANKeTKVPIITHSNA  173
ident   ||   ||           |                        | |        |   
Sbjct EDFIEMKKE-------GVWIVGEVG----lgTIKNpeDAAPMVEWAHK-HGFKVQMHTGG  195
DSSP  HHHHHHHHL-------LLLEEEEEL----llLLLLhhHHHHHHHHHHH-LLLEEEEELLL


DSSP  L-----LLHHHHHHHHHHhllllhhhEEELLHHH---LLLHHHHHHHHH-LLLEEEELLL
Query H-----NNTGLEQQRILTeegvdpgkILIGHLGD---TDNIDYIKKIAD-KGSFIGLDRY  224
ident                               |               | |           
Sbjct TsipgsSTVTADDVIKTK-------pDVVSHINGgptAISVQEVDRIMDeTDFAMEIVQC  248
DSSP  LlllllLLLLHHHHHHHL-------lLEEELLLLlllLLLHHHHHHHHHhLLLEEEEELL


DSSP  lllllllhhhHHHHHHHHHHLL----LLLLEEELLLLLlllllllllhhhhhhhlLLLLL
Query gldlflpvdkRNETTLRLIKDG----YSDKIMISHDYCctidwgtakpeykpklaPRWSI  280
ident                                    |                       |
Sbjct ---------gNPKIADYVARRAaekgQLGRVIFGNDAP----------------sGTGLI  283
DSSP  ---------lLHHHHHHHHHHHhhhlLHHHEEEELLLL----------------lLLLLL


DSSP  -LHHHhLHHHHHHLL-LLLHHHHHHHHLHHHHHHLL------------------------
Query -TLIFeDTIPFLKRN-GVNEEVIATIFKENPKKFFS------------------------  314
ident    |                ||       |                              
Sbjct pLGIL-RNMCQIASMsDIDPEVAVCMATGNSTAVYGlntgviapgkeadliimdtplgsv  342
DSSP  lLHHH-HHHHHHHHHlLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeellllll


DSSP  -------------------------------------------
Query -------------------------------------------  314
ident                                            
Sbjct aedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  lllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 25: Query=2vc5A Sbjct=3e74A Z-score=15.4

back to top
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL
Query ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
ident                                                     |    | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LllllhhhhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLLllLLLL--------H
Query LrvfseavrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTVmgLGRD--------I   76
ident                                |   |  |                     
Sbjct I----------------------GYETGTRAAAKGGITTXIEXPL--NQLPatvdrasiE   96
DSSP  L----------------------LHHHHHHHHHHLLEEEEEELLL--LLLLllllhhhhH


DSSP  HHHHHHhHLLLLEEEELEELLllllllhhhllllhhHHHHHHHHHHHlllllllLLLLLE
Query RFMEKVvKATGINLVAGTGIYiyidlpfyflnrsidEIADLFIHDIKegiqgtlNKAGFV  136
ident            |      |                    |                    
Sbjct LKFDAAkGKLTIDAAQLGGLV--------------sYNIDRLHELDE-------VGVVGF  135
DSSP  HHHHHHlLLLLLEEEELEELL--------------lLLLLLHHHHHH-------HLLLLE


DSSP  EEELllllllhHHHHHHHHHHHHHHHHLLLEEEELL------------------------
Query XIAAdepgitkDVEKVIRAAAIANKETKVPIITHSN------------------------  172
ident |                   |    |   |   |                          
Sbjct XCFV-----rdVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyv  190
DSSP  EEEL-----llLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhh


DSSP  ------LLLLHHHHHHHHHHHLLLlhhHEEELLHhHLLLhhHHHHHHHLL-----LEEEE
Query ------AHNNTGLEQQRILTEEGVdpgKILIGHLgDTDNidYIKKIADKG-----SFIGL  221
ident                       |         |                           
Sbjct asrpvfTEVEAIRRVLYLAKVAGC---RLHVCHV-SSPE--GVEEVTRARqegqdITCES  244
DSSP  hlllhhHHHHHHHHHHHHHHHHLL---LEEELLL-LLHH--HHHHHHHHHhllllEEEEE


DSSP  L---------------lllLLLLLL-hHHHHHHHHHHHHLLLllLEEELLLLLLllllll
Query D---------------rygLDLFLP-vDKRNETTLRLIKDGYsdKIMISHDYCCtidwgt  265
ident                                         |         |         
Sbjct CphyfvldtdqfeeigtlaKCSPPIrdLENQKGXWEKLFNGE--IDCLVSDHSP------  296
DSSP  LlhhhhllhhhhhhhlhhhLLLLLLllHHHHHHHHHHHHLLL--LLEELLLLLL------


DSSP  LLHHHH-----HHHLllLLLLHHHHLHHHHHH-LLLLLHHHHHHHHLHHHHHHLL-----
Query AKPEYK-----PKLAprWSITLIFEDTIPFLK-RNGVNEEVIATIFKENPKKFFS-----  314
ident   || |                             |            |    |      
Sbjct CPPEXKagnixKAWGgiAGLQSCXDVXFDEAVqKRGXSLPXFGKLXATNAADIFGlqqkg  356
DSSP  LLLLLLlllllLLLLllLLHHHHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct riapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqg  416
DSSP  llllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellll


DSSP  -------------
Query -------------  314
ident              
Sbjct fpvapkgqfilkh  429
DSSP  lllllllleelll


No 26: Query=2vc5A Sbjct=2ffiA Z-score=15.4

back to top
DSSP  llllllllllllhhHLLLEELLLLLLlllhhHHHHLHhhllhHHHHhHHHHHHHHHHHLL
Query mriplvgkdsieskDIGFTLIHEHLRvfseaVRQQWPhlyneDEEFrNAVNEVKRAMQFG   60
ident                      | |          |                        |
Sbjct -------------lHLTAIDSHAHVFsrglnLASQRR--yapNYDA-PLGDYLGQLRAHG   44
DSSP  -------------lLLLLEELLLLLLlhhhhHHLLLL--lllLLLL-LHHHHHHHHHHLL


DSSP  LLEEEELL--lLLLLL-LHHHHHHHHHllllEEEELEELlllllllhhhllllhhhHHHH
Query VKTIVDPT--vMGLGR-DIRFMEKVVKatgiNLVAGTGIyiyidlpfyflnrsideIADL  117
ident     |       |            |      |                           
Sbjct FSHGVLVQpsfLGTDNrYLLSALQTVP---gQLRGVVXL----------------eRDVE   85
DSSP  LLEELLLLlhhHLLLLhHHHHHHHHLL---lLLLLLLLL----------------lLLLL


DSSP  hHHHHHLLllllLLLLLLEEEELLLLLLlhHHHH--hhHHHHHHHHHHLLLEEEELLLll
Query fIHDIKEGiqgtLNKAGFVXIAADEPGItkDVEK--viRAAAIANKETKVPIITHSNAhn  175
ident       |           |                   |       |       |     
Sbjct -QATLAEX---aRLGVRGVRLNLXGQDX--PDLTgaqwRPLLERIGEQGWHVELHRQV--  137
DSSP  -HHHHHHH---hLLLLLEEELLLLLLLL--LLLLllllHHHHHHHHHHLLEEEELLLL--


DSSP  LHHHHHHHHHHhLLLLhhHEEELL-HHHL--LLHH--HHHHHHHL----LLEEEELLLLL
Query NTGLEQQRILTeEGVDpgKILIGH-LGDT--DNID--YIKKIADK----GSFIGLDRYGL  226
ident        | |         | | |                                    
Sbjct ADIPVLVRALQ-PYGL--DIVIDHfGRPDarRGLGqpGFAELLTLsgrgKVWVKVSGIYR  194
DSSP  LLHHHHHHHHL-LLLL--LEEELHhHLLLllLLLLllLHHHHLLLllllLEEEEEELHHH


DSSP  llLLLHHHHHHHHHHHHHLLL----LLLEEELLLLLlllllllllhhhhhhHLLLLLLLH
Query dlFLPVDKRNETTLRLIKDGY----SDKIMISHDYCctidwgtakpeykpkLAPRWSITL  282
ident                                  |                      |   
Sbjct -lQGSPEENLAFARQALCALEahygAERLXWGSDWP------------htqHESEVSFGS  241
DSSP  -lLLLHHHHHHHHHHHHHHHHhhllHHHEEEELLLL------------lllLLLLLLHHH


DSSP  HHHlHHHHHHlllLLHHHHHHHHLHHHHHHLL----
Query IFEdTIPFLKrngVNEEVIATIFKENPKKFFS----  314
ident   |     |                     |     
Sbjct AVE-QFEALG---CSAQLRQALLLDTARALFGfele  273
DSSP  HHH-HHHHHL---LLHHHHHHHHLHHHHHHLLllll


No 27: Query=2vc5A Sbjct=1itqA Z-score=15.3

back to top
DSSP  llllllllllllhhhlLLEELLLLLLLLlhhhhhhlhhhLLHH--HHHH----hhhhHHH
Query mriplvgkdsieskdiGFTLIHEHLRVFseavrqqwphlYNED--EEFR----navnEVK   54
ident                      |  |                                   
Sbjct --dffrdeaerimrdsPVIDGHNDLPWQ-----lldmfnNRLQdeRANLttlagthtNIP   53
DSSP  --lhhhhhhhhhhlllLEEEEEELHHHH-----hhhhhlLLLLlhHHLLllllllllLHH


DSSP  HHHHLLLLEEEELLLLL-----------lllLHHHHHHHH---HLLL-------------
Query RAMQFGVKTIVDPTVMG-----------lgrDIRFMEKVV---KATG-------------   87
ident       |                                      |              
Sbjct KLRAGFVGGQFWSVYTPcdtqnkdavrrtleQMDVVHRMCrmyPETFlyvtssagirqaf  113
DSSP  HHHHLLEEEEEEEELLLhhhllllhhhhhhhHHHHHHHHHhhlLLLEeelllhhhhhhhh


DSSP  ----LEEEELEELLLlllllhhhllllhhHHHHHHHHHHHlllllllLLLLLEEEE----
Query ----INLVAGTGIYIyidlpfyflnrsidEIADLFIHDIKegiqgtlNKAGFVXIA----  139
ident          |                                                  
Sbjct regkVASLIGVEGGH-----------sidSSLGVLRALYQ-------LGMRYLTLThscn  155
DSSP  hlllEEEEEEEELHH-----------hllLLHHHHHHHHH-------LLEEEEELLllll


DSSP  -----LLLLL-----lLHHHHH-hHHHHHHHHHHHLLLEEEELlllllHHHHHHHHHHHL
Query -----ADEPG-----iTKDVEK-vIRAAAIANKETKVPIITHSnahnnTGLEQQRILTEE  188
ident                                     | |                     
Sbjct tpwadNWLVDtgdsepQSQGLSpfGQRVVKELNRLGVLIDLAH-----VSVATMKATLQL  210
DSSP  lllllLHHHLllllllLLLLLLhhHHHHHHHHHHHLLEEELLL-----LLHHHHHHHHHH


DSSP  lLLHHhEEELLHHhLLLH-----hhHHHHHHLL----LEEEELLllLLLLLL------HH
Query gVDPGkILIGHLGdTDNI-----dyIKKIADKG----SFIGLDRygLDLFLP------VD  233
ident           |                          |                      
Sbjct -SRAP-VIFSHSS-AYSVcasrrnvPDDVLRLVkqtdSLVMVNF--YNNYISctnkanLS  265
DSSP  -LLLL-LEELLLL-LLLLlllllllLHHHHHHHhhhlLEEEELL--LHHHHLllllllHH


DSSP  HHHHHHHHHHHLlLLLLEEELLLLLlllllllllhhhhhhHLLL--LLLLHHHhLHHHHH
Query KRNETTLRLIKDgYSDKIMISHDYCctidwgtakpeykpkLAPR--WSITLIFeDTIPFL  291
ident                       |                   |           | |  |
Sbjct QVADHLDHIKEVaGARAVGFGGDFD------------gvpRVPEglEDVSKYP-DLIAEL  312
DSSP  HHHHHHHHHHHHlLHHHEEELLLLL------------lllLLLLllLLLLLHH-HHHHHH


DSSP  HLLLLLHHHHHHHHLHHHHHHLL----------------------------------
Query KRNGVNEEVIATIFKENPKKFFS----------------------------------  314
ident  |    |         |    |                                   
Sbjct LRRNWTEAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHLLLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll


No 28: Query=2vc5A Sbjct=3nqbA Z-score=15.2

back to top
DSSP  llllllllLLLL------------------------------------------------
Query mriplvgkDSIE------------------------------------------------   12
ident                                                             
Sbjct --------EPADlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgal   52
DSSP  --------LLHHhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelle


DSSP  ----------------------hhhlLLEELLLLLLLllhhhhhhlhhhllhhhhhHHHH
Query ----------------------skdiGFTLIHEHLRVfseavrqqwphlynedeefRNAV   50
ident                           |    | |                          
Sbjct iasvhepasrrdaaqvidaggayvspGLIDTHXHIES-----------------sxITPA   95
DSSP  eeeeellllllleeeeeelllleeeeLEEEEEELHHH-----------------hlLLHH


DSSP  HHHHHHHHLLLLEEEELLllLLLL-------LHHHHHHHHHlLLLEEEELE-ELLLLlLL
Query NEVKRAMQFGVKTIVDPTvmGLGR-------DIRFMEKVVKaTGINLVAGT-GIYIYiDL  102
ident          || |||                                             
Sbjct AYAAAVVARGVTTIVWDP--HEFGnvhgvdgVRWAAKAIEN-LPLRAILLApSCVPS-AP  151
DSSP  HHHHHHHLLLEEEEEELL--HHHHhhhlhhhHHHHHHHHLL-LLLEEEEEElLLLLL-LL


DSSP  LHHhllllhhhHHHHHHHHHHLllllllLLLLLEE-EELLlllLLHHhhHHHHHHHHHHH
Query PFYflnrsideIADLFIHDIKEgiqgtlNKAGFVX-IAADepgITKDveKVIRAAAIANK  161
ident             |                  |    |      |  |          |  
Sbjct GLE--rggadfDAAILADLLSW------PEIGGIAeIXNXrgvIERD--PRXSGIVQAGL  201
DSSP  LLL--llllllLHHHHHHHHLL------LLEEEEEeELLHhhhHLLL--HHHHHHHHHHH


DSSP  HHLLLEEEELlLLLL--hHHHHHHHHhhllllhhhEEELLHhhLLLHhHHHHHHHLLLEE
Query ETKVPIITHSnAHNN--tGLEQQRILteegvdpgkILIGHLgdTDNIdYIKKIADKGSFI  219
ident         |                               |               |  |
Sbjct AAEKLVCGHA-RGLKnadLNAFXAAG--------vSSDHEL--VSGE-DLXAKLRAGLTI  249
DSSP  HHLLEEEELL-LLLLhhhHHHHHHLL--------lLEELLL--LLHH-HHHHHHHLLLEE


DSSP  EELlLLLLllllhhHHHHHHHHHHHL--LLLLLEEELLLLLLLlllllllhhhhhhhllL
Query GLDrYGLDlflpvdKRNETTLRLIKD--GYSDKIMISHDYCCTidwgtakpeykpklapR  277
ident  |     |                              |                     
Sbjct ELR-GSHD------HLLPEFVAALNTlgHLPQTVTLCTDDVFP------------ddllQ  290
DSSP  EEE-LLLH------HHHHHHHHHHHHhlLLLLLEEEELLLLLH------------hhhhH


DSSP  LLL-LHHHHLHHHHHhlllLLHHHHHHHHLHHHHHHLL----------------------
Query WSI-TLIFEDTIPFLkrngVNEEVIATIFKENPKKFFS----------------------  314
ident                       |        |                            
Sbjct GGGlDDVVRRLVRYG----LKPEWALRAATLNAAQRLGrsdlgliaagrradivvfedln  346
DSSP  LLLhHHHHHHHHHLL----LLHHHHHHHHLHHHHHHHLlllllllllllllleeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct gfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlati  406
DSSP  llleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct drprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafatt  466
DSSP  ellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct vshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleev  526
DSSP  llllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct arafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespvie  586
DSSP  hhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleee


DSSP  -
Query -  314
ident  
Sbjct v  587
DSSP  l


No 29: Query=2vc5A Sbjct=3griA Z-score=15.1

back to top
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL
Query ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
ident                                                     ||   | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLLLLhhhhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLlllLLLL---------
Query LRVFSeavrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTvmgLGRD---------   75
ident ||                           | |   |  |          |          
Sbjct LREPG-------------geykeTIETGTKAAARGGFTTVCPXP---NTRPvpdsvehfe  104
DSSP  LLLLL-------------lllllLHHHHHHHHHHLLEEEEEELL---LLLLllllhhhhh


DSSP  --HHHHHHHHhllLLEEEELEEL---LLLLlllhhhllllhhhHHHHHHHHHHlllllll
Query --IRFMEKVVkatGINLVAGTGI---YIYIdlpfyflnrsideIADLFIHDIKegiqgtl  130
ident                       |                        |    |       
Sbjct alQKLIDDNA---QVRVLPYASIttrQLGK-------------ELVDFPALVK-------  141
DSSP  hhHHHHHHHL---LLEELLLEELlhhHLLL-------------LLLLHHHHHL-------


DSSP  LLLLLEEEElllllllhHHHHHHHHHHHHHHHHLLLEEEELL------------------
Query NKAGFVXIAadepgitkDVEKVIRAAAIANKETKVPIITHSN------------------  172
ident   |                        |        |  |                    
Sbjct EGAFAFTDD----gvgvQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrske  197
DSSP  LLLLLEEEL----llllLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhh


DSSP  ---------LLLLHHHHHHHHHHHLLLlhhHEEELLHHhllLHHHHHHHHHLL-----LE
Query ---------AHNNTGLEQQRILTEEGVdpgKILIGHLGdtdNIDYIKKIADKG-----SF  218
ident                          |         |            | |         
Sbjct lgipgipniCESVQIARDVLLAEAAGC---HYHVCHVS---TKESVRVIRDAKragihVT  251
DSSP  hllleellhHHHHHHHHHHHHHHHHLL---LEEELLLL---LHHHHHHHHHHHhllllEE


DSSP  EEEL---------------lllLLLLLL-hhhhHHHHHHHHHLLLllLEEELLLLLLlll
Query IGLD---------------rygLDLFLP-vdkrNETTLRLIKDGYsdKIMISHDYCCtid  262
ident                                   |  |    ||      |  |      
Sbjct AEVTphhlllteddipgnnaiyKXNPPLrstedREALLEGLLDGT--IDCIATDHAP---  306
DSSP  EEELhhhhhllhhhlllllhhhLLLLLLllhhhHHHHHHHHHLLL--LLEELLLLLL---


DSSP  lllLLHHHH-----HHHLllLLLL-HHHHLHHHHHH-LLLLLHHHHHHHHLHHHHHHLL-
Query wgtAKPEYK-----PKLAprWSIT-LIFEDTIPFLK-RNGVNEEVIATIFKENPKKFFS-  314
ident         |                  |                         |   |  
Sbjct ---HARDEKaqpxeKAPF-gIVGSeTAFPLLYTHFVkNGDWTLQQLVDYLTIKPCETFNl  362
DSSP  ---LLHHHHlllllLLLL-lLLLLlLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct eygtlkengyadltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  lllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel


No 30: Query=2vc5A Sbjct=3pnuA Z-score=14.6

back to top
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhHHHHHHHHHHHHHHlL
Query mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeEFRNAVNEVKRAMQfG   60
ident                      | |||                                  
Sbjct ---enlyfqsnamklkNPLDMHLHLR------------------DNQMLELIAPLSAR-D   38
DSSP  ---llllllllleeeeLLEEEEELLL------------------LHHHHHHHHHHHHL-L


DSSP  LLEEEELLLlLLLL-----LHHHHHHHHHLLL---LEEEELEELLllllllhhhllllhh
Query VKTIVDPTVmGLGR-----DIRFMEKVVKATG---INLVAGTGIYiyidlpfyflnrsid  112
ident     |                       ||                              
Sbjct FCAAVIMPNlIPPLcnledLKAYKMRILKACKdenFTPLMTLFFK--------------n   84
DSSP  LLEEEELLLlLLLLllhhhHHHHHHHHHHHHLlllLEEEEEEELL--------------l


DSSP  hHHHHHHHHHHllllllllLLLLEEEELL--------llLLLHhHHHHhHHHHHHHHHHL
Query eIADLFIHDIKegiqgtlnKAGFVXIAAD--------epGITKdVEKViRAAAIANKETK  164
ident                         |                    |        |     
Sbjct yDEKFLYSAKD--------EIFGIXLYPAgittnsnggvSSFD-IEYL-KPTLEAMSDLN  134
DSSP  lLHHHHHHHLL--------LLLEEEELLLllllllllllLLLL-HHHH-HHHHHHHHHLL


DSSP  LLEEEELL--------LLLLHhHHHHHHHHHLLLLhhHEEELLHhHLLLhhHHHHHHHLL
Query VPIITHSN--------AHNNTgLEQQRILTEEGVDpgKILIGHLgDTDNidYIKKIADKG  216
ident  |   |            |                  ||   |   |          |  
Sbjct IPLLVHGEtndfvmdrESNFA-KIYEKLAKHFPRL--KIVMEHI-TTKT--LCELLKDYE  188
DSSP  LLEEELLLllllhhhlLHHHH-HHHHHHHHHLLLL--LEEELLL-LLHH--HHHHHHHLL


DSSP  -LEEEElLLLL--------------------lLLLLhHHHHHHHHHHHhlLLLLLEEELL
Query -SFIGLdRYGL--------------------dLFLPvDKRNETTLRLIkdGYSDKIMISH  255
ident                                          |    |       | |   
Sbjct nLYATI-TLHHliitlddviggkmnphlfckpIAKR-YEDKEALCELA-fSGYEKVMFGS  245
DSSP  lEEEEE-LLHHhlllhhhhhlllllhhhllllLLLL-HHHHHHHHHHH-hLLLLLEEELL


DSSP  LLLLLlllLLLLhhhhhhhlllLLLLHHHHLHHHHHHLLlLLHHHHHHHHLHHHHHHLL-
Query DYCCTidwGTAKpeykpklaprWSITLIFEDTIPFLKRNgVNEEVIATIFKENPKKFFS-  314
ident |       | |            |   |        | |   ||        |  |    
Sbjct DSAPH-pkGCAA--------gvFSAPVILPVLAELFKQN-SSEENLQKFLSDNTCKIYDl  295
DSSP  LLLLL-llLLLL--------llLLHHHHHHHHHHHHHHH-LLHHHHHHHHLHHHHHHHLl


DSSP  -------------------------------------------
Query -------------------------------------------  314
ident                                            
Sbjct kfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  lllllleeeeellleelllleelllleellllllleelleell


No 31: Query=2vc5A Sbjct=2ogjA Z-score=14.5

back to top
DSSP  ----------------------------------------llllllllllllhhhlLLEE
Query ----------------------------------------mriplvgkdsieskdiGFTL   20
ident                                                         |   
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  LLLLL-LLLLhhhhhhlhhhllhhhhhhhhhhHHHH-HHHLLLLEEEE-LLLLllLLLH-
Query IHEHL-RVFSeavrqqwphlynedeefrnavnEVKR-AMQFGVKTIVD-PTVMglGRDI-   76
ident  | |                                     || | ||            
Sbjct LHVHIwHGGT------------------disiRPSEcGAERGVTTLVDaGSAGeaNFHGf  102
DSSP  EEELLlLLLL------------------llllLHHHlLHHHLEEEEEEeLLLLllLHHHh


DSSP  -HHHHHHHhllLLEEEELEELL-----------LLLLLLhhhllllhhhHHHHHHHHHHL
Query -RFMEKVVkatGINLVAGTGIY-----------IYIDLPfyflnrsideIADLFIHDIKE  124
ident                 |                   |              |       |
Sbjct rEYIIEPS---RERIKAFLNLGsiglvacnrvpELRDIK--------diDLDRILECYAE  151
DSSP  hHHLLLLL---LLEEEEEEELLlllllllllllLLLLHH--------hlLHHHHHHHHHL


DSSP  LLllllLLLLLEEEELLLL-LLLHhHHHHHHHHHHHHHHHLLLEEEELLlLLLH-HHHHH
Query GIqgtlNKAGFVXIAADEP-GITKdVEKVIRAAAIANKETKVPIITHSNaHNNT-GLEQQ  182
ident             |  |                     |  |||   |          |  
Sbjct NS----EHIVGLXVRASHViTGSW-GVTPVKLGKKIAKILKVPXXVHVG-EPPAlYDEVL  205
DSSP  LL----LLEEEEEEEELHHhHLLL-LLHHHHHHHHHHHHHLLLEEEEEL-LLLLlHHHHH


DSSP  HHHhhllllHHHEEELLHHHL----LLHH---HHHHHHHL-LLEEEELLLLLlllllhhh
Query RILteegvdPGKILIGHLGDT----DNID---YIKKIADK-GSFIGLDRYGLdlflpvdk  234
ident  ||             |                        |        |         
Sbjct EIL------GPGDVVTHCFNGksgsSIXEdedLFNLAERCeGIRLDIGHGGA------sf  253
DSSP  HHL------LLLLEEELLLLLllllLLLLlhhHHHHHHHLlLLEEELLLLLL------ll


DSSP  HHHHHHHHHHLLLLlLEEELLLLLLllllllllhhhhhhhLLLLLllHHHHlHHHHHHLL
Query RNETTLRLIKDGYSdKIMISHDYCCtidwgtakpeykpklAPRWSitLIFEdTIPFLKRN  294
ident         |  |      || |                              |   |   
Sbjct SFKVAEAAIARGLL-PFSISTDLHG------------hsxNFPVW--DLAT-TXSKLLSV  297
DSSP  LHHHHHHHHHLLLL-LLLLLLLLLL------------lllLLLLL--LHHH-HHHHHHHL


DSSP  LLLHHHHHHHHLHHHHHHLL----------------------------------------
Query GVNEEVIATIFKENPKKFFS----------------------------------------  314
ident     |        ||                                             
Sbjct DXPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleatdsngdvsrlkrl  357
DSSP  LLLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeeellllleeeeeee


DSSP  ----------------------
Query ----------------------  314
ident                       
Sbjct fepryavigaeaiaasryipra  379
DSSP  eeeeeeeelleeeellllllll


No 32: Query=2vc5A Sbjct=2dvtA Z-score=14.4

back to top
DSSP  llllllllllllhhhlLLEELLLLlLLLLHHHH-----hhlhhhllhhhhhhHHHH-HHH
Query mriplvgkdsieskdiGFTLIHEHlRVFSEAVR-----qqwphlynedeefrNAVN-EVK   54
ident                 |     ||     |                             |
Sbjct --------------mqGKVALEEH-FAIPETLQdsagfvpgdywkelqhrllDIQDtRLK   45
DSSP  --------------llLEEEEEEE-ELLHHHHHhhlllllllhhhhhhhhhhLLLLhHHH


DSSP  HHHHLLLLEEEELL----------------lLLLLL--LHHHHHHHHhlllLEEEELEEL
Query RAMQFGVKTIVDPT----------------vMGLGR--DIRFMEKVVkatgINLVAGTGI   96
ident      |  |                                   |          |    
Sbjct LMDAHGIETMILSLnapavqaipdrrkaieiARRANdvLAEECAKRP----DRFLAFAAL  101
DSSP  HHHHLLEEEEEEEElllhhhhlllhhhhhhhHHHHHhhHHHHHHHLL----LLEEEEELL


DSSP  lllllllhhhllllHHHHHHHHHHHHHLLllllllLLLLEEEELL----llllLHHHH--
Query yiyidlpfyflnrsIDEIADLFIHDIKEGiqgtlnKAGFVXIAAD----epgiTKDVE--  150
ident                |                                            
Sbjct ----------plqdPDAATEELQRCVNDL------GFVGALVNGFsqegdgqtPLYYDlp  145
DSSP  ----------llllHHHHHHHHHHHHHLL------LLLEEEEELLllllllllLLLLLlh


DSSP  HHHHHhHHHHHHHLLLEEEEL-----------------------LLLL--LHHHHHH-HH
Query KVIRAaAIANKETKVPIITHS-----------------------NAHN--NTGLEQQ-RI  184
ident               ||   |                         |       |      
Sbjct QYRPF-WGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtaVHALRLMaSG  204
DSSP  HHHHH-HHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLL


DSSP  HHHLLLLHhHEEELLHHHLlLHHH---------------------hHHHHHLLLEEEELL
Query LTEEGVDPgKILIGHLGDTdNIDY---------------------iKKIADKGSFIGLDR  223
ident |  |      |  || |                                      |    
Sbjct LFDEHPRL-NIILGHMGEGlPYMMwridhrnawvklpprypakrrfMDYFNENFHITTSG  263
DSSP  HHHHLLLL-LEEELHHHLLhHHHHhhhhhllllllllllllllllhHHHHHHHEEEELLL


DSSP  LlllllllhhhHHHHHHHHHHLLLLLLEEELLLLLlllllllllhhhhhhhlllLLLLHH
Query YgldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctidwgtakpeykpklaprWSITLI  283
ident            |  |    |     | |  | |                       |   
Sbjct N---------fRTQTLIDAILEIGADRILFSTDWP------------------fENIDHA  296
DSSP  L---------lLHHHHHHHHLLLLHHHEELLLLLL------------------lLLHHHH


DSSP  HHLHHHHHhlllLLHHHHHHHHLHHHHHHLL--
Query FEDTIPFLkrngVNEEVIATIFKENPKKFFS--  314
ident               |     |   |    |   
Sbjct SDWFNATS----IAEADRVKIGRTNARRLFKld  325
DSSP  HHHHHHLL----LLHHHHHHHHLHHHHHHLLll


No 33: Query=2vc5A Sbjct=4rdvB Z-score=14.3

back to top
DSSP  ---------------------------------llllllllllllhhhLLLEELLLLLLL
Query ---------------------------------mriplvgkdsieskdIGFTLIHEHLRV   27
ident                                                  |    | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFQ   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHH


DSSP  ----------------------lLHHHHHhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEE
Query ----------------------fSEAVRQqwphLYNEDEEFRNAVNEVKRAMQFGVKTIV   65
ident                                            |          |     
Sbjct ramaglaevagnpndsfwtwrelMYRMVA----RLSPEQIEVIACQLYIEMLKAGYTAVA  116
DSSP  hhhlllllllllllllhhhhhhhHHHHHL----LLLHHHHHHHHHHHHHHHHHHLEEEEE


DSSP  ELLL----------lllllLHHHHHHHHHLLLLEEEELEELLL---LLLLLHHhllllhh
Query DPTV----------mglgrDIRFMEKVVKATGINLVAGTGIYI---YIDLPFYflnrsid  112
ident                              | || |      |        |         
Sbjct EFHYvhhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYShagFGGQPASegqrrfi  176
DSSP  EEELllllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLeeeLLLEELLhhhllll


DSSP  hHHHHHHHHHHLLLllLLLL----lLLEE-EELLlllllhHHHHHHHHHHHHhHHHLLLE
Query eIADLFIHDIKEGIqgTLNK----aGFVX-IAADepgitkDVEKVIRAAAIAnKETKVPI  167
ident                                              |     |      | 
Sbjct nGSEAYLELLQRLR--APLEaaghsLGLCfHSLR-----aVTPQQIATVLAA-GHDDLPV  228
DSSP  lLHHHHHHHHHHHH--HHHHhhlleELEEeLLLL-----lLLHHHHHHHHLL-LLLLLLE


DSSP  EEELLLLL------------LHHHHHHHHHHhlllLHHHEEELLHHhLLLHHHHHHHHHL
Query ITHSNAHN------------NTGLEQQRILTeegvDPGKILIGHLGdTDNIDYIKKIADK  215
ident   |                                        |             |  
Sbjct HIHIAEQQkevddcqawsgrRPLQWLYENVA----VDQRWCLVHAT-HADPAEVAAMARS  283
DSSP  EEEELLLHhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEELL-LLLHHHHHHHHHH


DSSP  LLEEEeLLLL---LLLLLlhhhhHHHHHHHHHLLLllLEEELLLLLlllllllllhhhhh
Query GSFIGlDRYG---LDLFLpvdkrNETTLRLIKDGYsdKIMISHDYCctidwgtakpeykp  272
ident |   |                            |      |  |                
Sbjct GAVAG-LCLSteaNLGDG-----IFPATDFLAQGG--RLGIGSDSH--------------  321
DSSP  LLEEE-ELHHhhhHLLLL-----LLLHHHHHHLLL--EEEELLLLL--------------


DSSP  hhlllLLLL--HHHHLHHHHH-----hLLLL-------LHHHHHHHHLHHHHHHLL----
Query klaprWSIT--LIFEDTIPFL-----kRNGV-------NEEVIATIFKENPKKFFS----  314
ident       |                    ||                               
Sbjct -----VSLSvvEELRWLEYGQrlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGqpig  376
DSSP  -----LLLLhhHHHHHHHHHHhhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct slavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhage  436
DSSP  llllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllh


DSSP  ---------------
Query ---------------  314
ident                
Sbjct ersarafvqvlgell  451
DSSP  hhhhhhhhhhhhhhl


No 34: Query=2vc5A Sbjct=1j6pA Z-score=14.3

back to top
DSSP  -----------------------------------llllllllllllhhhlLLEELLLLL
Query -----------------------------------mriplvgkdsieskdiGFTLIHEHL   25
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH


DSSP  LL------------------lLHHHHHhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEEEL
Query RV------------------fSEAVRQqwphLYNEDEEFRNAVNEVKRAMQFGVKTIVDP   67
ident                                   |                 |    || 
Sbjct PXtllrgvaedlsfeewlfskVLPIED----RLTEKXAYYGTILAQXEXARHGIAGFVDX  116
DSSP  HHhhhllllllllhhhhhhllHHHHHL----LLLHHHHHHHHHHHHHHHHLLLEEEEEEE


DSSP  LlllllLLHHHHHHHHHLLLLEEEELEELLLlLLLLhhhllllhhhhhhHHHHHhHLLLl
Query TvmglgRDIRFMEKVVKATGINLVAGTGIYIyIDLPfyflnrsideiadLFIHDiKEGIq  127
ident              | |   |       |                                
Sbjct Y-----FHEEWIAKAVRDFGXRALLTRGLVD-SNGD----------dggRLEEN-LKLY-  158
DSSP  E-----LLHHHHHHHHHHHLLEEEEEEEELL-LLLL----------lllHHHHH-HHHH-


DSSP  lLLLL------lLLEE-EELLlllllhhHHHHHHHHHHHHHHHLLLEEEELLL--LLLHh
Query gTLNK------aGFVX-IAADepgitkdVEKVIRAAAIANKETKVPIITHSNA--HNNTg  178
ident                              |          |    |   |          
Sbjct -NEWNgfegrifVGFGpHSPY-----lcSEEYLKRVFDTAKSLNAPVTIHLYEtsKEEY-  211
DSSP  -HHHLlhhhleeEEEEeLLLL-----llLHHHHHHHHHHHHHHLLLEEEEELLllLLLL-


DSSP  hhhhHHHHHlLLLH-hHEEELLHHhLLLHHHHHHHHHLLLEEEELLLL--LLLLLlhhhh
Query leqqRILTEeGVDP-gKILIGHLGdTDNIDYIKKIADKGSFIGLDRYG--LDLFLpvdkr  235
ident                 |    |        |     |   |                   
Sbjct --dlEDILN-IGLKevKTIAAHCV-HLPERYFGVLKDIPFFVSHNPASnlKLGNG-----  262
DSSP  --llHHHHL-LLLLllLEEEEELL-LLLHHHHHHHLLLLEEEEELHHHhhHLLLL-----


DSSP  hhHHHHHHHLLLllLEEELLLLLlllllllllhhhhhhhlllLLLL--HHHHLHHHHHH-
Query neTTLRLIKDGYsdKIMISHDYCctidwgtakpeykpklaprWSIT--LIFEDTIPFLK-  292
ident      | |  |   |     |                      |              | 
Sbjct iaPVQRXIEHGX--KVTLGTDGA----------------asnNSLNlfFEXRLASLLQKa  304
DSSP  llLHHHHHHLLL--EEEELLLLL----------------lllLLLLhhHHHHHHHHHHHl


DSSP  --LLLLLHHHHHHHHLHHHHHHLL------------------------------------
Query --RNGVNEEVIATIFKENPKKFFS------------------------------------  314
ident                                                             
Sbjct qnPRNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvh  364
DSSP  llLLLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhh


DSSP  -------------------------------------------
Query -------------------------------------------  314
ident                                            
Sbjct afsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  llllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 35: Query=2vc5A Sbjct=1a4mA Z-score=14.3

back to top
DSSP  llllllllllllhhhlLLEELLLLLLL---------------------------------
Query mriplvgkdsieskdiGFTLIHEHLRV---------------------------------   27
ident                      | ||                                   
Sbjct ----------tpafnkPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmd   50
DSSP  ----------llllllLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhlll


DSSP  -------------llHHHHHhlhhHLLH-hhhhhHHHHHHHHHHhllLLEEEELLLLLLL
Query -------------fsEAVRQqwphLYNE-deefrNAVNEVKRAMqfgVKTIVDPTVMGLG   73
ident                  |                  |          |          | 
Sbjct kplslpgflakfdyyMPVIA---gCREAikriayEFVEMKAKEG---VVYVEVRYSPHLL  104
DSSP  llllhhhhhllhhhhHHHHL---lLHHHhhhhhhHHHHHHHHLL---EEEEEEEELLHHH


DSSP  ------------------------lLHHHHHHHHHLLLLEEEELEELLLlLLLLhhhlll
Query ------------------------rDIRFMEKVVKATGINLVAGTGIYIyIDLPfyflnr  109
ident                                    | ||                     
Sbjct anskvdpmpwnqtegdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMR-HQPS------  157
DSSP  llllllllhhhlllllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEEL-LLHH------


DSSP  lhhhHHHHHHHHHHLLlllllLLLLLEEEE-lLLLLLLhhHHHHHHHHHHHHHHHLLLEE
Query sideIADLFIHDIKEGiqgtlNKAGFVXIA-aDEPGITkdVEKVIRAAAIANKETKVPII  168
ident              |               |                 |            
Sbjct ----WSLEVLELCKKY---nqKTVVAMDLAgdETIEGS-sLFPGHVEAYEGAVKNGIHRT  209
DSSP  ----HHHHHHHHHHHL---llLLEEEEEEEllLLLLLH-hHLHHHHHHHHHHHHHLLEEE


DSSP  EELL--LLLLHHHHHHHHHHhllllhhhEEELLHHhlLLHH-HHHHHHHLLLEEEElLLL
Query THSN--AHNNTGLEQQRILTeegvdpgkILIGHLGdtDNID-YIKKIADKGSFIGLdRYG  225
ident  |           |   ||            ||                           
Sbjct VHAGevGSPEVVREAVDILK-------tERVGHGYhtIEDEaLYNRLLKENMHFEV-CPW  261
DSSP  EEELllLLHHHHHHHHHLLL-------lLEEEELHhhHHLHhHHHHHHHLLLEEEE-LHH


DSSP  L--LLLLLHHhhhHHHHHHHHLLLllLEEELLLLLLllllllllhhhhhhhlLLLLLLHH
Query L--DLFLPVDkrnETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykpklaPRWSITLI  283
ident                  |   |          |                           
Sbjct SsyLTGAWDPkttHAVVRFKNDKA--NYSLNTDDPL---------------iFKSTLDTD  304
DSSP  HhhHLLLLLLlllLHHHHHHHLLL--LEEELLLLLL---------------lLLLLHHHH


DSSP  HHLHHHHHHlllLLHHHHHHHHlHHHHHHL------------------l
Query FEDTIPFLKrngVNEEVIATIFkENPKKFF------------------s  314
ident    |          ||        |  |                     
Sbjct YQMTKKDMG---FTEEEFKRLN-INAAKSSflpeeekkellerlyreyq  349
DSSP  HHHHHHLLL---LLHHHHHHHH-HHHHHLLlllhhhhhhhhhhhhhhll


No 36: Query=2vc5A Sbjct=2gwgA Z-score=14.2

back to top
DSSP  llllllllllllhhhlLLEELLLLLL---llLHHHH---------------HHLHhHLLH
Query mriplvgkdsieskdiGFTLIHEHLR---vfSEAVR---------------QQWPhLYNE   42
ident                     || |        |  |                        
Sbjct ----------------XIIDIHGHYTtapkaLEDWRnrqiagikdpsvxpkVSEL-KISD   43
DSSP  ----------------LLEEEEEELLlllhhHHHHHhhhhhhhhlhhhlllHHHL-LLLH


DSSP  HHHHHHHHHH-HHHHHHLLLLEEEELL----------lLLLLLL--HHHHHHHHhlllLE
Query DEEFRNAVNE-VKRAMQFGVKTIVDPT----------vMGLGRD--IRFMEKVVkatgIN   89
ident ||          |     |    |                       |           |
Sbjct DELQASIIENqLKKXQERGSDLTVFSPragdfnvsstwAAICNElcYRVSQLFP----DN   99
DSSP  HHHHHHHHLLhHHHHHHHLLLEEEEELllllhhhhhhhHHHHHHhhHHHHHHLL----LL


DSSP  EEELEELlllllllhhHLLLLHHHHHHHHHHHHHLllllllLLLLLEEEEL---LLLLlL
Query LVAGTGIyiyidlpfyFLNRSIDEIADLFIHDIKEgiqgtlNKAGFVXIAA---DEPGiT  146
ident                                  ||                         
Sbjct FIGAAXL-------pqSPGVDPKTCIPELEKCVKE------YGFVAINLNPdpsGGHWtS  146
DSSP  EEEEEEL-------llLLLLLHHHHHHHHHHHHHL------LLLLEEEELLlllLLLLlL


DSSP  HHH-hhhHHHHHHHHHHHLLLEEEE-----LLLLllHHHHHHH-----hhHHLLLLHhHE
Query KDV-ekvIRAAAIANKETKVPIITH-----SNAHnnTGLEQQR-----ilTEEGVDPgKI  195
ident                 |   |   |                                 | 
Sbjct PPLtdriWYPIYEKXVELEIPAXIHvstgaHYLN--ADTTAFXqcvagdlFKDFPEL-KF  203
DSSP  LLLllhhHHHHHHHHHHHLLLEEELlllllHHHH--HHHHHHHhhhhllhHHHLLLL-LE


DSSP  EELLHHHL--LLHH------------hhhhhHHLLLEEEELLLlllllllhhhHHHHHHH
Query LIGHLGDT--DNID------------yikkiADKGSFIGLDRYgldlflpvdkRNETTLR  241
ident  | | |                              |     |                 
Sbjct VIPHGGGAvpYHWGrfrglaqexkkplledhVLNNIFFDTCVY----------HQPGIDL  253
DSSP  EELHHHLLlhHHHHhhhhhhhhlllllhhhhLLLLEEEELLLL----------LHHHHHH


DSSP  HHHLLLLLLEEELLLLLlllllllllhhhhhhHLLL-----llllHHHHlHHHHHhlLLL
Query LIKDGYSDKIMISHDYCctidwgtakpeykpkLAPR-----wsitLIFEdTIPFLkrNGV  296
ident |      |                                           |        
Sbjct LNTVIPVDNVLFASEXI-------------gaVRGIdprtgfyydDTKR-YIEAS--TIL  297
DSSP  HHHHLLHHHEELLLLLL-------------llLLLEelllleellLLHH-HHHHL--LLL


DSSP  LHHHHHHHHLHHHHHHLL--------------
Query NEEVIATIFKENPKKFFS--------------  314
ident   |    |   |                    
Sbjct TPEEKQQIYEGNARRVYPrldaalkakgkleh  329
DSSP  LHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll


No 37: Query=2vc5A Sbjct=3icjA Z-score=13.7

back to top
DSSP  --------------------------------------------llllllllllllhhhl
Query --------------------------------------------mriplvgkdsieskdi   16
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEELLLLLLL-------------------------------------------------
Query GFTLIHEHLRV-------------------------------------------------   27
ident  |   | ||                                                   
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  -------------------------------------------------llHHHHhhlhH
Query -------------------------------------------------fsEAVRqqwpH   38
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKII--neK  178
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHH--hhL


DSSP  HLLHHHHHHHHHHHHHHHHHLLLLEEEELLLLllllLHHHHHHHH--HLLLLEEEELEEL
Query LYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMglgrDIRFMEKVV--KATGINLVAGTGI   96
ident                      ||       |                     |  |    
Sbjct ILTVKDYKHYIESAQEHLLSLGVHSVGFMSVG--ekALKALFELEreGRLKMNVFAYLSP  236
DSSP  LLLHHHHHHHHHHHHHHHHHLLEEEEEEEEEL--hhHHHHHHHHHhlLLLLLEEEEEELH


DSSP  lllllllhhhllllhhhhhhHHHHHHHL----llllllllLLLEEEELLL----------
Query yiyidlpfyflnrsideiadLFIHDIKE----giqgtlnkAGFVXIAADE----------  142
ident                            |               ||   |           
Sbjct --------------------ELLDKLEElnlgkfegrrlrIWGVXLFVDGslgartalls  276
DSSP  --------------------HHHHHHHHhlllleellleeEEEEEEELLLllllllllll


DSSP  -----------LLLLhhHHHHHHHHHHHHHHHLLLEEEELLLLlLHHHHHHHHHHHLLLL
Query -----------PGITkdVEKVIRAAAIANKETKVPIITHSNAHnNTGLEQQRILTEEGVD  191
ident                      |       |        |                |    
Sbjct epytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAIGD-KAVDVALDAFEEAEFS  333
DSSP  lllllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEELLH-HHHHHHHHHHHHHLLL


DSSP  hhhEEELLHhHLLLHHHHHHHHHLLLEEEElLLLLllllLHHH-------------hhhH
Query pgkILIGHLgDTDNIDYIKKIADKGSFIGLdRYGLdlflPVDK-------------rneT  238
ident      | |       |    |      |            |                   
Sbjct ---GRIEHA-SLVRDDQLERIKELKVRISA-QPHF----IVSDwwivnrvgeerakwayR  384
DSSP  ---LEEEEL-LLLLHHHHHHHHHHLLEEEE-LLLH----HHHLllhhhhhhhhhhhhllL


DSSP  HHHHHhllLLLLEEELLLLLlllllllllhhhhhhhlllLLLLHHHhLHHHHHHLL----
Query TLRLIkdgYSDKIMISHDYCctidwgtakpeykpklaprWSITLIFeDTIPFLKRN----  294
ident    |       |   | |                               |          
Sbjct LKTLS---SITKLGFSTDSP-------------------IEPADPW-VSIDAAVNRyvvd  421
DSSP  HHHHH---HHLLEEELLLLL-------------------LLLLLHH-HHHHHHHHLllll


DSSP  ---LLLHHHHHHHHLHHHHHHLL------------------------
Query ---GVNEEVIATIFKENPKKFFS------------------------  314
ident     |  |                                       
Sbjct pgeRVSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
DSSP  hhhLLLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll


No 38: Query=2vc5A Sbjct=4ofcA Z-score=13.7

back to top
DSSP  llllllllllllhhhllLEELLLLLLLLlhhhHHHL--------hhHLLH----------
Query mriplvgkdsieskdigFTLIHEHLRVFseavRQQW--------phLYNE----------   42
ident                     || |                                    
Sbjct ----------------mKIDIHSHILPK---eWPDLkkrfgyggwvQLQHhskgeakllk   41
DSSP  ----------------lLEEEEEELLLL---lLLLHhhhhllllleEEEEeelleeeeee


DSSP  -----hHHHH---HHHHHHHHHHHLLLLEEEELL----------------lLLLL--LLH
Query -----dEEFR---NAVNEVKRAMQFGVKTIVDPT----------------vMGLG--RDI   76
ident                        | ||      |                   |      
Sbjct dgkvfrVVREncwDPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlCQLLnnDLA  101
DSSP  lleeeeEEEHhhlLHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhHHHHhhHHH


DSSP  HHHHHHHhlllLEEEELEELlllllllhhhlllLHHHHHHHHHHHHHLLllllllLLLLE
Query RFMEKVVkatgINLVAGTGIyiyidlpfyflnrSIDEIADLFIHDIKEGiqgtlnKAGFV  136
ident               |                               ||           |
Sbjct STVVSYP----RRFVGLGTL----------pmqAPELAVKEMERCVKEL------GFPGV  141
DSSP  HHHHHLL----LLEEEEELL----------lllLHHHHHHHHHHHHHLL------LLLEE


DSSP  EEELLlllLLHH---HHHHhHHHHHHHHHHLLLEEEEL-------------------LLL
Query XIAADepgITKD---VEKViRAAAIANKETKVPIITHS-------------------NAH  174
ident  |                       |    |     |                       
Sbjct QIGTH---VNEWdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPA  197
DSSP  EEELE---ELLEellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHH


DSSP  L--LHHHHHH-HHHHHLLLLHhHEEELLHHHLlLHHH--------------------hhh
Query N--NTGLEQQ-RILTEEGVDPgKILIGHLGDTdNIDY--------------------ikk  211
ident                |      |    | |                              
Sbjct EttIAICSMImGGVFEKFPKL-KVCFAHGGGAfPFTVgrishgfsmrpdlcaqdnpmnpk  256
DSSP  HhhHHHHHHHlLLHHHHLLLL-LEEELHHHLLhHHHHhhhhhhhhhlhhhhlllllllhh


DSSP  hhHLLLEEEELLLlllllllhhhHHHHHHHHHHLLLLLLEEELLLLLlllllllllhhhh
Query iaDKGSFIGLDRYgldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctidwgtakpeyk  271
ident                               |      ||     ||              
Sbjct kyLGSFYTDALVH----------DPLSLKLLTDVIGKDKVILGTDYP-------------  293
DSSP  hhLLLLEEELLLL----------LHHHHHHHHHHHLLLLEELLLLLL-------------


DSSP  hhhllllllLHHHhLHHHHHhlLLLLHHHHHHHHLHHHHHHLL------
Query pklaprwsiTLIFeDTIPFLkrNGVNEEVIATIFKENPKKFFS------  314
ident                 |         ||        |   |        
Sbjct ----fplgeLEPG-KLIESM--EEFDEETKNKLKAGNALAFLGlerkqf  335
DSSP  ----lllllLLLL-HHHHHL--LLLLHHHHHHHHLHHHHHHHLllhhhl


No 39: Query=2vc5A Sbjct=2uz9A Z-score=13.7

back to top
DSSP  -----------------------------------------------------lllllll
Query -----------------------------------------------------mriplvg    7
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  lllllhhhlLLEELLLLLLL-------------------LLHHhhhhlhhhlLHHHHHHH
Query kdsieskdiGFTLIHEHLRV-------------------FSEAvrqqwphlyNEDEEFRN   48
ident          |    | |                         |         | |     
Sbjct lshheffmpGLVDTHIHASQysfagssidlpllewltkyTFPA----ehrfqNIDFAEEV  116
DSSP  llllleeeeLEEEEEEEHHHhhhllllllllhhhhhhhlHHHH----hhhhhLHHHHHHH


DSSP  HHHHHHHHHHLLLLEEEELLLLllllLHHHHHHHHHLLLLEEEELEELLlllLLLH--hh
Query AVNEVKRAMQFGVKTIVDPTVMglgrDIRFMEKVVKATGINLVAGTGIYiyiDLPF--yf  106
ident     | |    |  |                       |     |       ||      
Sbjct YTRVVRRTLKNGTTTACYFATI-htdSSLLLADITDKFGQRAFVGKVCM---DLNDtfpe  172
DSSP  HHHHHHHHHHLLEEEEEEELLL-lhhHHHHHHHHHHHHLLEEEEELEEL---LLLLllll


DSSP  llllHHHHHHHHHHHHHLLLlLLLL--lLLLEE-EELLlllllhHHHHHHHHHHHHHHHH
Query lnrsIDEIADLFIHDIKEGIqGTLN--kAGFVX-IAADepgitkDVEKVIRAAAIANKET  163
ident       |          |             |              |          |  
Sbjct yketTEESIKETERFVSEML-QKNYsrvKPIVTpRFSL-----sCSETLMGELGNIAKTR  226
DSSP  llllHHHHHHHHHHHHHHHH-HHLLlleEEEEEeLLHH-----hLLHHHHHHHHHHHHHH


DSSP  LLLEEEELLL--------------lLLHHHHHHHHHhhllllHHHEEELLHhHLLLHHHH
Query KVPIITHSNA--------------hNNTGLEQQRILteegvdPGKILIGHLgDTDNIDYI  209
ident    |  |                   |                 |    |          
Sbjct DLHIQSHISEnrdeveavknlypsyKNYTSVYDKNN----llTNKTVMAHG-CYLSAEEL  281
DSSP  LLEEEEEELLlhhhhhhhhhhllllLLHHHHHHHLL----llLLLEEEEEL-LLLLHHHH


DSSP  HHHHHLLLEEEElLLLL---LLLLlhhhhHHHHHHHhHLLLllLEEELLLLLllllllll
Query KKIADKGSFIGLdRYGL---DLFLpvdkrNETTLRLiKDGYsdKIMISHDYCctidwgta  266
ident       |  |                       |         ||    |          
Sbjct NVFHERGASIAH-CPNSnlsLSSG-----FLNVLEV-LKHE-vKIGLGTDVA--------  325
DSSP  HHHHHHLLEEEE-LHHHhhhLLLL-----LLLHHHH-HHLL-lEEEELLLLL--------


DSSP  lhhhhhhhlllLLLL--HHHHLHHHHHHL--------LLLLHHHHHHHHLHH-HHHHLL-
Query kpeykpklaprWSIT--LIFEDTIPFLKR--------NGVNEEVIATIFKEN-PKKFFS-  314
ident             |                                               
Sbjct ---------ggYSYSmlDAIRRAVMVSNIllinkvneKSLTLKEVFRLATLGgSQALGLd  376
DSSP  ---------llLLLLhhHHHHHHHHHHHHhhhlllllLLLLHHHHHHHHLHHhHHHLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct geignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvg  436
DSSP  llllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeel


DSSP  --------
Query --------  314
ident         
Sbjct gkqvvpfs  444
DSSP  leeeelll


No 40: Query=2vc5A Sbjct=4qrnA Z-score=13.6

back to top
DSSP  llllllllllllhhhlLLEELLLLlLLLL-HHHHHHL-----------------------
Query mriplvgkdsieskdiGFTLIHEHlRVFS-EAVRQQW-----------------------   36
ident                       |                                     
Sbjct --smtqdlktggeqgyLRIATEEA-FATReIIDVYLRmirdgtadkgmvslwgfyaqsps   57
DSSP  --llllllllllllllLLEEEEEE-ELLHhHHHHHHHhhhhllllhhhhhhhhhhhhlll


DSSP  ----hhhllhhhhHHHHHHHHHHHHhllLLEEEELL----------------llllLLLH
Query ----phlynedeeFRNAVNEVKRAMqfgVKTIVDPT----------------vmglGRDI   76
ident                                                           | 
Sbjct eratqilerlldlGERRIADMDATG---IDKAILALtspgvqplhdldeartlatrANDT  114
DSSP  hhhhhhhhhhhllLHHHHHHHHHLL---LLEEEEEEllllllllllhhhhhhhhhhHHHH


DSSP  --HHHHHHHhlllLEEEELEELlllllllhhhllLLHHHHHHHHHHHHHLLllllllLLL
Query --RFMEKVVkatgINLVAGTGIyiyidlpfyflnRSIDEIADLFIHDIKEGiqgtlnKAG  134
ident       |                                 |        |          
Sbjct laDACQKYP----DRFIGMGTV----------apQDPEWSAREIHRGAREL------GFK  154
DSSP  hhHHHHHLL----LLEEELLLL----------llLLHHHHHHHHHHHHHLL------LLL


DSSP  LEEEELlllLLLHHHH--hhhHHHHHHHHHHLLLEEEEL---------------------
Query FVXIAAdepGITKDVE--kviRAAAIANKETKVPIITHS---------------------  171
ident    |                      |  |   |   |                      
Sbjct GIQINS---HTQGRYLdeeffDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaif  211
DSSP  LEEELL---LLLLLLLllhhhHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllll


DSSP  -LLLL--LHHHHHHH-HHHHLLLLHhHEEELLHHHLlLHHH-------------------
Query -NAHN--NTGLEQQR-ILTEEGVDPgKILIGHLGDTdNIDY-------------------  208
ident           |                |  || |                          
Sbjct gFGVEtgMHLLRLITiGIFDKYPSL-QIMVGHMGEAlPYWLyrldymhqagvrsqryerm  270
DSSP  hHHHHhhHHHHHHHHhLHHHHLLLL-LEEELHHHHLhHHHHhhhhhhhhhhhhlllllll


DSSP  ------hhhHHHLLLEEEELLLlllllllhhhHHHHHHHHHHLLLLLLEEELLLLLllll
Query ------ikkIADKGSFIGLDRYgldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctid  262
ident                                               |  |   ||     
Sbjct kplkktiegYLKSNVLVTNSGV---------aWEPAIKFCQQVMGEDRVMYAMDYP----  317
DSSP  llllllhhhHHHHLEEEELLLL---------lLHHHHHHHHHHHLHHHEELLLLLL----


DSSP  lllllhhhhhhhlllLLLLHHHHLHHHHHhlllLLHHHHHHHHLHHHHHHLL-
Query wgtakpeykpklaprWSITLIFEDTIPFLkrngVNEEVIATIFKENPKKFFS-  314
ident                                           |  |  | |  
Sbjct --------------yQYVADEVRAMDAMD----MSAQTKKKFFQTNAEKWFKl  352
DSSP  --------------lLLLHHHHHHHHLLL----LLHHHHHHHHLHHHHHHLLl


No 41: Query=2vc5A Sbjct=2imrA Z-score=13.6

back to top
DSSP  ---------------------------------------llllllllllllhhhlLLEEL
Query ---------------------------------------mriplvgkdsieskdiGFTLI   21
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  LLLLLLLLH--------hhhhhlhhhllhhhHHHHHHHHHHHHHHLLLLEEEELLlllll
Query HEHLRVFSE--------avrqqwphlynedeEFRNAVNEVKRAMQFGVKTIVDPTvmglg   73
ident | ||                               |          |     |       
Sbjct HTHLDMSAYefqalpyfqwipevvirgrhlrGVAAAQAGADTLTRLGAGGVGDIV-----  115
DSSP  EEELLLLHHhhhhlhhhhllhhhhhhhllllHHHHHHHHHHHHHHLLLLLEEEEE-----


DSSP  LLHHHHHHHhHLLLLEEEELEELLLlLLLLhhhlllLHHHHHHHHHHHHHLLlllLLLL-
Query RDIRFMEKVvKATGINLVAGTGIYIyIDLPfyflnrSIDEIADLFIHDIKEGiqgTLNK-  132
ident      |                                ||                    
Sbjct WAPEVMDALlAREDLSGTLYFEVLN-PFPD------KADEVFAAARTHLERW---RRLEr  165
DSSP  LLHHHHHHHhLLLLLLEEEEEEELL-LLHH------HHHHHHHHHHHHHHHH---HLLLl


DSSP  ---lLLEE-EELLlllllhhHHHHHHHHHHHHHHHLLLEEEELLLL--------------
Query ---aGFVX-IAADepgitkdVEKVIRAAAIANKETKVPIITHSNAH--------------  174
ident                          |           |   |   |              
Sbjct pglrLGLSpHTPF-----tvSHRLMRLLSDYAAGEGLPLQIHVAEHptelemfrtgggpl  220
DSSP  lleeEEEEeLLLL-----llLHHHHHHHHHHHHHHLLLLEEEELLLhhhhhhhhhlllll


DSSP  ------------------------LLHHHHHH-HHHHhllllHHHEEELLHhHLLLHHHH
Query ------------------------NNTGLEQQ-RILTeegvdPGKILIGHLgDTDNIDYI  209
ident                                                  |       | |
Sbjct wdnrmpalyphtlaevigrepgpdLTPVRYLDeLGVL-----AARPTLVHM-VNVTPDDI  274
DSSP  hhhllhhhllllhhhhhlllllllLLHHHHHHhHLLH-----HHLLEEEEL-LLLLHHHH


DSSP  HHHHHLLLEEEElLLLL--LLLLlhhHHHHhHHHHHHLLLllLEEELLLLLlllllllll
Query KKIADKGSFIGLdRYGL--DLFLpvdKRNEtTLRLIKDGYsdKIMISHDYCctidwgtak  267
ident    |  |             |                 |         |           
Sbjct ARVARAGCAVVT-CPRSnhHLEC---GTFD-WPAFAAAGV--EVALGTDSV---------  318
DSSP  HHHHHHLLLEEE-LHHHhhHLLL---LLLL-HHHHHHLLL--LEEELLLLH---------


DSSP  hhhhhhhlllLLLL--HHHHLHHHHHhlLLLLHHHHHHHHLHHHHHH-------------
Query peykpklaprWSIT--LIFEDTIPFLkrNGVNEEVIATIFKENPKKF-------------  312
ident                              |    |                         
Sbjct -------asgETLNvrEEVTFARQLY--PGLDPRVLVRAAVKGGQRVvgtpflrrgetwq  369
DSSP  -------hhhLLLLlhHHHHHHHHHL--LLLLHHHHHHHHHHHHHHHhllllllllllll


DSSP  ---------ll
Query ---------fs  314
ident            
Sbjct egfrwelsrdl  380
DSSP  hhhlhhhllll


No 42: Query=2vc5A Sbjct=1a5kC Z-score=13.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---------------------------------------------------lllllllll
Query ---------------------------------------------------mriplvgkd    9
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  lllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhhhHHHHHHHHHHLLLLEEEE---
Query sieskdiGFTLIHEHLRvfseavrqqwphlynedeefrnAVNEVKRAMQFGVKTIVD---   66
ident        |    | |                               |   || | |    
Sbjct egkivtaGGIDTHIHWI----------------------CPQQAEEALVSGVTTMVGggt  158
DSSP  llleeeeLEEEEEEELL----------------------LLLHHHHHHHHLEEEEEEell


DSSP  ---------LLLLllllLHHHHHHHHHLLLLEEEELEELLllllllhhhllllhhhHHHH
Query ---------PTVMglgrDIRFMEKVVKATGINLVAGTGIYiyidlpfyflnrsideIADL  117
ident                   |  |         |                          | 
Sbjct gpaagthatTCTP-gpwYISRMLQAADSLPVNIGLLGKGN--------------vsQPDA  203
DSSP  lllhhhhhlLLLL-hhhHHHHHHHHHLLLLLEEEEEEELL--------------llLHHH


DSSP  HHHHHHlllllllLLLLLEEEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELLLLL--
Query FIHDIKegiqgtlNKAGFVXIAADepgitkdVEKVIRAAAIANKETKVPIITHSNAHN--  175
ident                     |  |           |  |     |       ||   |  
Sbjct LREQVA-------AGVIGLEIHED----wgaTPAAIDCALTVADEMDIQVALHSDTLNes  252
DSSP  HHHHHH-------HLLLEEEEEHH----hllLHHHHHHHHHHHHHHLLEEEEELLLLLll


DSSP  lHHHHHHHHHHHLlllhhHEEELLHHHL---llhHHHHhHHHLL-LEEEElLLLL-----
Query nTGLEQQRILTEEgvdpgKILIGHLGDT---dniDYIKkIADKG-SFIGLdRYGL-----  226
ident                    |   |          | |                       
Sbjct gFVEDTLAAIGGR-----TIHTFHTEGAggghapDIIT-ACAHPnILPSS-TNPTlpytl  305
DSSP  lLHHHHHHHHLLL-----LEEELLLLLLllllllLHHH-HHHLLlEEEEE-EHHHlllll


DSSP  ---------------------------llLLLHHHHhHHHHHHHHLLLLllEEELLLLLl
Query ---------------------------dlFLPVDKRnETTLRLIKDGYSdkIMISHDYCc  259
ident                                           |   |       | |   
Sbjct ntidehldmlmvchhldpdiaedvafaesRIRRETI-AAEDVLHDLGAF--SLTSSDSQ-  361
DSSP  lhhhhhhhhhhhhhllllllhhhhhllllLLLHHHH-HHHHHHHHLLLL--LEEELLLL-


DSSP  llllllllhhhhhhhlllLLLLHHHHlHHHHHHLLL----------------lLHHHHHH
Query tidwgtakpeykpklaprWSITLIFEdTIPFLKRNG----------------vNEEVIAT  303
ident                                                             
Sbjct ----------------amGRVGEVIL-RTWQVAHRMkvqrgalaeetgdndnfRVKRYIA  404
DSSP  ----------------llLLLLLHHH-HHHHHHHHHhhhhlllllllllllhhHHHHHHH


DSSP  HHLHHHHHHLL-------------------------------------------------
Query IFKENPKKFFS-------------------------------------------------  314
ident     ||                                                      
Sbjct KYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasi  464
DSSP  LLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct ptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadm  524
DSSP  lllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhl


DSSP  ------------------------------------------
Query ------------------------------------------  314
ident                                           
Sbjct vhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllllllleeelllllleeelleellllllllllllllllll


No 43: Query=2vc5A Sbjct=3iacA Z-score=13.3

back to top
DSSP  ----------llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhHHHH--
Query ----------mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeEFRN--   48
ident                                | ||                         
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLS--------------pqeiADDRrf   46
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL--------------hhhhHHLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   48
ident                                                             
Sbjct dnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthl  106
DSSP  llhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhh


DSSP  --------------------------------hhHHHHHHHHLLLLEEEELLLLllLLLH
Query --------------------------------avNEVKRAMQFGVKTIVDPTVMglGRDI   76
ident                                          |  |               
Sbjct elrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDP--IDSL  164
DSSP  hhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLL--LLLL


DSSP  HHHHHHHHL--LLLEEEELEELL-LLLL---lLHHH------------LLLL--HHHHHH
Query RFMEKVVKA--TGINLVAGTGIY-IYID---lPFYF------------LNRS--IDEIAD  116
ident              |                                              
Sbjct EYHRQIAADdsIDIEVAPSWRPDkVFKIeldgFVDYlrkleaaadvsiTRFDdlRQALTR  224
DSSP  HHHHHHHHLllLLLEEELLLLLHhHHLLllllHHHHhhhhhhhhllllLLHHhhHHHHHH


DSSP  HHHHHHHlllllllLLLLLEEEELLLLLL---------------------------LHHH
Query LFIHDIKegiqgtlNKAGFVXIAADEPGI---------------------------TKDV  149
ident    |                                                        
Sbjct RLDHFAA-------CGCRASDHGIETLRFapvpddaqldailgkrlagetlseleiAQFT  277
DSSP  HHHHHHH-------LLLLEEEEEELLLLLlllllhhhhhhhhhhhhllllllhhhhHHHH


DSSP  HHHHHHHHHHHHHHLLLEEEELL------------------------LLLL-HHHHHHHH
Query EKVIRAAAIANKETKVPIITHSN------------------------AHNN-TGLEQQRI  184
ident   |                 |                                       
Sbjct TAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdNNISwALSRLLDS  337
DSSP  HHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleellLLLHhHHHHHHHH


DSSP  HHH-LLLLhhHEEELLhhHLLL-HHHHHHHHHLL--------LEEEEllLLLLllllHHH
Query LTE-EGVDpgKILIGHlgDTDN-IDYIKKIADKG--------SFIGLdrYGLDlflpVDK  234
ident           |                                  |              
Sbjct XDVtNELP--KTILYC--LNPRdNEVLATXIGNFqgpgiagkVQFGS-gWWFN---dQKD  389
DSSP  HHLlLLLL--EEEEEE--LLHHhHHHHHHHHHHLllllllllEEELL-lLHHH---lLHH


DSSP  HHHHHHHHHHL--LLLLLEEELLLLLLllllllllhhhhhhhllllLLLHHHHLHHHHHH
Query RNETTLRLIKD--GYSDKIMISHDYCCtidwgtakpeykpklaprwSITLIFEDTIPFLK  292
ident      |         |       |                            |     | 
Sbjct GXLRQLEQLSQxgLLSQFVGXLTDSRS------------------fLSYTRHEYFRRILC  431
DSSP  HHHHHHHHHHHhlLHHHLLLLLLLLLL------------------lLLLHHHHHHHHHHH


DSSP  LLL--------------lLHHHHHHHHLHHHHHHLL--
Query RNG--------------vNEEVIATIFKENPKKFFS--  314
ident                          |   |    |   
Sbjct NLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTik  469
DSSP  HHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLll


No 44: Query=2vc5A Sbjct=3qy6A Z-score=13.2

back to top
DSSP  llllllllllllhhhllLEELLLL-LLLLlhhhhhhlhhhllhhhHHHHHHHHHHHHHHL
Query mriplvgkdsieskdigFTLIHEH-LRVFseavrqqwphlynedeEFRNAVNEVKRAMQF   59
ident                     || | |                              |   
Sbjct -----------------MIDIHCHiLPAM-----------ddgagDSADSIEMARAAVRQ   32
DSSP  -----------------LEELLLLlLLLL-----------lllllLHHHHHHHHHHHHHL


DSSP  LLLEEEELLL-----LLLL---LLHH--HHHHHHH--LLLLEEEELEellllllllhhhl
Query GVKTIVDPTV-----MGLG---RDIR--FMEKVVK--ATGINLVAGTgiyiyidlpfyfl  107
ident |  ||                          |             |              
Sbjct GIRTIIATPHhnngvYKNEpaaVREAadQLNKRLIkeDIPLHVLPGQ-------------   79
DSSP  LLLEEELLLEellllLLLLhhhHHHHhhHHHHHHHhlLLLLEEELLL-------------


DSSP  lllhhhhhhhhhhhhhlllllllllllleEEELllllllhhHHHHHHHHHHH---hhhhL
Query nrsideiadlfihdikegiqgtlnkagfvXIAAdepgitkdVEKVIRAAAIA---nketK  164
ident                               |             |    |          
Sbjct -----------------------------EIRI--------YGEVEQDLAKRqllslndT  102
DSSP  -----------------------------EEEL--------LLLHHHHHHLLllllhhhL


DSSP  LLEEEELLLLLLH--HHHHHHHHHHLLLlhhHEEELLHHHL----LLHHHHHHHHHLLLE
Query VPIITHSNAHNNT--GLEQQRILTEEGVdpgKILIGHLGDT----DNIDYIKKIADKGSF  218
ident   |                   |   |       | |         |         ||  
Sbjct KYILIEFPFDHVPryAEQLFYDLQLKGY---IPVIAHPERNreirENPSLLYHLVEKGAA  159
DSSP  LEEEEELLLLLLLllHHHHHHHHHHLLL---EEEEELHHHLhhhhHLLHHHHHHHHLLLE


DSSP  EEeLLLLlllllLHHHHHHHHHHHHHLLLllLEEELLLLLLllllllllhhhhhhhlLLL
Query IGlDRYGldlflPVDKRNETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykpklaPRW  278
ident       |              |||             |                      
Sbjct SQ-ITSGslagiFGKQLKAFSLRLVEANL--IHFVASDAHN---------------vKTR  201
DSSP  EE-EEHHhhlllLLHHHHHHHHHHHHLLL--LLEEELLLLL---------------lLLL


DSSP  LlLHHHhLHHHHHHLLlLLHHHHHHHHlHHHHHHLL--------------
Query SiTLIFeDTIPFLKRNgVNEEVIATIFkENPKKFFS--------------  314
ident             |       |       ||                    
Sbjct N-FHTQ-EALYVLEKE-FGSELPYMLT-ENAELLLRnqtifrqppqpvkr  247
DSSP  L-LLHH-HHHHHHHHH-HLLHHHHHHH-HHHHHHHLllllllllllllll


No 45: Query=2vc5A Sbjct=1j5sA Z-score=13.0

back to top
DSSP  ---------llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhHHHH-
Query ---------mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeefRNAV-   50
ident                               | ||                        | 
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLD-------------------aKDIVe   41
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL-------------------hHHHHh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   50
ident                                                             
Sbjct nkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyew  101
DSSP  llllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhh


DSSP  ----------------------------------HHHHHHHHLLLLEEEELLLLlllLLH
Query ----------------------------------NEVKRAMQFGVKTIVDPTVMglgRDI   76
ident                                      |      |               
Sbjct ihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTDDP--vSTL  159
DSSP  hhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLLLL--lLLL


DSSP  HHHHHHHHLLL-LEEEELEELL--LLLL--lLHHH------------LLLL--HHHHHHH
Query RFMEKVVKATG-INLVAGTGIY--IYID--lPFYF------------LNRS--IDEIADL  117
ident     |   |                  |                                
Sbjct EHHRKAKEAVEgVTILPTWRPDraMNVDkegWREYvekmgerygedtSTLDgfLNALWKS  219
DSSP  HHHHHHHHHLLlLEEELLLLLHhhHLLLlllHHHHhhhhhhhhllllLLHHhhHHHHHHH


DSSP  HHHHHHlllllllLLLLLEEEELLL--------------------------lllLHHHHH
Query FIHDIKegiqgtlNKAGFVXIAADE--------------------------pgiTKDVEK  151
ident   |                  |  |                                   
Sbjct HEHFKE-------HGCVASDHALLEpsvyyvdenraravhekafsgekltqdeiNDYKAF  272
DSSP  HHHHHL-------LLLLEEEEEELLlllllllhhhhhhhhhhhlllllllhhhhHHHHHH


DSSP  HHHHHHHHHHHHLLLEEEELLL-----------------------LLLHhhhhHHHHHHL
Query VIRAAAIANKETKVPIITHSNA-----------------------HNNTgleqQRILTEE  188
ident         | ||      |  |                                |    |
Sbjct MMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnFLRI-aegLRYFLNE  331
DSSP  HHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleellLLLH-hhhHHHHHHH


DSSP  LLLhhHEEELLhhHLLL-HHHHHHHHHLL--LEEEELLlllllLLLH-HHHHHHHHHHHH
Query GVDpgKILIGHlgDTDN-IDYIKKIADKG--SFIGLDRygldlFLPV-DKRNETTLRLIK  244
ident      ||              |  ||        |        |             |  
Sbjct FDGklKIVLYV--LDPThLPTISTIARAFpnVYVGAPW----wFNDSpFGMEMHLKYLAS  385
DSSP  LLLllLEEEEE--LLHHhHHHHHHHHHHLllEEELLLL----lLLLLhHHHHHHHHHHHL


DSSP  LLLLLLE-EELLLLLLllllllllhhhhhhhllllLLLHHHHLHHHHHHLLLL-------
Query DGYSDKI-MISHDYCCtidwgtakpeykpklaprwSITLIFEDTIPFLKRNGV-------  296
ident             |                      |     |     |            
Sbjct VDLLYNLaGMVTDSRK-----------------llSFGSRTEMFRRVLSNVVGemvekgq  428
DSSP  LLLHHHLlLLLLLLLL-----------------llHHHHHHHHHHHHHHHHHHhhhhlll


DSSP  -----LHHHHHHHHLHHHHHHLL
Query -----NEEVIATIFKENPKKFFS  314
ident        |         ||  | 
Sbjct ipikeARELVKHVSYDGPKALFF  451
DSSP  llhhhHHHHHHHHHLHHHHHHHL


No 46: Query=2vc5A Sbjct=1yrrB Z-score=12.9

back to top
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL
Query ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
ident                                                     ||      
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  L-----LLLLHhhhhhlhhhllhhhHHHHHHHHHHHHHHLLLLEEEELLLLL----lllL
Query L-----RVFSEavrqqwphlynedeEFRNAVNEVKRAMQFGVKTIVDPTVMG----lgrD   75
ident                                   |     |                   
Sbjct GcggvqFNDTA-----------eavSVETLEIMQKANEKSGCTNYLPTLITTsdelmkqG  109
DSSP  EelleeLLLLL-----------lllLHHHHHHHHHHHHLLLEEEEEEEELLLlhhhhhhH


DSSP  HHHHHHHHHLLLLEE-EELEeLLLLllllhhhllllhHHHHHHHHHHHhllllllllLLL
Query IRFMEKVVKATGINL-VAGTgIYIYidlpfyflnrsiDEIADLFIHDIkegiqgtlnKAG  134
ident  | |                                     |                  
Sbjct VRVMREYLAKHPNQAlGLHLeGPWL-----------nAALVDFLCENA--------dVIT  150
DSSP  HHHHHHHHHHLLLLLlLEEEeLLLL-----------lLHHHHHHHHLH--------hHEE


DSSP  LEEEElllllllhhHHHHhHHHHHHHHhHLLLEEEELLlllLHHHHHHHHHHHLlllhhH
Query FVXIAadepgitkdVEKViRAAAIANKeTKVPIITHSNahnNTGLEQQRILTEEgvdpgK  194
ident  |  |                                    |  |               
Sbjct KVTLA-------peMVPA-EVISKLAN-AGIVVSAGHS---NATLKEAKAGFRA----gI  194
DSSP  EEEEL-------hhHLLH-HHHHHHHH-HLLEEEELLL---LLLHHHHHHHHHH----lE


DSSP  EEELLHHH-lLLHH-----hHHHHHHL-LLEEEELlllllllllHHHH-HHHHHHHHhLL
Query ILIGHLGD-tDNID-----yIKKIADK-GSFIGLDrygldlflpVDKR-NETTLRLIkDG  246
ident     ||      |          | |      |                           
Sbjct TFATHLYNamPYITgrepglAGAILDEaDIYCGII-------adGLHVdYANIRNAK-RL  246
DSSP  EEELLLLLllLLLLllllhhHHHHHHLlLLEEEEE-------llLLLLlHHHHHHHH-HH


DSSP  LLLLEEELLLLLlllllllllhhhhhhhlLLLLlLHHHHlHHHHHHLL-LLLHHHHHHHH
Query YSDKIMISHDYCctidwgtakpeykpklaPRWSiTLIFEdTIPFLKRN-GVNEEVIATIF  305
ident   ||     |                      |     |     |    |          
Sbjct KGDKLCLVTDAT-----------------SGSS-LTMIE-GVRNLVEHcGIALDEVLRMA  287
DSSP  HHHHEEEELLLL-----------------LLLL-LLHHH-HHHHHHHHhLLLHHHHHHHH


DSSP  LHHHHHHLL--------------------------------------
Query KENPKKFFS--------------------------------------  314
ident    |                                           
Sbjct TLYPARAIGvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  LHHHHHHLLllllllllllllllleeeellllleeeeeelleeeeel


No 47: Query=2vc5A Sbjct=4hk5D Z-score=12.8

back to top
DSSP  llllllllllllhhhlLLEELLLLlLLLL-HHHHHHLHH---------------------
Query mriplvgkdsieskdiGFTLIHEHlRVFS-EAVRQQWPH---------------------   38
ident                     || |                                    
Sbjct --------------tpVVVDIHTH-MYPPsYIAMLEKRQtiplvrtfpqadeprlillss   45
DSSP  --------------llLLEEEEEE-ELLHhHHHHHHLLLllleeeeelleeeeeeellhh


DSSP  --------------------hllhhhHHHHHHHHHHHHHhllLLEEEELLLLLL------
Query --------------------lynedeEFRNAVNEVKRAMqfgVKTIVDPTVMGL------   72
ident                                               |             
Sbjct elaaldaaladpaaklpgrplsthfaSLAQKMHFMDTNG---IRVSVISLANPWfdflap  102
DSSP  hhhhhhhhhhlllllllleellhhhlLHHHHHHHHHHLL---LLEEEEEELLLLllllll


DSSP  -----------lLLHHHHHHHHhlllLEEEELEELlllllllhhhlLLLHhHHHHHHHHH
Query -----------gRDIRFMEKVVkatgINLVAGTGIyiyidlpfyflNRSIdEIADLFIHD  121
ident                      |      |                               
Sbjct deapgiadavnaEFSDMCAQHV----GRLFFFAAL--------plsAPVD-AVKASIERV  149
DSSP  llhhhhhhhhhhHHHHHHHLLL----LLEEEEEEL--------lllLLHH-HHHHHHHHH


DSSP  HHLllllllLLLLLEEEELL--LLLL-LHHHHhhhHHHHHHHHhHLLLEEEEL-------
Query IKEgiqgtlNKAGFVXIAAD--EPGI-TKDVEkviRAAAIANKeTKVPIITHS-------  171
ident                         |                    |     |        
Sbjct KNL------KYCRGIILGTSglGKGLdDPHLL---PVFEAVAD-AKLLVFLHPhyglpne  199
DSSP  HLL------LLEEEEEELLLllLLLLlLHHHH---HHHHHHHH-LLLEEEELLlllllhh


DSSP  ------------------LLLL--LHHHHH--hHHHHHLLLLhhHEEELLHHHLlLHHH-
Query ------------------NAHN--NTGLEQ--qRILTEEGVDpgKILIGHLGDTdNIDY-  208
ident                                               |  | | |      
Sbjct vygprseeyghvlplalgFPMEttIAVARMymaGVFDHVRNL--QMLLAHSGGTlPFLAg  257
DSSP  hhlllhhhlllhhhhhlhHHHHhhHHHHHHhhlLHHHHLLLL--LEEEHHHHLLhHHHHh


DSSP  ------------------------hHHHHHLLLEEEELlllllllllhhhHHHHHHHHHH
Query ------------------------iKKIADKGSFIGLDrygldlflpvdkRNETTLRLIK  244
ident                                                           | 
Sbjct riescivhdghlvktgkvpkdrrtiWTVLKEQIYLDAV----------iySEVGLQAAIA  307
DSSP  hhhhhhhllhhhhhllllllllllhHHHHHHLEEEELL----------llLHHHHHHHHH


DSSP  LLLLLLEEELLLLLlllllllllhhhHHHH---llllLLLHHHhLHHHHHHLlllLHHHH
Query DGYSDKIMISHDYCctidwgtakpeyKPKL---aprwSITLIFeDTIPFLKRngvNEEVI  301
ident     |  |   |                         |  |                   
Sbjct SSGADRLMFGTDHP---------ffpPIEEdvqgpwdSSRLNA-QAVIKAVG--eGSSDA  355
DSSP  HHLHHHEELLLLLL---------lllLLLLllllllhHHHHHH-HHHHHHHL--lLLHHH


DSSP  HHHHLHHHHHHLL------------
Query ATIFKENPKKFFS------------  314
ident |     |     |            
Sbjct AAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  HHHHLHHHHHHLLlhhhhhhhhhhl


No 48: Query=2vc5A Sbjct=4dziC Z-score=12.3

back to top
DSSP  llllllllllllhhhlLLEELLLLLLLL--LHHH---------hHHLH------------
Query mriplvgkdsieskdiGFTLIHEHLRVF--SEAV---------rQQWP------------   37
ident                        |      |              |              
Sbjct ------------alnyRVIDVDNHYYEPldSFTRhldkkfkrrgVQMLsdgkrtwavigd   48
DSSP  ------------llllLEEEEEEELLLLllLLLLlllhhhllllEEEEelllleeeeell


DSSP  --------------------------------------hhlLHHHhHHHH---HHHHHHH
Query --------------------------------------hlyNEDEeFRNA---VNEVKRA   56
ident                                                             
Sbjct rvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkveRLAD-HPEYqnrDARIAVM  107
DSSP  eellllllllllleelllllhhhhhllllllllhhhllleeLHHH-LHHHllhHHHHHHH


DSSP  HHLLLLEEEELL---------------------lllllLLHHHHHhhhhllLLEEEELEE
Query MQFGVKTIVDPT---------------------vmglgRDIRFMEkvvkatGINLVAGTG   95
ident       |                                                 |   
Sbjct DEQDIETAFMLPtfgcgveealkhdieatmasvhafnlWLDEDWG--fdrpDHRIIAAPI  165
DSSP  HHHLEEEEEEELlhhhhhhhhllllhhhhhhhhhhhhhHHHHHLL--llllLLLEEELLL


DSSP  LlllllllhhhlllLHHHHHHHHHHHHHlllllllLLLLLEEEELlllLLLH-----HHH
Query IyiyidlpfyflnrSIDEIADLFIHDIKegiqgtlNKAGFVXIAAdepGITK-----DVE  150
ident                                      |  |                   
Sbjct V----------slaDPTRAVEEVDFVLA-------RGAKLVLVRP---APVPglvkpRSL  205
DSSP  L----------lllLHHHHHHHHHHHHH-------LLLLLEELLL---LLLLlllllLLL


DSSP  H--hhHHHHHHHHHHLLLEEEELL----------------------lLLLHHHHHHHHH-
Query K--viRAAAIANKETKVPIITHSN----------------------aHNNTGLEQQRIL-  185
ident              |  ||   |                                      
Sbjct GdrshDPVWARLAEAGVPVGFHLSdsgylhiaaawggakdpldqvllDDRAIHDTMASMi  265
DSSP  LlhhhHHHHHHHHHHLLLEEEELLllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHh


DSSP  ----HHLLLLhhHEEELLHHhlllhHHHHH----------------------hHHLLLEE
Query ----TEEGVDpgKILIGHLGdtdniDYIKK----------------------iADKGSFI  219
ident             |      |                                       |
Sbjct vhgvFTRHPK-lKAVSIENG----sYFVHRlikrlkkaantqpqyfpedpveqLRNNVWI  320
DSSP  hllhHHHLLL-lLEEEELLL----lLHHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEE


DSSP  EEllllllllllhhhHHHHHHHHHHLLLLLLEEELLLLLlllllllllhhhhhhhllLLL
Query GLdrygldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctidwgtakpeykpklapRWS  279
ident                       |      |||    |                       
Sbjct AP------------yYEDDLPELARVIGVDKILFGSDWP-----------------hGEG  351
DSSP  LL------------lLLLLHHHHHHHHLHHHLLLLLLLL-----------------lLLL


DSSP  L-LHHHhlHHHHHHllLLLHHHHHHHHLHHHHHHLL-----
Query I-TLIFedTIPFLKrnGVNEEVIATIFKENPKKFFS-----  314
ident             ||  |  |  |  |   |           
Sbjct LaSPVS--FTAELK--GFSESDIRKIMRDNALDLLGvqvgs  388
DSSP  LlLHHH--HHHHHL--LLLHHHHHHHHLHHHHHHHLlllll


No 49: Query=2vc5A Sbjct=3ooqA Z-score=11.7

back to top
DSSP  ------------------------------------llllllllllllhhhLLLEELLLL
Query ------------------------------------mriplvgkdsieskdIGFTLIHEH   24
ident                                                     ||   | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  -LLLLlhhhhhhlhhHLLH-----------------hhhHHHHhHHHHHHHHLLLLEEEE
Query -LRVFseavrqqwphLYNE-----------------deeFRNAvNEVKRAMQFGVKTIVD   66
ident                 |                               ||   ||     
Sbjct iGLFE-------egvGYYYsdgneatdpvtphvkaldgfNPQD-PAIERALAGGVTSVXI  112
DSSP  lLLLL-------lllLHHHlllllllllllllllhhhhlLLLL-HHHHHHHLLLEEEEEE


DSSP  LLLllllllhhhhhhhhhlllleeeeleeLLLLllllhhhllllhhhhhhhhhhhhhlll
Query PTVmglgrdirfmekvvkatginlvagtgIYIYidlpfyflnrsideiadlfihdikegi  126
ident                                                             
Sbjct VPG--------------------------SANP-----------vggqgsvikfrsiive  135
DSSP  LLL--------------------------LLLL-----------eeeeeeeeelllllhh


DSSP  lllllLLLLEEEELLL------------lllLHHHHHHHH--------------------
Query qgtlnKAGFVXIAADE------------pgiTKDVEKVIR--------------------  154
ident             |  |                     |||                    
Sbjct ecivkDPAGLKXAFGEnpkrvygerkqtpstRXGTAGVIRdyftkvknyxkkkelaqkeg  195
DSSP  hheeeEEEEEEEELLHhhhhhhhhlllllllHHHHHHHHHhhhhhhhhhhhhhhhhhhll


DSSP  ----------hhHHHHHHHLLLEEEELLLLlLHHHHHHHHHHHLLLlhhHEEELLHHHll
Query ----------aaAIANKETKVPIITHSNAHnNTGLEQQRILTEEGVdpgKILIGHLGDtd  204
ident                    | |   |        |   ||  | |       | |     
Sbjct keftetdlkxevGEXVLRKKIPARXHAHRA-DDILTAIRIAEEFGF---NLVIEHGTE--  249
DSSP  lllllllhhhhhHHHHHLLLLLEEEEELLH-HHHHHHHHHHHHHLL---LEEEEELLL--


DSSP  lHHHHHHHHHLLLEEEELLLLLLLL--llhhhHHHHHHHHHHLLLllLEEELLLLLllll
Query nIDYIKKIADKGSFIGLDRYGLDLF--lpvdkRNETTLRLIKDGYsdKIMISHDYCctid  262
ident      |  | |                       ||   | |||    |    |      
Sbjct aYKISKVLAEKKIPVVVGPLLTFRTklelkdlTXETIAKLLKDGV--LIALXCDHP----  303
DSSP  hHHHHHHHHHHLLLEEELLLLLLLLlhhhlllLLLHHHHHHHLLL--LEEELLLLL----


DSSP  lllllhhhhhhhlllLLLLHHHHlHHHHHHLLLLLHHHHHHHHLHHHHHHLL--------
Query wgtakpeykpklaprWSITLIFEdTIPFLKRNGVNEEVIATIFKENPKKFFS--------  314
ident                               | |  ||    |   || |           
Sbjct --------------vIPLEFATV-QAATAXRYGAKEEDLLKILTVNPAKILGledrigsi  348
DSSP  --------------lLLHHHHHH-HHHHHHHHLLLHHHHHHLLLHHHHHHLLllllllll


DSSP  ------------------------------------
Query ------------------------------------  314
ident                                     
Sbjct epgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  llllllleeeelllllllllleeeeeelleeeeell


No 50: Query=2vc5A Sbjct=2a3lA Z-score=11.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------------------llllllllllllhhhlLLEELLLLLL--------
Query --------------------------mriplvgkdsieskdiGFTLIHEHLR--------   26
ident                                                | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   26
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  --LLLHHHHHhlHHHLLH---------HHHHHHHHHHHHHHHHLLLLEEEELLLLL----
Query --VFSEAVRQqwPHLYNE---------DEEFRNAVNEVKRAMQFGVKTIVDPTVMG----   71
ident                                                             
Sbjct nlKYNPCGQS--RLREIFlkqdnliqgRFLGEITKQVFSDLEASKYQMAEYRISIYgrkm  298
DSSP  hhHHLLLLLL--HHHHHHlllllllllLLHHHHHHHHHHHHLLLLLEEEEEEEELLllll


DSSP  --lllLHHHHH--HHHHlllLEEEELEELLLllLLLHHH----LLLLhHHHHHHHHHHHH
Query --lgrDIRFME--KVVKatgINLVAGTGIYIyiDLPFYF----LNRSiDEIADLFIHDIK  123
ident                      | |             |            | |       
Sbjct sewdqLASWIVnnDLYS---ENVVWLIQLPR--LYNIYKdmgiVTSF-QNILDNIFIPLF  352
DSSP  lhhhhHHHHHHllLLLL---LLEEEEEEEEL--LHHHHLllllLLLL-HHHHHHHLLHHH


DSSP  LL-------llLLLLL--LLLEEEE-lLLLL-----------------llHHHHHHHHHH
Query EG-------iqGTLNK--AGFVXIA-aDEPG-----------------itKDVEKVIRAA  156
ident |                                                           
Sbjct EAtvdpdshpqLHVFLkqVVGFDLVddESKPerrptkhmptpaqwtnafnPAFSYYVYYC  412
DSSP  HHhhlhhhlllLHHHHllEEEEEEEllLLLLlllllllllllllllllllLLHHHHHHHH


DSSP  HHHHHHHL----------LLEEEELL-LLLL-HHHHHHHHHhhllllhhhEEELLHHhlL
Query AIANKETK----------VPIITHSN-AHNN-TGLEQQRILteegvdpgkILIGHLGdtD  204
ident                        ||  |                        | |     
Sbjct YANLYVLNklreskgmttITLRPHSGeAGDIdHLAATFLTC---------HSIAHGInlR  463
DSSP  HHHHHHHHhhhlllllllLEELLLLLlLLLLhHHHHHHHHL---------LLLLLLHhhH


DSSP  LHH-HHHHHHHLLLEEEeLLLLL--LLLLLHHHHhhHHHHHHHLLLllLEEELLLLLLll
Query NID-YIKKIADKGSFIGlDRYGL--DLFLPVDKRneTTLRLIKDGYsdKIMISHDYCCti  261
ident                           |||               |       | |     
Sbjct KSPvLQYLYYLAQIGLA-MSPLSnnSLFLDYHRN--PFPVFFLRGL--NVSLSTDDPL--  516
DSSP  HLHhHHHHHHHHLLLEE-ELHHHhlLLLLLLLLL--LHHHHHHLLL--LEEELLLLHH--


DSSP  llllllhhhhhhhllllLLLHHHHLHHHHHHlllLLHHHHHHHHlHHHHHHL--------
Query dwgtakpeykpklaprwSITLIFEDTIPFLKrngVNEEVIATIFkENPKKFF--------  313
ident                               |           |   |             
Sbjct ----------qihltkePLVEEYSIAASVWK---LSACDLCEIA-RNSVYQSgfshalks  562
DSSP  ----------hhlllllHHHHHHHHHHHHHL---LLHHHHHHHH-HHHHHHLlllhhhhh


DSSP  -----------------------------------------------------l
Query -----------------------------------------------------s  314
ident                                                       
Sbjct hwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 51: Query=2vc5A Sbjct=1v77A Z-score=10.9

back to top
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhhhhhHHHHHHHHlL
Query mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeefrnavNEVKRAMQfG   60
ident                  |                                     |    
Sbjct ---------------vKFIEMDIRDK------------------------EAYELAKE-W   20
DSSP  ---------------lLLEEEEELLH------------------------HHHHHHHH-H


DSSP  LLEEEELLLllllllhhhhhhhhhlllleeeeleeLLLLllllhhhllllhhhhhhhHHH
Query VKTIVDPTVmglgrdirfmekvvkatginlvagtgIYIYidlpfyflnrsideiadlFIH  120
ident     |                                                       
Sbjct FDEVVVSIK--------------------------FNEE-----------------vDKE   37
DSSP  LLEEEEEEE--------------------------ELLL-----------------lLHH


DSSP  HHhllllllLLLL-----LLEEEELllllllhhHHHHHHHHHHHHHhhLLLEEEELLlLL
Query DIkegiqgtLNKA-----GFVXIAAdepgitkdVEKVIRAAAIANKetKVPIITHSNaHN  175
ident                                       |      |     |   ||   
Sbjct KL-------REARkeygkVAILLSN-------pKPSLVRDTVQKFK--SYLIYVESN-DL   80
DSSP  HH-------HHHHhhhllEEEEEEL-------lLHHHHHHHHHHLL--LLEEEEELL-LH


DSSP  LHHHHHHHHHhhllllhhhEEELLHHH----LLLH-HHHHHHHHLLLEEEELlLLLL---
Query NTGLEQQRILteegvdpgkILIGHLGD----TDNI-DYIKKIADKGSFIGLDrYGLD---  227
ident                      |                 |    |    |          
Sbjct RVIRYSIEKG--------vDAIISPWVnrkdPGIDhVLAKLMVKKNVALGFS-LRPLlys  131
DSSP  HHHHHHHHLL--------lLEEELLLLllllLLLLhHHHHHHHHHLLEEEEE-LHHHhhl


DSSP  ----lllLHHHHHHHHHHHHHLLLllLEEELLLLLLllllllllhhhhhhhlllLLLL--
Query ----lflPVDKRNETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykpklaprWSIT--  281
ident                     |                                 |     
Sbjct npyeranLLRFMMKAWKLVEKYKV--RRFLTSSAQE-----------------kWDVRyp  172
DSSP  lhhhhhhHHHHHHHHHHHHHHHLL--LEEEELLLLL-----------------hHHLLlh


DSSP  -HHHHLHHHHHhlllLLHHHHHHHHLHHHHHHLL
Query -LIFEDTIPFLkrngVNEEVIATIFKENPKKFFS  314
ident                             |     
Sbjct rDLISLGVVIG----MEIPQAKASISMYPEIILK  202
DSSP  hHHHHHHHHLL----LLHHHHHHLLLHHHHHHHL


No 52: Query=2vc5A Sbjct=3dcpA Z-score=8.9

back to top
DSSP  llllllllllllhhhlLLEELLLLL-LLLLhhhhhhlhhhllhhhhhhHHHHHHHHHHHL
Query mriplvgkdsieskdiGFTLIHEHL-RVFSeavrqqwphlynedeefrNAVNEVKRAMQF   59
ident                      | |                             |  |   
Sbjct ----------------XKRDGHTHTeFCPH--------------gthdDVEEXVLKAIEL   30
DSSP  ----------------LLEEEEELLlLLLL--------------llllLHHHHHHHHHHL


DSSP  LLLEEEELLL--------------------LLLL-----lLHHHHHHHHHLLL--LEEEE
Query GVKTIVDPTV--------------------MGLG-----rDIRFMEKVVKATG--INLVA   92
ident                                                  |          
Sbjct DFDEYSIVEHaplssefxkntagdkeavttASXAxsdlpyYFKKXNHIKKKYAsdLLIHI   90
DSSP  LLLEEEEEEEllllhhhhhllllllhhhhlLLLLhhhhhhHHHHHHHHHHHLLllLEEEE


DSSP  LeellllllllhhhllllhhhhhhhhhhhhhlllllllllllleEEELlllLLLHhHHHH
Query GtgiyiyidlpfyflnrsideiadlfihdikegiqgtlnkagfvXIAAdepGITKdVEKV  152
ident |                                                   |       
Sbjct G------------------------------------------fEVDY---LIGY-EDFT  104
DSSP  E------------------------------------------eEEEL---LLLL-HHHH


DSSP  HHHHHHHHHhhlllEEEELL-----------------------------------lLLLH
Query IRAAAIANKetkvpIITHSN-----------------------------------aHNNT  177
ident                                                             
Sbjct RDFLNEYGP-qtddGVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlayLEGV  163
DSSP  HHHHHHHHH-hlleEEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhHHHH


DSSP  --HHHHhhHHHHllllhhHEEELLHHHL--------------------lLHHHHHHHHHL
Query --GLEQqrILTEegvdpgKILIGHLGDT--------------------dNIDYIKKIADK  215
ident     |    |            ||                                    
Sbjct kqSIEA--DLGL----fkPRRXGHISLCqkfqqffgedtsdfseevxekFRVILALVKKR  217
DSSP  hhHHHL--LLLL----llLLEELLLLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHH


DSSP  LLEEEELlLLLL---LLLLHhhHHHHHHHHHHLLLllLEEELLLLLLllllllllhhhhh
Query GSFIGLDrYGLD---LFLPVdkRNETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykp  272
ident                |                           |                
Sbjct DYELDFN-TAGLfkpLCGETypPKKIVTLASELQI--PFVYGSDSHG-------------  261
DSSP  LLEEEEE-LHHHhllLLLLLllLHHHHHHHHHLLL--LEEEELLLLL-------------


DSSP  hhllllLLLHHHHLHHHHHHlllllhhhhhhhhlhhhhhhll
Query klaprwSITLIFEDTIPFLKrngvneeviatifkenpkkffs  314
ident        |          |                       
Sbjct ----vqDIGRGYSTYCQKLE----------------------  277
DSSP  ----hhHLLLLHHHHHHHLL----------------------


No 53: Query=2vc5A Sbjct=3au2A Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------llllllllllllhhhllLEELLLLLLLLlhhhhhhlhhhl
Query --------------------mriplvgkdsieskdigFTLIHEHLRVFseavrqqwphly   40
ident                                            |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTYS------------  348
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLLL------------


DSSP  lhhhhhhHHHHHHHHHHHLLLLEEEELLL------------lllllLHHHHHHHHHLLLL
Query nedeefrNAVNEVKRAMQFGVKTIVDPTV------------mglgrDIRFMEKVVKATGI   88
ident                |   |                                      | 
Sbjct ---dgqnTLEELWEAAKTMGYRYLAVTDHspavrvaggpspeealkRVGEIRRFNETHGP  405
DSSP  ---llllLHHHHHHHHHHHLLLEEEEEEElhhhhllllllhhhhhhHHHHHHHHHHHHLL


DSSP  -EEEELeellllllllhhhllllhhhhhhhhhhhhhllllllllllllEEEELLLllllh
Query -NLVAGtgiyiyidlpfyflnrsideiadlfihdikegiqgtlnkagfVXIAADEpgitk  147
ident   | ||                                                      
Sbjct pYLLAG------------------------------------------AEVDIHP-----  418
DSSP  lEEEEE------------------------------------------EEEELLL-----


DSSP  hhhhHHHHhHHHHHhhllLEEEELLLLL--------LHHHHHHHHHhhllllhhHEEELL
Query dvekVIRAaAIANKetkvPIITHSNAHN--------NTGLEQQRILteegvdpgKILIGH  199
ident                                        |                   |
Sbjct -dgtLDYP-DWVLR-eldLVLVSVHSRFnlpkadqtKRLLKALENP-------fVHVLAH  468
DSSP  -lllLLLL-HHHHL-lllEEEEELLLLLlllhhhhhHHHHHHHLLL-------lLLEELL


DSSP  HHHL---------lLHHH-HHHHHHLLLEEEELlLLLLllllhhhHHHHHHHHHHLLLll
Query LGDT---------dNIDY-IKKIADKGSFIGLDrYGLDlflpvdkRNETTLRLIKDGYsd  249
ident                      |   ||     |    |                  |   
Sbjct PTARllgrrapieaDWEAvFQKAKEKGVAVEID-GYYD---rmdlPDDLARMAYGMGL--  522
DSSP  LLLLllllllllllLHHHhHHHHHHHLLEEEEE-LLLL---llllLHHHHHHHHHLLL--


DSSP  LEEELLLLLLllllllllhhhhhhhlllLLLLHHHhLHHHHHHLLLLLHHHhhHHHLH--
Query KIMISHDYCCtidwgtakpeykpklaprWSITLIFeDTIPFLKRNGVNEEViaTIFKE--  307
ident  |  | |                                    |     |          
Sbjct WISLSTDAHQ-----------------tDHLRFME-LAVGTAQRAWIGPER--VLNTLdy  562
DSSP  LEEEELLLLL-----------------hHHHHHHH-HHHHHHHHLLLLLLL--LHHHLlh


DSSP  -hHHHHLL-----
Query -nPKKFFS-----  314
ident              
Sbjct edLLSWLKarrgv  575
DSSP  hhHHHHHHlllll


No 54: Query=2vc5A Sbjct=1m65A Z-score=7.7

back to top
DSSP  llllllllllllhhhllLEELLLLLLLLLhhhhhhlhhhllhhhHHHHHHHHHHHHHhll
Query mriplvgkdsieskdigFTLIHEHLRVFSeavrqqwphlynedeEFRNAVNEVKRAMqfg   60
ident                      | |                             |      
Sbjct ----------------yPVDLHMHTVAST-----------haysTLSDYIAQAKQKG---   30
DSSP  ----------------lLEELLLLLLLLL-----------llllLHHHHHHHHHHHL---


DSSP  LLEEEELLL----LLLL------llHHHHHhhhHLLLLEEEELeellllllllhhhllll
Query VKTIVDPTV----MGLG------rdIRFMEkvvKATGINLVAGtgiyiyidlpfyflnrs  110
ident  |                                  |     |                 
Sbjct IKLFAITDHgpdmEDAPhhwhfinmRIWPR---VVDGVGILRG----------ieanikn   77
DSSP  LLEEEEEEEllllLLLLllhhhhhhHHLLL---EELLEEEEEE----------eeeelll


DSSP  hhhhhhhHHHHHHllllllllLLLLeeeelllllllhhhhhhhhhhhhhhhhhlllEEEE
Query ideiadlFIHDIKegiqgtlnKAGFvxiaadepgitkdvekviraaaianketkvpIITH  170
ident                                                         ||  
Sbjct vdgeidcSGKMFD--------SLDL-------------------------------IIAG   98
DSSP  lllllllLHHHHH--------HLLE-------------------------------EEEE


DSSP  L----------llLLLHHHHHHHHHhhllllhhhEEELLHHHL---LLHHHH-HHHHHLL
Query S----------naHNNTGLEQQRILteegvdpgkILIGHLGDT---DNIDYI-KKIADKG  216
ident                                     | | |               |   
Sbjct FhepvfaphdkatNTQAMIATIASG-------nvHIISHPGNPkyeIDVKAVaEAAAKHQ  151
DSSP  LlllllllllhhhHHHHHHHHHHLL-------llLEELLLLLLlllLLHHHHhHHHHHHL


DSSP  LEEEElLLLLlllllhhhHHHHHHHHHHLLLLlLEEELLLLLLllllllllhhhhhhhll
Query SFIGLdRYGLdlflpvdkRNETTLRLIKDGYSdKIMISHDYCCtidwgtakpeykpklap  276
ident                             |          |                    
Sbjct VALEI-NNSS--------NCREVAAAVRDAGG-WVALGSDSHT-----------------  184
DSSP  LEEEE-ELLL--------LHHHHHHHHHHHLL-LEEEELLLLL-----------------


DSSP  llLLLHHHhLHHHHHHLLLLLHHHHhhHHLH--hHHHHLL-------------
Query rwSITLIFeDTIPFLKRNGVNEEVIatIFKE--nPKKFFS-------------  314
ident               |       | |            |               
Sbjct afTMGEFE-ECLKILDAVDFPPERI--LNVSprrLLNFLEsrgmapiaefadl  234
DSSP  hhHLLLLH-HHHHHHHHLLLLHHHL--HHHLhhhHHHHHHhllllllhhhlll


No 55: Query=2vc5A Sbjct=3f2bA Z-score=7.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  --------------------------------llllllllllllhhhlLLEELLLLL-LL
Query --------------------------------mriplvgkdsieskdiGFTLIHEHL-RV   27
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTpMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLlLL


DSSP  LLhhhhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLLllLLLL-HHHHHHHHHLL
Query FSeavrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTVmgLGRD-IRFMEKVVKAT   86
ident                             |   |   |                    |  
Sbjct QM--------------davtSVTKLIEQAKKWGHPAIAVTDH--AVVQsFPEAYSAAKKH  164
DSSP  LL--------------llllLHHHHHHHHHHLLLLLEEELLL--LLLLlHHHHHHHHHHH


DSSP  LLEEEELeellllllllhhhllllhhhhhhhhhhhhhlllllllllllleEEEL------
Query GINLVAGtgiyiyidlpfyflnrsideiadlfihdikegiqgtlnkagfvXIAA------  140
ident |     |                                                     
Sbjct GMKVIYG------------------------------------------lEANIvddpfh  182
DSSP  LLLEEEE------------------------------------------eEEEEelllee


DSSP  -----------------lllllLHHH----hhHHHHHHHHHhhhLLLEEeellllllhhh
Query -----------------depgiTKDV----ekVIRAAAIANketKVPIIthsnahnntgl  179
ident                                                             
Sbjct vtllaqnetglknlfklvslshIQYFhrvpriPRSVLVKHR---DGLLV-----------  228
DSSP  eeeeellhhhhhhhhhhhhhhhLLLLllllleEHHHHHHLL---LLEEE-----------


DSSP  hhhhhhhhllllhhheEELLH-hhlLLHHhhHHHHHLLLEEEELlllLLLL---llhHHH
Query eqqrilteegvdpgkiLIGHL-gdtDNIDyiKKIADKGSFIGLDrygLDLF---lpvDKR  235
ident                   |              ||    |                    
Sbjct ----------------GSGCDkgelFDNV--EDIARFYDFLEVHppdVYKPlyvkdeEMI  270
DSSP  ----------------ELLLLllllLLLL--LLLHHHLLLEEELlhhHHLLlllllhHHH


DSSP  HHHHHHHHHLLL--lLLEEELLLLLLllllllLLHHH------------hHHHLlLLLLL
Query NETTLRLIKDGY--sDKIMISHDYCCtidwgtAKPEY------------kPKLApRWSIT  281
ident           |                                         |       
Sbjct KNIIRSIVALGEkldIPVVATGNVHYlnpedkIYRKIlihsqgganplnrHELP-DVYFR  329
DSSP  HHHHHHHHHHHHhllLLEEELLLLLLllhhhhHHHHHhhhllhhhlllllLLLL-LLLLL


DSSP  hHHHLHHHHHHLLLLL--HHHHHHHHLHHHHHH---------------------------
Query lIFEDTIPFLKRNGVN--EEVIATIFKENPKKF---------------------------  312
ident              |     |                                        
Sbjct -TTNEMLDCFSFLGPEkaKEIVVDNTQKIASLIgdvkpikdelytpriegadeeiremsy  388
DSSP  -LHHHHHHHHHHHHHHhhHHHHLHHHHHHHHLLlllllllllllllllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct rrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgs  448
DSSP  hhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct sfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdi  508
DSSP  lhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct pfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvk  568
DSSP  llhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct ayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtss  628
DSSP  hhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct ewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsstep  688
DSSP  llleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct lgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqel  748
DSSP  hlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct iqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpe  808
DSSP  hhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct wyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgs  868
DSSP  hhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct aairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgns  928
DSSP  hhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  312
ident                                                             
Sbjct lippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdh  988
DSSP  eellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllll


DSSP  ----ll
Query ----fs  314
ident       
Sbjct nqlslf  994
DSSP  llllll


No 56: Query=2vc5A Sbjct=2anuA Z-score=5.7

back to top
DSSP  llllllllllllhHHLLLEELLLLLLLLlhhhhhhlhhhllhhhhhhHHHHHHHHHHHLL
Query mriplvgkdsiesKDIGFTLIHEHLRVFseavrqqwphlynedeefrNAVNEVKRAMQFG   60
ident                      | |                            |      |
Sbjct -------------TEWLLCDFHVHTNXS---------------dghlPLGEVVDLFGKHG   32
DSSP  -------------LEEEEEEEEELLLLL---------------llllLHHHHHHHHHHLL


DSSP  LLEEEELLLLL----------------------lllLHHHHHHHHHLLL----LEEEELE
Query VKTIVDPTVMG----------------------lgrDIRFMEKVVKATG----INLVAGT   94
ident |                                            |         |  | 
Sbjct VDVVSITDHIVdrrtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGV   92
DSSP  LLEEEEEEEEElhhhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEE


DSSP  ELLLLLLllhhhllllhhhhhhhhhhhhhlllllllllllleeeelllllllhhhhHHHH
Query GIYIYIDlpfyflnrsideiadlfihdikegiqgtlnkagfvxiaadepgitkdveKVIR  154
ident  |    |                                                     
Sbjct EITNNTD---------------------------------lyhivavdvkeyvdpsLPVE  119
DSSP  EEEELLL---------------------------------leeeeeelllllllllLLHH


DSSP  HHHHHHHHHLLLEEEELL---lLLLHHHHHHHHHHHLlllhhhEEELlhhhlllhhhHHH
Query AAAIANKETKVPIITHSN---aHNNTGLEQQRILTEEgvdpgkILIGhlgdtdnidyIKK  211
ident       ||     |                                              
Sbjct EIVEKLKEQNALVIAAHPdrkkLSWYLWANXERFKDT-----fDAWE---ianrddlFNS  171
DSSP  HHHHHHHHLLLEEEELLLllllLLLHHHHLLLLLLLL-----lLEEE---eeelleeLHH


DSSP  HHHLLLEEeellllllllllhhhhhhhhhhhhhlllllleEELLLLLLllllllllhhhh
Query IADKGSFIgldrygldlflpvdkrnettlrlikdgysdkiMISHDYCCtidwgtakpeyk  271
ident    |                                        |               
Sbjct VGVKKYRY--------------------------------VANSDFHE------------  187
DSSP  HHHLLLLE--------------------------------EEELLLLL------------


DSSP  hhhlllLLLLHHhhlhhhhhhlllllhhhhhhHHLH---hhhHHLL--------------
Query pklaprWSITLIfedtipflkrngvneeviatIFKE---npkKFFS--------------  314
ident                                                             
Sbjct ------LWHVYS------------------wkTLVKseknieAIKEairkntdvaiylxr  223
DSSP  ------HHHHLL------------------eeEEEEelllhhHHHHhhhhllleeeeell


DSSP  -
Query -  314
ident  
Sbjct k  224
DSSP  l


No 57: Query=2vc5A Sbjct=2yb1A Z-score=5.7

back to top
DSSP  llllllllllllhhhllLEELLLLLLLLlhhhhhhlhhhllhhhHHHHHHHHHHHHHhll
Query mriplvgkdsieskdigFTLIHEHLRVFseavrqqwphlynedeEFRNAVNEVKRAMqfg   60
ident                      | | |                                  
Sbjct ----------------aNIDLHFHSRTS------------dgalTPTEVIDRAAARA---   29
DSSP  ----------------lLEELLLLLLLL------------llllLHHHHHHHHHLLL---


DSSP  LLEEEELLLLlllLLHHHHHHHHHLLLLEEEE-LEELlLLLLllhhhllllhhhhhHHHH
Query VKTIVDPTVMglgRDIRFMEKVVKATGINLVA-GTGIyIYIDlpfyflnrsideiaDLFI  119
ident                           ||                                
Sbjct PALLALTDHD-ctGGLAEAAAAAARRGIPFLNgVEVSvSWGRhtvhivglgidpaePALA   88
DSSP  LLEEEELLLL-llLLHHHHHHHHHHLLLLEEEeEEEEeEELLeeeeeeeellllllHHHH


DSSP  HHHH--------------------------------------------------llllll
Query HDIK--------------------------------------------------egiqgt  129
ident    |                                                        
Sbjct AGLKsiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkd  148
DSSP  HHHHhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllll


DSSP  lllllleeeelllllllhhhhHHHHHHHHHHHHHLLLEEEE-LLLLLL---HHHHHHHHH
Query lnkagfvxiaadepgitkdveKVIRAAAIANKETKVPIITH-SNAHNN---TGLEQQRIL  185
ident                           |                                 
Sbjct mrtvfrkyltpgkpgyvshqwASLEDAVGWIVGAGGMAVIAhPGRYDMgrtLIERLILDF  208
DSSP  hhhhhhhllllllllllllllLLHHHHHHHHHHLLLEEEELlHHHLLLlhhHHHHHHHHH


DSSP  HHLLLlhhhEEEL---lhHHLLLHHHH-HHHHHLLLEEeellllllllllhhhhhhhhhh
Query TEEGVdpgkILIG---hlGDTDNIDYI-KKIADKGSFIgldrygldlflpvdkrnettlr  241
ident    |       |         |            |                         
Sbjct QAAGG----QGIEvasgsHSLDDMHKFaLHADRHGLYA----------------------  242
DSSP  HHLLL----LEEEeeellLLHHHHHHHhHHHHHHLLEE----------------------


DSSP  hhhlllllleEELLLLLLllllllllhhhhhhhllLLLLlhhhhlhhhhhhlllllhhhh
Query likdgysdkiMISHDYCCtidwgtakpeykpklapRWSItlifedtipflkrngvneevi  301
ident               |                                             
Sbjct ----------SSGSDFHA----------------pGEDV---------------ghtedl  261
DSSP  ----------EEELLLLL----------------lLLLL---------------llllll


DSSP  hhhhlhHHHHHLL----------
Query atifkeNPKKFFS----------  314
ident                        
Sbjct ppicrpIWRELEArilrpadaen  284
DSSP  llllllHHHHLHHhlllllhhhl


No 58: Query=2vc5A Sbjct=3e38A Z-score=5.7

back to top
DSSP  -llllllllllllhhhlLLEELLLLLLLllhhhhhhlhhhllhhhhhhHHHHHHHHHHHL
Query -mriplvgkdsieskdiGFTLIHEHLRVfseavrqqwphlynedeefrNAVNEVKRAMQF   59
ident                       | |                            |  |   
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVF---------------sdglvWPTVRVDEAYRD   45
DSSP  llllllllllllllleeEEEELLLLLLL---------------lllllLHHHHHHHHHHL


DSSP  LLLEEEELLLLLLL--------lLHHHHHHHHHLLL---LEEE-ELEElLLLLlllhhhl
Query GVKTIVDPTVMGLG--------rDIRFMEKVVKATG---INLV-AGTGiYIYIdlpfyfl  107
ident |   |                    |             | |                  
Sbjct GLDAISLTEHIEYRphkqdvvsdHNRSFDLCREQAEklgILLIkGSEI-TRAX--apghf  102
DSSP  LLLEELLEEELLLLlllllllllLLHHHHHHHHHHHhhlLEELlEEEE-ELLL--lllee


DSSP  lllhhhhhhHHHHhhhlllllllllllleeeelllllllhhhhhHHHHHHHHHHHHLLLE
Query nrsideiadLFIHdikegiqgtlnkagfvxiaadepgitkdvekVIRAAAIANKETKVPI  167
ident                                                 |    |      
Sbjct naiflsdsnPLEQ------------------------------kDYKDAFREAKKQGAFX  132
DSSP  eeelllllhHHLL------------------------------lLHHHHHHHHHHLLLEE


DSSP  EEELLL-------LLLHhHHHHHHHHHLLLlhhhEEELLH---HHLLlhhHHHHHH-HLL
Query ITHSNA-------HNNTgLEQQRILTEEGVdpgkILIGHL---GDTDnidYIKKIA-DKG  216
ident                         |  ||       |                    || 
Sbjct FWNHPGwdsqqpdTTKW-WPEHTALYQEGC---xHGIEVAnghLYXP---EAIQWClDKN  185
DSSP  EELLLLlllllllLLLL-LHHHHHHHHLLL---lLEEEEEellEELL---HHHHHHhHHL


DSSP  LEEeellllllllllhhhhhhhhhhhhhlllllleEELLLLLLllllllllhhhhhhhlL
Query SFIgldrygldlflpvdkrnettlrlikdgysdkiMISHDYCCtidwgtakpeykpklaP  276
ident                                        |                    
Sbjct LTX--------------------------------IGTSDIHQ--------------piQ  199
DSSP  LEE--------------------------------EEELLLLL--------------lhH


DSSP  LLLllhhhHLHHhhhhlllllhhhhhhHHLH--------HHHHHLL--------------
Query RWSitlifEDTIpflkrngvneeviatIFKE--------NPKKFFS--------------  314
ident                             |                               
Sbjct TDY--dfeKGEH------------rtxTFVFakerslqgIREALDNrrtaayfhelligr  245
DSSP  HHL--lhhHLLL------------lleEEEEellllhhhHHHHHHLlleeeeelleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  314
ident                                                             
Sbjct edllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtr  305
DSSP  hhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeelllee


DSSP  -------------------------------------
Query -------------------------------------  314
ident                                      
Sbjct ytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=2vc5A Sbjct=1bksA Z-score=5.2

back to top
DSSP  llllllllllllHHHLLleelllllllllhhhhhhlhhhllhhhhhhhhhhhhhhhhhll
Query mriplvgkdsieSKDIGftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg   60
ident                                                             
Sbjct -----meryenlFAQLN-----------------------------------------dr   14
DSSP  -----lhhhhhhHHHHH-----------------------------------------hl


DSSP  lLEEEELLLLlllllhhhhhhhhhlllleeeeleellllllllhhhllLLHHHHHHHHHH
Query vKTIVDPTVMglgrdirfmekvvkatginlvagtgiyiyidlpfyflnRSIDEIADLFIH  120
ident       | |                                         |         
Sbjct rEGAFVPFVT-----------------------------------lgdPGIEQSLKIIDT   39
DSSP  lLLEEEEEEE-----------------------------------lllLLHHHHHHHHHH


DSSP  HHHLlllllllLLLLEEEEL-LLLL----------------llHHHHHHHHHHHHHHHHH
Query DIKEgiqgtlnKAGFVXIAA-DEPG----------------itKDVEKVIRAAAIANKET  163
ident  |          |                                        |      
Sbjct LIDA-------GADALELGVpFSDPladgptiqnanlrafaagVTPAQCFEMLALIREKH   92
DSSP  HHHL-------LLLLEEEELlLLLLllllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHL


DSSP  L-LLEEEELLlLLLH----hhHHHHHHHHLLllhhHEEELL-hhHLLLHHH-HHHHHHLL
Query K-VPIITHSNaHNNT----glEQQRILTEEGvdpgKILIGH-lgDTDNIDY-IKKIADKG  216
ident    ||       |                 |                             
Sbjct PtIPIGLLMY-ANLVfnngidAFYARCEQVG----VDSVLVadvPVEESAPfRQAALRHN  147
DSSP  LlLLEEEEEL-HHHHhlllhhHHHHHHHHHL----LLEEEElllLHHHLHHhHHHHHHLL


DSSP  LEEEELlLLLLlllLHHHHHHHHHHHhhlllllLEEELLLlllllllllllhhhhhhhlL
Query SFIGLDrYGLDlflPVDKRNETTLRLikdgysdKIMISHDycctidwgtakpeykpklaP  276
ident                 |                                           
Sbjct IAPIFI-CPPN---ADDDLLRQVASY------gRGYTYLL-------------------A  178
DSSP  LEEEEE-ELLL---LLHHHHHHHHHH------lLLLEEEL-------------------L


DSSP  LLLlLHHHHLHHHHH----------------------------------------hllll
Query RWSiTLIFEDTIPFL----------------------------------------krngv  296
ident         |                                                   
Sbjct LPL-HHLIEKLKEYHaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspk  237
DSSP  LLH-HHHHHHHHHHLllleeellllllhhhhhhhhhhllleeeellhhhhhhhhllllhh


DSSP  lhhhhhhhhlhhhhhhll
Query neeviatifkenpkkffs  314
ident                   
Sbjct qmlaelrsfvsamkaasr  255
DSSP  hhhhhhhhhhhhhhhlll