Results: dupa

Query: 2uz9A

MOLECULE: GUANINE DEAMINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2uz9-A 74.0  0.0  444   444  100 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   2:  3ls9-A 42.5  2.3  403   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   3:  1j6p-A 42.1  2.5  378   407   21 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   4:  2paj-A 40.4  2.4  368   421   21 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   5:  4rdv-B 37.6  2.9  394   451   18 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   6:  2oof-A 36.0  2.8  359   403   17 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   7:  4cqb-A 31.5  3.2  353   402   15 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  1k6w-A 30.0  3.2  344   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   9:  3mkv-A 29.9  3.1  339   414   18 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  10:  2imr-A 29.5  4.3  319   380   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  11:  3mtw-A 29.4  3.5  338   404   17 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  12:  3icj-A 28.4  3.1  320   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  13:  4c5y-A 27.4  3.0  341   436   18 PDB  MOLECULE: OCHRATOXINASE;                                             
  14:  2vun-A 26.7  3.9  326   385   16 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  3nqb-A 25.5  3.2  309   587   16 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  16:  1yrr-B 24.5  3.5  301   334   16 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  17:  1onx-A 23.7  3.5  311   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  18:  3ooq-A 22.7  3.3  278   384   19 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  19:  3giq-A 21.6  3.9  308   475   18 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  20:  1a4m-A 21.5  2.9  267   349   15 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  21:  2ogj-A 21.3  4.4  309   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  1gkp-A 20.1  4.2  317   458   13 PDB  MOLECULE: HYDANTOINASE;                                              
  23:  3gri-A 19.6  4.0  305   422   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  3e74-A 19.6  4.1  301   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  25:  4b3z-D 18.5  4.1  315   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  26:  1a5k-C 16.4  3.8  308   566   15 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  27:  2y1h-B 16.0  3.3  231   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  28:  3k2g-B 15.3  3.7  235   358   10 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  1bf6-A 14.8  3.9  230   291   10 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  3gg7-A 14.7  2.9  208   243   12 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  31:  2ob3-A 14.6  4.4  236   329   12 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  32:  3cjp-A 13.7  3.5  213   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  33:  2vc5-A 13.7  4.5  232   314   13 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  34:  3pnu-A 13.5  4.2  239   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  35:  3irs-A 12.9  4.0  224   281    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  36:  2dvt-A 12.8  3.7  217   325   14 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  37:  4qrn-A 12.7  3.6  216   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  38:  4dlf-A 12.6  3.7  213   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  39:  4mup-B 12.6  3.4  218   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  40:  2ffi-A 12.2  3.5  216   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  41:  4ofc-A 12.2  3.8  210   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  42:  4hk5-D 12.1  3.8  220   380   10 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  43:  1v77-A 11.8  2.9  179   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  44:  4dzi-C 11.5  3.7  213   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  45:  2qpx-A 11.4  4.2  219   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  46:  2a3l-A 11.3  3.8  262   616   13 PDB  MOLECULE: AMP DEAMINASE;                                             
  47:  1itq-A 11.0  3.7  214   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  48:  2gwg-A 11.0  4.1  215   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  49:  3dcp-A 10.0  3.0  169   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  50:  3iac-A  9.5  4.5  230   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  3qy6-A  9.4  3.6  183   247   16 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  52:  1j5s-A  9.1  4.0  230   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  53:  3au2-A  8.6  3.6  180   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3f2b-A  8.2  7.5  171   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1m65-A  7.8  4.1  176   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  7.7  3.8  179   255    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.0  4.2  151   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.6  3.6  164   342   15 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  5.4  3.4  145   224   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2uz9A Sbjct=2uz9A Z-score=74.0

back to top
DSSP  LLLEEEEEEEEELLLLLLLEEEEEEEEEELLLLLEEEEEEHHHHHHHHHHHLLLHHHEEE
Query PLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRE   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRE   60
DSSP  LLLEEEEEEEEELLLLLLLEEEEEEEEEELLLLLEEEEEEHHHHHHHHHHHLLLHHHEEE


DSSP  LLLLLEEEELEEEEEEEHHHHHHLLLLLLLLHHHHHHHLHHHHHHHHHLHHHHHHHHHHH
Query LSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRV  120
DSSP  LLLLLEEEELEEEEEEEHHHHHHLLLLLLLLHHHHHHHLHHHHHHHHHLHHHHHHHHHHH


DSSP  HHHHHHLLEEEEEEELLLLHHHHHHHHHHHHHHLLEEEEELEELLLLLLLLLLLLLHHHH
Query VRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEES  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEES  180
DSSP  HHHHHHLLEEEEEEELLLLHHHHHHHHHHHHHHLLEEEEELEELLLLLLLLLLLLLHHHH


DSSP  HHHHHHHHHHHHHHLLLLEEEEEEELLHHHLLHHHHHHHHHHHHHHLLEEEEEELLLHHH
Query IKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDE  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDE  240
DSSP  HHHHHHHHHHHHHHLLLLEEEEEEELLHHHLLHHHHHHHHHHHHHHLLEEEEEELLLHHH


DSSP  HHHHHHHLLLLLLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHH
Query VEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLS  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLS  300
DSSP  HHHHHHHLLLLLLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHH


DSSP  LLLLLLLHHHHHHLLLEEEELLLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLLLLLHHH
Query LSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVSNILLINKVNEKSLTLKE  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVSNILLINKVNEKSLTLKE  360
DSSP  LLLLLLLHHHHHHLLLEEEELLLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLLLLLHHH


DSSP  HHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLLLLLLLLLLLHHHHLLLLLHHHHH
Query VFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDISEAVIQK  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDISEAVIQK  420
DSSP  HHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLLLLLLLLLLLHHHHLLLLLHHHHH


DSSP  HHHHLLHHHEEEEEELLEEEELLL
Query FLYLGDDRNIEEVYVGGKQVVPFS  444
ident ||||||||||||||||||||||||
Sbjct FLYLGDDRNIEEVYVGGKQVVPFS  444
DSSP  HHHHLLHHHEEEEEELLEEEELLL


No 2: Query=2uz9A Sbjct=3ls9A Z-score=42.5

back to top
DSSP  llLEEEEE--EEEELLLLLllEEEEEEEEEELlLLLEEEEEEHhhhhhHHHHHlllhhHE
Query plAHIFRG--TFVHSTWTCpmEVLRDHLLGVSdSGKIVFLEEAsqqekLAKEWcfkpcEI   58
ident       ||               | |         |||                      
Sbjct --MILIRGltRVITFDDQE--RELEDADILID-GPKIVAVGKD----lSDRSV----sRT   47
DSSP  --LEEEEEeeEEELLLLLL--LEEEEEEEEEE-LLEEEEEELL----lLLLLL----lEE


DSSP  EELLlLLEEEELEEEEEEEHHHHHHLLL--LLLLLHHHHHHHLhHHHHH-----hhHLHH
Query RELShHEFFMPGLVDTHIHASQYSFAGS--SIDLPLLEWLTKYtFPAEH-----rfQNID  111
ident           |||   | |                   ||                   |
Sbjct IDGR-GMIALPGLINSHQHLYEGAMRAIpqLERVTMASWLEGV-LTRSAgwwrdgkFGPD  105
DSSP  EELL-LEEEEELEEEEEELHHHHHHLLLhhHLLLLHHHHHHHH-HHHHHhhhhlllLLHH


DSSP  HHHHHHHHHHHHHHHLLEEEEEEELLLL-----HHHHHHHHHHHHHHLLEEEEELEELLL
Query FAEEVYTRVVRRTLKNGTTTACYFATIH-----TDSSLLLADITDKFGQRAFVGKVCMDL  166
ident    ||   |    |  | ||                           | |       | |
Sbjct VIREVARAVLLESLLGGITTVADQHLFFpgataDSYIDATIEAATDLGIRFHAARSSMTL  165
DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELLLlllllLLHHHHHHHHHHHHLLEEEEEELLLLL


DSSP  LL-----LLLLLLLLHHHHHHHHHHHHHHHH-hhllLLEEEEEEELLHHHLLHHHHHHHH
Query ND-----TFPEYKETTEESIKETERFVSEML-qknySRVKPIVTPRFSLSCSETLMGELG  220
ident              |                        |     |         |     
Sbjct GKseggfCDDLFVEPVDRVVQHCLGLIDQYHepepfGMVRIALGPCGVPYDKPELFEAFA  225
DSSP  LHhhlllLLHHHLLLHHHHHHHHHHHHHHHLlllllLLEEEEELLLLLLLLLHHHHHHHH


DSSP  HHHHHHLLEEEEEELLLhHHHHHHHHHLLllLLHHHHHHHLLLLLLLEEEEELLLLLHHH
Query NIAKTRDLHIQSHISENrDEVEAVKNLYPsyKNYTSVYDKNNLLTNKTVMAHGCYLSAEE  280
ident   |   |     |  |          ||           |          ||      ||
Sbjct QMAADYDVRLHTHFYEP-LDAGMSDHLYG--MTPWRFLEKHGWASDRVWLAHAVVPPREE  282
DSSP  HHHHHHLLEEEEEELLL-LHHHHHHHHHL--LLHHHHHHHLLLLLLLEEEEELLLLLHHH


DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL-LLLLLLHHHHHHHH
Query LNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVA-GGYSYSMLDAIRRA  339
ident    |   |  |||     |    |     | |      | ||           |   | |
Sbjct IPEFADAGVAIAHLIAPDLRMGWGLAPIREYLDAGITVGFGTTGSaSNDGGNLLGDLRLA  342
DSSP  HHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLlLLLLLLHHHHHHHH


DSSP  HHHHHHHHHLLlLLLLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELLLLll
Query VMVSNILLINKvNEKSLTLKEVFRLATLGGSQALGLDgEIGNFEVGKEFDAILINPKAsd  399
ident          |   || |   |  | || |    ||     |  | |   |          
Sbjct ALAHRPADPNE-PEKWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLDG--  398
DSSP  HHHLHHHLLLL-HHHLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELLL--


DSSP  LLLLLllhhhhlllLLHHHHHHHH--HLLHhhEEEEEELLEEE----ELLL---------
Query SPIDLfygdffgdiSEAVIQKFLY--LGDDrnIEEVYVGGKQV----VPFS---------  444
ident                           | |      | | |        |           
Sbjct VDRVG---------VHDPAIGLIMtgLSDR--ASLVVVNGQVLveneRPVLadlerivan  447
DSSP  HHHLL---------LLLHHHHHHHllLLLL--LLEEEELLEEEeellEELLllhhhhhhh


DSSP  ------
Query ------  444
ident       
Sbjct ttalip  453
DSSP  hhhhll


No 3: Query=2uz9A Sbjct=1j6pA Z-score=42.1

back to top
DSSP  lLLEEEE-EEEEELllllLLEEEEEEEEEELlLLLEEEEEEHHHHhhhhhhhlllhhHEE
Query pLAHIFR-GTFVHStwtcPMEVLRDHLLGVSdSGKIVFLEEASQQeklakewcfkpcEIR   59
ident     |                            | |                        
Sbjct -HHXIIGnCLILKD----FSSEPFWGAVEIE-NGTIKRVLQGEVK------------VDL   42
DSSP  -LEEEEEeEEELLL----LLLLLEEEEEEEE-LLEEEEEEELLLL------------LLE


DSSP  ELLlLLEEEELEEEEEEEHHHHHHLLLLLLLLHHHHHHHLHHHHHHHHhLHHHHHHHHHH
Query ELShHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFqNIDFAEEVYTR  119
ident  ||      | |  || ||      |   ||   |||     | | |      |      
Sbjct DLS-GKLVXPALFNTHTHAPXTLLRGVAEDLSFEEWLFSKVLPIEDRL-TEKXAYYGTIL  100
DSSP  ELL-LEEEEELEEEEEELHHHHHHLLLLLLLLHHHHHHLLHHHHHLLL-LHHHHHHHHHH


DSSP  HHHHHHHLLEEEEEEELLllhhHHHHHHHHHHHHLLEEEEELEELLLlllllllllLHHH
Query VVRRTLKNGTTTACYFATihtdSSLLLADITDKFGQRAFVGKVCMDLndtfpeykeTTEE  179
ident         |                  |     || ||       |              
Sbjct AQXEXARHGIAGFVDXYF----HEEWIAKAVRDFGXRALLTRGLVDS-------ngDDGG  149
DSSP  HHHHHHLLLEEEEEEEEL----LHHHHHHHHHHHLLEEEEEEEELLL-------llLLLL


DSSP  HHHHHHHHHHHHHhHLLLLEEEEEEELLHHHLLHHHHHHHHHHHHHHLLEEEEEELLLHH
Query SIKETERFVSEMLqKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRD  239
ident    |      |       |      |     |||         ||        |  |   
Sbjct RLEENLKLYNEWN-GFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSK  208
DSSP  HHHHHHHHHHHHL-LHHHLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLEEEEELLLLL


DSSP  HHhhhhhhlllllLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHH
Query EVeavknlypsykNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNL  299
ident |                      |   ||  ||   |      |         | | |||
Sbjct EE-----------YDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNL  257
DSSP  LL-----------LLLHHHHLLLLLLLLEEEEELLLLLHHHHHHHLLLLEEEEELHHHHH


DSSP  HLLLLLLLHHHHHHLLLEEEELLLLL-LLLLLLHHHHHHHHHHHHHHHHhllllLLLLLH
Query SLSSGFLNVLEVLKHEVKIGLGTDVA-GGYSYSMLDAIRRAVMVSNILLinkvnEKSLTL  358
ident  |  |   |     |  |  |||| |    |       | |                |  
Sbjct KLGNGIAPVQRXIEHGXKVTLGTDGAaSNNSLNLFFEXRLASLLQKAQN-----PRNLDV  312
DSSP  HLLLLLLLHHHHHHLLLEEEELLLLLlLLLLLLHHHHHHHHHHHHHLLL-----LLLLLH


DSSP  HHHHHHHLHHHHHHLLLllLLLLLLLLLLLLEEEELLLLllLLLLLllhhhhllllLHHH
Query KEVFRLATLGGSQALGLdgEIGNFEVGKEFDAILINPKAsdSPIDLfygdffgdisEAVI  418
ident        |  | || |     |  | |   |   |                         
Sbjct NTCLKXVTYDGAQAXGF--KSGKIEEGWNADLVVIDLDL--PEXFP---------vQNIK  359
DSSP  HHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELLL--HHHLL---------hHHHH


DSSP  HHHHH-HLLHhhEEEEEELLEEE---ELLL--------------------
Query QKFLY-LGDDrnIEEVYVGGKQV---VPFS--------------------  444
ident                  | ||                             
Sbjct NHLVHaFSGE--VFATXVAGKWIyfdGEYPtidseevkrelariekelys  407
DSSP  HHHHHlLLLL--LLEEEELLEEEeelLLLLlllhhhhhhhhhhhhhhhhl


No 4: Query=2uz9A Sbjct=2pajA Z-score=40.4

back to top
DSSP  lLLEEEEEE--EEELLLL---LLLEEEEeEEEEELlLLLEEEEEEHHhhhhhhhhhlLLH
Query pLAHIFRGT--FVHSTWT---CPMEVLRdHLLGVSdSGKIVFLEEASqqeklakewcFKP   55
ident       |               |  |             |                   |
Sbjct -PSTLIRNAaaIMTGGRGtadDPSRVPG-PDIRIV-GDTIDAIGALA----------PRP   47
DSSP  -LEEEEELLleELLLLLLlllLLLLLLL-LLEEEE-LLEEEEELLLL----------LLL


DSSP  HH-EEELLlLLEEEELEEEEEEEHHHHHHLLLLllllhhhhhhhlhhhHHHHHhLHHHHH
Query CE-IRELShHEFFMPGLVDTHIHASQYSFAGSSidlpllewltkytfpAEHRFqNIDFAE  114
ident  | |          |  | || |  |    |                     |       
Sbjct GEtIVDAT-DCVIYPAWVNTHHHLFQSLLKGEP---------------FRALF-DERRFR   90
DSSP  LLeEEELL-LLEEEELEELLLLLHHHHHLLLLL---------------LHHHL-LHHHHH


DSSP  HHHHHHHHHHHHLLEEEEEEELLLL-----hHHHHHHHHHHHHHLLEEEEELEELLLLLL
Query EVYTRVVRRTLKNGTTTACYFATIH-----tDSSLLLADITDKFGQRAFVGKVCMDLNDT  169
ident              |  |              |||  |     | | |             
Sbjct LAARIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEKLGLRFVLLRGGATQTRQ  150
DSSP  HHHHHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHHLLLEEEEEELLLLLLLL


DSSP  LL------LLLLLHHHHHHHHHHHHHHHH-hhllLLEEEEEEELL-HHHLLHHHHHHHHH
Query FP------EYKETTEESIKETERFVSEML-qknySRVKPIVTPRF-SLSCSETLMGELGN  221
ident            ||        ||                   |     | |   | |   
Sbjct LEadlptaLRPETLDAYVADIERLAARYHdasprAMRRVVMAPTTvLYSISPREMRETAA  210
DSSP  LLllllhhHLLLLHHHHHHHHHHHHHHLLlllllLLEEEEELLLLlLLLLLHHHHHHHHH


DSSP  HHHHHLLEEEEEELllhhhhhhhhhhlllLLLHHHHHHHLLLLLLLEEEEELLLLLHHHH
Query IAKTRDLHIQSHISenrdeveavknlypsYKNYTSVYDKNNLLTNKTVMAHGCYLSAEEL  281
ident  |    |   || |                |           |      ||     | | 
Sbjct VARRLGLRMHSHLS---------------GKSPVAFCGEHDWLGSDVWYAHLVKVDADEI  255
DSSP  HHHHLLLEEEEELL---------------LLLHHHHHHHLLLLLLLEEEELLLLLLHHHH


DSSP  HHHHHHLLEEEELHHHHHHLlllllLHHHHHHLLLEEEELLLLL-LLLLLLHHHHHHHHH
Query NVFHERGASIAHCPNSNLSLssgflNVLEVLKHEVKIGLGTDVA-GGYSYSMLDAIRRAV  340
ident       |   |||| ||  |      | |     |    | | |       |        
Sbjct ALLAQTGTGVAHCPQSNGRL-----PVREMADAGVPVSIGVDGAaSNEAADMISEVHMTW  310
DSSP  HHHHHHLLEEEELHHHHHLL-----LLLLHHHHLLLEEELLLHHhHLLLLLHHHHHHHHH


DSSP  HHHHHHHhlllllllLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELLLLllL
Query MVSNILLinkvneksLTLKEVFRLATLGGSQALGLDgEIGNFEVGKEFDAILINPKAsdS  400
ident       |            ||    | ||    ||| | |   ||   |           
Sbjct LAQRARL--------ASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIAVYRLDD--P  359
DSSP  HHHHHLL--------LLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELLL--H


DSSP  LLLLllhhhhllllLHHHHHHHHHLLHHHEEEEEELLEEE---ELLL-------------
Query PIDLfygdffgdisEAVIQKFLYLGDDRNIEEVYVGGKQV---VPFS-------------  444
ident                         |           || |                    
Sbjct RYFG---------lHDPAIGPVASGGRPSVMALFSAGKRVvvdDLIEgvdikelggearr  410
DSSP  HHLL---------lLLHHHHHHHLLLLLEEEEEEELLEEEeelLLLLlllhhhhhhhhhh


DSSP  -----------
Query -----------  444
ident            
Sbjct vvrellrevvv  421
DSSP  hhhhhhhhhhl


No 5: Query=2uz9A Sbjct=4rdvB Z-score=37.6

back to top
DSSP  lllEEEEE-EEEELLlllllEEEEEEEEEELLLLLEEEEEEHHHhhhhhhhhlllhHHEE
Query plaHIFRG-TFVHSTwtcpmEVLRDHLLGVSDSGKIVFLEEASQqeklakewcfkpCEIR   59
ident                        |      |  |                          
Sbjct ---SAIFAeRALLPE-----GWARNVRFEISADGVLAEIRPDAN-----------aDGAE   41
DSSP  ---LEEEEeEEEELL-----EEEEEEEEEELLLLLEEEEELLLL-----------lLLLE


DSSP  ELLllLEEEELEEEEEEEHHHHHHLLLLLL-----LLHHHHHhHLHHHHHHHHhLHHHHH
Query ELShhEFFMPGLVDTHIHASQYSFAGSSID-----LPLLEWLtKYTFPAEHRFqNIDFAE  114
ident  |       ||    | || |   ||              |          |       |
Sbjct RLG--GAVLPGMPNLHSHAFQRAMAGLAEVagnpnDSFWTWR-ELMYRMVARL-SPEQIE   97
DSSP  ELL--LLEEELEEEEEELHHHHHHLLLLLLlllllLLHHHHH-HHHHHHHLLL-LHHHHH


DSSP  HHHHHHHHHHHHLLEEEEEEELLLL-----------HHHHHHHHHHHHHHLLEEEEELEE
Query EVYTRVVRRTLKNGTTTACYFATIH-----------TDSSLLLADITDKFGQRAFVGKVC  163
ident           || | |    |   |              ||         |       | 
Sbjct VIACQLYIEMLKAGYTAVAEFHYVHhdldgrsyadpAELSLRISRAASAAGIGLTLLPVL  157
DSSP  HHHHHHHHHHHHHLEEEEEEEELLLlllllllllllLHHHHHHHHHHHHHLLEEEEEELL


DSSP  LLLL-------LLLLLLLLlhhHHHHHHHHHHHHHHHH-LLLLEEEEEEELLHHHLLHHH
Query MDLN-------DTFPEYKEtteESIKETERFVSEMLQK-NYSRVKPIVTPRFSLSCSETL  215
ident                                                             
Sbjct YSHAgfggqpaSEGQRRFI---NGSEAYLELLQRLRAPlEAAGHSLGLCFHSLRAVTPQQ  214
DSSP  LLEEellleelLHHHLLLL---LLHHHHHHHHHHHHHHhHHHLLEELEEELLLLLLLHHH


DSSP  HHHHHHhhHHHL-LEEEEEELLLHHHHHHHHHHLLllLLHHHHHHHLLLLLLLEEEEELL
Query MGELGNiaKTRD-LHIQSHISENRDEVEAVKNLYPsyKNYTSVYDKNNLLTNKTVMAHGC  274
ident            | |    || |   ||                   |          |  
Sbjct IATVLA--AGHDdLPVHIHIAEQQKEVDDCQAWSG--RRPLQWLYENVAVDQRWCLVHAT  270
DSSP  HHHHHL--LLLLlLLEEEEELLLHHHHHHHHHHHL--LLHHHHHHHHLLLLLLEEEEELL


DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLllLLLLHHH
Query YLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAggYSYSMLD  334
ident      |       ||    |      |  |       |      | | |     | |   
Sbjct HADPAEVAAMARSGAVAGLCLSTEANLGDGIFPATDFLAQGGRLGIGSDSH--VSLSVVE  328
DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL--LLLLHHH


DSSP  HHHHHHHHHHHHHHLlllLLLL-------LHHHHHHHHLHHHHHHLLLllLLLLLLLLLL
Query AIRRAVMVSNILLINkvnEKSL-------TLKEVFRLATLGGSQALGLdgEIGNFEVGKE  387
ident   |                  |               |  || ||||    ||   ||  
Sbjct ELRWLEYGQRLRDRK---RNRLyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRR  383
DSSP  HHHHHHHHHHHHHLL---LLLLlllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLL


DSSP  LLEEEELLLLllLLLLLllhhhhllllLHHHHHHHHHLLHHHEEEEEELLEEE---ELLL
Query FDAILINPKAsdSPIDLfygdffgdisEAVIQKFLYLGDDRNIEEVYVGGKQV---VPFS  444
ident  |                          |     |  | ||    | | |  |       
Sbjct ADLLVLDGND--PYLAS-------aegDALLNRWLFAGGDRQVRDVMVAGRWVvrdGRHA  434
DSSP  LLEEEELLLL--HHHHL-------lllHHHHHHHHHHLLHHHEEEEEELLEEEellLLLL


DSSP  -----------------
Query -----------------  444
ident                  
Sbjct geersarafvqvlgell  451
DSSP  lhhhhhhhhhhhhhhhl


No 6: Query=2uz9A Sbjct=2oofA Z-score=36.0

back to top
DSSP  -LLLEEEE-EEEEELLLL-LLLEEEEEEEEEELlLLLEEEEEEHHHHHhhhhhhllLHHH
Query -PLAHIFR-GTFVHSTWT-CPMEVLRDHLLGVSdSGKIVFLEEASQQEklakewcfKPCE   57
ident           |             |  | |||   | |  |                |  
Sbjct lNCERVWLnVTPATLRSDlADYGLLEPHALGVH-EGRIHALVPXQDLK--------YPAH   51
DSSP  lLLLEEEEeEEELLLLLLlLLLLLLLLEEEEEE-LLEEEEEEEHHHLL--------LLLL


DSSP  EEELLLlLEEEELEEEEEEEHHHhhhllLLLL----------llhhhhhhHLHHHHHHHH
Query IRELSHhEFFMPGLVDTHIHASQysfagSSID----------lpllewltKYTFPAEHRF  107
ident            ||| | | |        |                               
Sbjct WQDXKG-KLVTPGLIDCHTHLIF---agSRAEefelrqkgvpyaeiarkgGGIISTVRAT  107
DSSP  LEELLL-LEEEELEEEEEELLLL---llLLHHhhhhhhhlllhhhhhhllLLHHHHHHHH


DSSP  H--LHHHHHHHHHHHHHHHHHLLEEEEEEELLL------LHHHHHHHHHHHHHHLLEEEE
Query Q--NIDFAEEVYTRVVRRTLKNGTTTACYFATI------HTDSSLLLADITDKFGQRAFV  159
ident      |   |     |      | ||                              |   
Sbjct RaaSEDQLFELALPRVKSLIREGVTTVEIKSGYgltledELKXLRVARRLGEALPIRVKT  167
DSSP  HhlLHHHHHHHHHHHHHHHHHHLEEEEEEELLLlllhhhHHHHHHHHHHHHHHLLLEEEE


DSSP  ELEE-LLLLlLLLL--lllLHHHHH-HHHHHHHHHHHhhlllleEEEEEELLH-HHLLHH
Query GKVC-MDLNdTFPE--ykeTTEESI-KETERFVSEMLqknysrvKPIVTPRFS-LSCSET  214
ident                      |              |          |         |  
Sbjct TLLAaHAVP-PEYRddpdsWVETICqEIIPAAAEAGL-------ADAVDVFCEhIGFSLA  219
DSSP  EEEEeLLLL-HHHLllhhhHHHHHHhLHHHHHHHLLL-------LLEEEEEELlLLLLHH


DSSP  HHHHHHHHHHHHLLEEEEEELLLHhhhhhhhhhlllllLHHHHHHhlllLLLLEEEEELL
Query LMGELGNIAKTRDLHIQSHISENRdeveavknlypsykNYTSVYDknnlLTNKTVMAHGC  274
ident         |    |    |                                      |  
Sbjct QTEQVYLAADQYGLAVKGHXDQLS------------nlGGSTLAA----NFGALSVDHLE  263
DSSP  HHHHHHHHHHHLLLEEEEEELLLL------------llLHHHHHH----HLLLLEEEELL


DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLL-LLLLHHHHHHLLLEEEELLLLL--LLLLLL
Query YLSAEELNVFHERGASIAHCPNSNLSLSS-GFLNVLEVLKHEVKIGLGTDVA--GGYSYS  331
ident ||  |       ||      |     |       |    |  |      |         |
Sbjct YLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKAGVPXAVSSDINpgTAPIVS  323
DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHLLLLEEELLLLLllLLLLLL


DSSP  HHHHHHHHHHHHHhhhhlllllllLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEE
Query MLDAIRRAVMVSNillinkvneksLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAI  391
ident    |   |                ||  |     |     |||     |   ||   |  
Sbjct LRXAXNXACTLFG-----------LTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFL  372
DSSP  HHHHHHHHHHHHL-----------LLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEE


DSSP  EELLLllllllllllhhhhlllllhHHHHHHHHLLHHHEEEEEELLEEEELll
Query LINPKasdspidlfygdffgdiseaVIQKFLYLGDDRNIEEVYVGGKQVVPfs  444
ident   |                            ||          | |       
Sbjct VWNCG--------------------HPAELSYLIGVDQLVSRVVNGEETLH--  403
DSSP  EELLL--------------------LLLHHHHLLLLLLEEEEEELLEELLL--


No 7: Query=2uz9A Sbjct=4cqbA Z-score=31.5

back to top
DSSP  --LLLEEEE-EEEEelllllllEEEEEEEEEELlLLLEEEEEEHhhhhhhhhHHLLlhhH
Query --PLAHIFR-GTFVhstwtcpmEVLRDHLLGVSdSGKIVFLEEAsqqeklakEWCFkpcE   57
ident       | |             |       |      |   |          |       
Sbjct skDFDLIIRnAYLS--------EKDSVYDIGIV-GDRIIKIEAK-------iEGTV--kD   42
DSSP  llLEEEEEEeEEEL--------LLLEEEEEEEE-LLEEEEEELL-------lLLLE--eE


DSSP  EEELLlLLEEEELEEEEEEEHHHHHHL-----LLLL--LLLHHHHHHhLHHHHHHHhHLH
Query IRELShHEFFMPGLVDTHIHASQYSFA-----GSSI--DLPLLEWLTkYTFPAEHRfQNI  110
ident            || || | |                                        
Sbjct EIDAK-GNLVSPGFVDAHTHMDKSFTStgerlPKFWsrPYTRDAAIE-DGLKYYKN-ATH   99
DSSP  EEELL-LLLEEELEEEEEELHHHLLLLlllllLLLLllLLLHHHHHH-HHHHHHHH-LLH


DSSP  HHHHHHHHHHHHHHHHLLEEEEEEELLL----LHHHHHHHHHHHHHH--LLEEEEELEE-
Query DFAEEVYTRVVRRTLKNGTTTACYFATI----HTDSSLLLADITDKF--GQRAFVGKVC-  163
ident                  ||              |                    |     
Sbjct EEIKRHVIEHAHMQVLHGTLYTRTHVDVdsvaKTKAVEAVLEAKEELkdLIDIQVVAFAq  159
DSSP  HHHHHHHHHHHHHHHHLLEEEEEEEEELllllLLHHHHHHHHHHHHLllLLEEEEEEELl


DSSP  -LLLLlllllllllHHHHHHHHHHHHHHHhhhlllleEEEEEELLH-HHLL--HHHHHHH
Query -MDLNdtfpeyketTEESIKETERFVSEMlqknysrvKPIVTPRFS-LSCS--ETLMGEL  219
ident                 ||                      |            |      
Sbjct sGFFV---------DLESESLIRKSLDMG--------CDLVGGVDPaTRENnvEGSLDLC  202
DSSP  lLLLL---------LLLHHHHHHHHHHHL--------LLEEELLLLlLLLLlhHHHHHHH


DSSP  HHHHHHHLLEEEEEELllhhHHHHHhhhlllllLHHHHHHHLL---lLLLLEEEEELLLL
Query GNIAKTRDLHIQSHISenrdEVEAVknlypsykNYTSVYDKNN---lLTNKTVMAHGCYL  276
ident    ||  |  |  ||         |                              |    
Sbjct FKLAKEYDVDIDYHIH----DIGTV------gvYSINRLAQKTiengYKGRVTTSHAWCF  252
DSSP  HHHHHHLLLEEEEEEL----LLHHH------hhHHHHHHHHHHhhllLLLLEEEEELLHH


DSSP  -------LHHHHHHHHHHLLEEEELHHHHhhllLLLLLHHHHHHLLLEEEELLLLL----
Query -------SAEELNVFHERGASIAHCPNSNlslsSGFLNVLEVLKHEVKIGLGTDVA----  325
ident          |        |     |  |          |   |      |   |      
Sbjct adapsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCASDNIrdfw  308
DSSP  hhllhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEELLLLllll


DSSP  LLLL-LLHHHHHHHHHHHHHHhhhlllllllLLHHHHHHHHLHHHHHHLLLLLLLlLLLL
Query GGYS-YSMLDAIRRAVMVSNIllinkvneksLTLKEVFRLATLGGSQALGLDGEIgNFEV  384
ident        |                         |       |  |   ||        ||
Sbjct VPFGnGDMVQGALIETQRLEL-------ktnRDLGLIWKMITSEGARVLGIEKNY-GIEV  360
DSSP  LLLLlLLHHHHHHHHHHHHLL-------llhHHHHHHHHHHLHHHHHHHLLHHHL-LLLL


DSSP  LLLLLEEEELLlllllllllllhhhhlllllhHHHHHHHHLLhhHEEEEEELLEEE---E
Query GKEFDAILINPkasdspidlfygdffgdiseaVIQKFLYLGDdrNIEEVYVGGKQV---V  441
ident ||  |    |                        |             |   |       
Sbjct GKKADLVVLNS--------------------lSPQWAIIDQA--KRLCVIKNGRIIvkdE  398
DSSP  LLLLLEEEELL--------------------lLHHHHHHHLL--LEEEEEELLEEEeelL


DSSP  LLL-
Query PFS-  444
ident     
Sbjct VIVa  402
DSSP  EELl


No 8: Query=2uz9A Sbjct=1k6wA Z-score=30.0

back to top
DSSP  lLLEEEEEEEEellllllLEEEEEEEEEELLlLLEEEEEEHHhhhhhhhhhlllHHHEEE
Query pLAHIFRGTFVhstwtcpMEVLRDHLLGVSDsGKIVFLEEASqqeklakewcfkPCEIRE   60
ident                               | |||      |                  
Sbjct -ALQTIINARL-------PGEEGLWQIHLQD-GKISAIDAQS-------gvmpiTENSLD   44
DSSP  -LLLEEEEELL-------LLLLLEEEEEEEL-LEEEEEEEEL-------lllllLLLEEE


DSSP  LLlLLEEEELEEEEEEEHHHHHH----llllLLLLhhHHHHHLHHHHhhhhHLHHHHHHH
Query LShHEFFMPGLVDTHIHASQYSF----agssIDLPllEWLTKYTFPAehrfQNIDFAEEV  116
ident         |  |  |||                                     |     
Sbjct AE-QGLVIPPFVEPHIHLDTTQTagqpnwnqSGTL--FEGIERWAER-kalLTHDDVKQR  100
DSSP  LL-LLEEELLEEEEEELLLLLLLllllllllLLLH--HHHHHHHHLL-hhhLLHHHHHHH


DSSP  HHHHHHHHHHLLEEEEEEELLLL---HHHHHHHHHHHHHH--LLEEEEELEE--LLLLll
Query YTRVVRRTLKNGTTTACYFATIH---TDSSLLLADITDKF--GQRAFVGKVC--MDLNdt  169
ident           ||                                            |   
Sbjct AWQTLKWQIANGIQHVRTHVDVSdatLTALKAMLEVKQEVapWIDLQIVAFPqeGILS--  158
DSSP  HHHHHHHHHHLLEEEEEEEEELLlllLHHHHHHHHHHHHHllLLEEEEEEELllLLLL--


DSSP  lllllllHHHHHHHHHHHHHHHhhhlllleEEEEEElLHHHL-----LHHHHHHHHHHHH
Query fpeyketTEESIKETERFVSEMlqknysrvKPIVTPrFSLSC-----SETLMGELGNIAK  224
ident                |                 |                        | 
Sbjct -------YPNGEALLEEALRLG--------ADVVGA-IPHFEftreyGVESLHKTFALAQ  202
DSSP  -------LLLHHHHHHHHHHLL--------LLEEEE-LHHHLllhhhHHHHHHHHHHHHH


DSSP  HHLLEEEEEELLLHhhHHHHhhhlllllLHHHHHHHLL---lLLLLEEEEELLLL-----
Query TRDLHIQSHISENRdeVEAVknlypsykNYTSVYDKNN---lLTNKTVMAHGCYL-----  276
ident   |  |  |  |     |                                |         
Sbjct KYDRLIDVHCDEID--DEQS--------RFVETVAALAhhegMGARVTASHTTAMhsyng  252
DSSP  HHLLEEEEEELLLL--LLLL--------LHHHHHHHHHhhhlLHHHEEEEELHHHhhllh


DSSP  --LHHHHHHHHHHLLEEEELHHHHHHLLL---------LLLLHHHHHHLLLEEEELLLLL
Query --SAEELNVFHERGASIAHCPNSNLSLSS---------GFLNVLEVLKHEVKIGLGTDVA  325
ident              |      |  |  |           |   | | |        | |  
Sbjct ayTSRLFRLLKMSGINFVANPLVNIHLQGrfdtypkrrGITRVKEMLESGINVCFGHDDV  312
DSSP  hhHHHHHHHHHHHLLEEEELHHHHHHHLLlllllllllLLLLHHHHHHLLLLEEELLLLL


DSSP  ----LLLL-LLHHHHHHHHHHHHHhhhhllllllllLHHHHHHHHLHHHHHHLLlLLLLl
Query ----GGYS-YSMLDAIRRAVMVSNillinkvnekslTLKEVFRLATLGGSQALGlDGEIg  380
ident            ||        |                     | |      |       
Sbjct fdpwYPLGtANMLQVLHMGLHVCQ-------lmgygQINDGLNLITHHSARTLN-LQDY-  363
DSSP  llllLLLLlLLHHHHHHHHHHHLL-------lllhhHHHHHHHHHLHHHHHHLL-LLLL-


DSSP  LLLLLLLLLEEEELLlllllllllllhhhhlllllhHHHHHHHHLLHhhEEEEEELLEEE
Query NFEVGKEFDAILINPkasdspidlfygdffgdiseaVIQKFLYLGDDrnIEEVYVGGKQV  440
ident     |     |                              |             |||  
Sbjct GIAAGNSANLIILPA--------------------eNGFDALRRQVP--VRYSVRGGKVI  401
DSSP  LLLLLLLLLEEEELL--------------------lLHHHHHHHLLL--LLEEEELLEEE


DSSP  EL------------------ll
Query VP------------------fs  444
ident                       
Sbjct AStqpaqttvyleqpeaidykr  423
DSSP  EEllllleeeellleeeellll


No 9: Query=2uz9A Sbjct=3mkvA Z-score=29.9

back to top
DSSP  LLLEEEE-EEEEELLlllLLEEEEEEEEEELlLLLEEEEEeHHHHhhhhhHHLLlhhHEE
Query PLAHIFR-GTFVHSTwtcPMEVLRDHLLGVSdSGKIVFLEeASQQeklakEWCFkpcEIR   59
ident      || |             |          | |                        
Sbjct LTTFLFRnGALLDPD---HPDLLQGFEILIE-DGFIREVS-DKPI-----KSSN--aHVI   48
DSSP  LLEEEEEeEEELLLL---LLLLEEEEEEEEE-LLEEEEEE-LLLL-----LLLL--lEEE


DSSP  ELLLlLEEEELEEEEEEEHHHHHHllllllllhhhhhhhLHHHHHHHhhLHHHHHHHHHH
Query ELSHhEFFMPGLVDTHIHASQYSFagssidlpllewltkYTFPAEHRfqNIDFAEEVYTR  119
ident         |||| | | |     |                                    
Sbjct DVKG-KTIMPGLIDLHVHVVAIEF---------------NLPRVATL--PNVLVTLRAVP   90
DSSP  ELLL-LEEEELEEEEEELLLLLLL---------------LHHHHLLL--LHHHHHHHHHH


DSSP  HHHHHHHLLEEEEEEELLllhhhHHHHHHHHH---HHLLEEEEE-LEELLLL--------
Query VVRRTLKNGTTTACYFATihtdsSLLLADITD---KFGQRAFVG-KVCMDLN--------  167
ident   |  |  | ||                         | | ||                 
Sbjct IMRAMLRRGFTTVRDAGG----aGYPFKQAVEsglVEGPRLFVSgRALSQTGghadprar  146
DSSP  HHHHHHHLLEEEEEELLL----lLHHHHHHHHlllLLLLEEEELlLEEELLLllllllll


DSSP  ---lLLLL------------lLLLH-HHHHHHHHHHHHHHhhhlllleEEEEEELLH---
Query ---dTFPE------------yKETT-EESIKETERFVSEMlqknysrvKPIVTPRFS---  208
ident                            |                            |   
Sbjct sdymPPDSpcgccvrvgalgrVADGvDEVRRAVREELQMG--------ADQIXIMASggv  198
DSSP  llllLLLLllllllllllleeELLLhHHHHHHHHHHHHHL--------LLLEEEELLlll


DSSP  ---------HHLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllllLHHHHHH
Query ---------LSCSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsykNYTSVYD  259
ident             ||         |  |      |                          
Sbjct asptdpvgvFGYSEDEIRAIVAEAQGRGTYVLAHAY---------------tpAAIARAV  243
DSSP  lllllllllLLLLHHHHHHHHHHHHLLLLLEEEEEL---------------lhHHHHHHH


DSSP  HLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-----------------
Query KNNLltnkTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS-----------------  302
ident             ||     |      | ||           |                  
Sbjct RCGV----RTIEHGNLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesiakia  299
DSSP  HLLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhhllhh


DSSP  --LLLL--LHHHHHHLLLEEEELLLLLllLLLLHHHHHHHHHHHhhhhhhlllllllLLH
Query --SGFL--NVLEVLKHEVKIGLGTDVAggYSYSMLDAIRRAVMVsnillinkvneksLTL  358
ident    |             || | |||          |  |    |             |  
Sbjct dvHGAGlhSIEIMKRAGVKMGFGTDLLgeAQRLQSDEFRILAEV-------------LSP  346
DSSP  hhHLLHhhHHHHHHHHLLLLLLLLLLLhhHHHHLLHHHHHHHLL-------------LLH


DSSP  HHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLlllllllllllhhhhlllllhHH
Query KEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPkasdspidlfygdffgdiseaVI  418
ident  ||   ||      ||     |    |   |                             
Sbjct AEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDG---------------------NP  385
DSSP  HHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELL---------------------LL


DSSP  HHHHHHL--LHHHEEEEEELLEEEEL-ll
Query QKFLYLG--DDRNIEEVYVGGKQVVP-fs  444
ident  |           |  |   |   |    
Sbjct LKSVDCLlgQGEHIPLVMKDGRLFVNele  414
DSSP  LLLLLLLllLLLLLLEEEELLEEEEElll


No 10: Query=2uz9A Sbjct=2imrA Z-score=29.5

back to top
DSSP  llleEEEEEE--EELLlllLLEEEEeEEEEELlllleEEEE------EHHHHHhhhhhhl
Query plahIFRGTF--VHSTwtcPMEVLRdHLLGVSdsgkiVFLE------EASQQEklakewc   52
ident         |                                         |         
Sbjct --htPRLLTCdvLYTG---AQSPGG-VVVVGE-----TVAAaghpdeLRRQYP-------   42
DSSP  --llEEEEEEleEELL---EELLEE-EEEELL-----EEEEeelhhhHHHHLL-------


DSSP  llhhhEEELLllleEEELEEEEEEEHHHhhhllllllllhHHHH------HHLHhHHHHh
Query fkpceIRELShhefFMPGLVDTHIHASQysfagssidlplLEWL------TKYTfPAEHr  106
ident        |        |  |  | |               |                   
Sbjct ----hAAEERagavIAPPPVNAHTHLDM-----sayefqaLPYFqwipevVIRG-RHLR-   91
DSSP  ----lLEEEEllleELLLLLEEEEELLL-----lhhhhhhLHHHhllhhhHHHH-LLLL-


DSSP  hhlhhhHHHHHHHHHHHHHHLLEEEEEEELLlLHHHHHHHHHHhhhHLLEEEEELEELLL
Query fqnidfAEEVYTRVVRRTLKNGTTTACYFATiHTDSSLLLADItdkFGQRAFVGKVCMDL  166
ident                      |                 |                    
Sbjct ------GVAAAQAGADTLTRLGAGGVGDIVW-APEVMDALLAR---EDLSGTLYFEVLNP  141
DSSP  ------HHHHHHHHHHHHHHLLLLLEEEEEL-LHHHHHHHHLL---LLLLEEEEEEELLL


DSSP  lllllllllLHHHHHHHHHHHHHHHHHHLLLLEEEEEEELLHHHLLHHHHHHHHHHHHHH
Query ndtfpeykeTTEESIKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTR  226
ident             |                         |      |  ||  |   |   
Sbjct ------fpdKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTVSHRLMRLLSDYAAGE  195
DSSP  ------lhhHHHHHHHHHHHHHHHHHLLLLLLEEEEEEELLLLLLLHHHHHHHHHHHHHH


DSSP  LLEEEEEELLLHHHHHHHHHH------------------------LLLLLLHHHHHHHLL
Query DLHIQSHISENRDEVEAVKNL------------------------YPSYKNYTSVYDKNN  262
ident  |  | |  |   | |                                        |   
Sbjct GLPLQIHVAEHPTELEMFRTGggplwdnrmpalyphtlaevigrePGPDLTPVRYLDELG  255
DSSP  LLLLEEEELLLHHHHHHHHHLllllhhhllhhhllllhhhhhlllLLLLLLHHHHHHHHL


DSSP  LLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELL
Query LLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGT  322
ident  |       |               |     || ||  |  |           |   |||
Sbjct VLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGVEVALGT  315
DSSP  LHHHLLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLLHHHHHHLLLLEEELL


DSSP  LLL-LLLLLLHHHHHHHHHHHHHhhhhllllllLLLHHHHHHHHLHHHHHHLLllllLLL
Query DVA-GGYSYSMLDAIRRAVMVSNillinkvnekSLTLKEVFRLATLGGSQALGldgeIGN  381
ident |    |           |                |      | |  ||    |       
Sbjct DSVaSGETLNVREEVTFARQLYP----------GLDPRVLVRAAVKGGQRVVG----TPF  361
DSSP  LLHhHHLLLLLHHHHHHHHHHLL----------LLLHHHHHHHHHHHHHHHHL----LLL


DSSP  LLLL-llllEEEELLlllllllllllhhhhlllllhhhhhhhhhLLHHheeeeeelleee
Query FEVG-kefdAILINPkasdspidlfygdffgdiseaviqkflylGDDRnieevyvggkqv  440
ident    |                                          |             
Sbjct LRRGetwqeGFRWEL-----------------------------SRDL------------  380
DSSP  LLLLllllhHHLHHH-----------------------------LLLL------------


DSSP  elll
Query vpfs  444
ident     
Sbjct ----  380
DSSP  ----


No 11: Query=2uz9A Sbjct=3mtwA Z-score=29.4

back to top
DSSP  LLLEEEEE-EEEELLlllLLEEEEEEEEEELLlLLEEEEEEHHHHhhhhhHHLLlhhHEE
Query PLAHIFRG-TFVHSTwtcPMEVLRDHLLGVSDsGKIVFLEEASQQeklakEWCFkpcEIR   59
ident                           |  | | | |                        
Sbjct AEIKAVSAaRLLDVA---SGKYVDNPLVIVTD-GRITSIGKKGDA-----VPAG--aTAV   49
DSSP  LLEEEEEEeEEEELL---LLEEEELEEEEEEL-LEEEEEEELLLL-----LLLL--lEEE


DSSP  ELLlLLEEEELEEEEEEEHHHhhHLLLLllllhhhhhHHLHhhhhhhhhLHHHHHHHHHH
Query ELShHEFFMPGLVDTHIHASQysFAGSSidlpllewlTKYTfpaehrfqNIDFAEEVYTR  119
ident  |       ||| | | |      |                           |   | | 
Sbjct DLP-GVTLLPGLIDMHVHLDS--LAEVG---------GYNS-----leySDRFWSVVQTA   92
DSSP  EEE-EEEEEELEEEEEELLLL--LLLLL---------HHHH-----hhlLHHHHHHHHHH


DSSP  HHHHHHHLLEEEEEEELLllhhHHHHHHHHHHHHL------LEEEEE-LEELLL----LL
Query VVRRTLKNGTTTACYFATihtdSSLLLADITDKFG------QRAFVG-KVCMDL----ND  168
ident     ||  | ||                              |                 
Sbjct NAKKTLEAGFTTVRNVGA----ADYDDVGLREAIDagyvpgPRIVTAaISFGATgghcDS  148
DSSP  HHHHHHHLLEEEEEELLL----LLLHHHHHHHHHHllllllLEEEELlLLEELLllllLL


DSSP  LL--------lllLLLH-HHHHHHHHHHHHHHhhhlllleEEEEEELLHH----------
Query TF--------peyKETT-EESIKETERFVSEMlqknysrvKPIVTPRFSL----------  209
ident ||                 |  |                                     
Sbjct TFfppsmdqknpfNSDSpDEARKAVRTLKKYG--------AQVIXICATGgvfsrgnepg  200
DSSP  LLllhhhllllllLLLLhHHHHHHHHHHHHLL--------LLEEEEELLLllllllllll


DSSP  --HLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllllLHHHHHHHLLLllll
Query --SCSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsykNYTSVYDKNNLltnk  267
ident         |      |         |                                  
Sbjct qqQLTYEEMKAVVDEAHMAGIKVAAHAH---------------gaSGIREAVRAGV----  241
DSSP  llLLLHHHHHHHHHHHHHLLLEEEEEEL---------------lhHHHHHHHHLLL----


DSSP  EEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL--
Query TVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS-------------------SGFL--  306
ident     |      |        ||                                      
Sbjct DTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdiGELQre  301
DSSP  LEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhhHHHHhh


DSSP  LHHHHHHLLLEEEELLLLLlLLLL-LHHHHHHHHHHHHhhhhhlllllllLLHHHHHHHH
Query NVLEVLKHEVKIGLGTDVAgGYSY-SMLDAIRRAVMVSnillinkvneksLTLKEVFRLA  365
ident |    ||  ||   |||    |            |                |       |
Sbjct NFRKALKAGVKMVYGTDAG-IYPHgDNAKQFAVMVRYG------------ATPLQAIQSA  348
DSSP  HHHHHHHHLLEEELLLLLL-LLLLlLHHHHHHHHHHLL------------LLHHHHHHHL


DSSP  LHHHHHHLLLLLLLLLLLLLLLLLEEEELLlllllllllllhhhhlllllhHHHHHHHHL
Query TLGGSQALGLDGEIGNFEVGKEFDAILINPkasdspidlfygdffgdiseaVIQKFLYLG  425
ident ||    |||     |   ||   | |                                  
Sbjct TLTAAEALGRSKDVGQVAVGRYGDMIAVAG---------------------DPLADVTTL  387
DSSP  LHHHHHHHLLLLLLLLLLLLLLLLEEEELL---------------------LLLLLHHHH


DSSP  LHhhEEEEEELLEEEELll
Query DDrnIEEVYVGGKQVVPfs  444
ident        |  ||  |    
Sbjct EK--PVFVMKGGAVVKApx  404
DSSP  HL--LLEEEELLEEEELll


No 12: Query=2uz9A Sbjct=3icjA Z-score=28.4

back to top
DSSP  lLLEEEE-EEEEELLLLllLEEEeeEEEEELlLLLEEEEEEHHHhhHHHHHHLLlhhHEE
Query pLAHIFR-GTFVHSTWTcpMEVLrdHLLGVSdSGKIVFLEEASQqeKLAKEWCFkpcEIR   59
ident         ||   |             |  |           |     |        || 
Sbjct -CMKALInGTIYTSFSP--VKKV--SGLVIS-NERVLYAGDSSTalRIAELAGG---EII   51
DSSP  -LEEEEElLEEEEEELL--EEEE--LEEEEE-LLEEEEEELHHHhhHHHHHHLL---EEE


DSSP  ELLLlLEEEELEEEEEEEHHHH-HHLLL--------------------------------
Query ELSHhEFFMPGLVDTHIHASQY-SFAGS--------------------------------   86
ident  |    | ||   | | |                                          
Sbjct DLKG-KFVMPAFFDSHLHLDELgMSLEMvdlrgvksmeelvervkkgrgriifgfgwdqd  110
DSSP  ELLL-LEEEELEEEEEELHHHHhHHHHLeellllllhhhhhhhhhlllllleeeeeelhh


DSSP  --------------lllllhhhHHHH-------------------------------lhh
Query --------------sidlplleWLTK-------------------------------ytf  101
ident                                                             
Sbjct elgrwptredldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralee  170
DSSP  hhlllllhhhhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhhh


DSSP  hhhHHHH---LHHHHHHHHHHHHHHHHHLLEEEEEEELLlLHHHHHHHHHHH--hHHLLE
Query paeHRFQ---NIDFAEEVYTRVVRRTLKNGTTTACYFATiHTDSSLLLADIT--dKFGQR  156
ident                           |  |                 |            
Sbjct srkIINEkilTVKDYKHYIESAQEHLLSLGVHSVGFMSV-GEKALKALFELEregRLKMN  229
DSSP  hhhHHHHlllLHHHHHHHHHHHHHHHHHLLEEEEEEEEE-LHHHHHHHHHHHhllLLLLE


DSSP  EEEELEElllllllllllllhhhhhHHHHHH---hHHHHhhLLLLEE-EEEEeLLHH---
Query AFVGKVCmdlndtfpeyketteesiKETERF---vSEMLqkNYSRVK-PIVTpRFSL---  209
ident  |                                          |     |   |     
Sbjct VFAYLSP------------------ELLDKLeelnLGKF--EGRRLRiWGVX-LFVDgsl  268
DSSP  EEEEELH------------------HHHHHHhhhlLLLE--ELLLEEeEEEE-EELLlll


DSSP  ---------------------HLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhl
Query ---------------------SCSETLMGELGNIAKTRDLHIQSHISenrdeveavknly  248
ident                              |    ||   |    |               
Sbjct gartallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAI-------------  315
DSSP  lllllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEEL-------------


DSSP  llllLHHHHHHHLL--llLLLEeEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLL--
Query psykNYTSVYDKNN--llTNKTvMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSG--  304
ident         |                |        |    |    |   |    |      
Sbjct --gdKAVDVALDAFeeaeFSGR-IEHASLVRDDQLERIKELKVRISAQPHFIVSDWWIvn  372
DSSP  --lhHHHHHHHHHHhhhlLLLE-EEELLLLLHHHHHHHHHHLLEEEELLLHHHHLLLHhh


DSSP  ---------LLLHHHHHHlLLEEEELLLLLLLlLLLHHHHHHHHHHHHHHHHHllllllL
Query ---------FLNVLEVLKhEVKIGLGTDVAGGySYSMLDAIRRAVMVSNILLInkvnekS  355
ident                      | |  ||            |  ||               
Sbjct rvgeerakwAYRLKTLSS-ITKLGFSTDSPIE-PADPWVSIDAAVNRYVVDPG-----eR  425
DSSP  hhhhhhhhhLLLHHHHHH-HLLEEELLLLLLL-LLLHHHHHHHHHHLLLLLHH-----hL


DSSP  LLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELLlllllllllllhhhhlllll
Query LTLKEVFRLATLGGSQALGLDgEIGNFEVGKEFDAILINPkasdspidlfygdffgdise  415
ident     |   | | |  |        |  | |     |                        
Sbjct VSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDR--------------------  464
DSSP  LLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELL--------------------


DSSP  hHHHHhhhhllhhheeeeeelleeeelll
Query aVIQKflylgddrnieevyvggkqvvpfs  444
ident     |                        
Sbjct -DPLK------------------------  468
DSSP  -LLLL------------------------


No 13: Query=2uz9A Sbjct=4c5yA Z-score=27.4

back to top
DSSP  --LLLEEEEE-EEEELLllllLEEEEEEEEEELLlLLEEEEEEHHHHhhHHHHHLLlhhH
Query --PLAHIFRG-TFVHSTwtcpMEVLRDHLLGVSDsGKIVFLEEASQQekLAKEWCFkpcE   57
ident       |               | ||   |  ||   | |           |        
Sbjct deAKVTIIYAgLLIPGD----GEPLRNAALVISD-KIIAFVGSEADI--PKKYLRS-tqS   52
DSSP  llLLEEEEEEeEELLLL----LLLEEEEEEEEEL-LEEEEEEEHHHL--LHHHHHH-llL


DSSP  EEELlllLEEEELEEEEEEEHhHHHHllllllllhhhhhHHLHhHHHHHHhLHHHHHHHH
Query IRELshhEFFMPGLVDTHIHAsQYSFagssidlpllewlTKYTfPAEHRFqNIDFAEEVY  117
ident           |||| | | |                                        
Sbjct THRV---PVLMPGLWDCHMHF-GGDD-----------dyYNDY-TSGLAT-HPASSGARL   95
DSSP  EEEE---EEEEELEEEEEELL-LLLL-----------llLLLL-HHHHHL-LHHHHHHHH


DSSP  HHHHHHHHHLLEEEEEEELLllhhHHHHHHHHHH---HHLLEEEEE-LEELLLL------
Query TRVVRRTLKNGTTTACYFATihtdSSLLLADITD---KFGQRAFVG-KVCMDLN------  167
ident  |     | || |     |          |         |                    
Sbjct ARGCWEALQNGYTSYRDLAG----YGCEVAKAINdgtIVGPNVYSSgAALSQTAghgdif  151
DSSP  HHHHHHHHHLLEEEEEELLL----LHHHHHHHHHlllLLLLEEEELlLEEELLLllllll


DSSP  ----llLLLL-----------------LLLH-HHHHHHHHHHHHHHhhhlllleEEEEEE
Query ----dtFPEY-----------------KETT-EESIKETERFVSEMlqknysrvKPIVTP  205
ident                                 ||                          
Sbjct alpageVLGSygvmnprpgywgagplcIADGvEEVRRAVRLQIRRG--------AKVIXV  203
DSSP  lllhhhHHHHhlllllllllllllleeELLLhHHHHHHHHHHHHHL--------LLLEEE


DSSP  LLHH------------HLLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllllL
Query RFSL------------SCSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsykN  253
ident   |               |          |         |                    
Sbjct MASGgvmsrddnpnfaQFSPEELKVIVEEAARQNRIVSAHVH---------------gkA  248
DSSP  ELLLllllllllllllLLLHHHHHHHHHHHHHLLLLEEEEEL---------------lhH


DSSP  HHHHHHHLLLllllEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-----------
Query YTSVYDKNNLltnkTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLS-----------  302
ident       |           |  |   |      | |                         
Sbjct GIMAAIKAGC----KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLasngeglvkes  304
DSSP  HHHHHHHHLL----LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhllllllllh


DSSP  -------LLLLL--HHHHHHLLLEEEELLLLLllllLLHHHHHHHHHHHHhhhhhlllll
Query -------SGFLN--VLEVLKHEVKIGLGTDVAggysYSMLDAIRRAVMVSnillinkvne  353
ident                    |  | | |||| |             ||             
Sbjct waklqalADSHLkaYQGAIKAGVTIALGTDTA--pgGPTALELQFAVERG----------  352
DSSP  hhlllhhHHHHHhhHHHHHHLLLLEELLLLLL--llLLLHHHHHHHHHLL----------


DSSP  lLLLHHHHHHHHLHHHHHHLL-lLLLLLLLLLLLLLLEEEELLlllllllllllhhhhll
Query kSLTLKEVFRLATLGGSQALG-lDGEIGNFEVGKEFDAILINPkasdspidlfygdffgd  412
ident    |  |    ||       |      |    | | | |                     
Sbjct -GMTPLEAIKAATANAPLSVGpqAPLTGQLREGYEADVIALEE-----------------  394
DSSP  -LLLHHHHHHHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELL-----------------


DSSP  lllhHHHHHHHH-LLHHHEEEEEELLEEEEL-------------ll
Query iseaVIQKFLYL-GDDRNIEEVYVGGKQVVP-------------fs  444
ident                      |  |||                   
Sbjct ----NPLEDIKVfQEPKAVTHVWKGGKLFKGpgigpwgedarnpfl  436
DSSP  ----LLLLLHHHhHLHHHEEEEEELLEEEELlllllllllllllll


No 14: Query=2uz9A Sbjct=2vunA Z-score=26.7

back to top
DSSP  lLLEEEEEE--EEELLLLLlLEEEEeEEEEELLlLLEEEEEEHHHHHhhhhHHLLlhhHE
Query pLAHIFRGT--FVHSTWTCpMEVLRdHLLGVSDsGKIVFLEEASQQEklakEWCFkpcEI   58
ident     |       |                 | | | |                      |
Sbjct -SKTIIKNIgkIVSGDIKS-PVLQA-DTIVVED-GLIAAIGGEELMK----DAGD--aTI   50
DSSP  -LEEEEELLleEELLLLLL-LEELL-LEEEEEL-LEEEEEELHHHHL----LLLL--lEE


DSSP  EELLLlLEEEELEEEEEEEHH---hHHHLLLlllllhhhhhhhlhhhhhhhhhlhhhhhh
Query RELSHhEFFMPGLVDTHIHAS---qYSFAGSsidlpllewltkytfpaehrfqnidfaee  115
ident           ||| ||| | |                                       
Sbjct IDAAG-STVTPGLLDTHVHVSggdyAPRQKT-----------------------------   80
DSSP  EELLL-LEEEELEEEEEELLLllleEHHHLE-----------------------------


DSSP  hhhHHHHHHHHLLEEEEEEELL-----------lLHHHHHHHHHHHHH---HLLEEEE-E
Query vytRVVRRTLKNGTTTACYFAT-----------iHTDSSLLLADITDK---FGQRAFV-G  160
ident          |  | ||                         |          |       
Sbjct --mDFISSALHGGVTTMISAGSphfpgrpkdaagTKALAITLSKSYYNarpAGVKVHGgA  138
DSSP  --eLHHHHHHLLLEEEEEELLLlllllllllhhhHHHHHHHHHHHHHHllhHHLEEELlE


DSSP  LEELLlllllllllllhhHHHH-HHHHHHHHHhhhlllleeEEEEELL-hHHLLHHHHHH
Query KVCMDlndtfpeyketteESIK-ETERFVSEMlqknysrvkPIVTPRF-sLSCSETLMGE  218
ident                               |           ||                
Sbjct VILEK-------------GLTEeDFIEMKKEG--------vWIVGEVGlgTIKNPEDAAP  177
DSSP  ELLLL-------------LLLHhHHHHHHHLL--------lLEEEEELllLLLLHHHHHH


DSSP  HHHHHHHHLLEEEEEELlLHHHhHHHHhhlllllLHHHHHHHLLLllllEEEEELL----
Query LGNIAKTRDLHIQSHISeNRDEvEAVKnlypsykNYTSVYDKNNLltnkTVMAHGC----  274
ident     |       | |                          |        |  |      
Sbjct MVEWAHKHGFKVQMHTG-GTSI-PGSS------tVTADDVIKTKP----DVVSHINggpt  225
DSSP  HHHHHHHLLLEEEEELL-LLLL-LLLL------lLLHHHHHHHLL----LEEELLLllll


DSSP  LLLHHHHHHHHH-HLLEEEELhHHHHhllLLLL--LHHHHHHLLL--EEEELLLLLL--l
Query YLSAEELNVFHE-RGASIAHCpNSNLslsSGFL--NVLEVLKHEV--KIGLGTDVAG--g  327
ident   |  |                                             | |      
Sbjct AISVQEVDRIMDeTDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPSgtg  281
DSSP  LLLHHHHHHHHHhLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLLlll


DSSP  LLLL-HHHHHHHHHHHHhhhhhllllllLLLHHHHHHHHLHHHHHHLLLllLLLLLLLLL
Query YSYS-MLDAIRRAVMVSnillinkvnekSLTLKEVFRLATLGGSQALGLdgEIGNFEVGK  386
ident       |         |                     ||       ||    |    ||
Sbjct LIPLgILRNMCQIASMS-----------DIDPEVAVCMATGNSTAVYGL--NTGVIAPGK  328
DSSP  LLLLhHHHHHHHHHHHL-----------LLLHHHHHHHHLHHHHHHHLL--LLLLLLLLL


DSSP  LLLEEEELLLlllLLLLLllhhhhlllllHHHHHHH--HHLLhhHEEEEEELLEEEEL--
Query EFDAILINPKasdSPIDLfygdffgdiseAVIQKFL--YLGDdrNIEEVYVGGKQVVP--  442
ident | | |                                        |  |   |  ||   
Sbjct EADLIIMDTP---LGSVA-----------EDAMGAIaaGDIP--GISVVLIDGEAVVTks  372
DSSP  LLLEEEEELL---LLLLL-----------LLHHHHHhhLLLL--EEEEEEELLEEEELll


DSSP  -----------ll
Query -----------fs  444
ident              
Sbjct rntppakraakil  385
DSSP  lllllllllleel


No 15: Query=2uz9A Sbjct=3nqbA Z-score=25.5

back to top
DSSP  ----------------------LLLEEEE-EEEEELLLlllLEEEEeEEEEELlLLLEEE
Query ----------------------PLAHIFR-GTFVHSTWtcpMEVLRdHLLGVSdSGKIVF   37
ident                               || |        |       |      |  
Sbjct epadlnddtlraravaaargdqRFDVLITgGTLVDVVT---GELRP-ADIGIV-GALIAS   55
DSSP  llhhhllhhhhhhhhhhhhlllLEEEEEElLEEELLLL---LLEEE-LEEEEE-LLEEEE


DSSP  EEEHHHHhhhhhhhlllhhHEEELLlLLEEEELEEEEEEEHHHHHhllllllllhhhhhh
Query LEEASQQeklakewcfkpcEIRELShHEFFMPGLVDTHIHASQYSfagssidlpllewlt   97
ident   |                            ||| ||| |                    
Sbjct VHEPASR--------rdaaQVIDAG-GAYVSPGLIDTHXHIESSX---------------   91
DSSP  EELLLLL--------lleeEEEELL-LLEEEELEEEEEELHHHHL---------------


DSSP  hlhhhhhhhhhlhhhhhHHHHHHHHHHHHLLEEEEEEELL-----lLHHHHHHHHHHHHH
Query kytfpaehrfqnidfaeEVYTRVVRRTLKNGTTTACYFAT-----iHTDSSLLLADITDK  152
ident                               | ||              |     |     
Sbjct -----------------ITPAAYAAAVVARGVTTIVWDPHefgnvhGVDGVRWAAKAIEN  134
DSSP  -----------------LLHHHHHHHHHLLLEEEEEELLHhhhhhhLHHHHHHHHHHHLL


DSSP  HLLEEEEELEEL--LLLLLLLLLLLlhhHHHHHHHHHHHHHhhhllllEEEEEEELLHH-
Query FGQRAFVGKVCM--DLNDTFPEYKEtteESIKETERFVSEMlqknysrVKPIVTPRFSL-  209
ident    ||                                 |                     
Sbjct LPLRAILLAPSCvpSAPGLERGGAD---FDAAILADLLSWP-------EIGGIAEIXNXr  184
DSSP  LLLEEEEEELLLllLLLLLLLLLLL---LLHHHHHHHHLLL-------LEEEEEEELLHh


DSSP  --hlLHHHHHHHHHHHHHHLLEEEEEELllhhhhhhhhhhllllLLHHHHHHHLLLllll
Query --scSETLMGELGNIAKTRDLHIQSHISenrdeveavknlypsyKNYTSVYDKNNLltnk  267
ident                          |                                  
Sbjct gvieRDPRXSGIVQAGLAAEKLVCGHAR-------------glkNADLNAFXAAGV----  227
DSSP  hhhlLLHHHHHHHHHHHHHLLEEEELLL-------------lllHHHHHHHHHLLL----


DSSP  EEEEELLL--LLHHHHHHHhhhlLEEEELhHHHHhllLLLL-LHHHHHHL---LLEEEEL
Query TVMAHGCY--LSAEELNVFhergASIAHCpNSNLslsSGFL-NVLEVLKH---EVKIGLG  321
ident                |         |     |           |              | 
Sbjct SSDHELVSgeDLXAKLRAG----LTIELR-GSHD---HLLPeFVAALNTLghlPQTVTLC  279
DSSP  LEELLLLLhhHHHHHHHLL----LEEEEE-LLLH---HHHHhHHHHHHHHlllLLLEEEE


DSSP  LLLLL----llLLLHHHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHHLLLlL
Query TDVAG----gySYSMLDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQALGLdG  377
ident ||              |  || |               |      | |||   | ||   
Sbjct TDDVFpddllqGGGLDDVVRRLVRYG------------LKPEWALRAATLNAAQRLGR-S  326
DSSP  LLLLLhhhhhhLLLHHHHHHHHHHLL------------LLHHHHHHHHLHHHHHHHLL-L


DSSP  LLLLLLLLLLLLEEEELllllllllllllhhhhlllllhhhhhHHHHLlhhHEEEEEELL
Query EIGNFEVGKEFDAILINpkasdspidlfygdffgdiseaviqkFLYLGddrNIEEVYVGG  437
ident   |    |   |                                |          |   |
Sbjct DLGLIAAGRRADIVVFE--------------------------DLNGF---SARHVLASG  357
DSSP  LLLLLLLLLLLLEEEEL--------------------------LLLLL---LEEEEEELL


DSSP  EEE-----ELLL------------------------------------------------
Query KQV-----VPFS------------------------------------------------  444
ident   |                                                         
Sbjct RAVaeggrXLVDiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwget  417
DSSP  EEEeelleELLLllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  444
ident                                                             
Sbjct eadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvf  477
DSSP  eeeeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  444
ident                                                             
Sbjct ggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreav  537
DSSP  ellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhh


DSSP  --------------------------------------------------
Query --------------------------------------------------  444
ident                                                   
Sbjct gkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 16: Query=2uz9A Sbjct=1yrrB Z-score=24.5

back to top
DSSP  lllEEEEE-EEEELLlllllEEEEEEEEEELlLLLEEEEEEHHHHhhhhhhhlLLHHHEE
Query plaHIFRG-TFVHSTwtcpmEVLRDHLLGVSdSGKIVFLEEASQQeklakewcFKPCEIR   59
ident                     | | ||       | |                     | |
Sbjct ---YALTQgRIFTGH-----EFLDDHAVVIA-DGLIKSVCPVAEL--------PPEIEQR   43
DSSP  ---LEEELlEEELLL-----LEELLEEEEEE-LLEEEEEEEHHHL--------LLLLLEE


DSSP  ELLlLLEEEELEEEEEEEhhHHHHLlllllllhhhhhhhlhhhhHHHHhlhHHHH-HHHH
Query ELShHEFFMPGLVDTHIHasQYSFAgssidlpllewltkytfpaEHRFqniDFAE-EVYT  118
ident  |       ||  |                                          |   
Sbjct SLN-GAILSPGFIDVQLN--GCGGV-----------------qfNDTA---EAVSvETLE   80
DSSP  ELL-LLEEEELEEEEEEL--EELLE-----------------elLLLL---LLLLhHHHH


DSSP  HHHHHHHHLLEEEEEEELLL----LHHHHH-HHHHHHHHHLLE-EEEELEELLLLlllll
Query RVVRRTLKNGTTTACYFATI----HTDSSL-LLADITDKFGQR-AFVGKVCMDLNdtfpe  172
ident        | | |                          |              ||     
Sbjct IMQKANEKSGCTNYLPTLITtsdeLMKQGVrVMREYLAKHPNQaLGLHLEGPWLN-----  135
DSSP  HHHHHHHLLLEEEEEEEELLllhhHHHHHHhHHHHHHHHLLLLlLLEEEELLLLL-----


DSSP  llllhHHHHHHHHHHHhhhhhhlllleEEEEEELLHHhLLHHhhHHHHHHHHhHLLEEEE
Query ykettEESIKETERFVsemlqknysrvKPIVTPRFSLsCSETlmGELGNIAKtRDLHIQS  232
ident                                                   |         
Sbjct -----AALVDFLCENA----------dVITKVTLAPE-MVPA--EVISKLAN-AGIVVSA  176
DSSP  -----LHHHHHHHHLH----------hHEEEEEELHH-HLLH--HHHHHHHH-HLLEEEE


DSSP  EelllhhhhhhhhhhlllLLLHHHHHHHLLLllllEEEEELLL----------llhHHHH
Query HisenrdeveavknlypsYKNYTSVYDKNNLltnkTVMAHGCY----------lsaEELN  282
ident                                    |   |                    
Sbjct G-------------hsnaTLKEAKAGFRAGI----TFATHLYNampyitgrepglaGAIL  219
DSSP  L-------------llllLHHHHHHHHHHLE----EEELLLLLllllllllllhhhHHHH


DSSP  HHHhhLLEEEELHHhhhhlLLLLL-LHHHHHHLLL-EEEELLLLL-LLLLlLHHHHHHHH
Query VFHerGASIAHCPNsnlslSSGFL-NVLEVLKHEV-KIGLGTDVA-GGYSySMLDAIRRA  339
ident                          |          |  | ||   |     |    |  
Sbjct DEA--DIYCGIIAD----gLHVDYaNIRNAKRLKGdKLCLVTDATsGSSL-TMIEGVRNL  272
DSSP  HLL--LLEEEEELL----lLLLLHhHHHHHHHHHHhHEEEELLLLlLLLL-LHHHHHHHH


DSSP  HHHHhhhhhllllllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEllllll
Query VMVSnillinkvnekSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILInpkasd  399
ident |                 | || | |||    | |     |    ||             
Sbjct VEHC-----------GIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAF------  315
DSSP  HHHH-----------LLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEE------


DSSP  lllllllhhhhlllllhhHHHHhhhllhhHEEEEEELLEEEELll
Query spidlfygdffgdiseavIQKFlylgddrNIEEVYVGGKQVVPfs  444
ident                      |        |    | |  ||   
Sbjct ------------------TPDF-------KITKTIVNGNEVVT-q  334
DSSP  ------------------LLLL-------LEEEEEELLEEEEE-l


No 17: Query=2uz9A Sbjct=1onxA Z-score=23.7

back to top
DSSP  ------LLLEEEEE-EEEELlllllLEEEEeEEEEELlLLLEEEEEEHhhhhhHHHHHLL
Query ------PLAHIFRG-TFVHStwtcpMEVLRdHLLGVSdSGKIVFLEEAsqqekLAKEWCF   53
ident              |                     |   |||                  
Sbjct midytaAGFTLLQGaHLYAP-----EDRGI-CDVLVA-NGKIIAVASN----iPSDIVPN   49
DSSP  llllhhHLLEEEEEeEEELL-----LEEEE-EEEEEE-LLEEEEEELL----lLLLLLLL


DSSP  lhhHEEELLlLLEEEELEEEEEEEHHHHhhllllllllhhhhhhhlHHHHhhhhhlhhhh
Query kpcEIRELShHEFFMPGLVDTHIHASQYsfagssidlpllewltkyTFPAehrfqnidfa  113
ident        ||      ||  | | |                         |          
Sbjct --cTVVDLS-GQILCPGFIDQHVHLIGG------------------GGEA------gptt   82
DSSP  --lEEEELL-LLEEEELEEEEEELLLLL------------------LLLL------lhhh


DSSP  hhHHHHhHHHHHHLLEEEEEEELL-----lLHHHHHHHHHHHHHHLLEEEEEL-EELLll
Query eeVYTRvVRRTLKNGTTTACYFAT-----iHTDSSLLLADITDKFGQRAFVGK-VCMDln  167
ident          |    | |             |  | |         |  |           
Sbjct rtPEVA-LSRLTEAGVTSVVGLLGtdsisrHPESLLAKTRALNEEGISAWMLTgAYHV--  139
DSSP  llLLLL-HHHHHHLLEEEEEELLLllllllLHHHHHHHHHHHHHHLLEEEEEEeLLLL--


DSSP  lllllllllhhhHHHH----HHHHHHHHHhhllllEEEEEEELLH---HHLL-HHHHHHH
Query dtfpeyketteeSIKE----TERFVSEMLqknysrVKPIVTPRFS---LSCS-ETLMGEL  219
ident                      |  |              |    |               
Sbjct ------------PSRTitgsVEKDVAIID------RVIGVXCAISdhrSAAPdVYHLANM  181
DSSP  ------------LLLLllllHHHHHHHLL------LEEEEEEEELlllLLLLlHHHHHHH


DSSP  HHHHHHHL------LEEEEEELllhhHHHHhhhhllllllHHHHHHHLL----llLLLEE
Query GNIAKTRD------LHIQSHISenrdEVEAvknlypsyknYTSVYDKNN----llTNKTV  269
ident                    |                                     |  
Sbjct AAESRVGGllggkpGVTVFHMG----DSKK----------ALQPIYDLLencdvpISKLL  227
DSSP  HHHHHHHHhhhlllLEEEEEEL----LLLL----------LLHHHHHHHhlllllHHHEE


DSSP  EEELL----LLLHhHHHHHHHhLLEEEELhHHHHhlLLLL--LLHHHHH-HLLL--EEEE
Query MAHGC----YLSAeELNVFHErGASIAHCpNSNLslSSGF--LNVLEVL-KHEV--KIGL  320
ident   |            |      |  |     |                           |
Sbjct PTHVNrnvpLFEQ-ALEFARK-GGTIDIT-SSID--EPVApaEGIARAVqAGIPlaRVTL  282
DSSP  EELHHhlhhHHHH-HHHHHHL-LLLEEEE-LLLL--LLLLhhHHHHHHHhLLLLhhHEEE


DSSP  LLLLLL---------------lLLLL-HHHHHHHHHHHHhhhhhllllllLLLHHHHHHH
Query GTDVAG---------------gYSYS-MLDAIRRAVMVSnillinkvnekSLTLKEVFRL  364
ident   |  |                      |      |                      | 
Sbjct SSDGNGsqpffddegnlthigvAGFEtLLETVQVLVKDY-----------DFSISDALRP  331
DSSP  ELLLLLeeeeellllleeeeeeLLLHhHHHHHHHHHHHH-----------LLLHHHHHHH


DSSP  HLHHHHHHLLLlLLLLLLLLLLLLLEEEElllllllllllllhhhhlllllhhHHHHhhh
Query ATLGGSQALGLdGEIGNFEVGKEFDAILInpkasdspidlfygdffgdiseavIQKFlyl  424
ident  |      | |    |    |   |                                   
Sbjct LTSSVAGFLNL-TGKGEILPGNDADLLVM------------------------TPEL---  363
DSSP  HLHHHHHHLLL-LLLLLLLLLLLLLEEEE------------------------LLLL---


DSSP  llhhHEEEEEELLEEE-----ELLL------
Query gddrNIEEVYVGGKQV-----VPFS------  444
ident      || ||  ||                 
Sbjct ----RIEQVYARGKLMvkdgkACVKgtfetd  390
DSSP  ----LEEEEEELLEEEeelleELLLllllll


No 18: Query=2uz9A Sbjct=3ooqA Z-score=22.7

back to top
DSSP  llLEEEE-EEEEELLllllLEEEEeEEEEELlLLLEEEEEEHhhhhhhhhHHLLlhhHEE
Query plAHIFR-GTFVHSTwtcpMEVLRdHLLGVSdSGKIVFLEEAsqqeklakEWCFkpcEIR   59
ident      |   |    |              ||  ||     |         |      || 
Sbjct --KILFKnATVFPIT----SRPFK-GDVLVS-NGKVEKVGEN-------iEDPD--aEIV   43
DSSP  --LEEEEeEEELLLL----LLLEE-EEEEEE-LLEEEEEELL-------lLLLL--lEEE


DSSP  ELLlLLEEEELEEEEEEEH-HHHHHllllllllhhhhhhhLHHHHH----------hhhh
Query ELShHEFFMPGLVDTHIHA-SQYSFagssidlpllewltkYTFPAE----------hrfq  108
ident  |    |  || || | |                                          
Sbjct DLT-GKFLFPGFVDAHSHIgLFEEG--------------vGYYYSDgneatdpvtphvka   88
DSSP  ELL-LLEEEELEEEEEELLlLLLLL--------------lLHHHLLlllllllllllllh


DSSP  lhhhHHHHhhHHHHHHHHLLEEEEEEELlllhhhhhhhhhhhhhhlleeeeeLEELllll
Query nidfAEEVytRVVRRTLKNGTTTACYFAtihtdssllladitdkfgqrafvgKVCMdlnd  168
ident               | |  | |                                      
Sbjct ldgfNPQD--PAIERALAGGVTSVXIVP------------------------GSAN----  118
DSSP  hhhlLLLL--HHHHHHHLLLEEEEEELL------------------------LLLL----


DSSP  llllllllhhhhhhhhhhhhhhhhhHLLL-LEEE-EEEElLHHH----------------
Query tfpeyketteesiketerfvsemlqKNYS-RVKP-IVTPrFSLS----------------  210
ident                                  |                          
Sbjct ----------pvggqgsvikfrsiiVEECiVKDPaGLKX-AFGEnpkrvygerkqtpstr  167
DSSP  ----------leeeeeeeeelllllHHHHeEEEEeEEEE-ELLHhhhhhhhhlllllllh


DSSP  -lLHHHHH------------------------------hhHHHHHHHLLEEEEEELllhh
Query -cSETLMG------------------------------elGNIAKTRDLHIQSHISenrd  239
ident                                         |            |      
Sbjct xgTAGVIRdyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAH----  223
DSSP  hhHHHHHHhhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEEL----


DSSP  hhhhhhhhlllllLHHHHHHHLL-llllLEEEEELLLLLHhHHHHHHHHLLEEEELHhhH
Query eveavknlypsykNYTSVYDKNN-lltnKTVMAHGCYLSAeELNVFHERGASIAHCPnsN  298
ident                               |  ||         |  |        |   
Sbjct -----------raDDILTAIRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVVGP--L  269
DSSP  -----------lhHHHHHHHHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEELL--L


DSSP  HHLL------LLLL-LHHHHHHLLLEEEELLLLLlLLLL-LHHHHHHHhHHHHhhhhhll
Query LSLS------SGFL-NVLEVLKHEVKIGLGTDVAgGYSY-SMLDAIRRaVMVSnillink  350
ident |                   ||  | | |  |                            
Sbjct LTFRtklelkDLTXeTIAKLLKDGVLIALXCDHP-VIPLeFATVQAAT-AXRY-------  320
DSSP  LLLLllhhhlLLLLlHHHHHHHLLLLEEELLLLL-LLLHhHHHHHHHH-HHHH-------


DSSP  llllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLlllllllllllhhhh
Query vnekSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPkasdspidlfygdff  410
ident                |      |||   ||  | ||  |                     
Sbjct ----GAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSG---------------  361
DSSP  ----LLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELL---------------


DSSP  lllllhhhhhHHHHLLhhHEEEEEELLEEEELLL
Query gdiseaviqkFLYLGDdrNIEEVYVGGKQVVPFS  444
ident                     | ||  |  |    
Sbjct ---------hPFDXKS--VVERVYIDGVEVFRRE  384
DSSP  ---------lLLLLLL--LEEEEEELLEEEEELL


No 19: Query=2uz9A Sbjct=3giqA Z-score=21.6

back to top
DSSP  -LLLEEEEE-EEEELLlllLLEEEEeEEEEELlLLLEEEEEEHHHHhhhhhhhlllhhHE
Query -PLAHIFRG-TFVHSTwtcPMEVLRdHLLGVSdSGKIVFLEEASQQeklakewcfkpcEI   58
ident   |     |      |        |   |||   | |    |                  
Sbjct eKLDFKITGgWIIDGT---GAPRRR-ADLGVR-DGRIAAIGELGAH---------parHA   46
DSSP  lLEEEEEELlEELLLL---LLLLEE-LEEEEE-LLEEEEEELLLLL---------leeEE


DSSP  EELLlLLEEEELEEEEEEEHHHHhhllllllllhhhhhhhlhhhhhhhhhlhhhhhHHHH
Query RELShHEFFMPGLVDTHIHASQYsfagssidlpllewltkytfpaehrfqnidfaeEVYT  118
ident    |      ||  | | |                                         
Sbjct WDAS-GKIVAPGFIDVHGHDDLM--------------------------------fVEKP   73
DSSP  EELL-LLEEEELEEELLLLLLLH--------------------------------hHHLL


DSSP  HhHHHHHHLLEEEEEEE----LLLL-------------------hHHHHHHHHHHH--HH
Query RvVRRTLKNGTTTACYF----ATIH-------------------tDSSLLLADITD--KF  153
ident    |     | ||                                          |    
Sbjct D-LRWKTSQGITTVVVGncgvSAAPaplpgntaaalallgetplfADVPAYFAALDaqRP  132
DSSP  L-LHHHHLLLEEEEEELllllLLLLllllllllhhhhhhllllllLLHHHHHHHHHhlLL


DSSP  LLEEEEELEELllllllllLLLL-----------HHHHHHHHHHHHHHHhhhlllleEEE
Query GQRAFVGKVCMdlndtfpeYKET-----------TEESIKETERFVSEMlqknysrvKPI  202
ident                                                             
Sbjct MINVAALVGHA-----nlrLAAMrdpqaaptaaeQQAMQDMLQAALEAG--------AVG  179
DSSP  LLEEEEEEEHH-----hhhHHHLllllllllhhhHHHHHHHHHHHHHHL--------LLE


DSSP  EEElLHHH-----LLHHHHHHHHHHHHHHLLEEEEEEllLHHHHhhhhhhlllllLHHHH
Query VTPrFSLS-----CSETLMGELGNIAKTRDLHIQSHIseNRDEVeavknlypsykNYTSV  257
ident                      |   |  |     |||    | |                
Sbjct FST-GLAYqpgavAQAAELEGLARVAAERRRLHTSHIrnEADGV----------eAAVEE  228
DSSP  EEE-ELLLllhhhLLHHHHHHHHHHHHHLLLEEEEELllLLLLH----------hHHHHH


DSSP  HHHLL-llllLEEEEELLL-------lLHHHHHHHHHH-----LLEEEELHhhHHHL---
Query YDKNN-lltnKTVMAHGCY-------lSAEELNVFHER-----GASIAHCPnsNLSL---  301
ident            ||  |           |   |                  |         
Sbjct VLAIGrgtgcATVVSHHKCmmpqnwgrSRATLANIDRAreqgvEVALDIYP--YPGSsti  286
DSSP  HHHHHhhhllEEEELLLLLllhhhlllHHHHHHHHHHHhhlllLEEEEELL--LLEEeee


DSSP  ------------------------------------------------------LLLL--
Query ------------------------------------------------------SSGF--  305
ident                                                             
Sbjct liperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEde  346
DSSP  llhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHhh


DSSP  -LLHHHHHhlllEEEELLLLL-----lLLLL--LHHHHHHHHHhhhhhhhhllllllLLL
Query -LNVLEVLkhevKIGLGTDVA-----gGYSY--SMLDAIRRAVmvsnillinkvnekSLT  357
ident                 | |              |      | |                |
Sbjct vKRIFQHP----CCMVGSDGLpndarpHPRLwgSFTRVLGRYV----------rearLMT  392
DSSP  hHHHHHLL----LEEELLLLLllllllLLHHhhHHHHHHHHHH----------hhllLLL


DSSP  HHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLLEEEELllllllllllllhhhhlllllhh
Query LKEVFRLATLGGSQALGLdGEIGNFEVGKEFDAILINpkasdspidlfygdffgdiseav  417
ident |       |       |   | |    |   |                            
Sbjct LEQAVARMTALPARVFGF-AERGVLQPGAWADVVVFD-----------------------  428
DSSP  HHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEEL-----------------------


DSSP  hHHHHH--------hlLHHHEEEEEELLEEEELLL-------------
Query iQKFLY--------lgDDRNIEEVYVGGKQVVPFS-------------  444
ident                     |  | | |  | |               
Sbjct -PDTVAdratwdeptlASVGIAGVLVNGAEVFPQPpadgrpgqvlrax  475
DSSP  -LLLLLllllllllllLLLLEEEEEELLEEEELLLlllllllllllll


No 20: Query=2uz9A Sbjct=1a4mA Z-score=21.5

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeEELEEEEEEEHHHHHH-------------------------llLLLL-LLHHH
Query lshheffMPGLVDTHIHASQYSF-------------------------agSSID-LPLLE   94
ident            |  | |                                      | |  
Sbjct ---tpafNKPKVELHVHLDGAIKpetilyfgkkrgialpadtveelrniiGMDKpLSLPG   57
DSSP  ---llllLLLEEEEEEEHHHLLLhhhhhhhhhhhllllllllhhhhhhhhLLLLlLLHHH


DSSP  HHHhLHHHHHH-HHHLHHHHHHHHHHHHHHHHHLLEEEEEEELLLL--------------
Query WLTkYTFPAEH-RFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIH--------------  139
ident  |                         |    | |          |              
Sbjct FLA-KFDYYMPvIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllanskvdpmpwnq  116
DSSP  HHL-LHHHHHHhHLLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhllllllllhhhl


DSSP  -------HHHHHHHHHHHHHHL----LEEEEELEELLLlllllllllLHHHHHhHHHHHH
Query -------TDSSLLLADITDKFG----QRAFVGKVCMDLndtfpeykeTTEESIkETERFV  188
ident         |   |                     ||               |  |     
Sbjct tegdvtpDDVVDLVNQGLQEGEqafgIKVRSILCCMRH---------QPSWSL-EVLELC  166
DSSP  llllllhHHHHHHHHHHHHHHHhhhlLEEEEEEEEELL---------LHHHHH-HHHHHH


DSSP  HHHHhhllllEEEEEEELLHH----HLLHHHHHHHHHHHHHHLLEEEEEELLLHhhhhhh
Query SEMLqknysrVKPIVTPRFSL----SCSETLMGELGNIAKTRDLHIQSHISENRdeveav  244
ident                          |       |    |     |   |  |        
Sbjct KKYN----qkTVVAMDLAGDEtiegSSLFPGHVEAYEGAVKNGIHRTVHAGEVG------  216
DSSP  HHLL----llLEEEEEEELLLllllHHHLHHHHHHHHHHHHHLLEEEEEELLLL------


DSSP  hhhlllllLHHHHHHHLLLLlllEEEEELLLLL--HHHHHHHHHHLLEEEELHHHHHHLL
Query knlypsykNYTSVYDKNNLLtnkTVMAHGCYLS--AEELNVFHERGASIAHCPNSNLSLS  302
ident                            ||          |           || |     
Sbjct ------spEVVREAVDILKT---ERVGHGYHTIedEALYNRLLKENMHFEVCPWSSYLTG  267
DSSP  ------lhHHHHHHHHLLLL---LEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHHHLL


DSSP  LL----lLLHHHHHHLLLEEEELLLLL-LLLLlLHHHHHHHHHHHHhhhhhllllllLLL
Query SG----fLNVLEVLKHEVKIGLGTDVA-GGYSySMLDAIRRAVMVSnillinkvnekSLT  357
ident          |           | ||      |                           |
Sbjct AWdpkttHAVVRFKNDKANYSLNTDDPlIFKS-TLDTDYQMTKKDM-----------GFT  315
DSSP  LLlllllLHHHHHHHLLLLEEELLLLLlLLLL-LHHHHHHHHHHLL-----------LLL


DSSP  HHHHHHHhLHHHHHHLLL----LLLLL--LLLLllllleeeelllllllllllllhhhhl
Query LKEVFRLaTLGGSQALGL----DGEIG--NFEVgkefdailinpkasdspidlfygdffg  411
ident   |  ||          |      |                                   
Sbjct EEEFKRL-NINAAKSSFLpeeeKKELLerLYRE---------------------------  347
DSSP  HHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH---------------------------


DSSP  llllhhhhhhhhhllhhheeeeeelleeeelll
Query diseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                  
Sbjct -------------------------------yq  349
DSSP  -------------------------------ll


No 21: Query=2uz9A Sbjct=2ogjA Z-score=21.3

back to top
DSSP  lLLEEEEEEEEELLLLLllEEEEeEEEEELLLLLEEEEEEHhhhhhhhhHHLLlhhHEEE
Query pLAHIFRGTFVHSTWTCpmEVLRdHLLGVSDSGKIVFLEEAsqqeklakEWCFkpcEIRE   60
ident                                 |||     |                 | 
Sbjct qAPILLTNVKPVGFGKG-aSQSS-TDILIGGDGKIAAVGSA-------lQAPA--dTQRI   49
DSSP  lLLEEEEEEEELLLLLL-lLLLL-EEEEELLLLLEEEEELL-------lLLLL--lEEEL


DSSP  LLllLEEEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhHHHHHHhHH
Query LShhEFFMPGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidFAEEVYtRV  120
ident      |  || || | |                                           
Sbjct DA--AFISPGWVDLHVHIW-------------------------------hGGTDIS-IR   75
DSSP  LL--LEEEELEEEEEELLL-------------------------------lLLLLLL-LL


DSSP  HHHHH-HLLEEEEEE-ELLLlHHHHHHHHH-HHHHHLLEEEEELEEL--llllllLLLL-
Query VRRTL-KNGTTTACY-FATIhTDSSLLLAD-ITDKFGQRAFVGKVCM--dlndtfPEYK-  174
ident         | ||                   |      |                     
Sbjct PSECGaERGVTTLVDaGSAG-EANFHGFREyIIEPSRERIKAFLNLGsiglvacnRVPEl  134
DSSP  HHHLLhHHLEEEEEEeLLLL-LLLHHHHHHhLLLLLLLEEEEEEELLllllllllLLLLl


DSSP  LLHHHHHH-HHHHHHHHHHhhllllEEEEEEeLLHH-----hlLHHHHHHHHHHHHHHLL
Query ETTEESIK-ETERFVSEMLqknysrVKPIVTpRFSL-----scSETLMGELGNIAKTRDL  228
ident                 |                            |       |||    
Sbjct RDIKDIDLdRILECYAENS-----eHIVGLX-VRAShvitgswGVTPVKLGKKIAKILKV  188
DSSP  LLHHHLLHhHHHHHHHLLL-----lLEEEEE-EEELhhhhlllLLHHHHHHHHHHHHHLL


DSSP  EEEEEELllhhhHHHHhhhllllllHHHHHHHLllLLLLEEEEELL------LLLH----
Query HIQSHISenrdeVEAVknlypsyknYTSVYDKNnlLTNKTVMAHGC------YLSA----  278
ident     |                              |    |  |                
Sbjct PXXVHVG-----EPPA---------LYDEVLEI--LGPGDVVTHCFngksgsSIXEdedl  232
DSSP  LEEEEEL-----LLLL---------LHHHHHHH--LLLLLEEELLLllllllLLLLlhhh


DSSP  -HHHHHHhhHLLEEEELHHHhhhllLLLL--LHHHHH-HLLLEEEELLLL-LLLL---LL
Query -EELNVFheRGASIAHCPNSnlslsSGFL--NVLEVL-KHEVKIGLGTDV-AGGY---SY  330
ident           |                |                   ||           
Sbjct fNLAERC--EGIRLDIGHGG-----ASFSfkVAEAAIaRGLLPFSISTDLhGHSXnfpVW  285
DSSP  hHHHHHL--LLLEEELLLLL-----LLLLhhHHHHHHhLLLLLLLLLLLLlLLLLlllLL


DSSP  LHHHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHHLLLLLlllLLLLLLLLLE
Query SMLDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQALGLDGeigNFEVGKEFDA  390
ident            |                  |    |        ||       ||   | 
Sbjct DLATTXSKLLSVD------------XPFENVVEAVTRNPASVIRLDX-enRLDVGQRADF  332
DSSP  LHHHHHHHHHHLL------------LLHHHHHHLLLHHHHHHLLLLL-llLLLLLLLLEE


DSSP  EEElllllllllllllhhhhlllllhhHHHH---------------hHHLLhhhEEEEEE
Query ILInpkasdspidlfygdffgdiseavIQKF---------------lYLGDdrnIEEVYV  435
ident                                                 |           
Sbjct TVF------------------------DLVDadleatdsngdvsrlkRLFE---PRYAVI  365
DSSP  EEE------------------------EEEEeeeeeellllleeeeeEEEE---EEEEEE


DSSP  LLEEEE-----lll
Query GGKQVV-----pfs  444
ident |             
Sbjct GAEAIAasryipra  379
DSSP  LLEEEEllllllll


No 22: Query=2uz9A Sbjct=1gkpA Z-score=20.1

back to top
DSSP  llLEEEEE-EEEELlllllLEEEEeEEEEELLlLLEEEEEeHHHHhhhhhhHLLLhhHEE
Query plAHIFRG-TFVHStwtcpMEVLRdHLLGVSDsGKIVFLEeASQQeklakeWCFKpcEIR   59
ident                                    |                     |  
Sbjct --PLLIKNgEIITA-----DSRYK-ADIYAEG-ETITRIG-QNLE------APPG-tEVI   43
DSSP  --LEEEELlEEEEL-----LEEEE-LEEEELL-LLLLEEE-LLLL------LLLL-lEEE


DSSP  ELLlLLEEEELEEEEEEEHHHhhhllllllllhhhhHHHLHhhhhhhhhlhhhhhhHHHH
Query ELShHEFFMPGLVDTHIHASQysfagssidlpllewLTKYTfpaehrfqnidfaeeVYTR  119
ident          ||  | | |                                          
Sbjct DAT-GKYVFPGFIDPHVHIYL--------------pFMATF------------akdTHET   76
DSSP  ELL-LLEEEELEEEEEELLLL--------------eELLEE------------lllLHHH


DSSP  HHHHHHHLLEEEEEEELLL--------LHHHHHHHHHHhhHHLLEEEEELEELLllllll
Query VVRRTLKNGTTTACYFATI--------HTDSSLLLADItdKFGQRAFVGKVCMDlndtfp  171
ident      |  ||||                       |                        
Sbjct GSKAALMGGTTTYIEMCCPsrnddaleGYQLWKSKAEG--NSYCDYTFHMAVSK------  128
DSSP  HHHHHHHLLEEEEEEEELLlllllhhhHHHHHHHHHLL--LLLLEEEEEEELLL------


DSSP  llllLHHHHHHHHHHHHHHHhhhlllleEEEEEeLLHH-----HLLHHHHHHHHHHHHHH
Query eykeTTEESIKETERFVSEMlqknysrvKPIVTpRFSL-----SCSETLMGELGNIAKTR  226
ident       |         |                  |             |      ||  
Sbjct ----FDEKTEGQLREIVADG--------ISSFX-IFLSyknffGVDDGEMYQTLRLAKEL  175
DSSP  ----LLLLHHHHHHHHHHLL--------LLEEE-EEELlllllLLLHHHHHHHHHHHHHH


DSSP  LLEEEEEElllhhhhhHHHHHLL-----------------------lllLHHHHHHHLL-
Query DLHIQSHIsenrdeveAVKNLYP-----------------------sykNYTSVYDKNN-  262
ident       |                                            |        
Sbjct GVIVTAHC-------eNAELVGRlqqkllsegktgpewhepsrpeaveaEGTARFATFLe  228
DSSP  LLEEEEEE-------lLHHHHHHhhhhhhhlllllhhhllllllhhhhhHHHHHHHHHHh


DSSP  llllLEEEEELLL--LLHHHHHHHH-HHLLEEEELHHHHHH------------------L
Query lltnKTVMAHGCY--LSAEELNVFH-ERGASIAHCPNSNLS------------------L  301
ident          |                     |       |                    
Sbjct ttgaTGYVVHLSCkpALDAAMAAKArGVPIYIESVIPHFLLdktyaerggveamkyimsP  288
DSSP  hhllEEEELLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLlhhhhhllhhhhhlllllL


DSSP  LLL-----llLHHHHHHlLLEEEELLLLL-------------------LLLLL-LHHHHH
Query SSG-----flNVLEVLKhEVKIGLGTDVA-------------------GGYSY-SMLDAI  336
ident                         |||                     |           
Sbjct PLRdkrnqkvLWDALAQ-GFIDTVGTDHCpfdteqkllgkeaftaipnGIPAIeDRVNLL  347
DSSP  LLLllhhhhhHHHHHHL-LLLLEEELLLLlllhhhhhhhlllhhhlllLLLLLlLHHHHH


DSSP  HHHHhhhhhhhhllllllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL
Query RRAVmvsnillinkvnekSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPK  396
ident                    |        |        ||    |   ||   |     | 
Sbjct YTYG----------vsrgRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQ  397
DSSP  HHHH----------llllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELL


DSSP  lllLLLLlllhhhhlllllhhhhhhhHHLLhhhEEEEEELLEEE-----ELLL-------
Query asdSPIDlfygdffgdiseaviqkflYLGDdrnIEEVYVGGKQV-----VPFS-------  444
ident                             |       | | ||                  
Sbjct ---YRGTisvktqhvnndyngfegfeIDGR---PSVVTVRGKVAvrdgqFVGEkgwgkll  451
DSSP  ---LLEEllhhhllllllllllllleELLE---EEEEEELLEEEeelleELLLlllllll


DSSP  -------
Query -------  444
ident        
Sbjct rrepmyf  458
DSSP  lllllll


No 23: Query=2uz9A Sbjct=3griA Z-score=19.6

back to top
DSSP  llLEEEE-EEEEellllllLEEEEeEEEEELLlLLEEEEEEHhhhhhhhhHHLLLhhHEE
Query plAHIFR-GTFVhstwtcpMEVLRdHLLGVSDsGKIVFLEEAsqqeklakEWCFKpcEIR   59
ident         |           |              |     |        |       | 
Sbjct --XKLIKnGKVL-----qnGELQQ-ADILIDG-KVIKQIAPA-------iEPSNG-vDII   43
DSSP  --LEEEElLEEE-----elLEEEE-LEEEEEL-LEEEEEELL-------lLLLLL-lEEE


DSSP  ELLlLLEEEELEEEEEEEHHH--HHHLlllllllhhhhhhhlhhhhhhhhhlhhhhhhHH
Query ELShHEFFMPGLVDTHIHASQ--YSFAgssidlpllewltkytfpaehrfqnidfaeeVY  117
ident       |  || || | |                                          
Sbjct DAK-GHFVSPGFVDVHVHLREpgGEYK------------------------------eTI   72
DSSP  ELL-LLEEEELEEEEEELLLLllLLLL------------------------------lLH


DSSP  HHHHHHHHHLLEEEEEEEL----LLLHH-HHHHHHHHHH-HHLLEEEEELEE---LLLLl
Query TRVVRRTLKNGTTTACYFA----TIHTD-SSLLLADITD-KFGQRAFVGKVC---MDLNd  168
ident           | || |                 |    |     |               
Sbjct ETGTKAAARGGFTTVCPXPntrpVPDSVeHFEALQKLIDdNAQVRVLPYASIttrQLGK-  131
DSSP  HHHHHHHHHLLEEEEEELLllllLLLLHhHHHHHHHHHHhHLLLEELLLEELlhhHLLL-


DSSP  llllllllhhhHHHHHHHHHHHHhhhlllleEEEEEELLhHHLL-HHHHHHHHHHHHHHL
Query tfpeyketteeSIKETERFVSEMlqknysrvKPIVTPRFsLSCS-ETLMGELGNIAKTRD  227
ident                    | |             |              |    |    
Sbjct -----------ELVDFPALVKEG--------AFAFTDDG-VGVQtASXXYEGXIEAAKVN  171
DSSP  -----------LLLLHHHHHLLL--------LLLEEELL-LLLLlHHHHHHHHHHHHHHL


DSSP  LEEEEEEL---------------------llHHHHHhhhhhlllllLHHHHHHHLL-lll
Query LHIQSHIS---------------------enRDEVEavknlypsykNYTSVYDKNN-llt  265
ident   |  |                                                      
Sbjct KAIVAHCEdnsliyggaxhegkrskelgipgIPNIC--------esVQIARDVLLAeaag  223
DSSP  LLEEELLLlhhhllllleellhhhhhhllleELLHH--------hhHHHHHHHHHHhhhl


DSSP  lLEEEEELLL--LLHHHHHHH-hHHLLEEEELHH-------------hhHHLLLLL----
Query nKTVMAHGCY--LSAEELNVF-hERGASIAHCPN-------------snLSLSSGF----  305
ident       |                         |                           
Sbjct cHYHVCHVSTkeSVRVIRDAKraGIHVTAEVTPHhlllteddipgnnaiYKXNPPLrste  283
DSSP  lLEEELLLLLhhHHHHHHHHHhlLLLEEEEELHHhhhllhhhlllllhhHLLLLLLllhh


DSSP  ---lLHHHHHHlLLEEEELLLLL----------------LLLL-LLHHHHHHhhhhhhhh
Query ---lNVLEVLKhEVKIGLGTDVA----------------GGYS-YSMLDAIRravmvsni  345
ident          |         || |                |                    
Sbjct dreaLLEGLLD-GTIDCIATDHAphardekaqpxekapfGIVGsETAFPLLY--------  334
DSSP  hhhhHHHHHHL-LLLLEELLLLLlllhhhhlllllllllLLLLlLLHHHHHH--------


DSSP  hhhlllllLLLLHHHHHHHHLHHHHHHLLLLllLLLLLLLLLLLEEEELLLlllLLLLll
Query llinkvneKSLTLKEVFRLATLGGSQALGLDgeIGNFEVGKEFDAILINPKasdSPIDlf  405
ident            ||       |        |    |        |   |      |     
Sbjct --thfvknGDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLD---SEQE-i  386
DSSP  --hhhlllLLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELL---LLEE-l


DSSP  lhhhhlllllhhhhhhhHHLLhhHEEEEEELLEEEELll
Query ygdffgdiseaviqkflYLGDdrNIEEVYVGGKQVVPfs  444
ident                        |     | |       
Sbjct kgedflskadntpfigyKVYG--NPILTXVEGEVKFE-g  422
DSSP  lhhhlllllllllllllEELL--EEEEEEELLEEEEE-l


No 24: Query=2uz9A Sbjct=3e74A Z-score=19.6

back to top
DSSP  LLLEEEEE-EEEELlllllLEEEEeEEEEELlLLLEEEEEEHhhhhhhhhhHLLLhhHEE
Query PLAHIFRG-TFVHStwtcpMEVLRdHLLGVSdSGKIVFLEEAsqqeklakeWCFKpcEIR   59
ident     |    |          |        |   |||                  |  |  
Sbjct SFDLIIKNgTVILE-----NEARV-VDIAVK-GGKIAAIGQD--------lGDAK--EVX   43
DSSP  LEEEEEELlEEELL-----LLEEE-LEEEEE-LLEEEEEELL--------lLLEE--EEE


DSSP  ELLlLLEEEELEEEEEEEHhhhhhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHHHH
Query ELShHEFFMPGLVDTHIHAsqysfagssidlpllewltkytfpaehrfqnidfaeeVYTR  119
ident   |      || || | |                                       |  
Sbjct DAS-GLVVSPGXVDAHTHI-------------------------------------GYET   65
DSSP  ELL-LLEEEELEEEEEELL-------------------------------------LHHH


DSSP  HHHHHHHLLEEEEEEEL------LLLHHHHH-HHHHHhhHHLLEEEEELEELLlllllll
Query VVRRTLKNGTTTACYFA------TIHTDSSL-LLADItdKFGQRAFVGKVCMDlndtfpe  172
ident   |   | | ||           |    |          |    |               
Sbjct GTRAAAKGGITTXIEXPlnqlpaTVDRASIElKFDAAkgKLTIDAAQLGGLVS-------  118
DSSP  HHHHHHHLLEEEEEELLllllllLLLHHHHHhHHHHHllLLLLEEEELEELLL-------


DSSP  llllhhHHHHHHHHHHHHHhhhlllleEEEEEElLHHHLLHHHHHHHHHHHHHHLLEEEE
Query yketteESIKETERFVSEMlqknysrvKPIVTPrFSLSCSETLMGELGNIAKTRDLHIQS  232
ident         |                         |                         
Sbjct ------YNIDRLHELDEVG--------VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVLV  163
DSSP  ------LLLLLHHHHHHHL--------LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEEE


DSSP  EELllhhHHHHHHH--------------------hlllllLHHHHHHHLL-llllLEEEE
Query HISenrdEVEAVKN--------------------lypsykNYTSVYDKNN-lltnKTVMA  271
ident |                                                           
Sbjct HCE----NALICDElgeeakregrvtahdyvasrpvftevEAIRRVLYLAkvagcRLHVC  219
DSSP  ELL----LHHHHHHhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHhhhllLEEEL


DSSP  ELLLLL-hHHHHHHHH--HLLEEEELHH-------------hhHHLLLLL-------lLH
Query HGCYLS-aEELNVFHE--RGASIAHCPN-------------snLSLSSGF-------lNV  308
ident |       ||               ||                   |             
Sbjct HVSSPEgvEEVTRARQegQDITCESCPHyfvldtdqfeeigtlAKCSPPIrdlenqkgXW  279
DSSP  LLLLHHhhHHHHHHHHllLLEEEEELLHhhhllhhhhhhhlhhHLLLLLLllhhhhhhHH


DSSP  HHHHHlLLEEEELLLLL----------------LLLLL-LHHHHHHhhhhhhhhhhhlll
Query LEVLKhEVKIGLGTDVA----------------GGYSY-SMLDAIRravmvsnillinkv  351
ident            |  |                  |     |  |                 
Sbjct EKLFN-GEIDCLVSDHSpcppexkagnixkawgGIAGLqSCXDVXF-----------dea  327
DSSP  HHHHL-LLLLEELLLLLllllllllllllllllLLLLHhHHHHHHH-----------hhh


DSSP  lllLLLHH-HHHHHHLHHHHHHLLLlLLLLLLLLLLLLLEEEELLLlllLLLLlllhhhh
Query nekSLTLK-EVFRLATLGGSQALGLdGEIGNFEVGKEFDAILINPKasdSPIDlfygdff  410
ident              |         ||    |    ||  |   | |    |          
Sbjct vqkRGXSLpXFGKLXATNAADIFGL-QQKGRIAPGKDADFVFIQPN---SSYV-ltnddl  382
DSSP  lllLLLLHhHHHHHHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELL---LLEE-llhhhl


DSSP  lllllhhhhhhhHHLLhhHEEEEEELLEEEEL---------------ll
Query gdiseaviqkflYLGDdrNIEEVYVGGKQVVP---------------fs  444
ident               |    |      |                      
Sbjct eyrhkvspyvgrTIGA--RITKTILRGDVIYDieqgfpvapkgqfilkh  429
DSSP  llllllllllllEELL--EEEEEEELLEEEEElllllllllllleelll


No 25: Query=2uz9A Sbjct=4b3zD Z-score=18.5

back to top
DSSP  lLLEEEEE-EEEELLlllllEEEEeEEEEELlLLLEEEEEeHHHHhhhhhhHLLLhhHEE
Query pLAHIFRG-TFVHSTwtcpmEVLRdHLLGVSdSGKIVFLEeASQQeklakeWCFKpcEIR   59
ident        |              |          | |                        
Sbjct -DRLLIKGgRIINDD-----QSLY-ADVYLE-DGLIKQIG-ENLI------VPGG-vKTI   44
DSSP  -LEEEEEEeEEELLL-----LEEE-EEEEEE-LLEEEEEE-LLLL------LLLL-lEEE


DSSP  ELLlLLEEEELEEEEEEEHHHhhhllllllllhhhhhhhlhhhhhhhhhlhhHHHHHHHH
Query ELShHEFFMPGLVDTHIHASQysfagssidlpllewltkytfpaehrfqnidFAEEVYTR  119
ident |        ||  |                                       |      
Sbjct EAN-GRMVIPGGIDVNTYLQK-------------------------------TAADDFFQ   72
DSSP  ELL-LLEEEELEEEEEELLLL-------------------------------LLLLLHHH


DSSP  HHHHHHHLLEEEEEEELLL-----LHHHHHHHHHHHHH-HLLEEEEELEELLllllllll
Query VVRRTLKNGTTTACYFATI-----HTDSSLLLADITDK-FGQRAFVGKVCMDlndtfpey  173
ident   |  |  |||                |        |                       
Sbjct GTRAALVGGTTMIIDHVVPepgssLLTSFEKWHEAADTkSCCDYSLHVDITS--------  124
DSSP  HHHHHHHLLEEEEEEEELLlllllHHHHHHHHHHHHHLlLLLEEEEEEELLL--------


DSSP  llLHHHHHHHHHHHHHHHHhhlllleEEEEEeLLHH-----HLLHHHHHHHHHHHHHHLL
Query keTTEESIKETERFVSEMLqknysrvKPIVTpRFSL-----SCSETLMGELGNIAKTRDL  228
ident          | |  |                            |     |     |    
Sbjct --WYDGVREELEVLVQDKG-------VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLGA  174
DSSP  --LLLLHHHHHHHHHHLLL-------LLEEE-EELLlllllLLLHHHHHHHHHHHHHHLL


DSSP  EEEEEE------------------------lllHHHHHhhhhhlllllLHHHHHHHLL-l
Query HIQSHI------------------------senRDEVEavknlypsykNYTSVYDKNN-l  263
ident  |  |                            | |                        
Sbjct VILVHAengdliaqeqkrilemgitgpeghalsRPEEL--------eaEAVFRAITIAgr  226
DSSP  EEEEELllhhhhhhhhhhhhhllllllhhhhhhLLHHH--------hhHHHHHHHHHHhh


DSSP  lllLEEEEELLL--LLHHHHHHH-hHHLLEEEELHHH-HHHL------------------
Query ltnKTVMAHGCY--LSAEELNVF-hERGASIAHCPNS-NLSL------------------  301
ident                                     |                       
Sbjct incPVYITKVMSksAADIIALARkkGPLVFGEPIAASlGTDGthywsknwakaaafvtsp  286
DSSP  hllLEEEEEELLhhHHHHHHHHHhhLLLEEEEELHHHhHLLLhhhhlllhhhhhhlllll


DSSP  LLLL------lLHHHHHHlLLEEEELLLLL-------------------LLLLL-LHHHH
Query SSGF------lNVLEVLKhEVKIGLGTDVA-------------------GGYSY-SMLDA  335
ident                          |                       |          
Sbjct PLSPdpttpdyLTSLLAC-GDLQVTGSGHCpystaqkavgkdnftlipeGVNGIeERMTV  345
DSSP  LLLLlllhhhhHHHHHHH-LLLLLLLLLLLlllhhhhhhhlllhhhlllLLLLLlLHHHH


DSSP  HHHHHhhhhhhhhllllllLLLHH-HHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEl
Query IRRAVmvsnillinkvnekSLTLK-EVFRLATLGGSQALGLDGEIGNFEVGKEFDAILIn  394
ident                                         |    |   ||   |     
Sbjct VWDKA-----------vatGKMDEnQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIW-  393
DSSP  HHHHH-----------lllLLLLHhHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEE-


DSSP  llllllllllllhhhhlllllhhHHHH---------------------hHHLLhhhEEEE
Query pkasdspidlfygdffgdiseavIQKF---------------------lYLGDdrnIEEV  433
ident                                                    |       |
Sbjct -----------------------DPDKlktitakshksaveynifegmeCHGS---PLVV  427
DSSP  -----------------------EEEEeeelllllllllllllllllleEEEE---EEEE


DSSP  EELLEEE-----ELLL----------------------------------
Query YVGGKQV-----VPFS----------------------------------  444
ident    || |                                           
Sbjct ISQGKIVfedgnINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  EELLEEEeelleELLLlllllllllllllhhhhhhhhhhhhhllllllll


No 26: Query=2uz9A Sbjct=1a5kC Z-score=16.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---LLLEEEE-EEEEELlllllLEEEEeEEEEELlLLLEEEEEEhhhhhhHHHH------
Query ---PLAHIFR-GTFVHStwtcpMEVLRdHLLGVSdSGKIVFLEEasqqekLAKE------   50
ident               |                ||   | |                     
Sbjct aadCVDLVLTnALIVDH-----WGIVK-ADIGVK-DGRIFAIGK------AGNPdiqpnv  107
DSSP  hhhLLLEEEEeEEEEEL-----LEEEE-EEEEEE-LLEEEEEEL------EELLllllll


DSSP  --HLLLhhHEEELLlLLEEEELEEEEEEEHHHhhhllllllllhhhhhhhlhhhhhhhhh
Query --WCFKpcEIRELShHEFFMPGLVDTHIHASQysfagssidlpllewltkytfpaehrfq  108
ident         |            |  |||||                               
Sbjct tiPIGAatEVIAAE-GKIVTAGGIDTHIHWIC----------------------------  138
DSSP  leELLLllEEEELL-LLEEEELEEEEEEELLL----------------------------


DSSP  lhhhhhhhhHHHHHHHHHLLEEEEEEEL------------LLLHHHHHHHHHHHHHHLLE
Query nidfaeevyTRVVRRTLKNGTTTACYFA------------TIHTDSSLLLADITDKFGQR  156
ident                 |  | ||                 |             |     
Sbjct ---------PQQAEEALVSGVTTMVGGGtgpaagthattcTPGPWYISRMLQAADSLPVN  189
DSSP  ---------LLHHHHHHHHLEEEEEEELllllhhhhhlllLLHHHHHHHHHHHHLLLLLE


DSSP  EEEELEELLlllllllllllhhhHHHHHHHHHHHHhhhlllleEEEEEElLHHHL-LHHH
Query AFVGKVCMDlndtfpeyketteeSIKETERFVSEMlqknysrvKPIVTPrFSLSC-SETL  215
ident                                |                            
Sbjct IGLLGKGNV-------------sQPDALREQVAAG--------VIGLEI-HEDWGaTPAA  227
DSSP  EEEEEELLL-------------lLHHHHHHHHHHL--------LLEEEE-EHHHLlLHHH


DSSP  HHHHHHHHHHHLLEEEEEElllhhhhhhHHHHlllLLLHhHHHHHLLLLLLlEEEEELL-
Query MGELGNIAKTRDLHIQSHIsenrdeveaVKNLypsYKNYtSVYDKNNLLTNkTVMAHGC-  274
ident        |   |     |            |                         |   
Sbjct IDCALTVADEMDIQVALHS--------dTLNE---SGFV-EDTLAAIGGRT-IHTFHTEg  274
DSSP  HHHHHHHHHHHLLEEEEEL--------lLLLL---LLLH-HHHHHHHLLLL-EEELLLLl


DSSP  -------LLLHhHHHHhhhHLLEEEELhHHHH----------------------------
Query -------YLSAeELNVfheRGASIAHCpNSNL----------------------------  299
ident                             |  |                            
Sbjct aggghapDIIT-ACAH---PNILPSST-NPTLpytlntidehldmlmvchhldpdiaedv  329
DSSP  lllllllLHHH-HHHL---LLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhhhh


DSSP  --------hllLLLL--LHHHHHhllleEEELLLLLLLLLLLhhHHHHHHHHHHHHHHHL
Query --------slsSGFL--NVLEVLkhevkIGLGTDVAGGYSYSmlDAIRRAVMVSNILLIN  349
ident                                  |            | |   |       
Sbjct afaesrirretIAAEdvLHDLGA----fSLTSSDSQAMGRVG--EVILRTWQVAHRMKVQ  383
DSSP  hlllllllhhhHHHHhhHHHLLL----lLEEELLLLLLLLLL--LHHHHHHHHHHHHHHH


DSSP  llLLLL---------lLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLllll
Query kvNEKS---------lTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKasds  400
ident                   |      |       |   | |  ||||  |     |     
Sbjct --RGALaeetgdndnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPA----  437
DSSP  --HLLLllllllllhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHH----


DSSP  llllllhhhhlllllhhhhHHHHhllhhHEEEEEELLEEEELLL----------------
Query pidlfygdffgdiseaviqKFLYlgddrNIEEVYVGGKQVVPFS----------------  444
ident                     |           |  ||                       
Sbjct -------------------FFGV-----KPATVIKGGMIAIAPMgdinasiptpqpvhyr  473
DSSP  -------------------HLLL-----LLLEEEELLEEEEEEEllllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  444
ident                                                             
Sbjct pmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpni  533
DSSP  elhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllle


DSSP  ---------------------------------
Query ---------------------------------  444
ident                                  
Sbjct tvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  eelllllleeelleellllllllllllllllll


No 27: Query=2uz9A Sbjct=2y1hB Z-score=16.0

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeEELEEEEEEEHHHHHHllllllllhhhhhhhlhhhhhhhhhlhhhhhHHHHHH
Query lshheffMPGLVDTHIHASQYSFagssidlpllewltkytfpaehrfqnidfaeEVYTRV  120
ident          |||| | | |   |                                    |
Sbjct -------GVGLVDCHCHLSAPDF------------------------------dRDLDDV   23
DSSP  -------LLLEEEEEELLLLHHH------------------------------lLLHHHH


DSSP  HHHHHHLLEEEEEEELLLLhHHHHHHHHHHHHHLLEEEEELEE-LLLLlLLLLlLLLHHH
Query VRRTLKNGTTTACYFATIHtDSSLLLADITDKFGQRAFVGKVC-MDLNdTFPEyKETTEE  179
ident      |         |                                        |   
Sbjct LEKAKKANVVALVAVAEHS-GEFEKIMQLSERYNGFVLPCLGVhPVQG-LDQR-SVTLKD   80
DSSP  HHHHHHLLEEEEEELLLLH-HHHHHHHHHHHHLLLLEEEEELLlLEEL-LLLE-ELLHHH


DSSP  HhHHHHHHHHHHHhhllllEEEEE-EELLHH-----------hlLHHHHHHHHHHHHHHL
Query SiKETERFVSEMLqknysrVKPIV-TPRFSL-----------scSETLMGELGNIAKTRD  227
ident                                                        ||   
Sbjct L-DVALPIIENYK-----dRLLAIgEVGLDFsprfagtgeqkeeQRQVLIRQIQLAKRLN  134
DSSP  H-HHHHHHHHHHL-----lLLLEEeEEEEELlllllllhhhhhhHHHHHHHHHHHHHHHL


DSSP  LEEEEEELllhhhhhhhhhhlllllLHHHHHHHLLllLLLEEEEELLlLLHHHHHHHHHH
Query LHIQSHISenrdeveavknlypsykNYTSVYDKNNllTNKTVMAHGCyLSAEELNVFHER  287
ident |    |                                 |                    
Sbjct LPVNVHSR-------------sagrPTINLLQEQG--AEKVLLHAFD-GRPSVAMEGVRA  178
DSSP  LLEEEEEE-------------llhhHHHHHHHHLL--LLLEEEELLL-LLHHHHHHHHHL


DSSP  LLEEEELhHHHHhlLLLLL--LHHHHHhlllEEEELLLLLLL-------LLLL-HHHHHH
Query GASIAHCpNSNLslSSGFL--NVLEVLkhevKIGLGTDVAGG-------YSYS-MLDAIR  337
ident |        |     ||     |         | | ||                      
Sbjct GYFFSIP-PSII--RSGQKqkLVKQLP--ltSICLETDSPALgpekqvrNEPWnISISAE  233
DSSP  LLEEEEL-HHHH--LLHHHhhHHHHLL--hhHEEELLLLLLLlllllllLLHHhHHHHHH


DSSP  HHHHHHhhhhhllllllLLLHHHHHHHHLHHHHHHLL-LLLLLlllllllllleeeelll
Query RAVMVSnillinkvnekSLTLKEVFRLATLGGSQALG-LDGEIgnfevgkefdailinpk  396
ident     |                 ||    |         |                     
Sbjct YIAQVK-----------GISVEEVIEVTTQNALKLFPkLRHLL-----------------  265
DSSP  HHHHHH-----------LLLHHHHHHHHHHHHHHHLLlHHHHL-----------------


DSSP  llllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query asdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                 
Sbjct ------------------------------------------------  265
DSSP  ------------------------------------------------


No 28: Query=2uz9A Sbjct=3k2gB Z-score=15.3

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------slselspchvrsgrixtv   18
DSSP  ------------------------------------------llllllllllllleeeel


DSSP  llllleeeeLEEEEEEEHHHhhhllllllllhhhhhhhlHHHH-----------------
Query lshheffmpGLVDTHIHASQysfagssidlpllewltkyTFPA-----------------  103
ident          |    | |                                           
Sbjct dgpipssalGHTLXHEHLQN-------------------DCRCwwnppqeperqylaeap   59
DSSP  leeeehhhlLLEELLLLLLE-------------------ELHHhllllllhhhhhhhhll


DSSP  -----------hhhhhlhhhhhHHHHHHHHHHHHLL---EEEEEEELLLlhhHHHHHHHH
Query -----------ehrfqnidfaeEVYTRVVRRTLKNG---TTTACYFATIhtdSSLLLADI  149
ident                                                             
Sbjct isieilselrqdpfvnkhnialDDLDLAIAEVKQFAavgGRSIVDPTCRgigRDPVKLRR  119
DSSP  llhhhhhhhhllhhhllllleeLLHHHHHHHHHHHHhllLLEEEELLLLlllLLHHHHHH


DSSP  HHHH-LLEEEEELEELLLLlllllLLLL------HHHHHHHHHHHHH-HHHHHLLlleEE
Query TDKF-GQRAFVGKVCMDLNdtfpeYKET------TEESIKETERFVS-EMLQKNYsrvKP  201
ident      |     |                            |                   
Sbjct ISAEtGVQVVXGAGYYLAS-----SXPEtaarlsADDIADEIVAEALeGTDGTDA--rIG  172
DSSP  HHHHhLLEEEELLLLLLHH-----HLLHhhhlllHHHHHHHHHHHHHlLLLLLLL--lLL


DSSP  EEEELLHH----hlLHHHHHHHHHHHHHHLLEEEEEELLLHhhhhhhhhhlllllLHHHH
Query IVTPRFSL----scSETLMGELGNIAKTRDLHIQSHISENRdeveavknlypsykNYTSV  257
ident                |              |    |                        
Sbjct LIGEIGVSsdftaeEEKSLRGAARAQVRTGLPLXVHLPGWF--------------RLAHR  218
DSSP  LEEEELLLllllhhHHHHHHHHHHHHHHHLLLEEELLLLLL--------------LLHHH


DSSP  HHHLL----llLLLEEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHL------LLLL
Query YDKNN----llTNKTVMAHGCYL--SAEELNVFHERGASIAHCPNSNLSL------SSGF  305
ident               ||  |                |||                      
Sbjct VLDLVeeegadLRHTVLCHXNPShxDPVYQATLAQRGAFLEFDXIGXDFFyadqgvQCPS  278
DSSP  HHHHHhhllllHHHEEELLLHHHllLHHHHHHHHHHLLEEEELLLLLLLEelllleELLL


DSSP  -----lLHHHHHHLLL--EEEELLLLL--------llLLLLhhHHHH-HHHHHHHhhhhl
Query -----lNVLEVLKHEV--KIGLGTDVA--------ggYSYSmlDAIR-RAVMVSNillin  349
ident         |    |     | |  ||             |                    
Sbjct ddevarAILGLADHGYldRILLSHDVFvkxxltryggNGYA--FVTKhFLPRLRR-----  331
DSSP  hhhhhhHHHHHHHLLLhhHEEELLLLLlhhhlhhhllLLLL--HHHHlHHHHHHH-----


DSSP  llllLLLLHHHHHHHHLHHHHHhLLLLLLllllllllllleeeelllllllllllllhhh
Query kvneKSLTLKEVFRLATLGGSQaLGLDGEignfevgkefdailinpkasdspidlfygdf  409
ident       |       |                                             
Sbjct ----HGLDDAALETLXVTNPRR-VFDASI-------------------------------  355
DSSP  ----LLLLHHHHHHHHLHHHHH-HHLLLL-------------------------------


DSSP  hlllllhhhhhhhhhllhhheeeeeelleeeelll
Query fgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                    
Sbjct --------------------------------egh  358
DSSP  --------------------------------lll


No 29: Query=2uz9A Sbjct=1bf6A Z-score=14.8

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeELEEEEEEEHHHhhhllllllllhhhhhhhlHHHH-hhhhhlhhhHHHHHHH
Query lshheffmPGLVDTHIHASQysfagssidlpllewltkyTFPA-ehrfqnidfAEEVYTR  119
ident          |    | |                                           
Sbjct ----sfdpTGYTLAHEHLHI-------------------DLSGfknnvdcrldQYAFICQ   37
DSSP  ----llllLLEEEEEELLLE-------------------ELHHhhllhhheelLHHHHHH


DSSP  HHHHHHHLLEEEEEEELLLL-hhHHHHHHHHHHHHLLEEEEELEELLLL-llllllllLH
Query VVRRTLKNGTTTACYFATIH-tdSSLLLADITDKFGQRAFVGKVCMDLN-dtfpeykeTT  177
ident         |                    |     |                        
Sbjct EMNDLMTRGVRNVIEMTNRYmgrNAQFMLDVMRETGINVVACTGYYQDAffpehvatrSV   97
DSSP  HHHHHHHLLEEEEEELLLHHhllLHHHHHHHHHHHLLEEEEEELLLLHHhlllhhhhlLH


DSSP  HHHHHHHHHHHHHHH-HHLLlleEEEEEeLLHH-----hLLHHHHHHHHHHHHHHLLEEE
Query EESIKETERFVSEML-QKNYsrvKPIVTpRFSL-----sCSETLMGELGNIAKTRDLHIQ  231
ident  |   |                   |               |                | 
Sbjct QELAQEMVDEIEQGIdGTEL--kAGIIAeIGTSegkitpLEEKVFIAAALAHNQTGRPIS  155
DSSP  HHHHHHHHHHHHLLLlLLLL--lEEEEEeEELLlllllhHHHHHHHHHHHHHHHHLLLEE


DSSP  EEELLlhhhhhhhhhhlllllLHHHHHHHLL----llLLLEEEEELL-LLLHHHHHHHHH
Query SHISEnrdeveavknlypsykNYTSVYDKNN----llTNKTVMAHGC-YLSAEELNVFHE  286
ident  | |                                        |               
Sbjct THTSF---------------sTMGLEQLALLqahgvdLSRVTVGHCDlKDNLDNILKMID  200
DSSP  EELHH---------------hLLHHHHHHHHhhllllHHHEEELLLLlLLLHHHHHHHHH


DSSP  HLLEEEELHHHhHHLLLLL----lLHHHHH-HLLL-EEEELLLLL--------llLLLLh
Query RGASIAHCPNSnLSLSSGF----lNVLEVL-KHEV-KIGLGTDVA--------ggYSYSm  332
ident  ||                                    |  |            | |  
Sbjct LGAYVQFDTIG-KNSYYPDekriaMLHALRdRGLLnRVMLSMDITrrshlkanggYGYD-  258
DSSP  LLLEEEELLLL-LLLLLLHhhhhhHHHHHHhLLLHhHEEELLLLLlhhhlhhhllLLLL-


DSSP  hHHHH-HHHHHHHhhhhlllllLLLLHHHHHHHHLHHHHHHLLlllllllllllllllee
Query lDAIR-RAVMVSNillinkvneKSLTLKEVFRLATLGGSQALGldgeignfevgkefdai  391
ident                              |        ||                    
Sbjct -YLLTtFIPQLRQ---------SGFSQADVDVMLRENPSQFFQ-----------------  291
DSSP  -HHHHlHHHHHHH---------LLLLHHHHHHHHLHHHHHHLL-----------------


DSSP  eelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query linpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                      
Sbjct -----------------------------------------------------  291
DSSP  -----------------------------------------------------


No 30: Query=2uz9A Sbjct=3gg7A Z-score=14.7

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeeLEEEEEEEHHHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHHHHH
Query lshheffmpGLVDTHIHASQYSfagssidlpllewltkytfpaehrfqnidfaeeVYTRV  120
ident           | | | |   |                                      |
Sbjct ---------SLIDFHVHLDLYP---------------------------------DPVAV   18
DSSP  ---------LLEEEEELHHHLL---------------------------------LHHHH


DSSP  HHHHHHLLEeEEEEELLLLHhHHHHHHHHHHhHLLEEEEELEE---LLLLllllllllLH
Query VRRTLKNGTtTACYFATIHTdSSLLLADITDkFGQRAFVGKVC---MDLNdtfpeykeTT  177
ident  |        |     |                                           
Sbjct ARACEERQL-TVLSVTTTPA-AWRGTLALAA-GRPHVWTALGFhpeVVSE--------RA   67
DSSP  HHHHHHLLL-EEEELLLLHH-HHHHHHHHHL-LLLLEEELLLLlhhHLLL--------LH


DSSP  HHHhHHHHHHHHHhhhhlllleEEEEEELLHH---------hlLHHHHHHHHHHHHHH-L
Query EESiKETERFVSEmlqknysrvKPIVTPRFSL---------scSETLMGELGNIAKTR-D  227
ident         |   |            |                                  
Sbjct ADL-PWFDRYLPE---------TRFVGEVGLDgspslrgtwtqQFAVFQHILRRCEDHgG  117
DSSP  HHL-HHHHHHHHH---------LLEEEEEELLllhhhhhhhhhHHHHHHHHHHHHHHLlL


DSSP  LEEEEEELllhhhhhhhhhhlllllLHHHHHHHLL---llllLEEEEELlLLLHHHHHHH
Query LHIQSHISenrdeveavknlypsykNYTSVYDKNN---lltnKTVMAHGcYLSAEELNVF  284
ident      |                      |                       |  ||   
Sbjct RILSIHSR-----------------RAESEVLNCLeanprsgTPILHWY-SGSVTELRRA  159
DSSP  EEEEEELL-----------------LLHHHHHHHHhhlhhheEEEEELL-LLLHHHHHHH


DSSP  HHHLLEEEELhHHHHhllLLLL--LHHHHHhlllEEEELLLLLLL------LLLL-HHHH
Query HERGASIAHCpNSNLslsSGFL--NVLEVLkhevKIGLGTDVAGG------YSYS-MLDA  335
ident    |                                   ||                   
Sbjct ISLGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETDGPFLeldgqaALPWdVKSV  214
DSSP  HHLLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLLLLLLeelleeLLHHhHHHH


DSSP  HHHHHHHHhhhhhllllllLLLHHHHHHHHLHHhHHHLLLlllllllllllllleeeell
Query IRRAVMVSnillinkvnekSLTLKEVFRLATLGgSQALGLdgeignfevgkefdailinp  395
ident                         || |         |                      
Sbjct VEGLSKIW-----------QIPASEVERIVKEN-VSRLLG--------------------  242
DSSP  HHHHHHHH-----------LLLHHHHHHHHHHH-HHHHHH--------------------


DSSP  lllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query kasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                  
Sbjct ------------------------------------------------t  243
DSSP  ------------------------------------------------l


No 31: Query=2uz9A Sbjct=2ob3A Z-score=14.6

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------drintv    6
DSSP  ------------------------------------------------------lleeel


DSSP  llllleeeeLEEEEEEEHHHhhhllllllllhhhhhhhlhhhHHHHHH-------LHHHH
Query lshheffmpGLVDTHIHASQysfagssidlpllewltkytfpAEHRFQ-------NIDFA  113
ident          |   || |                                           
Sbjct rgpitiseaGFTLTHEHICG---------------------sSAGFLRawpeffgSRKAL   45
DSSP  leeelhhhhLLEEEEELLEE---------------------lLLLHHHhlhhhhlLHHHH


DSSP  HHHHHHHHHHHHHLLEEEEEEELLL-lhhHHHHHHHHHHHHLLEEEEELEEL-lLLLLll
Query EEVYTRVVRRTLKNGTTTACYFATI-htdSSLLLADITDKFGQRAFVGKVCM-dLNDTfp  171
ident  |   |  ||    |  |     |        |||                         
Sbjct AEKAVRGLRRARAAGVRTIVDVSTFdigrDVSLLAEVSRAADVHIVAATGLWfdPPLS--  103
DSSP  HHHHHHHHHHHHHLLLLEEEELLLHhhllLHHHHHHHHHHHLLEEELEEELLllLLHH--


DSSP  lllLLHHHHHHHHHHHHHHHH-HHLLlleEEEEEeLLHH----hlLHHHHHHHHHHHHHH
Query eykETTEESIKETERFVSEML-QKNYsrvKPIVTpRFSL----scSETLMGELGNIAKTR  226
ident       ||      |                |              |             
Sbjct mrlRSVEELTQFFLREIQYGIeDTGI--rAGIIX-VATTgkatpfQELVLKAAARASLAT  160
DSSP  hhlLLHHHHHHHHHHHHHLLLlLLLL--lLLEEE-EELLllllhhHHHHHHHHHHHHHHH


DSSP  LLEEEEEELLLhhhhhhhhhhlllllLHHHHHHHLL----llLLLEEEEELL-LLLHHHH
Query DLHIQSHISENrdeveavknlypsykNYTSVYDKNN----llTNKTVMAHGC-YLSAEEL  281
ident       |                                          |         |
Sbjct GVPVTTHTAAS--------------qRDGEQQAAIFeseglsPSRVCIGHSDdTDDLSYL  206
DSSP  LLLEEEELLHH--------------hLHHHHHHHHHhhllllHHHEEELLHHhLLLHHHH


DSSP  HHHHHHLLEEEE-LHHH------------hhHLLL---LLLL-HHHHHHLLL--EEEELL
Query NVFHERGASIAH-CPNS------------nlSLSS---GFLN-VLEVLKHEV--KIGLGT  322
ident      ||  |                                             |    
Sbjct TALAARGYLIGLdHIPYsaiglednasasalLGIRswqTRALlIKALIDQGYmkQILVSN  266
DSSP  HHHHHLLLEEEElLLLLllllllllhhhhhhHLLLlhhHHHHhHHHHHHLLLhhHEEELL


DSSP  LLL-----------------llLLLLhhHHHH-HHHHHHHhhhhlllllLLLLHHHHHHH
Query DVA-----------------ggYSYSmlDAIR-RAVMVSNillinkvneKSLTLKEVFRL  364
ident |                                                |          
Sbjct DWTfgfssyvtnimdvmdrvnpDGMA--FIPLrVIPFLRE---------KGVPQETLAGI  315
DSSP  LLLleellllllhhhhhhhhllLHHH--HHHHlHHHHHHH---------LLLLHHHHHHH


DSSP  HLHHHHHHLLllllllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhh
Query ATLGGSQALGldgeignfevgkefdailinpkasdspidlfygdffgdiseaviqkflyl  424
ident         |                                                   
Sbjct TVTNPARFLS--------------------------------------------------  325
DSSP  HLHHHHHHHL--------------------------------------------------


DSSP  llhhheeeeeelleeeelll
Query gddrnieevyvggkqvvpfs  444
ident                     
Sbjct ----------------ptlr  329
DSSP  ----------------llll


No 32: Query=2uz9A Sbjct=3cjpA Z-score=13.7

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeeLEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhhhhHHHHHH
Query lshheffmpGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidfaeEVYTRV  120
ident             | | |                                           
Sbjct ---------LIIDGHTHVI-----------------------------------LPVEKH   16
DSSP  ---------LLEEEEEELL-----------------------------------LLHHHH


DSSP  HHHHHHLLEEEEEEELL---------------------------------lLHHHHHHHH
Query VRRTLKNGTTTACYFAT---------------------------------iHTDSSLLLA  147
ident        |      | |                                     |   | 
Sbjct IKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngktnsmidvRRNSIKELT   76
DSSP  HHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlllllllhhhHHHHHHHHH


DSSP  HHHHHHLLEEEEELEELLlllllllllLLHHHHHHHHHHHHHHHHhhlllleEEEEEELL
Query DITDKFGQRAFVGKVCMDlndtfpeykETTEESIKETERFVSEMLqknysrvKPIVTPRF  207
ident         |                            |                      
Sbjct NVIQAYPSRYVGFGNVPV--------gLSENDTNSYIEENIVNNK-------LVGIGELT  121
DSSP  HHHHHLLLLEEEEELLLL--------lLLHHHHHHHHHHHLLLLL-------LLEEEEEL


DSSP  HH-hlLHHHhHHHHHHHHHH-LLEEEEEELllhHHHHhhhhhllllLLHHHHHHHLL--l
Query SL-scSETLmGELGNIAKTR-DLHIQSHISenrDEVEavknlypsyKNYTSVYDKNN--l  263
ident         |             | |  |                                
Sbjct PAsgqIKSL-KPIFKYSMDSgSLPIWIHAF---NPLV---------LQDIKEIAELCkaf  168
DSSP  LLlllHHHH-HHHHHHHHHLlLLLEEELLL---LLLL---------HHHHHHHHHHHhhl


DSSP  lLLLEEEEEL-LLLLHHHHHHHHHH-LLEEEELhhHHHHlllLLLL--HHHHHhlllEEE
Query lTNKTVMAHG-CYLSAEELNVFHER-GASIAHCpnSNLSlssGFLN--VLEVLkhevKIG  319
ident         |              |              |     |     |      |  
Sbjct pKVPVILGHMgGSNWMTAVELAKEIqNLYLDTS--AYFS--tFVLKivINELP---lKCI  221
DSSP  lLLLEEEHHHhHHHHHHHHHHHHHLlLEEEELL--LLLL--hHHHHhhHHHLL---lLEE


DSSP  ELLLLLLlLLLLhhHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHhLLLLlll
Query LGTDVAGgYSYSmlDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQaLGLDgei  379
ident  |||            |      |                          |  |      
Sbjct FGTDMPF-GDLQ--LSIEAIKKMS------------NDSYVANAVLGDNISR-LLNI---  262
DSSP  LLLLLLL-LLHH--HHHHHHHHHL------------LLHHHHHHHHLHHHHH-HHLL---


DSSP  lllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeellee
Query gnfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkq  439
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  eelll
Query vvpfs  444
ident      
Sbjct -----  262
DSSP  -----


No 33: Query=2uz9A Sbjct=2vc5A Z-score=13.7

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct -----------------------------------------------------mriplvg    7
DSSP  -----------------------------------------------------lllllll


DSSP  llllleeeeLEEEEEEEHHHhhhllllllllhhhhhhhlHHHH----hhhhhLHHHHHHH
Query lshheffmpGLVDTHIHASQysfagssidlpllewltkyTFPA----ehrfqNIDFAEEV  116
ident          |    | |                         |         | |     
Sbjct kdsieskdiGFTLIHEHLRV-------------------FSEAvrqqwphlyNEDEEFRN   48
DSSP  lllllhhhlLLEELLLLLLL-------------------LLHHhhhhlhhhlLHHHHHHH


DSSP  HHHHHHHHHHLLEEEEEEELLL-lhhHHHHHHHHHHHHLLEEEEELEEL---LLLLllll
Query YTRVVRRTLKNGTTTACYFATI-htdSSLLLADITDKFGQRAFVGKVCM---DLNDtfpe  172
ident     | |    |  |                       |     |       ||      
Sbjct AVNEVKRAMQFGVKTIVDPTVMglgrDIRFMEKVVKATGINLVAGTGIYiyiDLPF--yf  106
DSSP  HHHHHHHHHHLLLLEEEELLLLllllLHHHHHHHHHLLLLEEEELEELLlllLLLH--hh


DSSP  llllHHHHHHHHHHHHHHHH-HHLLlleEEEEEeLLHH-----hLLHHHHHHHHHHHHHH
Query yketTEESIKETERFVSEML-QKNYsrvKPIVTpRFSL-----sCSETLMGELGNIAKTR  226
ident       |          |             |              |          |  
Sbjct lnrsIDEIADLFIHDIKEGIqGTLN--kAGFVX-IAADepgitkDVEKVIRAAAIANKET  163
DSSP  llllHHHHHHHHHHHHHLLLlLLLL--lLLLEE-EELLlllllhHHHHHHHHHHHHHHHH


DSSP  LLEEEEEELLlhhhhhhhhhhllllLLHHHHHHHLL----llLLLEEEEEL-LLLLHHHH
Query DLHIQSHISEnrdeveavknlypsyKNYTSVYDKNN----llTNKTVMAHG-CYLSAEEL  281
ident    |  |                   |                 |    |          
Sbjct KVPIITHSNA--------------hNNTGLEQQRILteegvdPGKILIGHLgDTDNIDYI  209
DSSP  LLLEEEELLL--------------lLLHHHHHHHHHhhllllHHHEEELLHhHLLLHHHH


DSSP  HHHHHHLLEEEE-LHHHhhhLLLL-----LLLHHHH-HHLL-lEEEELLLLL--------
Query NVFHERGASIAH-CPNSnlsLSSG-----FLNVLEV-LKHE-vKIGLGTDVA--------  325
ident       |  |                       |         ||    |          
Sbjct KKIADKGSFIGLdRYGL---DLFLpvdkrNETTLRLiKDGYsdKIMISHDYCctidwgta  266
DSSP  HHHHHLLLEEEElLLLL---LLLLlhhhhHHHHHHHhHLLLllLEEELLLLLllllllll


DSSP  ---------llLLLLhhHHHHHHHHHHHHhhhlllllLLLLHHHHHHHHLHHhHHHLLLl
Query ---------ggYSYSmlDAIRRAVMVSNIllinkvneKSLTLKEVFRLATLGgSQALGLd  376
ident             |                                               
Sbjct kpeykpklaprWSIT--LIFEDTIPFLKR--------NGVNEEVIATIFKEN-PKKFFS-  314
DSSP  lhhhhhhhlllLLLL--HHHHLHHHHHHL--------LLLLHHHHHHHHLHH-HHHHLL-


DSSP  llllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeel
Query geignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvg  436
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  leeeelll
Query gkqvvpfs  444
ident         
Sbjct --------  314
DSSP  --------


No 34: Query=2uz9A Sbjct=3pnuA Z-score=13.5

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ---------------------------------------------------------enl    3
DSSP  ---------------------------------------------------------lll


DSSP  LLLL-LEEEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhhHHHHHHH
Query LSHH-EFFMPGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidfAEEVYTR  119
ident              | | |                                          
Sbjct YFQSnAMKLKNPLDMHLHLR---------------------------------DNQMLEL   30
DSSP  LLLLlLEEEELLEEEEELLL---------------------------------LHHHHHH


DSSP  HHHHHHHlLEEEEEEEL-----LLLHHHHHHHHHHHHHHL----LEEEEELEELLlllll
Query VVRRTLKnGTTTACYFA-----TIHTDSSLLLADITDKFG----QRAFVGKVCMDlndtf  170
ident             |                        |                      
Sbjct IAPLSAR-DFCAAVIMPnlippLCNLEDLKAYKMRILKACkdenFTPLMTLFFKN-----   84
DSSP  HHHHHHL-LLLEEEELLlllllLLLHHHHHHHHHHHHHHHllllLEEEEEEELLL-----


DSSP  llllllhhhHHHHHHHHHHHhhhhlllleEEEEEeLLHH--------HLLH---HHHHHH
Query peyketteeSIKETERFVSEmlqknysrvKPIVTpRFSL--------SCSE---TLMGEL  219
ident            |       |                             |          
Sbjct --------yDEKFLYSAKDE---------IFGIX-LYPAgittnsngGVSSfdiEYLKPT  126
DSSP  --------lLHHHHHHHLLL---------LLEEE-ELLLllllllllLLLLllhHHHHHH


DSSP  HHHHHHHLLEEEEEEL---llHHHHHHHhhhlllllLHHHHHHHLLllllLEEEEELLLL
Query GNIAKTRDLHIQSHIS---enRDEVEAVknlypsykNYTSVYDKNNlltnKTVMAHGCYL  276
ident              |        |                    |      | || |    
Sbjct LEAMSDLNIPLLVHGEtndfvMDRESNF-------aKIYEKLAKHF-prlKIVMEHITTK  178
DSSP  HHHHHHLLLLEEELLLllllhHHLLHHH-------hHHHHHHHHHL-lllLEEELLLLLH


DSSP  L-hHHHHHhhHHLLEEEELHHHHH---------------HLLLLL-------lLHHHhhh
Query S-aEELNVfhERGASIAHCPNSNL---------------SLSSGF-------lNVLEvlk  313
ident    | |                                                      
Sbjct TlcELLKD--YENLYATITLHHLIitlddviggkmnphlFCKPIAkryedkeaLCELafs  236
DSSP  HhhHHHHH--LLLEEEEELLHHHLllhhhhhlllllhhhLLLLLLllhhhhhhHHHHhhl


DSSP  lLLEEEELLLLL--------LLLLLL-HHHHHHhhhhhhhhhhhllllllLLLHHHHHHH
Query hEVKIGLGTDVA--------GGYSYS-MLDAIRravmvsnillinkvnekSLTLKEVFRL  364
ident    |   | | |        |  |    |                               
Sbjct gYEKVMFGSDSAphpkgcaaGVFSAPvILPVLA------------elfkqNSSEENLQKF  284
DSSP  lLLLEEELLLLLllllllllLLLLHHhHHHHHH------------hhhhhHLLHHHHHHH


DSSP  HLHHHHHHlLLLLLlllllllLLLLEEEELLllllLLLL--lllhhhhlllllhhhhhhh
Query ATLGGSQAlGLDGEignfevgKEFDAILINPkasdSPID--lfygdffgdiseaviqkfl  422
ident                      ||                                     
Sbjct LSDNTCKI-YDLKF-------KEDKILTLEE----KEWQvpnvyedkynqvvpymageil  332
DSSP  HLHHHHHH-HLLLL-------LLLLEEEEEL----LLEElllleelllleelllllllee


DSSP  hHLLHHheeeeeelleeeelll
Query yLGDDRnieevyvggkqvvpfs  444
ident                       
Sbjct kFQLKH----------------  338
DSSP  lLEELL----------------


No 35: Query=2uz9A Sbjct=3irsA Z-score=12.9

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeELEEEEEEEHH--------HHHH--lLLLLLLLhhhhhhhlhhhhhhhhhlh
Query lshheffmPGLVDTHIHAS--------QYSF--aGSSIDLPllewltkytfpaehrfqni  110
ident             |               |                               
Sbjct --------LKIIDFRLRPPamgflnarIYTRpdiRNRFTRQ------------lgfepap   40
DSSP  --------LLLEELLLLLLlhhhhhlhHHHLhhhHHHHHHH------------hlllllh


DSSP  hhhhHHHHHHHHHHHHLLEEEEEEELLL-------LHHHHHHHHHHHHhhlLEEEEELEE
Query dfaeEVYTRVVRRTLKNGTTTACYFATI-------HTDSSLLLADITDkfgQRAFVGKVC  163
ident                  |                         |                
Sbjct saeeKSLELMFEEMAAAGIEQGVCVGRNssvlgsvSNADVAAVAKAYP---DKFHPVGSI   97
DSSP  hhhhLLHHHHHHHHHHLLLLEEEEELLEellleelLHHHHHHHHHHLL---LLEEEEEEL


DSSP  LLlllllllllLLHHHHHHHHHHHHHHHhhhlllleEEEEEElLHHHL-------LHHHh
Query MDlndtfpeykETTEESIKETERFVSEMlqknysrvKPIVTPrFSLSC-------SETLm  216
ident             |  |                      ||                  | 
Sbjct EA---------ATRKEAMAQMQEILDLG--------IRIVNL-EPGVWatpmhvdDRRL-  138
DSSP  LL---------LLHHHHHHHHHHHHHLL--------LLLEEE-LHHHLlllllllLHHH-


DSSP  HHHHHHHHHHLLEEEEEELLL----HHHHHhhhhhlllllLHHHHHHHLLllllLEEEEE
Query GELGNIAKTRDLHIQSHISEN----RDEVEavknlypsykNYTSVYDKNNlltnKTVMAH  272
ident   |                 |                                   |  |
Sbjct YPLYAFCEDNGIPVIMMTGGNagpdITYTN---------pEHIDRVLGDF-pdlTVVSSH  188
DSSP  HHHHHHHHHLLLLEEEELLLLllllHHHHL---------hHHHHHHHHHL-lllLEEEEH


DSSP  L-LLLLHHHHHHHHHHL-LEEEELhHHHHhlllLLLLhHHHHHL-----llEEEELLLLL
Query G-CYLSAEELNVFHERG-ASIAHCpNSNLslssGFLNvLEVLKH-----evKIGLGTDVA  325
ident |      |   |   |                                       ||   
Sbjct GnWPWVQEIIHVAFRRPnLYLSPD-MYLY---nLPGH-ADFIQAansfladRMLFGTAYP  243
DSSP  HhLLLHHHHHHHHHHLLlEEEELH-HHHL---lLLLH-HHHHHHhllhhhhLLLLLLLLL


DSSP  LlLLLLhHHHHHHHHHhhhhhhhllllllLLLHHHHHHHHLHHHHHhlLLLLllllllll
Query GgYSYSmLDAIRRAVMvsnillinkvnekSLTLKEVFRLATLGGSQalGLDGeignfevg  385
ident                                                  |          
Sbjct M-CPLK-EYTEWFLTL-------------PIKPDAMEKILHGNAER--LLAQ--------  278
DSSP  L-LLHH-HHHHHHHLL-------------LLLHHHHHHHHLHHHHH--HHHH--------


DSSP  lllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query kefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                            
Sbjct --------------------------------------------------------agr  281
DSSP  --------------------------------------------------------lll


No 36: Query=2uz9A Sbjct=2dvtA Z-score=12.8

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhHHHH----------hlh
Query lshheffMPGLVDTHIHASqysfagssidlpllewltkytfpaEHRF----------qni  110
ident        | | |    |                                           
Sbjct -------MQGKVALEEHFA------------------------IPETlqdsagfvpgdyw   29
DSSP  -------LLLEEEEEEEEL------------------------LHHHhhhhlllllllhh


DSSP  hhhhHHHHHHHHHHHHLL----EEEEEEEL---------------llLHHHHHHHHHHHH
Query dfaeEVYTRVVRRTLKNG----TTTACYFA---------------tiHTDSSLLLADITD  151
ident               ||        |                             ||    
Sbjct kelqHRLLDIQDTRLKLMdahgIETMILSLnapavqaipdrrkaieiARRANDVLAEECA   89
DSSP  hhhhHHHHLLLLHHHHHHhhllEEEEEEEElllhhhhlllhhhhhhhHHHHHHHHHHHHH


DSSP  HHLLEEEEELEELLlllllllllLLHHHHHHHHHHHHHHHHhhlllleEEEEEeLLHHH-
Query KFGQRAFVGKVCMDlndtfpeykETTEESIKETERFVSEMLqknysrvKPIVTpRFSLS-  210
ident |   |                          |  | |                     | 
Sbjct KRPDRFLAFAALPL---------QDPDAATEELQRCVNDLG-------FVGAL-VNGFSq  132
DSSP  HLLLLEEEEELLLL---------LLHHHHHHHHHHHHHLLL-------LLEEE-EELLLl


DSSP  ----------lLHHHhHHHHHHHHHHLLEEEEEE------------------llLHHHHH
Query ----------cSETLmGELGNIAKTRDLHIQSHI------------------seNRDEVE  242
ident                           |     |                           
Sbjct egdgqtplyydLPQY-RPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgpTWAFAQ  191
DSSP  lllllllllllLHHH-HHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhHLHHHH


DSSP  HhhhhlllllLHHHHHHH----llllLLLEEEEE-LLLLLHHH-----------------
Query AvknlypsykNYTSVYDK----nnllTNKTVMAH-GCYLSAEE-----------------  280
ident                                  | |  |                     
Sbjct E-------taVHALRLMAsglfdehpRLNIILGHmGEGLPYMMwridhrnawvklppryp  244
DSSP  H-------hhHHHHHHHHllhhhhllLLLEEELHhHLLHHHHHhhhhhllllllllllll


DSSP  -----hHHHHHHlLEEEELhhHHHHllllllLHHHHHHLLL--EEEELLLLLLLLLllhH
Query -----lNVFHERgASIAHCpnSNLSlssgflNVLEVLKHEV--KIGLGTDVAGGYSysmL  333
ident         | |    |      |                     |   ||          
Sbjct akrrfmDYFNEN-FHITTS--GNFR----tqTLIDAILEIGadRILFSTDWPFENI---D  294
DSSP  llllhhHHHHHH-EEEELL--LLLL----hhHHHHHHLLLLhhHEELLLLLLLLLH---H


DSSP  HHHHHHHHHhhhhhhllllllLLLHHHHHHHHLHHHHHhLLLLLlllllllllllleeee
Query DAIRRAVMVsnillinkvnekSLTLKEVFRLATLGGSQaLGLDGeignfevgkefdaili  393
ident  |                   |                 |                    
Sbjct HASDWFNAT------------SIAEADRVKIGRTNARR-LFKLD----------------  325
DSSP  HHHHHHHHL------------LLLHHHHHHHHLHHHHH-HLLLL----------------


DSSP  lllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query npkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                    
Sbjct ---------------------------------------------------  325
DSSP  ---------------------------------------------------


No 37: Query=2uz9A Sbjct=4qrnA Z-score=12.7

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct -------------------------------------------------------smtqd    5
DSSP  -------------------------------------------------------lllll


DSSP  llllleEEELEEEEEEEHH--------hhhhllllllllhhHHHHHLhhhhhhhhhlhhh
Query lshhefFMPGLVDTHIHAS--------qysfagssidlpllEWLTKYtfpaehrfqnidf  112
ident              |                                |             
Sbjct lktggeQGYLRIATEEAFAtreiidvylrmirdgtadkgmvSLWGFYaqspseratqile   65
DSSP  llllllLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhHHHHHHhhlllhhhhhhhh


DSSP  hhHHHH-HHHHHHHHLLEEEEEEEL---------------llLHHHHHHHHHHHHHHLLE
Query aeEVYT-RVVRRTLKNGTTTACYFA---------------tiHTDSSLLLADITDKFGQR  156
ident        |        |   |                      |     |||   |   |
Sbjct rlLDLGeRRIADMDATGIDKAILALtspgvqplhdldeartlATRANDTLADACQKYPDR  125
DSSP  hhHLLLhHHHHHHHHLLLLEEEEEEllllllllllhhhhhhhHHHHHHHHHHHHHHLLLL


DSSP  EEEELEELLlllllllllLLHHHHHHHHHHHHHHHHhhlllleEEEEEElLHHH-----l
Query AFVGKVCMDlndtfpeykETTEESIKETERFVSEMLqknysrvKPIVTPrFSLS-----c  211
ident                      | |  |  |   |                 |        
Sbjct FIGMGTVAP---------QDPEWSAREIHRGARELG-------FKGIQI-NSHTqgryld  168
DSSP  EEELLLLLL---------LLHHHHHHHHHHHHHLLL-------LLLEEE-LLLLllllll


DSSP  LHHHhHHHHHHHHHHLLEEEEEE-----------------llLHHHHHHhhhhlllllLH
Query SETLmGELGNIAKTRDLHIQSHI-----------------seNRDEVEAvknlypsykNY  254
ident  |             |     |                                      
Sbjct EEFF-DPIFRALVEVDQPLYIHPatspdsmidpmleagldgaIFGFGVE-------tgMH  220
DSSP  LHHH-HHHHHHHHHHLLLEEELLllllllllhhhhhhlllllLLHHHHH-------hhHH


DSSP  HHHHHH----llllLLLEEEEE-LLLLLHHH--------------------------hHH
Query TSVYDK----nnllTNKTVMAH-GCYLSAEE--------------------------lNV  283
ident                      | |  |                                 
Sbjct LLRLITigifdkypSLQIMVGHmGEALPYWLyrldymhqagvrsqryermkplkktieGY  280
DSSP  HHHHHHhlhhhhllLLLEEELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhhHH


DSSP  HHHHlLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLLLLLllhHHHHHHHHH
Query FHERgASIAHCPNsnlslssgflNVLEVLKHEV--KIGLGTDVAGGYSysmLDAIRRAVM  341
ident                                          |    |     |  |    
Sbjct LKSN-VLVTNSGV------awepAIKFCQQVMGedRVMYAMDYPYQYV---ADEVRAMDA  330
DSSP  HHHL-EEEELLLL------llhhHHHHHHHHHLhhHEELLLLLLLLLL---HHHHHHHHL


DSSP  hhhhhhhllllllLLLHHHHHHHHLHHHHHHLLLlllllllllllllleeeellllllll
Query vsnillinkvnekSLTLKEVFRLATLGGSQALGLdgeignfevgkefdailinpkasdsp  401
ident                                  |                          
Sbjct ------------mDMSAQTKKKFFQTNAEKWFKL--------------------------  352
DSSP  ------------lLLLHHHHHHHHLHHHHHHLLL--------------------------


DSSP  lllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query idlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                            
Sbjct -------------------------------------------  352
DSSP  -------------------------------------------


No 38: Query=2uz9A Sbjct=4dlfA Z-score=12.6

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhhhlhHHHHHhhhlhhhhhhhhhHH
Query lshheffmPGLVDTHIHASqysfagssidlpllewltkytFPAEHrfqnidfaeevytRV  120
ident             | | |                                           
Sbjct --------ALRIDSHQHFW------------------ryrAADYP-wigagmgvlardYL   33
DSSP  --------LLLEEEEELLL------------------lllHHHLL-llllllhhhlllLL


DSSP  HHHHHHLL----EEEEEEEL-LLLHHHHHHHHHHHHHHL-LEEEEELeelllllllllll
Query VRRTLKNG----TTTACYFA-TIHTDSSLLLADITDKFG-QRAFVGKvcmdlndtfpeyk  174
ident                          |    |           | ||              
Sbjct PDALHPLMhaqaLGASIAVQaRAGRDETAFLLELACDEArIAAVVGW-------------   80
DSSP  HHHHHHHHhhllLLEEEEELlLLLHHHHHHHHHHHLLLLlEEEEEEL-------------


DSSP  llhhhHHHHhHHHHHHHHhhllLLEEEEEEELLHHH-----LLHH-HHHHHHHHHHHHLL
Query etteeSIKEtERFVSEMLqknySRVKPIVTPRFSLS-----CSET-LMGELGNIAKTRDL  228
ident              | |                                          | 
Sbjct -edlrAPQL-AERVAEWR----GTKLRGFRHQLQDEadvraFVDDaDFARGVAWLQANDY  134
DSSP  -llllLLLH-HHHHHLLL----LLLEEEEEELHHHLllhhhHHHLhHHHHHHHHHHHLLL


DSSP  EEEEEELllhhhhhhhhhhlllllLHHHHHHHLL--lllLLEEEE-ELLL----------
Query HIQSHISenrdeveavknlypsykNYTSVYDKNN--lltNKTVMA-HGCY----------  275
ident                                           |    |            
Sbjct VYDVLVF----------------eRQLPDVQAFCarhdaHWLVLDhAGKPalaefdrddt  178
DSSP  EEEELLL----------------hHHHHHHHHHHhhlllLLEEEHhHHLLlhhhllllll


DSSP  ---lLHHHHHHHHHH-LLEEEELhhHHHHLL------------lLLLLHHHHHHLL--lE
Query ---lSAEELNVFHER-GASIAHCpnSNLSLS------------sGFLNVLEVLKHE--vK  317
ident         |                                           |       
Sbjct alarWRAALRELAALpHVVCKLS--GLVTEAdwrrglrasdlrhIEQCLDAALDAFgpqR  236
DSSP  hhhhHHHHHHHHHLLlLEEEEEL--LLLLLLlllllllhhhhhhHHHHHHHHHHHHlhhH


DSSP  EEELLLLLLLL-lllhHHHHHHHHHHHHhhhhlllllLLLLHHHHHHHHLHHHHHhLLLL
Query IGLGTDVAGGY-sysmLDAIRRAVMVSNillinkvneKSLTLKEVFRLATLGGSQaLGLD  376
ident    | |                                 |   |   |            
Sbjct LMFGSDWPVCLlaasyDEVASLVERWAE---------SRLSAAERSALWGGTAAR-CYAL  286
DSSP  EEELLLLLHHHhlllhHHHHHHHHHHHH---------HHLLHHHHHHHLLHHHHH-HLLL


DSSP  Llllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeel
Query Geignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvg  436
ident                                                             
Sbjct P-----------------------------------------------------------  287
DSSP  L-----------------------------------------------------------


DSSP  leeeelll
Query gkqvvpfs  444
ident         
Sbjct --------  287
DSSP  --------


No 39: Query=2uz9A Sbjct=4mupB Z-score=12.6

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct -----------------------------------------------------lvrklsg    7
DSSP  -----------------------------------------------------lllllll


DSSP  llllleeEELEEEEEEEHHhhhhllllllllhhhhhhhlHHHHHhhhhlhhhhhHHHHHH
Query lshheffMPGLVDTHIHASqysfagssidlpllewltkyTFPAEhrfqnidfaeEVYTRV  120
ident          | |||  |                                           
Sbjct tapnpafPRGAVDTQMHMY-----------lpgypalpgGPGLP------pgalPGPEDY   50
DSSP  lllllllLLLLEELLLLLL-----------lllllllllLLLLL------llllLLHHHH


DSSP  HHHHHHLLEEEEEEELL----LLHHHHHHHHHHHHhhlLEEEEELEElllllllllllll
Query VRRTLKNGTTTACYFAT----IHTDSSLLLADITDkfgQRAFVGKVCmdlndtfpeyket  176
ident  |     |                   |            |                   
Sbjct RRLMQWLGIDRVIITQGnahqRDNGNTLACVAEMG---EAAHAVVII-------------   94
DSSP  HHHHHHHLLLEEEEELLhhhlLLLHHHHHHHHHHH---HHEEEEELL-------------


DSSP  hhhHHHHhHHHHHHHHHHlllleEEEEEELLHH----HLLHhHHHHHHHHHHHHLLEEEE
Query teeSIKEtERFVSEMLQKnysrvKPIVTPRFSL----SCSEtLMGELGNIAKTRDLHIQS  232
ident         |                       |                 |   |     
Sbjct ---DATTtEKDMEKLTAA-----GTVGARIMDLpggaVNLS-ELDAVDERAHAADWMVAV  145
DSSP  ---LLLLlHHHHHHHHHL-----LEEEEEEELLllllLLHH-HHHHHHHHHHHLLLEEEE


DSSP  EElllhhHHHHhhhhllllLLHHHHHHHLLLlllLEEEEELL----------llLHHHHH
Query HIsenrdEVEAvknlypsyKNYTSVYDKNNLltnKTVMAHGC----------ylSAEELN  282
ident                            |        |  |               |  | 
Sbjct QF-----DGNG-------lLDHLPRLQKIRS---RWVFDHHGkffkgirtdgpeMAALLK  190
DSSP  EL-----LHHH-------hHHHHHHHHLLLL---EEEELHHHhlllllllllhhHHHHHH


DSSP  HHHHHLLEEEELhhHHHHLL-------lLLLLHHHHHHLL-lEEEELLLLLL--------
Query VFHERGASIAHCpnSNLSLS-------sGFLNVLEVLKHE-vKIGLGTDVAG--------  326
ident                    |                  |    |  ||            
Sbjct LIDRGNLWFKFA--GVYESSrkswpyadVAAFSRVIAAHApeRIVWGTNWPHnsvretaa  248
DSSP  HHHHLLEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLhhHEEELLLLLLlllllhhh


DSSP  lLLLLhhHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHhLLLLLLLlllllll
Query gYSYSmlDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQaLGLDGEIgnfevgk  386
ident                                     |         |             
Sbjct yPDDA--RLAELTLGWL------------PDEAARHRALVENPEA-LFKLSPV-------  286
DSSP  lLLHH--HHHHHHHLLL------------LLHHHHHHHHLHHHHH-HHLLLLL-------


DSSP  llleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query efdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                           
Sbjct ----------------------------------------------------------  286
DSSP  ----------------------------------------------------------


No 40: Query=2uz9A Sbjct=2ffiA Z-score=12.2

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhHHLHHHHhhhhhlhhhhhhHHHHH
Query lshheffmPGLVDTHIHASqysfagssidlpllewlTKYTFPAehrfqnidfaeeVYTRV  120
ident             | | |                     |                     
Sbjct ------lhLTAIDSHAHVF--------srglnlasqRRYAPNY----------daPLGDY   36
DSSP  ------llLLLEELLLLLL--------lhhhhhhllLLLLLLL----------llLHHHH


DSSP  HHHHHHLLEEEEEEELL----LLHHHHHHHHHHHHhhlLEEEEELEElllllllllllll
Query VRRTLKNGTTTACYFAT----IHTDSSLLLADITDkfgQRAFVGKVCmdlndtfpeyket  176
ident        |                   |                                
Sbjct LGQLRAHGFSHGVLVQPsflgTDNRYLLSALQTVP---GQLRGVVXL-------------   80
DSSP  HHHHHHLLLLEELLLLLhhhlLLLHHHHHHHHHLL---LLLLLLLLL-------------


DSSP  hhhHHHHhHHHHHHHHHhllllEEEEEEELLHHH-----lLHHHhHHHHHHHHHHLLEEE
Query teeSIKEtERFVSEMLQknysrVKPIVTPRFSLS-----cSETLmGELGNIAKTRDLHIQ  231
ident              |            |                    |         |  
Sbjct ---ERDVeQATLAEXAR----lGVRGVRLNLXGQdxpdltGAQW-RPLLERIGEQGWHVE  132
DSSP  ---LLLLlHHHHHHHHL----lLLLEEELLLLLLllllllLLLL-HHHHHHHHHHLLEEE


DSSP  EEELllhhhhhhhhhhlllllLHHHHHHHLLlllLLEEEE-ELLL---------LLHHHH
Query SHISenrdeveavknlypsykNYTSVYDKNNlltNKTVMA-HGCY---------LSAEEL  281
ident  |                                   |    |             || |
Sbjct LHRQ---------------vaDIPVLVRALQpygLDIVIDhFGRPdarrglgqpGFAELL  177
DSSP  ELLL---------------llLHHHHHHHHLlllLLEEELhHHLLlllllllllLHHHHL


DSSP  HHhHHHLLEEEELhhHHHHLLL-------LLLL-HHHHHHLLL--EEEELLLLLL-----
Query NVfHERGASIAHCpnSNLSLSS-------GFLN-VLEVLKHEV--KIGLGTDVAG-----  326
ident                    |                    |        | |        
Sbjct TLsGRGKVWVKVS--GIYRLQGspeenlaFARQaLCALEAHYGaeRLXWGSDWPHtqhes  235
DSSP  LLlLLLLEEEEEE--LHHHLLLlhhhhhhHHHHhHHHHHHHLLhhHEEEELLLLLlllll


DSSP  lLLLLhhHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHhLLLLLLLlllllll
Query gYSYSmlDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQaLGLDGEIgnfevgk  386
ident   |     |                            |        |             
Sbjct eVSFG--SAVEQFEALG------------CSAQLRQALLLDTARA-LFGFELE-------  273
DSSP  lLLHH--HHHHHHHHHL------------LLHHHHHHHHLHHHHH-HLLLLLL-------


DSSP  llleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query efdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                           
Sbjct ----------------------------------------------------------  273
DSSP  ----------------------------------------------------------


No 41: Query=2uz9A Sbjct=4ofcA Z-score=12.2

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeelEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhLHHH--------
Query lshheffmpgLVDTHIHASqysfagssidlpllewltkytfpaehrfqNIDF--------  112
ident             | | |                                           
Sbjct ---------mKIDIHSHIL---------------------------pkEWPDlkkrfgyg   24
DSSP  ---------lLEEEEEELL---------------------------llLLLLhhhhhlll


DSSP  ------------------------hhhhHHHHhHHHHHLL----EEEEEEEL--------
Query ------------------------aeevYTRVvRRTLKNG----TTTACYFA--------  136
ident                                              |              
Sbjct gwvqlqhhskgeakllkdgkvfrvvrenCWDP-EVRIREMdqkgVTVQALSTvpvmfsyw   83
DSSP  lleeeeeeelleeeeeelleeeeeeehhHLLH-HHHHHHHhhhlLLEEEEELlhhhhlll


DSSP  -------llLHHHHHHHHHHHHHHLLEEEEELEELLLlllllllllLHHHHHHHHHHHHH
Query -------tiHTDSSLLLADITDKFGQRAFVGKVCMDLndtfpeykeTTEESIKETERFVS  189
ident                 ||        |                     |   || || | 
Sbjct akpedtlnlCQLLNNDLASTVVSYPRRFVGLGTLPMQ---------APELAVKEMERCVK  134
DSSP  llhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELLLLL---------LHHHHHHHHHHHHH


DSSP  HHHhhlllleEEEEEeLLHHH-----lLHHHhHHHHHHHHHHLLEEEEEE----------
Query EMLqknysrvKPIVTpRFSLS-----cSETLmGELGNIAKTRDLHIQSHI----------  234
ident |          | |                |       |         |           
Sbjct ELG-------FPGVQ-IGTHVnewdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrma  185
DSSP  LLL-------LLEEE-EELEElleellLHHH-HHHHHHHHHHLLEEEEELllllllhhhh


DSSP  ----llLHHHHHhhhhhlllllLHHHHHHHL----llllLLEEEEE-LLLLLHHH-----
Query ----seNRDEVEavknlypsykNYTSVYDKN----nlltNKTVMAH-GCYLSAEE-----  280
ident                                         |   || |            
Sbjct kywlpwLVGMPA-------ettIAICSMIMGgvfekfpkLKVCFAHgGGAFPFTVgrish  238
DSSP  lllhhhHLHHHH-------hhhHHHHHHHLLlhhhhlllLLEEELHhHLLHHHHHhhhhh


DSSP  -----------------hHHHHhhLLEEEELHHhhhhllllllLHHHHHHLLL--EEEEL
Query -----------------lNVFHerGASIAHCPNsnlslssgflNVLEVLKHEV--KIGLG  321
ident                                                        |  ||
Sbjct gfsmrpdlcaqdnpmnpkKYLG--SFYTDALVH-------dplSLKLLTDVIGkdKVILG  289
DSSP  hhhhlhhhhlllllllhhHHLL--LLEEELLLL-------lhhHHHHHHHHHLllLEELL


DSSP  LLLL--LLLLllhhHHHHHHHHhhhhhhhlllllLLLLHHHHHHHHLHHHHHhLLLLLll
Query TDVA--GGYSysmlDAIRRAVMvsnillinkvneKSLTLKEVFRLATLGGSQaLGLDGei  379
ident ||     |                                    |               
Sbjct TDYPfpLGEL----EPGKLIES-----------mEEFDEETKNKLKAGNALA-FLGLE--  331
DSSP  LLLLllLLLL----LLLHHHHH-----------lLLLLHHHHHHHHLHHHHH-HHLLL--


DSSP  llllllLLLLeeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeellee
Query gnfevgKEFDailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkq  439
ident                                                             
Sbjct ------RKQF--------------------------------------------------  335
DSSP  ------HHHL--------------------------------------------------


DSSP  eelll
Query vvpfs  444
ident      
Sbjct -----  335
DSSP  -----


No 42: Query=2uz9A Sbjct=4hk5D Z-score=12.1

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhHHHLHH---------
Query lshheffMPGLVDTHIHASqysfagssidlpllewltkytfpaehRFQNID---------  111
ident         |  || | |                                           
Sbjct -------TPVVVDIHTHMY------------------------ppSYIAMLekrqtiplv   29
DSSP  -------LLLLEEEEEEEL------------------------lhHHHHHHhllllllee


DSSP  ----------------------------------hhhhhhhHHHHHHHHLL----EEEEE
Query ----------------------------------faeevytRVVRRTLKNG----TTTAC  133
ident                                                             
Sbjct rtfpqadeprlillsselaaldaaladpaaklpgrplsthfASLAQKMHFMdtngIRVSV   89
DSSP  eeelleeeeeeellhhhhhhhhhhhhlllllllleellhhhLLHHHHHHHHhhllLLEEE


DSSP  EEL--------------llLHHHHHHHHHHHHHHL-LEEEEELEELLlllllllllLLHH
Query YFA--------------tiHTDSSLLLADITDKFG-QRAFVGKVCMDlndtfpeykETTE  178
ident                             |          |                    
Sbjct ISLanpwfdflapdeapgiADAVNAEFSDMCAQHVgRLFFFAALPLS---------APVD  140
DSSP  EEEllllllllllllhhhhHHHHHHHHHHHHHLLLlLEEEEEELLLL---------LLHH


DSSP  HHHHHHHHHHHHHhhhllllEEEEEEeLLHHHL-----LHHHhHHHHHHHHHHLLEEEEE
Query ESIKETERFVSEMlqknysrVKPIVTpRFSLSC-----SETLmGELGNIAKTRDLHIQSH  233
ident       ||                                 |            |    |
Sbjct AVKASIERVKNLK-------YCRGII-LGTSGLgkgldDPHL-LPVFEAVADAKLLVFLH  191
DSSP  HHHHHHHHHHLLL-------LEEEEE-ELLLLLlllllLHHH-HHHHHHHHHLLLEEEEL


DSSP  E--------------------llLHHHhhhhhhhlllllLHHHHH-----HHLLllllLE
Query I--------------------seNRDEveavknlypsykNYTSVY-----DKNNlltnKT  268
ident                                                             
Sbjct PhyglpnevygprseeyghvlplALGF-------pmettIAVARMymagvFDHV-rnlQM  243
DSSP  LlllllhhhhlllhhhlllhhhhHLHH-------hhhhhHHHHHHhhllhHHHL-lllLE


DSSP  EEEE-LLLLLHH--------------------------HHHHHHhHLLEEEELHHhhhhl
Query VMAH-GCYLSAE--------------------------ELNVFHeRGASIAHCPNsnlsl  301
ident   || |  |                                |                  
Sbjct LLAHsGGTLPFLagriescivhdghlvktgkvpkdrrtIWTVLK-EQIYLDAVIY-----  297
DSSP  EEHHhHLLHHHHhhhhhhhhhllhhhhhllllllllllHHHHHH-HLEEEELLLL-----


DSSP  lllllLHHHHHHLLL--EEEELLLLLLLL------lllhhHHHHHHHHHHHhhhhlllll
Query ssgflNVLEVLKHEV--KIGLGTDVAGGY------sysmlDAIRRAVMVSNillinkvne  353
ident                      |||                     |  |           
Sbjct --sevGLQAAIASSGadRLMFGTDHPFFPpieedvqgpwdSSRLNAQAVIK---------  346
DSSP  --lhhHHHHHHHHHLhhHEELLLLLLLLLllllllllllhHHHHHHHHHHH---------


DSSP  lLLLH--HHHHHHHLHHHHHhLLLLLlllllllLLLLleeeelllllllllllllhhhhl
Query kSLTL--KEVFRLATLGGSQaLGLDGeignfevGKEFdailinpkasdspidlfygdffg  411
ident                |                                            
Sbjct -AVGEgsSDAAAVMGLNAVR-VLSLK-------AELE-----------------------  374
DSSP  -HHLLllHHHHHHHLHHHHH-HLLLH-------HHHH-----------------------


DSSP  llllhhhhhhhhhllhhheeeeeeLLEEeelll
Query diseaviqkflylgddrnieevyvGGKQvvpfs  444
ident                                  
Sbjct -----------------------hHHHH----h  380
DSSP  -----------------------hHHHH----l


No 43: Query=2uz9A Sbjct=1v77A Z-score=11.8

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhhhhhhhhhH
Query lshheffmPGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidfaeevytrV  120
ident                |                                            
Sbjct --------VKFIEMDIRDK---------------------------------------eA   13
DSSP  --------LLLEEEEELLH---------------------------------------hH


DSSP  HHHHHHLlEEEEEEELlllhhhhhhhhhhhhhhlleeeeelEELLlllllllllllhhhH
Query VRRTLKNgTTTACYFAtihtdssllladitdkfgqrafvgkVCMDlndtfpeyketteeS  180
ident                                                             
Sbjct YELAKEW-FDEVVVSI-------------------------KFNE--------------E   33
DSSP  HHHHHHH-LLEEEEEE-------------------------EELL--------------L


DSSP  HHHhhHHHHHHhhhlLLLEEEEEEELLhhhLLHHHHHHHHHHHHhhLLEEEEEELllhhh
Query IKEteRFVSEMlqknYSRVKPIVTPRFslsCSETLMGELGNIAKtrDLHIQSHISenrde  240
ident          |         |              |        |     |          
Sbjct VDK--EKLREA---rKEYGKVAILLSN---PKPSLVRDTVQKFK--SYLIYVESN-----   78
DSSP  LLH--HHHHHH---hHHHLLEEEEEEL---LLHHHHHHHHHHLL--LLEEEEELL-----


DSSP  hhhhhhhlllllLHHHHHHHLLLllllEEEEELL------LLLHHHHHHHHHHLLEEEEL
Query veavknlypsykNYTSVYDKNNLltnkTVMAHGC------YLSAEELNVFHERGASIAHC  294
ident                                                             
Sbjct ----------dlRVIRYSIEKGV----DAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS  124
DSSP  ----------lhHHHHHHHHLLL----LEEELLLllllllLLLHHHHHHHHHHLLEEEEE


DSSP  hHHHHHLL--------LLLL--LHHHHHHLLLEEEELLLLL-llLLLLHHHHHHHHHHHH
Query pNSNLSLS--------SGFL--NVLEVLKHEVKIGLGTDVA-ggYSYSMLDAIRRAVMVS  343
ident     |  |          |       | |  |   |              | |   |   
Sbjct -LRPLLYSnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQekwDVRYPRDLISLGVVIG  183
DSSP  -LHHHHHLlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLlhhHLLLHHHHHHHHHHLL


DSSP  hhhhhlllllllLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllllllll
Query nillinkvneksLTLKEVFRLATLGGSQALGldgeignfevgkefdailinpkasdspid  403
ident                              |                              
Sbjct ------------MEIPQAKASISMYPEIILK-----------------------------  202
DSSP  ------------LLHHHHHHLLLHHHHHHHL-----------------------------


DSSP  lllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query lfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                          
Sbjct -----------------------------------------  202
DSSP  -----------------------------------------


No 44: Query=2uz9A Sbjct=4dziC Z-score=11.5

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhhhlhhhHHHHHHLH----------
Query lshheffmPGLVDTHIHASqysfagssidlpllewltkytfpAEHRFQNI----------  110
ident             |   |                                           
Sbjct -----alnYRVIDVDNHYY-----------------------EPLDSFTRhldkkfkrrg   32
DSSP  -----lllLLEEEEEEELL-----------------------LLLLLLLLlllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  110
ident                                                             
Sbjct vqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverla   92
DSSP  eeeeelllleeeeelleellllllllllleelllllhhhhhllllllllhhhllleelhh


DSSP  -hhhhHHHHHHHHHHHHLLEEEEEEEL---------------------llLHHHHHH-HH
Query -dfaeEVYTRVVRRTLKNGTTTACYFA---------------------tiHTDSSLL-LA  147
ident                      ||                                     
Sbjct dhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdieatmasvhaFNLWLDEdWG  152
DSSP  hlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhhhhhHHHHHHHhLL


DSSP  HHhHHHLLeEEEELEELLLlllllllllLHHHHHHHHHHHHHHHhhhlllleEEEEEELL
Query DItDKFGQrAFVGKVCMDLndtfpeykeTTEESIKETERFVSEMlqknysrvKPIVTPRF  207
ident                                    |                   |  | 
Sbjct FD-RPDHR-IIAAPIVSLA---------DPTRAVEEVDFVLARG--------AKLVLVRP  193
DSSP  LL-LLLLL-EEELLLLLLL---------LHHHHHHHHHHHHHLL--------LLLEELLL


DSSP  HHH---------lLHHHhHHHHHHHHHHLLEEEEEE--------------------lllH
Query SLS---------cSETLmGELGNIAKTRDLHIQSHI--------------------senR  238
ident                                   |                         
Sbjct APVpglvkprslgDRSH-DPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldqvlL  252
DSSP  LLLllllllllllLHHH-HHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhhhhH


DSSP  HHHhhhhhhlllllLHHHHHHHL----lllllLEEEEE-LLLLLHHH-------------
Query DEVeavknlypsykNYTSVYDKN----nlltnKTVMAH-GCYLSAEE-------------  280
ident |                               | |    | |                  
Sbjct DDR--------aihDTMASMIVHgvftrhpklKAVSIEnGSYFVHRLikrlkkaantqpq  304
DSSP  LLH--------hhhHHHHHHHHLlhhhhllllLEEEELlLLLHHHHHhhhhhhhhhhlhh


DSSP  ------hHHHHhHLLEEEELHhhhhhllllLLLHHHHHHLLL--EEEELLLLL--LLLLl
Query ------lNVFHeRGASIAHCPnsnlslssgFLNVLEVLKHEV--KIGLGTDVA--GGYSy  330
ident                 ||                 |        ||  | |     |   
Sbjct yfpedpvEQLR-NNVWIAPYY---------EDDLPELARVIGvdKILFGSDWPhgEGLA-  353
DSSP  hllllhhHHHH-HHEEELLLL---------LLLHHHHHHHHLhhHLLLLLLLLllLLLL-


DSSP  LHHHHhHHHHHhhhhhhhllllllLLLHHHHHHHHLHHHHHhLLLLLlllllllllllle
Query SMLDAiRRAVMvsnillinkvnekSLTLKEVFRLATLGGSQaLGLDGeignfevgkefda  390
ident |                                         |                 
Sbjct SPVSF-TAELK-------------GFSESDIRKIMRDNALD-LLGVQ-------------  385
DSSP  LHHHH-HHHHL-------------LLLHHHHHHHHLHHHHH-HHLLL-------------


DSSP  eeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query ilinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                       
Sbjct ---------------------------------------------------vgs  388
DSSP  ---------------------------------------------------lll


No 45: Query=2uz9A Sbjct=2qpxA Z-score=11.4

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ---------------------------------------------------------gxd    3
DSSP  ---------------------------------------------------------lll


DSSP  llllleeEELEEEEEEEHhhHHHL------lLLLL-lLHHH------------------h
Query lshheffMPGLVDTHIHAsqYSFA------gSSID-lPLLE------------------w   95
ident           | | | |                                           
Sbjct dlsefvdQVPLLDHHCHF--LIDGkvpnrddRLAQvsTEADkdypladtknrlayhgfla   61
DSSP  llhhhhhHLLEEEEEELL--LLLLllllhhhHHHHhlLLLLllllhhhhlllhhhhhhhh


DSSP  hhhlhhhhhhhhhlhhhhhhhhhhhhHHHHHLLEEEEEEELLllhhhhhHHHHHHHHH-L
Query ltkytfpaehrfqnidfaeevytrvvRRTLKNGTTTACYFATihtdsslLLADITDKF-G  154
ident                           |                      |  | |    |
Sbjct lakefaldannplaaxndpgyatynhRIFGHFHFKELLIDTGfvpddpiLDLDQTAELvG  121
DSSP  hhhhhllllllllllllhhhhhhhhhHHHHHLLEEEEEEELLlllllllLLHHHHHHHhL


DSSP  LEEEEELEELllllllllLLLL---------HHHHHHHHHHHHHHHhhhlllleEEEEEe
Query QRAFVGKVCMdlndtfpeYKET---------TEESIKETERFVSEMlqknysrvKPIVTp  205
ident                                                             
Sbjct IPVKAIYRLE-----thaEDFXlehdnfaawWQAFSNDVKQAKAHG--------FVGFX-  167
DSSP  LLEEEEEEHH-----hhhHHHHlllllhhhhHHHHHHHHHLLLLLL--------LLLEE-


DSSP  LLHH---------------------------------hlLHHHHHHHHHHHHHHLLEEEE
Query RFSL---------------------------------scSETLMGELGNIAKTRDLHIQS  232
ident                                                       |   | 
Sbjct SIAAyrvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQF  227
DSSP  ELHHhhlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEE


DSSP  EELLLH--HHHHHHhhhllllllHHHHHHHLL----llllLEEEEELLLLLHHHHHHHHH
Query HISENR--DEVEAVknlypsyknYTSVYDKNN----lltnKTVMAHGCYLSAEELNVFHE  286
ident |                                       | |  |      |       
Sbjct HVGYGDadTDXYLG---------NPLLXRDYLkaftkkglKVVLLHCYPYHREAGYLASV  278
DSSP  EELLLLllLLHHHL---------LHHHHHHHHhhhhhhllLEEEEELLLLHHHHHHHHHH


DSSP  H-LLEEEEL--HHHHHhllllllLHHHHHHLLL--EEEELLLLL-llLLLLhhHHHHHHH
Query R-GASIAHC--PNSNLslssgflNVLEVLKHEV--KIGLGTDVA-ggYSYSmlDAIRRAV  340
ident             |             |         |    |       |    | |   
Sbjct FpNLYFDISllDNLGP--sgasrVFNEAVELAPytRILFASDAStypEXYG--LAARQFK  334
DSSP  LlLEEEELLlhHHHLH--hhhhhHHHHHLLLLLhhHEELLLLLLllhHHHH--HHHHHHH


DSSP  HHHHhhhhlllllLLLL----------hhhHHHHHLHHHHHhlLLLLlLLLLllllllle
Query MVSNillinkvneKSLT----------lkeVFRLATLGGSQalGLDGeIGNFevgkefda  390
ident                                                             
Sbjct QALV---------AHFNqlpfvdlaqkkawINAICWQTSAKlyHQER-ELRV--------  376
DSSP  HHHH---------HHHHllllllhhhhhhhHHHHHLHHHHHhlLLHH-HHLL--------


DSSP  eeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query ilinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                       
Sbjct ------------------------------------------------------  376
DSSP  ------------------------------------------------------


No 46: Query=2uz9A Sbjct=2a3lA Z-score=11.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------llleeEEEEEEEllllllleeeeeeeeeellll
Query ---------------------------plahiFRGTFVHstwtcpmevlrdhllgvsdsg   33
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRDF---------------------  159
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLLL---------------------


DSSP  leeeeeehhhhhhhhhhhlllhhheeellllleeEELEEEEEEEHHHHhHLLL-------
Query kivfleeasqqeklakewcfkpceirelshheffMPGLVDTHIHASQYsFAGS-------   86
ident                                       |||| | |              
Sbjct ---------------------------------yNVRKVDTHVHHSAC-MNQKhllrfik  185
DSSP  ---------------------------------lLLLEEEEEEELLLL-LLHHhhhhhhh


DSSP  ---------------------------------------------lllllhhHHHHhLHH
Query ---------------------------------------------sidlpllEWLTkYTF  101
ident                                                             
Sbjct sklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfDKFN-LKY  244
DSSP  hhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllLLLH-HHH


DSSP  H---------hhhHHHL---HHHHHHHHHHHHHHHH-HLLEeEEEEELLL------LHHH
Query P---------aehRFQN---IDFAEEVYTRVVRRTL-KNGTtTACYFATI------HTDS  142
ident                 |     |  |    |            | |   |        | 
Sbjct NpcgqsrlreiflKQDNliqGRFLGEITKQVFSDLEaSKYQ-MAEYRISIygrkmsEWDQ  303
DSSP  LlllllhhhhhhlLLLLlllLLLHHHHHHHHHHHHLlLLLE-EEEEEEELllllllHHHH


DSSP  HH---hhhHHHHhhLLEEeEELEELLLLLLLL--lllllHHHHHHHHHHHHHH-------
Query SL---llaDITDkfGQRAfVGKVCMDLNDTFP--eyketTEESIKETERFVSE-------  190
ident         |                 |                         |       
Sbjct LAswivnnDLYS--ENVV-WLIQLPRLYNIYKdmgivtsFQNILDNIFIPLFEatvdpds  360
DSSP  HHhhhhllLLLL--LLEE-EEEEEELLHHHHLlllllllLHHHHHHHLLHHHHhhhlhhh


DSSP  -hhHHLLlLEEEEEEELL----------------------hhhlLHHHHHHHHHHHHHHL
Query -mlQKNYsRVKPIVTPRF----------------------slscSETLMGELGNIAKTRD  227
ident                                                             
Sbjct hpqLHVFlKQVVGFDLVDdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLN  420
DSSP  lllLHHHhLLEEEEEEELllllllllllllllllllllllllllHHHHHHHHHHHHHHHH


DSSP  ----------LEEEEEELLlhhHHHHhhhhlllllLHHHHHHHLllllllEEEEELLLLL
Query ----------LHIQSHISEnrdEVEAvknlypsykNYTSVYDKNnlltnkTVMAHGCYLS  277
ident                |  |                                  |||  | 
Sbjct klreskgmttITLRPHSGE---AGDI---------DHLAATFLT-----cHSIAHGINLR  463
DSSP  hhhlllllllLEELLLLLL---LLLL---------HHHHHHHHH-----lLLLLLLHHHH


DSSP  --HHHHHHHHHHLLEEEELHHHHHhLLLL---LLLHHHHHHLLLEEEELLLL-LLLL--l
Query --AEELNVFHERGASIAHCPNSNLsLSSG---FLNVLEVLKHEVKIGLGTDV-AGGY--s  329
ident                 |  | ||                        | ||         
Sbjct ksPVLQYLYYLAQIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDpLQIHltk  522
DSSP  hlHHHHHHHHHHLLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLhHHHLlll


DSSP  lLHHHHHHHHHHHHhhhhhllllllLLLHHHHHHHhLHHHHHHLLL-LLLL--LLLLLLL
Query ySMLDAIRRAVMVSnillinkvnekSLTLKEVFRLaTLGGSQALGL-DGEI--GNFEVGK  386
ident          |  |             |                 |               
Sbjct ePLVEEYSIAASVW-----------KLSACDLCEI-ARNSVYQSGFsHALKshWIGKDYY  570
DSSP  lHHHHHHHHHHHHH-----------LLLHHHHHHH-HHHHHHHLLLlHHHHhhHLLLLLL


DSSP  llleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query efdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                           
Sbjct ------------krgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  ------------lllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 47: Query=2uz9A Sbjct=1itqA Z-score=11.0

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct -------------------------------------------------------dffrd    5
DSSP  -------------------------------------------------------lhhhh


DSSP  llllleeEELEEEEEEEHHHHHhllllllllhhhhhhhlhhhhhhhhhlhHHHHH-----
Query lshheffMPGLVDTHIHASQYSfagssidlpllewltkytfpaehrfqniDFAEE-----  115
ident             | |                                             
Sbjct eaerimrDSPVIDGHNDLPWQL-------------------------ldmFNNRLqdera   40
DSSP  hhhhhhlLLLEEEEEELHHHHH-------------------------hhhHLLLLllhhh


DSSP  -----hhhhHHHH-HHHLLEEEEEEELLL------------LHHHHHHHHHHHHHHL---
Query -----vytrVVRR-TLKNGTTTACYFATI------------HTDSSLLLADITDKFG---  154
ident                                                             
Sbjct nlttlagthTNIPkLRAGFVGGQFWSVYTpcdtqnkdavrrTLEQMDVVHRMCRMYPetf  100
DSSP  lllllllllLLHHhHHHLLEEEEEEEELLlhhhllllhhhhHHHHHHHHHHHHHHLLlle


DSSP  -----------------LEEEEELEELLlllllllllllhHHHHHHHHHHHHHHhhhlll
Query -----------------QRAFVGKVCMDlndtfpeykettEESIKETERFVSEMlqknys  197
ident                       |                   |                 
Sbjct lyvtssagirqafregkVASLIGVEGGH----------siDSSLGVLRALYQLG------  144
DSSP  eelllhhhhhhhhhlllEEEEEEEELHH----------hlLLLHHHHHHHHHLL------


DSSP  leEEEEEELLHHHLLH-------------------HHHHHHHHHHHHHLLEEEEEElllh
Query rvKPIVTPRFSLSCSE-------------------TLMGELGNIAKTRDLHIQSHIsenr  238
ident       |   |                                        |        
Sbjct --MRYLTLTHSCNTPWadnwlvdtgdsepqsqglsPFGQRVVKELNRLGVLIDLAH----  198
DSSP  --EEEEELLLLLLLLLlllhhhlllllllllllllHHHHHHHHHHHHHLLEEELLL----


DSSP  hhhhhhhhhlllllLHHHHHHHLLlllLLEEE-EELLL--------LLHHHHHHHHHHLL
Query deveavknlypsykNYTSVYDKNNlltNKTVM-AHGCY--------LSAEELNVFHERGA  289
ident                                      |             |        
Sbjct -----------vsvATMKATLQLS--rAPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDS  245
DSSP  -----------llhHHHHHHHHHL--lLLLEElLLLLLllllllllLLHHHHHHHHHHLL


DSSP  EEEELHHhhhhLLLL-----------llLHHHHHHLLL--EEEELLLLLLL-------LL
Query SIAHCPNsnlsLSSG-----------flNVLEVLKHEV--KIGLGTDVAGG-------YS  329
ident                                           | | |  |          
Sbjct LVMVNFY----NNYIsctnkanlsqvadHLDHIKEVAGarAVGFGGDFDGVprvpeglED  301
DSSP  EEEELLL----HHHHlllllllhhhhhhHHHHHHHHLLhhHEEELLLLLLLlllllllLL


DSSP  LLhhHHHHHhHHHHhhhhhlllllLLLLHHHHHHHHLHHHhHHLLlllllllllllllll
Query YSmlDAIRRaVMVSnillinkvneKSLTLKEVFRLATLGGsQALGldgeignfevgkefd  389
ident  |                         |  ||                            
Sbjct VS--KYPDL-IAEL--------lrRNWTEAEVKGALADNL-LRVF---------------  334
DSSP  LL--LHHHH-HHHH--------hhLLLLHHHHHHHHLHHH-HHHH---------------


DSSP  eeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query ailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                        
Sbjct --------------------eaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  --------------------hhhhhllllllllllllllhhhlllllllllllll


No 48: Query=2uz9A Sbjct=2gwgA Z-score=11.0

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeeLEEEEEEEhHHHH---hllllllllhhhhhhhlhhhhhhhhhlhHHHHHHH
Query lshheffmpGLVDTHIHaSQYS---fagssidlpllewltkytfpaehrfqniDFAEEVY  117
ident             | | |                                    |      
Sbjct ---------XIIDIHGH-YTTApkaledwrnrqiagikdpsvxpkvselkisdDELQASI   50
DSSP  ---------LLEEEEEE-LLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhHHHHHHH


DSSP  H-HHHHHHHHLLEEEEEEELL---------lLHHHHHHHHHHHHHHL-LEEEEELEeLLL
Query T-RVVRRTLKNGTTTACYFAT---------iHTDSSLLLADITDKFG-QRAFVGKVcMDL  166
ident            |                         |       |              
Sbjct IeNQLKKXQERGSDLTVFSPRagdfnvsstwAAICNELCYRVSQLFPdNFIGAAXLpQSP  110
DSSP  HlLHHHHHHHHLLLEEEEELLlllhhhhhhhHHHHHHHHHHHHHHLLlLEEEEEELlLLL


DSSP  LlllllllllhHHHHHhHHHHHHHH-HHHLllleEEEEEElLHHH----------lLHHH
Query NdtfpeykettEESIKeTERFVSEM-LQKNysrvKPIVTPrFSLS----------cSETL  215
ident                                                             
Sbjct G----------VDPKT-CIPELEKCvKEYG----FVAINL-NPDPsgghwtsppltDRIW  154
DSSP  L----------LLHHH-HHHHHHHHhHLLL----LLEEEE-LLLLlllllllllllLHHH


DSSP  hHHHHHHHHHHLLEEEEE-----eLLLHhhhhhhhhhlllllLHHH--hHHHLLllLLLE
Query mGELGNIAKTRDLHIQSH-----iSENRdeveavknlypsykNYTS--vYDKNNllTNKT  268
ident                  |        |                        |      | 
Sbjct -YPIYEKXVELEIPAXIHvstgahYLNA---------dttafXQCVagdLFKDF-pELKF  203
DSSP  -HHHHHHHHHHLLLEEELlllllhHHHH---------hhhhhHHHHhllHHHHL-lLLLE


DSSP  EEEE-LLLL---------------lhHHHHHHHhHLLEEEELHHhhhhllllllLHHHHH
Query VMAH-GCYL---------------saEELNVFHeRGASIAHCPNsnlslssgflNVLEVL  312
ident |  | |                                   |                  
Sbjct VIPHgGGAVpyhwgrfrglaqexkkpLLEDHVL-NNIFFDTCVY---hqpgidlLNTVIP  259
DSSP  EELHhHLLLhhhhhhhhhhhhhllllLHHHHLL-LLEEEELLLL---lhhhhhhHHHHLL


DSSP  hllLEEEELLLL-LLLL------lllhhHHHHHHHHHhhhhhhlllllLLLLHHHHHHHH
Query kheVKIGLGTDV-AGGY------sysmlDAIRRAVMVsnillinkvneKSLTLKEVFRLA  365
ident                             |  |                  ||  |     
Sbjct --vDNVLFASEXiGAVRgidprtgfyydDTKRYIEAS-----------TILTPEEKQQIY  306
DSSP  --hHHEELLLLLlLLLLleelllleellLLHHHHHHL-----------LLLLHHHHHHHH


DSSP  LHHHHHHLL-LLLLLlllllLLLLleeeelllllllllllllhhhhlllllhhhhhhhhh
Query TLGGSQALG-LDGEIgnfevGKEFdailinpkasdspidlfygdffgdiseaviqkflyl  424
ident           ||                                                
Sbjct EGNARRVYPrLDAAL-----KAKG------------------------------------  325
DSSP  LHHHHHHLHhHHHHH-----HHHH------------------------------------


DSSP  llhhheeeeeelleeeelll
Query gddrnieevyvggkqvvpfs  444
ident                     
Sbjct ----------------kleh  329
DSSP  ----------------hhll


No 49: Query=2uz9A Sbjct=3dcpA Z-score=10.0

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeeLEEEEEEEHH----HHHHllllllllhhhhhhhlhhhhhhhhhlhhhhhhH
Query lshheffmpGLVDTHIHAS----QYSFagssidlpllewltkytfpaehrfqnidfaeeV  116
ident             | | |                                           
Sbjct ---------XKRDGHTHTEfcphGTHD--------------------------------D   19
DSSP  ---------LLEEEEELLLllllLLLL--------------------------------L


DSSP  HHHHHHHHHHLLEEEEEEEL--------------------------llLHHHHHHHHHHH
Query YTRVVRRTLKNGTTTACYFA--------------------------tiHTDSSLLLADIT  150
ident     |                                                     | 
Sbjct VEEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttasxaxsdLPYYFKKXNHIK   79
DSSP  HHHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhlllllhhhHHHHHHHHHHHH


DSSP  HHHL--LEEEEeleelllllllllllllhhhhhhhhhhhhhhhhhhlllleeeEEEElLH
Query DKFG--QRAFVgkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpIVTPrFS  208
ident  |                                                          
Sbjct KKYAsdLLIHI------------------------------------------GFEV-DY   96
DSSP  HHLLllLEEEE------------------------------------------EEEE-EL


DSSP  HHlLHHHHHHHHHHHHhhllEEEEEElllhhhhhhHHHH---------------------
Query LScSETLMGELGNIAKtrdlHIQSHIsenrdeveaVKNL---------------------  247
ident |   |       |                                               
Sbjct LIgYEDFTRDFLNEYGpqtdDGVLSL--------hFLEGqggfrsidfsaedynegivqf  148
DSSP  LLlLHHHHHHHHHHHHhhllEEEEEL--------lEEEElleeeellllhhhhhhhlhhh


DSSP  -------lllllLHHHHH-HHLLllllLEEEEELLL---------------------lLH
Query -------ypsykNYTSVY-DKNNlltnKTVMAHGCY---------------------lSA  278
ident                                 |                           
Sbjct yggfeqaqlaylEGVKQSiEADLglfkPRRXGHISLcqkfqqffgedtsdfseevxekFR  208
DSSP  hllhhhhhhhhhHHHHHHhHLLLllllLLEELLLLHhhllhhhhlllhhhllhhhhhhHH


DSSP  HHHHHHHHHLLEEEELHhHHHHL---LLLLL---LHHHHHHLLLEEEELLLLLllLLLLh
Query EELNVFHERGASIAHCPnSNLSL---SSGFL---NVLEVLKHEVKIGLGTDVAggYSYSm  332
ident   |     |           |              |            | |         
Sbjct VILALVKKRDYELDFNT-AGLFKplcGETYPpkkIVTLASELQIPFVYGSDSHgvQDIG-  266
DSSP  HHHHHHHHHLLEEEEEL-HHHHLlllLLLLLlhhHHHHHHHLLLLEEEELLLLlhHHLL-


DSSP  hHHHHHHHHHHHhhhhlllllllllhhhhhhhhlhhhhhhllllllllllllllllleee
Query lDAIRRAVMVSNillinkvneksltlkevfrlatlggsqalgldgeignfevgkefdail  392
ident                                                             
Sbjct -RGYSTYCQKLE------------------------------------------------  277
DSSP  -LLHHHHHHHLL------------------------------------------------


DSSP  elllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query inpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                     
Sbjct ----------------------------------------------------  277
DSSP  ----------------------------------------------------


No 50: Query=2uz9A Sbjct=3iacA Z-score=9.5

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct -------------------------------------------atfxtedfllkndiart   17
DSSP  -------------------------------------------llllllllllllhhhhh


DSSP  llllleeEELEEEEEEEHH---------------hhhHLLLLLLL---------------
Query lshheffMPGLVDTHIHAS---------------qysFAGSSIDL---------------   90
ident             | | | |                                         
Sbjct lyhkyaaPXPIYDFHCHLSpqeiaddrrfdnlgqiwlEGDHYKWRalrsagvdeslitgk   77
DSSP  hhhhlllLLLEEELLLLLLhhhhhhllllllhhhhhhLLLLHHHHhhhhllllhhhllll


DSSP  -----------------------------------lhhhhhhhlhhhhhhhhhlhhhhhh
Query -----------------------------------pllewltkytfpaehrfqnidfaee  115
ident                                                             
Sbjct etsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklat  137
DSSP  lllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhll


DSSP  hhhhhhHHHHHLLEEEEEEELLLLHHhhHHHHHHHHH---HLLEEEEELEE--LLLL-LL
Query vytrvvRRTLKNGTTTACYFATIHTDssLLLADITDK---FGQRAFVGKVC--MDLN-DT  169
ident                             |                               
Sbjct pafsarGIXQQXNVRXVGTTDDPIDS--LEYHRQIAAddsIDIEVAPSWRPdkVFKIeLD  195
DSSP  hhhlhhHHHHHLLEEEEELLLLLLLL--LHHHHHHHHlllLLLEEELLLLLhhHHLLlLL


DSSP  LLLLL----------------llHHHHHHHHHHHHHHHhhhlllleEEEEEeLLHH----
Query FPEYK----------------etTEESIKETERFVSEMlqknysrvKPIVTpRFSL----  209
ident                                  |                          
Sbjct GFVDYlrkleaaadvsitrfddlRQALTRRLDHFAACG--------CRASD-HGIEtlrf  246
DSSP  LHHHHhhhhhhhhllllllhhhhHHHHHHHHHHHHHLL--------LLEEE-EEELllll


DSSP  ----------------------------hlLHHHHHHHHHHHHHHLLEEEEEElLLHH--
Query ----------------------------scSETLMGELGNIAKTRDLHIQSHIsENRD--  239
ident                                      ||     |    | ||       
Sbjct apvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHI-GAIRnn  305
DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEE-LEELll


DSSP  ----------------HHHHhhhhllllLLHHHHHHHLL---llLLLEEEeELLL--LLH
Query ----------------EVEAvknlypsyKNYTSVYDKNN---llTNKTVMaHGCY--LSA  278
ident                                 |             ||            
Sbjct ntrxfrllgpdtgfdsIGDN------niSWALSRLLDSXdvtneLPKTIL-YCLNprDNE  358
DSSP  lhhhhhhhllllllleELLL------llHHHHHHHHHHHhllllLLEEEE-EELLhhHHH


DSSP  HHHHHHHHH-------LLEEEElhhHHHHlllLLLL--HHHHHHLL---lEEEELLLLLl
Query EELNVFHER-------GASIAHcpnSNLSlssGFLN--VLEVLKHE---vKIGLGTDVAg  326
ident                                                     |  ||   
Sbjct VLATXIGNFqgpgiagKVQFGS-gwWFND-qkDGXLrqLEQLSQXGllsqFVGXLTDSR-  415
DSSP  HHHHHHHHLlllllllLEEELL-llHHHL-lhHHHHhhHHHHHHHLlhhhLLLLLLLLL-


DSSP  lLLLLhHHHHHHHHHHHHHHHHLL-----llllllLHHHHHHHHLHHHHHHLLlllllll
Query gYSYSmLDAIRRAVMVSNILLINK-----vnekslTLKEVFRLATLGGSQALGldgeign  381
ident                  | |                   |                    
Sbjct sFLSY-TRHEYFRRILCNLLGQWAqdgeipddeaxLSRXVQDICFNNAQRYFT-------  467
DSSP  lLLLL-HHHHHHHHHHHHHHHHHHhlllllllhhhHHHHHHHHHLHHHHHHLL-------


DSSP  lllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeee
Query fevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvv  441
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  lll
Query pfs  444
ident    
Sbjct -ik  469
DSSP  -ll


No 51: Query=2uz9A Sbjct=3qy6A Z-score=9.4

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeelEEEEEEEH-----HHHHhllllllllhhhhhhhlhhhhhhhhhlhhhHHH
Query lshheffmpgLVDTHIHA-----SQYSfagssidlpllewltkytfpaehrfqnidfAEE  115
ident             | | |                                           
Sbjct ----------MIDIHCHIlpamdDGAG------------------------------DSA   20
DSSP  ----------LEELLLLLlllllLLLL------------------------------LHH


DSSP  HHHHHHHHHHHLLEEEEEEELL-------LLHHHHHHHHHHHHH------HLLEEEEEle
Query VYTRVVRRTLKNGTTTACYFAT-------IHTDSSLLLADITDK------FGQRAFVGkv  162
ident       |     |  |                      ||   |             |  
Sbjct DSIEMARAAVRQGIRTIIATPHhnngvykNEPAAVREAADQLNKrlikedIPLHVLPG--   78
DSSP  HHHHHHHHHHHLLLLEEELLLEellllllLLHHHHHHHHHHHHHhhhhllLLLEEELL--


DSSP  elllllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLhhhllhhhHHHHHHH
Query cmdlndtfpeyketteesiketerfvsemlqknysrvkpivTPRFslscsetlMGELGNI  222
ident                                            |          ||    
Sbjct ----------------------------------------qEIRI--------YGEVEQD   90
DSSP  ----------------------------------------lEEEL--------LLLHHHH


DSSP  HHHH-------llEEEEEElllhhHHHHhhhhllllllHHHHHHHLL----lllLLEEEE
Query AKTR-------dlHIQSHIsenrdEVEAvknlypsyknYTSVYDKNN----lltNKTVMA  271
ident    |          |                                          | |
Sbjct LAKRqllslndtkYILIEF-----PFDH----------VPRYAEQLFydlqlkgYIPVIA  135
DSSP  HHLLllllhhhllEEEEEL-----LLLL----------LLLLHHHHHhhhhhllLEEEEE


DSSP  ELL-----llLHHHHHHHHHHLLEEEELHHHH-HHLL---LLLL--LHHHHhhllLEEEE
Query HGC-----ylSAEELNVFHERGASIAHCPNSN-LSLS---SGFL--NVLEVlkheVKIGL  320
ident |             |    | ||       |           |    |            
Sbjct HPErnreireNPSLLYHLVEKGAASQITSGSLaGIFGkqlKAFSlrLVEAN----LIHFV  191
DSSP  LHHhlhhhhhLLHHHHHHHHLLLEEEEEHHHHlLLLLhhhHHHHhhHHHLL----LLLEE


DSSP  LLLLL--llLLLLHHHHHHHHHHhhhhhhhllllllLLLHHHHHHHHlHHHHHhlLLLLL
Query GTDVA--ggYSYSMLDAIRRAVMvsnillinkvnekSLTLKEVFRLAtLGGSQalGLDGE  378
ident   |             |                            |          |   
Sbjct ASDAHnvktRNFHTQEALYVLEK-------------EFGSELPYMLT-ENAEL--LLRNQ  235
DSSP  ELLLLllllLLLLHHHHHHHHHH-------------HHLLHHHHHHH-HHHHH--HHLLL


DSSP  llllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelle
Query ignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggk  438
ident                                                             
Sbjct ------------------------------------------------------tifrqp  241
DSSP  ------------------------------------------------------llllll


DSSP  eeelll
Query qvvpfs  444
ident       
Sbjct pqpvkr  247
DSSP  llllll


No 52: Query=2uz9A Sbjct=1j5sA Z-score=9.1

back to top
DSSP  llleeeeeeeeellllLLLEeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtCPMEvlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct hmflgedylltnraavRLFN----------------------------------------   20
DSSP  llllllllllllhhhhHHHH----------------------------------------


DSSP  llllleeEELEEEEEEEHH--------------hhhhlLLLLLL----------------
Query lshheffMPGLVDTHIHAS--------------qysfaGSSIDL----------------   90
ident            || | |                                           
Sbjct ----evkDLPIVDPHNHLDakdivenkpwndiwevegaTDHYVWelmrrcgvseeyitgs   76
DSSP  ----hhlLLLEEELLLLLLhhhhhhllllllhhhhhllLLHHHHhhhhhllllhhhllll


DSSP  -------------------------------lhhhhhhhlhhhhhhhhhlhhhhhhhhhh
Query -------------------------------pllewltkytfpaehrfqnidfaeevytr  119
ident                                                             
Sbjct rsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemt  136
DSSP  llhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllll


DSSP  HHHHHHHLLEEEEEEELLLLHHhhHHHHHHHHHHL--LEEEEELEEL--LLLLL--LLLL
Query VVRRTLKNGTTTACYFATIHTDssLLLADITDKFG--QRAFVGKVCM--DLNDT--FPEY  173
ident              |          |                           |     ||
Sbjct PQKLLRDMKVEILCTTDDPVST--LEHHRKAKEAVegVTILPTWRPDraMNVDKegWREY  194
DSSP  HHHHHHHLLEEEEELLLLLLLL--LHHHHHHHHHLllLEEELLLLLHhhHLLLLllHHHH


DSSP  L---------------lLHHHHHHHHHHHHHHHhhhlllleEEEEEeLLHHH--------
Query K---------------eTTEESIKETERFVSEMlqknysrvKPIVTpRFSLS--------  210
ident                        |  | |                     |         
Sbjct VekmgerygedtstldgFLNALWKSHEHFKEHG--------CVASD-HALLEpsvyyvde  245
DSSP  HhhhhhhhllllllhhhHHHHHHHHHHHHHLLL--------LLEEE-EEELLlllllllh


DSSP  -----------------------lLHHHHHHHHHHHHHHLLEEEEEEL------------
Query -----------------------cSETLMGELGNIAKTRDLHIQSHIS------------  235
ident                             |   |          | ||             
Sbjct nraravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGalrdyrdslfkt  305
DSSP  hhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhh


DSSP  -----llhHHHHHHHhhllllLLHHHHHHHLLllllLEEEEeLLLL--LHHHHHHHHHHL
Query -----enrDEVEAVKnlypsyKNYTSVYDKNNlltnKTVMAhGCYL--SAEELNVFHERG  288
ident                                     | |                     
Sbjct lgpdsggdISTNFLR-----iAEGLRYFLNEFdgklKIVLY-VLDPthLPTISTIARAFP  359
DSSP  llllllllEELLLLL-----hHHHHHHHHHHLllllLEEEE-ELLHhhHHHHHHHHHHLL


DSSP  -LEEEEL-hHHHHhlllLLLL--HHHHHHLL---LEEEELLLLLllLLLLHHHHHHHHHH
Query -ASIAHC-pNSNLslssGFLN--VLEVLKHE---VKIGLGTDVAggYSYSMLDAIRRAVM  341
ident                                      |  ||       |          
Sbjct nVYVGAPwwFNDS---pFGMEmhLKYLASVDllyNLAGMVTDSR--KLLSFGSRTEMFRR  414
DSSP  lEEELLLllLLLL---hHHHHhhHHHHHLLLlhhHLLLLLLLLL--LLLHHHHHHHHHHH


DSSP  HHhhhhhlllllLLLL-------------hhhHHHHHLHHHHHHLLllllllllllllll
Query VSnillinkvneKSLT-------------lkeVFRLATLGGSQALGldgeignfevgkef  388
ident |                               |      |                    
Sbjct VL---------sNVVGemvekgqipikearelVKHVSYDGPKALFF--------------  451
DSSP  HH---------hHHHHhhhhlllllhhhhhhhHHHHHLHHHHHHHL--------------


DSSP  leeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query dailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                         
Sbjct --------------------------------------------------------  451
DSSP  --------------------------------------------------------


No 53: Query=2uz9A Sbjct=3au2A Z-score=8.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------llleeeeeeeeelllLLLLeeeeeeeeeellllleeeeeehhhhhhhh
Query ------------plahifrgtfvhstwTCPMevlrdhllgvsdsgkivfleeasqqekla   48
ident                                                             
Sbjct yaalglpwippplredqgeveaalegrLPKL-----------------------------  331
DSSP  hhhlllllllhhhlllllhhhhhhlllLLLL-----------------------------


DSSP  hhhlllhhheeellllleeEELEEEEEEEH---HHHHhllllllllhhhhhhhlhhhhhh
Query kewcfkpceirelshheffMPGLVDTHIHA---SQYSfagssidlpllewltkytfpaeh  105
ident                         |   |                               
Sbjct ----------------lelPQVKGDLQVHStysDGQN-----------------------  352
DSSP  ----------------llhHHLLEEEEELLlllLLLL-----------------------


DSSP  hhhlhhhhhhHHHHHHHHHHHLLEEEEEEEL-------------lLLHHHHHHHHHHHHH
Query rfqnidfaeeVYTRVVRRTLKNGTTTACYFA-------------tIHTDSSLLLADITDK  152
ident                       |                                     
Sbjct ----------TLEELWEAAKTMGYRYLAVTDhspavrvaggpspeEALKRVGEIRRFNET  402
DSSP  ----------LHHHHHHHHHHHLLLEEEEEEelhhhhllllllhhHHHHHHHHHHHHHHH


DSSP  HLL-EEEEEleelllllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLHHhl
Query FGQ-RAFVGkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpivTPRFSLsc  211
ident  |      |                                                   
Sbjct HGPpYLLAG-------------------------------------------AEVDIH--  417
DSSP  HLLlEEEEE-------------------------------------------EEEELL--


DSSP  lhhhhhhHHHHHhhhllEEEEEElllhHHHHHhhhhllLLLL-HHHHHHHLLLLlllEEE
Query setlmgeLGNIAktrdlHIQSHIsenrDEVEAvknlypSYKN-YTSVYDKNNLLtnkTVM  270
ident                                                   |       | 
Sbjct -pdgtldYPDWVlreldLVLVSV---hSRFNL----pkADQTkRLLKALENPFV---HVL  466
DSSP  -llllllLLHHHhllllEEEEEL---lLLLLL----lhHHHHhHHHHHHLLLLL---LEE


DSSP  EELLL-----------lLHHHHHHHHHHLLEEEELhHHHHhllLLLL---LHHHHHHLLL
Query AHGCY-----------lSAEELNVFHERGASIAHCpNSNLslsSGFL---NVLEVLKHEV  316
ident ||                        | |                 |             
Sbjct AHPTArllgrrapieadWEAVFQKAKEKGVAVEID-GYYD---RMDLpddLARMAYGMGL  522
DSSP  LLLLLllllllllllllHHHHHHHHHHHLLEEEEE-LLLL---LLLLlhhHHHHHHHLLL


DSSP  EEEELLLLLllLLLLhhHHHHHHHHHHHhhhhllllllLLLHhhhhhHHLHhhhhhlLLL
Query KIGLGTDVAggYSYSmlDAIRRAVMVSNillinkvnekSLTLkevfrLATLggsqalGLD  376
ident  | | ||                                        | ||       | 
Sbjct WISLSTDAHqtDHLR--FMELAVGTAQR---------aWIGP--ervLNTL---dyeDLL  566
DSSP  LEEEELLLLlhHHHH--HHHHHHHHHHH---------lLLLL--lllHHHL---lhhHHH


DSSP  Llllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeel
Query Geignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvg  436
ident                                                             
Sbjct S-----------------------------------------------------------  567
DSSP  H-----------------------------------------------------------


DSSP  leeeelll
Query gkqvvpfs  444
ident         
Sbjct wlkarrgv  575
DSSP  hhhlllll


No 54: Query=2uz9A Sbjct=3f2bA Z-score=8.2

back to top
DSSP  ------llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlLL
Query ------plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcFK   54
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaEL   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhHH


DSSP  HHH---------------------------------eeellllleEEELEEEEEeEHHHh
Query PCE---------------------------------irelshhefFMPGLVDTHiHASQy   81
ident                                                   |  |      
Sbjct MSGvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapEGEKRVELH-LHTP-  118
DSSP  HHLllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllLLLLLLLLL-LLLL-


DSSP  hhllllllllhhhhhhhlHHHHHhhhhlhhhhhhHHHHHHHHHHHLLEEEEEEEL-LLLH
Query sfagssidlpllewltkyTFPAEhrfqnidfaeeVYTRVVRRTLKNGTTTACYFA-TIHT  140
ident                                     |       | |             
Sbjct -----------------mSQMDA---------vtSVTKLIEQAKKWGHPAIAVTDhAVVQ  152
DSSP  -----------------lLLLLL---------llLHHHHHHHHHHLLLLLEEELLlLLLL


DSSP  hHHHHHHHHHHHHLLEEEEELEelllllllllllllhhhhhhhhhhhhhhhhhhllllee
Query dSSLLLADITDKFGQRAFVGKVcmdlndtfpeyketteesiketerfvsemlqknysrvk  200
ident  |         | |     |                                        
Sbjct -SFPEAYSAAKKHGMKVIYGLE--------------------------------------  173
DSSP  -LHHHHHHHHHHHLLLEEEEEE--------------------------------------


DSSP  eeeeeLLHH----------------------------------HLLHhhHHHHHHHHhhh
Query pivtpRFSL----------------------------------SCSEtlMGELGNIAktr  226
ident                                                     |       
Sbjct -----ANIVddpfhvtllaqnetglknlfklvslshiqyfhrvPRIP--RSVLVKHR---  223
DSSP  -----EEEEllleeeeeeellhhhhhhhhhhhhhhhlllllllLLEE--HHHHHHLL---


DSSP  LLEEeeeelllhhhhhhhhhhllllllhhhhhhhlllllllEEEEE----llllLHHHHH
Query DLHIqshisenrdeveavknlypsyknytsvydknnlltnkTVMAH----gcylSAEELN  282
ident |                                                           
Sbjct DGLL-------------------------------------VGSGCdkgelfdnVEDIAR  246
DSSP  LLEE-------------------------------------EELLLllllllllLLLLHH


DSSP  HHhhhlLEEEELHhhHHHLLL-----------LLLL-HHHHHHLLLEEEELLLLL-----
Query VFhergASIAHCPnsNLSLSS-----------GFLN-VLEVLKHEVKIGLGTDVA-----  325
ident             |                        |    |          |      
Sbjct FY----DFLEVHP--PDVYKPlyvkdeemiknIIRSiVALGEKLDIPVVATGNVHylnpe  300
DSSP  HL----LLEEELL--HHHHLLlllllhhhhhhHHHHhHHHHHHLLLLEEELLLLLlllhh


DSSP  -----------------------llLLLLHH-HHHHHHHHhhhhhhhlllllllLLHHHH
Query -----------------------ggYSYSML-DAIRRAVMvsnillinkvneksLTLKEV  361
ident                                                       |     
Sbjct dkiyrkilihsqgganplnrhelpdVYFRTTnEMLDCFSF--------------LGPEKA  346
DSSP  hhhhhhhhhhllhhhllllllllllLLLLLHhHHHHHHHH--------------HHHHHH


DSSP  HHHHLHHHHHhLLLL---------------------------------------------
Query FRLATLGGSQaLGLD---------------------------------------------  376
ident                                                             
Sbjct KEIVVDNTQK-IASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklvee  405
DSSP  HHHHLHHHHH-HHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct rlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpp  465
DSSP  hhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct hyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdid  525
DSSP  eeelllllleeellllllllhhhllllllllllllleeellllllhhhhlllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct lnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidr  585
DSSP  eeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct laagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnll  645
DSSP  hhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct kldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigi  705
DSSP  eeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct pefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrdd  765
DSSP  lllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct imvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkah  825
DSSP  hhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct aaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqa  885
DSSP  hhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhl


DSSP  -----------------------------------------llllllllllllleeeell
Query -----------------------------------------geignfevgkefdailinp  395
ident                                                             
Sbjct takekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaq  945
DSSP  lhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhh


DSSP  lllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query kasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                                  
Sbjct aivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 55: Query=2uz9A Sbjct=1m65A Z-score=7.8

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeelEEEEEEEHHhhhhllllllllhhhhhhhlhhhHHHHhhlhhhhhhHHHHH
Query lshheffmpgLVDTHIHASqysfagssidlpllewltkytfpAEHRfqnidfaeeVYTRV  120
ident            || | |                         |                 
Sbjct ---------yPVDLHMHTV-----------------------ASTH------aysTLSDY   22
DSSP  ---------lLEELLLLLL-----------------------LLLL------lllLHHHH


DSSP  HHHHHHLLEEEEEEEL-------LLLHHHH-hhhhHHHHHHLLEEEEEleelllllllll
Query VRRTLKNGTTTACYFA-------TIHTDSS-lllaDITDKFGQRAFVGkvcmdlndtfpe  172
ident        |                 |               |     |            
Sbjct IAQAKQKGIKLFAITDhgpdmedAPHHWHFinmriWPRVVDGVGILRG------------   70
DSSP  HHHHHHHLLLEEEEEEellllllLLLLHHHhhhhhLLLEELLEEEEEE------------


DSSP  llllhhhhhhhhhhhhhhhhhhlllleeeeEEELLHHhllhhhhhhhhhhHHHHLL----
Query yketteesiketerfvsemlqknysrvkpiVTPRFSLscsetlmgelgniAKTRDL----  228
ident                                                             
Sbjct ------------------------------IEANIKN-------vdgeidCSGKMFdsld   93
DSSP  ------------------------------EEEELLL-------llllllLLHHHHhhll


DSSP  EEEEEElllhhhhhHHHHhlLLLL-LHHHHHHHLLLLlllEEEEELLL-----lLHHHHH
Query HIQSHIsenrdeveAVKNlyPSYK-NYTSVYDKNNLLtnkTVMAHGCY-----lSAEELN  282
ident  |            |                             |               
Sbjct LIIAGF---hepvfAPHD--KATNtQAMIATIASGNV---HIISHPGNpkyeidVKAVAE  145
DSSP  EEEEEL---lllllLLLL--HHHHhHHHHHHHHLLLL---LEELLLLLllllllHHHHHH


DSSP  HHHHHLLEEEELHHHhhhlllLLLL-HHHHHHLLLEEEELLLLLlllLLLHhhhHHHHHH
Query VFHERGASIAHCPNSnlslssGFLN-VLEVLKHEVKIGLGTDVAggySYSMldaIRRAVM  341
ident               |              |        || |                  
Sbjct AAAKHQVALEINNSS------NCREvAAAVRDAGGWVALGSDSHtafTMGE---FEECLK  196
DSSP  HHHHHLLEEEEELLL------LHHHhHHHHHHHLLLEEEELLLLlhhHLLL---LHHHHH


DSSP  HHHHHHhlllllllllhhhhhhHHLHhhhhhlLLLLlllllllLLLLleeeellllllll
Query VSNILLinkvneksltlkevfrLATLggsqalGLDGeignfevGKEFdailinpkasdsp  401
ident                       |          |                          
Sbjct ILDAVD----------fpperiLNVS---prrLLNF-lesrgmAPIA-------------  229
DSSP  HHHHLL----------llhhhlHHHL---hhhHHHH-hhhlllLLLH-------------


DSSP  lllllhhhhlllllhhhhhhhhhllhhheeeeeELLEeeelll
Query idlfygdffgdiseaviqkflylgddrnieevyVGGKqvvpfs  444
ident                                            
Sbjct ---------------------------------EFAD-----l  234
DSSP  ---------------------------------HHLL-----l


No 56: Query=2uz9A Sbjct=1bksA Z-score=7.7

back to top
DSSP  llleeeeeeeeELLLlllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvHSTWtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct meryenlfaqlNDRR---------------------------------------------   15
DSSP  lhhhhhhhhhhHHLL---------------------------------------------


DSSP  llllleeeeleEEEEEEHHHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhHHHHHHH
Query lshheffmpglVDTHIHASQYSfagssidlpllewltkytfpaehrfqnidfaEEVYTRV  120
ident                                                       |     
Sbjct ---------egAFVPFVTLGDP------------------------------gIEQSLKI   36
DSSP  ---------llEEEEEEELLLL------------------------------lHHHHHHH


DSSP  HHHHHHLLEeEEEEELL-----------------------llHHHHHHHHHHHHHHL-lE
Query VRRTLKNGTtTACYFAT-----------------------ihTDSSLLLADITDKFG-qR  156
ident        |   |                                                
Sbjct IDTLIDAGA-DALELGVpfsdpladgptiqnanlrafaagvtPAQCFEMLALIREKHptI   95
DSSP  HHHHHHLLL-LLEEEELlllllllllhhhhhhhhhhhhhlllHHHHHHHHHHHHHHLllL


DSSP  EEEELEELLlllllllllllHHHHHHHHHHHHHHHHhhlllleEEEEEELlhhHLLHHHH
Query AFVGKVCMDlndtfpeyketTEESIKETERFVSEMLqknysrvKPIVTPRfslSCSETLM  216
ident                         |                     |             
Sbjct PIGLLMYAN---------lvFNNGIDAFYARCEQVG-------VDSVLVA---DVPVEES  136
DSSP  LEEEEELHH---------hhHLLLHHHHHHHHHHHL-------LLEEEEL---LLLHHHL


DSSP  HHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllLLLHHHHHHhlLLLLllEEEEELlll
Query GELGNIAKTRDLHIQSHISenrdeveavknlypsYKNYTSVYDknNLLTnkTVMAHGcyl  276
ident       |                                                     
Sbjct APFRQAALRHNIAPIFICP------------pnaDDDLLRQVA--SYGR--GYTYLLalp  180
DSSP  HHHHHHHHHLLLEEEEEEL------------lllLHHHHHHHH--HHLL--LLEEELlll


DSSP  LHHHHHHHHH-HLLEEEELhHHHHhlllllLLHHHHhhllleEEELLLllLLLL------
Query SAEELNVFHE-RGASIAHCpNSNLslssgfLNVLEVlkhevkIGLGTDvaGGYS------  329
ident          |   |                  |          |                
Sbjct LHHLIEKLKEyHAAPALQGfGISS-peqvsAAVRAG-----aAGAISG--SAIVkiiekn  232
DSSP  HHHHHHHHHHhLLLLEEELlLLLL-hhhhhHHHHHL-----lLEEEEL--LHHHhhhhhl


DSSP  ------------lLHHHHHHHHHhhhhhhhhlllllllllhhhhhhhhlhhhhhhlllll
Query ------------ySMLDAIRRAVmvsnillinkvneksltlkevfrlatlggsqalgldg  377
ident                                                             
Sbjct laspkqmlaelrsFVSAMKAASR-------------------------------------  255
DSSP  lllhhhhhhhhhhHHHHHHHLLL-------------------------------------


DSSP  lllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeell
Query eignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvgg  437
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  eeeelll
Query kqvvpfs  444
ident        
Sbjct -------  255
DSSP  -------


No 57: Query=2uz9A Sbjct=2yb1A Z-score=6.0

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleeeelEEEEEEEH---HHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHH
Query lshheffmpgLVDTHIHA---SQYSfagssidlpllewltkytfpaehrfqnidfaeeVY  117
ident             | | |                                           
Sbjct ---------aNIDLHFHSrtsDGAL---------------------------------TP   18
DSSP  ---------lLEELLLLLlllLLLL---------------------------------LH


DSSP  HHHHHHHHHLLEEEEEEELlllhhhHHHHHHHHHHHLLEEEEEleelllllllllllllh
Query TRVVRRTLKNGTTTACYFAtihtdsSLLLADITDKFGQRAFVGkvcmdlndtfpeykett  177
ident | |  |                       |      |     |                 
Sbjct TEVIDRAAARAPALLALTDhdctggLAEAAAAAARRGIPFLNG-----------------   61
DSSP  HHHHHHHHLLLLLEEEELLllllllHHHHHHHHHHLLLLEEEE-----------------


DSSP  hhhhhhhhhhhhhhhhhlllleeeeeEELLHH----------hllhhhhHHHHHHHHH--
Query eesiketerfvsemlqknysrvkpivTPRFSL----------scsetlmGELGNIAKT--  225
ident                                                    |    |   
Sbjct --------------------------VEVSVSwgrhtvhivglgidpaePALAAGLKSir   95
DSSP  --------------------------EEEEEEelleeeeeeeellllllHHHHHHHHHhh


DSSP  --------------------------------------------------hlleeeeeel
Query --------------------------------------------------rdlhiqshis  235
ident                                                             
Sbjct egrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrk  155
DSSP  llhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhh


DSSP  llhhhhhhhHHHLlllllhhhHHHH-lLLLL---lLEEEEELLL------lLHHHHHHHH
Query enrdeveavKNLYpsyknytsVYDK-nNLLT---nKTVMAHGCY------lSAEELNVFH  285
ident                                      | ||                 | 
Sbjct yltpgkpgyVSHQ------waSLEDavGWIVgaggMAVIAHPGRydmgrtlIERLILDFQ  209
DSSP  lllllllllLLLL------llLHHHhhHHHHhlllEEEELLHHHllllhhhHHHHHHHHH


DSSP  H-HLLEEEE-LHHHHHhlllLLLL--HHHHHHLLLEEEELLLLL-lllLLLHhhHHHHHH
Query E-RGASIAH-CPNSNLslssGFLN--VLEVLKHEVKIGLGTDVA-ggySYSMldAIRRAV  340
ident    |  |        |           |    |      | |                  
Sbjct AaGGQGIEVaSGSHSL----DDMHkfALHADRHGLYASSGSDFHapgeDVGH--TEDLPP  263
DSSP  HlLLLEEEEeELLLLH----HHHHhhHHHHHHHLLEEEEELLLLllllLLLL--LLLLLL


DSSP  hhhhhhhhlllllllllhhhhhhhhlhHHHHhlLLLLLllllllllllleeeelllllll
Query mvsnillinkvneksltlkevfrlatlGGSQalGLDGEignfevgkefdailinpkasds  400
ident                                   |                         
Sbjct ------------------------icrPIWR--ELEAR----------------------  275
DSSP  ------------------------lllLHHH--HLHHH----------------------


DSSP  llllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll
Query pidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
ident                                             
Sbjct -----------------------------------ilrpadaen  284
DSSP  -----------------------------------lllllhhhl


No 58: Query=2uz9A Sbjct=3e38A Z-score=5.6

back to top
DSSP  llleeeeeeeEELLllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfVHSTwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct -aqrrneiqvPDLD----------------------------------------------   13
DSSP  -lllllllllLLLL----------------------------------------------


DSSP  llllleeEELEEEEEEEH---HHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhhhHH
Query lshheffMPGLVDTHIHA---SQYSfagssidlpllewltkytfpaehrfqnidfaeeVY  117
ident             | | |                                           
Sbjct -----gyTTLKCDFHXHSvfsDGLV---------------------------------WP   35
DSSP  -----llEEEEEELLLLLlllLLLL---------------------------------LH


DSSP  HHHHHHHHHLLEEEEEEEL------------lLLHHHHHHHHHHHHHHLLEEEEEleell
Query TRVVRRTLKNGTTTACYFA------------tIHTDSSLLLADITDKFGQRAFVGkvcmd  165
ident |  |      |                      |  |  |      | |     |     
Sbjct TVRVDEAYRDGLDAISLTEhieyrphkqdvvsDHNRSFDLCREQAEKLGILLIKG-----   90
DSSP  HHHHHHHHHLLLLEELLEEellllllllllllLLLHHHHHHHHHHHHHLLEELLE-----


DSSP  lllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLHH--------------hl
Query lndtfpeyketteesiketerfvsemlqknysrvkpivTPRFSL--------------sc  211
ident                                                             
Sbjct -------------------------------------sEITRAXapghfnaiflsdsnpl  113
DSSP  -------------------------------------eEEELLLllleeeeelllllhhh


DSSP  lHHHHHHHHHHHHhHLLEeeeeelllhhhhhhhhhhllllllhhhhhhhllllllLEEEE
Query sETLMGELGNIAKtRDLHiqshisenrdeveavknlypsyknytsvydknnlltnKTVMA  271
ident            ||                                               
Sbjct eQKDYKDAFREAK-KQGA-------------------------------------FXFWN  135
DSSP  lLLLHHHHHHHHH-HLLL-------------------------------------EEEEL


DSSP  ELL--------LLLHHHHHHhHHHL--LEEEELHHHHhhlllLLLL-HHHHHHLLLEEEE
Query HGC--------YLSAEELNVfHERG--ASIAHCPNSNlslssGFLN-VLEVLKHEVKIGL  320
ident |               |       |    |                     |        
Sbjct HPGwdsqqpdtTKWWPEHTAlYQEGcxHGIEVANGHL-----YXPEaIQWCLDKNLTXIG  190
DSSP  LLLllllllllLLLLHHHHHhHHLLllLEEEEEELLE-----ELLHhHHHHHHHLLEEEE


DSSP  LLLLL------llllllhHHHHhhhhhhhhhhhhlllllllllhhhhhhhHLHHhhhhll
Query GTDVA------ggysysmLDAIrravmvsnillinkvneksltlkevfrlATLGgsqalg  374
ident   |                                                         
Sbjct TSDIHqpiqtdydfekgeHRTX----------------------------TFVF------  216
DSSP  ELLLLllhhhhllhhhllLLLE----------------------------EEEE------


DSSP  lllllllllllLLLL-----------------eeeelllllllllllllhHHHL------
Query ldgeignfevgKEFD-----------------ailinpkasdspidlfygDFFG------  411
ident            ||                                               
Sbjct ----------aKERSlqgirealdnrrtaayfhelligredllrpffekcVKIEevsrne  266
DSSP  ----------eLLLLhhhhhhhhhllleeeeelleeellhhhhhhhhhhhEEEEeeeeel


DSSP  ----lLLLHHHhhHHHH-----------------------------------------ll
Query ----dISEAVIqkFLYL-----------------------------------------gd  426
ident          |    | |                                           
Sbjct qgvtlSITNVT--DLVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfe  324
DSSP  leeeeEEEELL--LLLEeeeelllllleellleeeellleeeeeeeeellllllleeeee


DSSP  hhheeeeeelleeeelll
Query drnieevyvggkqvvpfs  444
ident                   
Sbjct vtnfivapdkglkytisl  342
DSSP  eeeeeeelleeeeeeeel


No 59: Query=2uz9A Sbjct=2anuA Z-score=5.4

back to top
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee
Query plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llllleEEELEEEEEEEHH---HHHHllllllllhhhhhhhlhhhhhhhhhlhhhhhhhH
Query lshhefFMPGLVDTHIHAS---QYSFagssidlpllewltkytfpaehrfqnidfaeevY  117
ident           | | | |                                           
Sbjct ------TEWLLCDFHVHTNxsdGHLP---------------------------------L   21
DSSP  ------LEEEEEEEEELLLlllLLLL---------------------------------H


DSSP  HHHHHHHHHLLEEEEEEEL-----------------------lLLHHHHHHHHHHHHHHL
Query TRVVRRTLKNGTTTACYFA-----------------------tIHTDSSLLLADITDKFG  154
ident   ||    | |                                   |    |        
Sbjct GEVVDLFGKHGVDVVSITDhivdrrtleqrkrngeplgaitedKFQDYLKRLWREQKRAW   81
DSSP  HHHHHHHHHLLLLEEEEEEeeelhhhhhhhhhlllllllllllLHHHHHHHHHHHHHHHH


DSSP  ----LEEEEEleelllllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLHH-
Query ----QRAFVGkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpivTPRFSL-  209
ident          |                                                  
Sbjct eeygXILIPG-------------------------------------------VEITNNt   98
DSSP  hhhlLEEEEE-------------------------------------------EEEEELl


DSSP  --------------HLLHhHHHHHHHHHHhHLLEEeeeelllhhhhhhhhhhllllllhh
Query --------------SCSEtLMGELGNIAKtRDLHIqshisenrdeveavknlypsyknyt  255
ident                 |     |     |                               
Sbjct dlyhivavdvkeyvDPSL-PVEEIVEKLK-EQNAL-------------------------  131
DSSP  lleeeeeellllllLLLL-LHHHHHHHHH-HLLLE-------------------------


DSSP  hhhhhlllllllEEEEEL-----llllhHHHHHHHHHLLEEE-ELHHhhhhllllLLLHh
Query svydknnlltnkTVMAHG-----cylsaEELNVFHERGASIA-HCPNsnlslssgFLNVl  309
ident                ||                |                      |   
Sbjct ------------VIAAHPdrkklswylwANXERFKDTFDAWEiANRD--------DLFN-  170
DSSP  ------------EEELLLlllllllhhhHLLLLLLLLLLEEEeEELL--------EELH-


DSSP  HHHHLLLEEEELLLLLLLLLllhHHHHhhhhhhhhhhhhlllllllllhhhhhhHHLH--
Query EVLKHEVKIGLGTDVAGGYSysmLDAIrravmvsnillinkvneksltlkevfrLATL--  367
ident  |           |                                              
Sbjct SVGVKKYRYVANSDFHELWH---VYSW---------------------------KTLVks  200
DSSP  HHHHLLLLEEEELLLLLHHH---HLLE---------------------------EEEEee


DSSP  -hhhhhLLLLllllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhll
Query -ggsqaLGLDgeignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgd  426
ident                                                             
Sbjct eknieaIKEA--------------------------------------------------  210
DSSP  lllhhhHHHH--------------------------------------------------


DSSP  hhheeeeeelleeeelll
Query drnieevyvggkqvvpfs  444
ident                   
Sbjct ----irkntdvaiylxrk  224
DSSP  ----hhhllleeeeelll