Results: dupa

Query: 2qpxA

MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2qpx-A 69.3  0.0  376   376  100 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
   2:  1j5s-A 25.2  3.8  337   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
   3:  3iac-A 22.2  3.4  324   469   13 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
   4:  3irs-A 19.2  3.1  239   281   14 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   5:  3cjp-A 17.8  2.8  212   262   15 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   6:  3giq-A 17.3  3.3  241   475   15 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   7:  4dlf-A 17.2  3.0  223   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   8:  2ob3-A 17.0  3.2  235   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   9:  1bf6-A 16.9  3.2  235   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  10:  2dvt-A 16.5  3.7  229   325   14 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  11:  3k2g-B 16.4  3.2  238   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  12:  4b3z-D 16.3  3.2  237   477   10 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  13:  1onx-A 16.0  3.2  227   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  14:  1gkp-A 15.8  3.1  225   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  15:  2vc5-A 15.8  3.0  232   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  16:  4hk5-D 15.8  3.7  238   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  17:  1itq-A 15.3  3.3  229   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  18:  2y1h-B 15.2  3.3  217   265   14 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  19:  3e74-A 15.0  3.2  222   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  20:  4qrn-A 14.9  3.5  220   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  21:  3pnu-A 14.7  3.2  220   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  2gwg-A 14.7  3.3  215   329   15 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  23:  4ofc-A 14.6  3.4  220   335   12 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  24:  2ffi-A 14.5  3.5  216   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  25:  4mup-B 14.4  3.4  215   286   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  26:  2vun-A 14.2  3.3  222   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  27:  1a5k-C 13.8  3.2  222   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  28:  1j6p-A 13.7  4.0  226   407   11 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  29:  2paj-A 13.6  3.6  214   421   11 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  30:  4dzi-C 13.6  4.0  231   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  31:  3gri-A 13.6  3.4  221   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  32:  3nqb-A 13.5  4.0  218   587    9 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  33:  3mkv-A 13.4  4.1  224   414   13 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  34:  3ls9-A 13.3  4.3  232   453   13 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  35:  3gg7-A 13.2  3.8  211   243   12 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  1k6w-A 13.1  4.6  237   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  37:  3mtw-A 12.8  4.1  215   404   15 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  38:  1a4m-A 12.6  4.0  228   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  39:  4c5y-A 12.5  4.1  224   436   13 PDB  MOLECULE: OCHRATOXINASE;                                             
  40:  4rdv-B 12.4  3.8  227   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  41:  2ogj-A 12.1  3.6  215   379   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  42:  4cqb-A 12.1  4.6  229   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  43:  2oof-A 11.9  4.7  222   403   10 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  44:  1yrr-B 11.7  3.5  194   334   10 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  45:  2imr-A 11.6  4.1  217   380    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  46:  2uz9-A 11.4  4.2  219   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  47:  3icj-A 11.0  4.4  220   468   11 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  48:  3ooq-A 10.8  4.3  207   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  3qy6-A 10.4  3.3  183   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1v77-A  9.0  3.7  170   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A  8.5  4.8  244   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3au2-A  8.0  4.1  202   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  1m65-A  7.0  3.9  176   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3dcp-A  6.1  4.0  156   277   14 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  5.5  3.7  153   994    7 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  4.9  4.1  153   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  4.7  4.2  147   284   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  4.3  4.2  148   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  3.1  4.2  122   224   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2qpxA Sbjct=2qpxA Z-score=69.3

back to top
DSSP  LLLLLHHHHHHLLEEEEEELLLLLLLLLLHHHHHHHHLLLLLLLLLHHHHLLLHHHHHHH
Query GXDDLSEFVDQVPLLDHHCHFLIDGKVPNRDDRLAQVSTEADKDYPLADTKNRLAYHGFL   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GXDDLSEFVDQVPLLDHHCHFLIDGKVPNRDDRLAQVSTEADKDYPLADTKNRLAYHGFL   60
DSSP  LLLLLHHHHHHLLEEEEEELLLLLLLLLLHHHHHHHHLLLLLLLLLHHHHLLLHHHHHHH


DSSP  HHHHHHLLLLLLLLLLLLHHHHHHHHHHHHHHLLEEEEEEELLLLLLLLLLLHHHHHHHH
Query ALAKEFALDANNPLAAXNDPGYATYNHRIFGHFHFKELLIDTGFVPDDPILDLDQTAELV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ALAKEFALDANNPLAAXNDPGYATYNHRIFGHFHFKELLIDTGFVPDDPILDLDQTAELV  120
DSSP  HHHHHHLLLLLLLLLLLLHHHHHHHHHHHHHHLLEEEEEEELLLLLLLLLLLHHHHHHHH


DSSP  LLLEEEEEEHHHHHHHHHLLLLLHHHHHHHHHHHHHLLLLLLLLLEEELHHHHLLLLLLL
Query GIPVKAIYRLETHAEDFXLEHDNFAAWWQAFSNDVKQAKAHGFVGFXSIAAYRVGLHLEP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GIPVKAIYRLETHAEDFXLEHDNFAAWWQAFSNDVKQAKAHGFVGFXSIAAYRVGLHLEP  180
DSSP  LLLEEEEEEHHHHHHHHHLLLLLHHHHHHHHHHHHHLLLLLLLLLEEELHHHHLLLLLLL


DSSP  LLHHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHLLLEEEEELLLLLLLLHHH
Query VNVIEAAAGFDTWKHSGEKRLTSKPLIDYXLYHVAPFIIAQDXPLQFHVGYGDADTDXYL  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VNVIEAAAGFDTWKHSGEKRLTSKPLIDYXLYHVAPFIIAQDXPLQFHVGYGDADTDXYL  240
DSSP  LLHHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHLLLEEEEELLLLLLLLHHH


DSSP  LLHHHHHHHHHHHHHHLLLEEEEELLLLHHHHHHHHHHLLLEEEELLLHHHHLHHHHHHH
Query GNPLLXRDYLKAFTKKGLKVVLLHCYPYHREAGYLASVFPNLYFDISLLDNLGPSGASRV  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GNPLLXRDYLKAFTKKGLKVVLLHCYPYHREAGYLASVFPNLYFDISLLDNLGPSGASRV  300
DSSP  LLHHHHHHHHHHHHHHLLLEEEEELLLLHHHHHHHHHHLLLEEEELLLHHHHLHHHHHHH


DSSP  HHHHLLLLLHHHEELLLLLLLLHHHHHHHHHHHHHHHHHHHHLLLLLLHHHHHHHHHHHH
Query FNEAVELAPYTRILFASDASTYPEXYGLAARQFKQALVAHFNQLPFVDLAQKKAWINAIC  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FNEAVELAPYTRILFASDASTYPEXYGLAARQFKQALVAHFNQLPFVDLAQKKAWINAIC  360
DSSP  HHHHLLLLLHHHEELLLLLLLLHHHHHHHHHHHHHHHHHHHHLLLLLLHHHHHHHHHHHH


DSSP  LHHHHHHLLLHHHHLL
Query WQTSAKLYHQERELRV  376
ident ||||||||||||||||
Sbjct WQTSAKLYHQERELRV  376
DSSP  LHHHHHHLLLHHHHLL


No 2: Query=2qpxA Sbjct=1j5sA Z-score=25.2

back to top
DSSP  -----------lLLLL--HHHHHHLLEEEEEELLL-----lLLLLLLHHHHHH-HHLL-l
Query -----------gXDDL--SEFVDQVPLLDHHCHFL-----iDGKVPNRDDRLA-QVST-e   40
ident                      |   |  | | |                           
Sbjct hmflgedylltnRAAVrlFNEVKDLPIVDPHNHLDakdiveNKPWNDIWEVEGaTDHYvw   60
DSSP  llllllllllllHHHHhhHHHHLLLLEEELLLLLLhhhhhhLLLLLLHHHHHLlLLHHhh


DSSP  LLLLLL-----------------------HHHHLLLHHHHHHHHHHHHHL----------
Query ADKDYP-----------------------LADTKNRLAYHGFLALAKEFA----------   67
ident                                       |                     
Sbjct ELMRRCgvseeyitgsrsnkekwlalakvFPRFVGNPTYEWIHLDLWRRFnikkviseet  120
DSSP  HHHHHLlllhhhllllllhhhhhhhhhhhHHHHLLLHHHHHHHHHHHHHLlllllllhhh


DSSP  --llLLLL-lLLLLhhhhhHHHHHHHHHLLEEEEEEELLlllllllLLHHHHH-HHHLLL
Query --ldANNP-lAAXNdpgyaTYNHRIFGHFHFKELLIDTGfvpddpiLDLDQTA-ELVGIP  123
ident                                  |                       |  
Sbjct aeeiWEETkkKLPE-----MTPQKLLRDMKVEILCTTDD--pvstlEHHRKAKeAVEGVT  173
DSSP  hhhhHHHHhhHLLL-----LLHHHHHHHLLEEEEELLLL--lllllHHHHHHHhHLLLLE


DSSP  EEEEEEHHHHHH-------hHHLL--------LLLHHHHHHHHHHHHHLLLLLLLLLEEE
Query VKAIYRLETHAE-------dFXLE--------HDNFAAWWQAFSNDVKQAKAHGFVGFXS  168
ident      |                                   |        | || |    
Sbjct ILPTWRPDRAMNvdkegwreYVEKmgerygedTSTLDGFLNALWKSHEHFKEHGCVASDH  233
DSSP  EELLLLLHHHHLlllllhhhHHHHhhhhhlllLLLHHHHHHHHHHHHHHHHLLLLLEEEE


DSSP  LHHhhlLLLLLLLLHHHHHHHHHHHHHHLL-llllLHHHHHHHHHHHHHHHHHHLLLEEE
Query IAAyrvGLHLEPVNVIEAAAGFDTWKHSGE-krltSKPLIDYXLYHVAPFIIAQDXPLQF  227
ident             |    | |                                      | 
Sbjct ALL---EPSVYYVDENRARAVHEKAFSGEKltqdeINDYKAFMMVQFGKMNQETNWVTQL  290
DSSP  EEL---LLLLLLLLHHHHHHHHHHHLLLLLllhhhHHHHHHHHHHHHHHHHHHHLLEEEE


DSSP  EELLL---------------LLLL-LHHHlLHHH-HHHHHHHHHHhLLLEEEEeLLLL--
Query HVGYG---------------DADT-DXYLgNPLL-XRDYLKAFTKkGLKVVLLhCYPY--  268
ident | |                   |     |       |  |  |    || ||        
Sbjct HIGALrdyrdslfktlgpdsGGDIsTNFL-RIAEgLRYFLNEFDG-KLKIVLY-VLDPth  347
DSSP  EELEEllllhhhhhhlllllLLLEeLLLL-LHHHhHHHHHHHLLL-LLLEEEE-ELLHhh


DSSP  HHHHHHHHHHLLLEE-EELLLHHhhLHHH-HHHHHHHHLLLLLHHHE-ELLLLLLlLHHH
Query HREAGYLASVFPNLY-FDISLLDnlGPSG-ASRVFNEAVELAPYTRI-LFASDAStYPEX  325
ident        |  ||| |                                     |       
Sbjct LPTISTIARAFPNVYvGAPWWFN--DSPFgMEMHLKYLASVDLLYNLaGMVTDSR-KLLS  404
DSSP  HHHHHHHHHHLLLEEeLLLLLLL--LLHHhHHHHHHHHHLLLLHHHLlLLLLLLL-LLLH


DSSP  HHHHHHHHHHHHHHHHHLL---LLLLHHHHHHHHHHHHLHHHHHHLLlhhhhll
Query YGLAARQFKQALVAHFNQL---PFVDLAQKKAWINAICWQTSAKLYHqerelrv  376
ident  |     |   |                                |         
Sbjct FGSRTEMFRRVLSNVVGEMvekGQIPIKEARELVKHVSYDGPKALFF-------  451
DSSP  HHHHHHHHHHHHHHHHHHHhhlLLLLHHHHHHHHHHHHLHHHHHHHL-------


No 3: Query=2qpxA Sbjct=3iacA Z-score=22.2

back to top
DSSP  -------------lllLLHH-HHHHLLEEEEEELLL------lLLLLL--LHHHHhhHHL
Query -------------gxdDLSE-FVDQVPLLDHHCHFL------iDGKVP--NRDDRlaQVS   38
ident                  |        |  | |||                          
Sbjct atfxtedfllkndiarTLYHkYAAPXPIYDFHCHLSpqeiaddRRFDNlgQIWLE--GDH   58
DSSP  llllllllllllhhhhHHHHhLLLLLLEEELLLLLLhhhhhhlLLLLLhhHHHHL--LLL


DSSP  LlllllLLHHH---------------------------hLLLHHHHHHHHHHHH-HLLL-
Query TeadkdYPLAD---------------------------tKNRLAYHGFLALAKE-FALD-   69
ident         |                                         |         
Sbjct Y---kwRALRSagvdeslitgketsdyekyxawantvpkTLGNPLYHWTHLELRrPFGIt  115
DSSP  H---hhHHHHHllllhhhlllllllhhhhhhhhhhhhhhLLLLHHHHHHHHHHHlLLLLl


DSSP  ------------LLLLlllLLHHHHHhhHHHHHHHLLEEEEEEELLllllllllLHHHH-
Query ------------ANNPlaaXNDPGYAtyNHRIFGHFHFKELLIDTGfvpddpilDLDQT-  116
ident                       |        |                         |  
Sbjct gtlfgpdtaesiWTQCnekLATPAFS--ARGIXQQXNVRXVGTTDD--pidsleYHRQIa  171
DSSP  lllllhhhhhhhHHHHhhhHLLHHHL--HHHHHHHLLEEEEELLLL--lllllhHHHHHh


DSSP  -hhhhLLLEEEEEEHHHHH-------hhHHLL--------LLLHHHHHHHHHHHHHLLLL
Query -aelvGIPVKAIYRLETHA-------edFXLE--------HDNFAAWWQAFSNDVKQAKA  160
ident       | |    |                             |    ||         |
Sbjct addsiDIEVAPSWRPDKVFkieldgfvdYLRKleaaadvsITRFDDLRQALTRRLDHFAA  231
DSSP  hllllLLEEELLLLLHHHHllllllhhhHHHHhhhhhlllLLLHHHHHHHHHHHHHHHHH


DSSP  LLLLLEEELHHhhlLLLLLLLL-HHHHHHHHHHHHHHLL-llllLHHHHHHHHHHHHHHH
Query HGFVGFXSIAAyrvGLHLEPVN-VIEAAAGFDTWKHSGE-krltSKPLIDYXLYHVAPFI  218
ident  |             |   ||       |                       |       
Sbjct CGCRASDHGIE---TLRFAPVPdDAQLDAILGKRLAGETlseleIAQFTTAVLVWLGRQY  288
DSSP  LLLLEEEEEEL---LLLLLLLLlHHHHHHHHHHHHLLLLllhhhHHHHHHHHHHHHHHHH


DSSP  HHHLLLEEEEELlLLLL-----------------LLHHHlLHHHHHHHHHHHH--HHLLL
Query IAQDXPLQFHVGyGDAD-----------------TDXYLgNPLLXRDYLKAFT--KKGLK  259
ident  |     | | |                                    |          |
Sbjct AARGWVXQLHIG-AIRNnntrxfrllgpdtgfdsIGDNN-ISWALSRLLDSXDvtNELPK  346
DSSP  HHHLLEEEEEEL-EELLllhhhhhhhllllllleELLLL-LHHHHHHHHHHHHllLLLLE


DSSP  EEEeELLL--LHHHHHHHHHHLL------LEEEEL-LLHHhhLHHH-HHHHHHHHLLLLL
Query VVLlHCYP--YHREAGYLASVFP------NLYFDI-SLLDnlGPSG-ASRVFNEAVELAP  309
ident   |  |               |          |                |          
Sbjct TIL-YCLNprDNEVLATXIGNFQgpgiagKVQFGSgWWFN--DQKDgXLRQLEQLSQXGL  403
DSSP  EEE-EELLhhHHHHHHHHHHHLLllllllLEEELLlLHHH--LLHHhHHHHHHHHHHHLL


DSSP  H-HHEELLLLLLlLHHHhHHHHHHHHHHHHHHHHLL-----LLLLHHHHHHHHHHHHLHH
Query Y-TRILFASDAStYPEXyGLAARQFKQALVAHFNQL-----PFVDLAQKKAWINAICWQT  363
ident          |              |   |     |         | |        ||   
Sbjct LsQFVGXLTDSR-SFLS-YTRHEYFRRILCNLLGQWaqdgeIPDDEAXLSRXVQDICFNN  461
DSSP  HhHLLLLLLLLL-LLLL-LHHHHHHHHHHHHHHHHHhhlllLLLLHHHHHHHHHHHHLHH


DSSP  HHHHLLlhhhhll
Query SAKLYHqerelrv  376
ident              
Sbjct AQRYFT-----ik  469
DSSP  HHHHLL-----ll


No 4: Query=2qpxA Sbjct=3irsA Z-score=19.2

back to top
DSSP  lllllhhhhhhLLEEEEEELLLLL-lllllhhHHHHHHLLLllllllhhhhllLHHHhhH
Query gxddlsefvdqVPLLDHHCHFLID-gkvpnrdDRLAQVSTEadkdypladtknRLAYhgF   59
ident                |                 |                   |     |
Sbjct -----------LKIIDFRLRPPAMgflnariyTRPDIRNRF-----------tRQLG--F   36
DSSP  -----------LLLEELLLLLLLHhhhhlhhhHLHHHHHHH-----------hHHHL--L


DSSP  HHHHhhhllllllllllllhhhHHHHHHHHHHHLLEEEEEEELLL-------llllllLL
Query LALAkefaldannplaaxndpgYATYNHRIFGHFHFKELLIDTGF-------vpddpiLD  112
ident                                                             
Sbjct EPAP-------------saeekSLELMFEEMAAAGIEQGVCVGRNssvlgsvsnadvaAV   83
DSSP  LLLH-------------hhhhlLHHHHHHHHHHLLLLEEEEELLEellleellhhhhhHH


DSSP  HHHHHhhhlLLEEEEEEHhhHHHHhhlllllhhhhHHHHHHHHHLLLLLLLLLEEELHHH
Query LDQTAelvgIPVKAIYRLetHAEDfxlehdnfaawWQAFSNDVKQAKAHGFVGFXSIAAY  172
ident                      |                           |          
Sbjct AKAYP----DKFHPVGSI--EAAT-----------RKEAMAQMQEILDLGIRIVNLEPGV  126
DSSP  HHHLL----LLEEEEEEL--LLLL-----------HHHHHHHHHHHHHLLLLLEEELHHH


DSSP  ---HLLLLlllllhhhhhhhhhhhhhhlllllllhhhhHHHHHHHHHHHHHHLLLEEEEE
Query ---RVGLHlepvnvieaaagfdtwkhsgekrltskpliDYXLYHVAPFIIAQDXPLQFHV  229
ident                                       |  ||    |      |     
Sbjct watPMHVD------------------------------DRRLYPLYAFCEDNGIPVIMMT  156
DSSP  lllLLLLL------------------------------LHHHHHHHHHHHHLLLLEEEEL


DSSP  LLLlllLLHHHLLHHHHHHHHHHHHhhLLLEEEEE-LLLLHHHHHHHHHHLLLEEEELLL
Query GYGdadTDXYLGNPLLXRDYLKAFTkkGLKVVLLH-CYPYHREAGYLASVFPNLYFDISL  288
ident |      |    ||      |  |    | ||  |   |   |    |   ||||     
Sbjct GGN-agPDITYTNPEHIDRVLGDFP--DLTVVSSHgNWPWVQEIIHVAFRRPNLYLSPDM  213
DSSP  LLL-llLLHHHHLHHHHHHHHHHLL--LLLEEEEHhHLLLHHHHHHHHHHLLLEEEELHH


DSSP  HhhhLHHHhhHHHHHHLLL---LLHHHEELLLLLLllhhHHHHHHHHHHHhhHHHHhlll
Query LdnlGPSGasRVFNEAVEL---APYTRILFASDAStypeXYGLAARQFKQalVAHFnqlp  345
ident                           | ||                 |            
Sbjct Y---LYNL--PGHADFIQAansFLADRMLFGTAYP--mcPLKEYTEWFLT--LPIK----  260
DSSP  H---HLLL--LLHHHHHHHhllHHHHLLLLLLLLL--llLHHHHHHHHHL--LLLL----


DSSP  lllhhhhHHHHHHHHLHHHHHHLLlhhhhll
Query fvdlaqkKAWINAICWQTSAKLYHqerelrv  376
ident              |       |         
Sbjct -------PDAMEKILHGNAERLLA---qagr  281
DSSP  -------HHHHHHHHLHHHHHHHH---hlll


No 5: Query=2qpxA Sbjct=3cjpA Z-score=17.8

back to top
DSSP  lllllhhhhhhlLEEEEEELLLLLlllllhhhhhhhhlllllllllhhhhlllhhhhhhh
Query gxddlsefvdqvPLLDHHCHFLIDgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
ident                | | |                                        
Sbjct ------------LIIDGHTHVILP------------------------------------   12
DSSP  ------------LLEEEEEELLLL------------------------------------


DSSP  hhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLLLLLL-----------
Query alakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFVPDDP-----------  109
ident                             |                               
Sbjct ----------------------vEKHIKIMDEAGVDKTILFSTSIHPETavnlrdvkkem   50
DSSP  ----------------------hHHHHHHHHHHLLLEEEEELLLLLHHHlllhhhhhhhh


DSSP  -------------------------lLLHHHHHhhhlLLEEEEEEHHhhhhhhhlllllh
Query -------------------------iLDLDQTAelvgIPVKAIYRLEthaedfxlehdnf  144
ident                                                             
Sbjct kklndvvngktnsmidvrrnsikeltNVIQAYP----SRYVGFGNVP------------v   94
DSSP  hhhhhhhlllllllhhhhhhhhhhhhHHHHHLL----LLEEEEELLL------------l


DSSP  hhHHHHHHHHHHL-LLLLLLLLE-EELHhHHLLLllllllhhhhhhhhhhhhhhllllll
Query aaWWQAFSNDVKQ-AKAHGFVGF-XSIAaYRVGLhlepvnvieaaagfdtwkhsgekrlt  202
ident                     ||                                      
Sbjct glSENDTNSYIEEnIVNNKLVGIgELTP-ASGQI--------------------------  127
DSSP  llLHHHHHHHHHHhLLLLLLLEEeEELL-LLLLH--------------------------


DSSP  lhhhhhHHHHHHHHHHH-HHLLLEEEEELLllllllhHHLL--HHHHHHHHHHHHhhLLL
Query skplidYXLYHVAPFII-AQDXPLQFHVGYgdadtdxYLGN--PLLXRDYLKAFTkkGLK  259
ident         |             |   |           |            |||      
Sbjct ------KSLKPIFKYSMdSGSLPIWIHAFN-------PLVLqdIKEIAELCKAFP--KVP  172
DSSP  ------HHHHHHHHHHHhLLLLLEEELLLL-------LLLHhhHHHHHHHHHHLL--LLL


DSSP  EEEEE-LLLLHHHHHHHHHHLLLEEEELLLHhhhlhhHHHHHHHHHLllLLHHHEELLLL
Query VVLLH-CYPYHREAGYLASVFPNLYFDISLLdnlgpsGASRVFNEAVelAPYTRILFASD  318
ident | | |        |  ||    ||| | |            |              |  |
Sbjct VILGHmGGSNWMTAVELAKEIQNLYLDTSAY------FSTFVLKIVI-nELPLKCIFGTD  225
DSSP  EEEHHhHHHHHHHHHHHHHHLLLEEEELLLL------LLHHHHHHHH-hHLLLLEELLLL


DSSP  LLllhhHHHHHHHHHHHHHHhhhhllllllhhhHHHHHHHHHLHHHHHHLLLhhhhll
Query AStypeXYGLAARQFKQALVahfnqlpfvdlaqKKAWINAICWQTSAKLYHQerelrv  376
ident          |     |                      ||        |         
Sbjct MP--fgDLQLSIEAIKKMSN-------------DSYVANAVLGDNISRLLNI------  262
DSSP  LL--llLHHHHHHHHHHHLL-------------LHHHHHHHHLHHHHHHHLL------


No 6: Query=2qpxA Sbjct=3giqA Z-score=17.3

back to top
DSSP  ----------------------------------------------lllllHHHHhhLLE
Query ----------------------------------------------gxddlSEFVdqVPL   14
ident                                                             
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgKIVA--PGF   58
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllLEEE--ELE


DSSP  EEEEELL--LLLLllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllll
Query LDHHCHF--LIDGkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldann   72
ident  | | |                                                      
Sbjct IDVHGHDdlMFVE-----------------------------------------------   71
DSSP  EELLLLLllHHHH-----------------------------------------------


DSSP  llllllhhhhhhhHHHHHHHLLEEEEEEE------------------llLLLLL------
Query plaaxndpgyatyNHRIFGHFHFKELLID------------------tgFVPDD------  108
ident                |                                            
Sbjct -----------kpDLRWKTSQGITTVVVGncgvsaapaplpgntaaalaLLGETplfadv  120
DSSP  -----------llLLHHHHLLLEEEEEELllllllllllllllllhhhhHHLLLlllllh


DSSP  --llLLHH-HHHHhhlLLEEEEEEHHHHHHHHHLL--lllHHHHHHHHHHHHHLLLLLLL
Query --piLDLD-QTAElvgIPVKAIYRLETHAEDFXLE--hdnFAAWWQAFSNDVKQAKAHGF  163
ident       || |      | | |                    ||  ||       |   | 
Sbjct payfAALDaQRPM---INVAALVGHANLRLAAMRDpqaapTAAEQQAMQDMLQAALEAGA  177
DSSP  hhhhHHHHhLLLL---LEEEEEEEHHHHHHHHLLLlllllLHHHHHHHHHHHHHHHHHLL


DSSP  LLEEELHHHHlllllllllhhhhhhhhhhhhhhlllLLLLhhHHHHHHHHHHHHHHHHLL
Query VGFXSIAAYRvglhlepvnvieaaagfdtwkhsgekRLTSkpLIDYXLYHVAPFIIAQDX  223
ident |||    ||                                      |   |        
Sbjct VGFSTGLAYQ--------------------------PGAV--AQAAELEGLARVAAERRR  209
DSSP  LEEEEELLLL--------------------------LHHH--LLHHHHHHHHHHHHHLLL


DSSP  LEEEEEllllllllHHHLLhHHHHHHHHhHHHH-LLLEEEEELLL-------LHHHHHHH
Query PLQFHVgygdadtdXYLGNpLLXRDYLKaFTKK-GLKVVLLHCYP-------YHREAGYL  275
ident     |                     |       |   |  |            |     
Sbjct LHTSHI-----rneADGVE-AAVEEVLA-IGRGtGCATVVSHHKCmmpqnwgRSRATLAN  262
DSSP  EEEEEL-----lllLLLHH-HHHHHHHH-HHHHhLLEEEELLLLLllhhhllLHHHHHHH


DSSP  HHHLL----LEEEELLlhHHHL--------------------------------------
Query ASVFP----NLYFDISllDNLG--------------------------------------  293
ident              ||      |                                      
Sbjct IDRAReqgvEVALDIY--PYPGsstiliperaetiddiritwstphpecsgeyladiaar  320
DSSP  HHHHHhlllLEEEEEL--LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhh


DSSP  -------------------hhhhHHHHHHHLllllHHHEELLLLLLL----LHHHHHHHH
Query -------------------psgaSRVFNEAVelapYTRILFASDAST----YPEXYGLAA  330
ident                                           ||                
Sbjct wgcdkttaarrlapagaiyfamdEDEVKRIF---qHPCCMVGSDGLPndarPHPRLWGSF  377
DSSP  hlllhhhhhhhhlleeeeeelllHHHHHHHH---hLLLEEELLLLLLllllLLLHHHHHH


DSSP  HHHHH-HHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLHHHHLL-------------
Query RQFKQ-ALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQERELRV-------------  376
ident                             |      |                        
Sbjct TRVLGrYVREAR--------lmTLEQAVARMTALPARVFGFAERGVLqpgawadvvvfdp  429
DSSP  HHHHHhHHHHLL--------llLHHHHHHHHLHHHHHHHLLLLLLLLllllllleeeell


DSSP  ----------------------------------------------
Query ----------------------------------------------  376
ident                                               
Sbjct dtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  lllllllllllllllllleeeeeelleeeellllllllllllllll


No 7: Query=2qpxA Sbjct=4dlfA Z-score=17.2

back to top
DSSP  lllllhhhhhhlLEEEEEELLLLLlllllhhhhhhhhllLLLLLLLhhhhlllhhhhhhh
Query gxddlsefvdqvPLLDHHCHFLIDgkvpnrddrlaqvstEADKDYPladtknrlayhgfl   60
ident                | | ||                                       
Sbjct -----------aLRIDSHQHFWRY---------raadypWIGAGMG--------------   26
DSSP  -----------lLLEEEEELLLLL---------lhhhllLLLLLLH--------------


DSSP  hhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLL----llllllLLHHHH
Query alakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGF----vpddpiLDLDQT  116
ident                           |                                 
Sbjct ---------------vlardylpDALHPLMHAQALGASIAVQARagrdetafllELACDE   71
DSSP  ---------------hhlllllhHHHHHHHHHLLLLEEEEELLLllhhhhhhhhHHHLLL


DSSP  HhhhlLLEEEEEEHHhhhhhhhlllllhhhhHHHHHHHHHLlLLLL-LLLEEELHHHHLL
Query AelvgIPVKAIYRLEthaedfxlehdnfaawWQAFSNDVKQaKAHG-FVGFXSIAAYRVG  175
ident |                                     |          ||         
Sbjct A----RIAAVVGWED--------------lrAPQLAERVAE-WRGTkLRGFRHQLQDEAD  112
DSSP  L----LEEEEEELLL--------------llLLLHHHHHHL-LLLLlEEEEEELHHHLLL


DSSP  LL--LLLLlhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHHLLLEEEEELlll
Query LH--LEPVnvieaaagfdtwkhsgekrltskplidyXLYHVAPFIIAQDXPLQFHVGygd  233
ident                                               | |      |    
Sbjct VRafVDDA----------------------------DFARGVAWLQANDYVYDVLVF---  141
DSSP  HHhhHHLH----------------------------HHHHHHHHHHHLLLEEEELLL---


DSSP  llllhhhLLHHHHHHHHHHHHhhLLLEEEE-ELLL--------------lhHHHHHHHhH
Query adtdxylGNPLLXRDYLKAFTkkGLKVVLL-HCYP--------------yhREAGYLAsV  278
ident                            ||     |                     ||  
Sbjct ------eRQLPDVQAFCARHD--AHWLVLDhAGKPalaefdrddtalarwrAALRELA-A  192
DSSP  ------hHHHHHHHHHHHHLL--LLLEEEHhHHLLlhhhllllllhhhhhhHHHHHHH-L


DSSP  LLLEEEELLLHhHHLH-----------HHHHHHHHHHLLLLLHHHEELLLLLL--llhHH
Query FPNLYFDISLLdNLGP-----------SGASRVFNEAVELAPYTRILFASDAS--typEX  325
ident  |      | |                         |       |  | ||         
Sbjct LPHVVCKLSGL-VTEAdwrrglrasdlRHIEQCLDAALDAFGPQRLMFGSDWPvcllaAS  251
DSSP  LLLEEEEELLL-LLLLlllllllhhhhHHHHHHHHHHHHHHLHHHEEELLLLLhhhhlLL


DSSP  HHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLHhhhll
Query YGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQErelrv  376
ident |   |                       |   |    | |  |        
Sbjct YDEVASLVERWAESRL----------SAAERSALWGGTAARCYALP-----  287
DSSP  HHHHHHHHHHHHHHHL----------LHHHHHHHLLHHHHHHLLLL-----


No 8: Query=2qpxA Sbjct=2ob3A Z-score=17.0

back to top
DSSP  ---lllllhhhhhhlLEEEEEELLL---------llllLLLHhhhhhhhlllllllllhh
Query ---gxddlsefvdqvPLLDHHCHFL---------idgkVPNRddrlaqvsteadkdypla   48
ident                     | |                  |                  
Sbjct drintvrgpitiseaGFTLTHEHICgssagflrawpefFGSR------------------   42
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhHLLH------------------


DSSP  hhlllhhhhhhhhhhhhhllllllllllllhhhHHHHHHHHHHHLLEEEEEEEL--LLLL
Query dtknrlayhgflalakefaldannplaaxndpgYATYNHRIFGHFHFKELLIDT--GFVP  106
ident                                   |    |                    
Sbjct ----------------------------kalaeKAVRGLRRARAAGVRTIVDVStfDIGR   74
DSSP  ----------------------------hhhhhHHHHHHHHHHHLLLLEEEELLlhHHLL


DSSP  llllLLHHHHHHHHLLLEEEEEEHHHhhHHHHlllllhhhHHHHHHHHHHLLLLL-----
Query ddpiLDLDQTAELVGIPVKAIYRLEThaEDFXlehdnfaaWWQAFSNDVKQAKAH-----  161
ident       |            |   |                                    
Sbjct --dvSLLAEVSRAADVHIVAATGLWF-dPPLS----mrlrSVEELTQFFLREIQYgiedt  127
DSSP  --lhHHHHHHHHHHLLEEELEEELLL-lLLHH----hhllLHHHHHHHHHHHHHLlllll


DSSP  --LLLLEEELHhHHLLlllllllhhhhhhhhhhhhhhlllllllHHHHHHHHHHHHHHHH
Query --GFVGFXSIAaYRVGlhlepvnvieaaagfdtwkhsgekrltsKPLIDYXLYHVAPFII  219
ident        |                                     |     |   |    
Sbjct giRAGIIXVAT-TGKA----------------------------TPFQELVLKAAARASL  158
DSSP  llLLLEEEEEL-LLLL----------------------------LHHHHHHHHHHHHHHH


DSSP  HHLLLEEEEELLllllllhHHLLHHH-HHHHHHHHHHhllLEEEEEL--LLLHHHHHHHH
Query AQDXPLQFHVGYgdadtdxYLGNPLL-XRDYLKAFTKkglKVVLLHC--YPYHREAGYLA  276
ident |   |   |                                |   |            ||
Sbjct ATGVPVTTHTAA-------SQRDGEQqAAIFESEGLS-psRVCIGHSddTDDLSYLTALA  210
DSSP  HHLLLEEEELLH-------HHLHHHHhHHHHHHLLLL-hhHEEELLHhhLLLHHHHHHHH


DSSP  HHLllEEEELLLhHHHL------------------HHHHHHHHHHHLLLLLHHHEELLLL
Query SVFpnLYFDISLlDNLG------------------PSGASRVFNEAVELAPYTRILFASD  318
ident                                                       ||   |
Sbjct ARG--YLIGLDH-IPYSaiglednasasallgirsWQTRALLIKALIDQGYMKQILVSND  267
DSSP  HLL--LEEEELL-LLLLlllllllhhhhhhhllllHHHHHHHHHHHHHLLLHHHEEELLL


DSSP  LLLL----------------hHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLH
Query ASTY----------------pEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQ  362
ident                                   |                     |   
Sbjct WTFGfssyvtnimdvmdrvnpDGMAFIPLRVIPFLREKG---------vPQETLAGITVT  318
DSSP  LLLEellllllhhhhhhhhllLHHHHHHHLHHHHHHHLL---------lLHHHHHHHHLH


DSSP  HHHHHLLlhhhhll
Query TSAKLYHqerelrv  376
ident   |           
Sbjct NPARFLS---ptlr  329
DSSP  HHHHHHL---llll


No 9: Query=2qpxA Sbjct=1bf6A Z-score=16.9

back to top
DSSP  lllllhhhhhhlLEEEEEELL--------------LLLLllllhhhhhhhhlllllllll
Query gxddlsefvdqvPLLDHHCHF--------------LIDGkvpnrddrlaqvsteadkdyp   46
ident                  | |               |                        
Sbjct -------sfdptGYTLAHEHLhidlsgfknnvdcrLDQY---------------------   32
DSSP  -------lllllLEEEEEELLleelhhhhllhhheELLH---------------------


DSSP  hhhhlllhhhhhhhhhhhhhllllllllllllhhHHHHHHHHHHHHLLEEEEEEEL---L
Query ladtknrlayhgflalakefaldannplaaxndpGYATYNHRIFGHFHFKELLIDT---G  103
ident                                                        |    
Sbjct ----------------------------------AFICQEMNDLMTRGVRNVIEMTnryM   58
DSSP  ----------------------------------HHHHHHHHHHHHLLEEEEEELLlhhH


DSSP  LLLllllLLHHHHHHHHLLLEEEEEEHH-hhhHHHHlllllhHHHH-HHHHHHHHLLLLL
Query FVPddpiLDLDQTAELVGIPVKAIYRLE-thaEDFXlehdnfAAWW-QAFSNDVKQAKAH  161
ident                  || | |                   |    |            
Sbjct GRN---aQFMLDVMRETGINVVACTGYYqdafFPEH-----vATRSvQELAQEMVDEIEQ  110
DSSP  LLL---hHHHHHHHHHHLLEEEEEELLLlhhhLLLH-----hHHLLhHHHHHHHHHHHHL


DSSP  -------LLLLEE-ELHHHHLLlllllllhhhhhhhhhhhhhhlllllllHHHHHHHHHH
Query -------GFVGFX-SIAAYRVGlhlepvnvieaaagfdtwkhsgekrltsKPLIDYXLYH  213
ident                                                    ||       
Sbjct gidgtelKAGIIAeIGTSEGKI----------------------------TPLEEKVFIA  142
DSSP  lllllllLEEEEEeEELLLLLL----------------------------LHHHHHHHHH


DSSP  HHHHHHHHLLLEEEEELLllllllhhhLLHHH-HHHHHHHHHHhllLEEEEELL--LLHH
Query VAPFIIAQDXPLQFHVGYgdadtdxylGNPLL-XRDYLKAFTKkglKVVLLHCY--PYHR  270
ident  |        |   |               |                |   ||       
Sbjct AALAHNQTGRPISTHTSF--------sTMGLEqLALLQAHGVD-lsRVTVGHCDlkDNLD  193
DSSP  HHHHHHHHLLLEEEELHH--------hLLHHHhHHHHHHLLLL-hhHEEELLLLllLLHH


DSSP  HHHHHHHHLllEEEELLLhHHHL----HHHHHHHHHHHLLLLLHHHEELLLLLLLL----
Query EAGYLASVFpnLYFDISLlDNLG----PSGASRVFNEAVELAPYTRILFASDASTY----  322
ident             |                                |     |        
Sbjct NILKMIDLG--AYVQFDT-IGKNsyypDEKRIAMLHALRDRGLLNRVMLSMDITRRshlk  250
DSSP  HHHHHHHLL--LEEEELL-LLLLllllHHHHHHHHHHHHHLLLHHHEEELLLLLLHhhlh


DSSP  ---hHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLlhhhhll
Query ---pEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHqerelrv  376
ident       |      |   |                |                      
Sbjct anggYGYDYLLTTFIPQLRQSG---------fSQADVDVMLRENPSQFFQ-------  291
DSSP  hhllLLLLHHHHLHHHHHHHLL---------lLHHHHHHHHLHHHHHHLL-------


No 10: Query=2qpxA Sbjct=2dvtA Z-score=16.5

back to top
DSSP  lllllhhhhhHLLEEEEEELL--------lllllLLLHHHHHHHHlllllllllhhhhll
Query gxddlsefvdQVPLLDHHCHF--------lidgkVPNRDDRLAQVsteadkdypladtkn   52
ident                    ||                    |                  
Sbjct ----------MQGKVALEEHFaipetlqdsagfvPGDYWKELQHR---------------   35
DSSP  ----------LLLEEEEEEEEllhhhhhhhllllLLLHHHHHHHH---------------


DSSP  lhhhhhhhhhhhhhllllllllllllhhhhHHHHHHHHHHLLEEEEEEELLL--------
Query rlayhgflalakefaldannplaaxndpgyATYNHRIFGHFHFKELLIDTGF--------  104
ident                                                             
Sbjct --------------------------lldiQDTRLKLMDAHGIETMILSLNApavqaipd   69
DSSP  --------------------------hhllLLHHHHHHHHLLEEEEEEEELLlhhhhlll


DSSP  ----------llllllLLHHHHHhhhlLLEEEEEEHhhHHHHhhlllllhhhhHHHHHHH
Query ----------vpddpiLDLDQTAelvgIPVKAIYRLetHAEDfxlehdnfaawWQAFSND  154
ident                                |   |     |             |    
Sbjct rrkaieiarrandvlaEECAKRP----DRFLAFAAL--PLQD-----------PDAATEE  112
DSSP  hhhhhhhhhhhhhhhhHHHHHLL----LLEEEEELL--LLLL-----------HHHHHHH


DSSP  HHLLLL-LLLLLEEELHhhhlllllllllhhhhhhhHHHHHhhlllllllhHHHH--HHH
Query VKQAKA-HGFVGFXSIAayrvglhlepvnvieaaagFDTWKhsgekrltskPLID--YXL  211
ident         ||||                                       ||       
Sbjct LQRCVNdLGFVGALVNG----------------fsqEGDGQ---------tPLYYdlPQY  147
DSSP  HHHHHHlLLLLEEEEEL----------------lllLLLLL---------lLLLLllHHH


DSSP  HHHHHHHHHHLLLEEEEE-----------llllLLLL--HHHLL--HHHHHHHHH-HHHH
Query YHVAPFIIAQDXPLQFHV-----------gygdADTD--XYLGN--PLLXRDYLK-AFTK  255
ident           | |   |                                           
Sbjct RPFWGEVEKLDVPFYLHPrnplpqdsriydghpWLLGptWAFAQetAVHALRLMAsGLFD  207
DSSP  HHHHHHHHHHLLLEEEELllllhhhlhhhlllhHHLHhhLHHHHhhHHHHHHHHHlLHHH


DSSP  --HLLLEEEEE-LLLLHHH------------------hhhhHHHL--LLEEEELLLHHhh
Query --KGLKVVLLH-CYPYHRE------------------agylASVF--PNLYFDISLLDnl  292
ident     |   | |                                     |     |     
Sbjct ehPRLNIILGHmGEGLPYMmwridhrnawvklpprypakrrFMDYfnENFHITTSGNF--  265
DSSP  hlLLLLEEELHhHLLHHHHhhhhhhllllllllllllllllHHHHhhHHEEEELLLLL--


DSSP  lhhhHHHHHHHHLLLLLHHHEELLLLLLLlhhHHHHHHHHHHHhhHHHHhllllllhhhh
Query gpsgASRVFNEAVELAPYTRILFASDASTypeXYGLAARQFKQalVAHFnqlpfvdlaqk  352
ident            |       ||||  |          |   |                   
Sbjct ----RTQTLIDAILEIGADRILFSTDWPF--eNIDHASDWFNA--TSIA-----------  306
DSSP  ----LHHHHHHHHLLLLHHHEELLLLLLL--lLHHHHHHHHHH--LLLL-----------


DSSP  HHHHHHHHLHHHHHHLLLHhhhll
Query KAWINAICWQTSAKLYHQErelrv  376
ident  |    |       |         
Sbjct EADRVKIGRTNARRLFKLD-----  325
DSSP  HHHHHHHHLHHHHHHLLLL-----


No 11: Query=2qpxA Sbjct=3k2gB Z-score=16.4

back to top
DSSP  ---------------lllllhhhhhhlLEEEEEELLL---------------llllllLH
Query ---------------gxddlsefvdqvPLLDHHCHFL---------------idgkvpNR   30
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeaPI   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlLL


DSSP  HHhhhhhllllllllLHHHHLLLhhhhhhhhhhhhhllllllllllllhhHHHHHHHHHH
Query DDrlaqvsteadkdyPLADTKNRlayhgflalakefaldannplaaxndpGYATYNHRIF   90
ident                 |                                   |      |
Sbjct SI------------eILSELRQD--------------pfvnkhnialddlDLAIAEVKQF   94
DSSP  LH------------hHHHHHHLL--------------hhhllllleellhHHHHHHHHHH


DSSP  HHLLEEEEEEELLlllllllLLHHHHHHHHLLLEEEEEEHH-hhhHHHHlllllhhhHHH
Query GHFHFKELLIDTGfvpddpiLDLDQTAELVGIPVKAIYRLE-thaEDFXlehdnfaaWWQ  149
ident            |          |       |  |                          
Sbjct AAVGGRSIVDPTCrgigrdpVKLRRISAETGVQVVXGAGYYlassXPET-------aARL  147
DSSP  HHLLLLEEEELLLllllllhHHHHHHHHHHLLEEEELLLLLlhhhLLHH-------hHLL


DSSP  H---HHHHHHLLLLL-------LLLLEE-ELHHHHLllllllllhhhhhhhhhhhhhhll
Query A---FSNDVKQAKAH-------GFVGFX-SIAAYRVglhlepvnvieaaagfdtwkhsge  198
ident                                                             
Sbjct SaddIADEIVAEALEgtdgtdaRIGLIGeIGVSSDF------------------------  183
DSSP  LhhhHHHHHHHHHHLlllllllLLLLEEeELLLLLL------------------------


DSSP  lllllHHHHHHHHHHHHHHHHHHLLLEEEEELLllllllhhhLLHHhHHHHHHHHH-HHL
Query krltsKPLIDYXLYHVAPFIIAQDXPLQFHVGYgdadtdxylGNPLlXRDYLKAFT-KKG  257
ident             |   |        ||  |               |     |        
Sbjct -----TAEEEKSLRGAARAQVRTGLPLXVHLPG---------WFRL-AHRVLDLVEeEGA  228
DSSP  -----LHHHHHHHHHHHHHHHHHLLLEEELLLL---------LLLL-HHHHHHHHHhLLL


DSSP  L--LEEEEELLLLHH---HHHHHHHhlLLEEEELLLhHHHL---------hhHHHHHHHH
Query L--KVVLLHCYPYHR---EAGYLASvfPNLYFDISLlDNLG---------psGASRVFNE  303
ident      || |  | |        ||                                |   
Sbjct DlrHTVLCHXNPSHXdpvYQATLAQ--RGAFLEFDX-IGXDffyadqgvqcpSDDEVARA  285
DSSP  LhhHEEELLLHHHLLlhhHHHHHHH--HLLEEEELL-LLLLleelllleellLHHHHHHH


DSSP  HLLLL---LHHHEELLLLLLLL-------hHHHHHHHHHHHHHHHHHHhllllllhhhHH
Query AVELA---PYTRILFASDASTY-------pEXYGLAARQFKQALVAHFnqlpfvdlaqKK  353
ident    ||      |||   |              |      |   |  |             
Sbjct ILGLAdhgYLDRILLSHDVFVKxxltryggNGYAFVTKHFLPRLRRHG---------lDD  336
DSSP  HHHHHhllLHHHEEELLLLLLHhhlhhhllLLLLHHHHLHHHHHHHLL---------lLH


DSSP  HHHHHHHLHHHHHHLLlhhhhll
Query AWINAICWQTSAKLYHqerelrv  376
ident |                      
Sbjct AALETLXVTNPRRVFD-asiegh  358
DSSP  HHHHHHHLHHHHHHHL-llllll


No 12: Query=2qpxA Sbjct=4b3zD Z-score=16.3

back to top
DSSP  -------------------------------------------lllllHHHHhhLLEEEE
Query -------------------------------------------gxddlSEFVdqVPLLDH   17
ident                                                           | 
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangRMVI--PGGIDV   58
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllLEEE--ELEEEE


DSSP  EELLLLLLLlllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhlllllllllll
Query HCHFLIDGKvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaax   77
ident                                                             
Sbjct NTYLQKTAA---------------------------------------------------   67
DSSP  EELLLLLLL---------------------------------------------------


DSSP  lhhhhhHHHHHHHHHLLEEEEEEELLL-----llllllLLHHHHHHHHLLLEEEEEEHhH
Query ndpgyaTYNHRIFGHFHFKELLIDTGF-----vpddpiLDLDQTAELVGIPVKAIYRLeT  132
ident           |                                                |
Sbjct ---ddfFQGTRAALVGGTTMIIDHVVPepgsslltsfeKWHEAADTKSCCDYSLHVDI-T  123
DSSP  ---llhHHHHHHHHHLLEEEEEEEELLlllllhhhhhhHHHHHHHLLLLLEEEEEEEL-L


DSSP  HHHhhhlllllhhhhhHHHHHHHHLLLL-LLLLLEEELHHHHlllllllllhhhhhhhhh
Query HAEdfxlehdnfaawwQAFSNDVKQAKA-HGFVGFXSIAAYRvglhlepvnvieaaagfd  191
ident                               |   |    ||                   
Sbjct SWY-------------DGVREELEVLVQdKGVNSFQVYMAYK------------------  152
DSSP  LLL-------------LLHHHHHHHHHHlLLLLEEEEELLLL------------------


DSSP  hhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEEL---------------------
Query twkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVG---------------------  230
ident                 |  ||    |          |                       
Sbjct ----------dvyqmSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpe  202
DSSP  ----------lllllLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllh


DSSP  llLLLLLHHHLL--HHHHHHHHHHHHhhlLLEEEEELLL--LHHHHHHHHHHLLLEEEEL
Query ygDADTDXYLGN--PLLXRDYLKAFTkkgLKVVLLHCYP--YHREAGYLASVFPNLYFDI  286
ident          |                     |                     |      
Sbjct ghALSRPEELEAeaVFRAITIAGRIN---CPVYITKVMSksAADIIALARKKGPLVFGEP  259
DSSP  hhHHHLLHHHHHhhHHHHHHHHHHHL---LLEEEEEELLhhHHHHHHHHHHHLLLEEEEE


DSSP  LlhHHHLHH---------------------------HHHHHHHHHLLlllHHHEELLLLL
Query SllDNLGPS---------------------------GASRVFNEAVElapYTRILFASDA  319
ident                                                          |  
Sbjct I--AASLGTdgthywsknwakaaafvtspplspdptTPDYLTSLLAC---GDLQVTGSGH  314
DSSP  L--HHHHHLllhhhhlllhhhhhhllllllllllllHHHHHHHHHHH---LLLLLLLLLL


DSSP  LL------------------lhHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHL
Query ST------------------ypEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICW  361
ident                                     ||                  |   
Sbjct CPystaqkavgkdnftlipegvNGIEERMTVVWDKAVATG--------kmDENQFVAVTS  366
DSSP  LLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLLLL--------llLHHHHHHHHL


DSSP  HHHHHHLLLH-HHHLL--------------------------------------------
Query QTSAKLYHQE-RELRV--------------------------------------------  376
ident    ||      |  |                                             
Sbjct TNAAKIFNLYpRKGRIavgsdadvviwdpdklktitakshksaveynifegmechgsplv  426
DSSP  HHHHHHHLLLlLLLLLllllllleeeeeeeeeeelllllllllllllllllleeeeeeee


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  376
ident                                                    
Sbjct visqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  eeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll


No 13: Query=2qpxA Sbjct=1onxA Z-score=16.0

back to top
DSSP  --------------------------------------------------lllllhhhhh
Query --------------------------------------------------gxddlsefvd   10
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  HLLEEEEEELLLLllllllhhhhhhhhlllLLLLLlhhhhlllhhhhhhhhhhhhhllll
Query QVPLLDHHCHFLIdgkvpnrddrlaqvsteADKDYpladtknrlayhgflalakefalda   70
ident      | | |                                                  
Sbjct CPGFIDQHVHLIG--------------gggEAGPT-------------------------   81
DSSP  EELEEEEEELLLL--------------lllLLLHH-------------------------


DSSP  llllllllhhhhhhhHHHHHHHLLEEEEEEELLLL-----lllllLLHHHHHHHhLLLEE
Query nnplaaxndpgyatyNHRIFGHFHFKELLIDTGFV-----pddpiLDLDQTAELvGIPVK  125
ident                                 |                   |  ||   
Sbjct ---------trtpevALSRLTEAGVTSVVGLLGTDsisrhpesllAKTRALNEE-GISAW  131
DSSP  ---------hlllllLHHHHHHLLEEEEEELLLLLlllllhhhhhHHHHHHHHH-LLEEE


DSSP  EEEE----HHHHhhhhhlllllhhhhhhhhhHHHHLL-LLLL-LLLEEELHH---HHLLl
Query AIYR----LETHaedfxlehdnfaawwqafsNDVKQA-KAHG-FVGFXSIAA---YRVGl  176
ident                                  |           | |            
Sbjct MLTGayhvPSRT-----------------itGSVEKDvAIIDrVIGVXCAISdhrSAAP-  173
DSSP  EEEEllllLLLL-----------------llLLHHHHhHHLLlEEEEEEEELlllLLLL-


DSSP  llllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHL------LLEEEEEL
Query hlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQD------XPLQFHVG  230
ident                                 | |   |                 || |
Sbjct ------------------------------DVYHLANMAAESRVGGllggkpGVTVFHMG  203
DSSP  ------------------------------LHHHHHHHHHHHHHHHhhhlllLEEEEEEL


DSSP  lllllllHHHLLHHHHHHHHHHHhHHLL-LEEEEELLL---LHHHHHHHHHHLllEEEEL
Query ygdadtdXYLGNPLLXRDYLKAFtKKGL-KVVLLHCYP---YHREAGYLASVFpnLYFDI  286
ident                  | |         |    |          |   |        ||
Sbjct -------DSKKALQPIYDLLENC-DVPIsKLLPTHVNRnvpLFEQALEFARKG--GTIDI  253
DSSP  -------LLLLLLHHHHHHHHLL-LLLHhHEEEELHHHlhhHHHHHHHHHHLL--LLEEE


DSSP  LlhHHHL-hhHHHHHHHHHL-LLLLHHHEELLLLLLL-------------lhhHHHHHHH
Query SllDNLG-psGASRVFNEAV-ELAPYTRILFASDAST-------------ypeXYGLAAR  331
ident                   ||    |  |    ||                          
Sbjct T--SSIDepvAPAEGIARAVqAGIPLARVTLSSDGNGsqpffddegnlthigvAGFETLL  311
DSSP  E--LLLLlllLHHHHHHHHHhLLLLHHHEEEELLLLLeeeeellllleeeeeeLLLHHHH


DSSP  HHHHHHHHHHHllllllhhhHHHHHHHHHLHHHHHHLLLHHHHLL---------------
Query QFKQALVAHFNqlpfvdlaqKKAWINAICWQTSAKLYHQERELRV---------------  376
ident    | ||                          |                          
Sbjct ETVQVLVKDYD--------fSISDALRPLTSSVAGFLNLTGKGEIlpgndadllvmtpel  363
DSSP  HHHHHHHHHHL--------lLHHHHHHHHLHHHHHHLLLLLLLLLllllllleeeellll


DSSP  ---------------------------
Query ---------------------------  376
ident                            
Sbjct rieqvyargklmvkdgkacvkgtfetd  390
DSSP  leeeeeelleeeeelleelllllllll


No 14: Query=2qpxA Sbjct=1gkpA Z-score=15.8

back to top
DSSP  ----------------------------------------lllllhhhhhHLLEEEEEEL
Query ----------------------------------------gxddlsefvdQVPLLDHHCH   20
ident                                                        | | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  L--------LLLLllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllll
Query F--------LIDGkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldann   72
ident            |                                                
Sbjct IylpfmatfAKDT-----------------------------------------------   73
DSSP  LlleelleeLLLL-----------------------------------------------


DSSP  llllllhhhhhhhHHHHHHHLLEEEEEEELL--------lllllllLLHHHHHhhhLLLE
Query plaaxndpgyatyNHRIFGHFHFKELLIDTG--------fvpddpiLDLDQTAelvGIPV  124
ident                                                             
Sbjct ----------hetGSKAALMGGTTTYIEMCCpsrnddalegyqlwkSKAEGNS---YCDY  120
DSSP  ----------hhhHHHHHHHLLEEEEEEEELllllllhhhhhhhhhHHHLLLL---LLEE


DSSP  EEEEEHHHhhhhhhlllllhhhhHHHHHHHHHLLLLLLLLLEEELhHHHLllllllllhh
Query KAIYRLEThaedfxlehdnfaawWQAFSNDVKQAKAHGFVGFXSIaAYRVglhlepvnvi  184
ident                                    | |   ||                 
Sbjct TFHMAVSK--------------fDEKTEGQLREIVADGISSFXIF-LSYK----------  155
DSSP  EEEEELLL--------------lLLLHHHHHHHHHHLLLLEEEEE-ELLL----------


DSSP  hhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEEL--------------
Query eaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVG--------------  230
ident                        |   |               |                
Sbjct -----------------nffgvDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqklls  198
DSSP  -----------------lllllLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhh


DSSP  -------llLLLLLHHHLL--HHHHHHHHHHHHhhlLLEEEEELLL--LHHHHHHHHHHL
Query -------ygDADTDXYLGN--PLLXRDYLKAFTkkgLKVVLLHCYP--YHREAGYLASVF  279
ident                             |             |         |       
Sbjct egktgpewhEPSRPEAVEAegTARFATFLETTG---ATGYVVHLSCkpALDAAMAAKARG  255
DSSP  lllllhhhlLLLLLHHHHHhhHHHHHHHHHHHL---LEEEELLLLLhhHHHHHHHHHHLL


DSSP  LLEEEELLlhHHHLHHH------------------------hHHHHHHHLlllLHHHEEL
Query PNLYFDISllDNLGPSG------------------------aSRVFNEAVelaPYTRILF  315
ident    |                                        |   |           
Sbjct VPIYIESV--IPHFLLDktyaerggveamkyimspplrdkrnQKVLWDAL--aQGFIDTV  311
DSSP  LLEEEEEE--HHHHHLLhhhhhllhhhhhlllllllllllhhHHHHHHHH--hLLLLLEE


DSSP  LLLLLL------------------lhHHHHHHHHHHHHHH-HHHHhllllllhhhHHHHH
Query ASDAST------------------ypEXYGLAARQFKQAL-VAHFnqlpfvdlaqKKAWI  356
ident   |                                                         
Sbjct GTDHCPfdteqkllgkeaftaipngiPAIEDRVNLLYTYGvSRGR---------lDIHRF  362
DSSP  ELLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHlLLLL---------lLHHHH


DSSP  HHHHLHHHHHHLLLH-HHHLL---------------------------------------
Query NAICWQTSAKLYHQE-RELRV---------------------------------------  376
ident         |||     |                                           
Sbjct VDAASTKAAKLFGLFpRKGTIavgsdadlvvydpqyrgtisvktqhvnndyngfegfeid  422
DSSP  HHHHLHHHHHHLLLLlLLLLLllllllleeeeelllleellhhhllllllllllllleel


DSSP  ------------------------------------
Query ------------------------------------  376
ident                                     
Sbjct grpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  leeeeeeelleeeeelleelllllllllllllllll


No 15: Query=2qpxA Sbjct=2vc5A Z-score=15.8

back to top
DSSP  ----lllllhhhhhhlLEEEEEELLL-------------lLLLLllhhhhhhhhllllll
Query ----gxddlsefvdqvPLLDHHCHFL-------------iDGKVpnrddrlaqvsteadk   43
ident                      | |                                    
Sbjct mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlyNEDE----------------   44
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhlLHHH----------------


DSSP  lllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELL
Query dypladtknrlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTG  103
ident                                                  |  |     | 
Sbjct -----------------------------------efrnaVNEVKRAMQFGVKTIVDPTV   69
DSSP  -----------------------------------hhhhhHHHHHHHHHLLLLEEEELLL


DSSP  lllllllLLHHHHHHHHLLLEEEEEEHHHhhhhhHLLLllHHHHHHHHHHHHHLLLLL--
Query fvpddpiLDLDQTAELVGIPVKAIYRLEThaedfXLEHdnFAAWWQAFSNDVKQAKAH--  161
ident                  ||   |                                     
Sbjct mglgrdiRFMEKVVKATGINLVAGTGIYI-yidlPFYF--LNRSIDEIADLFIHDIKEgi  126
DSSP  llllllhHHHHHHHHLLLLEEEELEELLL-llllLHHH--LLLLHHHHHHHHHHHHHLll


DSSP  -----LLLLEEELHHHHLLlllllllhhhhhhhhhhhhhhlllllllHHHHHHHHHHHHH
Query -----GFVGFXSIAAYRVGlhlepvnvieaaagfdtwkhsgekrltsKPLIDYXLYHVAP  216
ident           |  |                                            | 
Sbjct qgtlnKAGFVXIAADEPGI----------------------------TKDVEKVIRAAAI  158
DSSP  lllllLLLLEEEELLLLLL----------------------------LHHHHHHHHHHHH


DSSP  HHHHHLLLEEEEELLllllllHHHLlHHHH-HHHHHHHHHhllLEEEEELLLL--hHHHH
Query FIIAQDXPLQFHVGYgdadtdXYLGnPLLX-RDYLKAFTKkglKVVLLHCYPY--hREAG  273
ident        |   |               |   |           |    |           
Sbjct ANKETKVPIITHSNA------HNNT-GLEQqRILTEEGVD-pgKILIGHLGDTdniDYIK  210
DSSP  HHHHHLLLEEEELLL------LLLH-HHHHhHHHHHLLLL-hhHEEELLHHHLllhHHHH


DSSP  HHHHHLllEEEELLlHHHH----LHHHHHHHHHHHLLLLLHHHEELLLLLLLL-------
Query YLASVFpnLYFDISlLDNL----GPSGASRVFNEAVELAPYTRILFASDASTY-------  322
ident   |               |                        |    |           
Sbjct KIADKG--SFIGLD-RYGLdlflPVDKRNETTLRLIKDGYSDKIMISHDYCCTidwgtak  267
DSSP  HHHHLL--LEEEEL-LLLLllllLHHHHHHHHHHHHHLLLLLLEEELLLLLLLlllllll


DSSP  ---------hhHHHHHHHHHHHHHH-HHHHllllllhhhhHHHHHHHHLHHHHHHLLlhh
Query ---------peXYGLAARQFKQALV-AHFNqlpfvdlaqkKAWINAICWQTSAKLYHqer  372
ident               |        |     |             |  |      |      
Sbjct peykpklaprwSITLIFEDTIPFLKrNGVN----------EEVIATIFKENPKKFFS---  314
DSSP  hhhhhhhllllLLLHHHHLHHHHHHlLLLL----------HHHHHHHHLHHHHHHLL---


DSSP  hhll
Query elrv  376
ident     
Sbjct ----  314
DSSP  ----


No 16: Query=2qpxA Sbjct=4hk5D Z-score=15.8

back to top
DSSP  lllllhhhhhHLLEEEEEELLLLL-----------------lllLLHHHHhhhhllLLLL
Query gxddlsefvdQVPLLDHHCHFLID-----------------gkvPNRDDRlaqvstEADK   43
ident                | | |                                        
Sbjct ----------TPVVVDIHTHMYPPsyiamlekrqtiplvrtfpqADEPRL----ilLSSE   46
DSSP  ----------LLLLEEEEEEELLHhhhhhhhlllllleeeeellEEEEEE----elLHHH


DSSP  LLLH---------HHHLllhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLL
Query DYPL---------ADTKnrlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFH   94
ident    |                                                        
Sbjct LAALdaaladpaaKLPG----------------------rplsthfaslAQKMHFMDTNG   84
DSSP  HHHHhhhhhllllLLLL----------------------eellhhhllhHHHHHHHHHLL


DSSP  EEEEEEELLL-----------------llllllLLHHHHHhhhlLLEEEEEEHhhHHHHh
Query FKELLIDTGF-----------------vpddpiLDLDQTAelvgIPVKAIYRLetHAEDf  137
ident      |                               |              |       
Sbjct IRVSVISLANpwfdflapdeapgiadavnaefsDMCAQHV----GRLFFFAAL--PLSA-  137
DSSP  LLEEEEEELLllllllllllhhhhhhhhhhhhhHHHHLLL----LLEEEEEEL--LLLL-


DSSP  hlllllhhhHHHHHHHHHHLLLLLL-LLLEEELHhhhlllllllllhhhhhhhhhhhhhh
Query xlehdnfaaWWQAFSNDVKQAKAHG-FVGFXSIAayrvglhlepvnvieaaagfdtwkhs  196
ident             |        |      |                               
Sbjct ---------PVDAVKASIERVKNLKyCRGIILGT--------------------------  162
DSSP  ---------LHHHHHHHHHHHHLLLlEEEEEELL--------------------------


DSSP  llllLLLHhhHHHHhHHHHHHHHHHLLLEEEEEllLLLL-------------------ll
Query gekrLTSKplIDYXlYHVAPFIIAQDXPLQFHVgyGDAD-------------------td  237
ident     |            |             |                            
Sbjct --sgLGKGldDPHL-LPVFEAVADAKLLVFLHP-hYGLPnevygprseeyghvlplalgf  218
DSSP  --llLLLLllLHHH-HHHHHHHHHLLLEEEELL-lLLLLhhhhlllhhhlllhhhhhlhh


DSSP  hHHLL--HHHHH--HHHHHHhhHLLLEEEEE-LLLLHHH---------------------
Query xYLGN--PLLXR--DYLKAFtkKGLKVVLLH-CYPYHRE---------------------  271
ident                         |   | |                             
Sbjct pMETTiaVARMYmaGVFDHV--RNLQMLLAHsGGTLPFLagriescivhdghlvktgkvp  276
DSSP  hHHHHhhHHHHHhlLHHHHL--LLLLEEEHHhHLLHHHHhhhhhhhhhllhhhhhlllll


DSSP  -----hhHHHHhlLLEEEELLlhhhhlhhhHHHHHHHHLLLLLHHHEELLLLLLLLHH--
Query -----agYLASvfPNLYFDISlldnlgpsgASRVFNEAVELAPYTRILFASDASTYPE--  324
ident                 | |                  |       |  |  |    |   
Sbjct kdrrtiwTVLK--EQIYLDAV-------iySEVGLQAAIASSGADRLMFGTDHPFFPPie  327
DSSP  lllllhhHHHH--HLEEEELL-------llLHHHHHHHHHHHLHHHEELLLLLLLLLLll


DSSP  ----hhHHHHHHHHHHHHHHHHllllllhhhHHHHHHHHHLHHHHHHLLLHHHHL-----
Query ----xyGLAARQFKQALVAHFNqlpfvdlaqKKAWINAICWQTSAKLYHQERELR-----  375
ident           |   ||                     |              ||      
Sbjct edvqgpWDSSRLNAQAVIKAVG--------eGSSDAAAVMGLNAVRVLSLKAELEhhhhh  379
DSSP  llllllLHHHHHHHHHHHHHHL--------lLLHHHHHHHLHHHHHHLLLHHHHHhhhhh


DSSP  l
Query v  376
ident  
Sbjct h  380
DSSP  l


No 17: Query=2qpxA Sbjct=1itqA Z-score=15.3

back to top
DSSP  lllLLHHHHHH----LLEEEEEEL-LLLL-------LLLLLhhhhhhhhlllllllllhh
Query gxdDLSEFVDQ----VPLLDHHCH-FLID-------GKVPNrddrlaqvsteadkdypla   48
ident                 |  | |                                      
Sbjct --dFFRDEAERimrdSPVIDGHNDlPWQLldmfnnrLQDER-------------------   39
DSSP  --lHHHHHHHHhhllLLEEEEEELhHHHHhhhhlllLLLHH-------------------


DSSP  hhlllhhhhhhhhhhhhhllllllllllllhhhHHHH------HHHHHHHLLEEEEEEEL
Query dtknrlayhgflalakefaldannplaaxndpgYATY------NHRIFGHFHFKELLIDT  102
ident                                    |       |                
Sbjct --------------------------------aNLTTlagthtNIPKLRAGFVGGQFWSV   67
DSSP  --------------------------------hLLLLllllllLHHHHHHLLEEEEEEEE


DSSP  LLL------------lllllLLHHHH--hHHHL-----------------LLEEEEEE-H
Query GFV------------pddpiLDLDQT--aELVG-----------------IPVKAIYR-L  130
ident                                                             
Sbjct YTPcdtqnkdavrrtleqmdVVHRMCrmyPETFlyvtssagirqafregkVASLIGVEgG  127
DSSP  LLLhhhllllhhhhhhhhhhHHHHHHhhlLLLEeelllhhhhhhhhhlllEEEEEEEElH


DSSP  HHHHhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELhHHHLllllllllhhhhhhhh
Query ETHAedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIaAYRVglhlepvnvieaaagf  190
ident                                |                            
Sbjct HSID---------------sSLGVLRALYQLGMRYLTLT-HSCN-------------tpw  158
DSSP  HHLL---------------lLHHHHHHHHHLLEEEEELL-LLLL-------------lll


DSSP  hhhhhhlllllLLHH-hhHHHHHHHHHHHHHHLLLEEEEEllllllllhhhllHHHH-HH
Query dtwkhsgekrlTSKP-liDYXLYHVAPFIIAQDXPLQFHVgygdadtdxylgnPLLX-RD  248
ident                         |                                   
Sbjct adnwlvdtgdsEPQSqglSPFGQRVVKELNRLGVLIDLAH------------vSVATmKA  206
DSSP  lllhhhlllllLLLLlllLHHHHHHHHHHHHHLLEEELLL------------lLHHHhHH


DSSP  HHHHHhhhLLLEEE-EELLL-------LHHH-HHHHHHHlLLEEEELLlhHHHL------
Query YLKAFtkkGLKVVL-LHCYP-------YHRE-AGYLASVfPNLYFDISllDNLG------  293
ident  |         |                       |                        
Sbjct TLQLS---RAPVIFsHSSAYsvcasrrNVPDdVLRLVKQ-TDSLVMVN--FYNNyisctn  260
DSSP  HHHHL---LLLLEElLLLLLlllllllLLLHhHHHHHHH-HLLEEEEL--LLHHhhllll


DSSP  ---HHHHHHHHHHHLLLLLHHHEELLLLLL------llhHHHHHhHHHHHHHHHHHHhll
Query ---PSGASRVFNEAVELAPYTRILFASDAS------typEXYGLaARQFKQALVAHFnql  344
ident     |          | |      |  |           |            |       
Sbjct kanLSQVADHLDHIKEVAGARAVGFGGDFDgvprvpeglEDVSK-YPDLIAELLRRN---  316
DSSP  lllHHHHHHHHHHHHHHLLHHHEEELLLLLlllllllllLLLLL-HHHHHHHHHHLL---


DSSP  llllhhhHHHHHHHHHLHHHHHHLL---------------------------lhhhhll
Query pfvdlaqKKAWINAICWQTSAKLYH---------------------------qerelrv  376
ident          |                                                 
Sbjct ------wTEAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  ------lLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll


No 18: Query=2qpxA Sbjct=2y1hB Z-score=15.2

back to top
DSSP  lllllhhhhhHLLEEEEEELL---LLLLllllhhhhhhhhlllllllllhhhhlllhhhh
Query gxddlsefvdQVPLLDHHCHF---LIDGkvpnrddrlaqvsteadkdypladtknrlayh   57
ident            | | | |||      |                                 
Sbjct ----------GVGLVDCHCHLsapDFDR--------------------------------   18
DSSP  ----------LLLEEEEEELLllhHHLL--------------------------------


DSSP  hhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELL--lllllllLLHHH
Query gflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTG--fvpddpiLDLDQ  115
ident                                         |                   
Sbjct ------------------------dlDDVLEKAKKANVVALVAVAEhsgefekimQLSER   54
DSSP  ------------------------lhHHHHHHHHHLLEEEEEELLLlhhhhhhhhHHHHH


DSSP  HHhhhlLLEEEEEEHH-----------hhHHHHhlllllhhhhhhhHHHHHHLLLLlLLL
Query TAelvgIPVKAIYRLE-----------thAEDFxlehdnfaawwqaFSNDVKQAKAhGFV  164
ident         |                      |                      |     
Sbjct YN----GFVLPCLGVHpvqgldqrsvtlkDLDV-------------ALPIIENYKD-RLL   96
DSSP  LL----LLEEEEELLLleelllleellhhHHHH-------------HHHHHHHHLL-LLL


DSSP  LE-EELHHHhlllllllllhhhhhhhhhhhhhhlllllLLHHHHHHHHHHHHHHHHHHLL
Query GF-XSIAAYrvglhlepvnvieaaagfdtwkhsgekrlTSKPLIDYXLYHVAPFIIAQDX  223
ident                                         |      |            
Sbjct AIgEVGLDF---------------------sprfagtgEQKEEQRQVLIRQIQLAKRLNL  135
DSSP  EEeEEEEEL---------------------lllllllhHHHHHHHHHHHHHHHHHHHHLL


DSSP  LEEEEELlllllllhhhLLHHH-HHHHHHHHHhhlLLEEEEELLlLHHHHHHHHHHLlLE
Query PLQFHVGygdadtdxylGNPLL-XRDYLKAFTkkgLKVVLLHCYpYHREAGYLASVFpNL  282
ident |   |                               || |                    
Sbjct PVNVHSR----------SAGRPtINLLQEQGA---EKVLLHAFD-GRPSVAMEGVRA-GY  180
DSSP  LEEEEEE----------LLHHHhHHHHHHLLL---LLEEEELLL-LLHHHHHHHHHL-LL


DSSP  EEELLlhhHHLHHHhhHHHHHHLLLLLHHHEELLLLLL------llhHHHHhHHHHHHHH
Query YFDISlldNLGPSGasRVFNEAVELAPYTRILFASDAS------typEXYGlAARQFKQA  336
ident  | |                  |   | | |    |                        
Sbjct FFSIP---PSIIRS--GQKQKLVKQLPLTSICLETDSPalgpekqvrNEPW-NISISAEY  234
DSSP  EEEEL---HHHHLL--HHHHHHHHHLLHHHEEELLLLLlllllllllLLHH-HHHHHHHH


DSSP  HHHHHHllllllhhHHHHHHHHHhLHHHHHHLL-LHHHHll
Query LVAHFNqlpfvdlaQKKAWINAIcWQTSAKLYH-QERELrv  376
ident                    |     |   ||       |  
Sbjct IAQVKG-------iSVEEVIEVT-TQNALKLFPkLRHLL--  265
DSSP  HHHHHL-------lLHHHHHHHH-HHHHHHHLLlHHHHL--


No 19: Query=2qpxA Sbjct=3e74A Z-score=15.0

back to top
DSSP  -----------------------------------------lllllhHHHHhLLEEEEEE
Query -----------------------------------------gxddlsEFVDqVPLLDHHC   19
ident                                                  |      | | 
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasgLVVS-PGXVDAHT   59
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllLEEE-ELEEEEEE


DSSP  LLLlllllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllh
Query HFLidgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaaxnd   79
ident |                                                           
Sbjct HIG---------------------------------------------------------   62
DSSP  LLL---------------------------------------------------------


DSSP  hhhhHHHHHHHHHLLEEEEEEELLLLL------lllllLHHHHhHHHLLLEEEEEEHHHH
Query pgyaTYNHRIFGHFHFKELLIDTGFVP------ddpilDLDQTaELVGIPVKAIYRLETH  133
ident         |                               |       |       |   
Sbjct ---yETGTRAAAKGGITTXIEXPLNQLpatvdrasielKFDAAkGKLTIDAAQLGGLVSY  119
DSSP  ---hHHHHHHHHHLLEEEEEELLLLLLlllllhhhhhhHHHHHlLLLLLEEEELEELLLL


DSSP  hhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELHhhhlllllllllhhhhhhhhhhh
Query aedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIAayrvglhlepvnvieaaagfdtw  193
ident                             | ||||                          
Sbjct -----------------NIDRLHELDEVGVVGFXCFV-----------------------  139
DSSP  -----------------LLLLHHHHHHHLLLLEEEEL-----------------------


DSSP  hhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELlllllLLHH--------------
Query khsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGygdadTDXY--------------  239
ident               |      |        |   |                         
Sbjct ----------rdvNDWQFFKGAQKLGELGQPVLVHCE----nALICdelgeeakregrvt  185
DSSP  ----------lllLHHHHHHHHHHHHHHLLLEEEELL----lHHHHhhhhhhhhhhllll


DSSP  ---------hlLHHHH-HHHHHHHHHHLLLEEEEELLllHHHHHHHHHHL----LLEEEE
Query ---------lgNPLLX-RDYLKAFTKKGLKVVLLHCYpyHREAGYLASVF----PNLYFD  285
ident                  |  |      |      |      |                  
Sbjct ahdyvasrpvfTEVEAiRRVLYLAKVAGCRLHVCHVS--SPEGVEEVTRArqegQDITCE  243
DSSP  hhhhhhlllhhHHHHHhHHHHHHHHHHLLLEEELLLL--LHHHHHHHHHHhhllLLEEEE


DSSP  LLlhHHHLHHH---------------------hhHHHHHH-LLLLlhhHEELLLLLLL--
Query ISllDNLGPSG---------------------asRVFNEA-VELApytRILFASDAST--  321
ident                                       |              || |   
Sbjct SC--PHYFVLDtdqfeeigtlakcsppirdlenqKGXWEKlFNGE---IDCLVSDHSPcp  298
DSSP  EL--LHHHHLLhhhhhhhlhhhllllllllhhhhHHHHHHhHLLL---LLEELLLLLLll


DSSP  -------------lhHHHHHHHHHHHHHHH-HHHHllllllhhhHHHHHHHHHLHHHHHH
Query -------------ypEXYGLAARQFKQALV-AHFNqlpfvdlaqKKAWINAICWQTSAKL  367
ident                              |                           |  
Sbjct pexkagnixkawggiAGLQSCXDVXFDEAVqKRGX---------SLPXFGKLXATNAADI  349
DSSP  lllllllllllllllLLHHHHHHHHHHHHLlLLLL---------LHHHHHHHHLHHHHHH


DSSP  LLLHHHHLL---------------------------------------------------
Query YHQERELRV---------------------------------------------------  376
ident        |                                                    
Sbjct FGLQQKGRIapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdv  409
DSSP  LLLLLLLLLllllllleeeeelllleellhhhllllllllllllleelleeeeeeellee


DSSP  --------------------
Query --------------------  376
ident                     
Sbjct iydieqgfpvapkgqfilkh  429
DSSP  eeelllllllllllleelll


No 20: Query=2qpxA Sbjct=4qrnA Z-score=14.9

back to top
DSSP  --lllllhhhhHHLLEEEEEELL------------------------lllllLLLHHHHH
Query --gxddlsefvDQVPLLDHHCHF------------------------lidgkVPNRDDRL   34
ident                       |                                   | 
Sbjct smtqdlktggeQGYLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyAQSPSERA   60
DSSP  lllllllllllLLLLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhHHLLLHHH


DSSP  HHHlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLL
Query AQVsteadkdypladtknrlayhgflalakefaldannplaaxndpgyatYNHRIFGHFH   94
ident  |                                                          
Sbjct TQI--------------------------------------lerlldlgeRRIADMDATG   82
DSSP  HHH--------------------------------------hhhhhlllhHHHHHHHHLL


DSSP  EEEEEEELLL------------------llllllLLHHHHHhhhlLLEEEEEEhhHHHHh
Query FKELLIDTGF------------------vpddpiLDLDQTAelvgIPVKAIYRleTHAEd  136
ident                                                             
Sbjct IDKAILALTSpgvqplhdldeartlatrandtlaDACQKYP----DRFIGMGT--VAPQ-  135
DSSP  LLEEEEEELLllllllllhhhhhhhhhhhhhhhhHHHHHLL----LLEEELLL--LLLL-


DSSP  hhlllllhhhHHHHHHHHHHLLLL-LLLLLEEELHHhhlllllllllhhhhhhhhhhhhh
Query fxlehdnfaaWWQAFSNDVKQAKA-HGFVGFXSIAAyrvglhlepvnvieaaagfdtwkh  195
ident                           || |                              
Sbjct ----------DPEWSAREIHRGAReLGFKGIQINSH------------------------  161
DSSP  ----------LHHHHHHHHHHHHHlLLLLLEEELLL------------------------


DSSP  hllllLLLH-hhHHHHhHHHHHHHHHHLLLEEEE----------------ellLLLLLlH
Query sgekrLTSK-plIDYXlYHVAPFIIAQDXPLQFH----------------vgyGDADTdX  238
ident                            | ||  |                          
Sbjct -----TQGRyldEEFF-DPIFRALVEVDQPLYIHpatspdsmidpmleagldgAIFGF-G  214
DSSP  -----LLLLlllLHHH-HHHHHHHHHHLLLEEELlllllllllhhhhhhllllLLLHH-H


DSSP  HHLL--HHHHH--HHHHHHHhhLLLEEEEE-LLLLHH-----------------------
Query YLGN--PLLXR--DYLKAFTkkGLKVVLLH-CYPYHR-----------------------  270
ident        |               |     |                              
Sbjct VETGmhLLRLItiGIFDKYP--SLQIMVGHmGEALPYwlyrldymhqagvrsqryermkp  272
DSSP  HHHHhhHHHHHhhLHHHHLL--LLLEEELHhHHLHHHhhhhhhhhhhhhhhlllllllll


DSSP  ---hhhhHHHHllLEEEELLLHHhhlhhhHHHHHHHHLLLLLHHHEELLLLLLLlhhHHH
Query ---eagyLASVfpNLYFDISLLDnlgpsgASRVFNEAVELAPYTRILFASDASTypeXYG  327
ident              |     |                        |   | |         
Sbjct lkktiegYLKS--NVLVTNSGVA------WEPAIKFCQQVMGEDRVMYAMDYPY--qYVA  322
DSSP  llllhhhHHHH--LEEEELLLLL------LHHHHHHHHHHHLHHHEELLLLLLL--lLLH


DSSP  HHHHHHHHhhHHHHhllllllhhhhHHHHHHHHLHHHHHHLLLhhhhll
Query LAARQFKQalVAHFnqlpfvdlaqkKAWINAICWQTSAKLYHQerelrv  376
ident    |                                  |          
Sbjct DEVRAMDA--MDMS-----------AQTKKKFFQTNAEKWFKL------  352
DSSP  HHHHHHHL--LLLL-----------HHHHHHHHLHHHHHHLLL------


No 21: Query=2qpxA Sbjct=3pnuA Z-score=14.7

back to top
DSSP  --lllllHHHHhHLLEEEEEELLLLLLllllhhhhhhhhlllllllllhhhhlllhhhhh
Query --gxddlSEFVdQVPLLDHHCHFLIDGkvpnrddrlaqvsteadkdypladtknrlayhg   58
ident                 || | |                                      
Sbjct enlyfqsNAMK-LKNPLDMHLHLRDNQ---------------------------------   26
DSSP  lllllllLLEE-EELLEEEEELLLLHH---------------------------------


DSSP  hhhhhhhhllllllllllllhhhhhhhhHHHHHHLlEEEEEEELLLL-----lllllLLH
Query flalakefaldannplaaxndpgyatynHRIFGHFhFKELLIDTGFV-----pddpiLDL  113
ident                                     |    |                  
Sbjct -----------------------mleliAPLSARD-FCAAVIMPNLIpplcnledlkAYK   62
DSSP  -----------------------hhhhhHHHHHLL-LLEEEELLLLLlllllhhhhhHHH


DSSP  HHHHHHH---LLLEEEEEEHHhhhhhhhlllllhhhhhhhHHHHHHLLLlLLLLLEEELh
Query DQTAELV---GIPVKAIYRLEthaedfxlehdnfaawwqaFSNDVKQAKaHGFVGFXSIa  170
ident                                                ||     | |   
Sbjct MRILKACkdeNFTPLMTLFFK-----------------nyDEKFLYSAK-DEIFGIXLY-  103
DSSP  HHHHHHHlllLLEEEEEEELL-----------------llLHHHHHHHL-LLLLEEEEL-


DSSP  HHHLllllllllhhhhhhhhhhhhhhlllllllhhHHHH--HHHHHHHHHHHHLLLEEEE
Query AYRVglhlepvnvieaaagfdtwkhsgekrltskpLIDY--XLYHVAPFIIAQDXPLQFH  228
ident                                           |            ||  |
Sbjct PAGI-----------------------ttnsnggvSSFDieYLKPTLEAMSDLNIPLLVH  140
DSSP  LLLL-----------------------llllllllLLLLhhHHHHHHHHHHHLLLLEEEL


DSSP  ELllllLLLH-HHLL-HHHH-HHHHHHHHhhLLLEEEEELLllHHHHHHHHHHLLLEEEE
Query VGygdaDTDX-YLGN-PLLX-RDYLKAFTkkGLKVVLLHCYpyHREAGYLASVFPNLYFD  285
ident                          | |    || |  |          |     |||  
Sbjct GE---tNDFVmDRESnFAKIyEKLAKHFP--RLKIVMEHIT--TKTLCELLKDYENLYAT  193
DSSP  LL---lLLLHhHLLHhHHHHhHHHHHHLL--LLLEEELLLL--LHHHHHHHHHLLLEEEE


DSSP  LLLHHhhLHHH--------------------hhhhhHHHLL--lllHHHEELLLLLLL--
Query ISLLDnlGPSG--------------------asrvfNEAVE--lapYTRILFASDAST--  321
ident | |                                     |     |    | ||     
Sbjct ITLHH--LIITlddviggkmnphlfckpiakryedkEALCElafsgYEKVMFGSDSAPhp  251
DSSP  ELLHH--HLLLhhhhhlllllhhhllllllllhhhhHHHHHhhhllLLLEEELLLLLLll


DSSP  -----lhHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLlHHHHLL
Query -----ypEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHqERELRV  376
ident                                                  | |        
Sbjct kgcaagvFSAPVILPVLAELFKQNS----------SEENLQKFLSDNTCKIYD-LKFKED  300
DSSP  lllllllLLHHHHHHHHHHHHHHHL----------LHHHHHHHHLHHHHHHHL-LLLLLL


DSSP  --------------------------------------
Query --------------------------------------  376
ident                                       
Sbjct kiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  leeeeellleelllleelllleellllllleelleell


No 22: Query=2qpxA Sbjct=2gwgA Z-score=14.7

back to top
DSSP  lllllhhhhhhlLEEEEEELLLLLLLlllhhhhhhhhlllllllllhhhhlllhhhhhhh
Query gxddlsefvdqvPLLDHHCHFLIDGKvpnrddrlaqvsteadkdypladtknrlayhgfl   60
ident                | | |     |                                  
Sbjct ------------XIIDIHGHYTTAPK---------------------aledwrnrqiagi   27
DSSP  ------------LLEEEEEELLLLLH---------------------hhhhhhhhhhhhh


DSSP  hhhhhhllllllllllllhhhHHHHH-HHHHHHLLEEEEEEELLL------------lll
Query alakefaldannplaaxndpgYATYN-HRIFGHFHFKELLIDTGF------------vpd  107
ident                          |                                  
Sbjct kdpsvxpkvselkisddelqaSIIENqLKKXQERGSDLTVFSPRAgdfnvsstwaaicne   87
DSSP  hlhhhlllhhhllllhhhhhhHHHLLhHHHHHHHLLLEEEEELLLllhhhhhhhhhhhhh


DSSP  lllLLHHHHHhhhlLLEEEEEEhhHHHHhhhlllllhhhhhhHHHHHHHLLLLL-LLLLE
Query dpiLDLDQTAelvgIPVKAIYRleTHAEdfxlehdnfaawwqAFSNDVKQAKAH-GFVGF  166
ident                                                        |||  
Sbjct lcyRVSQLFP----DNFIGAAX--LPQS--------pgvdpkTCIPELEKCVKEyGFVAI  133
DSSP  hhhHHHHHLL----LLEEEEEE--LLLL--------llllhhHHHHHHHHHHHLlLLLEE


DSSP  EELHhHHLLlllllllhhhhhhhhhhhhhhlllllLLHH-hhHHHHHHHHHHHHHHLLLE
Query XSIAaYRVGlhlepvnvieaaagfdtwkhsgekrlTSKP-liDYXLYHVAPFIIAQDXPL  225
ident         |                             |   |   |           | 
Sbjct NLNP-DPSG------------------------ghWTSPpltDRIWYPIYEKXVELEIPA  168
DSSP  EELL-LLLL------------------------llLLLLlllLHHHHHHHHHHHHHLLLE


DSSP  EEEelllLLLLlhHHLL--HHHHH--HHHHHHhhHLLLEEEEE-LLLLHHH---------
Query QFHvgygDADTdxYLGN--PLLXR--DYLKAFtkKGLKVVLLH-CYPYHRE---------  271
ident   |                       |  | |    || |  |                 
Sbjct XIH--vsTGAHylNADTtaFXQCVagDLFKDF--PELKFVIPHgGGAVPYHwgrfrglaq  224
DSSP  EEL--llLLLHhhHHHHhhHHHHHhlLHHHHL--LLLLEEELHhHLLLHHHhhhhhhhhh


DSSP  --hhhhhHHLL--LEEEELLLHhhhlhhhHHHHHHHHLLLLLHHHEELLLLLLL------
Query --agylaSVFP--NLYFDISLLdnlgpsgASRVFNEAVELAPYTRILFASDAST------  321
ident              |  ||                       |    ||||          
Sbjct exkkpllEDHVlnNIFFDTCVY-------HQPGIDLLNTVIPVDNVLFASEXIGavrgid  277
DSSP  hlllllhHHHLllLEEEELLLL-------LHHHHHHHHHHLLHHHEELLLLLLLllllee


DSSP  --lhhhhhHHHHHHHHhhHHHHhllllllhhhHHHHHHHHHLHHHHHHLL-LHHHHL---
Query --ypexygLAARQFKQalVAHFnqlpfvdlaqKKAWINAICWQTSAKLYH-QERELR---  375
ident            |                           |        |      |    
Sbjct prtgfyydDTKRYIEA--STIL----------TPEEKQQIYEGNARRVYPrLDAALKakg  325
DSSP  lllleellLLHHHHHH--LLLL----------LHHHHHHHHLHHHHHHLHhHHHHHHhhh


DSSP  ---l
Query ---v  376
ident     
Sbjct kleh  329
DSSP  hhll


No 23: Query=2qpxA Sbjct=4ofcA Z-score=14.6

back to top
DSSP  lllllhhhhhhlLEEEEEELLLLLL-----------------llLLHHHH-------hHH
Query gxddlsefvdqvPLLDHHCHFLIDG-----------------kvPNRDDR-------lAQ   36
ident                | | | |                                      
Sbjct ------------MKIDIHSHILPKEwpdlkkrfgyggwvqlqhhSKGEAKllkdgkvfRV   48
DSSP  ------------LLEEEEEELLLLLlllhhhhhllllleeeeeeELLEEEeeelleeeEE


DSSP  HLllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEE
Query VSteadkdypladtknrlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFK   96
ident |                                                  |        
Sbjct VR---------------------------------------encwdpEVRIREMDQKGVT   69
DSSP  EE---------------------------------------hhhllhHHHHHHHHHHLLL


DSSP  EEEEELLLL------------------lllllLLHHHHHhhhlLLEEEEEEHhhHHHHhh
Query ELLIDTGFV------------------pddpiLDLDQTAelvgIPVKAIYRLetHAEDfx  138
ident      |  |                                          |        
Sbjct VQALSTVPVmfsywakpedtlnlcqllnndlaSTVVSYP----RRFVGLGTL--PMQA--  121
DSSP  EEEEELLHHhhlllllhhhhhhhhhhhhhhhhHHHHHLL----LLEEEEELL--LLLL--


DSSP  lllllhhhhhHHHHHHHHLLLL-LLLLLEEELHHhhlllllllllhhhhhhhhhhhhhhl
Query lehdnfaawwQAFSNDVKQAKA-HGFVGFXSIAAyrvglhlepvnvieaaagfdtwkhsg  197
ident                         || |                                
Sbjct ---------pELAVKEMERCVKeLGFPGVQIGTH--------------------------  146
DSSP  ---------hHHHHHHHHHHHHlLLLLEEEEELE--------------------------


DSSP  lllLLLHhhhHHHHHHHHHHHHHHLLLEEEEEllLLLL-------------llhHHLL--
Query ekrLTSKpliDYXLYHVAPFIIAQDXPLQFHVgyGDAD-------------tdxYLGN--  242
ident              |  |          |  |                             
Sbjct ---VNEWdlnAQELFPVYAAAERLKCSLFVHP-wDMQMdgrmakywlpwlvgmpAETTia  202
DSSP  ---ELLEellLHHHHHHHHHHHHHLLEEEEEL-lLLLLlhhhhlllhhhhlhhhHHHHhh


DSSP  HHHHH--HHHHHHHhhLLLEEEEE-LLLLHH----------------------hhhhHHH
Query PLLXR--DYLKAFTkkGLKVVLLH-CYPYHR----------------------eagyLAS  277
ident             |    |||   |                                    
Sbjct ICSMImgGVFEKFP--KLKVCFAHgGGAFPFtvgrishgfsmrpdlcaqdnpmnpkkYLG  260
DSSP  HHHHHllLHHHHLL--LLLEEELHhHLLHHHhhhhhhhhhhhlhhhhlllllllhhhHLL


DSSP  HlllEEEELLlhhhhlhhHHHHHHHHHLLLLLHHHEELLLLLLllhhhhhHHHHHHHhHH
Query VfpnLYFDISlldnlgpsGASRVFNEAVELAPYTRILFASDAStypexygLAARQFKqAL  337
ident      | |                                |               |   
Sbjct S---FYTDAL-------vHDPLSLKLLTDVIGKDKVILGTDYP----fplGELEPGK-LI  305
DSSP  L---LEEELL-------lLLHHHHHHHHHHHLLLLEELLLLLL----lllLLLLLLH-HH


DSSP  HHHHHllllllhhhHHHHHHHHHLHHHHHHLLL-HHHHll
Query VAHFNqlpfvdlaqKKAWINAICWQTSAKLYHQ-ERELrv  376
ident                    |                    
Sbjct ESMEE--------fDEETKNKLKAGNALAFLGLeRKQF--  335
DSSP  HHLLL--------lLHHHHHHHHLHHHHHHHLLlHHHL--


No 24: Query=2qpxA Sbjct=2ffiA Z-score=14.5

back to top
DSSP  lllllhhhhhhlLEEEEEELLLLL-----lllllhHHHHhhhlllllllllhhhhlllhh
Query gxddlsefvdqvPLLDHHCHFLID-----gkvpnrDDRLaqvsteadkdypladtknrla   55
ident                | | |                                        
Sbjct ---------lhlTAIDSHAHVFSRglnlasqrryaPNYD---------------------   30
DSSP  ---------lllLLEELLLLLLLHhhhhhllllllLLLL---------------------


DSSP  hhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLLEEEEEEELLLL----lllllL
Query yhgflalakefaldannplaaxndpgyatYNHRIFGHFHFKELLIDTGFV----pddpiL  111
ident                                        |                    
Sbjct -------------------------aplgDYLGQLRAHGFSHGVLVQPSFlgtdnryllS   65
DSSP  -------------------------llhhHHHHHHHHLLLLEELLLLLHHhllllhhhhH


DSSP  LHHHHHhhhllLEEEEEEHHhhhhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELHH
Query DLDQTAelvgiPVKAIYRLEthaedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIAA  171
ident  |                ||                              |  |      
Sbjct ALQTVP----gQLRGVVXLE----------------rdvEQATLAEXARLGVRGVRLNLX  105
DSSP  HHHHLL----lLLLLLLLLL----------------lllLHHHHHHHHLLLLLEEELLLL


DSSP  HHLLLLLLLllhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHHLLLEEEEELl
Query YRVGLHLEPvnvieaaagfdtwkhsgekrltskplidYXLYHVAPFIIAQDXPLQFHVGy  231
ident       |                                       |  |      |   
Sbjct GQDXPDLTG----------------------------AQWRPLLERIGEQGWHVELHRQ-  136
DSSP  LLLLLLLLL----------------------------LLLHHHHHHHHHHLLEEEELLL-


DSSP  llllllhhhLLHHHHHHHHHHHHhhlLLEEEE-ELLL---------LHHHHHHhhHHLL-
Query gdadtdxylGNPLLXRDYLKAFTkkgLKVVLL-HCYP---------YHREAGYlaSVFP-  280
ident                   |       |  |      |            |          
Sbjct --------vADIPVLVRALQPYG---LDIVIDhFGRPdarrglgqpGFAELLT--LSGRg  183
DSSP  --------lLLHHHHHHHHLLLL---LLEEELhHHLLlllllllllLHHHHLL--LLLLl


DSSP  LEEEELLLhHHHL-------HHHHHHHHHHHLLLLLHHHEELLLLLL----llhHHHHHH
Query NLYFDISLlDNLG-------PSGASRVFNEAVELAPYTRILFASDAS----typEXYGLA  329
ident       |                |              |    ||            | |
Sbjct KVWVKVSG-IYRLqgspeenLAFARQALCALEAHYGAERLXWGSDWPhtqheseVSFGSA  242
DSSP  LEEEEEEL-HHHLlllhhhhHHHHHHHHHHHHHHLLHHHEEEELLLLlllllllLLHHHH


DSSP  HHHHHHHHHhhhhllllllhhhHHHHHHHHHLHHHHHHLLLHHHhll
Query ARQFKQALVahfnqlpfvdlaqKKAWINAICWQTSAKLYHQERElrv  376
ident   ||                        |    |   |   | |   
Sbjct VEQFEALGC-------------SAQLRQALLLDTARALFGFELE---  273
DSSP  HHHHHHHLL-------------LHHHHHHHHLHHHHHHLLLLLL---


No 25: Query=2qpxA Sbjct=4mupB Z-score=14.4

back to top
DSSP  --lllllhhhHHHLL--EEEEEELLLLLL---llllhhhHHHHhlllllllllhhhhlll
Query --gxddlsefVDQVP--LLDHHCHFLIDG---kvpnrddRLAQvsteadkdypladtknr   53
ident               |    |   |    |                               
Sbjct lvrklsgtapNPAFPrgAVDTQMHMYLPGypalpggpglPPGA-----------------   43
DSSP  llllllllllLLLLLllLEELLLLLLLLLllllllllllLLLL-----------------


DSSP  hhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLLL----lll
Query layhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFVP----ddp  109
ident                                   |           |  |          
Sbjct --------------------------lpgpEDYRRLMQWLGIDRVIITQGNAHqrdngnt   77
DSSP  --------------------------lllhHHHHHHHHHHLLLEEEEELLHHHllllhhh


DSSP  lLLHHHHHhhhllLEEEEEEHhhhhhhhhlllllhhhhhhHHHH-HHHLLLLLLLLLEEE
Query iLDLDQTAelvgiPVKAIYRLethaedfxlehdnfaawwqAFSN-DVKQAKAHGFVGFXS  168
ident                 |                            |     | | ||   
Sbjct lACVAEMG----eAAHAVVII-----------------daTTTEkDMEKLTAAGTVGARI  116
DSSP  hHHHHHHH----hHEEEEELL-----------------llLLLHhHHHHHHHLLEEEEEE


DSSP  LHHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEE
Query IAAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFH  228
ident                                           |  |     | |      
Sbjct MDLPG------------------------------gavNLSELDAVDERAHAADWMVAVQ  146
DSSP  ELLLL------------------------------lllLHHHHHHHHHHHHHLLLEEEEE


DSSP  ELlllllllhhhLLHHHHHHHHHHHhhhLLLEEEEE-LLLL--------hhhhHHHHHHL
Query VGygdadtdxylGNPLLXRDYLKAFtkkGLKVVLLH-CYPY--------hreaGYLASVF  279
ident                |     |          |  |                        
Sbjct FD---------gNGLLDHLPRLQKI---RSRWVFDHhGKFFkgirtdgpemaaLLKLIDR  194
DSSP  LL---------hHHHHHHHHHHHLL---LLEEEELHhHHLLlllllllhhhhhHHHHHHH


DSSP  LLEEEELLLHhHHLH---HHHHHHHHHHLLL--LLHHHEELLLLLL----llhhhhhHHH
Query PNLYFDISLLdNLGP---SGASRVFNEAVEL--APYTRILFASDAS----typexygLAA  330
ident  || |                  |             ||                    |
Sbjct GNLWFKFAGV-YESSrksWPYADVAAFSRVIaaHAPERIVWGTNWPhnsvretaaypDDA  253
DSSP  LLEEEEELLH-HHLLlllLLLHHHHHHHHHHhhHLHHHEEELLLLLllllllhhhllLHH


DSSP  HHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLHHHhll
Query RQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQERElrv  376
ident |     |                |            |         
Sbjct RLAELTLGWLP----------DEAARHRALVENPEALFKLSPV---  286
DSSP  HHHHHHHLLLL----------LHHHHHHHHLHHHHHHHLLLLL---


No 26: Query=2qpxA Sbjct=2vunA Z-score=14.2

back to top
DSSP  ------------------------------------------------lllllhhhhhHL
Query ------------------------------------------------gxddlsefvdQV   12
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LEEEEEELLLLllllllhhhHHHHhlllllllllhhhhlllhhhhhhhhhhhhhllllll
Query PLLDHHCHFLIdgkvpnrddRLAQvsteadkdypladtknrlayhgflalakefaldann   72
ident  ||| | |                                                    
Sbjct GLLDTHVHVSG-----gdyaPRQK------------------------------------   79
DSSP  LEEEEEELLLL-----lleeHHHL------------------------------------


DSSP  llllllhhhhhhHHHHHHHHLLEEEEEEELLLLLLL--------------lllLHHHHHh
Query plaaxndpgyatYNHRIFGHFHFKELLIDTGFVPDD--------------pilDLDQTAe  118
ident                    |                                        
Sbjct ----------tmDFISSALHGGVTTMISAGSPHFPGrpkdaagtkalaitlskSYYNAR-  128
DSSP  ----------eeLHHHHHHLLLEEEEEELLLLLLLLllllhhhhhhhhhhhhhHHHHLL-


DSSP  HHLLLEE-EEEEHhhhHHHHhlllllhhhhhhhHHHHHHLLLLLLLLLE-EELHhhhlll
Query LVGIPVK-AIYRLethAEDFxlehdnfaawwqaFSNDVKQAKAHGFVGF-XSIAayrvgl  176
ident   |  |      |                       |    |  |               
Sbjct PAGVKVHgGAVIL---EKGL-------------TEEDFIEMKKEGVWIVgEVGL------  166
DSSP  HHHLEEElLEELL---LLLL-------------LHHHHHHHHHLLLLEEeEELL------


DSSP  llllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLLLLL
Query hlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGDADT  236
ident                                                  | | |      
Sbjct --------------------------gtikNPEDAAPMVEWAHKHGFKVQMHTGGTSIPG  200
DSSP  --------------------------llllLHHHHHHHHHHHHHLLLEEEEELLLLLLLL


DSSP  LHhhLLHHHH-HHHHhhhhhhllLEEEEELL----LLHH-HHHHHHHHLLlEEEELLlhH
Query DXylGNPLLX-RDYLkaftkkglKVVLLHCY----PYHR-EAGYLASVFPnLYFDISllD  290
ident                          |  |           |              |    
Sbjct SS--TVTADDvIKTK--------PDVVSHINggptAISVqEVDRIMDETD-FAMEIV--Q  247
DSSP  LL--LLLHHHhHHHL--------LLEEELLLllllLLLHhHHHHHHHHLL-LEEEEE--L


DSSP  HHLhhhhHHHHHHHLLLL----LHHHEELLLLLLllhHHHHHHHHHHHHHH-HHHHhlll
Query NLGpsgaSRVFNEAVELA----PYTRILFASDAStypEXYGLAARQFKQAL-VAHFnqlp  345
ident                  |       |  |  ||        |                  
Sbjct CGN----PKIADYVARRAaekgQLGRVIFGNDAPsgtGLIPLGILRNMCQIaSMSD----  299
DSSP  LLL----HHHHHHHHHHHhhhlLHHHEEEELLLLlllLLLLLHHHHHHHHHhHHLL----


DSSP  lllhhhHHHHHHHHHLHHHHHHLLLhHHHLL-----------------------------
Query fvdlaqKKAWINAICWQTSAKLYHQeRELRV-----------------------------  376
ident                   |   |                                     
Sbjct -----iDPEVAVCMATGNSTAVYGL-NTGVIapgkeadliimdtplgsvaedamgaiaag  353
DSSP  -----lLHHHHHHHHLHHHHHHHLL-LLLLLllllllleeeeelllllllllhhhhhhhl


DSSP  --------------------------------
Query --------------------------------  376
ident                                 
Sbjct dipgisvvlidgeavvtksrntppakraakil  385
DSSP  llleeeeeeelleeeellllllllllllleel


No 27: Query=2qpxA Sbjct=1a5kC Z-score=13.8

back to top
DSSP  -----------------lllLLHH------------------------------------
Query -----------------gxdDLSE------------------------------------    7
ident                      |                                      
Sbjct snisrqayadmfgptvgdkvRLADtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeELLLllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    7
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  --hhhHLLEEEEEELLLLllllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhh
Query --fvdQVPLLDHHCHFLIdgkvpnrddrlaqvsteadkdypladtknrlayhgflalake   65
ident           | | |                                             
Sbjct egkivTAGGIDTHIHWIC------------------------------------------  138
DSSP  llleeEELEEEEEEELLL------------------------------------------


DSSP  hllllllllllllhhhhhhHHHHHHHHLLEEEEEEELlLLLL-------------lllLL
Query faldannplaaxndpgyatYNHRIFGHFHFKELLIDTgFVPD-------------dpiLD  112
ident                                         |                   
Sbjct ------------------pQQAEEALVSGVTTMVGGG-TGPAagthattctpgpwyisRM  179
DSSP  ------------------lLHHHHHHHHLEEEEEEEL-LLLLhhhhhlllllhhhhhhHH


DSSP  HHHHhHHHLLLEEEEEEHHhhhhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELhHH
Query LDQTaELVGIPVKAIYRLEthaedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIaAY  172
ident |                                              | |  |       
Sbjct LQAA-DSLPVNIGLLGKGN-----------------vsQPDALREQVAAGVIGLEIH-ED  220
DSSP  HHHH-LLLLLEEEEEEELL-----------------llLHHHHHHHHHHLLLEEEEE-HH


DSSP  HLllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEElll
Query RVglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVgyg  232
ident                                                  |     |    
Sbjct WG-------------------------------aTPAAIDCALTVADEMDIQVALHS---  246
DSSP  HL-------------------------------lLHHHHHHHHHHHHHHLLEEEEEL---


DSSP  llllLHHHllhhHHHHHHHHHHHhlLLEEEEELLLL----hhHHHHHHHhLLLEEEELLL
Query dadtDXYLgnplLXRDYLKAFTKkgLKVVLLHCYPY----hrEAGYLASvFPNLYFDISL  288
ident     |          | | |           |                   ||       
Sbjct ----DTLN-esgFVEDTLAAIGG--RTIHTFHTEGAggghapDIITACA-HPNILPSSTN  298
DSSP  ----LLLL-lllLHHHHHHHHLL--LLEEELLLLLLllllllLHHHHHH-LLLEEEEEEH


DSSP  HhhhlhhHHHH----------------------------------------HHHHHLlll
Query LdnlgpsGASR----------------------------------------VFNEAVela  308
ident                                                             
Sbjct P------TLPYtlntidehldmlmvchhldpdiaedvafaesrirretiaaEDVLHD---  349
DSSP  H------HLLLlllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHH---


DSSP  lHHHEELLLLLLllhhHHHHHHHHHHHHHHHHHH--LLLLLL----HHHHHHHHHHHHLH
Query pYTRILFASDAStypeXYGLAARQFKQALVAHFN--QLPFVD----LAQKKAWINAICWQ  362
ident      |  ||        |       |                            |    
Sbjct lGAFSLTSSDSQ-amgRVGEVILRTWQVAHRMKVqrGALAEEtgdnDNFRVKRYIAKYTI  408
DSSP  lLLLLEEELLLL-lllLLLLHHHHHHHHHHHHHHhhLLLLLLllllLHHHHHHHHHLLLH


DSSP  HHHHHLLLH-HHHLL---------------------------------------------
Query TSAKLYHQE-RELRV---------------------------------------------  376
ident   |                                                         
Sbjct NPALTHGIAhEVGSIevgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpq  468
DSSP  HHHHHLLLLlLLLLLllllllleeeelhhhlllllleeeelleeeeeeelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct pvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhns  528
DSSP  lleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhlllll


DSSP  --------------------------------------
Query --------------------------------------  376
ident                                       
Sbjct lqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllleeelllllleeelleellllllllllllllllll


No 28: Query=2qpxA Sbjct=1j6pA Z-score=13.7

back to top
DSSP  ---------------------------------------lllllhhhhhHLLEEEEEEL-
Query ---------------------------------------gxddlsefvdQVPLLDHHCH-   20
ident                                                     |   | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHa   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELh


DSSP  LLLLlllllhhhHHHHhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllllllllhh
Query FLIDgkvpnrddRLAQvsTEADkdypladtknrlayhgflalakefaldannplaaxndp   80
ident                                                             
Sbjct PXTL-----lrgVAED-lSFEE-------------------wlfskvlpiedrltekxay   95
DSSP  HHHH-----hllLLLL-lLHHH-------------------hhhllhhhhhllllhhhhh


DSSP  hhhhHHHHHHHHLLEEEEEEELLllllllllLHHHHHHHHLLLEEEEEEHHH--hHHHHh
Query gyatYNHRIFGHFHFKELLIDTGfvpddpilDLDQTAELVGIPVKAIYRLET--hAEDFx  138
ident                                         |        |          
Sbjct ygtiLAQXEXARHGIAGFVDXYF-----heeWIAKAVRDFGXRALLTRGLVDsngDDGG-  149
DSSP  hhhhHHHHHHHLLLEEEEEEEEL-----lhhHHHHHHHHHLLEEEEEEEELLlllLLLL-


DSSP  lllllhhhhhhhhHHHHHLLLLLL-------LLLEEELHHHHlllllllllhhhhhhhhh
Query lehdnfaawwqafSNDVKQAKAHG-------FVGFXSIAAYRvglhlepvnvieaaagfd  191
ident                                ||||     |                   
Sbjct ------------rLEENLKLYNEWngfegriFVGFGPHSPYL------------------  179
DSSP  ------------hHHHHHHHHHHHllhhhleEEEEEELLLLL------------------


DSSP  hhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllLLHHHllhhHHHHHHH
Query twkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadTDXYLgnplLXRDYLK  251
ident                    |  |         |   |                   | | 
Sbjct --------------cSEEYLKRVFDTAKSLNAPVTIHLYET---SKEEY----DLEDILN  218
DSSP  --------------lLHHHHHHHHHHHHHHLLLEEEEELLL---LLLLL----LLHHHHL


DSSP  HHHHhLLLEEEEELLLLhhhhHHHHHHlLLEEEELLlhHHHLH--hhhhhHHHHHLLLLL
Query AFTKkGLKVVLLHCYPYhreaGYLASVfPNLYFDISllDNLGP--sgasrVFNEAVELAP  309
ident    |   |    ||                                          |   
Sbjct IGLK-EVKTIAAHCVHLperyFGVLKD-IPFFVSHN--PASNLklgngiaPVQRXIEHGX  274
DSSP  LLLL-LLLEEEEELLLLlhhhHHHHLL-LLEEEEEL--HHHHHhllllllLHHHHHHLLL


DSSP  hhHEELLLLLLLlhHHHHhHHHHHHHHHHHHH-HLLLlllhhhHHHHHHHHHLHHHHHHL
Query ytRILFASDASTypEXYGlAARQFKQALVAHF-NQLPfvdlaqKKAWINAICWQTSAKLY  368
ident         |                 |                             |   
Sbjct --KVTLGTDGAAsnNSLN-LFFEXRLASLLQKaQNPR----nlDVNTCLKXVTYDGAQAX  327
DSSP  --EEEELLLLLLllLLLL-HHHHHHHHHHHHHlLLLL----llLHHHHHHHHLHHHHHHH


DSSP  LLHhHHLL----------------------------------------------------
Query HQErELRV----------------------------------------------------  376
ident                                                             
Sbjct GFK-SGKIeegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgey  386
DSSP  LLL-LLLLllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellll


DSSP  ---------------------
Query ---------------------  376
ident                      
Sbjct ptidseevkrelariekelys  407
DSSP  llllhhhhhhhhhhhhhhhhl


No 29: Query=2qpxA Sbjct=2pajA Z-score=13.6

back to top
DSSP  -------------------------------------------------lllllhhhhhH
Query -------------------------------------------------gxddlsefvdQ   11
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLEEEEEELLLlllllllhhhHHHHHlllllllllhhhhlllhhhhhhhhhhhhhlllll
Query VPLLDHHCHFLidgkvpnrddRLAQVsteadkdypladtknrlayhgflalakefaldan   71
ident       | |                                                   
Sbjct PAWVNTHHHLF-------qslLKGEP--------------------------------fr   81
DSSP  ELEELLLLLHH-------hhhLLLLL--------------------------------lh


DSSP  lllllllhhhhhhhhhHHHHHLLEEEEEEELLL----lllllllLHHHHHHHHLLLEEEE
Query nplaaxndpgyatynhRIFGHFHFKELLIDTGF----vpddpilDLDQTAELVGIPVKAI  127
ident                                              |   ||  |      
Sbjct alfderrfrlaariglIELARSGCATVADHNYVyypgmpfdssaILFEEAEKLGLRFVLL  141
DSSP  hhllhhhhhhhhhhhhHHHHLLLEEEEEELLLLllllllllhhhHHHHHHHHLLLEEEEE


DSSP  EEHH-----------hhhHHHHlllllhhhhHHHHHHHHHLLLLLLL---------LLEE
Query YRLE-----------thaEDFXlehdnfaawWQAFSNDVKQAKAHGF---------VGFX  167
ident                                  |   |     |            |   
Sbjct RGGAtqtrqleadlptalRPET---------LDAYVADIERLAARYHdaspramrrVVMA  192
DSSP  ELLLlllllllllllhhhLLLL---------HHHHHHHHHHHHHHLLllllllleeEEEL


DSSP  E-LHHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEE
Query S-IAAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQ  226
ident      |                                          |           
Sbjct PtTVLYS--------------------------------iSPREMRETAAVARRLGLRMH  220
DSSP  LlLLLLL--------------------------------lLHHHHHHHHHHHHHLLLEEE


DSSP  EEELlllllllhhHLLHHHHHHHHhhhhhhllLEEEEELLLLhHHHHHHHHHLlLEEEEL
Query FHVGygdadtdxyLGNPLLXRDYLkaftkkglKVVLLHCYPYhREAGYLASVFpNLYFDI  286
ident  |                               |   |          |           
Sbjct SHLS--------gKSPVAFCGEHD----wlgsDVWYAHLVKVdADEIALLAQT-GTGVAH  267
DSSP  EELL--------lLLHHHHHHHLL----llllLEEEELLLLLlHHHHHHHHHH-LLEEEE


DSSP  LlhHHHLHhhhhhHHHHHLLLLLhhHEELLLLLLLlhHHHH--HHHHHHHHHHHHHHhll
Query SllDNLGPsgasrVFNEAVELAPytRILFASDASTypEXYG--LAARQFKQALVAHFnql  344
ident                 |              |     |             |  |     
Sbjct C--PQSNG---rlPVREMADAGV--PVSIGVDGAAsnEAADmiSEVHMTWLAQRARL---  317
DSSP  L--HHHHH---llLLLLHHHHLL--LEEELLLHHHhlLLLLhhHHHHHHHHHHHHLL---


DSSP  llllhhhHHHHHHHHHLHHHHHHLLLHHHHLL----------------------------
Query pfvdlaqKKAWINAICWQTSAKLYHQERELRV----------------------------  376
ident          |          |          |                            
Sbjct ------aSIAEVIHWGTAGGARVMGLDEVGKVavgyaadiavyrlddpryfglhdpaigp  371
DSSP  ------lLHHHHHHHHLHHHHHHHLLLLLLLLllllllleeeeelllhhhlllllhhhhh


DSSP  --------------------------------------------------
Query --------------------------------------------------  376
ident                                                   
Sbjct vasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  hhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 30: Query=2qpxA Sbjct=4dziC Z-score=13.6

back to top
DSSP  lllllhhhHHHLLEEEEEELLLLL------------------------------------
Query gxddlsefVDQVPLLDHHCHFLID------------------------------------   24
ident                |   |                                        
Sbjct --------ALNYRVIDVDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnh   52
DSSP  --------LLLLLEEEEEEELLLLlllllllllhhhlllleeeeelllleeeeelleell


DSSP  --lllllHHHHHhhHLLL------llllLLHHHHLllhhhhhhhhhhhhhlllllllLLL
Query --gkvpnRDDRLaqVSTE------adkdYPLADTKnrlayhgflalakefaldannpLAA   76
ident                                |                           |
Sbjct fipnptfDPIIV-pGCLDllfrgeipdgVDPASLM-------------------kveRLA   92
DSSP  lllllllLLEEL-lLLLHhhhhllllllLLHHHLL-------------------leeLHH


DSSP  L-lhhhhhHHHHHHHHHLLEEEEEEeLLLL----------------------lllllLLH
Query X-ndpgyaTYNHRIFGHFHFKELLIdTGFV----------------------pddpiLDL  113
ident                                                           | 
Sbjct DhpeyqnrDARIAVMDEQDIETAFM-LPTFgcgveealkhdieatmasvhafnlwldEDW  151
DSSP  HlhhhllhHHHHHHHHHHLEEEEEE-ELLHhhhhhhhllllhhhhhhhhhhhhhhhhHHL


DSSP  HhhhhhhlLLEEEEEEHHhhhhhhhlllllhhhHHHHHHHHHHLLLLLLLLLEEELhHHH
Query DqtaelvgIPVKAIYRLEthaedfxlehdnfaaWWQAFSNDVKQAKAHGFVGFXSIaAYR  173
ident             |                            |    | |           
Sbjct G--fdrpdHRIIAAPIVS-------------laDPTRAVEEVDFVLARGAKLVLVR-PAP  195
DSSP  L--lllllLLEEELLLLL-------------llLHHHHHHHHHHHHHLLLLLEELL-LLL


DSSP  LllllllllhhhHHHHhhhhhhhlllllllHHHH-HHHHHHHHHHHHHHLLLEEEEElll
Query VglhlepvnvieAAAGfdtwkhsgekrltsKPLI-DYXLYHVAPFIIAQDXPLQFHVgyg  232
ident |                                  |     |         |  ||    
Sbjct V----------pGLVK--------------PRSLgDRSHDPVWARLAEAGVPVGFHL---  228
DSSP  L----------lLLLL--------------LLLLlLHHHHHHHHHHHHHLLLEEEEL---


DSSP  llLLLH---------------------HHLL--HHHHH--HHHHHHhhHLLLEEEEELLl
Query daDTDX---------------------YLGN--PLLXR--DYLKAFtkKGLKVVLLHCYp  267
ident   |                                               || |      
Sbjct -sDSGYlhiaaawggakdpldqvllddRAIHdtMASMIvhGVFTRH--PKLKAVSIENG-  284
DSSP  -lLLLLhhhhhhllllllhhhhhhhllHHHHhhHHHHHhlLHHHHL--LLLLEEEELLL-


DSSP  lHHHH------------------hhhhHHLL--LEEEELLlhhhhlhhhHHHHHHHHLLL
Query yHREA------------------gylaSVFP--NLYFDISlldnlgpsgASRVFNEAVEL  307
ident                                  |                     |    
Sbjct -SYFVhrlikrlkkaantqpqyfpedpVEQLrnNVWIAPY---------YEDDLPELARV  334
DSSP  -LLHHhhhhhhhhhhhhhlhhhllllhHHHHhhHEEELLL---------LLLLHHHHHHH


DSSP  LLHHHEELLLLLLLlhhHHHHHHHhHHHHHHHHhhllllllhhhHHHHHHHHHLHHHHHH
Query APYTRILFASDASTypeXYGLAARqFKQALVAHfnqlpfvdlaqKKAWINAICWQTSAKL  367
ident      ||| ||              |   |                  |  |       |
Sbjct IGVDKILFGSDWPH-geGLASPVS-FTAELKGF-----------SESDIRKIMRDNALDL  381
DSSP  HLHHHLLLLLLLLL-llLLLLHHH-HHHHHLLL-----------LHHHHHHHHLHHHHHH


DSSP  LLlhhhhll
Query YHqerelrv  376
ident          
Sbjct LG--vqvgs  388
DSSP  HL--lllll


No 31: Query=2qpxA Sbjct=3griA Z-score=13.6

back to top
DSSP  ----------------------------------------lllllhhhhHHLLEEEEEEL
Query ----------------------------------------gxddlsefvDQVPLLDHHCH   20
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfVSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleEEELEEEEEEL


DSSP  LL---LLLLlllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhlllllllllll
Query FL---IDGKvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaax   77
ident         |                                                   
Sbjct LRepgGEYK---------------------------------------------------   69
DSSP  LLlllLLLL---------------------------------------------------


DSSP  lhhhhhhhhhHHHHHLLEEEEEEELLLL--------llllllLHHHHHhhhLLLEEEEEE
Query ndpgyatynhRIFGHFHFKELLIDTGFV--------pddpilDLDQTAelvGIPVKAIYR  129
ident                  |                          |  |      |     
Sbjct ---etietgtKAAARGGFTTVCPXPNTRpvpdsvehfealqkLIDDNA---QVRVLPYAS  123
DSSP  ---llhhhhhHHHHHLLEEEEEELLLLLlllllhhhhhhhhhHHHHHL---LLEELLLEE


DSSP  HHHHHHhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELHhhhlllllllllhhhhhhh
Query LETHAEdfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIAayrvglhlepvnvieaaag  189
ident   |                     |       |   |                       
Sbjct ITTRQL-------------gkELVDFPALVKEGAFAFTDDG-------------------  151
DSSP  LLHHHL-------------llLLLLHHHHHLLLLLLEEELL-------------------


DSSP  hhhhhhhlllllllhhHHHHHHHHHHHHHHHHLLLEEEEEllllllLLHH----------
Query fdtwkhsgekrltskpLIDYXLYHVAPFIIAQDXPLQFHVgygdadTDXY----------  239
ident                     | |               |                     
Sbjct -------------vgvQTASXXYEGXIEAAKVNKAIVAHC----edNSLIyggaxhegkr  194
DSSP  -------------lllLLHHHHHHHHHHHHHHLLLEEELL----llHHHLlllleellhh


DSSP  ----------hLLHHHH-HHHHHHHHHHLLLEEEEELLllHHHHHHHHHHL----LLEEE
Query ----------lGNPLLX-RDYLKAFTKKGLKVVLLHCYpyHREAGYLASVF----PNLYF  284
ident                             |      |      |                 
Sbjct skelgipgipnICESVQiARDVLLAEAAGCHYHVCHVS--TKESVRVIRDAkragIHVTA  252
DSSP  hhhhllleellHHHHHHhHHHHHHHHHHLLLEEELLLL--LHHHHHHHHHHhhllLLEEE


DSSP  ELLLHHhhlhhhHHHH----------------------HHHHLLLLLHH-HEELLLLLLL
Query DISLLDnlgpsgASRV----------------------FNEAVELAPYT-RILFASDAST  321
ident                                            |          | |   
Sbjct EVTPHH------LLLTeddipgnnaiykxnpplrstedREALLEGLLDGtIDCIATDHAP  306
DSSP  EELHHH------HHLLhhhlllllhhhllllllllhhhHHHHHHHHHLLlLLEELLLLLL


DSSP  L---------------hHHHHHHhhhHHHHHHHHHHLLLlllhhhHHHHHHHHHLHHHHH
Query Y---------------pEXYGLAarqFKQALVAHFNQLPfvdlaqKKAWINAICWQTSAK  366
ident                       |   |                                 
Sbjct HardekaqpxekapfgiVGSETA---FPLLYTHFVKNGD-----wTLQQLVDYLTIKPCE  358
DSSP  LlhhhhlllllllllllLLLLLH---HHHHHHHHLLLLL-----lLHHHHHHHHLHHHHH


DSSP  HLLLHhHHLL--------------------------------------------------
Query LYHQErELRV--------------------------------------------------  376
ident     |                                                       
Sbjct TFNLE-YGTLkengyadltiidldseqeikgedflskadntpfigykvygnpiltxvege  417
DSSP  HLLLL-LLLLllllllleeeeelllleellhhhllllllllllllleelleeeeeeelle


DSSP  -----
Query -----  376
ident      
Sbjct vkfeg  422
DSSP  eeeel


No 32: Query=2qpxA Sbjct=3nqbA Z-score=13.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------lllllhhhhhHLLEEEEEEL--LLLLlllllhhhhhhhhlllllllllhhhhll
Query ------gxddlsefvdQVPLLDHHCH--FLIDgkvpnrddrlaqvsteadkdypladtkn   52
ident                    | | | |                                  
Sbjct srrdaaqvidaggayvSPGLIDTHXHieSSXI----------------------------   92
DSSP  lllleeeeeelllleeEELEEEEEELhhHHLL----------------------------


DSSP  lhhhhhhhhhhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLL-----ll
Query rlayhgflalakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFV-----pd  107
ident                                                 |           
Sbjct -----------------------------tpAAYAAAVVARGVTTIVWDPHEFgnvhgvd  123
DSSP  -----------------------------lhHHHHHHHHLLLEEEEEELLHHHhhhhlhh


DSSP  lllLLHHHHHHHhLLLEEEEEEHHHhHHHHHLLLllhhhhhhhHHHHHHLLLLLL-LLLE
Query dpiLDLDQTAELvGIPVKAIYRLEThAEDFXLEHdnfaawwqaFSNDVKQAKAHG-FVGF  166
ident            |                   ||                         | 
Sbjct gvrWAAKAIENL-PLRAILLAPSCV-PSAPGLER----ggadfDAAILADLLSWPeIGGI  177
DSSP  hhhHHHHHHLLL-LLEEEEEELLLL-LLLLLLLL----lllllLHHHHHHHHLLLlEEEE


DSSP  E-ELHHhhlllllllllhhhhhhhhhhhhhhlllllllhhHHHHHHHHHHHHHHHHLLLE
Query X-SIAAyrvglhlepvnvieaaagfdtwkhsgekrltskpLIDYXLYHVAPFIIAQDXPL  225
ident                                           |           |     
Sbjct AeIXNX------------------------------rgviERDPRXSGIVQAGLAAEKLV  207
DSSP  EeELLH------------------------------hhhhLLLHHHHHHHHHHHHHLLEE


DSSP  EEEELlllllllhhhlLHHH--HHHHHHHhhhhlLLEEEEELLL--LHHHHHHHHhhlll
Query QFHVGygdadtdxylgNPLL--XRDYLKAftkkgLKVVLLHCYP--YHREAGYLAsvfpn  281
ident   |                         |                               
Sbjct CGHAR-----------GLKNadLNAFXAA-----GVSSDHELVSgeDLXAKLRAG-----  246
DSSP  EELLL-----------LLLHhhHHHHHHL-----LLLEELLLLLhhHHHHHHHLL-----


DSSP  EEEELLlhHHHLhhHHHHHHHHHLL--llLHHHEELLLLLLLLHHH--hHHHHHHHHHHH
Query LYFDISllDNLGpsGASRVFNEAVE--laPYTRILFASDASTYPEX--yGLAARQFKQAL  337
ident |                  |  |               |          |          
Sbjct LTIELR--GSHD--HLLPEFVAALNtlghLPQTVTLCTDDVFPDDLlqgGGLDDVVRRLV  302
DSSP  LEEEEE--LLLH--HHHHHHHHHHHhhllLLLLEEEELLLLLHHHHhhlLLHHHHHHHHH


DSSP  HHHHhllllllhhhhHHHHHHHHLHHHHHHLLLHHHHLL---------------------
Query VAHFnqlpfvdlaqkKAWINAICWQTSAKLYHQERELRV---------------------  376
ident                  |         |                                
Sbjct RYGL----------kPEWALRAATLNAAQRLGRSDLGLIaagrradivvfedlngfsarh  352
DSSP  HLLL----------lHHHHHHHHLHHHHHHHLLLLLLLLllllllleeeellllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct vlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprft  412
DSSP  eeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct qwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdsh  472
DSSP  eeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct nltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafed  532
DSSP  leeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhh


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  376
ident                                                        
Sbjct lreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 33: Query=2qpxA Sbjct=3mkvA Z-score=13.4

back to top
DSSP  ---------------------------------------------lllllhhhhhHLLEE
Query ---------------------------------------------gxddlsefvdQVPLL   15
ident                                                           | 
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEELLL-----------lLLLLllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhh
Query DHHCHFL-----------iDGKVpnrddrlaqvsteadkdypladtknrlayhgflalak   64
ident | | |                                                       
Sbjct DLHVHVVaiefnlprvatlPNVL-------------------------------------   83
DSSP  EEEELLLlllllhhhhlllLHHH-------------------------------------


DSSP  hhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLllllllllLHHHHH--hHHLL
Query efaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGfvpddpilDLDQTA--eLVGI  122
ident                        |      |       |                   | 
Sbjct --------------vtlraVPIMRAMLRRGFTTVRDAGG----agypFKQAVEsglVEGP  125
DSSP  --------------hhhhhHHHHHHHHHLLEEEEEELLL----llhhHHHHHHlllLLLL


DSSP  LEEEEE-EHHH-----------------------------hHHHHhlllllhhhHHHHHH
Query PVKAIY-RLET-----------------------------hAEDFxlehdnfaaWWQAFS  152
ident         |                                                   
Sbjct RLFVSGrALSQtgghadprarsdymppdspcgccvrvgalgRVAD---------GVDEVR  176
DSSP  EEEELLlEEELllllllllllllllllllllllllllllleEELL---------LHHHHH


DSSP  HHHHLLLLLLLLLEEELHHH---------HLLLllllllhhhhhhhhhhhhhhlllllll
Query NDVKQAKAHGFVGFXSIAAY---------RVGLhlepvnvieaaagfdtwkhsgekrlts  203
ident   |      |    |  |            |                             
Sbjct RAVREELQMGADQIXIMASGgvasptdpvGVFG---------------------------  209
DSSP  HHHHHHHHHLLLLEEEELLLlllllllllLLLL---------------------------


DSSP  hhhHHHHHHHHHHHHHHHLLLEEEEELlllllllhhhLLHHHHhhhHHHHhhhlllEEEE
Query kplIDYXLYHVAPFIIAQDXPLQFHVGygdadtdxylGNPLLXrdyLKAFtkkglkVVLL  263
ident                         |                                   
Sbjct --ySEDEIRAIVAEAQGRGTYVLAHAY--------tpAAIARA---VRCG-----vRTIE  251
DSSP  --lLHHHHHHHHHHHHLLLLLEEEEEL--------lhHHHHHH---HHLL-----lLEEE


DSSP  ELLLLHHHHHHHHHHLlLEEEELLlHHHHL----------------------HHHHHHHH
Query HCYPYHREAGYLASVFpNLYFDISlLDNLG----------------------PSGASRVF  301
ident |      |   |       |     |                                  
Sbjct HGNLIDDETARLVAEH-GAYVVPT-LVTYDalasegekyglppesiakiadvHGAGLHSI  309
DSSP  ELLLLLHHHHHHHHHH-LLEEELL-HHHHHhhhhhlllllllhhhhllhhhhHLLHHHHH


DSSP  HHHLLLLLhhHEELLLLLLlLHHHhHHHHHhHHHHHHHHHhllllllhhhHHHHHHHHHL
Query NEAVELAPytRILFASDAStYPEXyGLAARqFKQALVAHFnqlpfvdlaqKKAWINAICW  361
ident              |  |         |        |                |   |   
Sbjct EIMKRAGV--KMGFGTDLL-GEAQ-RLQSD-EFRILAEVL----------SPAEVIASAT  354
DSSP  HHHHHHLL--LLLLLLLLL-HHHH-HHLLH-HHHHHHLLL----------LHHHHHHHLL


DSSP  HHHHHHLLLH-HHHLL--------------------------------------------
Query QTSAKLYHQE-RELRV--------------------------------------------  376
ident   ||          |                                             
Sbjct IVSAEVLGMQdKLGRIvpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  HHHHHHLLLLlLLLLLllllllleeeellllllllllllllllllleeeelleeeeelll


No 34: Query=2qpxA Sbjct=3ls9A Z-score=13.3

back to top
DSSP  ---------------------------------------------lllllhhhhhHLLEE
Query ---------------------------------------------gxddlsefvdQVPLL   15
ident                                                           | 
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  EEEEL-LLLLlllllHHHHHHHhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllll
Query DHHCH-FLIDgkvpnRDDRLAQvsTEADkdypladtknrlayhgflalakefaldannpl   74
ident   | |                   | |                                 
Sbjct NSHQHlYEGA--mraIPQLERV--TMAS--------------wlegvltrsagwwrdgkf  102
DSSP  EEEELhHHHH--hllLHHHLLL--LHHH--------------hhhhhhhhhhhhhhllll


DSSP  llllhhhhhhhHHHHHHHLLEEEEEEELLL----lllllllLHHHHHHHHLLLEEEEEEH
Query aaxndpgyatyNHRIFGHFHFKELLIDTGF----vpddpilDLDQTAELVGIPVKAIYRL  130
ident                              |                |   ||   |    
Sbjct gpdvirevaraVLLESLLGGITTVADQHLFfpgatadsyidATIEAATDLGIRFHAARSS  162
DSSP  lhhhhhhhhhhHHHHHHHLLEEEEEEEELLllllllllhhhHHHHHHHHHLLEEEEEELL


DSSP  HH------------hHHHHhlllllhhhhhHHHHHHHHLLLLLL---------LLLEEEL
Query ET------------hAEDFxlehdnfaawwQAFSNDVKQAKAHG---------FVGFXSI  169
ident  |              |                                           
Sbjct MTlgkseggfcddlfVEPV-----------DRVVQHCLGLIDQYhepepfgmvRIALGPC  211
DSSP  LLllhhhlllllhhhLLLH-----------HHHHHHHHHHHHHHlllllllleEEEELLL


DSSP  HHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEE
Query AAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHV  229
ident                                              |      |  |  | 
Sbjct GVPY--------------------------------dKPELFEAFAQMAADYDVRLHTHF  239
DSSP  LLLL--------------------------------lLHHHHHHHHHHHHHHLLEEEEEE


DSSP  LLLlllLLHHH----llhHHHHHHHHHHHhhllLEEEEELLLLhhhhHHHHHHLlLEEEE
Query GYGdadTDXYL----gnpLLXRDYLKAFTkkglKVVLLHCYPYhreaGYLASVFpNLYFD  285
ident        |             |   |        | | |                     
Sbjct YEP---LDAGMsdhlygmTPWRFLEKHGW-asdRVWLAHAVVPpreeIPEFADA-GVAIA  294
DSSP  LLL---LHHHHhhhhhllLHHHHHHHLLL-lllLEEEEELLLLlhhhHHHHHHH-LLEEE


DSSP  LLlHHHHLH-hhhhhHHHHHLLLLLhhHEELLLLLLLlhHHHHhHHHHHHHHHHHHH---
Query ISlLDNLGP-sgasrVFNEAVELAPytRILFASDASTypEXYGlAARQFKQALVAHF---  341
ident                   |           |    |               |  ||    
Sbjct HL-IAPDLRmgwglaPIREYLDAGI--TVGFGTTGSAsnDGGN-LLGDLRLAALAHRpad  350
DSSP  EL-HHHHHHllllllLHHHHHHLLL--EEEELLLLLLllLLLL-HHHHHHHHHHHLHhhl


DSSP  --HLLLlllhhhHHHHHHHHHLHHHHHHLLLHHHHLL-----------------------
Query --NQLPfvdlaqKKAWINAICWQTSAKLYHQERELRV-----------------------  376
ident                         ||                                  
Sbjct pnEPEK----wlSARELLRMATRGSAECLGRPDLGVLeegraadiacwrldgvdrvgvhd  406
DSSP  llLHHH----llLHHHHHHHLLHHHHHHLLLLLLLLLllllllleeeeelllhhhlllll


DSSP  -----------------------------------------------
Query -----------------------------------------------  376
ident                                                
Sbjct paiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  hhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 35: Query=2qpxA Sbjct=3gg7A Z-score=13.2

back to top
DSSP  lllllhhhhhhlLEEEEEEL--LLLLlllllhhhhhhhhlllllllllhhhhlllhhhhh
Query gxddlsefvdqvPLLDHHCH--FLIDgkvpnrddrlaqvsteadkdypladtknrlayhg   58
ident              | | | |     |                                  
Sbjct ------------SLIDFHVHldLYPD----------------------------------   14
DSSP  ------------LLEEEEELhhHLLL----------------------------------


DSSP  hhhhhhhhllllllllllllhhhhhhhhhHHHHHLLEeEEEEELLlllllllLLHHhHHH
Query flalakefaldannplaaxndpgyatynhRIFGHFHFkELLIDTGfvpddpiLDLDqTAE  118
ident                              |          |  |          |   | 
Sbjct ------------------------pvavaRACEERQL-TVLSVTT-tpaawrGTLA-LAA   47
DSSP  ------------------------hhhhhHHHHHLLL-EEEELLL-lhhhhhHHHH-HHL


DSSP  HhLLLEEEEEEH-HHHH-HHHHlllllhhhhhhhHHHHHHLLLLlLLLLEE-ELHHHHll
Query LvGIPVKAIYRL-ETHA-EDFXlehdnfaawwqaFSNDVKQAKAhGFVGFX-SIAAYRvg  175
ident      |            |                                         
Sbjct G-RPHVWTALGFhPEVVsERAA------------DLPWFDRYLP-ETRFVGeVGLDGS--   91
DSSP  L-LLLEEELLLLlHHHLlLLHH------------HLHHHHHHHH-HLLEEEeEELLLL--


DSSP  lllllllhhhhhhhhhhhhhhlllllLLHHHHHHHHHHHHHHHHHH-LLLEEEEELllll
Query lhlepvnvieaaagfdtwkhsgekrlTSKPLIDYXLYHVAPFIIAQ-DXPLQFHVGygda  234
ident                                      |            |  |      
Sbjct ----------------------pslrGTWTQQFAVFQHILRRCEDHgGRILSIHSR----  125
DSSP  ----------------------hhhhHHHHHHHHHHHHHHHHHHHLlLEEEEEELL----


DSSP  lllhhhLLHHHHHHHHHHHHhHLLLEEEEELLLLhHHHHHHHHHLLlEEEELLLHHhhlh
Query dtdxylGNPLLXRDYLKAFTkKGLKVVLLHCYPYhREAGYLASVFPnLYFDISLLDnlgp  294
ident                | |         |             |       |          
Sbjct ------RAESEVLNCLEANP-RSGTPILHWYSGS-VTELRRAISLG-CWFSVGPTM----  172
DSSP  ------LLHHHHHHHHHHLH-HHEEEEEELLLLL-HHHHHHHHHLL-LEEEELHHH----


DSSP  hhHHHHHHHHLLLLLHHHEELLLLLL-----llhHHHHHhHHHHHHHHHHHHHllllllh
Query sgASRVFNEAVELAPYTRILFASDAS-----typEXYGLaARQFKQALVAHFNqlpfvdl  349
ident               |  | |   |                       |            
Sbjct -vRTQKGAALIRSMPRDRVLTETDGPfleldgqaALPWD-VKSVVEGLSKIWQ-------  223
DSSP  -hLLHHHHHHHHHLLHHHEEELLLLLlleelleeLLHHH-HHHHHHHHHHHHL-------


DSSP  hHHHHHHHHHhLHHHHHHLLlhhhhll
Query aQKKAWINAIcWQTSAKLYHqerelrv  376
ident                  |         
Sbjct iPASEVERIV-KENVSRLLG------t  243
DSSP  lLHHHHHHHH-HHHHHHHHH------l


No 36: Query=2qpxA Sbjct=1k6wA Z-score=13.1

back to top
DSSP  ----------------------------------------lllllhhhhhHLLEEEEEEL
Query ----------------------------------------gxddlsefvdQVPLLDHHCH   20
ident                                                     |    | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  L--LLLLLLLLHHHhhhhhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllllllll
Query F--LIDGKVPNRDDrlaqvsTEADkdypladtknrlayhgflalakefaldannplaaxn   78
ident          ||         |                                       
Sbjct LdtTQTAGQPNWNQ----sgTLFE--------------------gierwaerkallthdd   96
DSSP  LllLLLLLLLLLLL----llLHHH--------------------hhhhhhllhhhllhhh


DSSP  hhhhhhHHHHHHHHLLEEEEEEELL------lllllllLLHHHHHHhhLLLEEEEEEHHH
Query dpgyatYNHRIFGHFHFKELLIDTG------fvpddpiLDLDQTAElvGIPVKAIYRLET  132
ident                                             |    |          
Sbjct vkqrawQTLKWQIANGIQHVRTHVDvsdatltalkamlEVKQEVAP--WIDLQIVAFPQE  154
DSSP  hhhhhhHHHHHHHHLLEEEEEEEEEllllllhhhhhhhHHHHHHLL--LLEEEEEEELLL


DSSP  -hHHHHhlllllhhhhhhHHHHHHHLLLLLLLLLEEELHHHHlllllllllhhhhhhhhh
Query -hAEDFxlehdnfaawwqAFSNDVKQAKAHGFVGFXSIAAYRvglhlepvnvieaaagfd  191
ident                           |   |      |                      
Sbjct giLSYP------------NGEALLEEALRLGADVVGAIPHFE------------------  184
DSSP  llLLLL------------LHHHHHHHHHHLLLLEEEELHHHL------------------


DSSP  hhhhhlllllLLHHHHHHHHHHHHHHHHHHLLLEEEEELLLllllLHHHLLHhhHHHHHH
Query twkhsgekrlTSKPLIDYXLYHVAPFIIAQDXPLQFHVGYGdadtDXYLGNPllXRDYLK  251
ident                    |          |     |        |              
Sbjct ----------FTREYGVESLHKTFALAQKYDRLIDVHCDEI----DDEQSRF--VETVAA  228
DSSP  ----------LLHHHHHHHHHHHHHHHHHHLLEEEEEELLL----LLLLLLH--HHHHHH


DSSP  HHHHHLL--LEEEEELLLL-------hhhhhHHHHHLLlEEEELLlHHHHLH--------
Query AFTKKGL--KVVLLHCYPY-------hreagYLASVFPnLYFDISlLDNLGP--------  294
ident      |    |   |                 |        |                  
Sbjct LAHHEGMgaRVTASHTTAMhsyngaytsrlfRLLKMSG-INFVAN-PLVNIHlqgrfdty  286
DSSP  HHHHHLLhhHEEEEELHHHhhllhhhhhhhhHHHHHHL-LEEEEL-HHHHHHhlllllll


DSSP  --hhhhhHHHHHLLLLLhhHEELLLLLLLL----hHHHHhhHHHH-HHHHH--HHHHlll
Query --sgasrVFNEAVELAPytRILFASDASTY----pEXYGlaARQF-KQALV--AHFNqlp  345
ident           |  |        |  |                 |     |          
Sbjct pkrrgitRVKEMLESGI--NVCFGHDDVFDpwyplGTAN--MLQVlHMGLHvcQLMG---  339
DSSP  lllllllLHHHHHHLLL--LEEELLLLLLLlllllLLLL--HHHHhHHHHHhlLLLL---


DSSP  lllHHHHHHhHHHHHLHHHHHHLLLhHHHLL-----------------------------
Query fvdLAQKKAwINAICWQTSAKLYHQeRELRV-----------------------------  376
ident      |            ||                                        
Sbjct ---YGQIND-GLNLITHHSARTLNL-QDYGIaagnsanliilpaengfdalrrqvpvrys  394
DSSP  ---HHHHHH-HHHHHLHHHHHHLLL-LLLLLllllllleeeellllhhhhhhhlllllee


DSSP  -----------------------------
Query -----------------------------  376
ident                              
Sbjct vrggkviastqpaqttvyleqpeaidykr  423
DSSP  eelleeeeellllleeeellleeeellll


No 37: Query=2qpxA Sbjct=3mtwA Z-score=12.8

back to top
DSSP  ----------------------------------------------lllllhhhhhHLLE
Query ----------------------------------------------gxddlsefvdQVPL   14
ident                                                            |
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEELLLlllllllhhhHHHHhllllLLLLlhhhhlllhhhhhhhhhhhhhllllllll
Query LDHHCHFLidgkvpnrddRLAQvsteaDKDYpladtknrlayhgflalakefaldannpl   74
ident  | | |                        |                             
Sbjct IDMHVHLD-------slaEVGG---ynSLEY-----------------------------   81
DSSP  EEEEELLL-------lllLLLH---hhHHHL-----------------------------


DSSP  llllhhhhhhhhhHHHHHLLEEEEEEELLLLlllllLLHHHHHH--HHLLLEEEE-EEHH
Query aaxndpgyatynhRIFGHFHFKELLIDTGFVpddpiLDLDQTAE--LVGIPVKAI-YRLE  131
ident                     |                           |           
Sbjct sdrfwsvvqtanaKKTLEAGFTTVRNVGAAD-yddvGLREAIDAgyVPGPRIVTAaISFG  140
DSSP  lhhhhhhhhhhhhHHHHHLLEEEEEELLLLL-lhhhHHHHHHHLllLLLLEEEELlLLEE


DSSP  -------------------HHHHhhhlllllhhhhhHHHHHHHHLLLLLLLLLEEELHHH
Query -------------------THAEdfxlehdnfaawwQAFSNDVKQAKAHGFVGFXSIAAY  172
ident                                           |   |  |    |  |  
Sbjct atgghcdstffppsmdqknPFNS----------dspDEARKAVRTLKKYGAQVIXICATG  190
DSSP  llllllllllllhhhllllLLLL----------llhHHHHHHHHHHHHLLLLEEEEELLL


DSSP  --------hlLLLLllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLL
Query --------rvGLHLepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXP  224
ident              |                                   |          
Sbjct gvfsrgnepgQQQL----------------------------TYEEMKAVVDEAHMAGIK  222
DSSP  llllllllllLLLL----------------------------LHHHHHHHHHHHHHLLLE


DSSP  EEEEELlllllllhhhLLHHhhhhhhhhhhhhlLLEEEEELLlLHHH-HHHHHHHLlLEE
Query LQFHVGygdadtdxylGNPLlxrdylkaftkkgLKVVLLHCYpYHRE-AGYLASVFpNLY  283
ident    |            |                      |           ||      |
Sbjct VAAHAH----------GASG------ireavraGVDTIEHAS-LVDDeGIKLAVQK-GAY  264
DSSP  EEEEEL----------LHHH------hhhhhhlLLLEEEELL-LLLHhHHHHHHHH-LLE


DSSP  EELLlHHHHLH----------------------hhhHHHHHHHLLLLLhhHEELLLLLLl
Query FDISlLDNLGP----------------------sgaSRVFNEAVELAPytRILFASDASt  321
ident |      |                               |  |             ||  
Sbjct FSMD-IYNTDYtqaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAG-  320
DSSP  EELL-LLLHHHhhhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLL-


DSSP  lhhHHHHHHHhHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLLH-HHHLL----
Query ypeXYGLAARqFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHQE-RELRV----  376
ident      |  |       |                        | |           |    
Sbjct -iyPHGDNAK-QFAVMVRYG---------aTPLQAIQSATLTAAEALGRSkDVGQVavgr  369
DSSP  -llLLLLHHH-HHHHHHHLL---------lLHHHHHHHLLHHHHHHHLLLlLLLLLllll


DSSP  -----------------------------------
Query -----------------------------------  376
ident                                    
Sbjct ygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  llleeeelllllllhhhhhllleeeelleeeelll


No 38: Query=2qpxA Sbjct=1a4mA Z-score=12.6

back to top
DSSP  lllllhHHHHHLLEEEEEEL--LLLL--LLLL-------------LHHHHHHHHL-----
Query gxddlsEFVDQVPLLDHHCH--FLID--GKVP-------------NRDDRLAQVS-----   38
ident             |    | |    |                        |          
Sbjct ------TPAFNKPKVELHVHldGAIKpeTILYfgkkrgialpadtVEELRNIIGMdkpls   54
DSSP  ------LLLLLLLEEEEEEEhhHLLLhhHHHHhhhhhllllllllHHHHHHHHLLlllll


DSSP  ---LLLLllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLLE
Query ---TEADkdypladtknrlayhgflalakefaldannplaaxndpgyatYNHRIFGHFHF   95
ident      |                                                      
Sbjct lpgFLAK----------------------fdyympviagcreaikriayEFVEMKAKEGV   92
DSSP  hhhHHLL----------------------hhhhhhhhlllhhhhhhhhhHHHHHHHHLLE


DSSP  EEEEEELL------------------------llllllllLHHHHHHHHLLLEEEEEEHH
Query KELLIDTG------------------------fvpddpilDLDQTAELVGIPVKAIYRLE  131
ident                                          |       || |  |    
Sbjct VYVEVRYSphllanskvdpmpwnqtegdvtpddvvdlvnqGLQEGEQAFGIKVRSILCCM  152
DSSP  EEEEEEELlhhhllllllllhhhlllllllhhhhhhhhhhHHHHHHHHHLLEEEEEEEEE


DSSP  hhhhhhhlllllhhhhhhhhhhHHHLLLLLL---LLLEEEL-HHHHLLlllllllhhhhh
Query thaedfxlehdnfaawwqafsnDVKQAKAHG---FVGFXSI-AAYRVGlhlepvnvieaa  187
ident                            |       |           |            
Sbjct -------------rhqpswsleVLELCKKYNqktVVAMDLAgDETIEG------------  187
DSSP  -------------lllhhhhhhHHHHHHHLLlllEEEEEEElLLLLLL------------


DSSP  hhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllllhhhLLHHHHH
Query agfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadtdxylGNPLLXR  247
ident                                         | |          | |   |
Sbjct -----------------ssLFPGHVEAYEGAVKNGIHRTVHAGEV--------GSPEVVR  222
DSSP  -----------------hhHLHHHHHHHHHHHHHLLEEEEEELLL--------LLHHHHH


DSSP  HHHHHHhhhlLLEEEEELLlLHHH---hHHHHHHLlLEEEELLlHHHHLH-----hhhhH
Query DYLKAFtkkgLKVVLLHCYpYHRE---aGYLASVFpNLYFDISlLDNLGP-----sgasR  299
ident                 | |    |            |  |                    
Sbjct EAVDIL----KTERVGHGY-HTIEdealYNRLLKE-NMHFEVC-PWSSYLtgawdpkttH  275
DSSP  HHHHLL----LLLEEEELH-HHHHlhhhHHHHHHL-LLEEEEL-HHHHHHlllllllllL


DSSP  HHHHHLLLLLhhHEELLLLLLLlhhhhhHHHHHHHHHH-HHHHhllllllhhhHHHHHHH
Query VFNEAVELAPytRILFASDASTypexygLAARQFKQAL-VAHFnqlpfvdlaqKKAWINA  358
ident                   |                |                        
Sbjct AVVRFKNDKA--NYSLNTDDPL---ifkSTLDTDYQMTkKDMG---------fTEEEFKR  321
DSSP  HHHHHHHLLL--LEEELLLLLL---lllLLHHHHHHHHhHLLL---------lLHHHHHH


DSSP  HhLHHHHHHLLL----HHHHLL-------
Query IcWQTSAKLYHQ----ERELRV-------  376
ident       ||          ||         
Sbjct L-NINAAKSSFLpeeeKKELLErlyreyq  349
DSSP  H-HHHHHHLLLLlhhhHHHHHHhhhhhll


No 39: Query=2qpxA Sbjct=4c5yA Z-score=12.5

back to top
DSSP  -------------------------------------------------lllllhhhhhH
Query -------------------------------------------------gxddlsefvdQ   11
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  LLEEEEEELLLLLLllllHHHHhhhhlllllllllhhhhlllhhhhhhhhhhhhhlllll
Query VPLLDHHCHFLIDGkvpnRDDRlaqvsteadkdypladtknrlayhgflalakefaldan   71
ident   | | | ||  |                                               
Sbjct PGLWDCHMHFGGDD----DYYN---------------------------------dytsg   83
DSSP  ELEEEEEELLLLLL----LLLL---------------------------------llhhh


DSSP  lllllllhhhhhHHHHHHHHHLLEEEEEEELLlllllllLLHHHH--hhHHLLLEEEE-E
Query nplaaxndpgyaTYNHRIFGHFHFKELLIDTGfvpddpiLDLDQT--aeLVGIPVKAI-Y  128
ident                                |                  ||  |     
Sbjct lathpassgarlARGCWEALQNGYTSYRDLAG----ygcEVAKAIndgtIVGPNVYSSgA  139
DSSP  hhllhhhhhhhhHHHHHHHHHLLEEEEEELLL----lhhHHHHHHhlllLLLLEEEELlL


DSSP  EHH----------------hhhHHHHLL--------lllhhhhHHHHHHHHHLLLLLLLL
Query RLE----------------thaEDFXLE--------hdnfaawWQAFSNDVKQAKAHGFV  164
ident  |                                                |      |  
Sbjct ALSqtaghgdifalpagevlgsYGVMNPrpgywgagplciadgVEEVRRAVRLQIRRGAK  199
DSSP  EEEllllllllllllhhhhhhhHLLLLLllllllllleeelllHHHHHHHHHHHHHHLLL


DSSP  LEEELHHH---------hLLLLlllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHH
Query GFXSIAAY---------rVGLHlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVA  215
ident   |  |                                                 |    
Sbjct VIXVMASGgvmsrddnpnFAQF-----------------------------SPEELKVIV  230
DSSP  LEEEELLLllllllllllLLLL-----------------------------LHHHHHHHH


DSSP  HHHHHHLLLEEEEELlllllllHHHLlHHHHHHHHhhhhhhlllEEEEELLLLHHHHHHH
Query PFIIAQDXPLQFHVGygdadtdXYLGnPLLXRDYLkaftkkglkVVLLHCYPYHREAGYL  275
ident      |      ||           |                    | |      |   |
Sbjct EEAARQNRIVSAHVH-------GKAG-IMAAIKAG--------cKSLEHVSYADEEVWEL  274
DSSP  HHHHHLLLLEEEEEL-------LHHH-HHHHHHHL--------lLEEEELLLLLHHHHHH


DSSP  HHHLlLEEEELLlHHHHLHH---------------------hhHHHHHHHLLLLLhhHEE
Query ASVFpNLYFDISlLDNLGPS---------------------gaSRVFNEAVELAPytRIL  314
ident                                                  |        | 
Sbjct MKEK-GILYVAT-RSVIEIFlasngeglvkeswaklqaladshLKAYQGAIKAGV--TIA  330
DSSP  HHHH-LLEEELL-HHHHHHHhhhllllllllhhhlllhhhhhhHHHHHHHHHLLL--LEE


DSSP  LLLLLLllHHHHhhhHHHHHHHHHHHHhllllllhhhhHHHHHHHHLHHHHHHL--LLHH
Query FASDAStyPEXYglaARQFKQALVAHFnqlpfvdlaqkKAWINAICWQTSAKLY--HQER  372
ident    |           |     |                                      
Sbjct LGTDTA-pGGPT---ALELQFAVERGG---------mtPLEAIKAATANAPLSVgpQAPL  377
DSSP  LLLLLL-lLLLL---HHHHHHHHHLLL---------llHHHHHHHHLLLHHHHHhhHLLL


DSSP  HHLL-------------------------------------------------------
Query ELRV-------------------------------------------------------  376
ident                                                            
Sbjct TGQLregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  LLLLllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 40: Query=2qpxA Sbjct=4rdvB Z-score=12.4

back to top
DSSP  -------------------------------------lllllhhhhhHLLEEEEEELLLl
Query -------------------------------------gxddlsefvdQVPLLDHHCHFLi   23
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-


DSSP  llllllhhhHHHH-----hllLLLLlllhhhhlllhhhhhhhhhhhhhllllllllllll
Query dgkvpnrddRLAQ-----vstEADKdypladtknrlayhgflalakefaldannplaaxn   78
ident           ||                                                
Sbjct ----qramaGLAEvagnpndsFWTW--------------------relmyrmvarlspeq   95
DSSP  ----hhhhlLLLLllllllllHHHH--------------------hhhhhhhhllllhhh


DSSP  hhhhhhHHHHHHHHLLEEEEEEELLL----------llllllLLHHHHHHHHLLLEEEEE
Query dpgyatYNHRIFGHFHFKELLIDTGF----------vpddpiLDLDQTAELVGIPVKAIY  128
ident                                           |     |   ||      
Sbjct ieviacQLYIEMLKAGYTAVAEFHYVhhdldgrsyadpaelsLRISRAASAAGIGLTLLP  155
DSSP  hhhhhhHHHHHHHHHLEEEEEEEELLlllllllllllllhhhHHHHHHHHHHLLEEEEEE


DSSP  EHH----------------HHHHhhhlllllhhhhhhhHHHHHHLLLLLL--------lL
Query RLE----------------THAEdfxlehdnfaawwqaFSNDVKQAKAHG--------fV  164
ident  |                                                          
Sbjct VLYshagfggqpasegqrrFING---------------SEAYLELLQRLRapleaaghsL  200
DSSP  LLLleeellleellhhhllLLLL---------------HHHHHHHHHHHHhhhhhhlleE


DSSP  LEEELHHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHH-HHHHhhLL
Query GFXSIAAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVA-PFIIaqDX  223
ident |                                                |        | 
Sbjct GLCFHSLRA--------------------------------vTPQQIATVLaAGHD--DL  226
DSSP  LEEELLLLL--------------------------------lLHHHHHHHHlLLLL--LL


DSSP  LEEEEELLLlllLLHHH-------LLHHHH-HHHHhhhhhhllLEEEEELLLLHHHHHHH
Query PLQFHVGYGdadTDXYL-------GNPLLX-RDYLkaftkkglKVVLLHCYPYHREAGYL  275
ident |   |                                         | |           
Sbjct PVHIHIAEQ--qKEVDDcqawsgrRPLQWLyENVA-----vdqRWCLVHATHADPAEVAA  279
DSSP  LEEEEELLL--hHHHHHhhhhhllLHHHHHhHHLL-----lllLEEEEELLLLLHHHHHH


DSSP  HHHLlLEEEELLlHHHHLHhhhhHHHHhhLLLLL--hhHEELLLLLLllhhHHHHhHHHH
Query ASVFpNLYFDISlLDNLGPsgasRVFNeaVELAP--ytRILFASDAStypeXYGLaARQF  333
ident              |           |            |    ||               
Sbjct MARS-GAVAGLC-LSTEAN-lgdGIFP--ATDFLaqggRLGIGSDSH----VSLS-VVEE  329
DSSP  HHHH-LLEEEEL-HHHHHH-lllLLLL--HHHHHhlllEEEELLLLL----LLLL-HHHH


DSSP  HHHHHHH-----hHLLL--lLLHHHHHHHHHHHHLHHHHHH-LLLH-------HHHLL--
Query KQALVAH-----fNQLP--fVDLAQKKAWINAICWQTSAKL-YHQE-------RELRV--  376
ident    |                 |                |              |      
Sbjct LRWLEYGqrlrdrKRNRlyrDDQPMIGRTLYDAALAGGAQAlGQPIgslavgrRADLLvl  389
DSSP  HHHHHHHhhhhhlLLLLlllLLLLLHHHHHHHHHHHHHHHHhLLLLlllllllLLLEEee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct dgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlge  449
DSSP  llllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhh


DSSP  --
Query --  376
ident   
Sbjct ll  451
DSSP  hl


No 41: Query=2qpxA Sbjct=2ogjA Z-score=12.1

back to top
DSSP  --------------------------------------------lllllhhhhHHLLEEE
Query --------------------------------------------gxddlsefvDQVPLLD   16
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafISPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleEEELEEE


DSSP  EEELLLLLlllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllll
Query HHCHFLIDgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaa   76
ident  | |                                                        
Sbjct LHVHIWHG----------------------------------------------------   68
DSSP  EEELLLLL----------------------------------------------------


DSSP  llhhhhhhhhhhhHHHLLEEEEEEELLLllllllLLHHHHHHHHLLLEEEEEEHHHH---
Query xndpgyatynhriFGHFHFKELLIDTGFvpddpiLDLDQTAELVGIPVKAIYRLETH---  133
ident                      |                   |      ||   |      
Sbjct --gtdisirpsecGAERGVTTLVDAGSAgeanfhGFREYIIEPSRERIKAFLNLGSIglv  126
DSSP  --lllllllhhhlLHHHLEEEEEEELLLllllhhHHHHHLLLLLLLEEEEEEELLLLlll


DSSP  ---------HHHHhlllllhhhhhhhHHHHHH-LLLLLL--LLLEEELHHHHLlllllll
Query ---------AEDFxlehdnfaawwqaFSNDVK-QAKAHG--FVGFXSIAAYRVglhlepv  181
ident                                           || |  |           
Sbjct acnrvpelrDIKD------------iDLDRILeCYAENSehIVGLXVRASHVI-------  167
DSSP  lllllllllLHHH------------lLHHHHHhHHHLLLllEEEEEEEELHHH-------


DSSP  lhhhhhhhhhhhhhhlllllLLHHhhHHHHHHHHHHHHHHLLLEEEEELlllllllHHHL
Query nvieaaagfdtwkhsgekrlTSKPliDYXLYHVAPFIIAQDXPLQFHVGygdadtdXYLG  241
ident                      |                    |   |||           
Sbjct -------------------tGSWG--VTPVKLGKKIAKILKVPXXVHVG-------EPPA  199
DSSP  -------------------hLLLL--LHHHHHHHHHHHHHLLLEEEEEL-------LLLL


DSSP  LHHHHHHHHhhhhhhLLLEEEEELL-----LLHH---hhhHHHHHLLLEEEELLlhHHHL
Query NPLLXRDYLkaftkkGLKVVLLHCY-----PYHR---eagYLASVFPNLYFDISllDNLG  293
ident         |      |   |  ||                 ||        ||       
Sbjct LYDEVLEIL------GPGDVVTHCFngksgSSIXededlfNLAERCEGIRLDIG--HGGA  251
DSSP  LHHHHHHHL------LLLLEEELLLlllllLLLLllhhhhHHHHHLLLLEEELL--LLLL


DSSP  hhhHHHHHHHHL-LLLLhhHEELLLLLLllHHHH---hHHHHHHHHHHHHHHhllllllh
Query psgASRVFNEAV-ELAPytRILFASDAStyPEXY---gLAARQFKQALVAHFnqlpfvdl  349
ident       |   |              |                     |            
Sbjct -sfSFKVAEAAIaRGLL--PFSISTDLH--GHSXnfpvWDLATTXSKLLSVD--------  298
DSSP  -llLHHHHHHHHhLLLL--LLLLLLLLL--LLLLllllLLHHHHHHHHHHLL--------


DSSP  hhhHHHHHHHHLHHHHHHLLLhhHHLL---------------------------------
Query aqkKAWINAICWQTSAKLYHQerELRV---------------------------------  376
ident                |                                            
Sbjct -xpFENVVEAVTRNPASVIRL--DXENrldvgqradftvfdlvdadleatdsngdvsrlk  355
DSSP  -llHHHHHHLLLHHHHHHLLL--LLLLlllllllleeeeeeeeeeeeeeellllleeeee


DSSP  ------------------------
Query ------------------------  376
ident                         
Sbjct rlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeelleeeellllllll


No 42: Query=2qpxA Sbjct=4cqbA Z-score=12.1

back to top
DSSP  -----------------------------------------lllllhhhhhHLLEEEEEE
Query -----------------------------------------gxddlsefvdQVPLLDHHC   19
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  L--LLLL-LLLLLHHHHhhhhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllllll
Query H--FLID-GKVPNRDDRlaqvsTEADkdypladtknrlayhgflalakefaldannplaa   76
ident |                     |                                     
Sbjct HmdKSFTsTGERLPKFW-srpyTRDA--------------------aiedglkyyknath   99
DSSP  LhhHLLLlLLLLLLLLL-llllLHHH--------------------hhhhhhhhhhhllh


DSSP  llhhhhhhhhhHHHHHLLEEEEEEELL-------lllllllLLHHHHHHhhLLLEEEEEE
Query xndpgyatynhRIFGHFHFKELLIDTG-------fvpddpiLDLDQTAElvGIPVKAIYR  129
ident                                                     |       
Sbjct eeikrhviehaHMQVLHGTLYTRTHVDvdsvaktkaveavlEAKEELKD--LIDIQVVAF  157
DSSP  hhhhhhhhhhhHHHHHLLEEEEEEEEElllllllhhhhhhhHHHHHLLL--LLEEEEEEE


DSSP  HHH-hHHHHhlllllhhhhhhHHHHHHHLLLLLLLLLEEELhHHHLllllllllhhhhhh
Query LET-hAEDFxlehdnfaawwqAFSNDVKQAKAHGFVGFXSIaAYRVglhlepvnvieaaa  188
ident        |                         |                          
Sbjct AQSgfFVDL------------ESESLIRKSLDMGCDLVGGV-DPAT--------------  190
DSSP  LLLllLLLL------------LHHHHHHHHHHHLLLEEELL-LLLL--------------


DSSP  hhhhhhhhlllllllhHHHHHHHHHHHHHHHHHLLLEEEEELlllllllHHHLLHHHHHH
Query gfdtwkhsgekrltskPLIDYXLYHVAPFIIAQDXPLQFHVGygdadtdXYLGNPLLXRD  248
ident                       |          |     |                    
Sbjct --------------reNNVEGSLDLCFKLAKEYDVDIDYHIH------dIGTVGVYSINR  230
DSSP  --------------llLLHHHHHHHHHHHHHHLLLEEEEEEL------lLHHHHHHHHHH


DSSP  HHHHHHHHLL--LEEEEELLLL-------hhhhHHHHHHLlLEEEELL-LHHHhlhhhhh
Query YLKAFTKKGL--KVVLLHCYPY-------hreaGYLASVFpNLYFDIS-LLDNlgpsgas  298
ident         |    |   |                 |        |               
Sbjct LAQKTIENGYkgRVTTSHAWCFadapsewldeaIPLYKDS-GMKFVTCfSSTP-----pt  284
DSSP  HHHHHHHLLLllLEEEEELLHHhhllhhhhhhhHHHHHHH-LLEEEEElLLLL-----ll


DSSP  hHHHHHLLLLLhhHEELLLLLLLL----hHHHHhhHHHHHHHHH--HHHHLLLlllhhhh
Query rVFNEAVELAPytRILFASDASTY----pEXYGlaARQFKQALV--AHFNQLPfvdlaqk  352
ident        |         |||                 |                      
Sbjct mPVIKLLEAGI--NLGCASDNIRDfwvpfGNGD--MVQGALIETqrLELKTNR------d  334
DSSP  lLHHHHHHLLL--EEEEELLLLLLlllllLLLL--HHHHHHHHHhhHLLLLHH------h


DSSP  hhHHHHHHLHHHHHHLLLHHHHLL------------------------------------
Query kaWINAICWQTSAKLYHQERELRV------------------------------------  376
ident    |        |     |                                         
Sbjct lgLIWKMITSEGARVLGIEKNYGIevgkkadlvvlnslspqwaiidqakrlcvikngrii  394
DSSP  hhHHHHHHLHHHHHHHLLHHHLLLllllllleeeellllhhhhhhhllleeeeeelleee


DSSP  --------
Query --------  376
ident         
Sbjct vkdeviva  402
DSSP  eelleell


No 43: Query=2qpxA Sbjct=2oofA Z-score=11.9

back to top
DSSP  --------------------------------------------------lllllhhhhh
Query --------------------------------------------------gxddlsefvd   10
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  HLLEEEEEEL-LLLLlllllHHHHHHhhlllllllllhhhhlllhhhhhhhhhhhhhlll
Query QVPLLDHHCH-FLIDgkvpnRDDRLAqvsteadkdypladtknrlayhgflalakefald   69
ident    | | | |          |                                       
Sbjct TPGLIDCHTHlIFAG----sRAEEFE-----------lrqkgvpyaeiarkgggiistvr  105
DSSP  EELEEEEEELlLLLL----lLHHHHH-----------hhhhlllhhhhhhllllhhhhhh


DSSP  lllllllllhhhhhhHHHHHHHHLLEEEEEEELLLL-----lllllLLHHHHHHHHLLLE
Query annplaaxndpgyatYNHRIFGHFHFKELLIDTGFV-----pddpiLDLDQTAELVGIPV  124
ident                               |  |                   |   | |
Sbjct atraasedqlfelalPRVKSLIREGVTTVEIKSGYGltledelkxlRVARRLGEALPIRV  165
DSSP  hhhhllhhhhhhhhhHHHHHHHHHLEEEEEEELLLLllhhhhhhhhHHHHHHHHHLLLEE


DSSP  EEEEEHHHHHHHhHLLLllhhHHHHHHH-HHHHLLLL-LLLLLEEELHHHHlllllllll
Query KAIYRLETHAEDfXLEHdnfaAWWQAFS-NDVKQAKA-HGFVGFXSIAAYRvglhlepvn  182
ident |                     |           |                         
Sbjct KTTLLAAHAVPPeYRDD--pdSWVETICqEIIPAAAEaGLADAVDVFCEHI---------  214
DSSP  EEEEEEELLLLHhHLLL--hhHHHHHHHhLHHHHHHHlLLLLEEEEEELLL---------


DSSP  hhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllllhhHLL
Query vieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadtdxyLGN  242
ident                                |             |              
Sbjct ----------------------gfSLAQTEQVYLAADQYGLAVKGHXDQL-------SNL  245
DSSP  ----------------------llLHHHHHHHHHHHHHLLLEEEEEELLL-------LLL


DSSP  HhhhhhhhhhhhhhLLLE-EEEELLLLHHHHHHHHHHLlLEEEELLlHHHHLH--hhhhh
Query PllxrdylkaftkkGLKV-VLLHCYPYHREAGYLASVFpNLYFDISlLDNLGP--sgasr  299
ident                       |      |                              
Sbjct G-------gstlaaNFGAlSVDHLEYLDPEGIQALAHR-GVVATLL-PTAFYFlketklp  296
DSSP  L-------hhhhhhHLLLlEEEELLLLLHHHHHHHHHH-LLEEEEL-HHHHHHlllllll


DSSP  HHHHHLLLLLhhHEELLLLLLL-lhHHHHhhHHHHHHHHhhhhhllllllhhhHHHHHHH
Query VFNEAVELAPytRILFASDAST-ypEXYGlaARQFKQALvahfnqlpfvdlaqKKAWINA  358
ident                  ||             |                          |
Sbjct PVVALRKAGV--PXAVSSDINPgtaPIVS--LRXAXNXA--------ctlfglTPVEAXA  344
DSSP  LHHHHHHLLL--LEEELLLLLLlllLLLL--HHHHHHHH--------hhhhllLHHHHHH


DSSP  HHLHHHHHHLLLH-HHHLL----------------------------------------
Query ICWQTSAKLYHQE-RELRV----------------------------------------  376
ident       |                                                    
Sbjct GVTRHAARALGEQeQLGQLrvgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
DSSP  HLLHHHHHHLLLLlLLLLLllllllleeeellllllhhhhlllllleeeeeelleelll


No 44: Query=2qpxA Sbjct=1yrrB Z-score=11.7

back to top
DSSP  ----------------------------------------lllllhhhhHHLLEEEEEEL
Query ----------------------------------------gxddlsefvDQVPLLDHHCH   20
ident                                                        |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaiLSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleEEELEEEEEEL


DSSP  Lllllllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhh
Query Flidgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaaxndp   80
ident                                                             
Sbjct G--------------------------------------------cggvqfndtaeavsv   76
DSSP  E--------------------------------------------elleelllllllllh


DSSP  hhhhhhhHHHHHLLEEEEEEELLL--------lllllllLHHHHhhhhLLLE-EEEEEHH
Query gyatynhRIFGHFHFKELLIDTGF--------vpddpilDLDQTaelvGIPV-KAIYRLE  131
ident                   |                     |                   
Sbjct etleimqKANEKSGCTNYLPTLITtsdelmkqgvrvmreYLAKH----PNQAlGLHLEGP  132
DSSP  hhhhhhhHHHHLLLEEEEEEEELLllhhhhhhhhhhhhhHHHHL----LLLLlLEEEELL


DSSP  hhhhhhhlllllhhhhhHHHHHHHHLLLlLLLLLEEELhhhhlllllllllhhhhhhhhh
Query thaedfxlehdnfaawwQAFSNDVKQAKaHGFVGFXSIaayrvglhlepvnvieaaagfd  191
ident                   |                                         
Sbjct --------------wlnAALVDFLCENA-DVITKVTLA----------------------  155
DSSP  --------------lllLHHHHHHHHLH-HHEEEEEEL----------------------


DSSP  hhhhhlllllllhhhhHHHHHHHHHHHHHHLLLEEEEEllllllllhhhllhHHHHHHHH
Query twkhsgekrltskpliDYXLYHVAPFIIAQDXPLQFHVgygdadtdxylgnpLLXRDYLK  251
ident                       |                                    |
Sbjct ---------------pEMVPAEVISKLANAGIVVSAGH-------------sNATLKEAK  187
DSSP  ---------------hHHLLHHHHHHHHHHLLEEEELL-------------lLLLHHHHH


DSSP  HHHHHlLLEEEEELLL-------lhhhhhHHHHHLLLEEEELLlhHHHLHhHHHHHHHHH
Query AFTKKgLKVVLLHCYP-------yhreagYLASVFPNLYFDISllDNLGPsGASRVFNEA  304
ident |           | |                       |  |                 |
Sbjct AGFRA-GITFATHLYNampyitgrepglaGAILDEADIYCGII--ADGLH-VDYANIRNA  243
DSSP  HHHHH-LEEEELLLLLllllllllllhhhHHHHHLLLLEEEEE--LLLLL-LLHHHHHHH


DSSP  LLLLLhHHEELLLLLLllhHHHHhhHHHHHHHH-HHHHhllllllhhhHHHHHHHHHLHH
Query VELAPyTRILFASDAStypEXYGlaARQFKQAL-VAHFnqlpfvdlaqKKAWINAICWQT  363
ident   |          ||                 |                           
Sbjct KRLKG-DKLCLVTDAT-sgSSLT--MIEGVRNLvEHCG---------iALDEVLRMATLY  290
DSSP  HHHHH-HHEEEELLLL-llLLLL--HHHHHHHHhHHHL---------lLHHHHHHHHLHH


DSSP  HHHHLLLH-HHHLL------------------------------
Query SAKLYHQE-RELRV------------------------------  376
ident  |     | |                                  
Sbjct PARAIGVEkRLGTLaagkvanltaftpdfkitktivngnevvtq  334
DSSP  HHHHLLLLlLLLLLllllllleeeellllleeeeeelleeeeel


No 45: Query=2qpxA Sbjct=2imrA Z-score=11.6

back to top
DSSP  -------------------------------------------lllllhHHHHHLLEEEE
Query -------------------------------------------gxddlsEFVDQVPLLDH   17
ident                                                    |   |    
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeraGAVIAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelLLEELLLLLEE


DSSP  EELLL-------lllllllhhhHHHHHlllllllllhhhhlllhhhhhhhhhhhhhllll
Query HCHFL-------idgkvpnrddRLAQVsteadkdypladtknrlayhgflalakefalda   70
ident | |                                                         
Sbjct HTHLDmsayefqalpyfqwipeVVIRG---------------------------------   87
DSSP  EEELLllhhhhhhlhhhhllhhHHHHH---------------------------------


DSSP  llllllllhhhhhhhhhHHHHHLLEEEEEEELLLllllllLLHHHHHhhhLLLEEEEEEH
Query nnplaaxndpgyatynhRIFGHFHFKELLIDTGFvpddpiLDLDQTAelvGIPVKAIYRL  130
ident                                           |                 
Sbjct ----rhlrgvaaaqagaDTLTRLGAGGVGDIVWA--pevmDALLARE---DLSGTLYFEV  138
DSSP  ----llllhhhhhhhhhHHHHHLLLLLEEEEELL--hhhhHHHHLLL---LLLEEEEEEE


DSSP  HhhhhhhhlllllhhHHHHHHHHHHHL-LLLLL-------LLLEEELHHHHlllllllll
Query EthaedfxlehdnfaAWWQAFSNDVKQ-AKAHG-------FVGFXSIAAYRvglhlepvn  182
ident                                           |                 
Sbjct L----------npfpDKADEVFAAARThLERWRrlerpglRLGLSPHTPFT---------  179
DSSP  L----------lllhHHHHHHHHHHHHhHHHHHlllllleEEEEEELLLLL---------


DSSP  hhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllllHHHL-
Query vieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadtdXYLG-  241
ident                                          ||| ||             
Sbjct -----------------------vSHRLMRLLSDYAAGEGLPLQIHVAEH-----PTELe  211
DSSP  -----------------------lLHHHHHHHHHHHHHHLLLLEEEELLL-----HHHHh


DSSP  --------------------------------lhHHHHHHH-HHHHhhLLLEEEEELLLL
Query --------------------------------npLLXRDYL-KAFTkkGLKVVLLHCYPY  268
ident                                      |               | |    
Sbjct mfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLGVL--AARPTLVHMVNV  269
DSSP  hhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHLLH--HHLLEEEELLLL


DSSP  hhhHHHHHHHLLlEEEELLlHHHHLH-hhhhhHHHHHLLLLLhhHEELLLLLLLlhHHHH
Query hreAGYLASVFPnLYFDISlLDNLGP-sgasrVFNEAVELAPytRILFASDASTypEXYG  327
ident                                                   |     |   
Sbjct tpdDIARVARAG-CAVVTC-PRSNHHlecgtfDWPAFAAAGV--EVALGTDSVAsgETLN  325
DSSP  lhhHHHHHHHHL-LLEEEL-HHHHHHllllllLHHHHHHLLL--LEEELLLLHHhhLLLL


DSSP  hhHHHHHHHHHHHHHLLllllhhhhHHHHHHHHLHHHHHHLllhhHHLL-----------
Query laARQFKQALVAHFNQLpfvdlaqkKAWINAICWQTSAKLYhqerELRV-----------  376
ident    |            |                                           
Sbjct --VREEVTFARQLYPGL-------dPRVLVRAAVKGGQRVV----GTPFlrrgetwqegf  372
DSSP  --LHHHHHHHHHHLLLL-------lHHHHHHHHHHHHHHHH----LLLLllllllllhhh


DSSP  --------
Query --------  376
ident         
Sbjct rwelsrdl  380
DSSP  lhhhllll


No 46: Query=2qpxA Sbjct=2uz9A Z-score=11.4

back to top
DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------gxd    3
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  llhhhhhHLLEEEEEELL--LLLLllllhhhHHHHhlLLLLllllhhhhlllhhhhhhhh
Query dlsefvdQVPLLDHHCHF--LIDGkvpnrddRLAQvsTEADkdypladtknrlayhgfla   61
ident           | | | |                                           
Sbjct lshheffMPGLVDTHIHAsqYSFA------gSSID-lPLLE------------------w   95
DSSP  llllleeEELEEEEEEEHhhHHHL------lLLLL-lLHHH------------------h


DSSP  hhhhhllllllllllllhhhhhhhhhHHHHHLLEEEEEEELLlllllllLLHHHHHHHhL
Query lakefaldannplaaxndpgyatynhRIFGHFHFKELLIDTGfvpddpiLDLDQTAELvG  121
ident                           |                      |  | |    |
Sbjct ltkytfpaehrfqnidfaeevytrvvRRTLKNGTTTACYFATihtdsslLLADITDKF-G  154
DSSP  hhhlhhhhhhhhhlhhhhhhhhhhhhHHHHHLLEEEEEEELLllhhhhhHHHHHHHHH-L


DSSP  LLEEEEEEHH-----hhhHHHHlllllhhhhHHHHHHHHHLLLLLL--------LLLEE-
Query IPVKAIYRLE-----thaEDFXlehdnfaawWQAFSNDVKQAKAHG--------FVGFX-  167
ident                                                             
Sbjct QRAFVGKVCMdlndtfpeYKET---------TEESIKETERFVSEMlqknysrvKPIVTp  205
DSSP  LEEEEELEELllllllllLLLL---------HHHHHHHHHHHHHHHhhhlllleEEEEEe


DSSP  ELHHhhlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEE
Query SIAAyrvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQF  227
ident                                                       |   | 
Sbjct RFSL---------------------------------scSETLMGELGNIAKTRDLHIQS  232
DSSP  LLHH---------------------------------hlLHHHHHHHHHHHHHHLLEEEE


DSSP  EELLLLllLLHHHL---------LHHHHHHHHhhhhhhllLEEEEELLLLHHHHHHHHHH
Query HVGYGDadTDXYLG---------NPLLXRDYLkaftkkglKVVLLHCYPYHREAGYLASV  278
ident |                                       | |  |      |       
Sbjct HISENR--DEVEAVknlypsyknYTSVYDKNN----lltnKTVMAHGCYLSAEELNVFHE  286
DSSP  EELLLH--HHHHHHhhhllllllHHHHHHHLL----llllLEEEEELLLLLHHHHHHHHH


DSSP  LlLEEEELLlhHHHLH--hhhhhHHHHHLLLLLhhHEELLLLLLllhHHHH--HHHHHHH
Query FpNLYFDISllDNLGP--sgasrVFNEAVELAPytRILFASDAStypEXYG--LAARQFK  334
ident             |             |         |    |       |    | |   
Sbjct R-GASIAHC--PNSNLslssgflNVLEVLKHEV--KIGLGTDVA-ggYSYSmlDAIRRAV  340
DSSP  H-LLEEEEL--HHHHHhllllllLHHHHHHLLL--EEEELLLLL-llLLLLhhHHHHHHH


DSSP  HHHH---------HHHHllllllhhhhhhhHHHHHLHHHHHhlLLHH-HHLL--------
Query QALV---------AHFNqlpfvdlaqkkawINAICWQTSAKlyHQER-ELRV--------  376
ident                                                             
Sbjct MVSNillinkvneKSLT----------lkeVFRLATLGGSQalGLDGeIGNFevgkefda  390
DSSP  HHHHhhhhlllllLLLL----------hhhHHHHHLHHHHHhlLLLLlLLLLllllllle


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  376
ident                                                       
Sbjct ilinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  eeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 47: Query=2qpxA Sbjct=3icjA Z-score=11.0

back to top
DSSP  ------------------------------------------------lllllhhhhhHL
Query ------------------------------------------------gxddlsefvdQV   12
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LEEEEEEL--LLLL--LLLL----------------------LHHH--------------
Query PLLDHHCH--FLID--GKVP----------------------NRDD--------------   32
ident    | | |   |      |                                         
Sbjct AFFDSHLHldELGMslEMVDlrgvksmeelvervkkgrgriiFGFGwdqdelgrwptred  120
DSSP  LEEEEEELhhHHHHhhHLEEllllllhhhhhhhhhlllllleEEEEelhhhhlllllhhh


DSSP  -----hhhhhlllLLLL--------------------------LLHHhhlllhhhhhhhh
Query -----rlaqvsteADKD--------------------------YPLAdtknrlayhgfla   61
ident                                               |             
Sbjct ldvidrpvflyrrCFHVavmnskmidllnlkpskdfdestgivRERA-------------  167
DSSP  hlllllleeeeelLLLEeeelhhhhhhhllllllleelllleeEHHH-------------


DSSP  hhhhhllllllllllllhhhhhHHHHHHHHHLLEEEEEEELLLlllllllLHHH--hhhH
Query lakefaldannplaaxndpgyaTYNHRIFGHFHFKELLIDTGFvpddpilDLDQ--taeL  119
ident                                                    |        
Sbjct leesrkiinekiltvkdykhyiESAQEHLLSLGVHSVGFMSVG--ekalkALFEleregR  225
DSSP  hhhhhhhhhhllllhhhhhhhhHHHHHHHHHLLEEEEEEEEEL--hhhhhHHHHhhhllL


DSSP  HLLLEEEEEEHhhhhhhhhlllllhhhhhhhHHHH--hHLLLL----lLLLLEEELHHH-
Query VGIPVKAIYRLethaedfxlehdnfaawwqaFSND--vKQAKA----hGFVGFXSIAAY-  172
ident     | |                                  |         | |      
Sbjct LKMNVFAYLSP------------------elLDKLeelNLGKFegrrlRIWGVXLFVDGs  267
DSSP  LLLEEEEEELH------------------hhHHHHhhhLLLLEellleEEEEEEEELLLl


DSSP  --------------------HLLLLLllllhhhhhhhhhhhhhhlllllllhhhhhHHHH
Query --------------------RVGLHLepvnvieaaagfdtwkhsgekrltskplidYXLY  212
ident                                                             
Sbjct lgartallsepytdnpttsgELVMNK------------------------------DEIV  297
DSSP  llllllllllllllllllllLLLLLH------------------------------HHHH


DSSP  HHHHHHHHHLLLEEEEELlllllllHHHLlHHHHHHHHHHHHhhlLLEEEEELLLLhhhh
Query HVAPFIIAQDXPLQFHVGygdadtdXYLGnPLLXRDYLKAFTkkgLKVVLLHCYPYhrea  272
ident  |             |                   |               |        
Sbjct EVIERAKPLGLDVAVHAI-------GDKA-VDVALDAFEEAE---FSGRIEHASLVrddq  346
DSSP  HHHHHHLLLLLEEEEEEL-------LHHH-HHHHHHHHHHHL---LLLEEEELLLLlhhh


DSSP  HHHHHHLLlEEEELLlhHHHLHHH-------------hhhHHHHHLLLLlhhHEELLLLL
Query GYLASVFPnLYFDISllDNLGPSG-------------asrVFNEAVELApytRILFASDA  319
ident                       |                                |  | 
Sbjct LERIKELK-VRISAQ--PHFIVSDwwivnrvgeerakwayRLKTLSSIT---KLGFSTDS  400
DSSP  HHHHHHHL-LEEEEL--LLHHHHLllhhhhhhhhhhhhllLHHHHHHHL---LEEELLLL


DSSP  LllhhHHHHhhHHHHHHHHHHhhllllllhhhHHHHHHHHHLHHHHHHLLLHHHHLL---
Query StypeXYGLaaRQFKQALVAHfnqlpfvdlaqKKAWINAICWQTSAKLYHQERELRV---  376
ident                 | |                         ||     |        
Sbjct P--iePADP--WVSIDAAVNR--yvvdpgervSREEALHLYTHGSAQVTLAEDLGKLerg  454
DSSP  L--llLLLH--HHHHHHHHHL--llllhhhllLHHHHHHHLLHHHHHHLLLLLLLLLlll


DSSP  --------------
Query --------------  376
ident               
Sbjct fraeyiildrdplk  468
DSSP  lllleeeellllll


No 48: Query=2qpxA Sbjct=3ooqA Z-score=10.8

back to top
DSSP  ----------------------------------------lllllhhhhhHLLEEEEEEL
Query ----------------------------------------gxddlsefvdQVPLLDHHCH   20
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  --LLLLLLlllHHHHhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllll
Query --FLIDGKvpnRDDRlaqvsteadkdypladtknrlayhgflalakefaldannplaaxn   78
ident       |                                                     
Sbjct igLFEEGV---GYYY---------------------------sdgneatdpvtphvkald   90
DSSP  llLLLLLL---LHHH---------------------------lllllllllllllllhhh


DSSP  hhhhHHHHHHHHHHLLEEEEEEELL--------lllllllllhHHHHhhhllLEEEeeeh
Query dpgyATYNHRIFGHFHFKELLIDTG--------fvpddpildlDQTAelvgiPVKAiyrl  130
ident                      |  |                            ||     
Sbjct gfnpQDPAIERALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEEC-----IVKD----  141
DSSP  hlllLLHHHHHHHLLLEEEEEELLLlllleeeeeeeeelllllHHHH-----EEEE----


DSSP  hhhhhhhhlllllhhhhhhhhhhhhhllllllLLLEEELHHHHLllllllllhhhhhhhh
Query ethaedfxlehdnfaawwqafsndvkqakahgFVGFXSIAAYRVglhlepvnvieaaagf  190
ident                                   |                         
Sbjct --------------------------------PAGLKXAFGENP----------------  153
DSSP  --------------------------------EEEEEEELLHHH----------------


DSSP  hhhhhhLLLL-LLLHHHHHHHHHHHH------------------------------HHHH
Query dtwkhsGEKR-LTSKPLIDYXLYHVA------------------------------PFII  219
ident         |                                                   
Sbjct -krvygERKQtPSTRXGTAGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevgEXVL  212
DSSP  -hhhhhHLLLlLLLHHHHHHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhhHHHH


DSSP  HHLLLEEEEELLllllllhhhLLHHHHHHHHHHHHhhlLLEEEEELLlLHHHHHHHHHHL
Query AQDXPLQFHVGYgdadtdxylGNPLLXRDYLKAFTkkgLKVVLLHCYpYHREAGYLASVF  279
ident     |   |               |        |       |  |               
Sbjct RKKIPARXHAHR--------aDDILTAIRIAEEFG---FNLVIEHGT-EAYKISKVLAEK  260
DSSP  LLLLLEEEEELL--------hHHHHHHHHHHHHHL---LLEEEEELL-LHHHHHHHHHHH


DSSP  LlEEEELLLhHHHL------hhHHHHHHHHHLLLLLhhHEELLLLLLllhhHHHHhHHHH
Query PnLYFDISLlDNLG------psGASRVFNEAVELAPytRILFASDAStypeXYGLaARQF  333
ident                                        |    |           |   
Sbjct K-IPVVVGP-LLTFrtklelkdLTXETIAKLLKDGV--LIALXCDHP--viPLEF-ATVQ  313
DSSP  L-LLEEELL-LLLLlllhhhllLLLLHHHHHHHLLL--LEEELLLLL--llLHHH-HHHH


DSSP  HHHHH-HHHHllllllhhhhHHHHHHHHLHHHHHHLLLH-HHHLL---------------
Query KQALV-AHFNqlpfvdlaqkKAWINAICWQTSAKLYHQE-RELRV---------------  376
ident                           |     ||    | |                   
Sbjct AATAXrYGAK----------EEDLLKILTVNPAKILGLEdRIGSIepgkdadlvvwsghp  363
DSSP  HHHHHhHLLL----------HHHHHHLLLHHHHHHLLLLlLLLLLllllllleeeellll


DSSP  ---------------------
Query ---------------------  376
ident                      
Sbjct fdxksvvervyidgvevfrre  384
DSSP  lllllleeeeeelleeeeell


No 49: Query=2qpxA Sbjct=3qy6A Z-score=10.4

back to top
DSSP  lllllhhhhhhllEEEEEELL-------LLLLllllhhhhhhhhlllllllllhhhhlll
Query gxddlsefvdqvpLLDHHCHF-------LIDGkvpnrddrlaqvsteadkdypladtknr   53
ident                | |||          |                             
Sbjct -------------MIDIHCHIlpamddgAGDS----------------------------   19
DSSP  -------------LEELLLLLlllllllLLLH----------------------------


DSSP  hhhhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLLEEEEEEELL-------lll
Query layhgflalakefaldannplaaxndpgyatYNHRIFGHFHFKELLIDTG-------fvp  106
ident                                   |                         
Sbjct ---------------------------adsiEMARAAVRQGIRTIIATPHhnngvyknep   52
DSSP  ---------------------------hhhhHHHHHHHHLLLLEEELLLEellllllllh


DSSP  llllLLHHHHHH-----hhLLLEEEEEehhhhhhhhhlllllhhhhhhhhhhhhhlllll
Query ddpiLDLDQTAE-----lvGIPVKAIYrlethaedfxlehdnfaawwqafsndvkqakah  161
ident        ||             |                                     
Sbjct aavrEAADQLNKrlikediPLHVLPGQ---------------------------------   79
DSSP  hhhhHHHHHHHHhhhhlllLLEEELLL---------------------------------


DSSP  lllleEELHhhhlllllllllhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHH---
Query gfvgfXSIAayrvglhlepvnvieaaagfdtwkhsgekrltskplidyXLYHVAPFI---  218
ident                                                             
Sbjct -----EIRI-------------------------------------ygEVEQDLAKRqll   97
DSSP  -----EEEL-------------------------------------llLHHHHHHLLlll


DSSP  -hhhLLLEEEEELlllllllHHHLLhHHHHHHHHHHHHHLLLEEEEELLLL------hhH
Query -iaqDXPLQFHVGygdadtdXYLGNpLLXRDYLKAFTKKGLKVVLLHCYPY------hrE  271
ident                                       ||   |  |             
Sbjct slndTKYILIEFP-------FDHVP-RYAEQLFYDLQLKGYIPVIAHPERNreirenpsL  149
DSSP  lhhhLLEEEEELL-------LLLLL-LLHHHHHHHHHHLLLEEEEELHHHLhhhhhllhH


DSSP  HHHHHHHLllEEEELL-LHHH-HLHHHHHHHHHHHLLLLLhhHEELLLLLLLLhHHHHHh
Query AGYLASVFpnLYFDIS-LLDN-LGPSGASRVFNEAVELAPytRILFASDASTYpEXYGLa  329
ident    |          |                    ||         ||||          
Sbjct LYHLVEKG--AASQITsGSLAgIFGKQLKAFSLRLVEANL--IHFVASDAHNVkTRNFH-  204
DSSP  HHHHHHLL--LEEEEEhHHHLlLLLHHHHHHHHHHHHLLL--LLEEELLLLLLlLLLLL-


DSSP  HHHHHHHHHHHHHllllllhhhhHHHHHHHHlHHHHHHLLLH-------hhhll
Query ARQFKQALVAHFNqlpfvdlaqkKAWINAICwQTSAKLYHQE-------relrv  376
ident        |   |                         |                
Sbjct TQEALYVLEKEFG----------SELPYMLT-ENAELLLRNQtifrqppqpvkr  247
DSSP  HHHHHHHHHHHHL----------LHHHHHHH-HHHHHHHLLLllllllllllll


No 50: Query=2qpxA Sbjct=1v77A Z-score=9.0

back to top
DSSP  lllllhhhhhhLLEEEEEELLLLllllllhhhhhhhhlllllllllhhhhlllhhhhhhh
Query gxddlsefvdqVPLLDHHCHFLIdgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
ident            |                                                
Sbjct -----------VKFIEMDIRDKE-------------------------------------   12
DSSP  -----------LLLEEEEELLHH-------------------------------------


DSSP  hhhhhhllllllllllllhhhhhhhhhhHHHHlLEEEEEEElllllllllllhhhhhhhh
Query alakefaldannplaaxndpgyatynhrIFGHfHFKELLIDtgfvpddpildldqtaelv  120
ident                                   | |                       
Sbjct -------------------------ayeLAKE-WFDEVVVS-------------------   27
DSSP  -------------------------hhhHHHH-HLLEEEEE-------------------


DSSP  llleeeeEEHHHHhhhhhlllllhhhhhhhhhhhhHLLLLLLL-----LLEEELHHhhll
Query gipvkaiYRLETHaedfxlehdnfaawwqafsndvKQAKAHGF-----VGFXSIAAyrvg  175
ident                                    |            |           
Sbjct -------IKFNEE--------------------vdKEKLREARkeygkVAILLSNP----   56
DSSP  -------EEELLL--------------------llHHHHHHHHhhhllEEEEEELL----


DSSP  lllllllhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHhhLLLEEEEEllllll
Query lhlepvnvieaaagfdtwkhsgekrltskplidYXLYHVAPFIIaqDXPLQFHVgygdad  235
ident                                                             
Sbjct -------------------------------kpSLVRDTVQKFK--SYLIYVES------   77
DSSP  -------------------------------lhHHHHHHHHHLL--LLEEEEEL------


DSSP  llhhhlLHHHH-HHHHHHhhhhlLLEEEEELLL----LHHHhhHHHHH--LLLEEEELLl
Query tdxylgNPLLX-RDYLKAftkkgLKVVLLHCYP----YHREagYLASV--FPNLYFDISl  288
ident       | |   |                               ||      |     | 
Sbjct ------NDLRViRYSIEK-----GVDAIISPWVnrkdPGID-hVLAKLmvKKNVALGFS-  124
DSSP  ------LLHHHhHHHHHL-----LLLEEELLLLllllLLLL-hHHHHHhhHHLLEEEEE-


DSSP  hHHHLH-------HHHHHHHHHHLLLLL--HHHEELLLLLLlLHHHHHhhHHHHHHHHHH
Query lDNLGP-------SGASRVFNEAVELAP--YTRILFASDAStYPEXYGlaARQFKQALVA  339
ident                  |    |  |      |    | |           |      | 
Sbjct -LRPLLysnpyerANLLRFMMKAWKLVEkyKVRRFLTSSAQ-EKWDVR-yPRDLISLGVV  181
DSSP  -LHHHHhllhhhhHHHHHHHHHHHHHHHhhLLLEEEELLLL-LHHHLL-lHHHHHHHHHH


DSSP  HHhllllllhhhhHHHHHHHHLHHHHHHLLlhhhhll
Query HFnqlpfvdlaqkKAWINAICWQTSAKLYHqerelrv  376
ident                   |                  
Sbjct IG---------meIPQAKASISMYPEIILK-------  202
DSSP  LL---------llHHHHHHLLLHHHHHHHL-------


No 51: Query=2qpxA Sbjct=2a3lA Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------LLLL------lhHHHHHLLEEEEEEL---LLLL--L
Query ------------------------GXDD------lsEFVDQVPLLDHHCH---FLID--G   25
ident                                          |   | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnaDKEFlaqksaphRDFYNVRKVDTHVHhsaCMNQkhL  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhHHHHhhhhhlllLLLLLLLEEEEEEElllLLLHhhH


DSSP  LLL-------------------------------------LHHH--------hhhhhlLL
Query KVP-------------------------------------NRDD--------rlaqvsTE   40
ident                                         | |                 
Sbjct LRFiksklrkepdevvifrdgtyltlrevfesldltgydlNVDLldvhadkstfhrfdKF  240
DSSP  HHHhhhhhhllllllleeelleeelhhhhhhhhlllllllLLLLllllllllllllllLL


DSSP  LLllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhHHHHHHHHHHLLEeEEEE
Query ADkdypladtknrlayhgflalakefaldannplaaxndpgyATYNHRIFGHFHFkELLI  100
ident                                                             
Sbjct NL----------kynpcgqsrlreiflkqdnliqgrflgeitKQVFSDLEASKYQ-MAEY  289
DSSP  HH----------hhllllllhhhhhhlllllllllllhhhhhHHHHHHHLLLLLE-EEEE


DSSP  ELL---------lllllllllhHHHHhhhlLLEEEEEEHHH--hhhhhhlLLLLHHHHHH
Query DTG---------fvpddpildlDQTAelvgIPVKAIYRLET--haedfxlEHDNFAAWWQ  149
ident                       |         |     |               |     
Sbjct RISiygrkmsewdqlaswivnnDLYS----ENVVWLIQLPRlyniykdmgIVTSFQNILD  345
DSSP  EEElllllllhhhhhhhhhhllLLLL----LLEEEEEEEELlhhhhllllLLLLLHHHHH


DSSP  HHHHHHH----------llLLLL--LLLEEELhhhhlllllllllhhhhhHHHHHHHhhL
Query AFSNDVK----------qaKAHG--FVGFXSIaayrvglhlepvnvieaaAGFDTWKhsG  197
ident                           |||                          |    
Sbjct NIFIPLFeatvdpdshpqlHVFLkqVVGFDLV----ddeskperrptkhmPTPAQWT--N  399
DSSP  HHLLHHHhhhhlhhhllllHHHHllEEEEEEE----llllllllllllllLLLLLLL--L


DSSP  LLLLLlHHHHHHHHHHHHHHHHHH------LLLEEEEELLLlllllHHHLLHHHHHHHhh
Query EKRLTsKPLIDYXLYHVAPFIIAQ------DXPLQFHVGYGdadtdXYLGNPLLXRDYlk  251
ident            |                     |  | |                     
Sbjct AFNPAfSYYVYYCYANLYVLNKLReskgmtTITLRPHSGEA-----GDIDHLAATFLT--  452
DSSP  LLLLLhHHHHHHHHHHHHHHHHHHllllllLLEELLLLLLL-----LLLHHHHHHHHH--


DSSP  hhhhhlllEEEEELLLLH--hhhHHHHHHLlLEEEELLlHHHHL-----HHHHhhHHHHH
Query aftkkglkVVLLHCYPYH--reaGYLASVFpNLYFDISlLDNLG-----PSGAsrVFNEA  304
ident             |           ||           |                  |   
Sbjct -------cHSIAHGINLRkspvlQYLYYLA-QIGLAMS-PLSNNslfldYHRN--PFPVF  501
DSSP  -------lLLLLLLHHHHhlhhhHHHHHHH-LLLEEEL-HHHHLlllllLLLL--LHHHH


DSSP  LLLLLhhHEELLLLLLLL-hhhhHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHlHH
Query VELAPytRILFASDASTY-pexyGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICwQT  363
ident              |                  |                      |    
Sbjct FLRGL--NVSLSTDDPLQihltkEPLVEEYSIAASVWK---------lSACDLCEIA-RN  549
DSSP  HHLLL--LEEELLLLHHHhllllLHHHHHHHHHHHHHL---------lLHHHHHHHH-HH


DSSP  HHHH-LLLHHHHLL----------------------------------------------
Query SAKL-YHQERELRV----------------------------------------------  376
ident |                                                           
Sbjct SVYQsGFSHALKSHwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkav  609
DSSP  HHHHlLLLHHHHHHhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllll


DSSP  -------
Query -------  376
ident        
Sbjct isdevvp  616
DSSP  lllllll


No 52: Query=2qpxA Sbjct=3au2A Z-score=8.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  -----------------------------------------------lllllhhhhhhll
Query -----------------------------------------------gxddlsefvdqvp   13
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  eeeeeellllllllllhhhhhhhhllllllllLHHHhlLLHHhhHHHHhHHHHLLLLLL-
Query lldhhchflidgkvpnrddrlaqvsteadkdyPLADtkNRLAyhGFLAlAKEFALDANN-   72
ident                                        |    |         |     
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqAAGK--RRPL--GAVL-SLARSLLEAIr  175
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhHLLL--LEEH--HHHH-HHHHHHHHHHh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   72
ident                                                             
Sbjct alpgveraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvf  235
DSSP  lllllleeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   72
ident                                                             
Sbjct lknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriage  295
DSSP  elllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeell


DSSP  -------------------llllllhhhhhhhhhhhhhHLLEEEE-EEEL--LLLLllll
Query -------------------plaaxndpgyatynhrifgHFHFKEL-LIDT--GFVPddpi  110
ident                                           |                 
Sbjct teeevyaalglpwippplredqgeveaalegrlpklleLPQVKGDlQVHStySDGQ-ntl  354
DSSP  lhhhhhhhlllllllhhhlllllhhhhhhlllllllllHHHLLEEeEELLllLLLL-llh


DSSP  LLHHHHHHHHLL-LEEEEEEHHHhHHHHhlllllhhhhhhhHHHHHHLLLLLL-------
Query LDLDQTAELVGI-PVKAIYRLEThAEDFxlehdnfaawwqaFSNDVKQAKAHG-------  162
ident   |   |   |                                                 
Sbjct EELWEAAKTMGYrYLAVTDHSPAvRVAG-----------gpSPEEALKRVGEIrrfneth  403
DSSP  HHHHHHHHHHLLlEEEEEEELHHhHLLL-----------llLHHHHHHHHHHHhhhhhhh


DSSP  -----lLLEEELHhhHLLLLlllllhhhhhhhhhhhhhhlllllllhhhhhhhhhhHHHH
Query -----fVGFXSIAayRVGLHlepvnvieaaagfdtwkhsgekrltskplidyxlyhVAPF  217
ident        |                                                    
Sbjct gppyllAGAEVDI--HPDGT---------------------------------ldyPDWV  428
DSSP  llleeeEEEEEEL--LLLLL---------------------------------lllLHHH


DSSP  HHhHLLLEEEEElllllLLLH--HHLL--HHHHHHHHhhhhhhlLLEEEEELL-------
Query IIaQDXPLQFHVgygdaDTDX--YLGN--PLLXRDYLkaftkkgLKVVLLHCY-------  266
ident            |                  |                || |         
Sbjct LR-ELDLVLVSV---hsRFNLpkADQTkrLLKALENP-------FVHVLAHPTarllgrr  477
DSSP  HL-LLLEEEEEL---llLLLLlhHHHHhhHHHHHLLL-------LLLEELLLLlllllll


DSSP  ----LLHHHHHHHHHHLlLEEEELLLhhHHLHhhHHHHHHHHLLLLlhhHEELLLLLL--
Query ----PYHREAGYLASVFpNLYFDISLldNLGPsgASRVFNEAVELApytRILFASDAS--  320
ident              |         |                 |            |     
Sbjct apieADWEAVFQKAKEK-GVAVEIDG-yYDRMdlPDDLARMAYGMG---LWISLSTDAhq  532
DSSP  llllLLHHHHHHHHHHH-LLEEEEEL-lLLLLllLHHHHHHHHHLL---LLEEEELLLll


DSSP  -LLHHHHHHHHHHHHHHHhhhhhllllllhhhhhhhHHHHHL-----hhHHHHLLlhhhh
Query -TYPEXYGLAARQFKQALvahfnqlpfvdlaqkkawINAICW-----qtSAKLYHqerel  374
ident         ||      |                                           
Sbjct tDHLRFMELAVGTAQRAW-----------------iGPERVLntldyedLLSWLK--arr  573
DSSP  hHHHHHHHHHHHHHHHLL-----------------lLLLLLHhhllhhhHHHHHH--lll


DSSP  ll
Query rv  376
ident   
Sbjct gv  575
DSSP  ll


No 53: Query=2qpxA Sbjct=1m65A Z-score=7.0

back to top
DSSP  lllllhhhhhhlLEEEEEELLllllllllhhhhhhhhlllllllllhhhhlllhhhhhhh
Query gxddlsefvdqvPLLDHHCHFlidgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
ident                | | |                                        
Sbjct ------------YPVDLHMHT---------------------------------------    9
DSSP  ------------LLEELLLLL---------------------------------------


DSSP  hhhhhhllllllllllllhhhhhhhhhhhhhhlleeeeeeelLLLL-llllLLHHHHHHH
Query alakefaldannplaaxndpgyatynhrifghfhfkellidtGFVP-ddpiLDLDQTAEL  119
ident                                                     |    |  
Sbjct -----------------------------------------vASTHaystlSDYIAQAKQ   28
DSSP  -----------------------------------------lLLLLllllhHHHHHHHHH


DSSP  HLLLE-eEEEEHH----HHHHhhhlllllhhhhhhhhhhHHHLLLLL--------llLLE
Query VGIPV-kAIYRLE----THAEdfxlehdnfaawwqafsnDVKQAKAH--------gfVGF  166
ident  ||                                                       | 
Sbjct KGIKLfaITDHGPdmedAPHH-----------------wHFINMRIWprvvdgvgilRGI   71
DSSP  HLLLEeeEEEELLllllLLLL-----------------hHHHHHHHLlleelleeeeEEE


DSSP  EELHhhhLLLLlllllhhhhhhhhhhhhhhlllllllhhhhhhHHHH-HHHHHhhhlLLE
Query XSIAayrVGLHlepvnvieaaagfdtwkhsgekrltskplidyXLYH-VAPFIiaqdXPL  225
ident                                                             
Sbjct EANI---KNVD-----------------------------geiDCSGkMFDSL----DLI   95
DSSP  EEEL---LLLL-----------------------------lllLLLHhHHHHL----LEE


DSSP  EEEellLLLLLLH---HHLL--HHHH-HHHHhhhhhhlllEEEEELL-----LLHHHHHH
Query QFHvgyGDADTDX---YLGN--PLLX-RDYLkaftkkglkVVLLHCY-----PYHREAGY  274
ident                                             |               
Sbjct IAG--fHEPVFAPhdkATNTqaMIATiASGN--------vHIISHPGnpkyeIDVKAVAE  145
DSSP  EEE--lLLLLLLLllhHHHHhhHHHHhHLLL--------lLEELLLLlllllLLHHHHHH


DSSP  HHHHLlLEEEELLlhHHHLhhhHHHHHHHHLLLLLhhHEELLLLlLLLHhhhhhhHHHHH
Query LASVFpNLYFDISllDNLGpsgASRVFNEAVELAPytRILFASDaSTYPexyglaARQFK  334
ident  |         |             |                || |              
Sbjct AAAKH-QVALEIN--NSSN---CREVAAAVRDAGG--WVALGSD-SHTA-ftmgeFEECL  195
DSSP  HHHHH-LLEEEEE--LLLL---HHHHHHHHHHHLL--LEEEELL-LLLH-hhlllLHHHH


DSSP  HHHHHHHhllllllhhhhhhHHHHHHLH---HHHHHLL--------lHHHHll
Query QALVAHFnqlpfvdlaqkkaWINAICWQ---TSAKLYH--------qERELrv  376
ident   | |                   |                         |  
Sbjct KILDAVD------------fPPERILNVsprRLLNFLEsrgmapiaeFADL--  234
DSSP  HHHHHLL------------lLHHHLHHHlhhHHHHHHHhllllllhhHLLL--


No 54: Query=2qpxA Sbjct=3dcpA Z-score=6.1

back to top
DSSP  lllllhhhhhhlLEEEEEELLllllllllhhhhhhhhlllllllllhhhhlllhhhhhhh
Query gxddlsefvdqvPLLDHHCHFlidgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
ident                | | |                                        
Sbjct ------------XKRDGHTHT---------------------------------------    9
DSSP  ------------LLEEEEELL---------------------------------------


DSSP  hhhhhhllllllllllllhhhhhhhhhHHHHHLLEEEEEEELL-----------------
Query alakefaldannplaaxndpgyatynhRIFGHFHFKELLIDTG-----------------  103
ident                                   | |  |                    
Sbjct ------------efcphgthddveexvLKAIELDFDEYSIVEHaplssefxkntagdkea   57
DSSP  ------------llllllllllhhhhhHHHHHLLLLEEEEEEEllllhhhhhllllllhh


DSSP  ------------lllllllLLHHHHHHhhLLLEEEEeehhhhhhhhhlllllhhhhhhhh
Query ------------fvpddpiLDLDQTAElvGIPVKAIyrlethaedfxlehdnfaawwqaf  151
ident                          |                                  
Sbjct vttasxaxsdlpyyfkkxnHIKKKYAS--DLLIHIG------------------------   91
DSSP  hhlllllhhhhhhhhhhhhHHHHHLLL--LLEEEEE------------------------


DSSP  hhhhhlllllllllEEELHhhhlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHH
Query sndvkqakahgfvgFXSIAayrvglhlepvnvieaaagfdtwkhsgekrltskplIDYXL  211
ident               |                                             
Sbjct --------------FEVDY------------------------------------LIGYE  101
DSSP  --------------EEEEL------------------------------------LLLLH


DSSP  HHHHHHHHHHLL---leEEEE----------llLLLL---------------llhHHLL-
Query YHVAPFIIAQDX---plQFHV----------gyGDAD---------------tdxYLGN-  242
ident      |                                                      
Sbjct DFTRDFLNEYGPqtddgVLSLhflegqggfrsiDFSAedynegivqfyggfeqaqLAYLe  161
DSSP  HHHHHHHHHHHHhlleeEEELleeeelleeeelLLLHhhhhhhlhhhhllhhhhhHHHHh


DSSP  -HHHHHhhHHHHhhHLLL-EEEEELLL---------------------lhHHHHHHHHHL
Query -PLLXRdyLKAFtkKGLK-VVLLHCYP---------------------yhREAGYLASVF  279
ident                  |     |                          |    |    
Sbjct gVKQSI--EADL--GLFKpRRXGHISLcqkfqqffgedtsdfseevxekfRVILALVKKR  217
DSSP  hHHHHH--HLLL--LLLLlLEELLLLHhhllhhhhlllhhhllhhhhhhhHHHHHHHHHH


DSSP  LlEEEELLlhHHHLH-------hhHHHHHHHHLLLLLhhHEELLLLLLLLhHHHHHHHHH
Query PnLYFDISllDNLGP-------sgASRVFNEAVELAPytRILFASDASTYpEXYGLAARQ  332
ident      |                         | ||         ||        |     
Sbjct D-YELDFN--TAGLFkplcgetypPKKIVTLASELQI--PFVYGSDSHGV-QDIGRGYST  271
DSSP  L-LEEEEE--LHHHHlllllllllLHHHHHHHHHLLL--LEEEELLLLLH-HHLLLLHHH


DSSP  HHHHHHhhhhllllllhhhhhhhhhhhhlhhhhhhlllhhhhll
Query FKQALVahfnqlpfvdlaqkkawinaicwqtsaklyhqerelrv  376
ident   | |                                       
Sbjct YCQKLE--------------------------------------  277
DSSP  HHHHLL--------------------------------------


No 55: Query=2qpxA Sbjct=3f2bA Z-score=5.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -----------------------------------lllllhhhHHHL-LEEEEEELLlll
Query -----------------------------------gxddlsefVDQV-PLLDHHCHFlid   24
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtAPEGeKRVELHLHT---  117
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllLLLLlLLLLLLLLL---


DSSP  lllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhh
Query gkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaaxndpgyat   84
ident                                                             
Sbjct ------------------------------------------------pmsqmdavtsvt  129
DSSP  ------------------------------------------------llllllllllhh


DSSP  hhhHHHHHLLEEEEEEELLlllllllLLHHHHHHHHLLLEEEEEEHH-------------
Query ynhRIFGHFHFKELLIDTGfvpddpiLDLDQTAELVGIPVKAIYRLE-------------  131
ident                                 |   |  |                    
Sbjct kliEQAKKWGHPAIAVTDH-avvqsfPEAYSAAKKHGMKVIYGLEANivddpfhvtllaq  188
DSSP  hhhHHHHHLLLLLEEELLL-lllllhHHHHHHHHHHLLLEEEEEEEEeellleeeeeeel


DSSP  ----------hHHHHHHLllllhhhhhhhhhhhhhllllllllleeelhhhhllllllll
Query ----------tHAEDFXLehdnfaawwqafsndvkqakahgfvgfxsiaayrvglhlepv  181
ident                                                             
Sbjct netglknlfklVSLSHIQ------------------------------------------  206
DSSP  lhhhhhhhhhhHHHHHLL------------------------------------------


DSSP  lhhhhhhhhhhhhhhlLLLLllhhhhhhHHHHHHHHHhhHLLLEEEEELlllllllhhhL
Query nvieaaagfdtwkhsgEKRLtskplidyXLYHVAPFIiaQDXPLQFHVGygdadtdxylG  241
ident                                                             
Sbjct --------------yfHRVP------riPRSVLVKHR--DGLLVGSGCD--------kgE  236
DSSP  --------------llLLLL------leEHHHHHHLL--LLEEEELLLL--------llL


DSSP  LHHHHHHHHhhhhhhlLLEEEEE----------------lllLHHHHHHHHHHLLlEEEE
Query NPLLXRDYLkaftkkgLKVVLLH----------------cypYHREAGYLASVFPnLYFD  285
ident       |             |                       |    |          
Sbjct LFDNVEDIA------rFYDFLEVhppdvykplyvkdeemiknIIRSIVALGEKLD-IPVV  289
DSSP  LLLLLLLLH------hHLLLEEEllhhhhlllllllhhhhhhHHHHHHHHHHHLL-LLEE


DSSP  LllhhhhlhhhhhhhhhhhlllllhhheelLLLLLLLH----------------------
Query IslldnlgpsgasrvfneavelapytrilfASDASTYP----------------------  323
ident                                                             
Sbjct A-----------------------------TGNVHYLNpedkiyrkilihsqgganplnr  320
DSSP  E-----------------------------LLLLLLLLhhhhhhhhhhhhllhhhlllll


DSSP  -----hHHHHhHHHHHHHHHHHHhllllllhhhhhhhhHHHH--LHHHHHhlLLHH----
Query -----eXYGLaARQFKQALVAHFnqlpfvdlaqkkawiNAIC--WQTSAKlyHQER----  372
ident                                              |  |           
Sbjct helpdvYFRT-TNEMLDCFSFLG----------pekakEIVVdnTQKIAS--LIGDvkpi  367
DSSP  llllllLLLL-HHHHHHHHHHHH----------hhhhhHHHLhhHHHHHH--LLLLllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct kdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylish  427
DSSP  lllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct klvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgf  487
DSSP  hhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct dlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfged  547
DSSP  hllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct nvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivv  607
DSSP  leeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct pdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgi  667
DSSP  lllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct dpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfse  727
DSSP  lhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct lvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesv  787
DSSP  hhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct rkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhplly  847
DSSP  lllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct yasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergf  907
DSSP  hhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  372
ident                                                             
Sbjct sfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgk  967
DSSP  eellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhl


DSSP  -----------------------hhll
Query -----------------------elrv  376
ident                            
Sbjct lsktlleylesrgcldslpdhnqlslf  994
DSSP  llhhhhhhhhhllllllllllllllll


No 56: Query=2qpxA Sbjct=1bksA Z-score=4.9

back to top
DSSP  --lllllhhhhhhlleeeeEELL--lLLLLLllhhhhhhhhlllllllllhhhhlllhhh
Query --gxddlsefvdqvplldhHCHF--lIDGKVpnrddrlaqvsteadkdypladtknrlay   56
ident                             |                               
Sbjct meryenlfaqlndrregafVPFVtlgDPGIE-----------------------------   31
DSSP  lhhhhhhhhhhhhlllleeEEEEellLLLHH-----------------------------


DSSP  hhhhhhhhhhllllllllllllhhhhhhhhhhhhhhlLEEEEEEELL---------llLL
Query hgflalakefaldannplaaxndpgyatynhrifghfHFKELLIDTG---------fvPD  107
ident                                           |                 
Sbjct --------------------------qslkiidtlidAGADALELGVpfsdpladgptIQ   65
DSSP  --------------------------hhhhhhhhhhhLLLLLEEEELlllllllllhhHH


DSSP  LLL-------------llhhhhhhhhllLEEEEEEHHH-HHHHHhlllllhhhhhhHHHH
Query DPI-------------ldldqtaelvgiPVKAIYRLET-HAEDFxlehdnfaawwqAFSN  153
ident                                                             
Sbjct NANlrafaagvtpaqcfemlalirekhpTIPIGLLMYAnLVFNN------------GIDA  113
DSSP  HHHhhhhhhlllhhhhhhhhhhhhhhllLLLEEEEELHhHHHLL------------LHHH


DSSP  HHHLLLLLLLLLEEELHhhhlllllllllhhhhhhhhhhhhhhlllllllhhhhhhHHHH
Query DVKQAKAHGFVGFXSIAayrvglhlepvnvieaaagfdtwkhsgekrltskplidyXLYH  213
ident         |                                                   
Sbjct FYARCEQVGVDSVLVAD-----------------------------------vpveESAP  138
DSSP  HHHHHHHHLLLEEEELL-----------------------------------llhhHLHH


DSSP  HHHHHHHHLLLEEEEELlllllllhhhLLHHH-HHHHHHHHhhhllLEEEEEL-llLHHH
Query VAPFIIAQDXPLQFHVGygdadtdxylGNPLL-XRDYLKAFtkkglKVVLLHC-ypYHRE  271
ident              |              |                            |  
Sbjct FRQAALRHNIAPIFICP----------PNADDdLLRQVASY----gRGYTYLLalpLHHL  184
DSSP  HHHHHHHLLLEEEEEEL----------LLLLHhHHHHHHHH----lLLLEEELlllHHHH


DSSP  HHHHHHHLllEEEELLLHhHHLHHHHHHHHHHHlllllhhhEELLLLLL--LLHH-----
Query AGYLASVFpnLYFDISLLdNLGPSGASRVFNEAvelapytrILFASDAS--TYPE-----  324
ident    |                  |   |                 |   |           
Sbjct IEKLKEYH-aAPALQGFG-ISSPEQVSAAVRAG--------AAGAISGSaiVKIIeknla  234
DSSP  HHHHHHHL-lLLEEELLL-LLLHHHHHHHHHHL--------LLEEEELLhhHHHHhhlll


DSSP  -----------hhhhHHHHHHhhhhhhhhllllllhhhhhhhhhhhhlhhhhhhlllhhh
Query -----------xyglAARQFKqalvahfnqlpfvdlaqkkawinaicwqtsaklyhqere  373
ident                                                             
Sbjct spkqmlaelrsfvsaMKAASR---------------------------------------  255
DSSP  lhhhhhhhhhhhhhhHHHLLL---------------------------------------


DSSP  hll
Query lrv  376
ident    
Sbjct ---  255
DSSP  ---


No 57: Query=2qpxA Sbjct=2yb1A Z-score=4.7

back to top
DSSP  lllllhhhhhhlLEEEEEELLllllllllhhhhhhhhlllllllllhhhhlllhhhhhhh
Query gxddlsefvdqvPLLDHHCHFlidgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
ident                | | |                                        
Sbjct ------------ANIDLHFHS---------------------------------------    9
DSSP  ------------LLEELLLLL---------------------------------------


DSSP  hhhhhhllllllllllllhhhhhhhhhhhhHHLLEEEEEEELLlllllllLLHHHHHHHH
Query alakefaldannplaaxndpgyatynhrifGHFHFKELLIDTGfvpddpiLDLDQTAELV  120
ident                                      |                  |   
Sbjct --------------rtsdgaltptevidraAARAPALLALTDH-dctgglAEAAAAAARR   54
DSSP  --------------llllllllhhhhhhhhHLLLLLEEEELLL-lllllhHHHHHHHHHL


DSSP  LLLEEEEEEHH-------------------------HHHHHHHlllllhhhhhhhhhhhh
Query GIPVKAIYRLE-------------------------THAEDFXlehdnfaawwqafsndv  155
ident |||                                                         
Sbjct GIPFLNGVEVSvswgrhtvhivglgidpaepalaagLKSIREG-----------------   97
DSSP  LLLEEEEEEEEeeelleeeeeeeellllllhhhhhhHHHHHLL-----------------


DSSP  hllllllllleeelhhhhlllllllllhhhhhhhhHHHHHHLL-----------------
Query kqakahgfvgfxsiaayrvglhlepvnvieaaagfDTWKHSGE-----------------  198
ident                                                             
Sbjct ----------------------------------rLERARQMGasleaagiagcfdgamr  123
DSSP  ----------------------------------hHHHHHHHHhhhhhlllllhhhhhhl


DSSP  -------------------------------------lllllHHHHhhHHHHHHHHHHHH
Query -------------------------------------krltsKPLIdyXLYHVAPFIIAQ  221
ident                                                  |      |   
Sbjct wcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQW-aSLEDAVGWIVGA  182
DSSP  llllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLLL-lLHHHHHHHHHHL


DSSP  LLLEE-EEELLllllllHHHLlhhHHHHHHHHHHHHLLLEEEE---ELLL-LHHHHHHHH
Query DXPLQ-FHVGYgdadtdXYLGnplLXRDYLKAFTKKGLKVVLL---HCYP-YHREAGYLA  276
ident        | |          |   |       |   |                      |
Sbjct GGMAViAHPGR------YDMG-rtLIERLILDFQAAGGQGIEVasgSHSLdDMHKFALHA  235
DSSP  LLEEEeLLHHH------LLLL-hhHHHHHHHHHHHLLLLEEEEeelLLLHhHHHHHHHHH


DSSP  HHLLlEEEElllhhhhlhhhhhhhhhhhlllllhhheelLLLLLLLhHHHHhhhhhhhhh
Query SVFPnLYFDislldnlgpsgasrvfneavelapytrilfASDASTYpEXYGlaarqfkqa  336
ident      ||                                 ||     |  |         
Sbjct DRHG-LYAS-----------------------------sGSDFHAPgEDVG---------  256
DSSP  HHHL-LEEE-----------------------------eELLLLLLlLLLL---------


DSSP  hhhhhhllllllhhhhhhhhhhhhlhHHHHHLLL----hhhhll
Query lvahfnqlpfvdlaqkkawinaicwqTSAKLYHQ----erelrv  376
ident                                             
Sbjct ----------------htedlppicrPIWRELEArilrpadaen  284
DSSP  ----------------llllllllllLHHHHLHHhlllllhhhl


No 58: Query=2qpxA Sbjct=3e38A Z-score=4.3

back to top
DSSP  lllllhhHHHH-----LLEEEEEELlllllllllhhhhhhhhlllllllllhhhhlllhh
Query gxddlseFVDQ-----VPLLDHHCHflidgkvpnrddrlaqvsteadkdypladtknrla   55
ident         |           | | |                                   
Sbjct aqrrneiQVPDldgytTLKCDFHXH-----------------------------------   25
DSSP  lllllllLLLLlllleEEEEELLLL-----------------------------------


DSSP  hhhhhhhhhhhllllllllllllhhhhhhhhhHHHHHLLEEEEEEELL--------llll
Query yhgflalakefaldannplaaxndpgyatynhRIFGHFHFKELLIDTG--------fvpd  107
ident                                                             
Sbjct ------------------svfsdglvwptvrvDEAYRDGLDAISLTEHieyrphkqdvvs   67
DSSP  ------------------lllllllllhhhhhHHHHHLLLLEELLEEEllllllllllll


DSSP  lllLLHHHHHHHH---LLLEEEEEEHHhhhhhhhlllllhhhhhhhhhhHHHLlllllll
Query dpiLDLDQTAELV---GIPVKAIYRLEthaedfxlehdnfaawwqafsnDVKQakahgfv  164
ident       |   |     ||                                          
Sbjct dhnRSFDLCREQAeklGILLIKGSEIT------raxapghfnaiflsdsNPLE-------  114
DSSP  lllHHHHHHHHHHhhhLLEELLEEEEE------lllllleeeeelllllHHHL-------


DSSP  leeelhhhhlllllllllhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHHLLL
Query gfxsiaayrvglhlepvnvieaaagfdtwkhsgekrltskplidYXLYHVAPFIIAQDXP  224
ident                                                         |   
Sbjct -------------------------------------------qKDYKDAFREAKKQGAF  131
DSSP  -------------------------------------------lLLHHHHHHHHHHLLLE


DSSP  EEEE-ELLLLllLLHHHLLHHH-HHHHHHHHhhhlLLEEEEE-----lLLLH-HHHHHHH
Query LQFH-VGYGDadTDXYLGNPLL-XRDYLKAFtkkgLKVVLLH-----cYPYH-REAGYLA  276
ident       |                                          |          
Sbjct XFWNhPGWDS--QQPDTTKWWPeHTALYQEG----CXHGIEVanghlyXPEAiQWCLDKN  185
DSSP  EEELlLLLLL--LLLLLLLLLHhHHHHHHLL----LLLEEEEeelleeLLHHhHHHHHHL


DSSP  hhlllEEEElllhhhhlhhhhhhhhhhhlllllhhheeLLLLLLLLHH-------hhHHH
Query svfpnLYFDislldnlgpsgasrvfneavelapytrilFASDASTYPE-------xyGLA  329
ident      |                                  ||                  
Sbjct -----LTXI-----------------------------GTSDIHQPIQtdydfekgeHRT  211
DSSP  -----LEEE-----------------------------EELLLLLLHHhhllhhhllLLL


DSSP  H-----------------------hHHHHHH-----------------------------
Query A-----------------------rQFKQAL-----------------------------  337
ident                           |   |                             
Sbjct XtfvfakerslqgirealdnrrtaaYFHELLigredllrpffekcvkieevsrneqgvtl  271
DSSP  EeeeeellllhhhhhhhhhllleeeEELLEEellhhhhhhhhhhheeeeeeeeelleeee


DSSP  -------HHHH-------------------------------------------------
Query -------VAHF-------------------------------------------------  341
ident                                                             
Sbjct sitnvtdLVLKlkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfiva  331
DSSP  eeeelllLLEEeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeee


DSSP  --hlLLLLLhhhhhhhhhhhhlhhhhhhlllhhhhll
Query --nqLPFVDlaqkkawinaicwqtsaklyhqerelrv  376
ident     |                                
Sbjct pdkgLKYTI--------------------------sl  342
DSSP  lleeEEEEE--------------------------el


No 59: Query=2qpxA Sbjct=2anuA Z-score=3.1

back to top
DSSP  lllllhhhhhhLLEEEEEELL------LLLLllllhhhhhhhhlllllllllhhhhlllh
Query gxddlsefvdqVPLLDHHCHF------LIDGkvpnrddrlaqvsteadkdypladtknrl   54
ident              | | | |       |  |                             
Sbjct ---------teWLLCDFHVHTnxsdghLPLG-----------------------------   22
DSSP  ---------leEEEEEEEELLllllllLLHH-----------------------------


DSSP  hhhhhhhhhhhhllllllllllllhhhhhhhhhhhHHHLlEEEEEEELL-----------
Query ayhgflalakefaldannplaaxndpgyatynhriFGHFhFKELLIDTG-----------  103
ident                                      |       |              
Sbjct -----------------------------evvdlfGKHG-VDVVSITDHivdrrtleqrk   52
DSSP  -----------------------------hhhhhhHHLL-LLEEEEEEEeelhhhhhhhh


DSSP  -----------llllllllLHHHHHHHHL----LLEEEEeehhhhhhhhhlllllhhhhh
Query -----------fvpddpilDLDQTAELVG----IPVKAIyrlethaedfxlehdnfaaww  148
ident                     |                                       
Sbjct rngeplgaitedkfqdylkRLWREQKRAWeeygXILIPG---------------------   91
DSSP  hllllllllllllhhhhhhHHHHHHHHHHhhhlLEEEEE---------------------


DSSP  hhhhhhhhllllllllleEELHhhHLLLllllllhhhhhhhhhhhhhhlllllllhhhhh
Query qafsndvkqakahgfvgfXSIAayRVGLhlepvnvieaaagfdtwkhsgekrltskplid  208
ident                            |                                
Sbjct -----------------vEITN--NTDL--------------------------------  100
DSSP  -----------------eEEEE--LLLL--------------------------------


DSSP  hhhhhhhhhhhhhllleeeeellllllllhhhllhhhhhHHHHHHHHHLL----LEEEEE
Query yxlyhvapfiiaqdxplqfhvgygdadtdxylgnpllxrDYLKAFTKKGL----KVVLLH  264
ident                                                |       |   |
Sbjct ------------------------yhivavdvkeyvdpsLPVEEIVEKLKeqnaLVIAAH  136
DSSP  ------------------------eeeeeelllllllllLLHHHHHHHHHhlllEEEELL


DSSP  LLL-----lhhhhhHHHHHLlLEEEE-LLLHHhhlhhhhhhHHHHHLLLLLhhHEELLLL
Query CYP-----yhreagYLASVFpNLYFD-ISLLDnlgpsgasrVFNEAVELAPytRILFASD  318
ident                                |          ||         |    ||
Sbjct PDRkklswylwanxERFKDT-FDAWEiANRDD---------LFNSVGVKKY--RYVANSD  184
DSSP  LLLlllllhhhhllLLLLLL-LLEEEeEELLE---------ELHHHHHLLL--LEEEELL


DSSP  LLlLHHHhHHHHhhhhhhhhhhhhllllllhhhhhhhhhhHHLHhhhhhlllHHHH----
Query AStYPEXyGLAArqfkqalvahfnqlpfvdlaqkkawinaICWQtsaklyhqEREL----  374
ident                                                             
Sbjct FH-ELWH-VYSW----------------------------KTLV-------kSEKNieai  207
DSSP  LL-LHHH-HLLE----------------------------EEEE-------eELLLhhhh


DSSP  ---------------ll
Query ---------------rv  376
ident                  
Sbjct keairkntdvaiylxrk  224
DSSP  hhhhhhllleeeeelll