Results: dupa

Query: 2pajA

MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2paj-A 77.6  0.0  421   421  100 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   2:  3ls9-A 47.5  2.1  399   453   29 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   3:  1j6p-A 43.7  2.5  375   407   24 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   4:  2uz9-A 40.4  2.4  368   444   21 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   5:  4rdv-B 37.8  2.7  383   451   22 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   6:  2oof-A 35.9  2.9  345   403   17 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   7:  4cqb-A 34.8  2.7  337   402   16 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  1k6w-A 32.6  3.0  334   423   19 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   9:  2vun-A 32.6  3.3  328   385   17 PDB  MOLECULE: ENAMIDASE;                                                 
  10:  3mtw-A 32.5  2.9  338   404   19 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  11:  3mkv-A 32.4  2.7  332   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  12:  4c5y-A 30.4  3.1  345   436   14 PDB  MOLECULE: OCHRATOXINASE;                                             
  13:  3nqb-A 29.4  3.3  329   587   15 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  1onx-A 29.1  3.1  320   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  15:  3icj-A 28.8  2.8  310   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  16:  3giq-A 26.7  3.3  314   475   18 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  17:  1yrr-B 26.4  3.4  304   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  2imr-A 26.0  4.8  298   380   26 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  19:  1gkp-A 25.2  3.5  319   458   18 PDB  MOLECULE: HYDANTOINASE;                                              
  20:  3gri-A 25.2  3.2  309   422   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  2ogj-A 25.0  4.1  314   379   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  3ooq-A 24.5  2.8  277   384   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  23:  3e74-A 24.0  3.6  305   429   15 PDB  MOLECULE: ALLANTOINASE;                                              
  24:  4b3z-D 23.4  3.7  317   477   15 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  25:  1a4m-A 20.2  3.1  252   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  26:  1a5k-C 18.9  3.1  300   566   17 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  27:  1bf6-A 17.3  3.2  225   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  28:  2y1h-B 17.3  2.9  219   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  29:  3k2g-B 17.0  3.1  230   358   16 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  30:  2ob3-A 17.0  3.3  228   329   14 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  31:  3cjp-A 16.2  2.9  205   262   10 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  32:  2vc5-A 16.1  3.9  233   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  3gg7-A 15.9  3.1  207   243   11 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  34:  4dlf-A 15.8  3.4  217   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  35:  4mup-B 15.7  3.0  213   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  36:  2ffi-A 15.6  3.0  211   273   10 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  37:  4hk5-D 15.4  3.4  222   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  38:  4ofc-A 15.0  3.3  213   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  39:  2dvt-A 14.7  3.4  217   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  40:  3irs-A 14.6  3.4  213   281    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  41:  3pnu-A 14.5  3.6  233   338    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  42:  2gwg-A 14.1  3.7  217   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  43:  2a3l-A 14.1  3.8  260   616   14 PDB  MOLECULE: AMP DEAMINASE;                                             
  44:  4qrn-A 14.1  3.4  218   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  45:  1v77-A 13.8  2.8  175   202    6 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  46:  1itq-A 13.7  3.3  224   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  47:  2qpx-A 13.6  3.6  214   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  48:  4dzi-C 12.6  3.5  208   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  1j5s-A 11.9  3.7  224   451    9 PDB  MOLECULE: URONATE ISOMERASE;                                         
  50:  3iac-A 11.9  3.7  225   469    8 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  3qy6-A 11.1  3.2  178   247    9 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  52:  3dcp-A 10.3  3.0  167   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3au2-A  9.9  4.3  188   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3f2b-A  9.4  6.9  183   994   10 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1m65-A  8.9  3.6  177   234    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  8.5  3.9  178   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  6.8  3.3  145   224    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  6.5  4.2  160   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  5.7  4.0  162   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2pajA Sbjct=2pajA Z-score=77.6

back to top
DSSP  LEEEEELLLEELLLLLLLLLLLLLLLLLLEEEELLEEEEELLLLLLLLLEEEELLLLEEE
Query PSTLIRNAAAIMTGGRGTADDPSRVPGPDIRIVGDTIDAIGALAPRPGETIVDATDCVIY   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PSTLIRNAAAIMTGGRGTADDPSRVPGPDIRIVGDTIDAIGALAPRPGETIVDATDCVIY   60
DSSP  LEEEEELLLEELLLLLLLLLLLLLLLLLLEEEELLEEEEELLLLLLLLLEEEELLLLEEE


DSSP  ELEELLLLLHHHHHLLLLLLHHHLLHHHHHHHHHHHHHHHHLLLEEEEEELLLLLLLLLL
Query PAWVNTHHHLFQSLLKGEPFRALFDERRFRLAARIGLIELARSGCATVADHNYVYYPGMP  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PAWVNTHHHLFQSLLKGEPFRALFDERRFRLAARIGLIELARSGCATVADHNYVYYPGMP  120
DSSP  ELEELLLLLHHHHHLLLLLLHHHLLHHHHHHHHHHHHHHHHLLLEEEEEELLLLLLLLLL


DSSP  LLHHHHHHHHHHHLLLEEEEEELLLLLLLLLLLLLLHHHLLLLHHHHHHHHHHHHHHLLL
Query FDSSAILFEEAEKLGLRFVLLRGGATQTRQLEADLPTALRPETLDAYVADIERLAARYHD  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FDSSAILFEEAEKLGLRFVLLRGGATQTRQLEADLPTALRPETLDAYVADIERLAARYHD  180
DSSP  LLHHHHHHHHHHHLLLEEEEEELLLLLLLLLLLLLLHHHLLLLHHHHHHHHHHHHHHLLL


DSSP  LLLLLLEEEEELLLLLLLLLLHHHHHHHHHHHHHLLLEEEEELLLLLHHHHHHHLLLLLL
Query ASPRAMRRVVMAPTTVLYSISPREMRETAAVARRLGLRMHSHLSGKSPVAFCGEHDWLGS  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ASPRAMRRVVMAPTTVLYSISPREMRETAAVARRLGLRMHSHLSGKSPVAFCGEHDWLGS  240
DSSP  LLLLLLEEEEELLLLLLLLLLHHHHHHHHHHHHHLLLEEEEELLLLLHHHHHHHLLLLLL


DSSP  LEEEELLLLLLHHHHHHHHHHLLEEEELHHHHHLLLLLLHHHHLLLEEELLLHHHHLLLL
Query DVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRLPVREMADAGVPVSIGVDGAASNEAA  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRLPVREMADAGVPVSIGVDGAASNEAA  300
DSSP  LEEEELLLLLLHHHHHHHHHHLLEEEELHHHHHLLLLLLHHHHLLLEEELLLHHHHLLLL


DSSP  LHHHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEELLLHH
Query DMISEVHMTWLAQRARLASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRLDDPR  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DMISEVHMTWLAQRARLASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRLDDPR  360
DSSP  LHHHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEELLLHH


DSSP  HLLLLLHHHHHHHLLLLLEEEEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHHHHHHHH
Query YFGLHDPAIGPVASGGRPSVMALFSAGKRVVVDDLIEGVDIKELGGEARRVVRELLREVV  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YFGLHDPAIGPVASGGRPSVMALFSAGKRVVVDDLIEGVDIKELGGEARRVVRELLREVV  420
DSSP  HLLLLLHHHHHHHLLLLLEEEEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHHHHHHHH


DSSP  L
Query V  421
ident |
Sbjct V  421
DSSP  L


No 2: Query=2pajA Sbjct=3ls9A Z-score=47.5

back to top
DSSP  lEEEEELLLEELLLLLllllLLLLLLLLLEEEELLEEEEELL-LLLLLLLEEEELLLLEE
Query pSTLIRNAAAIMTGGRgtadDPSRVPGPDIRIVGDTIDAIGA-LAPRPGETIVDATDCVI   59
ident    |||      |               || | |  | | |  |  |      |      
Sbjct -MILIRGLTRVITFDD----QERELEDADILIDGPKIVAVGKdLSDRSVSRTIDGRGMIA   55
DSSP  -LEEEEEEEEEELLLL----LLLEEEEEEEEEELLEEEEEELlLLLLLLLEEEELLLEEE


DSSP  EELEELLLLLHHHHHLLLL----------------lLHHH------LLHHHHHHHHHHHH
Query YPAWVNTHHHLFQSLLKGE----------------pFRAL------FDERRFRLAARIGL   97
ident  |   | | ||                           |       |     |  ||  |
Sbjct LPGLINSHQHLYEGAMRAIpqlervtmaswlegvltRSAGwwrdgkFGPDVIREVARAVL  115
DSSP  EELEEEEEELHHHHHHLLLhhhllllhhhhhhhhhhHHHHhhhlllLLHHHHHHHHHHHH


DSSP  HHHHLLLEEEEEELLLLLLLLLLLLHHHHHHHHHHHLLLEEEEEELLLLLLLLLlllllh
Query IELARSGCATVADHNYVYYPGMPFDSSAILFEEAEKLGLRFVLLRGGATQTRQLeadlpt  157
ident  |    |  ||||                  | |  || ||   |   |           
Sbjct LESLLGGITTVADQHLFFPGATADSYIDATIEAATDLGIRFHAARSSMTLGKSE-ggfcd  174
DSSP  HHHHHLLEEEEEEEELLLLLLLLLLHHHHHHHHHHHHLLEEEEEELLLLLLHHH-lllll


DSSP  hHLLLLHHHHHHHHHHHHHHLLLLLLLLLEEEEELLLLlLLLLLHHHHHHHHHHHHHLLL
Query aLRPETLDAYVADIERLAARYHDASPRAMRRVVMAPTTvLYSISPREMRETAAVARRLGL  217
ident  |  |  |  |     |   ||   |  | |    |        |      |  |     
Sbjct dLFVEPVDRVVQHCLGLIDQYHEPEPFGMVRIALGPCG-VPYDKPELFEAFAQMAADYDV  233
DSSP  hHHLLLHHHHHHHHHHHHHHHLLLLLLLLEEEEELLLL-LLLLLHHHHHHHHHHHHHHLL


DSSP  EEEEELL------------LLLHHHHHHHLLLLLLLEEEELLLLLLHHHHHHHHHHLLEE
Query RMHSHLS------------GKSPVAFCGEHDWLGSDVWYAHLVKVDADEIALLAQTGTGV  265
ident | | |              |  |  |   | |    || || |     ||   |  |   
Sbjct RLHTHFYepldagmsdhlyGMTPWRFLEKHGWASDRVWLAHAVVPPREEIPEFADAGVAI  293
DSSP  EEEEEELlllhhhhhhhhhLLLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEE


DSSP  EELHHHHHLL-----LLLLHHHHLLLEEELLLHHHHLLLLLHHHHHHHHHHHHHHLL---
Query AHCPQSNGRL-----PVREMADAGVPVSIGVDGAASNEAADMISEVHMTWLAQRARL---  317
ident ||      |      | ||  |||  |  |  | |||             || |      
Sbjct AHLIAPDLRMgwglaPIREYLDAGITVGFGTTGSASNDGGNLLGDLRLAALAHRPADpne  353
DSSP  EELHHHHHHLlllllLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHLHHHLlll


DSSP  ----LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHH
Query ----ASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRLDDPRYFGLHDPAIGPVA  373
ident      |  |     | | |   |    |    | |||||  |||     | ||||||   
Sbjct pekwLSARELLRMATRGSAECLGRPDLGVLEEGRAADIACWRLDGVDRVGVHDPAIGLIM  413
DSSP  hhhlLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHH


DSSP  LLLLLEEEEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHhhhhhhhl
Query SGGRPSVMALFSAGKRVVVDDLIEGVDIKELGGEARRVVRellrevvv  421
ident  |           |   |        |                     
Sbjct TGLSDRASLVVVNGQVLVENERPVLADLERIVANTTALIP--------  453
DSSP  LLLLLLLLEEEELLEEEEELLEELLLLHHHHHHHHHHHLL--------


No 3: Query=2pajA Sbjct=1j6pA Z-score=43.7

back to top
DSSP  LEEEEELLlEELLLLllllllLLLLLLLLEEEELLEEEEEL-LLLLlllleEEELLLLEE
Query PSTLIRNAaAIMTGGrgtaddPSRVPGPDIRIVGDTIDAIG-ALAPrpgetIVDATDCVI   59
ident     | |   |           |        |   ||                |      
Sbjct HHXIIGNC-LILKDF------SSEPFWGAVEIENGTIKRVLqGEVK----vDLDLSGKLV   49
DSSP  LEEEEEEE-EELLLL------LLLLEEEEEEEELLEEEEEEeLLLL----lLEELLLEEE


DSSP  EELEELLLLLHHHHHLLLLL---------------LHHHLLHHHHHHHHHHHHHHHHLLL
Query YPAWVNTHHHLFQSLLKGEP---------------FRALFDERRFRLAARIGLIELARSG  104
ident  ||  ||| |    || |                       |            | || |
Sbjct XPALFNTHTHAPXTLLRGVAedlsfeewlfskvlpIEDRLTEKXAYYGTILAQXEXARHG  109
DSSP  EELEEEEEELHHHHHHLLLLllllhhhhhhllhhhHHLLLLHHHHHHHHHHHHHHHHLLL


DSSP  EEEEEELLLlllllllllHHHHHHHHHHHLLLEEEEEELLLLLlllllllllhhhlllLH
Query CATVADHNYvyypgmpfdSSAILFEEAEKLGLRFVLLRGGATQtrqleadlptalrpeTL  164
ident  |   |                        | |  | ||                     
Sbjct IAGFVDXYF---------HEEWIAKAVRDFGXRALLTRGLVDS-------------ngDD  147
DSSP  EEEEEEEEL---------LHHHHHHHHHHHLLEEEEEEEELLL-------------llLL


DSSP  HHHHHHHHHHHHHLLLLLllLLEEEEELLLLlLLLLLHHHHHHHHHHHHHLLLEEEEELL
Query DAYVADIERLAARYHDASprAMRRVVMAPTTvLYSISPREMRETAAVARRLGLRMHSHLS  224
ident          |              |   |    |  |          |  |      || 
Sbjct GGRLEENLKLYNEWNGFE--GRIFVGFGPHS-PYLCSEEYLKRVFDTAKSLNAPVTIHLY  204
DSSP  LLHHHHHHHHHHHHLLHH--HLEEEEEEELL-LLLLLHHHHHHHHHHHHHHLLLEEEEEL


DSSP  -----LLLHhHHHHHLLLLLLLEEEELLLLLLHHHHHHHHHHLLEEEELHHHHHLL----
Query -----GKSPvAFCGEHDWLGSDVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRL----  275
ident                          || |         |      | | | ||  |    
Sbjct etskeEYDL-EDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLgngi  263
DSSP  lllllLLLL-HHHHLLLLLLLLEEEEELLLLLHHHHHHHLLLLEEEEELHHHHHHLllll


DSSP  -LLLLHHHHLLLEEELLLHHHHLLLLLHHHHHHHHHHHHHHLL---LLHHHHHHHHLHHH
Query -PVREMADAGVPVSIGVDGAASNEAADMISEVHMTWLAQRARL---ASIAEVIHWGTAGG  331
ident  ||      |  |  | ||||||       |     | | |               |  |
Sbjct aPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASLLQKAQNprnLDVNTCLKXVTYDG  323
DSSP  lLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHHHLLLlllLLHHHHHHHHLHHH


DSSP  HHHHLLlLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHHLLLLLeEEEEEELLEEEE
Query ARVMGLdEVGKVAVGYAADIAVYRLDDPRYFGLHDPAIGPVASGGRPsVMALFSAGKRVV  391
ident |   |    ||   |  ||  |  || |  |         |       | |   |||   
Sbjct AQAXGF-KSGKIEEGWNADLVVIDLDLPEXFPVQNIKNHLVHAFSGE-VFATXVAGKWIY  381
DSSP  HHHHLL-LLLLLLLLLLLLEEEEELLLHHHLLHHHHHHHHHHLLLLL-LLEEEELLEEEE


DSSP  ELLLLLLLLHHHHHHHHHHHHHHHHHhhhl
Query VDDLIEGVDIKELGGEARRVVRELLRevvv  421
ident  |      |  |   |  |   ||      
Sbjct FDGEYPTIDSEEVKRELARIEKELYS----  407
DSSP  ELLLLLLLLHHHHHHHHHHHHHHHHL----


No 4: Query=2pajA Sbjct=2uz9A Z-score=40.4

back to top
DSSP  -LEEEEELLleELLLLLLlllLLLLLLL-LLEEEE-LLEEEEELLLL----------LLL
Query -PSTLIRNAaaIMTGGRGtadDPSRVPG-PDIRIV-GDTIDAIGALA----------PRP   47
ident       |               |  |             |                   |
Sbjct pLAHIFRGT--FVHSTWT---CPMEVLRdHLLGVSdSGKIVFLEEASqqeklakewcFKP   55
DSSP  lLLEEEEEE--EEELLLL---LLLEEEEeEEEEELlLLLEEEEEEHHhhhhhhhhhlLLH


DSSP  LLeEEELL-LLEEEELEELLLLLHHHHHLLLLL---------------LHHHL-LHHHHH
Query GEtIVDAT-DCVIYPAWVNTHHHLFQSLLKGEP---------------FRALF-DERRFR   90
ident  | |          |  | || |  |    |                     |       
Sbjct CE-IRELShHEFFMPGLVDTHIHASQYSFAGSSidlpllewltkytfpAEHRFqNIDFAE  114
DSSP  HH-EEELLlLLEEEELEEEEEEEHHHHHHLLLLllllhhhhhhhlhhhHHHHHhLHHHHH


DSSP  HHHHHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHHLLLEEEEEELLLLLLLL
Query LAARIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEKLGLRFVLLRGGATQTRQ  150
ident              |  |              |||  |     | | |             
Sbjct EVYTRVVRRTLKNGTTTACYFATIH-----tDSSLLLADITDKFGQRAFVGKVCMDLNDT  169
DSSP  HHHHHHHHHHHHLLEEEEEEELLLL-----hHHHHHHHHHHHHHLLEEEEELEELLLLLL


DSSP  LLllllhhHLLLLHHHHHHHHHHHHHHLLlllllLLEEEEELLLLlLLLLLHHHHHHHHH
Query LEadlptaLRPETLDAYVADIERLAARYHdasprAMRRVVMAPTTvLYSISPREMRETAA  210
ident            ||        ||                   |     | |   | |   
Sbjct FP------EYKETTEESIKETERFVSEML-qknySRVKPIVTPRF-SLSCSETLMGELGN  221
DSSP  LL------LLLLLHHHHHHHHHHHHHHHH-hhllLLEEEEEEELL-HHHLLHHHHHHHHH


DSSP  HHHHLLLEEEEELL---------------LLLHHHHHHHLLLLLLLEEEELLLLLLHHHH
Query VARRLGLRMHSHLS---------------GKSPVAFCGEHDWLGSDVWYAHLVKVDADEI  255
ident  |    |   || |                |           |      ||     | | 
Sbjct IAKTRDLHIQSHISenrdeveavknlypsYKNYTSVYDKNNLLTNKTVMAHGCYLSAEEL  281
DSSP  HHHHHLLEEEEEELllhhhhhhhhhhlllLLLHHHHHHHLLLLLLLEEEEELLLLLHHHH


DSSP  HHHHHHLLEEEELHHHHHLL-----LLLLHHHHLLLEEELLLHHhHLLLLLHHHHHHHHH
Query ALLAQTGTGVAHCPQSNGRL-----PVREMADAGVPVSIGVDGAaSNEAADMISEVHMTW  310
ident       |   |||| ||  |      | |     |    | | |       |        
Sbjct NVFHERGASIAHCPNSNLSLssgflNVLEVLKHEVKIGLGTDVA-GGYSYSMLDAIRRAV  340
DSSP  HHHHHHLLEEEELHHHHHHLlllllLHHHHHHLLLEEEELLLLL-LLLLLLHHHHHHHHH


DSSP  HHHHHLL--------LLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELLL--H
Query LAQRARL--------ASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIAVYRLDD--P  359
ident       |            ||    | ||    ||| | |   ||   |           
Sbjct MVSNILLinkvneksLTLKEVFRLATLGGSQALGLDgEIGNFEVGKEFDAILINPKAsdS  400
DSSP  HHHHHHHhlllllllLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELLLLllL


DSSP  HHLL---------lLLHHHHHHHLLLLLEEEEEEELLEEEeelLLLLlllhhhhhhhhhh
Query RYFG---------lHDPAIGPVASGGRPSVMALFSAGKRVvvdDLIEgvdikelggearr  410
ident                         |           || |                    
Sbjct PIDLfygdffgdisEAVIQKFLYLGDDRNIEEVYVGGKQV---VPFS-------------  444
DSSP  LLLLllhhhhllllLHHHHHHHHHLLHHHEEEEEELLEEE---ELLL-------------


DSSP  hhhhhhhhhhl
Query vvrellrevvv  421
ident            
Sbjct -----------  444
DSSP  -----------


No 5: Query=2pajA Sbjct=4rdvB Z-score=37.8

back to top
DSSP  leEEEElLLEELLlllllllLLLLLLLLLEEEEL-LEEEEEL--LLLLLllleEEELlLL
Query psTLIRnAAAIMTggrgtadDPSRVPGPDIRIVG-DTIDAIG--ALAPRpgetIVDAtDC   57
ident     |  |                       |        |   | |             
Sbjct --SAIF-AERALL-------PEGWARNVRFEISAdGVLAEIRpdANADG----AERL-GG   45
DSSP  --LEEE-EEEEEE-------LLEEEEEEEEEELLlLLEEEEEllLLLLL----LEEL-LL


DSSP  EEEELEELLLLLHHHHHLLLLL-------------------LHHHLLHHHHHHHHHHHHH
Query VIYPAWVNTHHHLFQSLLKGEP-------------------FRALFDERRFRLAARIGLI   98
ident    |   | | | ||    |                       |          |    |
Sbjct AVLPGMPNLHSHAFQRAMAGLAevagnpndsfwtwrelmyrMVARLSPEQIEVIACQLYI  105
DSSP  LEEELEEEEEELHHHHHHLLLLlllllllllhhhhhhhhhhHHLLLLHHHHHHHHHHHHH


DSSP  HHHLLLEEEEEELLLLLL---LLLL---lLHHHHHHHHHHHLLLEEEEEELLLLLL----
Query ELARSGCATVADHNYVYY---PGMP---fDSSAILFEEAEKLGLRFVLLRGGATQT----  148
ident |    |   ||   ||               |      |   |    ||           
Sbjct EMLKAGYTAVAEFHYVHHdldGRSYadpaELSLRISRAASAAGIGLTLLPVLYSHAgfgg  165
DSSP  HHHHHLEEEEEEEELLLLlllLLLLllllHHHHHHHHHHHHHLLEEEEEELLLLEEelll


DSSP  -LLLLlllLHHHLLLLHHHHHHHHHHHHHHLLLlllllLEEEEELLLLlLLLLLHHHHHH
Query -RQLEadlPTALRPETLDAYVADIERLAARYHDaspraMRRVVMAPTTvLYSISPREMRE  207
ident     |             ||     || |                    |    |     
Sbjct qPASE---GQRRFINGSEAYLELLQRLRAPLEA----aGHSLGLCFHS-LRAVTPQQIAT  217
DSSP  eELLH---HHLLLLLLHHHHHHHHHHHHHHHHH----hLLEELEEELL-LLLLLHHHHHH


DSSP  HH-HHHHhlLLEEEEELL-------------LLLHHHHHHHLLLLLLLEEEELLLLLLHH
Query TA-AVARrlGLRMHSHLS-------------GKSPVAFCGEHDWLGSDVWYAHLVKVDAD  253
ident    |      |  | |               |  |     |           |    |  
Sbjct VLaAGHD--DLPVHIHIAeqqkevddcqawsGRRPLQWLYENVAVDQRWCLVHATHADPA  275
DSSP  HHlLLLL--LLLEEEEELllhhhhhhhhhhhLLLHHHHHHHHLLLLLLEEEEELLLLLHH


DSSP  HHHHHHHHLLEEEELHHHHHLL-----LLLLHHHHLLLEEELLLHHhhlLLLLHHHHHHH
Query EIALLAQTGTGVAHCPQSNGRL-----PVREMADAGVPVSIGVDGAasnEAADMISEVHM  308
ident | |  |  |     |      |     |       |    || |            |   
Sbjct EVAAMARSGAVAGLCLSTEANLgdgifPATDFLAQGGRLGIGSDSH---VSLSVVEELRW  332
DSSP  HHHHHHHHLLEEEELHHHHHHLlllllLHHHHHHLLLEEEELLLLL---LLLLHHHHHHH


DSSP  HHHHHH-----HLLL-------LHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEEEEEL
Query TWLAQR-----ARLA-------SIAEVIHWGTAGGARVMGLdEVGKVAVGYAADIAVYRL  356
ident     ||                          ||||   |    |  |||  ||  |   
Sbjct LEYGQRlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDG  391
DSSP  HHHHHHhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELL


DSSP  LLHHHLLLL--LHHHHHHHLLLLLEEEEEEELLEEEEELLLLLLLLhhHHHHHHHHHHHH
Query DDPRYFGLH--DPAIGPVASGGRPSVMALFSAGKRVVVDDLIEGVDikELGGEARRVVRE  414
ident  ||                 ||   |     ||  || |    |            |  |
Sbjct NDPYLASAEgdALLNRWLFAGGDRQVRDVMVAGRWVVRDGRHAGEE--RSARAFVQVLGE  449
DSSP  LLHHHHLLLlhHHHHHHHHHLLHHHEEEEEELLEEEELLLLLLLHH--HHHHHHHHHHHH


DSSP  HHhhhhl
Query LLrevvv  421
ident ||     
Sbjct LL-----  451
DSSP  HL-----


No 6: Query=2pajA Sbjct=2oofA Z-score=35.9

back to top
DSSP  --LEEEEELLlEELLLLLlllLLLL-LLLL-LLEEEELLEEEEELLL--LLLLLLeEEEL
Query --PSTLIRNAaAIMTGGRgtaDDPS-RVPG-PDIRIVGDTIDAIGAL--APRPGEtIVDA   54
ident         |     |      |                  | |         |     | 
Sbjct lnCERVWLNV-TPATLRS---DLADyGLLEpHALGVHEGRIHALVPXqdLKYPAH-WQDX   55
DSSP  llLLEEEEEE-EELLLLL---LLLLlLLLLlEEEEEELLEEEEEEEHhhLLLLLL-LEEL


DSSP  LLLEEEELEELLLLLHHHhHLLLL--------------------------lLHHHLLHHH
Query TDCVIYPAWVNTHHHLFQsLLKGE--------------------------pFRALFDERR   88
ident       |     | ||                                         |  
Sbjct KGKLVTPGLIDCHTHLIF-AGSRAeefelrqkgvpyaeiarkgggiistvrATRAASEDQ  114
DSSP  LLLEEEELEEEEEELLLL-LLLLHhhhhhhhhlllhhhhhhllllhhhhhhHHHHLLHHH


DSSP  HHHHHHHHHHHHHLLLEEEEEELLLLLLLLL-llLHHHHHHHHHHHLLLEEEEEELL--L
Query FRLAARIGLIELARSGCATVADHNYVYYPGM-pfDSSAILFEEAEKLGLRFVLLRGG--A  145
ident     |      | | |  ||                        | |  |         |
Sbjct LFELALPRVKSLIREGVTTVEIKSGYGLTLEdelKXLRVARRLGEALPIRVKTTLLAahA  174
DSSP  HHHHHHHHHHHHHHHLEEEEEEELLLLLLHHhhhHHHHHHHHHHHHLLLEEEEEEEEelL


DSSP  LLL-LLLLllllhhhlllLHHHHH-HHHHHHHHHLLllllllleeEEELlLLLL-LLLLH
Query TQT-RQLEadlptalrpeTLDAYV-ADIERLAARYHdaspramrrVVMApTTVL-YSISP  202
ident                            |   |                          | 
Sbjct VPPeYRDD-------pdsWVETICqEIIPAAAEAGL--------aDAVD-VFCEhIGFSL  218
DSSP  LLHhHLLL-------hhhHHHHHHhLHHHHHHHLLL--------lLEEE-EEELlLLLLH


DSSP  HHHHHHHHHHHHLLLEEEEELLlllHHHHHhhlLLLL-LLEEEELLLLLLHHHHHHHHHH
Query REMRETAAVARRLGLRMHSHLSgksPVAFCgehDWLG-SDVWYAHLVKVDADEIALLAQT  261
ident          |   ||    |                        ||   |   |  ||  
Sbjct AQTEQVYLAADQYGLAVKGHXD-qlSNLGG-stLAANfGALSVDHLEYLDPEGIQALAHR  276
DSSP  HHHHHHHHHHHHLLLEEEEEEL-llLLLLH-hhHHHHlLLLEEEELLLLLHHHHHHHHHH


DSSP  LLEEEELHHHHHLL------LLLLHHHHLLLEEELLLHHH-HLLLLLHHHHHHHHHHHHH
Query GTGVAHCPQSNGRL------PVREMADAGVPVSIGVDGAA-SNEAADMISEVHMTWLAQR  314
ident |      |     |      ||     ||||     |                       
Sbjct GVVATLLPTAFYFLketklpPVVALRKAGVPXAVSSDINPgTAPIVSLRXAXNXACTLFG  336
DSSP  LLEEEELHHHHHHLllllllLHHHHHHLLLLEEELLLLLLlLLLLLLHHHHHHHHHHHHL


DSSP  hllLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELllhhhllllLHHHHHHH
Query arlASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIAVYRLddpryfglhDPAIGPVA  373
ident        |     |   ||  |     |   ||  ||  |                    
Sbjct ---LTPVEAXAGVTRHAARALGEQeQLGQLRVGXLADFLVWNC---------GHPAELSY  384
DSSP  ---LLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL---------LLLLHHHH


DSSP  LLLLLEEEEEEELLEEEEEllllllllhhhhhhhhhhhhhhhhhhhhl
Query SGGRPSVMALFSAGKRVVVddliegvdikelggearrvvrellrevvv  421
ident   |          |                                  
Sbjct LIGVDQLVSRVVNGEETLH-----------------------------  403
DSSP  LLLLLLEEEEEELLEELLL-----------------------------


No 7: Query=2pajA Sbjct=4cqbA Z-score=34.8

back to top
DSSP  ---LEEEEELLlEELLllllllllllLLLLLLEEEELLEEEEEL-LLLLLllLEEEELLL
Query ---PSTLIRNAaAIMTggrgtaddpsRVPGPDIRIVGDTIDAIG-ALAPRpgETIVDATD   56
ident        ||||                    || |||| |  |             ||  
Sbjct skdFDLIIRNA-YLSE----------KDSVYDIGIVGDRIIKIEaKIEGT-vKDEIDAKG   48
DSSP  lllEEEEEEEE-EELL----------LLEEEEEEEELLEEEEEElLLLLL-eEEEEELLL


DSSP  LEEEELEELLLLLHHHHHLLL---------------------llLHHHLLHHHHHHHHHH
Query CVIYPAWVNTHHHLFQSLLKG---------------------epFRALFDERRFRLAARI   95
ident     |  |  | |   |                                           
Sbjct NLVSPGFVDAHTHMDKSFTSTgerlpkfwsrpytrdaaiedglkYYKNATHEEIKRHVIE  108
DSSP  LLEEELEEEEEELHHHLLLLLlllllllllllllhhhhhhhhhhHHHHLLHHHHHHHHHH


DSSP  HHHHHHLLLEEEEEELLLlLLLLL---llLHHHHHHHHHHhLLLEEEEEELL--LLLLll
Query GLIELARSGCATVADHNYvYYPGM---pfDSSAILFEEAEkLGLRFVLLRGG--ATQTrq  150
ident         |      |                    ||                      
Sbjct HAHMQVLHGTLYTRTHVD-VDSVAktkavEAVLEAKEELK-DLIDIQVVAFAqsGFFV--  164
DSSP  HHHHHHHLLEEEEEEEEE-LLLLLllhhhHHHHHHHHHLL-LLLEEEEEEELllLLLL--


DSSP  llllllhhhLLLLHHHHHHHHHHHHhhllllllllleeEEELlLLLL--LLLL-HHHHHH
Query leadlptalRPETLDAYVADIERLAaryhdaspramrrVVMApTTVL--YSIS-PREMRE  207
ident            |                                                
Sbjct ---------DLESESLIRKSLDMGC-------------DLVG-GVDPatRENNvEGSLDL  201
DSSP  ---------LLLHHHHHHHHHHHLL-------------LEEE-LLLLllLLLLhHHHHHH


DSSP  HHHHHHHLLLEEEEELL-----llLHHHHHHHLL---lLLLLEEEELLLLL-------LH
Query TAAVARRLGLRMHSHLS-----gkSPVAFCGEHD---wLGSDVWYAHLVKV-------DA  252
ident     |         |                           |   |             
Sbjct CFKLAKEYDVDIDYHIHdigtvgvYSINRLAQKTiengYKGRVTTSHAWCFadapsewLD  261
DSSP  HHHHHHHLLLEEEEEELllhhhhhHHHHHHHHHHhhllLLLLEEEEELLHHhhllhhhHH


DSSP  HHHHHHHHHLLEEEELHHHHH-llLLLLHHHHLLLEEELLLHHH---HLLLLL-HHHHHH
Query DEIALLAQTGTGVAHCPQSNG-rlPVREMADAGVPVSIGVDGAA---SNEAAD-MISEVH  307
ident   | |    |     |  |     ||     ||       |             |     
Sbjct EAIPLYKDSGMKFVTCFSSTPptmPVIKLLEAGINLGCASDNIRdfwVPFGNGdMVQGAL  321
DSSP  HHHHHHHHHLLEEEEELLLLLlllLHHHHHHLLLEEEEELLLLLlllLLLLLLlHHHHHH


DSSP  HHHHHHHHLL-LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEELllhhhlllll
Query MTWLAQRARL-ASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRLddpryfglhd  366
ident                      |  |||| |        ||  ||  |             
Sbjct IETQRLELKTnRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNS----------  371
DSSP  HHHHHHLLLLhHHHHHHHHHHLHHHHHHHLLHHHLLLLLLLLLLEEEELL----------


DSSP  HHHH-HHHLLllLEEEEEEELLEEEEELLLLLLllhhhhhhhhhhhhhhhhhhhhl
Query PAIG-PVASGgrPSVMALFSAGKRVVVDDLIEGvdikelggearrvvrellrevvv  421
ident                      |   | |  |                         
Sbjct LSPQwAIIDQ--AKRLCVIKNGRIIVKDEVIVA-----------------------  402
DSSP  LLHHhHHHHL--LLEEEEEELLEEEEELLEELL-----------------------


No 8: Query=2pajA Sbjct=1k6wA Z-score=32.6

back to top
DSSP  LEEEEELlLEELlllllllllllLLLL-LLEEEELLEEEEELL----LLLLllLEEEELL
Query PSTLIRNaAAIMtggrgtaddpsRVPG-PDIRIVGDTIDAIGA----LAPRpgETIVDAT   55
ident     | | |                 |   |      | || |          |   || 
Sbjct ALQTIIN-ARLP-----------GEEGlWQIHLQDGKISAIDAqsgvMPIT--ENSLDAE   46
DSSP  LLLEEEE-ELLL-----------LLLLeEEEEEELLEEEEEEEelllLLLL--LLEEELL


DSSP  LLEEEELEELLLLLHHHHHLLL-----------------llLHHHLLHHHHHHHHHHHHH
Query DCVIYPAWVNTHHHLFQSLLKG-----------------epFRALFDERRFRLAARIGLI   98
ident      |  |  | ||      |                     ||         |   | 
Sbjct QGLVIPPFVEPHIHLDTTQTAGqpnwnqsgtlfegierwaeRKALLTHDDVKQRAWQTLK  106
DSSP  LLEEELLEEEEEELLLLLLLLLlllllllllhhhhhhhhhlLHHHLLHHHHHHHHHHHHH


DSSP  HHHLLLEEEEEELLLLLLLLLL-lLHHHHHHHHHHhLLLEEEEEELL--LLLLlllllll
Query ELARSGCATVADHNYVYYPGMP-fDSSAILFEEAEkLGLRFVLLRGG--ATQTrqleadl  155
ident      |   |  |  |                |                           
Sbjct WQIANGIQHVRTHVDVSDATLTalKAMLEVKQEVA-PWIDLQIVAFPqeGILS-------  158
DSSP  HHHHLLEEEEEEEEELLLLLLHhhHHHHHHHHHHL-LLLEEEEEEELllLLLL-------


DSSP  lhhhlLLLH-HHHHHHHHHHHhhllllllllleeEEELLlLLLLL----lLHHHHHHHHH
Query ptalrPETL-DAYVADIERLAaryhdaspramrrVVMAPtTVLYS----iSPREMRETAA  210
ident                     |              |                     | |
Sbjct -----YPNGeALLEEALRLGA-------------DVVGA-IPHFEftreyGVESLHKTFA  199
DSSP  -----LLLHhHHHHHHHHLLL-------------LEEEE-LHHHLllhhhHHHHHHHHHH


DSSP  HHHHLLLEEEEELL----LLLH-HHHHHhLLLL----LLLEEEELLLLL-------LHHH
Query VARRLGLRMHSHLS----GKSP-VAFCGeHDWL----GSDVWYAHLVKV-------DADE  254
ident  |         |        |  |             |  |   |               
Sbjct LAQKYDRLIDVHCDeiddEQSRfVETVA-ALAHhegmGARVTASHTTAMhsyngayTSRL  258
DSSP  HHHHHLLEEEEEELllllLLLLhHHHHH-HHHHhhllHHHEEEEELHHHhhllhhhHHHH


DSSP  HHHHHHHLLEEEELHHHHHLL--------------LLLLHHHHLLLEEELLLHHH---HL
Query IALLAQTGTGVAHCPQSNGRL--------------PVREMADAGVPVSIGVDGAA---SN  297
ident   ||   |      |  |  |               | ||   |  |  | |        
Sbjct FRLLKMSGINFVANPLVNIHLqgrfdtypkrrgitRVKEMLESGINVCFGHDDVFdpwYP  318
DSSP  HHHHHHHLLEEEELHHHHHHHllllllllllllllLHHHHHHLLLLEEELLLLLLlllLL


DSSP  LL-LLHHHHHHHHHHHHHHLL--LLHHhHHHHHLHHHHHHHLLLLLlLLLLLLLLLEEEE
Query EA-ADMISEVHMTWLAQRARL--ASIAeVIHWGTAGGARVMGLDEVgKVAVGYAADIAVY  354
ident    | |    ||                     |   ||   |      | |  |     
Sbjct LGtANMLQVLHMGLHVCQLMGygQIND-GLNLITHHSARTLNLQDY-GIAAGNSANLIIL  376
DSSP  LLlLLHHHHHHHHHHHLLLLLhhHHHH-HHHHHLHHHHHHLLLLLL-LLLLLLLLLEEEE


DSSP  ELllhhhlllllHHHH-HHHLLllLEEEEEEELLEEEEELLllllllhhhhhhhhhhhhh
Query RLddpryfglhdPAIG-PVASGgrPSVMALFSAGKRVVVDDliegvdikelggearrvvr  413
ident                           |      ||                         
Sbjct PA----------ENGFdALRRQ--VPVRYSVRGGKVIASTQ---------paqttvyleq  415
DSSP  LL----------LLHHhHHHHL--LLLLEEEELLEEEEELL---------llleeeelll


DSSP  hhhhhhhl
Query ellrevvv  421
ident         
Sbjct peaidykr  423
DSSP  eeeellll


No 9: Query=2pajA Sbjct=2vunA Z-score=32.6

back to top
DSSP  LEEEEELLLEELLLLLLllllLLLLLLLLEEEELLEEEEELL--LLLL-LLLEEEELLLL
Query PSTLIRNAAAIMTGGRGtaddPSRVPGPDIRIVGDTIDAIGA--LAPR-PGETIVDATDC   57
ident   | | |   |  |               |      | |||   |       || ||   
Sbjct SKTIIKNIGKIVSGDIK----SPVLQADTIVVEDGLIAAIGGeeLMKDaGDATIIDAAGS   56
DSSP  LEEEEELLLEEELLLLL----LLEELLLEEEEELLEEEEEELhhHHLLlLLLEEEELLLL


DSSP  EEEELEELLLLLHH---hHHLLLlllhhhllhhhhhhhhhHHHHHHHLLLEEEEEELLLL
Query VIYPAWVNTHHHLF---qSLLKGepfralfderrfrlaarIGLIELARSGCATVADHNYV  114
ident    |    || |                                     |  |       
Sbjct TVTPGLLDTHVHVSggdyAPRQK---------------tmDFISSALHGGVTTMISAGSP  101
DSSP  EEEELEEEEEELLLllleEHHHL---------------eeLHHHHHHLLLEEEEEELLLL


DSSP  ----LLLL------lllLHHHHHHHHHHhLLLEEEE-EELLLlllllllllllhhhllLL
Query ----YYPG------mpfDSSAILFEEAEkLGLRFVL-LRGGAtqtrqleadlptalrpET  163
ident                    |          |                             
Sbjct hfpgRPKDaagtkalaiTLSKSYYNARP-AGVKVHGgAVILE----------------KG  144
DSSP  llllLLLLhhhhhhhhhHHHHHHHHLLH-HHLEEELlEELLL----------------LL


DSSP  HHhhHHHHHHHHHHLLllllllleeEEELLLLLlLLLLHHHHHHHHHHHHHLLLEEEEEL
Query LDayVADIERLAARYHdaspramrrVVMAPTTVlYSISPREMRETAAVARRLGLRMHSHL  223
ident |     |                               |         |   |     | 
Sbjct LT--EEDFIEMKKEGV---------WIVGEVGLgTIKNPEDAAPMVEWAHKHGFKVQMHT  193
DSSP  LL--HHHHHHHHHLLL---------LEEEEELLlLLLLHHHHHHHHHHHHHLLLEEEEEL


DSSP  L------LLLHHHHHHHLLLlllLEEEELLL----LLLHHHHHHHHH-HLLEEEELhHHH
Query S------GKSPVAFCGEHDWlgsDVWYAHLV----KVDADEIALLAQ-TGTGVAHCpQSN  272
ident             |               |           |       |        |  
Sbjct GgtsipgSSTVTADDVIKTK---PDVVSHINggptAISVQEVDRIMDeTDFAMEIV-QCG  249
DSSP  LllllllLLLLLHHHHHHHL---LLEEELLLllllLLLHHHHHHHHHhLLLEEEEE-LLL


DSSP  H----llLLLLHHHHLL--LEEELLLHHH-HLLLL-LHHHHHHHHHHHHHhllLLHHHHH
Query G----rlPVREMADAGV--PVSIGVDGAA-SNEAA-DMISEVHMTWLAQRarlASIAEVI  324
ident          |  |  |    |  | |                                  
Sbjct NpkiadyVARRAAEKGQlgRVIFGNDAPSgTGLIPlGILRNMCQIASMSD---IDPEVAV  306
DSSP  LhhhhhhHHHHHHHHLLhhHEEEELLLLLlLLLLLlHHHHHHHHHHHHLL---LLHHHHH


DSSP  HHHLHHHHHHHLLlLLLLLLLLLLLLEEEEELLLHhHLLLllHHHHHHHLLLLLEEEEEE
Query HWGTAGGARVMGLdEVGKVAVGYAADIAVYRLDDPrYFGLhdPAIGPVASGGRPSVMALF  384
ident    |     | ||   |  | |  ||                 | |  | |  |      
Sbjct CMATGNSTAVYGL-NTGVIAPGKEADLIIMDTPLG-SVAE--DAMGAIAAGDIPGISVVL  362
DSSP  HHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELLLL-LLLL--LHHHHHHHLLLLEEEEEE


DSSP  ELLEEEEELLLlllllhhhhhhhhhhhhhhhhhhhhl
Query SAGKRVVVDDLiegvdikelggearrvvrellrevvv  421
ident   |  ||                              
Sbjct IDGEAVVTKSR--------------ntppakraakil  385
DSSP  ELLEEEELLLL--------------llllllllleel


No 10: Query=2pajA Sbjct=3mtwA Z-score=32.5

back to top
DSSP  -LEEEEElLLEELLLLllllllLLLLLL-LLEEEELLEEEEELL--LLLLLLLEEEELLL
Query -PSTLIRnAAAIMTGGrgtaddPSRVPG-PDIRIVGDTIDAIGA--LAPRPGETIVDATD   56
ident         ||                   |        |  ||    |   | | ||   
Sbjct aEIKAVS-AARLLDVA------SGKYVDnPLVIVTDGRITSIGKkgDAVPAGATAVDLPG   53
DSSP  lLEEEEE-EEEEEELL------LLEEEElEEEEEELLEEEEEEEllLLLLLLLEEEEEEE


DSSP  LEEEELEELLLLLHHHhhLLLLL--LHHHLLHHHHHHHHHHHHHHHHLLLEEEEEELLLL
Query CVIYPAWVNTHHHLFQslLKGEP--FRALFDERRFRLAARIGLIELARSGCATVADHNYV  114
ident     |     | ||    |             |                |  ||      
Sbjct VTLLPGLIDMHVHLDS--LAEVGgyNSLEYSDRFWSVVQTANAKKTLEAGFTTVRNVGAA  111
DSSP  EEEEELEEEEEELLLL--LLLLLhhHHHHLLHHHHHHHHHHHHHHHHHLLEEEEEELLLL


DSSP  LllllllLHHHHHHHHHH---HLLLEEEEEE-LLLLLL-----LLLL-LLLLhhHLLLLH
Query YypgmpfDSSAILFEEAE---KLGLRFVLLR-GGATQT-----RQLE-ADLPtaLRPETL  164
ident             | |        | | |                            |   
Sbjct D------YDDVGLREAIDagyVPGPRIVTAAiSFGATGghcdsTFFPpSMDQ--KNPFNS  163
DSSP  L------LHHHHHHHHHHlllLLLLEEEELLlLEELLLlllllLLLLhHHLL--LLLLLL


DSSP  ------HHHHHHHHHHHhhllllllllleeEEELLlLLLL------------LLLHHHHH
Query ------DAYVADIERLAaryhdaspramrrVVMAPtTVLY------------SISPREMR  206
ident          |                     |                         || 
Sbjct dspdeaRKAVRTLKKYG------------aQVIXI-CATGgvfsrgnepgqqQLTYEEMK  210
DSSP  llhhhhHHHHHHHHHLL------------lLEEEE-ELLLllllllllllllLLLHHHHH


DSSP  HHHHHHHHLLLEEEEELLllLHHHHHHHLLLllllEEEELLLLLLHHHHHHHHHHLLEEE
Query ETAAVARRLGLRMHSHLSgkSPVAFCGEHDWlgsdVWYAHLVKVDADEIALLAQTGTGVA  266
ident      |   |     |    |                  |   ||   | |  | |    
Sbjct AVVDEAHMAGIKVAAHAHgaSGIREAVRAGV----DTIEHASLVDDEGIKLAVQKGAYFS  266
DSSP  HHHHHHHHLLLEEEEEELlhHHHHHHHHLLL----LEEEELLLLLHHHHHHHHHHLLEEE


DSSP  ELHHHHHLL--------------------------LLLLHHHHLLLEEELLLHHhHLLLL
Query HCPQSNGRL--------------------------PVREMADAGVPVSIGVDGAaSNEAA  300
ident                                      |    |||    | |        
Sbjct MDIYNTDYTqaegkkngvlednlrkdrdigelqreNFRKALKAGVKMVYGTDAG-IYPHG  325
DSSP  LLLLLHHHHhhhhhhhlllhhhhhhhhhhhhhhhhHHHHHHHHLLEEELLLLLL-LLLLL


DSSP  LHHHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELllh
Query DMISEVHMTWLAQrarlASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIAVYRLddp  359
ident |                |     |   |   |   |    || ||||   |         
Sbjct DNAKQFAVMVRYG----ATPLQAIQSATLTAAEALGRSkDVGQVAVGRYGDMIAVAG---  378
DSSP  LHHHHHHHHHHLL----LLHHHHHHHLLHHHHHHHLLLlLLLLLLLLLLLLEEEELL---


DSSP  hhlllllHHHHHHHLllLLEEeEEEELLEEEEELlllllllhhhhhhhhhhhhhhhhhhh
Query ryfglhdPAIGPVASggRPSVmALFSAGKRVVVDdliegvdikelggearrvvrellrev  419
ident             |       |      |  |                             
Sbjct -------DPLADVTT-lEKPV-FVMKGGAVVKAP--------------------------  403
DSSP  -------LLLLLHHH-hHLLL-EEEELLEEEELL--------------------------


DSSP  hl
Query vv  421
ident   
Sbjct -x  404
DSSP  -l


No 11: Query=2pajA Sbjct=3mkvA Z-score=32.4

back to top
DSSP  -LEEEEELLlEELLLLllllllLLLLLL-LLEEEELLEEEEELL-LLLLLLLEEEELLLL
Query -PSTLIRNAaAIMTGGrgtaddPSRVPG-PDIRIVGDTIDAIGA-LAPRPGETIVDATDC   57
ident     | ||  |                    | |    |                |    
Sbjct lTTFLFRNG-ALLDPD------HPDLLQgFEILIEDGFIREVSDkPIKSSNAHVIDVKGK   53
DSSP  lLEEEEEEE-EELLLL------LLLLEEeEEEEEELLEEEEEELlLLLLLLLEEEELLLL


DSSP  EEEELEELLLLLHHHhHLLLllLHHHLLHHHHHHHHHHHHHHHHLLLEEEEEELLLllll
Query VIYPAWVNTHHHLFQsLLKGepFRALFDERRFRLAARIGLIELARSGCATVADHNYvyyp  117
ident  | |     | |            |        | |        | |  || |       
Sbjct TIMPGLIDLHVHVVA-IEFNlpRVATLPNVLVTLRAVPIMRAMLRRGFTTVRDAGG----  108
DSSP  EEEELEEEEEELLLL-LLLLhhHHLLLLHHHHHHHHHHHHHHHHHLLEEEEEELLL----


DSSP  lllllhHHHHHHHHH---HLLLEEEEEE-LLLLLL----lLLLL--LLLHH---------
Query gmpfdsSAILFEEAE---KLGLRFVLLR-GGATQT----rQLEA--DLPTA---------  158
ident               |     | |                         |           
Sbjct -----aGYPFKQAVEsglVEGPRLFVSGrALSQTGghadpRARSdyMPPDSpcgccvrvg  163
DSSP  -----lLHHHHHHHHlllLLLLEEEELLlEEELLLlllllLLLLllLLLLLlllllllll


DSSP  --hlLLLH----HHHHHHHHHHHhhllllllllleeEEELlLLLL------------LLL
Query --lrPETL----DAYVADIERLAaryhdaspramrrVVMApTTVL------------YSI  200
ident                |                                            
Sbjct algrVADGvdevRRAVREELQMG------------aDQIX-IMASggvasptdpvgvFGY  210
DSSP  lleeELLLhhhhHHHHHHHHHHL------------lLLEE-EELLllllllllllllLLL


DSSP  LHHHHHHHHHHHHHLLLEEEEELLllLHHHHHHHLLLllllEEEELLLLLLHHHHHHHHH
Query SPREMRETAAVARRLGLRMHSHLSgkSPVAFCGEHDWlgsdVWYAHLVKVDADEIALLAQ  260
ident |  | |   | |   |     |       |               |    |     | | 
Sbjct SEDEIRAIVAEAQGRGTYVLAHAYtpAAIARAVRCGV----RTIEHGNLIDDETARLVAE  266
DSSP  LHHHHHHHHHHHHLLLLLEEEEELlhHHHHHHHHLLL----LEEEELLLLLHHHHHHHHH


DSSP  HLLEEEELHHHHHLL--------------------------LLLLHHHHLLLEEELLLHH
Query TGTGVAHCPQSNGRL--------------------------PVREMADAGVPVSIGVDGA  294
ident  |  |         |                              |  |||    | |  
Sbjct HGAYVVPTLVTYDALasegekyglppesiakiadvhgaglhSIEIMKRAGVKMGFGTDLL  326
DSSP  HLLEEELLHHHHHHHhhhlllllllhhhhllhhhhhllhhhHHHHHHHHLLLLLLLLLLL


DSSP  H-HLLLLlhHHHHHHHHHHhhhllLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEE
Query A-SNEAAdmISEVHMTWLAqrarlASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIA  352
ident            |             | ||||   |   | | |     |    |  ||  
Sbjct GeAQRLQ--SDEFRILAEV-----LSPAEVIASATIVSAEVLGMQdKLGRIVPGAHADVL  379
DSSP  HhHHHHL--LHHHHHHHLL-----LLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEE


DSSP  EEElllhhhlllllHHHH-HHHL-LLLL-EEEEEEELLEEEEELlllllllhhhhhhhhh
Query VYRlddpryfglhdPAIG-PVAS-GGRP-SVMALFSAGKRVVVDdliegvdikelggear  409
ident |                   |    |           |   |                  
Sbjct VVD-----------GNPLkSVDClLGQGeHIPLVMKDGRLFVNE----------------  412
DSSP  EEL-----------LLLLlLLLLlLLLLlLLLEEEELLEEEEEL----------------


DSSP  hhhhhhhhhhhl
Query rvvrellrevvv  421
ident             
Sbjct ----------le  414
DSSP  ----------ll


No 12: Query=2pajA Sbjct=4c5yA Z-score=30.4

back to top
DSSP  ---LEEEEElLLEELLLLllllllLLLLLLLLEEEELLEEEEEL---LLLL--LLLL-EE
Query ---PSTLIRnAAAIMTGGrgtaddPSRVPGPDIRIVGDTIDAIG---ALAP--RPGE-TI   51
ident      | |  |     |                 |    |   |                
Sbjct deaKVTIIY-AGLLIPGD------GEPLRNAALVISDKIIAFVGseaDIPKkyLRSTqST   53
DSSP  lllLEEEEE-EEEELLLL------LLLEEEEEEEEELLEEEEEEehhHLLHhhHHHLlLE


DSSP  EELllLEEEELEELLLLLHhHHHL--lLLLL-HHHLLHHHHHHHHHHHHHHHHLLLEEEE
Query VDAtdCVIYPAWVNTHHHLfQSLL--kGEPF-RALFDERRFRLAARIGLIELARSGCATV  108
ident       |  |     | |                             |  |    |    
Sbjct HRV--PVLMPGLWDCHMHF-GGDDdyyNDYTsGLATHPASSGARLARGCWEALQNGYTSY  110
DSSP  EEE--EEEEELEEEEEELL-LLLLlllLLLHhHHHLLHHHHHHHHHHHHHHHHHLLEEEE


DSSP  EELLLlllllllllHHHHHHHHHH---HLLLEEEEEE-LLLLLL----lLLLLLLL--HH
Query ADHNYvyypgmpfdSSAILFEEAE---KLGLRFVLLR-GGATQT----rQLEADLP--TA  158
ident  |                           |                              
Sbjct RDLAG---------YGCEVAKAINdgtIVGPNVYSSGaALSQTAghgdiFALPAGEvlGS  161
DSSP  EELLL---------LHHHHHHHHHlllLLLLEEEELLlEEELLLlllllLLLLHHHhhHH


DSSP  HL---------------LLLH-HHHHHHHHHHHHHLLllllllleeEEELLlLLLL----
Query LR---------------PETL-DAYVADIERLAARYHdaspramrrVVMAPtTVLY----  198
ident                                   |            |            
Sbjct YGvmnprpgywgagplcIADGvEEVRRAVRLQIRRGA---------KVIXV-MASGgvms  211
DSSP  HLllllllllllllleeELLLhHHHHHHHHHHHHHLL---------LLEEE-ELLLllll


DSSP  --------LLLHHHHHHHHHHHHHLLLEEEEELLLLLHHHHHHhLLLLlllEEEELLLLL
Query --------SISPREMRETAAVARRLGLRMHSHLSGKSPVAFCGeHDWLgsdVWYAHLVKV  250
ident           || |       | |       |  ||                   |    
Sbjct rddnpnfaQFSPEELKVIVEEAARQNRIVSAHVHGKAGIMAAI-KAGC---KSLEHVSYA  267
DSSP  llllllllLLLHHHHHHHHHHHHHLLLLEEEEELLHHHHHHHH-HHLL---LEEEELLLL


DSSP  LHHHHHHHHHHLLEEEELHHHHHLL-------------------------LLLLHHHHLL
Query DADEIALLAQTGTGVAHCPQSNGRL-------------------------PVREMADAGV  285
ident |     |    |                                             |||
Sbjct DEEVWELMKEKGILYVATRSVIEIFlasngeglvkeswaklqaladshlkAYQGAIKAGV  327
DSSP  LHHHHHHHHHHLLEEELLHHHHHHHhhhllllllllhhhlllhhhhhhhhHHHHHHHLLL


DSSP  LEEELLLHHhhlllLLHHHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHL--LLLLLLL
Query PVSIGVDGAasneaADMISEVHMTWLAQRarlASIAEVIHWGTAGGARVMG--LDEVGKV  343
ident     | | |          |                | |   ||      |      |  
Sbjct TIALGTDTA---pgGPTALELQFAVERGG---MTPLEAIKAATANAPLSVGpqAPLTGQL  381
DSSP  LEELLLLLL---llLLLHHHHHHHHHLLL---LLHHHHHHHHLLLHHHHHHhhLLLLLLL


DSSP  LLLLLLLEEEEELllhhhlllllHHHHHHHL-LLLLEEEEEEELLEEEEELLLLLLllhh
Query AVGYAADIAVYRLddpryfglhdPAIGPVAS-GGRPSVMALFSAGKRVVVDDLIEGvdik  402
ident   || ||                              |      ||              
Sbjct REGYEADVIALEE----------NPLEDIKVfQEPKAVTHVWKGGKLFKGPGIGPW----  427
DSSP  LLLLLLLEEEELL----------LLLLLHHHhHLHHHEEEEEELLEEEELLLLLLL----


DSSP  hhhhhhhhhhhhhhhhhhl
Query elggearrvvrellrevvv  421
ident                    
Sbjct ----------gedarnpfl  436
DSSP  ----------lllllllll


No 13: Query=2pajA Sbjct=3nqbA Z-score=29.4

back to top
DSSP  -----------------------LEEEEELLlEELLLLllllllLLLLLLLLEEEELLEE
Query -----------------------PSTLIRNAaAIMTGGrgtaddPSRVPGPDIRIVGDTI   37
ident                           ||                       || |||  |
Sbjct epadlnddtlraravaaargdqrFDVLITGG-TLVDVV------TGELRPADIGIVGALI   53
DSSP  llhhhllhhhhhhhhhhhhllllEEEEEELL-EEELLL------LLLEEELEEEEELLEE


DSSP  EEELL--LLLLllLEEEELLLLEEEELEELLLLLHHHHHllllllhhhllhhhhhHHHHH
Query DAIGA--LAPRpgETIVDATDCVIYPAWVNTHHHLFQSLlkgepfralfderrfrLAARI   95
ident                  ||      |    || |   |                      
Sbjct ASVHEpaSRRD-aAQVIDAGGAYVSPGLIDTHXHIESSX----------------ITPAA   96
DSSP  EEEELllLLLL-eEEEEELLLLEEEELEEEEEELHHHHL----------------LLHHH


DSSP  HHHHHHLLLEEEEEELLL-LLLLllllLHHHHHHHHHHHLLLEEEEEELLL--LLLLLLL
Query GLIELARSGCATVADHNY-VYYPgmpfDSSAILFEEAEKLGLRFVLLRGGA--TQTRQLE  152
ident         |  |               |         | | ||  ||             
Sbjct YAAAVVARGVTTIVWDPHeFGNV-hgvDGVRWAAKAIENLPLRAILLAPSCvpSAPGLER  155
DSSP  HHHHHHLLLEEEEEELLHhHHHH-hlhHHHHHHHHHHLLLLLEEEEEELLLllLLLLLLL


DSSP  llllhhHLLLlhhHHHHHHHHHHHHLLllllllleEEEELLLLLLL-llLHHH-HHHHHH
Query adlptaLRPEtldAYVADIERLAARYHdaspramrRVVMAPTTVLY-siSPRE-MRETAA  210
ident                 |    |                 |                    
Sbjct ------GGAD---FDAAILADLLSWPE--------IGGIAEIXNXRgviERDPrXSGIVQ  198
DSSP  ------LLLL---LLHHHHHHHHLLLL--------EEEEEEELLHHhhhLLLHhHHHHHH


DSSP  HHHHLLLEEEEELL--lLLHHHHHHhLLLLlllEEEELLLLLLhhHHHHHHHHLLEEEEL
Query VARRLGLRMHSHLS--gKSPVAFCGeHDWLgsdVWYAHLVKVDadEIALLAQTGTGVAHC  268
ident            |                          ||             |      
Sbjct AGLAAEKLVCGHARglkNADLNAFX-AAGV---SSDHELVSGE--DLXAKLRAGLTIELR  252
DSSP  HHHHHLLEEEELLLlllHHHHHHHH-HLLL---LEELLLLLHH--HHHHHHHLLLEEEEE


DSSP  HhHHHL---lLLLLHHHH---LLLEEELLLHHHHLLL---LLHHHHHHHHHHHHhhllLL
Query PqSNGR---lPVREMADA---GVPVSIGVDGAASNEA---ADMISEVHMTWLAQrarlAS  319
ident   |        |            |    |                |             
Sbjct G-SHDHllpeFVAALNTLghlPQTVTLCTDDVFPDDLlqgGGLDDVVRRLVRYG----LK  307
DSSP  L-LLHHhhhhHHHHHHHHlllLLLEEEELLLLLHHHHhhlLLHHHHHHHHHHLL----LL


DSSP  HHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEElllhhhlllllhHHHHhhllllLE
Query IAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRlddpryfglhdpAIGPvasggrPS  379
ident         |   |   |    |  | |  ||| |                         |
Sbjct PEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFE------------DLNG------FS  349
DSSP  HHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEL------------LLLL------LL


DSSP  EEEEEELLEEEEELLLL-LLLL--------------------------------------
Query VMALFSAGKRVVVDDLI-EGVD--------------------------------------  400
ident        |  |                                                 
Sbjct ARHVLASGRAVAEGGRXlVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrp  409
DSSP  EEEEEELLEEEEELLEElLLLLllllhhhllllllllllhhhhllllllleeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  400
ident                                                             
Sbjct rftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvsh  469
DSSP  llleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeellll


DSSP  -------------hhhhhhhhhhhhHHHHhHHHL--------------------------
Query -------------ikelggearrvvRELLrEVVV--------------------------  421
ident                                |                            
Sbjct dshnltvfggnagdxalaanavigtGGGX-AVASegkvtailplplsglvsdapleevar  528
DSSP  lllleeeeellhhhhhhhhhhhhhlLLEE-EEEElleeeeeeelllllllllllhhhhhh


DSSP  -----------------------------------------------------------
Query -----------------------------------------------------------  421
ident                                                            
Sbjct afedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 14: Query=2pajA Sbjct=1onxA Z-score=29.1

back to top
DSSP  -------LEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEEL-LLLL--LLLLE
Query -------PSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIG-ALAP--RPGET   50
ident          ||   |                    |       | |          |  |
Sbjct midytaaGFTLLQGA-HLYAP--------EDRGICDVLVANGKIIAVAsNIPSdiVPNCT   51
DSSP  llllhhhLLEEEEEE-EEELL--------LEEEEEEEEEELLEEEEEElLLLLllLLLLE


DSSP  EEELLLLEEEELEELLLLLHHHHhllllLLHHHLlhhhhhhHHHHhHHHHHLLLEEEEEE
Query IVDATDCVIYPAWVNTHHHLFQSllkgePFRALFderrfrlAARIgLIELARSGCATVAD  110
ident  ||       |     | ||                          |  |   |   |  
Sbjct VVDLSGQILCPGFIDQHVHLIGG---ggEAGPTT-----rtPEVA-LSRLTEAGVTSVVG  102
DSSP  EEELLLLEEEELEEEEEELLLLL---llLLLHHH-----llLLLL-HHHHHHLLEEEEEE


DSSP  LLL-LLLLllllLHHHHHHHHHHHLLLEEEEEE-LLLLllllllllllhhhllllhhhHH
Query HNY-VYYPgmpfDSSAILFEEAEKLGLRFVLLR-GGATqtrqleadlptalrpetldaYV  168
ident              |           |     |                            
Sbjct LLGtDSIS-rhpESLLAKTRALNEEGISAWMLTgAYHV------------------psRT  143
DSSP  LLLlLLLL-llhHHHHHHHHHHHHHLLEEEEEEeLLLL------------------llLL


DSSP  HH--HHHH-HHHLllllllllEEEEELlLLLL---LLLL-HHHHHHHHHHHHHLL-----
Query AD--IERL-AARYhdaspramRRVVMApTTVL---YSIS-PREMRETAAVARRLG-----  216
ident      |   |           |                         ||  |  |     
Sbjct ITgsVEKDvAIID--------RVIGVX-CAISdhrSAAPdVYHLANMAAESRVGGllggk  194
DSSP  LLllHHHHhHHLL--------LEEEEE-EEELlllLLLLlHHHHHHHHHHHHHHHhhhll


DSSP  -LEEEEELL-lLLHHHHHHHLL----llLLLEEEELL-LLLL--HHHHHHHHHHlLEEEE
Query -LRMHSHLS-gKSPVAFCGEHD----wlGSDVWYAHL-VKVD--ADEIALLAQTgTGVAH  267
ident       |    |                 |     |    |                   
Sbjct pGVTVFHMGdsKKALQPIYDLLencdvpISKLLPTHVnRNVPlfEQALEFARKG-GTIDI  253
DSSP  lLEEEEEELllLLLLHHHHHHHhlllllHHHEEEELHhHLHHhhHHHHHHHHLL-LLEEE


DSSP  LHhHHHLL-----LLLLHH-HHLL--LEEELLL-HHHH------------lLLLLhHHHH
Query CPqSNGRL-----PVREMA-DAGV--PVSIGVD-GAAS------------nEAADmISEV  306
ident    |                       |    |                   |       
Sbjct TS-SIDEPvapaeGIARAVqAGIPlaRVTLSSDgNGSQpffddegnlthigVAGF-ETLL  311
DSSP  EL-LLLLLllhhhHHHHHHhLLLLhhHEEEELLlLLEEeeellllleeeeeELLL-HHHH


DSSP  HHHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEElllhhhlllll
Query HMTWLAQRARLASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRlddpryfglhd  366
ident             ||       |   |    |   |    |  ||  |             
Sbjct ETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT-----------  360
DSSP  HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEL-----------


DSSP  hHHHHhhllllleEEEEEELLEEEEELLL--LLLLLHHhhhhhhhhhhhhhhhhhhl
Query pAIGPvasggrpsVMALFSAGKRVVVDDL--IEGVDIKelggearrvvrellrevvv  421
ident                     ||  | |      |                       
Sbjct -PELR--------IEQVYARGKLMVKDGKacVKGTFET------------------d  390
DSSP  -LLLL--------EEEEEELLEEEEELLEelLLLLLLL------------------l


No 15: Query=2pajA Sbjct=3icjA Z-score=28.8

back to top
DSSP  LEEEEELLlEELLLLLlllllLLLLlLLLEEEELLEEEEEL---LLLL---LLLLEEEEL
Query PSTLIRNAaAIMTGGRgtaddPSRVpGPDIRIVGDTIDAIG---ALAP---RPGETIVDA   54
ident       |   | |        |         |        |            |  | | 
Sbjct CMKALING-TIYTSFS-----PVKK-VSGLVISNERVLYAGdssTALRiaeLAGGEIIDL   53
DSSP  LEEEEELL-EEEEEEL-----LEEE-ELEEEEELLEEEEEElhhHHHHhhhHHLLEEEEL


DSSP  LLLEEEELEELLLLLHHH-HHLL-------------------------------------
Query TDCVIYPAWVNTHHHLFQ-SLLK-------------------------------------   76
ident       ||    | ||                                            
Sbjct KGKFVMPAFFDSHLHLDElGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelg  113
DSSP  LLLEEEELEEEEEELHHHhHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhl


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------ge   78
ident                                                             
Sbjct rwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrk  173
DSSP  llllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhh


DSSP  lLHHH-LLHHHHHHHHHHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHH--HHLL
Query pFRAL-FDERRFRLAARIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEA--EKLG  135
ident                       |   |   |                  |||      | 
Sbjct iINEKiLTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE------KALKALFELEreGRLK  227
DSSP  hHHHLlLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH------HHHHHHHHHHhlLLLL


DSSP  LEEEEEELLllllllllllllhhhllllhhHHHHHH--HHHHhhLLLLlllLLEE-EEEL
Query LRFVLLRGGatqtrqleadlptalrpetldAYVADI--ERLAarYHDAsprAMRR-VVMA  192
ident                                         |             |     
Sbjct MNVFAYLSP---------------------ELLDKLeeLNLG--KFEG---RRLRiWGVX  261
DSSP  LEEEEEELH---------------------HHHHHHhhHLLL--LEEL---LLEEeEEEE


DSSP  LlLLLL-----------------------LLLHHHHHHHHHHHHHLLLEEEEELLllLHH
Query PtTVLY-----------------------SISPREMRETAAVARRLGLRMHSHLSgkSPV  229
ident    |                              |  |    |  |||    |      |
Sbjct L-FVDGslgartallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHAIgdKAV  320
DSSP  E-ELLLlllllllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEELlhHHH


DSSP  HHHHHL---LLLLllEEEELLLLLLHHHHHHHHHHLLEEEELHHHHHLL-----------
Query AFCGEH---DWLGsdVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRL-----------  275
ident                    |   |  |               |                 
Sbjct DVALDAfeeAEFS--GRIEHASLVRDDQLERIKELKVRISAQPHFIVSDwwivnrvgeer  378
DSSP  HHHHHHhhhHLLL--LEEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLllhhhhhhhhh


DSSP  -----LLLLHHHhLLLEEELLLHHhhLLLLLHHHHHHHHHHHH-HHLL--LLHHHHHHHH
Query -----PVREMADaGVPVSIGVDGAasNEAADMISEVHMTWLAQ-RARL--ASIAEVIHWG  327
ident                      |     | ||                    |  |  |  
Sbjct akwayRLKTLSS-ITKLGFSTDSP--IEPADPWVSIDAAVNRYvVDPGerVSREEALHLY  435
DSSP  hhhllLHHHHHH-HLLEEELLLLL--LLLLLHHHHHHHHHHLLlLLHHhlLLHHHHHHHL


DSSP  LHHHHHHHLLLLLLLLLLLLLLLEEEEELllhhhlllllHHHHhhhllllleeeeeeell
Query TAGGARVMGLDEVGKVAVGYAADIAVYRLddpryfglhdPAIGpvasggrpsvmalfsag  387
ident | | | |      ||   |  |                                      
Sbjct THGSAQVTLAEDLGKLERGFRAEYIILDR----------DPLK-----------------  468
DSSP  LHHHHHHLLLLLLLLLLLLLLLLEEEELL----------LLLL-----------------


DSSP  eeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query krvvvddliegvdikelggearrvvrellrevvv  421
ident                                   
Sbjct ----------------------------------  468
DSSP  ----------------------------------


No 16: Query=2pajA Sbjct=3giqA Z-score=26.7

back to top
DSSP  --LEEEEELLlEELLLLLLlllllLLLLlLLEEEELLEEEEELL-LLLLllLEEEELLLL
Query --PSTLIRNAaAIMTGGRGtaddpSRVPgPDIRIVGDTIDAIGA-LAPRpgETIVDATDC   57
ident       |     |  |         |    |       | |||   |        ||   
Sbjct ekLDFKITGG-WIIDGTGA-----PRRR-ADLGVRDGRIAAIGElGAHP-aRHAWDASGK   52
DSSP  llEEEEEELL-EELLLLLL-----LLEE-LEEEEELLEEEEEELlLLLL-eEEEEELLLL


DSSP  EEEELEELLLLLHHHHhllllllhhhllhhhhHHHHHHhHHHHHLLLEEEEEEL----LL
Query VIYPAWVNTHHHLFQSllkgepfralfderrfRLAARIgLIELARSGCATVADH----NY  113
ident    |     | |                           |      |  ||         
Sbjct IVAPGFIDVHGHDDLM----------------FVEKPD-LRWKTSQGITTVVVGncgvSA   95
DSSP  EEEELEEELLLLLLLH----------------HHHLLL-LHHHHLLLEEEEEELllllLL


DSSP  LLLLL------------------lllLHHHHHHHHHHhlLLEEEEEELLLllllllllll
Query VYYPG------------------mpfDSSAILFEEAEklGLRFVLLRGGAtqtrqleadl  155
ident    |                         | |             | | |          
Sbjct APAPLpgntaaalallgetplfadvpAYFAALDAQRP--MINVAALVGHA----------  143
DSSP  LLLLLlllllhhhhhhllllllllhhHHHHHHHHLLL--LLEEEEEEEHH----------


DSSP  lhhhLLLL-----------HHHHHHHHHHHHHHLLllllllleeEEELlLLLL----LLL
Query ptalRPET-----------LDAYVADIERLAARYHdaspramrrVVMApTTVL----YSI  200
ident                      |                      |    |          
Sbjct -nlrLAAMrdpqaaptaaeQQAMQDMLQAALEAGA---------VGFS-TGLAyqpgAVA  192
DSSP  -hhhHHHLllllllllhhhHHHHHHHHHHHHHHLL---------LEEE-EELLlllhHHL


DSSP  LHHHHHHHHHHHHHLLLEEEEELL-----llLHHHHHHHLL-llllLEEEELLLL-----
Query SPREMRETAAVARRLGLRMHSHLS-----gkSPVAFCGEHD-wlgsDVWYAHLVK-----  249
ident    |    | ||        ||           |                 |        
Sbjct QAAELEGLARVAAERRRLHTSHIRneadgveAAVEEVLAIGrgtgcATVVSHHKCmmpqn  252
DSSP  LHHHHHHHHHHHHHLLLEEEEELLlllllhhHHHHHHHHHHhhhllEEEELLLLLllhhh


DSSP  --LLHHHHHHHHHHL-----LEEEELHhhHHLL---------------------------
Query --VDADEIALLAQTG-----TGVAHCPqsNGRL---------------------------  275
ident         |                 |                                 
Sbjct wgRSRATLANIDRAReqgveVALDIYP--YPGSstiliperaetiddiritwstphpecs  310
DSSP  llLHHHHHHHHHHHHhllllEEEEELL--LLEEeeellhhhllllllleeeeelllhhhl


DSSP  --------------------------------------LLLLHHhhllLEEELLL-HHHH
Query --------------------------------------PVREMAdagvPVSIGVD-GAAS  296
ident                                                     | |     
Sbjct geyladiaarwgcdkttaarrlapagaiyfamdedevkRIFQHP----CCMVGSDgLPND  366
DSSP  lllhhhhhhhhlllhhhhhhhhlleeeeeelllhhhhhHHHHLL----LEEELLLlLLLL


DSSP  ---LLLLLhhHHHHHHH-HHHHHLL-LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLE
Query ---NEAADmiSEVHMTW-LAQRARL-ASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADI  351
ident                      |              ||  ||| |  | |    |  || 
Sbjct arpHPRLW--GSFTRVLgRYVREARlMTLEQAVARMTALPARVFGFAERGVLQPGAWADV  424
DSSP  lllLLHHH--HHHHHHHhHHHHHLLlLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLE


DSSP  EEEelllhhhlllllHHHHhhHLLL---------LLEEEEEEELLEEEEelLLLLLLlhh
Query AVYrlddpryfglhdPAIGpvASGG---------RPSVMALFSAGKRVVvdDLIEGVdik  402
ident  |                                          |  |            
Sbjct VVF------------DPDT--VADRatwdeptlaSVGIAGVLVNGAEVF--PQPPAD---  465
DSSP  EEE------------LLLL--LLLLlllllllllLLLEEEEEELLEEEE--LLLLLL---


DSSP  hhhhhhhhhhhhhhhhhhl
Query elggearrvvrellrevvv  421
ident                    
Sbjct ---------grpgqvlrax  475
DSSP  ---------llllllllll


No 17: Query=2pajA Sbjct=1yrrB Z-score=26.4

back to top
DSSP  leEEEELLlEELLLLlllllllLLLLLLLEEEELLEEEEELLL-LLLLLLEEEELLLLEE
Query psTLIRNAaAIMTGGrgtaddpSRVPGPDIRIVGDTIDAIGAL-APRPGETIVDATDCVI   59
ident           | ||                 |    |          |            
Sbjct --YALTQG-RIFTGH-------EFLDDHAVVIADGLIKSVCPVaELPPEIEQRSLNGAIL   50
DSSP  --LEEELL-EEELLL-------LEELLEEEEEELLEEEEEEEHhHLLLLLLEEELLLLEE


DSSP  EELEELLLLLHhHHHLlllllHHHLLhhhHHHHHHHHHHHHHLLLEEEEEELLLLLLLLL
Query YPAWVNTHHHLfQSLLkgepfRALFDerrFRLAARIGLIELARSGCATVADHNYVYYPGM  119
ident  |                                 |       |||              
Sbjct SPGFIDVQLNG-CGGV--qfnDTAEA--vSVETLEIMQKANEKSGCTNYLPTLITTSDEL  105
DSSP  EELEEEEEELE-ELLE--ellLLLLL--lLHHHHHHHHHHHHLLLEEEEEEEELLLLHHH


DSSP  llLHHHHHHHHHHHLLLE-EEEEELLLLllllllllllhhhllllhHHHHHHHHHHHhhl
Query pfDSSAILFEEAEKLGLR-FVLLRGGATqtrqleadlptalrpetlDAYVADIERLAary  178
ident          |   |       |   |                     | |      |   
Sbjct mkQGVRVMREYLAKHPNQaLGLHLEGPW----------------lnAALVDFLCENA---  146
DSSP  hhHHHHHHHHHHHHLLLLlLLEEEELLL----------------llLHHHHHHHHLH---


DSSP  lllllllleEEEELlLLLLlllLHHHhHHHHHHHHHLLLEEEEELLlllHHHHHHH--LL
Query hdaspramrRVVMApTTVLysiSPREmRETAAVARRLGLRMHSHLSgksPVAFCGE--HD  236
ident                |            |        |       |              
Sbjct --------dVITKV-TLAP---EMVP-AEVISKLANAGIVVSAGHS-naTLKEAKAgfRA  192
DSSP  --------hHEEEE-EELH---HHLL-HHHHHHHHHHLLEEEELLL-llLHHHHHHhhHH


DSSP  LLllLEEEELLL--LLLH----hhHHHHHHH-LLEEEELHHhHHLL---LLLLHHHHLL-
Query WLgsDVWYAHLV--KVDA----deIALLAQT-GTGVAHCPQsNGRL---PVREMADAGV-  285
ident                                                    |        
Sbjct GI--TFATHLYNamPYITgrepglAGAILDEaDIYCGIIAD-GLHVdyaNIRNAKRLKGd  249
DSSP  LE--EEELLLLLllLLLLllllhhHHHHHHLlLLEEEEELL-LLLLlhhHHHHHHHHHHh


DSSP  LEEELLLHHhHLLLlLHHHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHLLL-LLLLLL
Query PVSIGVDGAaSNEAaDMISEVHMTWLAQRarlASIAEVIHWGTAGGARVMGLD-EVGKVA  344
ident       |         ||  |               ||    |   ||  |     |  |
Sbjct KLCLVTDATsGSSL-TMIEGVRNLVEHCG---IALDEVLRMATLYPARAIGVEkRLGTLA  305
DSSP  HEEEELLLLlLLLL-LHHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHLLLLlLLLLLL


DSSP  LLLLLLEEEEelllhhhlllllhHHHHhhlllllEEEEEEELLEEEEELlllllllhhhh
Query VGYAADIAVYrlddpryfglhdpAIGPvasggrpSVMALFSAGKRVVVDdliegvdikel  404
ident  |  |                                     |  ||             
Sbjct AGKVANLTAF-------------TPDF-------KITKTIVNGNEVVTQ-----------  334
DSSP  LLLLLLEEEE-------------LLLL-------LEEEEEELLEEEEEL-----------


DSSP  hhhhhhhhhhhhhhhhl
Query ggearrvvrellrevvv  421
ident                  
Sbjct -----------------  334
DSSP  -----------------


No 18: Query=2pajA Sbjct=2imrA Z-score=26.0

back to top
DSSP  LEEEeELLLEELLLLlllllllLLLLLLlEEEELlEEEEEL---LLLLLlllEEEElLLL
Query PSTLiRNAAAIMTGGrgtaddpSRVPGPdIRIVGdTIDAIG---ALAPRpgeTIVDaTDC   57
ident               |          ||     || |  | |    |              
Sbjct HTPR-LLTCDVLYTG-------AQSPGG-VVVVGeTVAAAGhpdELRRQ-ypHAAE-ERA   49
DSSP  LLEE-EEEELEEELL-------EELLEE-EEEELlEEEEEElhhHHHHH-llLLEE-EEL


DSSP  E--EEELEELLLLLHHH--------------hhLLLLLLHhhllhhHHHHHHHHHHHHHH
Query V--IYPAWVNTHHHLFQ--------------slLKGEPFRalfderRFRLAARIGLIELA  101
ident    | |  || | ||                               |   ||  |   | 
Sbjct GavIAPPPVNAHTHLDMsayefqalpyfqwipeVVIRGRH-----lRGVAAAQAGADTLT  104
DSSP  LleELLLLLEEEEELLLlhhhhhhlhhhhllhhHHHHHLL-----lLHHHHHHHHHHHHH


DSSP  LLLEEEEEELLLLLllllllLHHHHHHHHHHhllLEEEEEELLLLLLllllllllhhhll
Query RSGCATVADHNYVYypgmpfDSSAILFEEAEklgLRFVLLRGGATQTrqleadlptalrp  161
ident | |   | |                |        |   |                     
Sbjct RLGAGGVGDIVWAP------EVMDALLARED---LSGTLYFEVLNPF--------pdkad  147
DSSP  HLLLLLEEEEELLH------HHHHHHHLLLL---LLEEEEEEELLLL--------hhhhh


DSSP  LLHHHHHHHHHHHHHHLLlllllLLEEEEELLLLlLLLLLHHHHHHHHHHHHHLLLEEEE
Query ETLDAYVADIERLAARYHdasprAMRRVVMAPTTvLYSISPREMRETAAVARRLGLRMHS  221
ident |   |     ||              |    | |     | | ||     |   ||    
Sbjct EVFAAARTHLERWRRLER-----PGLRLGLSPHT-PFTVSHRLMRLLSDYAAGEGLPLQI  201
DSSP  HHHHHHHHHHHHHHLLLL-----LLEEEEEEELL-LLLLLHHHHHHHHHHHHHHLLLLEE


DSSP  ELL---------------------------------------LLLHHHHHHHLLLLLLLE
Query HLS---------------------------------------GKSPVAFCGEHDWLGSDV  242
ident |                                            ||    |   |    
Sbjct HVAehptelemfrtgggplwdnrmpalyphtlaevigrepgpDLTPVRYLDELGVLAARP  261
DSSP  EELllhhhhhhhhhlllllhhhllhhhllllhhhhhllllllLLLHHHHHHHHLLHHHLL


DSSP  EEELLLLLLHHHHHHHHHHLLEEEELHHHHHLL-----LLLLHHHHLLLEEELLLHHHHL
Query WYAHLVKVDADEIALLAQTGTGVAHCPQSNGRL-----PVREMADAGVPVSIGVDGAASN  297
ident    | | |  | ||  |  |  |  || ||  |          | ||| |  | |  || 
Sbjct TLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLecgtfDWPAFAAAGVEVALGTDSVASG  321
DSSP  EEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLlllllLHHHHHHLLLLEEELLLLHHHH


DSSP  LLLLHHHHHHHHHHHHHhlLLLHHHHHHHHLHHHHHHHLllllLLLLLL--llllEEEEe
Query EAADMISEVHMTWLAQRarLASIAEVIHWGTAGGARVMGldevGKVAVG--yaadIAVYr  355
ident |      ||                       || || |                     
Sbjct ETLNVREEVTFARQLYP--GLDPRVLVRAAVKGGQRVVG----TPFLRRgetwqeGFRW-  374
DSSP  LLLLLHHHHHHHHHHLL--LLLHHHHHHHHHHHHHHHHL----LLLLLLlllllhHHLH-


DSSP  lllhhhlllllhhhhhhhllllLEEEeeeelleeeeellllllllhhhhhhhhhhhhhhh
Query lddpryfglhdpaigpvasggrPSVMalfsagkrvvvddliegvdikelggearrvvrel  415
ident                                                             
Sbjct ----------------------ELSR----------------------------------  378
DSSP  ----------------------HHLL----------------------------------


DSSP  hhhhhl
Query lrevvv  421
ident       
Sbjct ----dl  380
DSSP  ----ll


No 19: Query=2pajA Sbjct=1gkpA Z-score=25.2

back to top
DSSP  lEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEELL-LLLLLLLEEEELLLLEE
Query pSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIGA-LAPRPGETIVDATDCVI   59
ident    || |   | |               ||   | ||  ||  |   ||    |||    
Sbjct -PLLIKNG-EIITA--------DSRYKADIYAEGETITRIGQnLEAPPGTEVIDATGKYV   50
DSSP  -LEEEELL-EEEEL--------LEEEELEEEELLLLLLEEELlLLLLLLLEEEELLLLEE


DSSP  EELEELLLLLHHHhhlllllLHHHLlhhhhhHHHHHHHHHHHLLLEEEEEELLLLLLLL-
Query YPAWVNTHHHLFQsllkgepFRALFderrfrLAARIGLIELARSGCATVADHNYVYYPG-  118
ident  |     | |                          |       |  |            
Sbjct FPGFIDPHVHIYL-------PFMAT---fakDTHETGSKAALMGGTTTYIEMCCPSRNDd  100
DSSP  EELEEEEEELLLL-------EELLE---ellLLHHHHHHHHHHLLEEEEEEEELLLLLLl


DSSP  ---llLLHHHHHHHHHhhlLLEEEEEELLLLllllllllllhhhlllLHHHHHHHHHHHH
Query ---mpFDSSAILFEEAeklGLRFVLLRGGATqtrqleadlptalrpeTLDAYVADIERLA  175
ident                                                             
Sbjct alegyQLWKSKAEGNS---YCDYTFHMAVSK----------------FDEKTEGQLREIV  141
DSSP  hhhhhHHHHHHHLLLL---LLEEEEEEELLL----------------LLLLHHHHHHHHH


DSSP  HHLLllllllleeEEELLlLLLL----LLLHHHHHHHHHHHHHLLLEEEEELL-------
Query ARYHdaspramrrVVMAPtTVLY----SISPREMRETAAVARRLGLRMHSHLS-------  224
ident |                     |         ||  |   |  ||     |         
Sbjct ADGI---------SSFXI-FLSYknffGVDDGEMYQTLRLAKELGVIVTAHCEnaelvgr  191
DSSP  HLLL---------LEEEE-EELLllllLLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhh


DSSP  ------------------------llLHHHHHHHLL-llllLEEEELLLLLLhhHHHHHH
Query ------------------------gkSPVAFCGEHD-wlgsDVWYAHLVKVDadEIALLA  259
ident                              |                ||            
Sbjct lqqkllsegktgpewhepsrpeaveaEGTARFATFLettgaTGYVVHLSCKP--ALDAAM  249
DSSP  hhhhhhhlllllhhhllllllhhhhhHHHHHHHHHHhhhllEEEELLLLLHH--HHHHHH


DSSP  HHL-----LEEEELHHHHHLL---------------------------LLLLHHHHLLLE
Query QTG-----TGVAHCPQSNGRL---------------------------PVREMADAGVPV  287
ident                                                         |   
Sbjct AAKargvpIYIESVIPHFLLDktyaerggveamkyimspplrdkrnqkVLWDALAQGFID  309
DSSP  HHHhllllEEEEEEHHHHHLLhhhhhllhhhhhlllllllllllhhhhHHHHHHHLLLLL


DSSP  EELLLHHH------------------HLLLLLhhHHHHHHHHHH-HHLLLLHHHHHHHHL
Query SIGVDGAA------------------SNEAADmiSEVHMTWLAQ-RARLASIAEVIHWGT  328
ident   | |                        |      |              |        
Sbjct TVGTDHCPfdteqkllgkeaftaipnGIPAIE--DRVNLLYTYGvSRGRLDIHRFVDAAS  367
DSSP  EEELLLLLllhhhhhhhlllhhhlllLLLLLL--LHHHHHHHHHlLLLLLLHHHHHHHHL


DSSP  HHHHHHHLLL-LLLLLLLLLLLLEEEEELLLHhhlllllhhhhhhhLLLL----------
Query AGGARVMGLD-EVGKVAVGYAADIAVYRLDDPryfglhdpaigpvaSGGR----------  377
ident    |   ||    |  |||  ||  ||                                 
Sbjct TKAAKLFGLFpRKGTIAVGSDADLVVYDPQYR--------------GTISvktqhvnndy  413
DSSP  HHHHHHLLLLlLLLLLLLLLLLLEEEEELLLL--------------EELLhhhlllllll


DSSP  ---------LEEEEEEELLEEEEELLLLLlllhhhhhhhhhhhhhhhhhhhhl
Query ---------PSVMALFSAGKRVVVDDLIEgvdikelggearrvvrellrevvv  421
ident                   ||  | |                            
Sbjct ngfegfeidGRPSVVTVRGKVAVRDGQFV--------gekgwgkllrrepmyf  458
DSSP  lllllleelLEEEEEEELLEEEEELLEEL--------llllllllllllllll


No 20: Query=2pajA Sbjct=3griA Z-score=25.2

back to top
DSSP  lEEEEELLlEELLllllllllLLLLLLLLEEEELLEEEEEL-LLLLLLLLEEEELLLLEE
Query pSTLIRNAaAIMTggrgtaddPSRVPGPDIRIVGDTIDAIG-ALAPRPGETIVDATDCVI   59
ident    || |                     || | |  |  |  |  |  |  | ||     
Sbjct -XKLIKNG-KVLQ--------NGELQQADILIDGKVIKQIApAIEPSNGVDIIDAKGHFV   50
DSSP  -LEEEELL-EEEE--------LLEEEELEEEEELLEEEEEElLLLLLLLLEEEELLLLEE


DSSP  EELEELLLLLHHhhhllllllhhhllhhHHHH--HHHHHHHHHHLLLEEEEEELLLLLLl
Query YPAWVNTHHHLFqsllkgepfralfderRFRL--AARIGLIELARSGCATVADHNYVYYp  117
ident  |  |  | ||                           |    || |  ||         
Sbjct SPGFVDVHVHLR--------------epGGEYkeTIETGTKAAARGGFTTVCPXPNTRPv   96
DSSP  EELEEEEEELLL--------------llLLLLllLHHHHHHHHHHLLEEEEEELLLLLLl


DSSP  llllLHHHHHHHHHH-HLLLEEEEEEL----LLLLlllllllllhhhllllhhHHHHhHH
Query gmpfDSSAILFEEAE-KLGLRFVLLRG----GATQtrqleadlptalrpetldAYVAdIE  172
ident          |          |                                  |    
Sbjct pdsvEHFEALQKLIDdNAQVRVLPYASittrQLGK------------------ELVD-FP  137
DSSP  lllhHHHHHHHHHHHhHLLLEELLLEEllhhHLLL------------------LLLL-HH


DSSP  HHHHHLLllllllleeEEELLLLllLLLL-HHHHHHHHHHHHHLLLEEEEELL-------
Query RLAARYHdaspramrrVVMAPTTvlYSIS-PREMRETAAVARRLGLRMHSHLS-------  224
ident  |                                 |    |         |         
Sbjct ALVKEGA---------FAFTDDG--VGVQtASXXYEGXIEAAKVNKAIVAHCEdnsliyg  186
DSSP  HHHLLLL---------LLEEELL--LLLLlHHHHHHHHHHHHHHLLLEEELLLlhhhlll


DSSP  ---------------------llLHHHHHHHLL-llllLEEEELLLLLL-hHHHHHHHH-
Query ---------------------gkSPVAFCGEHD-wlgsDVWYAHLVKVD-aDEIALLAQ-  260
ident                           |                |         |      
Sbjct gaxhegkrskelgipgipnicesVQIARDVLLAeaagcHYHVCHVSTKEsvRVIRDAKRa  246
DSSP  lleellhhhhhhllleellhhhhHHHHHHHHHHhhhllLEEELLLLLHHhhHHHHHHHHl


DSSP  -HLLEEEELHHH------------------HHLL------LLLLHHHHLLLEEELLLHHH
Query -TGTGVAHCPQS------------------NGRL------PVREMADAGVPVSIGVDGAA  295
ident          |                                 |    |    |  | | 
Sbjct gIHVTAEVTPHHlllteddipgnnaiykxnPPLRstedreALLEGLLDGTIDCIATDHAP  306
DSSP  lLLEEEEELHHHhhllhhhlllllhhhlllLLLLlhhhhhHHHHHHHLLLLLEELLLLLL


DSSP  --------------HLLLLLhHHHHHHHHHHH-hHLLLLHHHHHHHHLHHHHHHHLLLlL
Query --------------SNEAADmISEVHMTWLAQ-rARLASIAEVIHWGTAGGARVMGLDeV  340
ident                                                |        |   
Sbjct hardekaqpxekapFGIVGS-ETAFPLLYTHFvkNGDWTLQQLVDYLTIKPCETFNLE-Y  364
DSSP  llhhhhllllllllLLLLLL-LLHHHHHHHHHllLLLLLHHHHHHHHLHHHHHHLLLL-L


DSSP  LLLLLLLLLLEEEEELLLHH------hlllllhhhhhhHLLLlLEEEEEEELLEEEEELl
Query GKVAVGYAADIAVYRLDDPR------yfglhdpaigpvASGGrPSVMALFSAGKRVVVDd  394
ident |       ||     ||                                   |       
Sbjct GTLKENGYADLTIIDLDSEQeikgedflskadntpfigYKVY-GNPILTXVEGEVKFEG-  422
DSSP  LLLLLLLLLLEEEEELLLLEellhhhllllllllllllLEEL-LEEEEEEELLEEEEEL-


DSSP  llllllhhhhhhhhhhhhhhhhhhhhl
Query liegvdikelggearrvvrellrevvv  421
ident                            
Sbjct ---------------------------  422
DSSP  ---------------------------


No 21: Query=2pajA Sbjct=2ogjA Z-score=25.0

back to top
DSSP  -LEEEEELLlEELLLLlllllLLLLLLLLLEEEE-LLEEEEELLLLLLLLLEEEELlLLE
Query -PSTLIRNAaAIMTGGrgtadDPSRVPGPDIRIV-GDTIDAIGALAPRPGETIVDAtDCV   58
ident     |  |       |             || |     | | |     |  |        
Sbjct qAPILLTNV-KPVGFG-----KGASQSSTDILIGgDGKIAAVGSALQAPADTQRID-AAF   53
DSSP  lLLEEEEEE-EELLLL-----LLLLLLLEEEEELlLLLEEEEELLLLLLLLEEELL-LLE


DSSP  EEELEELLLLLHHhhhllllllhhhllhhHHHHHHhHHHHHHH-LLLEEEEEELLLLLll
Query IYPAWVNTHHHLFqsllkgepfralfderRFRLAArIGLIELA-RSGCATVADHNYVYyp  117
ident | | ||  | |                         |   |     |  |  |       
Sbjct ISPGWVDLHVHIW---------------hGGTDIS-IRPSECGaERGVTTLVDAGSAG--   95
DSSP  EEELEEEEEELLL---------------lLLLLLL-LLHHHLLhHHLEEEEEEELLLL--


DSSP  llllLHHHHHHH-HHHHLLLEEEEEELL------------LLLLllllllllhhhllLLH
Query gmpfDSSAILFE-EAEKLGLRFVLLRGG------------ATQTrqleadlptalrpETL  164
ident            |   |    |                                       
Sbjct ---eANFHGFREyIIEPSRERIKAFLNLgsiglvacnrvpELRD-------------IKD  139
DSSP  ---lLLHHHHHHhLLLLLLLEEEEEEELllllllllllllLLLL-------------HHH


DSSP  HHhHHHHHHHHHHLLLllllllEEEEELlLLLL-LLLL---HHHHHHHHHHHHHLLLEEE
Query DAyVADIERLAARYHDaspramRRVVMApTTVL-YSIS---PREMRETAAVARRLGLRMH  220
ident       |    |            |                          |  |     
Sbjct ID-LDRILECYAENSE------HIVGLX-VRAShVITGswgVTPVKLGKKIAKILKVPXX  191
DSSP  LL-HHHHHHHHHLLLL------LEEEEE-EEELhHHHLlllLHHHHHHHHHHHHHLLLEE


DSSP  EELL-lllHHHHHHHlLLLLlLEEEELLL------LLLH--HHHHHHHHH-LLEEEELhH
Query SHLS-gksPVAFCGEhDWLGsDVWYAHLV------KVDA--DEIALLAQT-GTGVAHCpQ  270
ident  |            |           |              |   |     |        
Sbjct VHVGeppaLYDEVLE-ILGP-GDVVTHCFngksgsSIXEdeDLFNLAERCeGIRLDIG-H  248
DSSP  EEELllllLHHHHHH-HLLL-LLEEELLLllllllLLLLlhHHHHHHHHLlLLEEELL-L


DSSP  HHH---llLLLLHH-HHLLLEEELLLHH-HHLL--LLLHHHHHHHHHHHHhhllLLHHHH
Query SNG---rlPVREMA-DAGVPVSIGVDGA-ASNE--AADMISEVHMTWLAQrarlASIAEV  323
ident                    | ||  |    |      |                     |
Sbjct GGAsfsfkVAEAAIaRGLLPFSISTDLHgHSXNfpVWDLATTXSKLLSVD----XPFENV  304
DSSP  LLLlllhhHHHHHHhLLLLLLLLLLLLLlLLLLllLLLHHHHHHHHHHLL----LLHHHH


DSSP  HHHHLHHHHHHHLLLLlllLLLL-LLLLEEEEELlLHHH-lllllhhhhhhHLLLLLeEE
Query IHWGTAGGARVMGLDEvgkVAVG-YAADIAVYRLdDPRY-fglhdpaigpvASGGRPsVM  381
ident     |   | |  ||           ||  |  |                          
Sbjct VEAVTRNPASVIRLDX-enRLDVgQRADFTVFDL-VDADleatdsngdvsrLKRLFE-PR  361
DSSP  HHLLLHHHHHHLLLLL-llLLLLlLLLEEEEEEE-EEEEeeeellllleeeEEEEEE-EE


DSSP  EEEELLEEeEELLllllllhhhhhhhhhhhhhhhhhhhhl
Query ALFSAGKRvVVDDliegvdikelggearrvvrellrevvv  421
ident                                         
Sbjct YAVIGAEA-IAAS---------------------ryipra  379
DSSP  EEEELLEE-EELL---------------------llllll


No 22: Query=2pajA Sbjct=3ooqA Z-score=24.5

back to top
DSSP  lEEEEELLlEELLLLlllllllLLLLLLLEEEELLEEEEEL-LLLLLlLLEEEELLLLEE
Query pSTLIRNAaAIMTGGrgtaddpSRVPGPDIRIVGDTIDAIG-ALAPRpGETIVDATDCVI   59
ident    |  ||              ||    |           |          ||| |    
Sbjct -KILFKNA-TVFPIT-------SRPFKGDVLVSNGKVEKVGeNIEDP-DAEIVDLTGKFL   50
DSSP  -LEEEEEE-EELLLL-------LLLEEEEEEEELLEEEEEElLLLLL-LLEEEELLLLEE


DSSP  EELEELLLLLH-HHHHLllllLHHHL---------------lhhhHHHHhhHHHHHHHLL
Query YPAWVNTHHHL-FQSLLkgepFRALF---------------derrFRLAarIGLIELARS  103
ident  |  |  | |                                                  
Sbjct FPGFVDAHSHIgLFEEG---vGYYYSdgneatdpvtphvkaldgfNPQD--PAIERALAG  105
DSSP  EELEEEEEELLlLLLLL---lLHHHLllllllllllllllhhhhlLLLL--HHHHHHHLL


DSSP  LEEEEEELLL----lllllllllhhhHHHHHHHhllleeeeeellllllllllllllhhh
Query GCATVADHNY----vyypgmpfdssaILFEEAEklglrfvllrggatqtrqleadlptal  159
ident |   |                     |  ||                             
Sbjct GVTSVXIVPGsanpvggqgsvikfrsIIVEECI---------------------------  138
DSSP  LEEEEEELLLlllleeeeeeeeelllLLHHHHE---------------------------


DSSP  llllhhhhhhhhhhhhhhllllllllLEEE-EELLlLLLLLL----------------LH
Query rpetldayvadierlaaryhdaspraMRRV-VMAPtTVLYSI----------------SP  202
ident                                                             
Sbjct --------------------------VKDPaGLKX-AFGENPkrvygerkqtpstrxgTA  171
DSSP  --------------------------EEEEeEEEE-ELLHHHhhhhhhlllllllhhhHH


DSSP  HHHHH------------------------------hHHHHHHLLLEEEEELLllLHHHHH
Query REMRE------------------------------tAAVARRLGLRMHSHLSgkSPVAFC  232
ident    |                                     |       |          
Sbjct GVIRDyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRKKIPARXHAHraDDILTA  231
DSSP  HHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLLLLLEEEEELlhHHHHHH


DSSP  HHLL-llllLEEEELLLLLLHhHHHHHHHHLLEEE-ELHHhHHLL----------LLLLH
Query GEHD-wlgsDVWYAHLVKVDAdEIALLAQTGTGVA-HCPQsNGRL----------PVREM  280
ident               |           ||     |         |                
Sbjct IRIAeefgfNLVIEHGTEAYK-ISKVLAEKKIPVVvGPLL-TFRTklelkdltxeTIAKL  289
DSSP  HHHHhhhllLEEEEELLLHHH-HHHHHHHHLLLEEeLLLL-LLLLlhhhllllllHHHHH


DSSP  HHHLLLEEELLLHHhhLLLL-LHHHHHHHhHHHHHhllLLHHHHHHHHLHHHHHHHLLL-
Query ADAGVPVSIGVDGAasNEAA-DMISEVHMtWLAQRarlASIAEVIHWGTAGGARVMGLD-  338
ident    ||      |                          |         |   |   ||  
Sbjct LKDGVLIALXCDHP--VIPLeFATVQAAT-AXRYG---AKEEDLLKILTVNPAKILGLEd  343
DSSP  HHLLLLEEELLLLL--LLLHhHHHHHHHH-HHHHL---LLHHHHHHLLLHHHHHHLLLLl


DSSP  LLLLLLLLLLLLEEEEELllhhhlllllhhhHHHHllLLLEEEEEEELLEEEEELlllll
Query EVGKVAVGYAADIAVYRLddpryfglhdpaiGPVAsgGRPSVMALFSAGKRVVVDdlieg  398
ident   |    |  ||  |                 |        |      |  |        
Sbjct RIGSIEPGKDADLVVWSG-------------HPFD--XKSVVERVYIDGVEVFRR-----  383
DSSP  LLLLLLLLLLLLEEEELL-------------LLLL--LLLLEEEEEELLEEEEEL-----


DSSP  llhhhhhhhhhhhhhhhhhhhhl
Query vdikelggearrvvrellrevvv  421
ident                        
Sbjct ----------------------e  384
DSSP  ----------------------l


No 23: Query=2pajA Sbjct=3e74A Z-score=24.0

back to top
DSSP  -LEEEEELLlEELLLlllllllLLLLLlLLEEEELLEEEEELL-LLLLllLEEEELLLLE
Query -PSTLIRNAaAIMTGgrgtaddPSRVPgPDIRIVGDTIDAIGA-LAPRpgETIVDATDCV   58
ident      | |                     ||   |  | |||  |         ||   |
Sbjct sFDLIIKNG-TVILE-------NEARV-VDIAVKGGKIAAIGQdLGDA--KEVXDASGLV   49
DSSP  lEEEEEELL-EEELL-------LLEEE-LEEEEELLEEEEEELlLLLE--EEEEELLLLE


DSSP  EEELEELLLLLHhhhhllllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLLLLL--
Query IYPAWVNTHHHLfqsllkgepfralfderrfrlAARIGLIELARSGCATVADHNYVYY--  116
ident   |  |  | |                          |    |  |  |           
Sbjct VSPGXVDAHTHI---------------------GYETGTRAAAKGGITTXIEXPLNQLpa   88
DSSP  EEELEEEEEELL---------------------LHHHHHHHHHHLLEEEEEELLLLLLll


DSSP  ---llllLLHHHHHHHHHhhlLLEEEEEELLLLllllllllllhhhllllhhHHHHHHHH
Query ---pgmpFDSSAILFEEAeklGLRFVLLRGGATqtrqleadlptalrpetldAYVADIER  173
ident                            | |                              
Sbjct tvdrasiELKFDAAKGKL---TIDAAQLGGLVS-------------------YNIDRLHE  126
DSSP  lllhhhhHHHHHHHLLLL---LLEEEELEELLL-------------------LLLLLHHH


DSSP  HHHHLlllllllleEEEELLllLLLLLLHHHHHHHHHHHHHLLLEEEEELL---------
Query LAARYhdaspramrRVVMAPttVLYSISPREMRETAAVARRLGLRMHSHLS---------  224
ident |              |                   |     ||     |           
Sbjct LDEVG---------VVGFXC--FVRDVNDWQFFKGAQKLGELGQPVLVHCEnalicdelg  175
DSSP  HHHHL---------LLLEEE--ELLLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhh


DSSP  ----------------------llLHHHHHHHLLL-lllLEEEELLLLLLhhHHHHHHHH
Query ----------------------gkSPVAFCGEHDW-lgsDVWYAHLVKVDadEIALLAQT  261
ident                                             |               
Sbjct eeakregrvtahdyvasrpvftevEAIRRVLYLAKvagcRLHVCHVSSPE--GVEEVTRA  233
DSSP  hhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHhhllLEEELLLLLHH--HHHHHHHH


DSSP  L-----LEEEELHH------------------hHHLL------LLLLHHHHLLLEEELLL
Query G-----TGVAHCPQ------------------sNGRL------PVREMADAGVPVSIGVD  292
ident            ||                                 |    |       |
Sbjct RqegqdITCESCPHyfvldtdqfeeigtlakcsPPIRdlenqkGXWEKLFNGEIDCLVSD  293
DSSP  HhllllEEEEELLHhhhllhhhhhhhlhhhlllLLLLlhhhhhHHHHHHHLLLLLEELLL


DSSP  HHH---------------HLLLLL-HHHHHH-HHHHHHHhllLLHHHHHHHHLHHHHHHH
Query GAA---------------SNEAAD-MISEVH-MTWLAQRarlASIAEVIHWGTAGGARVM  335
ident                                            |            |   
Sbjct HSPcppexkagnixkawgGIAGLQsCXDVXFdEAVQKRG---XSLPXFGKLXATNAADIF  350
DSSP  LLLlllllllllllllllLLLLHHhHHHHHHhHHLLLLL---LLHHHHHHHHLHHHHHHL


DSSP  LLLLLLLLLLLLLLLEEEEEL-LLHH-----hlllllhhhhhhhLLLLLeEEEEEELLEE
Query GLDEVGKVAVGYAADIAVYRL-DDPR-----yfglhdpaigpvaSGGRPsVMALFSAGKR  389
ident ||   |  | |  ||                               |          |  
Sbjct GLQQKGRIAPGKDADFVFIQPnSSYVltnddleyrhkvspyvgrTIGAR-ITKTILRGDV  409
DSSP  LLLLLLLLLLLLLLLEEEEELlLLEEllhhhlllllllllllllEELLE-EEEEEELLEE


DSSP  EEELL-LLLLLlhhhhhhhhhhhhhhhhhhhhl
Query VVVDD-LIEGVdikelggearrvvrellrevvv  421
ident                                  
Sbjct IYDIEqGFPVA-------------pkgqfilkh  429
DSSP  EEELLlLLLLL-------------lllleelll


No 24: Query=2pajA Sbjct=4b3zD Z-score=23.4

back to top
DSSP  LEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEELL-LLLLLLLEEEELLLLEE
Query PSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIGA-LAPRPGETIVDATDCVI   59
ident    ||     |                 |       |  ||  |    |     |     
Sbjct DRLLIKGG-RIIND--------DQSLYADVYLEDGLIKQIGEnLIVPGGVKTIEANGRMV   51
DSSP  LEEEEEEE-EEELL--------LLEEEEEEEEELLEEEEEELlLLLLLLLEEEELLLLEE


DSSP  EELEELLLLLHHHhhllllllhhhllhhHHHHHHHHHHHHHHLLLEEEEEELLLLLLLL-
Query YPAWVNTHHHLFQsllkgepfralfderRFRLAARIGLIELARSGCATVADHNYVYYPG-  118
ident  |        |                         |       |     ||        
Sbjct IPGGIDVNTYLQK---------------TAADDFFQGTRAALVGGTTMIIDHVVPEPGSs   96
DSSP  EELEEEEEELLLL---------------LLLLLHHHHHHHHHHLLEEEEEEEELLLLLLl


DSSP  ---llLLHHHHHHHHHhhlLLEEEEEELLLLllllllllllhhhllLLHHHhHHHHHHHH
Query ---mpFDSSAILFEEAeklGLRFVLLRGGATqtrqleadlptalrpETLDAyVADIERLA  175
ident                         |                               | | 
Sbjct lltsfEKWHEAADTKS---CCDYSLHVDITS---------------WYDGV-REELEVLV  137
DSSP  hhhhhHHHHHHHHLLL---LLEEEEEEELLL---------------LLLLH-HHHHHHHH


DSSP  HHLLllllllleEEEELLllLLLL-----LLHHHHHHHHHHHHHLLLEEEEELL------
Query ARYHdaspramrRVVMAPttVLYS-----ISPREMRETAAVARRLGLRMHSHLS------  224
ident                               |     |       ||     |        
Sbjct QDKG--------VNSFQV--YMAYkdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdlia  187
DSSP  HLLL--------LLEEEE--ELLLlllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhh


DSSP  -------------------------llLHHHHHHHLL-llllLEEEELLLLLL--HHHHH
Query -------------------------gkSPVAFCGEHD-wlgsDVWYAHLVKVD--ADEIA  256
ident                              |             |                
Sbjct qeqkrilemgitgpeghalsrpeeleaEAVFRAITIAgrincPVYITKVMSKSaaDIIAL  247
DSSP  hhhhhhhhllllllhhhhhhllhhhhhHHHHHHHHHHhhhllLEEEEEELLHHhhHHHHH


DSSP  HH-hHHLLEEEELHHH-HHLL-----------------------------LLLLHHHhLL
Query LL-aQTGTGVAHCPQS-NGRL-----------------------------PVREMADaGV  285
ident                |                                       |  | 
Sbjct ARkkGPLVFGEPIAASlGTDGthywsknwakaaafvtspplspdpttpdyLTSLLAC-GD  306
DSSP  HHhhLLLEEEEELHHHhHLLLhhhhlllhhhhhhllllllllllllhhhhHHHHHHH-LL


DSSP  LEEELLLHHH------------------HLLLLL-HHHHHHHHH-HHHHhllLLHHHHHH
Query PVSIGVDGAA------------------SNEAAD-MISEVHMTW-LAQRarlASIAEVIH  325
ident     |                                  |                    
Sbjct LQVTGSGHCPystaqkavgkdnftlipeGVNGIEeRMTVVWDKAvATGK---MDENQFVA  363
DSSP  LLLLLLLLLLllhhhhhhhlllhhhlllLLLLLLlHHHHHHHHHlLLLL---LLHHHHHH


DSSP  HHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELLL------hhhlllllhhhhhhhLLLLL
Query WGTAGGARVMGLD-EVGKVAVGYAADIAVYRLDD------pryfglhdpaigpvaSGGRP  378
ident       |    |    |  |||  ||      |                           
Sbjct VTSTNAAKIFNLYpRKGRIAVGSDADVVIWDPDKlktitakshksaveynifegmECHGS  423
DSSP  HHLHHHHHHHLLLlLLLLLLLLLLLLEEEEEEEEeeellllllllllllllllllEEEEE


DSSP  eEEEEEELLEEEEELLLLLLL------------lhhhhhhhhhhhhhhhhhhhhl
Query sVMALFSAGKRVVVDDLIEGV------------dikelggearrvvrellrevvv  421
ident       | || |  |  |                                     
Sbjct -PLVVISQGKIVFEDGNINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  -EEEEEELLEEEEELLEELLLlllllllllllllhhhhhhhhhhhhhllllllll


No 25: Query=2pajA Sbjct=1a4mA Z-score=20.2

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct -------------------------------------------------------tpafN    5
DSSP  -------------------------------------------------------llllL


DSSP  ELEELLLLLHHHHHL-------------------------LLLL---------------L
Query PAWVNTHHHLFQSLL-------------------------KGEP---------------F   80
ident    |  | ||                                                  
Sbjct KPKVELHVHLDGAIKpetilyfgkkrgialpadtveelrnIIGMdkplslpgflakfdyY   65
DSSP  LLEEEEEEEHHHLLLhhhhhhhhhhhllllllllhhhhhhHHLLlllllhhhhhllhhhH


DSSP  HHHL--LHHHHHHHHHHHHHHHHLLLEEEEEELLLLLL-------LLLL---------lL
Query RALF--DERRFRLAARIGLIELARSGCATVADHNYVYY-------PGMP---------fD  122
ident               |       |  |   |               |             |
Sbjct MPVIagCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdPMPWnqtegdvtpdD  125
DSSP  HHHHllLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHHhllllllLLHHhlllllllhhH


DSSP  HHHHHHHHHHHLL----LEEEEEELLLLLlllllllllhhhlllLHHHHHHHHHHHHhHL
Query SSAILFEEAEKLG----LRFVLLRGGATQtrqleadlptalrpeTLDAYVADIERLAaRY  178
ident                                                      |     |
Sbjct VVDLVNQGLQEGEqafgIKVRSILCCMRH---------------QPSWSLEVLELCK-KY  169
DSSP  HHHHHHHHHHHHHhhhlLEEEEEEEEELL---------------LHHHHHHHHHHHH-HL


DSSP  LLllllllEEEEELLLLLLL--lLLHHH-HHHHHHHHHHLLLEEEEELL---llLHHHHH
Query HDaspramRRVVMAPTTVLY--sISPRE-MRETAAVARRLGLRMHSHLS---gkSPVAFC  232
ident           | |           |      |    |   |     |         |   
Sbjct NQ-----kTVVAMDLAGDETiegSSLFPgHVEAYEGAVKNGIHRTVHAGevgspEVVREA  224
DSSP  LL-----lLEEEEEEELLLLlllHHHLHhHHHHHHHHHHHLLEEEEEELllllhHHHHHH


DSSP  HHLLLLlllEEEELLLLL--LHHHHHHHHHHLLEEEELHHHHHLL---------LLLLHH
Query GEHDWLgsdVWYAHLVKV--DADEIALLAQTGTGVAHCPQSNGRL---------PVREMA  281
ident              |      |      |         || |              |    
Sbjct VDILKT---ERVGHGYHTieDEALYNRLLKENMHFEVCPWSSYLTgawdpktthAVVRFK  281
DSSP  HHLLLL---LEEEELHHHhhLHHHHHHHHHLLLEEEELHHHHHHLlllllllllHHHHHH


DSSP  HHLLLEEELLLHHHHLLLlLHHHHHHHHHHHHHhllLLHHHHHHHhLHHHHHHHL-----
Query DAGVPVSIGVDGAASNEAaDMISEVHMTWLAQRarlASIAEVIHWgTAGGARVMG-----  336
ident       |   |               ||            |         |         
Sbjct NDKANYSLNTDDPLIFKS-TLDTDYQMTKKDMG---FTEEEFKRL-NINAAKSSFlpeee  336
DSSP  HLLLLEEELLLLLLLLLL-LHHHHHHHHHHLLL---LLHHHHHHH-HHHHHHLLLllhhh


DSSP  LLLLL--LLLLllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeell
Query LDEVG--KVAVgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvdd  394
ident   |                                                         
Sbjct KKELLerLYRE-------------------------------------------------  347
DSSP  HHHHHhhHHHH-------------------------------------------------


DSSP  llllllhhhhhhhhhhhhhhhhhhhhl
Query liegvdikelggearrvvrellrevvv  421
ident                            
Sbjct -------------------------yq  349
DSSP  -------------------------ll


No 26: Query=2pajA Sbjct=1a5kC Z-score=18.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----LEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEELLLL-----------L
Query ----PSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIGALA-----------P   45
ident           ||  |                 ||      | |||               
Sbjct aadcVDLVLTNA-LIVDH--------WGIVKADIGVKDGRIFAIGKAGnpdiqpnvtipI  111
DSSP  hhhlLLEEEEEE-EEEEL--------LEEEEEEEEEELLEEEEEELEEllllllllleeL


DSSP  LLLLEEEELLLLEEEELEELLLLLHHhhhllllllhhhllhhhhhhhHHHHHHHHHLLLE
Query RPGETIVDATDCVIYPAWVNTHHHLFqsllkgepfralfderrfrlaARIGLIELARSGC  105
ident         |           || |                             |   || 
Sbjct GAATEVIAAEGKIVTAGGIDTHIHWI---------------------CPQQAEEALVSGV  150
DSSP  LLLLEEEELLLLEEEELEEEEEEELL---------------------LLLHHHHHHHHLE


DSSP  EEEEEL-----------LLLLllllllLHHHHHHHHHHHLLLEEEEEELLLLllllllll
Query ATVADH-----------NYVYypgmpfDSSAILFEEAEKLGLRFVLLRGGATqtrqlead  154
ident  |                                  |  |     ||  |          
Sbjct TTMVGGgtgpaagthatTCTP----gpWYISRMLQAADSLPVNIGLLGKGNV--------  198
DSSP  EEEEEElllllhhhhhlLLLL----hhHHHHHHHHHHLLLLLEEEEEEELLL--------


DSSP  llhhhlllLHHHHHHHHHHHhhhllllllllleeEEELLLllLLLL-LHHHHHHHHHHHH
Query lptalrpeTLDAYVADIERLaaryhdaspramrrVVMAPTtvLYSI-SPREMRETAAVAR  213
ident           ||                                    |        || 
Sbjct -------sQPDALREQVAAG-------------vIGLEIH--EDWGaTPAAIDCALTVAD  236
DSSP  -------lLHHHHHHHHHHL-------------lLEEEEE--HHHLlLHHHHHHHHHHHH


DSSP  HLLLEEEEELL----LLLHhHHHHHLLLLLlLEEEELLLL----lLHHHHHHHHHHLLEE
Query RLGLRMHSHLS----GKSPvAFCGEHDWLGsDVWYAHLVK----vDADEIALLAQTGTGV  265
ident         |                           |          | |   |      
Sbjct EMDIQVALHSDtlneSGFV-EDTLAAIGGR-TIHTFHTEGaggghAPDIITACAHPNILP  294
DSSP  HHLLEEEEELLllllLLLH-HHHHHHHLLL-LEEELLLLLlllllLLLHHHHHHLLLEEE


DSSP  EELHHH---------------------------------------hhllLLLLHHHhLLL
Query AHCPQS---------------------------------------ngrlPVREMADaGVP  286
ident                                                          |  
Sbjct SSTNPTlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaEDVLHDL-GAF  353
DSSP  EEEHHHllllllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHHL-LLL


DSSP  EEELLLHHHHlLLLLhhHHHHHHHHHHHHLL---------------lLHHHHHHHHLHHH
Query VSIGVDGAASnEAADmiSEVHMTWLAQRARL---------------aSIAEVIHWGTAGG  331
ident      |  |             ||                            |   |   
Sbjct SLTSSDSQAM-GRVG--EVILRTWQVAHRMKvqrgalaeetgdndnfRVKRYIAKYTINP  410
DSSP  LEEELLLLLL-LLLL--LHHHHHHHHHHHHHhhhlllllllllllhhHHHHHHHLLLHHH


DSSP  HHHHLLL-LLLLLLLLLLLLEEEEELllhhhlllllhhHHHHhlllLLEEeEEEELLEEE
Query ARVMGLD-EVGKVAVGYAADIAVYRLddpryfglhdpaIGPVasggRPSVmALFSAGKRV  390
ident |   |   |||   ||  ||  |                                 |   
Sbjct ALTHGIAhEVGSIEVGKLADLVVWSP------------AFFG----VKPA-TVIKGGMIA  453
DSSP  HHHLLLLlLLLLLLLLLLLLEEEELH------------HHLL----LLLL-EEEELLEEE


DSSP  EEL---------------LLLL--------------------------------------
Query VVD---------------DLIE--------------------------------------  397
ident                                                             
Sbjct IAPmgdinasiptpqpvhYRPMfgalgsarhhcrltflsqaaaangvaerlnlrsaiavv  513
DSSP  EEEellllllllllllleEEELhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeel


DSSP  -----------------------------lllhhhhhhhhhhhhhhhhhhhhl
Query -----------------------------gvdikelggearrvvrellrevvv  421
ident                                                      
Sbjct kgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 27: Query=2pajA Sbjct=1bf6A Z-score=17.3

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct --------------------------------------------------------sfdp    4
DSSP  --------------------------------------------------------llll


DSSP  ELEELLLLLHHhhhlllllLHHH-----llhhHHHHHHHHHHHHHHLLLEEEEEELLLLL
Query PAWVNTHHHLFqsllkgepFRAL-----fderRFRLAARIGLIELARSGCATVADHNYVY  115
ident       | ||                                  |   |   |      |
Sbjct TGYTLAHEHLH-------iDLSGfknnvdcrlDQYAFICQEMNDLMTRGVRNVIEMTNRY   57
DSSP  LLEEEEEELLL-------eELHHhhllhhheeLLHHHHHHHHHHHHHLLEEEEEELLLHH


DSSP  lllllllHHHHHHHHHHHLLLEEEEEELL-LLLLllllllllhhHLLL---LHHHHHHHH
Query ypgmpfdSSAILFEEAEKLGLRFVLLRGG-ATQTrqleadlptaLRPE---TLDAYVADI  171
ident                    |   |   |                                
Sbjct ----mgrNAQFMLDVMRETGINVVACTGYyQDAF---------fPEHVatrSVQELAQEM  104
DSSP  ----hllLHHHHHHHHHHHLLEEEEEELLlLHHH---------lLLHHhhlLHHHHHHHH


DSSP  HHHHHHLlllllllleEEEELlLLLLL-----lLLHHHHHHHHHHHHHLLLEEEEELLll
Query ERLAARYhdaspramrRVVMApTTVLY-----sISPREMRETAAVARRLGLRMHSHLSgk  226
ident                     |                     |      |     | |  
Sbjct VDEIEQG--idgtelkAGIIA-EIGTSegkitpLEEKVFIAAALAHNQTGRPISTHTSfs  161
DSSP  HHHHHLL--lllllllEEEEE-EEELLlllllhHHHHHHHHHHHHHHHHLLLEEEELHhh


DSSP  lHHHHHHHLL----llLLLEEEELLL--LLLHhHHHHHHHHLLEEEELHHHHHLL-----
Query sPVAFCGEHD----wlGSDVWYAHLV--KVDAdEIALLAQTGTGVAHCPQSNGRL-----  275
ident                  | |   |          |      |  |               
Sbjct tMGLEQLALLqahgvdLSRVTVGHCDlkDNLD-NILKMIDLGAYVQFDTIGKNSYypdek  220
DSSP  lLHHHHHHHHhhllllHHHEEELLLLllLLHH-HHHHHHHLLLEEEELLLLLLLLllhhh


DSSP  ---LLLLHH-HHLL-LEEELLLHHH-------hlLLLLhhHHHH-HHHHHHHHLlLLHHH
Query ---PVREMA-DAGV-PVSIGVDGAA-------snEAADmiSEVH-MTWLAQRARlASIAE  322
ident                 |    |               |                  | | 
Sbjct riaMLHALRdRGLLnRVMLSMDITRrshlkanggYGYD--YLLTtFIPQLRQSG-FSQAD  277
DSSP  hhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhllLLLL--HHHHlHHHHHHHLL-LLHHH


DSSP  HHHHHLHHHHHHHLlllllllllllllleeeeelllhhhlllllhhhhhhhllllleeee
Query VIHWGTAGGARVMGldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvma  382
ident |                                                           
Sbjct VDVMLRENPSQFFQ----------------------------------------------  291
DSSP  HHHHHLHHHHHHLL----------------------------------------------


DSSP  eeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query lfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                        
Sbjct ---------------------------------------  291
DSSP  ---------------------------------------


No 28: Query=2pajA Sbjct=2y1hB Z-score=17.3

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct -----------------------------------------------------------G    1
DSSP  -----------------------------------------------------------L


DSSP  ELEELLLLLH-HHHHllllllhhhllhhhHHHHhHHHHHHHHLLLEEEEEELLLLLLlll
Query PAWVNTHHHL-FQSLlkgepfralfderrFRLAaRIGLIELARSGCATVADHNYVYYpgm  119
ident    |  | ||                    |      |                      
Sbjct VGLVDCHCHLsAPDF--------------DRDL-DDVLEKAKKANVVALVAVAEHSG---   43
DSSP  LLEEEEEELLlLHHH--------------LLLH-HHHHHHHHHLLEEEEEELLLLHH---


DSSP  llLHHHHHHHHHHhllLEEEEEELLL-lLLLLllllllhhhllLLHHHHHHHHHHHHHhl
Query pfDSSAILFEEAEklgLRFVLLRGGA-tQTRQleadlptalrpETLDAYVADIERLAAry  178
ident        | |             |    |                ||     ||      
Sbjct efEKIMQLSERYN---GFVLPCLGVHpvQGLD-----qrsvtlKDLDVALPIIENYKD--   93
DSSP  hhHHHHHHHHHLL---LLEEEEELLLleELLL-----leellhHHHHHHHHHHHHHLL--


DSSP  llllllllEEEEELLLlLLLL------------lLHHHHHHHHHHHHHLLLEEEEELLll
Query hdaspramRRVVMAPTtVLYS------------iSPREMRETAAVARRLGLRMHSHLSgk  226
ident         |         |                          | || |    |    
Sbjct --------RLLAIGEV-GLDFsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR--  142
DSSP  --------LLLEEEEE-EEELlllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE--


DSSP  lHHHHHHHLL--llLLLEEEELLLLLLHhHHHHHHHHLLEEEELhHHHHLL-----LLLL
Query sPVAFCGEHD--wlGSDVWYAHLVKVDAdEIALLAQTGTGVAHCpQSNGRL-----PVRE  279
ident                  |                   |        |  |       |  
Sbjct sAGRPTINLLqeqgAEKVLLHAFDGRPS-VAMEGVRAGYFFSIP-PSIIRSgqkqkLVKQ  200
DSSP  lLHHHHHHHHhhllLLLEEEELLLLLHH-HHHHHHHLLLEEEEL-HHHHLLhhhhhHHHH


DSSP  HHhhllLEEELLLHHHHL------LLLL-HHHHHHHHHHHHHhllLLHHH-HHHHhLHHH
Query MAdagvPVSIGVDGAASN------EAAD-MISEVHMTWLAQRarlASIAE-VIHWgTAGG  331
ident             |  |                              |  |      |   
Sbjct LP--ltSICLETDSPALGpekqvrNEPWnISISAEYIAQVKG---ISVEEvIEVT-TQNA  254
DSSP  LL--hhHEEELLLLLLLLllllllLLHHhHHHHHHHHHHHHL---LLHHHhHHHH-HHHH


DSSP  HHHHL-LLLLlllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleee
Query ARVMG-LDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrv  390
ident       |                                                     
Sbjct LKLFPkLRHL--------------------------------------------------  264
DSSP  HHHLLlHHHH--------------------------------------------------


DSSP  eellllllllhhhhhhhhhhhhhhhhhhhhl
Query vvddliegvdikelggearrvvrellrevvv  421
ident                                
Sbjct ------------------------------l  265
DSSP  ------------------------------l


No 29: Query=2pajA Sbjct=3k2gB Z-score=17.0

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ----------------------------------slselspchvrsgrixtvdgpipssa   26
DSSP  ----------------------------------llllllllllllleeeelleeeehhh


DSSP  eLEELLLLLHH----------------------------------hhhllLLLLhhhllh
Query pAWVNTHHHLF----------------------------------qsllkGEPFralfde   86
ident       | ||                                                  
Sbjct lGHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkHNIA------   80
DSSP  lLLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllLLLE------


DSSP  hHHHHHHHHHHHHHHLLLEEEEEELLLLLlllllllHHHHHHHHHHHLLLEEEEEElLLL
Query rRFRLAARIGLIELARSGCATVADHNYVYypgmpfdSSAILFEEAEKLGLRFVLLRgGAT  146
ident       |       |  |     |                |       |   |       
Sbjct lDDLDLAIAEVKQFAAVGGRSIVDPTCRG----igrDPVKLRRISAETGVQVVXGAgYYL  136
DSSP  eLLHHHHHHHHHHHHHLLLLEEEELLLLL----lllLHHHHHHHHHHHLLEEEELLlLLL


DSSP  LLllllllllhhhLLLL------hHHHHHHHHHHHH------HLLLlllllleeEEELLL
Query QTrqleadlptalRPET------lDAYVADIERLAA------RYHDaspramrrVVMAPT  194
ident                         |     |   |                         
Sbjct AS-----------SXPEtaarlsaDDIADEIVAEALegtdgtDARI--------GLIGEI  177
DSSP  HH-----------HLLHhhhlllhHHHHHHHHHHHHllllllLLLL--------LLEEEE


DSSP  LLLL---lLLHHHHHHHHHHHHHLLLEEEEELL-llLHHHHHHHLL----llLLLEEEEL
Query TVLY---sISPREMRETAAVARRLGLRMHSHLS-gkSPVAFCGEHD----wlGSDVWYAH  246
ident  |            |  |    | ||    ||                           |
Sbjct GVSSdftaEEEKSLRGAARAQVRTGLPLXVHLPgwfRLAHRVLDLVeeegadLRHTVLCH  237
DSSP  LLLLlllhHHHHHHHHHHHHHHHHLLLEEELLLlllLLHHHHHHHHhhllllHHHEEELL


DSSP  LLLL--LHHHHHHHHHHLLEEE-ELHHhHHLL----------------LLLLHHHHLL--
Query LVKV--DADEIALLAQTGTGVA-HCPQsNGRL----------------PVREMADAGV--  285
ident       |    | ||| |                                   || |   
Sbjct XNPShxDPVYQATLAQRGAFLEfDXIG-XDFFyadqgvqcpsddevarAILGLADHGYld  296
DSSP  LHHHllLHHHHHHHHHHLLEEEeLLLL-LLLEelllleelllhhhhhhHHHHHHHLLLhh


DSSP  LEEELLLH-HHHL-----LLLLhHHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHhLLLL
Query PVSIGVDG-AASN-----EAADmISEVHMTWLAQRARLASIAEVIHWGTAGGARVmGLDE  339
ident       |                           |      |           ||     
Sbjct RILLSHDVfVKXXltrygGNGY-AFVTKHFLPRLRRHGLDDAALETLXVTNPRRV-FDAS  354
DSSP  HEEELLLLlLHHHlhhhlLLLL-LHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHH-HLLL


DSSP  llllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelllllll
Query vgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegv  399
ident                                                             
Sbjct ------------------------------------------------------------  354
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhhhhhhhl
Query dikelggearrvvrellrevvv  421
ident                       
Sbjct ------------------iegh  358
DSSP  ------------------llll


No 30: Query=2pajA Sbjct=2ob3A Z-score=17.0

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ----------------------------------------------drintvrgpitise   14
DSSP  ----------------------------------------------lleeelleeelhhh


DSSP  eLEELLLLLHHhhhllllllhHHLL--------HHHHHHHHHHHHHHHHLLLEEEEEELL
Query pAWVNTHHHLFqsllkgepfrALFD--------ERRFRLAARIGLIELARSGCATVADHN  112
ident      || |                               |  ||      |  |  |  
Sbjct aGFTLTHEHIC------gssaGFLRawpeffgsRKALAEKAVRGLRRARAAGVRTIVDVS   68
DSSP  hLLEEEEELLE------elllLHHHhlhhhhllHHHHHHHHHHHHHHHHHLLLLEEEELL


DSSP  LLLlllllllHHHHHHHHHHHLLLEEEEEELL-LLLLllllllllhhhLLLL---hHHHH
Query YVYypgmpfdSSAILFEEAEKLGLRFVLLRGG-ATQTrqleadlptalRPET---lDAYV  168
ident               | |         |   |                             
Sbjct TFD----igrDVSLLAEVSRAADVHIVAATGLwFDPP-----------LSMRlrsvEELT  113
DSSP  LHH----hllLHHHHHHHHHHHLLEEELEEELlLLLL-----------HHHHlllhHHHH


DSSP  HHHHHHHH------HLLLlllllleeEEELLlLLLL---lLLHHHHHHHHHHHHHLLLEE
Query ADIERLAA------RYHDaspramrrVVMAPtTVLY---sISPREMRETAAVARRLGLRM  219
ident     |                                            |      |   
Sbjct QFFLREIQygiedtGIRA--------GIIXV-ATTGkatpFQELVLKAAARASLATGVPV  164
DSSP  HHHHHHHHllllllLLLL--------LEEEE-ELLLlllhHHHHHHHHHHHHHHHHLLLE


DSSP  EEELL-llLHHHHHHHLL----llLLLEEEELL-LLLLHHHHHHHHHHLLEEEELHHHHH
Query HSHLS-gkSPVAFCGEHD----wlGSDVWYAHL-VKVDADEIALLAQTGTGVAHCPQSNG  273
ident   |                      | |   |     |      ||  |           
Sbjct TTHTAasqRDGEQQAAIFeseglsPSRVCIGHSdDTDDLSYLTALAARGYLIGLDHIPYS  224
DSSP  EEELLhhhLHHHHHHHHHhhllllHHHEEELLHhHLLLHHHHHHHHHLLLEEEELLLLLL


DSSP  L----------------------lLLLLHHHHLL--LEEELLLHH---------------
Query R----------------------lPVREMADAGV--PVSIGVDGA---------------  294
ident                               | |         |                 
Sbjct AiglednasasallgirswqtralLIKALIDQGYmkQILVSNDWTfgfssyvtnimdvmd  284
DSSP  LllllllhhhhhhhllllhhhhhhHHHHHHHLLLhhHEEELLLLLleellllllhhhhhh


DSSP  hhLLLLLHhHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleeee
Query asNEAADMiSEVHMTWLAQRARLASIAEVIHWGTAGGARVMGldevgkvavgyaadiavy  354
ident   |                |                 ||                     
Sbjct rvNPDGMA-FIPLRVIPFLREKGVPQETLAGITVTNPARFLS------------------  325
DSSP  hhLLLHHH-HHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHL------------------


DSSP  elllhhhlllllhhhhhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhh
Query rlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvre  414
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  hhhhhhl
Query llrevvv  421
ident        
Sbjct ---ptlr  329
DSSP  ---llll


No 31: Query=2pajA Sbjct=3cjpA Z-score=16.2

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEELLLLLHHhhhllllllhhhllhhhhhHHHHHHHHHHHLLLEEEEEELLLL------
Query pAWVNTHHHLFqsllkgepfralfderrfrLAARIGLIELARSGCATVADHNYV------  114
ident       | |                     |            |                
Sbjct -LIIDGHTHVI-------------------LPVEKHIKIMDEAGVDKTILFSTSihpeta   40
DSSP  -LLEEEEEELL-------------------LLHHHHHHHHHHHLLLEEEEELLLllhhhl


DSSP  ----------------------lLLLL---llLHHHHHHHHHHhllLEEEEEELLLLLll
Query ----------------------yYPGM---pfDSSAILFEEAEklgLRFVLLRGGATQtr  149
ident                                                | |          
Sbjct vnlrdvkkemkklndvvngktnsMIDVrrnsiKELTNVIQAYP---SRYVGFGNVPVG--   95
DSSP  llhhhhhhhhhhhhhhhllllllLHHHhhhhhHHHHHHHHHLL---LLEEEEELLLLL--


DSSP  lllllllhhhllLLHHHHHHHHHHH-HHHLlllllllleEEEELlLLLLLllLHHHHHHH
Query qleadlptalrpETLDAYVADIERL-AARYhdaspramrRVVMApTTVLYsiSPREMRET  208
ident                      ||                 |                   
Sbjct ------------LSENDTNSYIEENiVNNK---------LVGIG-ELTPAsgQIKSLKPI  133
DSSP  ------------LLHHHHHHHHHHHlLLLL---------LLEEE-EELLLllLHHHHHHH


DSSP  HHHHHHLL-LEEEEELL---lLLHHHHHHHLL--llllLEEEELL-LLLLHHHHHHHHHH
Query AAVARRLG-LRMHSHLS---gKSPVAFCGEHD--wlgsDVWYAHL-VKVDADEIALLAQT  261
ident        | |    |              |         |   |           |    
Sbjct FKYSMDSGsLPIWIHAFnplvLQDIKEIAELCkafpkvPVILGHMgGSNWMTAVELAKEI  193
DSSP  HHHHHHLLlLLEEELLLllllHHHHHHHHHHHhhllllLEEEHHHhHHHHHHHHHHHHHL


DSSP  L-LEEEELhhHHHL-----lLLLLHHhhllLEEELLLHHhhLLLLlhHHHHHHHHHHHhh
Query G-TGVAHCpqSNGR-----lPVREMAdagvPVSIGVDGAasNEAAdmISEVHMTWLAQra  315
ident                        |          | |                       
Sbjct QnLYLDTS--AYFStfvlkiVINELP---lKCIFGTDMP--FGDL--QLSIEAIKKMS--  242
DSSP  LlEEEELL--LLLLhhhhhhHHHHLL---lLEELLLLLL--LLLH--HHHHHHHHHHL--


DSSP  llLLHHHHHHHHLHHHHHHHLLllllllllllllleeeeelllhhhlllllhhhhhhhll
Query rlASIAEVIHWGTAGGARVMGLdevgkvavgyaadiavyrlddpryfglhdpaigpvasg  375
ident                  |                                          
Sbjct --NDSYVANAVLGDNISRLLNI--------------------------------------  262
DSSP  --LLHHHHHHHHLHHHHHHHLL--------------------------------------


DSSP  llleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query grpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                               
Sbjct ----------------------------------------------  262
DSSP  ----------------------------------------------


No 32: Query=2pajA Sbjct=2vc5A Z-score=16.1

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ---------------------------------------------mriplvgkdsieskd   15
DSSP  ---------------------------------------------llllllllllllhhh


DSSP  eLEELLLLLHHHhhlllllLHHHL-------LHHHHHHHHHHHHHHHHLLLEEEEEELLL
Query pAWVNTHHHLFQsllkgepFRALF-------DERRFRLAARIGLIELARSGCATVADHNY  113
ident       | ||           |          |      |          |  |  |   
Sbjct iGFTLIHEHLRV------fSEAVRqqwphlyNEDEEFRNAVNEVKRAMQFGVKTIVDPTV   69
DSSP  lLLEELLLLLLL------lLHHHHhhlhhhlLHHHHHHHHHHHHHHHHHLLLLEEEELLL


DSSP  LLlllllllHHHHHHHHHHHLLLEEEEEEL-LLLL-LLLLlllllhhhlllLHHHHHHHH
Query VYypgmpfdSSAILFEEAEKLGLRFVLLRG-GATQ-TRQLeadlptalrpeTLDAYVADI  171
ident                      |   |   |                       |      
Sbjct MG----lgrDIRFMEKVVKATGINLVAGTGiYIYIdLPFY-------flnrSIDEIADLF  118
DSSP  LL----lllLHHHHHHHHHLLLLEEEELEElLLLLlLLHH-------hlllLHHHHHHHH


DSSP  HHHH------HHLLllllllleEEEELLlLLLL----lLLHHHHHHHHHHHHHLLLEEEE
Query ERLA------ARYHdaspramrRVVMAPtTVLY----sISPREMRETAAVARRLGLRMHS  221
ident                                             |  |            
Sbjct IHDIkegiqgTLNK--------AGFVXI-AADEpgitkDVEKVIRAAAIANKETKVPIIT  169
DSSP  HHHHhlllllLLLL--------LLLEEE-ELLLllllhHHHHHHHHHHHHHHHHLLLEEE


DSSP  ELL-lLLHHHHHHHLLL----lLLLEEEELL-LLLLHHHHHHHHHHLLEEEELHHHHHLL
Query HLS-gKSPVAFCGEHDW----lGSDVWYAHL-VKVDADEIALLAQTGTGVAHCPQSNGRL  275
ident |                            ||      | |   |  |             
Sbjct HSNahNNTGLEQQRILTeegvdPGKILIGHLgDTDNIDYIKKIADKGSFIGLDRYGLDLF  229
DSSP  ELLllLLHHHHHHHHHHhllllHHHEEELLHhHLLLHHHHHHHHHLLLEEEELLLLLLLL


DSSP  --------LLLLHHHHLL--LEEELLLHH----------------hhlLLLLhhHHHHHH
Query --------PVREMADAGV--PVSIGVDGA----------------asnEAADmiSEVHMT  309
ident                 |      |  |                                |
Sbjct lpvdkrneTTLRLIKDGYsdKIMISHDYCctidwgtakpeykpklaprWSIT--LIFEDT  287
DSSP  llhhhhhhHHHHHHHLLLllLEEELLLLLlllllllllhhhhhhhlllLLLL--HHHHLH


DSSP  HHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleeeeelllhhhlllllhhh
Query WLAQRARLASIAEVIHWGTAGGARVMGldevgkvavgyaadiavyrlddpryfglhdpai  369
ident                                                             
Sbjct IPFLKRNGVNEEVIATIFKENPKKFFS---------------------------------  314
DSSP  HHHHHLLLLLHHHHHHHHLHHHHHHLL---------------------------------


DSSP  hhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query gpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                                     
Sbjct ----------------------------------------------------  314
DSSP  ----------------------------------------------------


No 33: Query=2pajA Sbjct=3gg7A Z-score=15.9

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEELLLLLHHHHHllllllhhhllhhhhhhHHHHHHHHHHLLLEeEEEELLLLLlllll
Query pAWVNTHHHLFQSLlkgepfralfderrfrlAARIGLIELARSGCaTVADHNYVYypgmp  120
ident       | ||                                    ||            
Sbjct -SLIDFHVHLDLYP-----------------DPVAVARACEERQL-TVLSVTTTP-----   36
DSSP  -LLEEEEELHHHLL-----------------LHHHHHHHHHHLLL-EEEELLLLH-----


DSSP  llHHHHHHHHHHHLlLEEEEEELL---LLLLllllllllhhhLLLLHHHHHHHHHHHhhh
Query fdSSAILFEEAEKLgLRFVLLRGG---ATQTrqleadlptalRPETLDAYVADIERLaar  177
ident           |           |                   |   |             
Sbjct -aAWRGTLALAAGR-PHVWTALGFhpeVVSE-----------RAADLPWFDRYLPET---   80
DSSP  -hHHHHHHHHHLLL-LLEEELLLLlhhHLLL-----------LHHHLHHHHHHHHHL---


DSSP  llllllllleeEEELlLLLLL---------llLHHHHHHHHHHHHHL-LLEEEEELLlll
Query yhdaspramrrVVMApTTVLY---------siSPREMRETAAVARRL-GLRMHSHLSgks  227
ident                    |                            |     |     
Sbjct -----------RFVG-EVGLDgspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR--r  126
DSSP  -----------LEEE-EEELLllhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL--l


DSSP  HHHHHHHLL---llllLEEEELLLlLLHHHHHHHHHHLLEEEELHhHHHLL-----LLLL
Query PVAFCGEHD---wlgsDVWYAHLVkVDADEIALLAQTGTGVAHCPqSNGRL-----PVRE  279
ident                              |       |      |    |        | 
Sbjct AESEVLNCLeanprsgTPILHWYS-GSVTELRRAISLGCWFSVGP-TMVRTqkgaaLIRS  184
DSSP  LHHHHHHHHhhlhhheEEEEELLL-LLHHHHHHHHHLLLEEEELH-HHHLLhhhhhHHHH


DSSP  HHhhllLEEELLLHHHHL----LLLLHhHHHHHHHHHHHHLLLL-HHHHHHHhLHHHHHh
Query MAdagvPVSIGVDGAASN----EAADMiSEVHMTWLAQRARLAS-IAEVIHWgTAGGARv  334
ident |      |    ||         |                                  | 
Sbjct MP--rdRVLTETDGPFLEldgqAALPW-DVKSVVEGLSKIWQIPaSEVERIV-KENVSR-  239
DSSP  LL--hhHEEELLLLLLLEelleELLHH-HHHHHHHHHHHHHLLLhHHHHHHH-HHHHHH-


DSSP  HLLLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeell
Query MGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvdd  394
ident                                                             
Sbjct LLGT--------------------------------------------------------  243
DSSP  HHHL--------------------------------------------------------


DSSP  llllllhhhhhhhhhhhhhhhhhhhhl
Query liegvdikelggearrvvrellrevvv  421
ident                            
Sbjct ---------------------------  243
DSSP  ---------------------------


No 34: Query=2pajA Sbjct=4dlfA Z-score=15.8

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  ELEELLLLLHHhhhlllllLHHHL--------lhhhhhHHHHHHHHHHHLLLEEEEEELL
Query PAWVNTHHHLFqsllkgepFRALF--------derrfrLAARIGLIELARSGCATVADHN  112
ident       | |           ||                                      
Sbjct ALRIDSHQHFW-------rYRAADypwigagmgvlardYLPDALHPLMHAQALGASIAVQ   53
DSSP  LLLEEEEELLL-------lLLHHHllllllllhhhlllLLHHHHHHHHHHLLLLEEEEEL


DSSP  LLLLlllllLHHHHHHHHHHHLLLEEEEEELlllllllllllllhhhlllLHHHHHHHHH
Query YVYYpgmpfDSSAILFEEAEKLGLRFVLLRGgatqtrqleadlptalrpeTLDAYVADIE  172
ident          |  | | | |                                         
Sbjct ARAG----rDETAFLLELACDEARIAAVVGW----------------edlRAPQLAERVA   93
DSSP  LLLL----hHHHHHHHHHHLLLLLEEEEEEL----------------lllLLLLHHHHHH


DSSP  HhHHHLllllllllEEEEELLlLLLLL----lLHHH--HHHHHHHHHHLLLEEEEELLll
Query RlAARYhdaspramRRVVMAPtTVLYS----iSPRE--MRETAAVARRLGLRMHSHLSgk  226
ident                                            |                
Sbjct E-WRGT--------KLRGFRH-QLQDEadvraFVDDadFARGVAWLQANDYVYDVLVF-e  142
DSSP  L-LLLL--------LEEEEEE-LHHHLllhhhHHHLhhHHHHHHHHHHLLLEEEELLL-h


DSSP  LHHHHHHHLL--llllLEEEE-LLLL-------------lLHHHHHHHHHHL-LEEEELh
Query SPVAFCGEHD--wlgsDVWYA-HLVK-------------vDADEIALLAQTG-TGVAHCp  269
ident                                                ||           
Sbjct RQLPDVQAFCarhdahWLVLDhAGKPalaefdrddtalarWRAALRELAALPhVVCKLS-  201
DSSP  HHHHHHHHHHhhllllLEEEHhHHLLlhhhllllllhhhhHHHHHHHHHLLLlEEEEEL-


DSSP  hHHHLL-----------------LLLLHHHHLL--LEEELLLHHHHL--LLLLhhHHHHH
Query qSNGRL-----------------PVREMADAGV--PVSIGVDGAASN--EAADmiSEVHM  308
ident                              ||        | |          |       
Sbjct -GLVTEadwrrglrasdlrhieqCLDAALDAFGpqRLMFGSDWPVCLlaASYD--EVASL  258
DSSP  -LLLLLllllllllhhhhhhhhhHHHHHHHHHLhhHEEELLLLLHHHhlLLHH--HHHHH


DSSP  HHHHHHHLlLLHHHHHHHHLHHHHHHHLLLlllllllllllleeeeelllhhhlllllhh
Query TWLAQRARlASIAEVIHWGTAGGARVMGLDevgkvavgyaadiavyrlddpryfglhdpa  368
ident        |  | ||         ||   |                               
Sbjct VERWAESR-LSAAERSALWGGTAARCYALP------------------------------  287
DSSP  HHHHHHHH-LLHHHHHHHLLHHHHHHLLLL------------------------------


DSSP  hhhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query igpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                                      
Sbjct -----------------------------------------------------  287
DSSP  -----------------------------------------------------


No 35: Query=2pajA Sbjct=4mupB Z-score=15.7

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct ---------------------------------------------lvrklsgtapnpafP   15
DSSP  ---------------------------------------------llllllllllllllL


DSSP  ELEELLLLLHHhhhllllllhhhLLHH----------hhhHHHHHHHHHHHLLLEEEEEE
Query PAWVNTHHHLFqsllkgepfralFDER----------rfrLAARIGLIELARSGCATVAD  110
ident    | |  |                                            |   |  
Sbjct RGAVDTQMHMY-----------lPGYPalpggpglppgalPGPEDYRRLMQWLGIDRVII   64
DSSP  LLLEELLLLLL-----------lLLLLlllllllllllllLLHHHHHHHHHHHLLLEEEE


DSSP  LLL--LLLLllllLHHHHHHHHHHhllLEEEEEELlllllllllllllhhhllllHHHHH
Query HNY--VYYPgmpfDSSAILFEEAEklgLRFVLLRGgatqtrqleadlptalrpetLDAYV  168
ident                      |                                      
Sbjct TQGnaHQRD---nGNTLACVAEMG---EAAHAVVI------------------idATTTE  100
DSSP  ELLhhHLLL---lHHHHHHHHHHH---HHEEEEEL------------------llLLLLH


DSSP  HHHHHHHHHlllllllllEEEEELLlLLLL---LLLHhHHHHHHHHHHHLLLEEEEELL-
Query ADIERLAARyhdaspramRRVVMAPtTVLY---SISPrEMRETAAVARRLGLRMHSHLS-  224
ident  | | | |            |       |         |       |             
Sbjct KDMEKLTAA---------GTVGARI-MDLPggaVNLS-ELDAVDERAHAADWMVAVQFDg  149
DSSP  HHHHHHHHL---------LEEEEEE-ELLLlllLLHH-HHHHHHHHHHHLLLEEEEELLh


DSSP  --lLLHHHHHHHLLllllLEEEE-LLLL--------lLHHHHHHHHHHL-LEEEELhhHH
Query --gKSPVAFCGEHDwlgsDVWYA-HLVK--------vDADEIALLAQTG-TGVAHCpqSN  272
ident                         |                   |   |           
Sbjct nglLDHLPRLQKIR---sRWVFDhHGKFfkgirtdgpEMAALLKLIDRGnLWFKFA--GV  204
DSSP  hhhHHHHHHHHLLL---lEEEELhHHHLllllllllhHHHHHHHHHHHLlEEEEEL--LH


DSSP  HLL------------LLLLHHHHL-lLEEELLLHHHH-------LLLLlhHHHHHHHHHH
Query GRL------------PVREMADAG-vPVSIGVDGAAS-------NEAAdmISEVHMTWLA  312
ident                  |  |         |                         |   
Sbjct YESsrkswpyadvaaFSRVIAAHApeRIVWGTNWPHNsvretaaYPDD--ARLAELTLGW  262
DSSP  HHLlllllllhhhhhHHHHHHHHLhhHEEELLLLLLLllllhhhLLLH--HHHHHHHHLL


DSSP  HhhllLLHHHHHHHHLHHHHHHHLLLLLlllllllllleeeeelllhhhlllllhhhhhh
Query QrarlASIAEVIHWGTAGGARVMGLDEVgkvavgyaadiavyrlddpryfglhdpaigpv  372
ident         |               |  |                                
Sbjct L----PDEAARHRALVENPEALFKLSPV--------------------------------  286
DSSP  L----LLHHHHHHHHLHHHHHHHLLLLL--------------------------------


DSSP  hllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query asggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                                  
Sbjct -------------------------------------------------  286
DSSP  -------------------------------------------------


No 36: Query=2pajA Sbjct=2ffiA Z-score=15.6

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ----------------------------------------------------------lh    2
DSSP  ----------------------------------------------------------ll


DSSP  ELEELLLLLHH---hhhlllllLHHHLlhhhhhHHHHHHHHHHHLLLEEEEEELL-LLLL
Query PAWVNTHHHLF---qsllkgepFRALFderrfrLAARIGLIELARSGCATVADHN-YVYY  116
ident       | | |                            |  |   |             
Sbjct LTAIDSHAHVFsrglnlasqrrYAPNY-----dAPLGDYLGQLRAHGFSHGVLVQpSFLG   57
DSSP  LLLEELLLLLLlhhhhhhllllLLLLL-----lLLHHHHHHHHHHLLLLEELLLLlHHHL


DSSP  lllllLHHHHHHHHHHhllLEEEEEELlllllllllllllhhhllllhhhHHHHhHHHHH
Query pgmpfDSSAILFEEAEklgLRFVLLRGgatqtrqleadlptalrpetldaYVADiERLAA  176
ident                                                            |
Sbjct --tdnRYLLSALQTVP---GQLRGVVX----------------------lERDVeQATLA   90
DSSP  --lllHHHHHHHHHLL---LLLLLLLL----------------------lLLLLlHHHHH


DSSP  HLLLllllllEEEEELLLlLLLL--LLHHH--HHHHHHHHHHLLLEEEEELLllLHHHHH
Query RYHDaspramRRVVMAPTtVLYS--ISPRE--MRETAAVARRLGLRMHSHLSgkSPVAFC  232
ident                                  |         |     |          
Sbjct EXAR-----lGVRGVRLN-LXGQdxPDLTGaqWRPLLERIGEQGWHVELHRQ-vADIPVL  143
DSSP  HHHL-----lLLLEEELL-LLLLllLLLLLllLHHHHHHHHHHLLEEEELLL-lLLHHHH


DSSP  HHLLL-lllLEEEE-LLLL---------LLHHHHHHhHHHLLEEEELhhHHHLL------
Query GEHDW-lgsDVWYA-HLVK---------VDADEIALlAQTGTGVAHCpqSNGRL------  275
ident          |                    |    |       |        ||      
Sbjct VRALQpyglDIVIDhFGRPdarrglgqpGFAELLTLsGRGKVWVKVS--GIYRLqgspee  201
DSSP  HHHHLllllLEEELhHHLLlllllllllLHHHHLLLlLLLLEEEEEE--LHHHLlllhhh


DSSP  -------LLLLHHHHLL--LEEELLLHHHH----lLLLLhhHHHHHHHHHHhhllLLHHH
Query -------PVREMADAGV--PVSIGVDGAAS----nEAADmiSEVHMTWLAQrarlASIAE  322
ident                        | |               | |            |   
Sbjct nlafarqALCALEAHYGaeRLXWGSDWPHTqheseVSFG--SAVEQFEALG----CSAQL  255
DSSP  hhhhhhhHHHHHHHHLLhhHEEEELLLLLLlllllLLHH--HHHHHHHHHL----LLHHH


DSSP  HHHHHLHHHHHhHLLLLLlllllllllleeeeelllhhhlllllhhhhhhhllllleeee
Query VIHWGTAGGARvMGLDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvma  382
ident                 |                                           
Sbjct RQALLLDTARA-LFGFEL------------------------------------------  272
DSSP  HHHHHLHHHHH-HLLLLL------------------------------------------


DSSP  eeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query lfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                        
Sbjct --------------------------------------e  273
DSSP  --------------------------------------l


No 37: Query=2pajA Sbjct=4hk5D Z-score=15.4

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct -----------------------------------------------------------T    1
DSSP  -----------------------------------------------------------L


DSSP  ELEELLLLLHHhhhllllllHHHL------------------------------------
Query PAWVNTHHHLFqsllkgepfRALF------------------------------------   84
ident |  |  | |            |                                      
Sbjct PVVVDIHTHMY-----ppsyIAMLekrqtiplvrtfpqadeprlillsselaaldaalad   56
DSSP  LLLEEEEEEEL-----lhhhHHHHhlllllleeeeelleeeeeeellhhhhhhhhhhhhl


DSSP  --------lhhhhhHHHHHHHHHHHLLLEEEEEELLL---------llLLLLllLHHHHH
Query --------derrfrLAARIGLIELARSGCATVADHNY---------vyYPGMpfDSSAIL  127
ident                            |                     ||      |  
Sbjct paaklpgrplsthfASLAQKMHFMDTNGIRVSVISLAnpwfdflapdeAPGIadAVNAEF  116
DSSP  llllllleellhhhLLHHHHHHHHHHLLLLEEEEEELlllllllllllHHHHhhHHHHHH


DSSP  HHHHHHLLLEEEEEELLLLllllllllllhhhlLLLHHHHHHHHHHHHHHLllllllllE
Query FEEAEKLGLRFVLLRGGATqtrqleadlptalrPETLDAYVADIERLAARYhdaspramR  187
ident          |                           ||  | |||              
Sbjct SDMCAQHVGRLFFFAALPL--------------SAPVDAVKASIERVKNLK--------Y  154
DSSP  HHHHHLLLLLEEEEEELLL--------------LLLHHHHHHHHHHHHLLL--------L


DSSP  EEEELLllLLLLLL----HHHHHHHHHHHHHLLLEEEEELL-------------------
Query RVVMAPttVLYSIS----PREMRETAAVARRLGLRMHSHLS-------------------  224
ident                                  |    |                     
Sbjct CRGIIL--GTSGLGkgldDPHLLPVFEAVADAKLLVFLHPHyglpnevygprseeyghvl  212
DSSP  EEEEEE--LLLLLLllllLHHHHHHHHHHHHLLLEEEELLLllllhhhhlllhhhlllhh


DSSP  ---------llLHHHHH--HHLL--llllLEEEEL-LLLL--------------------
Query ---------gkSPVAFC--GEHD--wlgsDVWYAH-LVKV--------------------  250
ident              ||                  ||                         
Sbjct plalgfpmettIAVARMymAGVFdhvrnlQMLLAHsGGTLpflagriescivhdghlvkt  272
DSSP  hhhlhhhhhhhHHHHHHhhLLHHhhllllLEEEHHhHLLHhhhhhhhhhhhhllhhhhhl


DSSP  ------lhHHHHHHHhHLLEEEELHHhhhllLLLLHHHHLL--LEEELLLHHHH------
Query ------daDEIALLAqTGTGVAHCPQsngrlPVREMADAGV--PVSIGVDGAAS------  296
ident              |                                 | |          
Sbjct gkvpkdrrTIWTVLK-EQIYLDAVIY--sevGLQAAIASSGadRLMFGTDHPFFppieed  329
DSSP  llllllllLHHHHHH-HLEEEELLLL--lhhHHHHHHHHHLhhHEELLLLLLLLllllll


DSSP  ----LLLLlhHHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHLLLLlllllllllllee
Query ----NEAAdmISEVHMTWLAQRarlASIAEVIHWGTAGGARVMGLDEvgkvavgyaadia  352
ident                    |                    ||  |               
Sbjct vqgpWDSS--RLNAQAVIKAVG---EGSSDAAAVMGLNAVRVLSLKA-------------  371
DSSP  llllLHHH--HHHHHHHHHHHL---LLLHHHHHHHLHHHHHHLLLHH-------------


DSSP  eeelllhhhlllllhhhhhhhllllleeeeeeeLLEEeeellllllllhhhhhhhhhhhh
Query vyrlddpryfglhdpaigpvasggrpsvmalfsAGKRvvvddliegvdikelggearrvv  412
ident                                                             
Sbjct -----------------------------elehHHHH-----------------------  379
DSSP  -----------------------------hhhhHHHH-----------------------


DSSP  hhhhhhhhl
Query rellrevvv  421
ident          
Sbjct --------h  380
DSSP  --------l


No 38: Query=2pajA Sbjct=4ofcA Z-score=15.0

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEELLLLLHHhhhllllllhhhLLHH---------------------------------
Query pAWVNTHHHLFqsllkgepfralFDER---------------------------------   87
ident       | |                                                   
Sbjct -MKIDIHSHIL-----------pKEWPdlkkrfgyggwvqlqhhskgeakllkdgkvfrv   48
DSSP  -LLEEEEEELL-----------lLLLLlhhhhhllllleeeeeeelleeeeeelleeeee


DSSP  --hhhHHHHHHHHHHHLLLEEEEEELLL----------llLLLLllLHHHHHHHHHHHLL
Query --rfrLAARIGLIELARSGCATVADHNY----------vyYPGMpfDSSAILFEEAEKLG  135
ident              |    |    |                           |        
Sbjct vrencWDPEVRIREMDQKGVTVQALSTVpvmfsywakpedTLNLcqLLNNDLASTVVSYP  108
DSSP  eehhhLLHHHHHHHHHHHLLLEEEEELLhhhhlllllhhhHHHHhhHHHHHHHHHHHHLL


DSSP  LEEEEEELLLLLlllllllllhhhlllLHHHHHHHHHHHHHHLLllllllleEEEELLlL
Query LRFVLLRGGATQtrqleadlptalrpeTLDAYVADIERLAARYHdaspramrRVVMAPtT  195
ident  ||| |     |                    |   ||                      
Sbjct RRFVGLGTLPMQ---------------APELAVKEMERCVKELG--------FPGVQI-G  144
DSSP  LLEEEEELLLLL---------------LHHHHHHHHHHHHHLLL--------LLEEEE-E


DSSP  LLL---lllHHHHHHHHHHHHHLLLEEEEELL----------------------llLHHH
Query VLY---sisPREMRETAAVARRLGLRMHSHLS----------------------gkSPVA  230
ident            |     | | ||      |                              
Sbjct THVnewdlnAQELFPVYAAAERLKCSLFVHPWdmqmdgrmakywlpwlvgmpaettIAIC  204
DSSP  LEElleellLHHHHHHHHHHHHHLLEEEEELLlllllhhhhlllhhhhlhhhhhhhHHHH


DSSP  HHH-HLLL---lllLEEEEL-LLLLLHHH----------------------hHHHHhhLL
Query FCG-EHDW---lgsDVWYAH-LVKVDADE----------------------iALLAqtGT  263
ident                |  ||                                  |     
Sbjct SMImGGVFekfpklKVCFAHgGGAFPFTVgrishgfsmrpdlcaqdnpmnpkKYLG--SF  262
DSSP  HHHlLLHHhhllllLEEELHhHLLHHHHHhhhhhhhhhlhhhhlllllllhhHHLL--LL


DSSP  EEEELHHhhhllLLLLHHHHLL--LEEELLLHHH-HLLLllhhHHHHHHHhHHHHllLLH
Query GVAHCPQsngrlPVREMADAGV--PVSIGVDGAA-SNEAadmiSEVHMTWlAQRArlASI  320
ident                   |      |  | |      |                      
Sbjct YTDALVH--dplSLKLLTDVIGkdKVILGTDYPFpLGEL----EPGKLIE-SMEE--FDE  313
DSSP  EEELLLL--lhhHHHHHHHHHLllLEELLLLLLLlLLLL----LLLHHHH-HLLL--LLH


DSSP  HHHHHHHLHHHHHHHLLLLLlllllllllleeeeelllhhhlllllhhhhhhhlllllee
Query AEVIHWGTAGGARVMGLDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsv  380
ident                ||                                           
Sbjct ETKNKLKAGNALAFLGLERK----------------------------------------  333
DSSP  HHHHHHHLHHHHHHHLLLHH----------------------------------------


DSSP  eeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query malfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                          
Sbjct ---------------------------------------qf  335
DSSP  ---------------------------------------hl


No 39: Query=2pajA Sbjct=2dvtA Z-score=14.7

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct -----------------------------------------------------------M    1
DSSP  -----------------------------------------------------------L


DSSP  ELEELLLLLHHhhhlllllLHHH--------llhhhhhHHHH-HHHHHHHLLLEEEEEEL
Query PAWVNTHHHLFqsllkgepFRAL--------fderrfrLAAR-IGLIELARSGCATVADH  111
ident    |    |                             |      |      |  |    
Sbjct QGKVALEEHFA---ipetlQDSAgfvpgdywkelqhrlLDIQdTRLKLMDAHGIETMILS   58
DSSP  LLEEEEEEEEL---lhhhhHHHLllllllhhhhhhhhhHLLLlHHHHHHHHLLEEEEEEE


DSSP  L--LLLL-----LLLL---lLHHHHHHHHHHHLLLEEEEEELLLLllllllllllhhhll
Query N--YVYY-----PGMP---fDSSAILFEEAEKLGLRFVLLRGGATqtrqleadlptalrp  161
ident                          | ||  |   ||                       
Sbjct LnaPAVQaipdrRKAIeiarRANDVLAEECAKRPDRFLAFAALPL---------------  103
DSSP  EllLHHHhlllhHHHHhhhhHHHHHHHHHHHHLLLLEEEEELLLL---------------


DSSP  LLHHHHHHHHHHHHHHLLllllllleEEEELlLLLLL---------lLLHHHHHHHHHHH
Query ETLDAYVADIERLAARYHdaspramrRVVMApTTVLY---------sISPREMRETAAVA  212
ident    ||      |               |                         |      
Sbjct QDPDAATEELQRCVNDLG--------FVGAL-VNGFSqegdgqtplyYDLPQYRPFWGEV  154
DSSP  LLHHHHHHHHHHHHHLLL--------LLEEE-EELLLllllllllllLLLHHHHHHHHHH


DSSP  HHLLLEEEEEL--------------------------lllLHHHHHHHL----lllllLE
Query RRLGLRMHSHL--------------------------sgkSPVAFCGEH----dwlgsDV  242
ident   |      |                                                  
Sbjct EKLDVPFYLHPrnplpqdsriydghpwllgptwafaqetaVHALRLMASglfdehprlNI  214
DSSP  HHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhhhHHHHHHHHLlhhhhllllLE


DSSP  EEEL-LLLLLHHH----------------------hHHHHhHLLEEEELhhHHHL-lLLL
Query WYAH-LVKVDADE----------------------iALLAqTGTGVAHCpqSNGR-lPVR  278
ident    |                                                | |     
Sbjct ILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFHITTS--GNFRtqTLI  271
DSSP  EELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEEEELL--LLLLhhHHH


DSSP  LHHHHLL--LEEELLLHHhhLLLLlhHHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHL
Query EMADAGV--PVSIGVDGAasNEAAdmISEVHMTWLAQrarlASIAEVIHWGTAGGARVMG  336
ident                |     |                      |     |     |   
Sbjct DAILEIGadRILFSTDWP--FENI--DHASDWFNATS----IAEADRVKIGRTNARRLFK  323
DSSP  HHHLLLLhhHEELLLLLL--LLLH--HHHHHHHHHLL----LLHHHHHHHHLHHHHHHLL


DSSP  LLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeellll
Query LDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddli  396
ident ||                                                          
Sbjct LD----------------------------------------------------------  325
DSSP  LL----------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhhhhhhl
Query egvdikelggearrvvrellrevvv  421
ident                          
Sbjct -------------------------  325
DSSP  -------------------------


No 40: Query=2pajA Sbjct=3irsA Z-score=14.6

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  ELEELLLLLHH-----------hhhlLLLL---lhhhllhhhhhHHHHHHHHHHHLLLEE
Query PAWVNTHHHLF-----------qsllKGEP---fralfderrfrLAARIGLIELARSGCA  106
ident                                                     | |  |  
Sbjct LKIIDFRLRPPamgflnariytrpdiRNRFtrqlgfepapsaeeKSLELMFEEMAAAGIE   60
DSSP  LLLEELLLLLLlhhhhhlhhhhlhhhHHHHhhhhlllllhhhhhLLHHHHHHHHHHLLLL


DSSP  EEEELLLLLL--lllllLHHHHHHHHHHhllLEEEEEELLLLllllllllllhhhllLLH
Query TVADHNYVYY--pgmpfDSSAILFEEAEklgLRFVLLRGGATqtrqleadlptalrpETL  164
ident                     |            |                        | 
Sbjct QGVCVGRNSSvlgsvsnADVAAVAKAYP---DKFHPVGSIEA---------------ATR  102
DSSP  EEEEELLEELlleellhHHHHHHHHHLL---LLEEEEEELLL---------------LLH


DSSP  HHHHHHHHHHHHHLLllllllleeEEELLlLLLL-----lllHHHHHHHHHHHHHLLLEE
Query DAYVADIERLAARYHdaspramrrVVMAPtTVLY-----sisPREMRETAAVARRLGLRM  219
ident     |                                      |      |     |   
Sbjct KEAMAQMQEILDLGI---------RIVNL-EPGVwatpmhvdDRRLYPLYAFCEDNGIPV  152
DSSP  HHHHHHHHHHHHLLL---------LLEEE-LHHHllllllllLHHHHHHHHHHHHLLLLE


DSSP  EEELL-------LLLHHHHHHHLL--llllLEEEELL-LLLLHHHHHHHHHHL-LEEEEL
Query HSHLS-------GKSPVAFCGEHD--wlgsDVWYAHL-VKVDADEIALLAQTG-TGVAHC  268
ident                                |   |         |              
Sbjct IMMTGgnagpdiTYTNPEHIDRVLgdfpdlTVVSSHGnWPWVQEIIHVAFRRPnLYLSPD  212
DSSP  EEELLllllllhHHHLHHHHHHHHhhllllLEEEEHHhLLLHHHHHHHHHHLLlEEEELH


DSSP  HhHHHLL----LLLLHHHHLL--LEEELLLHHhhLLLLlhHHHHHHHHHHHhhllLLHHH
Query PqSNGRL----PVREMADAGV--PVSIGVDGAasNEAAdmISEVHMTWLAQrarlASIAE  322
ident       |         |          |                                
Sbjct M-YLYNLpghaDFIQAANSFLadRMLFGTAYP--MCPL--KEYTEWFLTLP----IKPDA  263
DSSP  H-HHLLLllhhHHHHHHLLHHhhLLLLLLLLL--LLLH--HHHHHHHHLLL----LLHHH


DSSP  HHHHHLHHHHHhHLLLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeee
Query VIHWGTAGGARvMGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvma  382
ident           |                                                 
Sbjct MEKILHGNAER-LLAQ--------------------------------------------  278
DSSP  HHHHHLHHHHH-HHHH--------------------------------------------


DSSP  eeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query lfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                        
Sbjct ------------------------------------agr  281
DSSP  ------------------------------------lll


No 41: Query=2pajA Sbjct=3pnuA Z-score=14.5

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllLEEE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdCVIY   60
ident                                                             
Sbjct ------------------------------------------------enlyfqsnAMKL   12
DSSP  ------------------------------------------------llllllllLEEE


DSSP  ELEELLLLLHHhhhllllllhhhllhhhHHHHHHHHHHHHHLLlEEEEEELLLLLLllll
Query PAWVNTHHHLFqsllkgepfralfderrFRLAARIGLIELARSgCATVADHNYVYYpgmp  120
ident       | ||                              ||                  
Sbjct KNPLDMHLHLR-----------------DNQMLELIAPLSARD-FCAAVIMPNLIPplcn   54
DSSP  ELLEEEEELLL-----------------LHHHHHHHHHHHHLL-LLEEEELLLLLLllll


DSSP  lLHHHHHHHHHHH----LLLEEEEEELLLLllllllllllhhhllllhhhhHHHHHHHHH
Query fDSSAILFEEAEK----LGLRFVLLRGGATqtrqleadlptalrpetldayVADIERLAA  176
ident             |                                               
Sbjct lEDLKAYKMRILKackdENFTPLMTLFFKN-------------------ydEKFLYSAKD   95
DSSP  hHHHHHHHHHHHHhhllLLLEEEEEEELLL-------------------llHHHHHHHLL


DSSP  HllllllllleEEEELllLLLL--------LLLH---HHHHHHHHHHHHLLLEEEEELL-
Query RyhdaspramrRVVMAptTVLY--------SISP---REMRETAAVARRLGLRMHSHLS-  224
ident                                 |         |      |      |   
Sbjct E----------IFGIX--LYPAgittnsngGVSSfdiEYLKPTLEAMSDLNIPLLVHGEt  143
DSSP  L----------LLEEE--ELLLllllllllLLLLllhHHHHHHHHHHHHLLLLEEELLLl


DSSP  -------llLHHHHHHHLL--llllLEEEELLLLLLhhHHHHHHHHL-LEEEELHHHHHL
Query -------gkSPVAFCGEHD--wlgsDVWYAHLVKVDadEIALLAQTG-TGVAHCPQSNGR  274
ident                               |          ||                 
Sbjct ndfvmdresNFAKIYEKLAkhfprlKIVMEHITTKT--LCELLKDYEnLYATITLHHLII  201
DSSP  lllhhhllhHHHHHHHHHHhhllllLEEELLLLLHH--HHHHHHHLLlEEEEELLHHHLL


DSSP  L--------------------------LLLLHH-hhLLLEEELLLHHH-------HLLLL
Query L--------------------------PVREMA-daGVPVSIGVDGAA-------SNEAA  300
ident                               | |      |  | | |            |
Sbjct TlddviggkmnphlfckpiakryedkeALCELAfsgYEKVMFGSDSAPhpkgcaaGVFSA  261
DSSP  LhhhhhlllllhhhllllllllhhhhhHHHHHHhllLLLEEELLLLLLlllllllLLLLH


DSSP  LhhHHHHHHHHHHHHLlLLHHHHHHHHLHHHHHHhLLLLLllllllLLLLEEEEellLHH
Query DmiSEVHMTWLAQRARlASIAEVIHWGTAGGARVmGLDEVgkvavgYAADIAVYrldDPR  360
ident                   |                               |         
Sbjct P--VILPVLAELFKQN-SSEENLQKFLSDNTCKI-YDLKF------KEDKILTL-eeKEW  310
DSSP  H--HHHHHHHHHHHHH-LLHHHHHHHHLHHHHHH-HLLLL------LLLLEEEE-elLLE


DSSP  H---------lllllhhhhhhHLLLLLEeeeeeelleeeeellllllllhhhhhhhhhhh
Query Y---------fglhdpaigpvASGGRPSvmalfsagkrvvvddliegvdikelggearrv  411
ident                                                             
Sbjct QvpnvyedkynqvvpymageiLKFQLKH--------------------------------  338
DSSP  ElllleelllleellllllleELLEELL--------------------------------


DSSP  hhhhhhhhhl
Query vrellrevvv  421
ident           
Sbjct ----------  338
DSSP  ----------


No 42: Query=2pajA Sbjct=2gwgA Z-score=14.1

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEELLLLLhHHHHlllllLHHH----------------------lLHHHHHHHHH-HHH
Query pAWVNTHHHlFQSLlkgepFRAL----------------------fDERRFRLAAR-IGL   97
ident       | |                                                  |
Sbjct -XIIDIHGH-YTTA---pkALEDwrnrqiagikdpsvxpkvselkiSDDELQASIIeNQL   55
DSSP  -LLEEEEEE-LLLL---lhHHHHhhhhhhhhhhlhhhlllhhhlllLHHHHHHHHHlLHH


DSSP  HHHHLLLEEEEEELLL----llLLLL---llLHHHHHHHHHHhllLEEEEEELLLLLLLl
Query IELARSGCATVADHNY----vyYPGM---pfDSSAILFEEAEklgLRFVLLRGGATQTRq  150
ident       |                                        |            
Sbjct KKXQERGSDLTVFSPRagdfnvSSTWaaicnELCYRVSQLFP---DNFIGAAXLPQSPG-  111
DSSP  HHHHHHLLLEEEEELLlllhhhHHHHhhhhhHHHHHHHHHLL---LLEEEEEELLLLLL-


DSSP  llllllhhhlllLHHHHHHHHHHHHHHLLllllllleEEEELLllLLLL---------ll
Query leadlptalrpeTLDAYVADIERLAARYHdaspramrRVVMAPttVLYS---------is  201
ident                      |     |          |                     
Sbjct -----------vDPKTCIPELEKCVKEYG--------FVAINL--NPDPsgghwtspplt  150
DSSP  -----------lLHHHHHHHHHHHHHLLL--------LLEEEE--LLLLlllllllllll


DSSP  HHHHHHHHHHHHHLLLEEEEE--------llllLHHHHH--HHLL--llllLEEEEL-LL
Query PREMRETAAVARRLGLRMHSH--------lsgkSPVAFC--GEHD--wlgsDVWYAH-LV  248
ident  |           |      |                 |  |              |   
Sbjct DRIWYPIYEKXVELEIPAXIHvstgahylnadtTAFXQCvaGDLFkdfpelKFVIPHgGG  210
DSSP  LHHHHHHHHHHHHHLLLEEELlllllhhhhhhhHHHHHHhhLLHHhhllllLEEELHhHL


DSSP  LL---------------lhHHHHHHHhHLLEEEELHH--hhhllLLLLHHhhlLLEEELL
Query KV---------------daDEIALLAqTGTGVAHCPQ--sngrlPVREMAdagVPVSIGV  291
ident  |                                |                    |    
Sbjct AVpyhwgrfrglaqexkkpLLEDHVL-NNIFFDTCVYhqpgidlLNTVIP--vDNVLFAS  267
DSSP  LLhhhhhhhhhhhhhllllLHHHHLL-LLEEEELLLLlhhhhhhHHHHLL--hHHEELLL


DSSP  LHHHHLL------lllhhHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHL--LLLLlll
Query DGAASNE------aadmiSEVHMTWLAQRarlASIAEVIHWGTAGGARVMG--LDEVgkv  343
ident                                     |          ||           
Sbjct EXIGAVRgidprtgfyydDTKRYIEASTI---LTPEEKQQIYEGNARRVYPrlDAAL---  321
DSSP  LLLLLLLleelllleellLLHHHHHHLLL---LLHHHHHHHHLHHHHHHLHhhHHHH---


DSSP  llllllleeeeelllhhhlllllhhhhhhhllllleeeeeeeLLEEeeellllllllhhh
Query avgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsAGKRvvvddliegvdike  403
ident                                                             
Sbjct ---------------------------------------kakGKLE--------------  328
DSSP  ---------------------------------------hhhHHHL--------------


DSSP  hhhhhhhhhhhhhhhhhl
Query lggearrvvrellrevvv  421
ident                   
Sbjct -----------------h  329
DSSP  -----------------l


No 43: Query=2pajA Sbjct=2a3lA Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------leeeeellleellllllLLLLL-lLLLLlleeeelleeeeellllllllleeee
Query ------pstlirnaaaimtggrgTADDP-sRVPGpdirivgdtidaigalaprpgetivd   53
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnADKEFlaQKSA--------------------------  154
DSSP  hhhhhhhhhhhhhhhhhhhhhhhHHHHHhhHHHL--------------------------


DSSP  llLLEE--EELEELLLLLHHHHhLLLL---------------------------------
Query atDCVI--YPAWVNTHHHLFQSlLKGE---------------------------------   78
ident             | || |                                          
Sbjct --PHRDfyNVRKVDTHVHHSAC-MNQKhllrfiksklrkepdevvifrdgtyltlrevfe  211
DSSP  --LLLLllLLLEEEEEEELLLL-LLHHhhhhhhhhhhhllllllleeelleeelhhhhhh


DSSP  ---------------------------------------lLHHHL-------LHHHHHHH
Query ---------------------------------------pFRALF-------DERRFRLA   92
ident                                          |  |         |     
Sbjct sldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrLREIFlkqdnliQGRFLGEI  271
DSSP  hhlllllllllllllllllllllllllllhhhhllllllhHHHHHlllllllLLLLHHHH


DSSP  HHHHHHHHH-LLLEeEEEELLLLLLLL--lllLHHHHH--hHHHHhllLEEEEEELLLLL
Query ARIGLIELA-RSGCaTVADHNYVYYPG--mpfDSSAIL--fEEAEklgLRFVLLRGGATQ  147
ident        |               |                           | |      
Sbjct TKQVFSDLEaSKYQ-MAEYRISIYGRKmsewdQLASWIvnnDLYS---ENVVWLIQLPRL  327
DSSP  HHHHHHHHLlLLLE-EEEEEEELLLLLllhhhHHHHHHhllLLLL---LLEEEEEEEELL


DSSP  LLL-LLLLLlhhhlllLHHHHHHHHHH---------hhHHLLLllllllEEEEELLLL--
Query TRQ-LEADLptalrpeTLDAYVADIER---------laARYHDaspramRRVVMAPTT--  195
ident                  ||                                |        
Sbjct YNIyKDMGI-vtsfqnILDNIFIPLFEatvdpdshpqlHVFLK------QVVGFDLVDde  380
DSSP  HHHhLLLLL-llllhhHHHHHLLHHHHhhhlhhhllllHHHHL------LEEEEEEELll


DSSP  -------------------lllllLHHHHHHHHHHHHHLL----------LEEEEELL--
Query -------------------vlysiSPREMRETAAVARRLG----------LRMHSHLS--  224
ident                                  |    |                |    
Sbjct skperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSGea  440
DSSP  llllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLll


DSSP  -LLLHHHHHhHLLLllllEEEELLLLL--LHHHHHHHHHHLLEEEELHHHHHLL------
Query -GKSPVAFCgEHDWlgsdVWYAHLVKV--DADEIALLAQTGTGVAHCPQSNGRL------  275
ident       |              ||            |      | |  | ||  |      
Sbjct gDIDHLAAT-FLTC----HSIAHGINLrkSPVLQYLYYLAQIGLAMSPLSNNSLfldyhr  495
DSSP  lLLHHHHHH-HHHL----LLLLLLHHHhhLHHHHHHHHHHLLLEEELHHHHLLLllllll


DSSP  -LLLLHHHHLLLEEELLLHHHHLL--LLLHHHHHHHHHHHHHhllLLHHHHHHHHlHHHH
Query -PVREMADAGVPVSIGVDGAASNE--AADMISEVHMTWLAQRarlASIAEVIHWGtAGGA  332
ident  |       |  ||   |              |             |             
Sbjct nPFPVFFLRGLNVSLSTDDPLQIHltKEPLVEEYSIAASVWK---LSACDLCEIA-RNSV  551
DSSP  lLHHHHHHLLLLEEELLLLHHHHLllLLHHHHHHHHHHHHHL---LLHHHHHHHH-HHHH


DSSP  HHHLL-LLLLllllllLLLEeeeelllhhhlllllhhhhhhhllllleeeeeeelleeee
Query RVMGL-DEVGkvavgyAADIavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvv  391
ident    |               |                                        
Sbjct YQSGFsHALK------SHWI-------------------gkdyykrgpdgndihktnvph  586
DSSP  HHLLLlHHHH------HHHL-------------------llllllllhhhllhhhhlllh


DSSP  ellllllllhhhhhhhhhhhhhhhhhhhhl
Query vddliegvdikelggearrvvrellrevvv  421
ident                               
Sbjct irvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhhhhlllllllllllll


No 44: Query=2pajA Sbjct=4qrnA Z-score=14.1

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeellllEEE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcVIY   60
ident                                                             
Sbjct -----------------------------------------------smtqdlktggEQG   13
DSSP  -----------------------------------------------llllllllllLLL


DSSP  ELEELLLLLHHhhhlllllLHHHL------------------------------lhhhhh
Query PAWVNTHHHLFqsllkgepFRALF------------------------------derrfr   90
ident      |                                                      
Sbjct YLRIATEEAFA------trEIIDVylrmirdgtadkgmvslwgfyaqspseratqilerl   67
DSSP  LLLEEEEEEEL------lhHHHHHhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhh


DSSP  HHHH-HHHHHHHLLLEEEEEELLL----------llLLLLllLHHHHHHHHHHHLLLEEE
Query LAAR-IGLIELARSGCATVADHNY----------vyYPGMpfDSSAILFEEAEKLGLRFV  139
ident |             |                                |     |   || 
Sbjct LDLGeRRIADMDATGIDKAILALTspgvqplhdldeARTLatRANDTLADACQKYPDRFI  127
DSSP  HLLLhHHHHHHHHLLLLEEEEEELlllllllllhhhHHHHhhHHHHHHHHHHHHLLLLEE


DSSP  EEELLLLLlllllllllhhhlllLHHHHHHHHHHHHHHLLllllllleEEEELLlLLLL-
Query LLRGGATQtrqleadlptalrpeTLDAYVADIERLAARYHdaspramrRVVMAPtTVLY-  198
ident      | |                       | | |                        
Sbjct GMGTVAPQ---------------DPEWSAREIHRGARELG--------FKGIQI-NSHTq  163
DSSP  ELLLLLLL---------------LHHHHHHHHHHHHHLLL--------LLLEEE-LLLLl


DSSP  -lLLHH-HHHHHHHHHHHLLLEEEEELL-------------------------llLHHHH
Query -sISPR-EMRETAAVARRLGLRMHSHLS-------------------------gkSPVAF  231
ident                          |                                  
Sbjct grYLDEeFFDPIFRALVEVDQPLYIHPAtspdsmidpmleagldgaifgfgvetgMHLLR  223
DSSP  llLLLLhHHHHHHHHHHHHLLLEEELLLlllllllhhhhhhlllllllhhhhhhhHHHHH


DSSP  HHHL----lllllLEEEEL-LLLLLHHH--------------------------HHHHHh
Query CGEH----dwlgsDVWYAH-LVKVDADE--------------------------IALLAq  260
ident                   |                                      |  
Sbjct LITIgifdkypslQIMVGHmGEALPYWLyrldymhqagvrsqryermkplkktiEGYLK-  282
DSSP  HHHHlhhhhllllLEEELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-


DSSP  HLLEEEELhhHHHL-lLLLLHHHHLL--LEEELLLHHhHLLLllhHHHHHHHHHHHhhll
Query TGTGVAHCpqSNGR-lPVREMADAGV--PVSIGVDGAaSNEAadmISEVHMTWLAQrarl  317
ident     |                        |    |            ||           
Sbjct SNVLVTNS--GVAWepAIKFCQQVMGedRVMYAMDYP-YQYV---ADEVRAMDAMD----  332
DSSP  HLEEEELL--LLLLhhHHHHHHHHHLhhHEELLLLLL-LLLL---HHHHHHHHLLL----


DSSP  LLHHHHHHHHLHHHHHHHLLllllllllllllleeeeelllhhhlllllhhhhhhhllll
Query ASIAEVIHWGTAGGARVMGLdevgkvavgyaadiavyrlddpryfglhdpaigpvasggr  377
ident  |                 |                                        
Sbjct MSAQTKKKFFQTNAEKWFKL----------------------------------------  352
DSSP  LLHHHHHHHHLHHHHHHLLL----------------------------------------


DSSP  leeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query psvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                             
Sbjct --------------------------------------------  352
DSSP  --------------------------------------------


No 45: Query=2pajA Sbjct=1v77A Z-score=13.8

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  ELEELLLLLHHhhhllllllhhhllhhhhhhhhhHHHHHHHLLlEEEEEEllllllllll
Query PAWVNTHHHLFqsllkgepfralfderrfrlaarIGLIELARSgCATVADhnyvyypgmp  120
ident                                                |            
Sbjct VKFIEMDIRDK-----------------------EAYELAKEW-FDEVVV----------   26
DSSP  LLLEEEEELLH-----------------------HHHHHHHHH-LLEEEE----------


DSSP  llhhhhhhhhhhhllleeeeEELLLLllllllllllhhhllllhhhHHHHhhHHHHHLLL
Query fdssailfeeaeklglrfvlLRGGATqtrqleadlptalrpetldaYVADieRLAARYHD  180
ident                                                |            
Sbjct --------------------SIKFNE--------------------EVDK--EKLREARK   44
DSSP  --------------------EEEELL--------------------LLLH--HHHHHHHH


DSSP  llllllEEEEELLLLLllllLHHHHHHHHHHHHhlLLEEEEELLllLHHHHHHhlLLLLl
Query aspramRRVVMAPTTVlysiSPREMRETAAVARrlGLRMHSHLSgkSPVAFCGehDWLGs  240
ident         |            |   | |                                
Sbjct ----eyGKVAILLSNP----KPSLVRDTVQKFK--SYLIYVESNdlRVIRYSI--EKGV-   91
DSSP  ----hhLLEEEEEELL----LHHHHHHHHHHLL--LLEEEEELLlhHHHHHHH--HLLL-


DSSP  lEEEELLL------LLLHHHHHHHHHHLLEEEELhHHHHLL---------------LLLL
Query dVWYAHLV------KVDADEIALLAQTGTGVAHCpQSNGRL---------------PVRE  279
ident                 |     |                                     
Sbjct -DAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYsnpyeranllrfmmkAWKL  149
DSSP  -LEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHllhhhhhhhhhhhhhHHHH


DSSP  HHHHLLLEEELLLHHHhlLLLL-HHHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHLll
Query MADAGVPVSIGVDGAAsnEAAD-MISEVHMTWLAQrarlASIAEVIHWGTAGGARVMGld  338
ident      |                                   |                  
Sbjct VEKYKVRRFLTSSAQE-kWDVRyPRDLISLGVVIG----MEIPQAKASISMYPEIILK--  202
DSSP  HHHHLLLEEEELLLLL-hHHLLlHHHHHHHHHHLL----LLHHHHHHLLLHHHHHHHL--


DSSP  lllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeellllll
Query evgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddlieg  398
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhhhl
Query vdikelggearrvvrellrevvv  421
ident                        
Sbjct -----------------------  202
DSSP  -----------------------


No 46: Query=2pajA Sbjct=1itqA Z-score=13.7

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleEE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcvIY   60
ident                                                             
Sbjct -----------------------------------------------dffrdeaerimRD   13
DSSP  -----------------------------------------------lhhhhhhhhhhLL


DSSP  ELEELLLLLHHHHhllllllHHHLLHHH-------hhhhhhhHHHH-HHLLLEEEEEELL
Query PAWVNTHHHLFQSllkgepfRALFDERR-------frlaariGLIE-LARSGCATVADHN  112
ident       |  |             |  |                 |  |            
Sbjct SPVIDGHNDLPWQ------lLDMFNNRLqderanlttlagthTNIPkLRAGFVGGQFWSV   67
DSSP  LLEEEEEELHHHH------hHHHHLLLLllhhhlllllllllLLHHhHHHLLEEEEEEEE


DSSP  LLL-------LLLLllLHHHHHHHHH---HHLL-----------------LEEEEEELLL
Query YVY-------YPGMpfDSSAILFEEA---EKLG-----------------LRFVLLRGGA  145
ident |                                                         | 
Sbjct YTPcdtqnkdAVRRtlEQMDVVHRMCrmyPETFlyvtssagirqafregkVASLIGVEGG  127
DSSP  LLLhhhllllHHHHhhHHHHHHHHHHhhlLLLEeelllhhhhhhhhhlllEEEEEEEELH


DSSP  LllllllllllhhhllLLHHhhHHHHHHHHHHLLllllllleeEEELLLLllLLLL----
Query TqtrqleadlptalrpETLDayVADIERLAARYHdaspramrrVVMAPTTvlYSIS----  201
ident                             |                   |           
Sbjct H--------------sIDSS--LGVLRALYQLGM---------RYLTLTHscNTPWadnw  162
DSSP  H--------------hLLLL--HHHHHHHHHLLE---------EEEELLLllLLLLlllh


DSSP  --------------HHHHHHHHHHHHHLLLEEEEELLlllHHHHHHHL--LLLLlLEEE-
Query --------------PREMRETAAVARRLGLRMHSHLSgksPVAFCGEH--DWLGsDVWY-  244
ident                           |||            ||             |   
Sbjct lvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLAHV---SVATMKATlqLSRA-PVIFs  218
DSSP  hhllllllllllllLHHHHHHHHHHHHHLLEEELLLL---LHHHHHHHhhHLLL-LLEEl


DSSP  ELLLL--------LLHHHHHHHHHHLLEEEELhhHHHLL--------------LLLLHHH
Query AHLVK--------VDADEIALLAQTGTGVAHCpqSNGRL--------------PVREMAD  282
ident              |  |   |  ||   |                               
Sbjct HSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN--FYNNYisctnkanlsqvadHLDHIKE  276
DSSP  LLLLLllllllllLLHHHHHHHHHHLLEEEEL--LLHHHhlllllllhhhhhhHHHHHHH


DSSP  HLL--LEEELLLHHHH-----llLLLHhHHHHHhHHHHHHLLLLHHHHHHHHLHHHHHHH
Query AGV--PVSIGVDGAAS-----neAADMiSEVHMtWLAQRARLASIAEVIHWGTAGGARVM  335
ident       |  | |                            |    |||         || 
Sbjct VAGarAVGFGGDFDGVprvpeglEDVS-KYPDL-IAELLRRNWTEAEVKGALADNLLRVF  334
DSSP  HLLhhHEEELLLLLLLlllllllLLLL-LHHHH-HHHHHHLLLLHHHHHHHHLHHHHHHH


DSSP  Llllllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelll
Query Gldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddl  395
ident                                                             
Sbjct E---------------------------------------------------aveqasnl  343
DSSP  H---------------------------------------------------hhhhllll


DSSP  lllllhhhhhhhhhhhhhhhhhhhhl
Query iegvdikelggearrvvrellrevvv  421
ident                           
Sbjct tqapeeepipldqlggscrthygyss  369
DSSP  llllllllllhhhlllllllllllll


No 47: Query=2pajA Sbjct=2qpxA Z-score=13.6

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct -------------------------------------------------gxddlsefvdQ   11
DSSP  -------------------------------------------------lllllhhhhhH


DSSP  ELEELLLLLHH-------hhhLLLLL--------------------------------lh
Query PAWVNTHHHLF-------qslLKGEP--------------------------------fr   81
ident       | |                                                   
Sbjct VPLLDHHCHFLidgkvpnrddRLAQVsteadkdypladtknrlayhgflalakefaldan   71
DSSP  LLEEEEEELLLlllllllhhhHHHHHlllllllllhhhhlllhhhhhhhhhhhhhlllll


DSSP  hhllhhhhhhhhhhhhHHHHLLLEEEEEELLLLllllllllhhhHHHHHHHHLLLEEEEE
Query alfderrfrlaariglIELARSGCATVADHNYVyypgmpfdssaILFEEAEKLGLRFVLL  141
ident                                              |   ||  |      
Sbjct nplaaxndpgyatynhRIFGHFHFKELLIDTGF----vpddpilDLDQTAELVGIPVKAI  127
DSSP  lllllllhhhhhhhhhHHHHHLLEEEEEEELLL----lllllllLHHHHHHHHLLLEEEE


DSSP  ELLLlllllllllllhhhLLLL---------HHHHHHHHHHHHHHLLllllllleeEEEL
Query RGGAtqtrqleadlptalRPET---------LDAYVADIERLAARYHdaspramrrVVMA  192
ident                                  |   |     |            |   
Sbjct YRLE-----------thaEDFXlehdnfaawWQAFSNDVKQAKAHGF---------VGFX  167
DSSP  EEHH-----------hhhHHHHlllllhhhhHHHHHHHHHLLLLLLL---------LLEE


DSSP  LlLLLLL--------------------------------lLHHHHHHHHHHHHHLLLEEE
Query PtTVLYS--------------------------------iSPREMRETAAVARRLGLRMH  220
ident      |                                          |           
Sbjct S-IAAYRvglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQ  226
DSSP  E-LHHHHlllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEE


DSSP  EELL--------lLLHHHHHHHLL----llllLEEEELLLLLlHHHHHHHHHH-LLEEEE
Query SHLS--------gKSPVAFCGEHD----wlgsDVWYAHLVKVdADEIALLAQT-GTGVAH  267
ident  |                               |   |          |           
Sbjct FHVGygdadtdxyLGNPLLXRDYLkaftkkglKVVLLHCYPYhREAGYLASVFpNLYFDI  286
DSSP  EEELlllllllhhHLLHHHHHHHHhhhhhhllLEEEEELLLLhHHHHHHHHHLlLEEEEL


DSSP  L--HHHHH---llLLLLHHHHLL--LEEELLLHHHhlLLLLhhHHHHHHHHHHHHLL---
Query C--PQSNG---rlPVREMADAGV--PVSIGVDGAAsnEAADmiSEVHMTWLAQRARL---  317
ident                 |              |     |             |  |     
Sbjct SllDNLGPsgasrVFNEAVELAPytRILFASDASTypEXYG--LAARQFKQALVAHFnql  344
DSSP  LlhHHHLHhhhhhHHHHHLLLLLhhHEELLLLLLLlhHHHH--HHHHHHHHHHHHHHhll


DSSP  ------lLHHHHHHHHLHHHHHHHLLLLLLLLllllllleeeeelllhhhlllllhhhhh
Query ------aSIAEVIHWGTAGGARVMGLDEVGKVavgyaadiavyrlddpryfglhdpaigp  371
ident          |          |          |                            
Sbjct pfvdlaqKKAWINAICWQTSAKLYHQERELRV----------------------------  376
DSSP  llllhhhHHHHHHHHHLHHHHHHLLLHHHHLL----------------------------


DSSP  hhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query vasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                                   
Sbjct --------------------------------------------------  376
DSSP  --------------------------------------------------


No 48: Query=2pajA Sbjct=4dziC Z-score=12.6

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct ---------------------------------------------------------alN    3
DSSP  ---------------------------------------------------------llL


DSSP  ELEELLLLLHHhhhllllllHHHLLH----------------------------------
Query PAWVNTHHHLFqsllkgepfRALFDE----------------------------------   86
ident         |                                                   
Sbjct YRVIDVDNHYY--------ePLDSFTrhldkkfkrrgvqmlsdgkrtwavigdrvnhfip   55
DSSP  LLEEEEEEELL--------lLLLLLLllllhhhlllleeeeelllleeeeelleelllll


DSSP  --------------------------------------hhhhHHHHHHHHHHHLLLEEEE
Query --------------------------------------rrfrLAARIGLIELARSGCATV  108
ident                                                           | 
Sbjct nptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETA  115
DSSP  lllllleelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEE


DSSP  EELLLLL-------------LLLL----llLHHHHHHhhhhhlLLEEEEEELLLLLllll
Query ADHNYVY-------------YPGM----pfDSSAILFeeaeklGLRFVLLRGGATQtrql  151
ident                                              |              
Sbjct FMLPTFGcgveealkhdieaTMASvhafnlWLDEDWG--fdrpDHRIIAAPIVSLA----  169
DSSP  EEELLHHhhhhhhllllhhhHHHHhhhhhhHHHHHLL--llllLLLEEELLLLLLL----


DSSP  lllllhhhlllLHHHHHHHHHHHHHHLLllllllleeEEELLlLLLLL--------llHH
Query eadlptalrpeTLDAYVADIERLAARYHdaspramrrVVMAPtTVLYS--------isPR  203
ident                 |       ||                                 |
Sbjct -----------DPTRAVEEVDFVLARGA---------KLVLV-RPAPVpglvkprslgDR  208
DSSP  -----------LHHHHHHHHHHHHHLLL---------LLEEL-LLLLLllllllllllLH


DSSP  HHHHHHHHHHHLLLEEEEEL---------------------------lllLHHHHHH-HL
Query EMRETAAVARRLGLRMHSHL---------------------------sgkSPVAFCG-EH  235
ident       |     |     ||                                 |      
Sbjct SHDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldqvllddraihDTMASMIvHG  268
DSSP  HHHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhhhhhllhhhhHHHHHHHhLL


DSSP  LL---lllLEEEE-LLLLL-LHHH------------------hHHHHhHLLEEEELHhhh
Query DW---lgsDVWYA-HLVKV-DADE------------------iALLAqTGTGVAHCPqsn  272
ident                                              |       |      
Sbjct VFtrhpklKAVSIeNGSYFvHRLIkrlkkaantqpqyfpedpvEQLR-NNVWIAPYY---  324
DSSP  HHhhllllLEEEElLLLLHhHHHHhhhhhhhhhlhhhllllhhHHHH-HHEEELLLL---


DSSP  hllLLLLHHHHLL--LEEELLLHHH-HLLLlLHHHHhHHHHHHhhhllLLHHHHHHHHLH
Query grlPVREMADAGV--PVSIGVDGAA-SNEAaDMISEvHMTWLAqrarlASIAEVIHWGTA  329
ident       | |          | |       |    |              |          
Sbjct -edDLPELARVIGvdKILFGSDWPHgEGLA-SPVSF-TAELKG-----FSESDIRKIMRD  376
DSSP  -llLHHHHHHHHLhhHLLLLLLLLLlLLLL-LHHHH-HHHHLL-----LLHHHHHHHHLH


DSSP  HHHHHHLlllllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeellee
Query GGARVMGldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkr  389
ident       |                                                     
Sbjct NALDLLG-----------------------------------------------------  383
DSSP  HHHHHHL-----------------------------------------------------


DSSP  eeellllllllhhhhhhhhhhhhhhhhhhhhl
Query vvvddliegvdikelggearrvvrellrevvv  421
ident                                 
Sbjct ---------------------------vqvgs  388
DSSP  ---------------------------lllll


No 49: Query=2pajA Sbjct=1j5sA Z-score=11.9

back to top
DSSP  ---------leeeeellleELLLllllllllllllllleeeelleeeeelllllllllee
Query ---------pstlirnaaaIMTGgrgtaddpsrvpgpdirivgdtidaigalaprpgeti   51
ident                                                             
Sbjct hmflgedylltnraavrlfNEVK-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------


DSSP  eelllleeEELEELLLLLHHhhhllllllhhhllhhhhhHHHH-----------------
Query vdatdcviYPAWVNTHHHLFqsllkgepfralfderrfrLAAR-----------------   94
ident             |  | ||                                         
Sbjct --------DLPIVDPHNHLD------------------aKDIVenkpwndiwevegatdh   57
DSSP  --------LLLEEELLLLLL------------------hHHHHhllllllhhhhhllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   94
ident                                                             
Sbjct yvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvis  117
DSSP  hhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllll


DSSP  ------------------hHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHHLL-
Query ------------------iGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEKLG-  135
ident                        |                               |    
Sbjct eetaeeiweetkkklpemtPQKLLRDMKVEILCTTDDPV------STLEHHRKAKEAVEg  171
DSSP  hhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLLLL------LLLHHHHHHHHHLLl


DSSP  LEEEEEELLL--LLLLLLLlllLHHHL-------------llLHHHHHHHHHHHhHHLLl
Query LRFVLLRGGA--TQTRQLEadlPTALR-------------peTLDAYVADIERLaARYHd  180
ident                                            | |     |        
Sbjct VTILPTWRPDraMNVDKEG--wREYVEkmgerygedtstldgFLNALWKSHEHF-KEHG-  227
DSSP  LEEELLLLLHhhHLLLLLL--hHHHHHhhhhhhllllllhhhHHHHHHHHHHHH-HLLL-


DSSP  lllllleEEEELlLLLL------------------------------lllLHHHHHHHHH
Query aspramrRVVMApTTVL------------------------------ysiSPREMRETAA  210
ident         |       |                                     |     
Sbjct -------CVASD-HALLepsvyyvdenraravhekafsgekltqdeindyKAFMMVQFGK  279
DSSP  -------LLEEE-EEELllllllllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHH


DSSP  HHHHLLLEEEEELL------------------------LLLHHHHHHHLL---llllLEE
Query VARRLGLRMHSHLS------------------------GKSPVAFCGEHD---wlgsDVW  243
ident            |                                                
Sbjct MNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnFLRIAEGLRYFLnefdgklKIV  339
DSSP  HHHHHLLEEEEEELeellllhhhhhhlllllllleellLLLHHHHHHHHHhhlllllLEE


DSSP  EeLLLL--LLHHHHHHHHHHL-LEEEElhhhHHLL--------LLLLHHHHL---LLEEE
Query YaHLVK--VDADEIALLAQTG-TGVAHcpqsNGRL--------PVREMADAG---VPVSI  289
ident                         |                       |           
Sbjct L-YVLDptHLPTISTIARAFPnVYVGA---pWWFNdspfgmemHLKYLASVDllyNLAGM  395
DSSP  E-EELLhhHHHHHHHHHHHLLlEEELL---lLLLLllhhhhhhHHHHHHLLLlhhHLLLL


DSSP  LLLHHhhLLLLLhHHHHHHHHHHH-HHLL-----------lLHHHHHHHHLHHHHHHHLl
Query GVDGAasNEAADmISEVHMTWLAQ-RARL-----------aSIAEVIHWGTAGGARVMGl  337
ident   |           |   |                          | |    |       
Sbjct VTDSR--KLLSF-GSRTEMFRRVLsNVVGemvekgqipikeARELVKHVSYDGPKALFF-  451
DSSP  LLLLL--LLLHH-HHHHHHHHHHHhHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-


DSSP  llllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelllll
Query devgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddlie  397
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhhhhhhhhhhhhl
Query gvdikelggearrvvrellrevvv  421
ident                         
Sbjct ------------------------  451
DSSP  ------------------------


No 50: Query=2pajA Sbjct=3iacA Z-score=11.9

back to top
DSSP  ----------leeeeelllEELLlllllllllllllllleeeelleeeeellllllllle
Query ----------pstlirnaaAIMTggrgtaddpsrvpgpdirivgdtidaigalaprpget   50
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eeelllleeEELEELLLLLHH----------------hhHLLLLL---------------
Query ivdatdcviYPAWVNTHHHLF----------------qsLLKGEP---------------   79
ident                 | ||                                        
Sbjct --------aPXPIYDFHCHLSpqeiaddrrfdnlgqiwlEGDHYKwralrsagvdeslit   75
DSSP  --------lLLLEEELLLLLLhhhhhhllllllhhhhhhLLLLHHhhhhhhllllhhhll


DSSP  --------------------------------------------------lhhhllhhhh
Query --------------------------------------------------fralfderrf   89
ident                                                             
Sbjct gketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekl  135
DSSP  lllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhh


DSSP  hhhhhHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHH--LLLEEEEEELLL--
Query rlaarIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEK--LGLRFVLLRGGA--  145
ident                   |             ||       |                  
Sbjct atpafSARGIXQQXNVRXVGTTDDPI------DSLEYHRQIAADdsIDIEVAPSWRPDkv  189
DSSP  llhhhLHHHHHHHLLEEEEELLLLLL------LLLHHHHHHHHLllLLLEEELLLLLHhh


DSSP  LLLLLLLllllHHHL--------------llLHHHHHHHHHHHHHHLlllllllleEEEE
Query TQTRQLEadlpTALR--------------peTLDAYVADIERLAARYhdaspramrRVVM  191
ident                                   |        ||               
Sbjct FKIELDG---fVDYLrkleaaadvsitrfddLRQALTRRLDHFAACG---------CRAS  237
DSSP  HLLLLLL---hHHHHhhhhhhhllllllhhhHHHHHHHHHHHHHHLL---------LLEE


DSSP  LlLLLLL-------------------------------llLHHHHHHHHHHHHHLLLEEE
Query ApTTVLY-------------------------------siSPREMRETAAVARRLGLRMH  220
ident                                                        |    
Sbjct D-HGIETlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQ  296
DSSP  E-EEELLllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEE


DSSP  EELL--------------------------lLLHHHHHHHLL---llllLEEEeLLLL--
Query SHLS--------------------------gKSPVAFCGEHD---wlgsDVWYaHLVK--  249
ident  |                                                          
Sbjct LHIGairnnntrxfrllgpdtgfdsigdnniSWALSRLLDSXdvtnelpKTIL-YCLNpr  355
DSSP  EEELeellllhhhhhhhllllllleelllllHHHHHHHHHHHhllllllEEEE-EELLhh


DSSP  LLHHHHHHHHHH-------LLEEEElhhhHHLL--------LLLLHHHHLL---LEEELL
Query VDADEIALLAQT-------GTGVAHcpqsNGRL--------PVREMADAGV---PVSIGV  291
ident                                                  |     |    
Sbjct DNEVLATXIGNFqgpgiagKVQFGS---gWWFNdqkdgxlrQLEQLSQXGLlsqFVGXLT  412
DSSP  HHHHHHHHHHHLlllllllLEEELL---lLHHHllhhhhhhHHHHHHHHLLhhhLLLLLL


DSSP  LHHhhLLLLLhhHHHHHHHHHHHHLL--------------lLHHHHHHHHLHHHHHHHLl
Query DGAasNEAADmiSEVHMTWLAQRARL--------------aSIAEVIHWGTAGGARVMGl  337
ident |                        |                   |         |    
Sbjct DSR--SFLSY--TRHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-  467
DSSP  LLL--LLLLL--HHHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-


DSSP  llllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelllll
Query devgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddlie  397
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhhhhhhhhhhhhl
Query gvdikelggearrvvrellrevvv  421
ident                         
Sbjct ----------------------ik  469
DSSP  ----------------------ll


No 51: Query=2pajA Sbjct=3qy6A Z-score=11.1

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  elEELLLLLH-----HHHHllllllhhhllhhhHHHHHHHHHHHHHLLLEEEEEELLL--
Query paWVNTHHHL-----FQSLlkgepfralfderrFRLAARIGLIELARSGCATVADHNY--  113
ident       | |                                     | |  |        
Sbjct --MIDIHCHIlpamdDGAG--------------DSADSIEMARAAVRQGIRTIIATPHhn   44
DSSP  --LEELLLLLlllllLLLL--------------LHHHHHHHHHHHHHLLLLEEELLLEel


DSSP  -llllllllLHHHHHHHHHHHL-----LLEEEEEEllllllllllllllhhhllllhhhh
Query -vyypgmpfDSSAILFEEAEKL-----GLRFVLLRggatqtrqleadlptalrpetlday  167
ident                      |      |                               
Sbjct ngvyknepaAVREAADQLNKRLikediPLHVLPGQ-------------------------   79
DSSP  lllllllhhHHHHHHHHHHHHHhhlllLLEEELLL-------------------------


DSSP  hhhhhhhhhhllllllllleeeeelLLLLlllllhhhHHHHHHHHHHL-------lLEEE
Query vadierlaaryhdaspramrrvvmaPTTVlysispreMRETAAVARRL-------gLRMH  220
ident                                        |                    
Sbjct -------------------------EIRI--------YGEVEQDLAKRqllslndtKYIL  106
DSSP  -------------------------EEEL--------LLLHHHHHHLLllllhhhlLEEE


DSSP  EELLllLHHHHHHhLLLL-----llLEEEELLL-----LLLHHHHHHHHHHLLEEEELHH
Query SHLSgkSPVAFCGeHDWL-----gsDVWYAHLV-----KVDADEIALLAQTGTGVAHCPQ  270
ident                              ||                |   |        
Sbjct IEFPfdHVPRYAE-QLFYdlqlkgyIPVIAHPErnreiRENPSLLYHLVEKGAASQITSG  165
DSSP  EELLllLLLLLHH-HHHHhhhhlllEEEEELHHhlhhhHHLLHHHHHHHHLLLEEEEEHH


DSSP  H--HHLL---------LLLLHhhhlLLEEELLLHHH-hlLLLLHHHHHHHHHHHhhhllL
Query S--NGRL---------PVREMadagVPVSIGVDGAA-snEAADMISEVHMTWLAqrarlA  318
ident |                |              |                           
Sbjct SlaGIFGkqlkafslrLVEAN----LIHFVASDAHNvktRNFHTQEALYVLEKE-----F  216
DSSP  HhlLLLLhhhhhhhhhHHHLL----LLLEEELLLLLlllLLLLHHHHHHHHHHH-----H


DSSP  LHHHHHHHhLHHHHHHHLLLlllllllllllleeeeelllhhhlllllhhhhhhhlllll
Query SIAEVIHWgTAGGARVMGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrp  378
ident          |                                                  
Sbjct GSELPYML-TENAELLLRNQ----------------------------------------  235
DSSP  LLHHHHHH-HHHHHHHHLLL----------------------------------------


DSSP  eeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query svmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                            
Sbjct -------------------------------tifrqppqpvkr  247
DSSP  -------------------------------llllllllllll


No 52: Query=2pajA Sbjct=3dcpA Z-score=10.3

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eLEELLLLLHH----HHHLlllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLL---
Query pAWVNTHHHLF----QSLLkgepfralfderrfrlAARIGLIELARSGCATVADHNY---  113
ident       | |                                                   
Sbjct -XKRDGHTHTEfcphGTHD----------------DVEEXVLKAIELDFDEYSIVEHapl   43
DSSP  -LLEEEEELLLllllLLLL----------------LHHHHHHHHHHLLLLEEEEEEElll


DSSP  ------------------LLLLLLLLLHHHHHHHHHHHLL--LEEEEEELllllllllll
Query ------------------VYYPGMPFDSSAILFEEAEKLG--LRFVLLRGgatqtrqlea  153
ident                                      |    |                 
Sbjct ssefxkntagdkeavttaSXAXSDLPYYFKKXNHIKKKYAsdLLIHIGFE----------   93
DSSP  lhhhhhllllllhhhhllLLLHHHHHHHHHHHHHHHHHLLllLEEEEEEE----------


DSSP  lllhhhllllhhhhhhhhhhhhhhllllllllleeeeellLLLLLLlLHHHHHHHHHHHH
Query dlptalrpetldayvadierlaaryhdaspramrrvvmapTTVLYSiSPREMRETAAVAR  213
ident                                            |        |       
Sbjct ----------------------------------------VDYLIG-YEDFTRDFLNEYG  112
DSSP  ----------------------------------------EELLLL-LHHHHHHHHHHHH


DSSP  hllleeEEELL-----------------------------------llLHHHHH-HHLLl
Query rlglrmHSHLS-----------------------------------gkSPVAFC-GEHDw  237
ident          |                                        |         
Sbjct pqtddgVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaylEGVKQSiEADLg  172
DSSP  hhlleeEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhHHHHHHhHLLLl


DSSP  llllEEEELLLL---------------------lLHHHHHHHHHHLLEEEELHhHHHLL-
Query lgsdVWYAHLVK---------------------vDADEIALLAQTGTGVAHCPqSNGRL-  275
ident         |                              ||                   
Sbjct lfkpRRXGHISLcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNT-AGLFKp  231
DSSP  llllLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEEL-HHHHLl


DSSP  ----------LLLLHHHHLLLEEELLLHHHhlLLLLhhHHHHHHHHHHHhllllhhhhhh
Query ----------PVREMADAGVPVSIGVDGAAsnEAADmiSEVHMTWLAQRarlasiaevih  325
ident            |        |   | |                                 
Sbjct lcgetyppkkIVTLASELQIPFVYGSDSHG-vQDIG--RGYSTYCQKLE-----------  277
DSSP  llllllllhhHHHHHHHLLLLEEEELLLLL-hHHLL--LLHHHHHHHLL-----------


DSSP  hhlhhhhhhhllllllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeee
Query wgtaggarvmgldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfs  385
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query agkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                     
Sbjct ------------------------------------  277
DSSP  ------------------------------------


No 53: Query=2pajA Sbjct=3au2A Z-score=9.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  -------------------------------------------------leeeeELLL--
Query -------------------------------------------------pstliRNAA--    9
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagETEEev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelLLHHhh


DSSP  ----------------eelllllllLLLLLlllllleeeelleeeeellllllllleeee
Query ----------------aimtggrgtADDPSrvpgpdirivgdtidaigalaprpgetivd   53
ident                             |                               
Sbjct yaalglpwippplredqgeveaaleGRLPK------------------------------  330
DSSP  hhhlllllllhhhlllllhhhhhhlLLLLL------------------------------


DSSP  lllleeeELEElllllhhhhhllllllhhhllhhhhhhhhhhhhhhhhllleeEEEE-LL
Query atdcviyPAWVnthhhlfqsllkgepfralfderrfrlaariglielarsgcaTVAD-HN  112
ident           |                                                 
Sbjct ----lleLPQV------------------------------------------KGDLqVH  344
DSSP  ----lllHHHL------------------------------------------LEEEeEL


DSSP  LLLLllllLLHHHHHHHHHHHLLLEEEEEELLLLLlllllllllhhHLLLLHHHHHHHHH
Query YVYYpgmpFDSSAILFEEAEKLGLRFVLLRGGATQtrqleadlptaLRPETLDAYVADIE  172
ident   |           | | |   | |                                   
Sbjct STYS--dgQNTLEELWEAAKTMGYRYLAVTDHSPA--------vrvAGGPSPEEALKRVG  394
DSSP  LLLL--llLLLHHHHHHHHHHHLLLEEEEEEELHH--------hhlLLLLLHHHHHHHHH


DSSP  HHHHHLllllllLLEEEEELlLLLL-----LLLLhhhhHHHHHHHhhllLEEEEELL---
Query RLAARYhdasprAMRRVVMApTTVL-----YSISpremRETAAVArrlgLRMHSHLS---  224
ident                    |                                        
Sbjct EIRRFN--ethgPPYLLAGA-EVDIhpdgtLDYP----DWVLREL----DLVLVSVHsrf  443
DSSP  HHHHHH--hhhlLLEEEEEE-EEELlllllLLLL----HHHHLLL----LEEEEELLlll


DSSP  ------llLHHHHHHHLLLLlllEEEELLL-----------LLLHHHHHHHHHHLLEEEE
Query ------gkSPVAFCGEHDWLgsdVWYAHLV-----------KVDADEIALLAQTGTGVAH  267
ident                |          ||                          |  |  
Sbjct nlpkadqtKRLLKALENPFV---HVLAHPTarllgrrapieADWEAVFQKAKEKGVAVEI  500
DSSP  lllhhhhhHHHHHHHLLLLL---LEELLLLlllllllllllLLHHHHHHHHHHHLLEEEE


DSSP  LH-HHHH---llLLLLHHHHLLLEEELLLHhhhlllLLHHHHHHHHHHhhhhllllhhHH
Query CP-QSNG---rlPVREMADAGVPVSIGVDGaasneaADMISEVHMTWLaqrarlasiaEV  323
ident               |     |   |   |         |   |                 
Sbjct DGyYDRMdlpddLARMAYGMGLWISLSTDAhqtdhlRFMELAVGTAQR---------aWI  551
DSSP  ELlLLLLlllhhHHHHHHHLLLLEEEELLLllhhhhHHHHHHHHHHHH---------lLL


DSSP  HHHhlHHHH----hhHLLLlllllllllllleeeeelllhhhlllllhhhhhhhllllle
Query IHWgtAGGA----rvMGLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrps  379
ident                                                             
Sbjct GPE--RVLNtldyedLLSW-----------------------------------------  568
DSSP  LLL--LLHHhllhhhHHHH-----------------------------------------


DSSP  eeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query vmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                           
Sbjct -----------------------------------lkarrgv  575
DSSP  -----------------------------------hhlllll


No 54: Query=2pajA Sbjct=3f2bA Z-score=9.4

back to top
DSSP  --------------------------------------------leeeeellleelllll
Query --------------------------------------------pstlirnaaaimtggr   16
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  llllllllllllleeeelleeeeellllllLLLEEE---ellllEEEELEELLLLLHHhh
Query gtaddpsrvpgpdirivgdtidaigalaprPGETIV---datdcVIYPAWVNTHHHLFqs   73
ident                                   |               |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtaPEGEKRVELHLHTP--  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELllllllllLLLLLLLLLLLLLL--


DSSP  hllllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHH
Query llkgepfralfderrfrlAARIGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEK  133
ident                               |    |             |       | |
Sbjct ----------msqmdavtSVTKLIEQAKKWGHPAIAVTDHAV-----vQSFPEAYSAAKK  163
DSSP  ----------llllllllLHHHHHHHHHHLLLLLEEELLLLL-----lLLHHHHHHHHHH


DSSP  LLLEEEEEELlllllllllllllhhhllllhhhhhhhhhhhhhhllllllllleeeeell
Query LGLRFVLLRGgatqtrqleadlptalrpetldayvadierlaaryhdaspramrrvvmap  193
ident  |                                                          
Sbjct HGMKVIYGLE--------------------------------------------------  173
DSSP  HLLLEEEEEE--------------------------------------------------


DSSP  LLLL----------------------------------LLLLhhhHHHHHHHHHhllLEE
Query TTVL----------------------------------YSISpreMRETAAVARrlgLRM  219
ident                                         |                   
Sbjct ANIVddpfhvtllaqnetglknlfklvslshiqyfhrvPRIP---RSVLVKHRD---GLL  227
DSSP  EEEEllleeeeeeellhhhhhhhhhhhhhhhlllllllLLEE---HHHHHHLLL---LEE


DSSP  EeelllllhhhhhhhllllllleEEELL----LLLLhhhHHHHhHHLLEEEELHHHHHLL
Query HshlsgkspvafcgehdwlgsdvWYAHL----VKVDadeIALLaQTGTGVAHCPQSNGRL  275
ident                                                      |      
Sbjct V----------------------GSGCDkgelFDNV---EDIA-RFYDFLEVHPPDVYKP  261
DSSP  E----------------------ELLLLllllLLLL---LLLH-HHLLLEEELLHHHHLL


DSSP  -----------LLLLHHHHL----LLEEELLLHH--------------------------
Query -----------PVREMADAG----VPVSIGVDGA--------------------------  294
ident              |     |     ||                                 
Sbjct lyvkdeemiknIIRSIVALGekldIPVVATGNVHylnpedkiyrkilihsqgganplnrh  321
DSSP  lllllhhhhhhHHHHHHHHHhhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllll


DSSP  --HHLLlLLHH-HHHHHHHHhhhhllLLHHHHHHHHLHHHHHHHLL--------------
Query --ASNEaADMI-SEVHMTWLaqrarlASIAEVIHWGTAGGARVMGL--------------  337
ident                                              |              
Sbjct elPDVY-FRTTnEMLDCFSF------LGPEKAKEIVVDNTQKIASLigdvkpikdelytp  374
DSSP  llLLLL-LLLHhHHHHHHHH------HHHHHHHHHHLHHHHHHHHLllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  337
ident                                                             
Sbjct riegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksl  434
DSSP  llllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhh


DSSP  ---------------------------------------------------lllllllll
Query ---------------------------------------------------devgkvavg  346
ident                                                             
Sbjct ddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdknc  494
DSSP  hllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllll


DSSP  lllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeellllllllhhhhhh
Query yaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelgg  406
ident                                                             
Sbjct prcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragt  554
DSSP  llllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeee


DSSP  hhhHHHHHHHHHHHL---------------------------------------------
Query earRVVRELLREVVV---------------------------------------------  421
ident             |                                               
Sbjct igtVADKTAYGFVKAyasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiy  614
DSSP  eeeLLHHHHHHHHHHhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct dftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktipt  674
DSSP  hllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct ddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgl  734
DSSP  llhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct shgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkglt  794
DSSP  llllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct pefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftv  854
DSSP  hhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct raedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidl  914
DSSP  llllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  421
ident                                                             
Sbjct yrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlle  974
DSSP  lllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhh


DSSP  --------------------
Query --------------------  421
ident                     
Sbjct ylesrgcldslpdhnqlslf  994
DSSP  hhhhllllllllllllllll


No 55: Query=2pajA Sbjct=1m65A Z-score=8.9

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eleelllllhhhhhllllllhhhllhhhhhhhhhhhhhhhhlllEEEEEELLLLLLLlll
Query pawvnthhhlfqsllkgepfralfderrfrlaariglielarsgCATVADHNYVYYPgmp  120
ident                                                      |      
Sbjct --------------------------------------------YPVDLHMHTVAST-ha   15
DSSP  --------------------------------------------LLEELLLLLLLLL-ll


DSSP  LLHHHHHHHHHHHLLLEEEEEELLLLLLllllllllhhHLLLLHHHHHHhHHHHhhHLLL
Query FDSSAILFEEAEKLGLRFVLLRGGATQTrqleadlptaLRPETLDAYVAdIERLaaRYHD  180
ident           |   |                                             
Sbjct YSTLSDYIAQAKQKGIKLFAITDHGPDM----------EDAPHHWHFIN-MRIW--PRVV   62
DSSP  LLLHHHHHHHHHHHLLLEEEEEEELLLL----------LLLLLLHHHHH-HHHL--LLEE


DSSP  llllLLEEEEELLLLL-----LLLLlhhhHHHHHHHHhhllLEEEEEL-----------l
Query asprAMRRVVMAPTTV-----LYSIspreMRETAAVArrlgLRMHSHL-----------s  224
ident                                                             
Sbjct ---dGVGILRGIEANIknvdgEIDC----SGKMFDSL----DLIIAGFhepvfaphdkat  111
DSSP  ---lLEEEEEEEEEELlllllLLLL----LHHHHHHL----LEEEEELlllllllllhhh


DSSP  llLHHHHHHHLLLLlllEEEELLL-----LLLHHHHHHHHHHLLEEEELhHHHH-llLLL
Query gkSPVAFCGEHDWLgsdVWYAHLV-----KVDADEIALLAQTGTGVAHCpQSNG-rlPVR  278
ident                      |                 |           |        
Sbjct ntQAMIATIASGNV---HIISHPGnpkyeIDVKAVAEAAAKHQVALEIN-NSSNcreVAA  167
DSSP  hhHHHHHHHHLLLL---LEELLLLlllllLLHHHHHHHHHHHLLEEEEE-LLLLhhhHHH


DSSP  LHHHHLLLEEELLLHhhhllllLHHHHHHHHHHHHhhllllhhHHHHhhlHHHH---hhH
Query EMADAGVPVSIGVDGaasneaaDMISEVHMTWLAQrarlasiaEVIHwgtAGGA---rvM  335
ident    |||  |  | |                                              
Sbjct AVRDAGGWVALGSDShtaftmgEFEECLKILDAVD--------FPPE---RILNvsprrL  216
DSSP  HHHHHLLLEEEELLLllhhhllLLHHHHHHHHHLL--------LLHH---HLHHhlhhhH


DSSP  LLLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelll
Query GLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddl  395
ident                                                             
Sbjct LNF---------------------------------------------------------  219
DSSP  HHH---------------------------------------------------------


DSSP  lllllhhhhhhhhhhhhhhhhhhhhl
Query iegvdikelggearrvvrellrevvv  421
ident                           
Sbjct -----------lesrgmapiaefadl  234
DSSP  -----------hhhllllllhhhlll


No 56: Query=2pajA Sbjct=1bksA Z-score=8.5

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleEE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcvIY   60
ident                                                             
Sbjct ----------------------------------------------meryenlfaqlnDR   14
DSSP  ----------------------------------------------lhhhhhhhhhhhHL


DSSP  ELEELlLLLHHhhhllllllhhhLLHHHHHHHHHHHHHHHhllleeeEEELLLLLLL---
Query PAWVNtHHHLFqsllkgepfralFDERRFRLAARIGLIELarsgcatVADHNYVYYP---  117
ident                                                 |    |      
Sbjct REGAF-VPFVT---------lgdPGIEQSLKIIDTLIDAG------aDALELGVPFSdpl   58
DSSP  LLLEE-EEEEE---------lllLLHHHHHHHHHHHHHLL------lLLEEEELLLLlll


DSSP  ------------------LLLL--LHHHHHHHHHHhlllEEEEEELLLLllllllllllh
Query ------------------GMPF--DSSAILFEEAEklglRFVLLRGGATqtrqleadlpt  157
ident                            |   |                            
Sbjct adgptiqnanlrafaagvTPAQcfEMLALIREKHP----TIPIGLLMYA-----------  103
DSSP  lllhhhhhhhhhhhhhllLHHHhhHHHHHHHHHLL----LLLEEEEELH-----------


DSSP  hhlLLLHH-HHHHHHHHHHHHLLllllllleeEEELLLllllLLLHHHHHHHHHHHHHLL
Query alrPETLD-AYVADIERLAARYHdaspramrrVVMAPTtvlySISPREMRETAAVARRLG  216
ident             |   |                              |       | |  
Sbjct ---NLVFNnGIDAFYARCEQVGV---------DSVLVA----DVPVEESAPFRQAALRHN  147
DSSP  ---HHHHLlLHHHHHHHHHHHLL---------LEEEEL----LLLHHHLHHHHHHHHHLL


DSSP  LEEEEELL---lLLHHHHHHHllllllLEEEELLlLLLHHHHHHHHH-HLLEEEEL-HHH
Query LRMHSHLS---gKSPVAFCGEhdwlgsDVWYAHLvKVDADEIALLAQ-TGTGVAHC-PQS  271
ident                                  |       |  |              |
Sbjct IAPIFICPpnadDDLLRQVAS----ygRGYTYLLaLPLHHLIEKLKEyHAAPALQGfGIS  203
DSSP  LEEEEEELllllHHHHHHHHH----hlLLLEEELlLLHHHHHHHHHHhLLLLEEELlLLL


DSSP  H---hlllLLLHhhhlllEEELLL-HHHH----------------lLLLL--HHHHHhhh
Query N---grlpVREMadagvpVSIGVD-GAAS----------------nEAAD--MISEVhmt  309
ident         ||                                                  
Sbjct SpeqvsaaVRAG-----aAGAISGsAIVKiieknlaspkqmlaelrSFVSamKAASR---  255
DSSP  LhhhhhhhHHHL-----lLEEEELlHHHHhhhhllllhhhhhhhhhHHHHhhHHLLL---


DSSP  hhhhhhllllhhhhhhhhlhhhhhhhllllllllllllllleeeeelllhhhlllllhhh
Query wlaqrarlasiaevihwgtaggarvmgldevgkvavgyaadiavyrlddpryfglhdpai  369
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  hhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query gpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                                     
Sbjct ----------------------------------------------------  255
DSSP  ----------------------------------------------------


No 57: Query=2pajA Sbjct=2anuA Z-score=6.8

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
ident                                                             
Sbjct ----------------------------------------------------------tE    2
DSSP  ----------------------------------------------------------lE


DSSP  ELEELLLLLH---HHHHllllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLL----
Query PAWVNTHHHL---FQSLlkgepfralfderrfrlAARIGLIELARSGCATVADHNY----  113
ident       | |       |                             |   |         
Sbjct WLLCDFHVHTnxsDGHL-----------------PLGEVVDLFGKHGVDVVSITDHivdr   45
DSSP  EEEEEEEELLlllLLLL-----------------LHHHHHHHHHHLLLLEEEEEEEeelh


DSSP  --------------LLLLLLlLLHHHHHHHHHHHLL----LEEEEEELLLLLllllllll
Query --------------VYYPGMpFDSSAILFEEAEKLG----LRFVLLRGGATQtrqleadl  155
ident                       |    |  |                             
Sbjct rtleqrkrngeplgAITEDKfQDYLKRLWREQKRAWeeygXILIPGVEITNN--------   97
DSSP  hhhhhhhhllllllLLLLLLhHHHHHHHHHHHHHHHhhhlLEEEEEEEEEEL--------


DSSP  lhhhllllhhhhhhhhhhhhhhllllllllleeeeelllllLLLL-----------lhHH
Query ptalrpetldayvadierlaaryhdaspramrrvvmapttvLYSI-----------spRE  204
ident                                                             
Sbjct ----------------------------------------tDLYHivavdvkeyvdpsLP  117
DSSP  ----------------------------------------lLLEEeeeelllllllllLL


DSSP  HHHHHHHHHHLLLEEEEELL--------llLHHHHHhhLLLLlllEEEEL-----LLLLl
Query MRETAAVARRLGLRMHSHLS--------gkSPVAFCgeHDWLgsdVWYAH-----LVKVd  251
ident   |                                    |               |    
Sbjct VEEIVEKLKEQNALVIAAHPdrkklswylwANXERF--KDTF---DAWEIanrddLFNS-  171
DSSP  HHHHHHHHHHLLLEEEELLLlllllllhhhHLLLLL--LLLL---LEEEEeelleELHH-


DSSP  hhhHHHHhhhllEEEElhhhhhllllllhhhhllleeeLLLHHhhLLLLlhHHHHhhhhh
Query adeIALLaqtgtGVAHcpqsngrlpvremadagvpvsiGVDGAasNEAAdmISEVhmtwl  311
ident                                         |                   
Sbjct -vgVKKY-----RYVA----------------------NSDFH--ELWH--VYSW-----  194
DSSP  -hhHLLL-----LEEE----------------------ELLLL--LHHH--HLLE-----


DSSP  hhhhllllhhhhhhhHLHH----hhHHHLLllllllllllllleeeeelllhhhlllllh
Query aqrarlasiaevihwGTAG----gaRVMGLdevgkvavgyaadiavyrlddpryfglhdp  367
ident                                                             
Sbjct --------------kTLVKseknieAIKEA------------------------------  210
DSSP  --------------eEEEEelllhhHHHHH------------------------------


DSSP  hhhhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query aigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
ident                                                       
Sbjct ----------------------------------------irkntdvaiylxrk  224
DSSP  ----------------------------------------hhhllleeeeelll


No 58: Query=2pajA Sbjct=2yb1A Z-score=6.5

back to top
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  elEELLLLLH----HHHHllllllhhhllhhhhhhhHHHHHHHHHLLLEEEEEELLLLLl
Query paWVNTHHHL----FQSLlkgepfralfderrfrlaARIGLIELARSGCATVADHNYVYy  116
ident       | |                                   |    |  |       
Sbjct -aNIDLHFHSrtsdGALT------------------PTEVIDRAAARAPALLALTDHDC-   40
DSSP  -lLEELLLLLllllLLLL------------------HHHHHHHHHLLLLLEEEELLLLL-


DSSP  lllllLHHHHHHHHHHHLLLEEEEEELLL----------------------------LLL
Query pgmpfDSSAILFEEAEKLGLRFVLLRGGA----------------------------TQT  148
ident         |     |   |  |                                      
Sbjct ----tGGLAEAAAAAARRGIPFLNGVEVSvswgrhtvhivglgidpaepalaaglksIRE   96
DSSP  ----lLLHHHHHHHHHHLLLLEEEEEEEEeeelleeeeeeeellllllhhhhhhhhhHHL


DSSP  L--LLLLLL---------------------lHHHL-------------------------
Query R--QLEADL---------------------pTALR-------------------------  160
ident                                                             
Sbjct GrlERARQMgasleaagiagcfdgamrwcdnPEMIsrthfarhlvdsgavkdmrtvfrky  156
DSSP  LhhHHHHHHhhhhhhlllllhhhhhhlllllHHHLlhhhhhhhhhhllllllhhhhhhhl


DSSP  ---------lLLHHhhhhhhhhhhhhllllllllleeeeellllllllllhhHHHHHHHH
Query ---------pETLDayvadierlaaryhdaspramrrvvmapttvlysisprEMRETAAV  211
ident                                                             
Sbjct ltpgkpgyvsHQWA--------------------------------------SLEDAVGW  178
DSSP  llllllllllLLLL--------------------------------------LHHHHHHH


DSSP  HHHLLLEEE-EELL----LLLHHHHHHHLLL-lllLEEE---eLLLLL-lHHHHHHHHHH
Query ARRLGLRMH-SHLS----GKSPVAFCGEHDW-lgsDVWY---aHLVKV-dADEIALLAQT  261
ident     |      |      |                                         
Sbjct IVGAGGMAViAHPGrydmGRTLIERLILDFQaaggQGIEvasgSHSLDdmHKFALHADRH  238
DSSP  HHHLLLEEEeLLHHhlllLHHHHHHHHHHHHhlllLEEEeeelLLLHHhhHHHHHHHHHH


DSSP  LLEEEElhhhhhllllllhhhhllleeeLLLHHHHlLLLLHhhhhhhhhhhhhhllllhh
Query GTGVAHcpqsngrlpvremadagvpvsiGVDGAASnEAADMisevhmtwlaqrarlasia  321
ident |                           | |  |  |                       
Sbjct GLYASS----------------------GSDFHAPgEDVGH-------------------  257
DSSP  LLEEEE----------------------ELLLLLLlLLLLL-------------------


DSSP  hhhhhhlhhhhHHHL-LLLLlllllllllleeeeelllhhhlllllhhhhhhhlllllee
Query evihwgtaggaRVMG-LDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsv  380
ident                 |                                           
Sbjct --tedlppicrPIWReLEAR----------------------------------------  275
DSSP  --lllllllllLHHHhLHHH----------------------------------------


DSSP  eeeeELLEeeeellllllllhhhhhhhhhhhhhhhhhhhhl
Query malfSAGKrvvvddliegvdikelggearrvvrellrevvv  421
ident      |                                   
Sbjct -ilrPADA-------------------------------en  284
DSSP  -lllLLHH-------------------------------hl


No 59: Query=2pajA Sbjct=3e38A Z-score=5.7

back to top
DSSP  leeeeellleeLLLLLLlllllllllllleeeelleeeeellllllllleeeelllleee
Query pstlirnaaaiMTGGRGtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
ident                 |                                           
Sbjct ---aqrrneiqVPDLDG-----------------------------------------yt   16
DSSP  ---llllllllLLLLLL-----------------------------------------le


DSSP  ELEELLLLLH----HHHHllllllhhhllhhhhhhhHHHHHHHHHLLLEEEEEELLLL--
Query PAWVNTHHHL----FQSLlkgepfralfderrfrlaARIGLIELARSGCATVADHNYV--  114
ident       | |                                 |  | |            
Sbjct TLKCDFHXHSvfsdGLVW------------------PTVRVDEAYRDGLDAISLTEHIey   58
DSSP  EEEEELLLLLllllLLLL------------------HHHHHHHHHHLLLLEELLEEELll


DSSP  --lLLLLLLLHH---HHHHHHHHHLLLEEEEEELLLlllllllllllhhhllllhhhhhh
Query --yYPGMPFDSS---AILFEEAEKLGLRFVLLRGGAtqtrqleadlptalrpetldayva  169
ident          |         | |||||                                  
Sbjct rphKQDVVSDHNrsfDLCREQAEKLGILLIKGSEIT------------------------   94
DSSP  lllLLLLLLLLLhhhHHHHHHHHHHLLEELLEEEEE------------------------


DSSP  hhhhhhhhllllllllleeeeelllllllLLLH-----------------hHHHHHHHHH
Query dierlaaryhdaspramrrvvmapttvlySISP-----------------rEMRETAAVA  212
ident                                                            |
Sbjct -----------------------------RAXApghfnaiflsdsnpleqkDYKDAFREA  125
DSSP  -----------------------------LLLLlleeeeelllllhhhlllLHHHHHHHH


DSSP  HHLLLEEEEELL-------LLLHHHHHHHLLL-lllLEEEE-----lLLLLlhhhHHHHH
Query RRLGLRMHSHLS-------GKSPVAFCGEHDW-lgsDVWYA-----hLVKVdadeIALLA  259
ident    |                                                   |    
Sbjct KKQGAFXFWNHPgwdsqqpDTTKWWPEHTALYqegcXHGIEvanghlYXPE---aIQWCL  182
DSSP  HHLLLEEEELLLlllllllLLLLLLHHHHHHHhlllLLEEEeeelleELLH---hHHHHH


DSSP  HHLLEEEElhhhhhllllllhhhhllleeeLLLHHHHLLL----llhHHHHhhhhhhhhh
Query QTGTGVAHcpqsngrlpvremadagvpvsiGVDGAASNEA----admISEVhmtwlaqra  315
ident                                 |                           
Sbjct DKNLTXIG----------------------TSDIHQPIQTdydfekgEHRT---------  211
DSSP  HHLLEEEE----------------------ELLLLLLHHHhllhhhlLLLL---------


DSSP  llllhhhhhhhHLHH----hhhhHLLL------------------lllllllllllleee
Query rlasiaevihwGTAG----garvMGLD------------------evgkvavgyaadiav  353
ident                                                             
Sbjct ----------xTFVFakerslqgIREAldnrrtaayfhelligredllrpffekcvkiee  261
DSSP  ----------eEEEEellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeee


DSSP  eelllhhhlllLLHHhHHHH--------------llllleeeeeeelleeeeelllllll
Query yrlddpryfglHDPAiGPVA--------------sggrpsvmalfsagkrvvvddliegv  399
ident                                                             
Sbjct vsrneqgvtlsITNV-TDLVlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggd  320
DSSP  eeeelleeeeeEEEL-LLLLeeeeelllllleellleeeellleeeeeeeeellllllle


DSSP  lhhhhhhhhhhhhhhhhhhhhl
Query dikelggearrvvrellrevvv  421
ident                       
Sbjct vnfevtnfivapdkglkytisl  342
DSSP  eeeeeeeeeeelleeeeeeeel