Results: dupa

Query: 2oofA

MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2oof-A 76.0  0.0  403   403  100 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   2:  2uz9-A 36.0  2.8  359   444   17 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   3:  3ls9-A 36.0  2.8  367   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   4:  2paj-A 35.9  2.9  345   421   17 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   5:  4cqb-A 35.4  2.7  354   402   16 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   6:  3mkv-A 35.3  2.9  345   414   21 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   7:  1k6w-A 35.0  2.9  356   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   8:  1j6p-A 34.7  2.7  340   407   15 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   9:  3mtw-A 34.6  3.3  337   404   20 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  10:  4c5y-A 33.5  2.9  345   436   17 PDB  MOLECULE: OCHRATOXINASE;                                             
  11:  4rdv-B 29.7  3.0  341   451   16 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  12:  2vun-A 28.4  3.2  318   385   16 PDB  MOLECULE: ENAMIDASE;                                                 
  13:  3icj-A 28.1  2.9  325   468   18 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  14:  1yrr-B 25.8  3.5  307   334   16 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  15:  1onx-A 25.7  3.5  312   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  16:  3nqb-A 25.3  3.3  311   587   18 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  17:  3giq-A 24.8  3.9  328   475   20 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  18:  2ogj-A 24.3  3.9  303   379   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  19:  1gkp-A 24.1  3.8  319   458   18 PDB  MOLECULE: HYDANTOINASE;                                              
  20:  3ooq-A 23.9  3.2  283   384   18 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  21:  3gri-A 23.0  3.8  312   422   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  4b3z-D 22.6  4.1  320   477   13 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  23:  3e74-A 22.3  3.7  298   429   19 PDB  MOLECULE: ALLANTOINASE;                                              
  24:  2imr-A 22.3  5.0  300   380   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  25:  1a4m-A 19.6  3.2  264   349   16 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  26:  2y1h-B 19.2  3.3  235   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  27:  1a5k-C 18.6  3.3  293   566   18 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  28:  3k2g-B 17.1  4.0  243   358   16 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  1bf6-A 17.0  3.8  234   291   15 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  2ob3-A 16.8  4.1  239   329   18 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  31:  2vc5-A 16.2  4.5  238   314   17 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  32:  1v77-A 16.0  2.6  178   202   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  33:  3cjp-A 16.0  3.4  211   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  34:  2ffi-A 15.8  3.4  224   273   13 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  3gg7-A 15.8  3.4  212   243   11 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  4mup-B 15.5  3.3  220   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  37:  2a3l-A 15.3  3.9  276   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  38:  3irs-A 14.7  3.8  224   281    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  39:  4dlf-A 14.3  3.9  220   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  40:  1itq-A 13.9  3.6  223   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  41:  4hk5-D 13.4  4.5  235   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  42:  2dvt-A 13.3  4.0  219   325   11 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  43:  4ofc-A 13.2  4.1  225   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  44:  3pnu-A 13.1  4.2  238   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  45:  2gwg-A 13.1  4.1  222   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  46:  4qrn-A 12.6  4.1  223   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  47:  3qy6-A 12.3  3.3  189   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  4dzi-C 12.1  3.9  214   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  2qpx-A 11.9  4.7  222   376   10 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  50:  3dcp-A 11.2  2.7  169   277   13 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  51:  1m65-A 11.0  3.6  187   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  52:  3au2-A 10.9  3.6  181   575   14 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3iac-A 10.3  4.0  216   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  54:  1j5s-A 10.2  4.7  230   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  55:  3f2b-A  9.4  7.3  180   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  8.5  3.9  179   255   11 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  7.9  3.2  154   224   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  6.7  4.2  150   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  6.1  3.6  161   342   14 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2oofA Sbjct=2oofA Z-score=76.0

back to top
DSSP  LLLLEEEEEEEELLLLLLLLLLLLLLLEEEEEELLEEEEEEEHHHLLLLLLLEELLLLEE
Query LNCERVWLNVTPATLRSDLADYGLLEPHALGVHEGRIHALVPXQDLKYPAHWQDXKGKLV   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LNCERVWLNVTPATLRSDLADYGLLEPHALGVHEGRIHALVPXQDLKYPAHWQDXKGKLV   60
DSSP  LLLLEEEEEEEELLLLLLLLLLLLLLLEEEEEELLEEEEEEEHHHLLLLLLLEELLLLEE


DSSP  EELEEEEEELLLLLLLLHHHHHHHHHLLLHHHHHHLLLLHHHHHHHHHHLLHHHHHHHHH
Query TPGLIDCHTHLIFAGSRAEEFELRQKGVPYAEIARKGGGIISTVRATRAASEDQLFELAL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TPGLIDCHTHLIFAGSRAEEFELRQKGVPYAEIARKGGGIISTVRATRAASEDQLFELAL  120
DSSP  EELEEEEEELLLLLLLLHHHHHHHHHLLLHHHHHHLLLLHHHHHHHHHHLLHHHHHHHHH


DSSP  HHHHHHHHHLEEEEEEELLLLLLHHHHHHHHHHHHHHHHHLLLEEEEEEEEELLLLHHHL
Query PRVKSLIREGVTTVEIKSGYGLTLEDELKXLRVARRLGEALPIRVKTTLLAAHAVPPEYR  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PRVKSLIREGVTTVEIKSGYGLTLEDELKXLRVARRLGEALPIRVKTTLLAAHAVPPEYR  180
DSSP  HHHHHHHHHLEEEEEEELLLLLLHHHHHHHHHHHHHHHHHLLLEEEEEEEEELLLLHHHL


DSSP  LLHHHHHHHHHHLHHHHHHHLLLLLEEEEEELLLLLLHHHHHHHHHHHHHLLLEEEEEEL
Query DDPDSWVETICQEIIPAAAEAGLADAVDVFCEHIGFSLAQTEQVYLAADQYGLAVKGHXD  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DDPDSWVETICQEIIPAAAEAGLADAVDVFCEHIGFSLAQTEQVYLAADQYGLAVKGHXD  240
DSSP  LLHHHHHHHHHHLHHHHHHHLLLLLEEEEEELLLLLLHHHHHHHHHHHHHLLLEEEEEEL


DSSP  LLLLLLHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLLHHH
Query QLSNLGGSTLAANFGALSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKETKLPPVVA  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QLSNLGGSTLAANFGALSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKETKLPPVVA  300
DSSP  LLLLLLHHHHHHHLLLLEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLLHHH


DSSP  HHHLLLLEEELLLLLLLLLLLLLHHHHHHHHHHHHLLLHHHHHHHLLHHHHHHLLLLLLL
Query LRKAGVPXAVSSDINPGTAPIVSLRXAXNXACTLFGLTPVEAXAGVTRHAARALGEQEQL  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LRKAGVPXAVSSDINPGTAPIVSLRXAXNXACTLFGLTPVEAXAGVTRHAARALGEQEQL  360
DSSP  HHHLLLLEEELLLLLLLLLLLLLHHHHHHHHHHHHLLLHHHHHHHLLHHHHHHLLLLLLL


DSSP  LLLLLLLLLLEEEELLLLLLHHHHLLLLLLEEEEEELLEELLL
Query GQLRVGXLADFLVWNCGHPAELSYLIGVDQLVSRVVNGEETLH  403
ident |||||||||||||||||||||||||||||||||||||||||||
Sbjct GQLRVGXLADFLVWNCGHPAELSYLIGVDQLVSRVVNGEETLH  403
DSSP  LLLLLLLLLLEEEELLLLLLHHHHLLLLLLEEEEEELLEELLL


No 2: Query=2oofA Sbjct=2uz9A Z-score=36.0

back to top
DSSP  lLLLEEEEeEEELLLLLLlLLLLLLLLEEEEEE-LLEEEEEEEHHHLL--------LLLL
Query lNCERVWLnVTPATLRSDlADYGLLEPHALGVH-EGRIHALVPXQDLK--------YPAH   51
ident           |             |  | |||   | |  |                |  
Sbjct -PLAHIFR-GTFVHSTWT-CPMEVLRDHLLGVSdSGKIVFLEEASQQEklakewcfKPCE   57
DSSP  -LLLEEEE-EEEEELLLL-LLLEEEEEEEEEELlLLLEEEEEEHHHHHhhhhhhllLHHH


DSSP  LEELLL-LEEEELEEEEEELLLL---llLLHHhhhhhhhlllhhhhhhllLLHHHHHHHH
Query WQDXKG-KLVTPGLIDCHTHLIF---agSRAEefelrqkgvpyaeiarkgGGIISTVRAT  107
ident            ||| | | |        |                               
Sbjct IRELSHhEFFMPGLVDTHIHASQysfagSSID----------lpllewltKYTFPAEHRF  107
DSSP  EEELLLlLEEEELEEEEEEEHHHhhhllLLLL----------llhhhhhhHLHHHHHHHH


DSSP  HhlLHHHHHHHHHHHHHHHHHHLEEEEEEELLLlllhhhHHHHHHHHHHHHHHLLLEEEE
Query RaaSEDQLFELALPRVKSLIREGVTTVEIKSGYgltledELKXLRVARRLGEALPIRVKT  167
ident      |   |     |      | ||                              |   
Sbjct Q--NIDFAEEVYTRVVRRTLKNGTTTACYFATI------HTDSSLLLADITDKFGQRAFV  159
DSSP  H--LHHHHHHHHHHHHHHHHHLLEEEEEEELLL------LHHHHHHHHHHHHHHLLEEEE


DSSP  EEEEeLLLL-HHHLllhhhHHHHHHhLHHHHHHHLLL-------LLEEEEEELlLLLLHH
Query TLLAaHAVP-PEYRddpdsWVETICqEIIPAAAEAGL-------ADAVDVFCEhIGFSLA  219
ident                      |              |          |         |  
Sbjct GKVC-MDLNdTFPE--ykeTTEESI-KETERFVSEMLqknysrvKPIVTPRFS-LSCSET  214
DSSP  ELEE-LLLLlLLLL--lllLHHHHH-HHHHHHHHHHHhhlllleEEEEEELLH-HHLLHH


DSSP  HHHHHHHHHHHLLLEEEEEELLLL------------llLHHHHHH----HLLLLEEEELL
Query QTEQVYLAADQYGLAVKGHXDQLS------------nlGGSTLAA----NFGALSVDHLE  263
ident         |    |    |                                      |  
Sbjct LMGELGNIAKTRDLHIQSHISENRdeveavknlypsykNYTSVYDknnlLTNKTVMAHGC  274
DSSP  HHHHHHHHHHHHLLEEEEEELLLHhhhhhhhhhlllllLHHHHHHhlllLLLLEEEEELL


DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHLLLLEEELLLLLllLLLLLL
Query YLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKAGVPXAVSSDINpgTAPIVS  323
ident ||  |       ||      |     |       |    |  |      |         |
Sbjct YLSAEELNVFHERGASIAHCPNSNLSLSS-GFLNVLEVLKHEVKIGLGTDVA--GGYSYS  331
DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLL-LLLLHHHHHHLLLEEEELLLLL--LLLLLL


DSSP  HHHHHHHHHHHHL-----------LLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEE
Query LRXAXNXACTLFG-----------LTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFL  372
ident    |   |                ||  |     |     |||     |   ||   |  
Sbjct MLDAIRRAVMVSNillinkvneksLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAI  391
DSSP  HHHHHHHHHHHHHhhhhlllllllLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEE


DSSP  EELLL--------------------LLLHHHHLLLLLLEEEEEELLEELLL--
Query VWNCG--------------------HPAELSYLIGVDQLVSRVVNGEETLH--  403
ident   |                            ||          | |       
Sbjct LINPKasdspidlfygdffgdiseaVIQKFLYLGDDRNIEEVYVGGKQVVPfs  444
DSSP  EELLLllllllllllhhhhlllllhHHHHHHHHLLHHHEEEEEELLEEEELll


No 3: Query=2oofA Sbjct=3ls9A Z-score=36.0

back to top
DSSP  lllLEEEEEE-EELLLLLLLlllLLLLLEEEEEELLEEEEEEEHhhLLLL--LLLEELLL
Query lncERVWLNV-TPATLRSDLadyGLLEPHALGVHEGRIHALVPXqdLKYP--AHWQDXKG   57
ident               |          ||          | |      |         |  |
Sbjct ---MILIRGLtRVITFDDQE---RELEDADILIDGPKIVAVGKD--LSDRsvSRTIDGRG   52
DSSP  ---LEEEEEEeEEELLLLLL---LEEEEEEEEEELLEEEEEELL--LLLLllLEEEELLL


DSSP  LEEEELEEEEEELLLL-LLLLHHHHHHHhhlllhhhhhhllLLHHHHHHHHH---HLLHH
Query KLVTPGLIDCHTHLIF-AGSRAEEFELRqkgvpyaeiarkgGGIISTVRATR---AASED  113
ident     ||||  | ||   |       |                |                |
Sbjct MIALPGLINSHQHLYEgAMRAIPQLERV-------tmaswlEGVLTRSAGWWrdgKFGPD  105
DSSP  EEEEELEEEEEELHHHhHHLLLHHHLLL-------lhhhhhHHHHHHHHHHHhllLLLHH


DSSP  HHHHHHHHHHHHHHHHLEEEEEEELLLLL-LHHHhhHHHHHHHHHHHHLLLEEEEEEEeE
Query QLFELALPRVKSLIREGVTTVEIKSGYGL-TLEDelKXLRVARRLGEALPIRVKTTLLaA  172
ident    | |          | |||            |              | ||        
Sbjct VIREVARAVLLESLLGGITTVADQHLFFPgATAD--SYIDATIEAATDLGIRFHAARS-S  162
DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELLLLlLLLL--LHHHHHHHHHHHHLLEEEEEEL-L


DSSP  LLL-------lHHHLllhhhHHHHHHhLHHHHHHHLLL--------LLEEEEEELLlLLL
Query HAV-------pPEYRddpdsWVETICqEIIPAAAEAGL--------ADAVDVFCEHiGFS  217
ident                      |                          |           
Sbjct MTLgkseggfcDDLF---vePVDRVV-QHCLGLIDQYHepepfgmvRIALGPCGVP-YDK  217
DSSP  LLLlhhhllllLHHH---llLHHHHH-HHHHHHHHHHLllllllleEEEELLLLLL-LLL


DSSP  HHHHHHHHHHHHHLLLEEEEEELLLLLL---------LHHH-----HHHHlLLLEEEELL
Query LAQTEQVYLAADQYGLAVKGHXDQLSNL---------GGST-----LAANfGALSVDHLE  263
ident     |     |  |      |                           |        |  
Sbjct PELFEAFAQMAADYDVRLHTHFYEPLDAgmsdhlygmTPWRflekhGWAS-DRVWLAHAV  276
DSSP  HHHHHHHHHHHHHHLLEEEEEELLLLHHhhhhhhhllLHHHhhhhlLLLL-LLEEEEELL


DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHLLLLEEELLLLLLlLLLLLL
Query YLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKAGVPXAVSSDINPgTAPIVS  323
ident     | |   |  ||    |           | |      ||                  
Sbjct VPPREEIPEFADAGVAIAHLIAPDLRMGW-GLAPIREYLDAGITVGFGTTGSA-SNDGGN  334
DSSP  LLLHHHHHHHHHHLLEEEELHHHHHHLLL-LLLLHHHHHHLLLEEEELLLLLL-LLLLLL


DSSP  HHHHHHHHHHHH----------LLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLLEEE
Query LRXAXNXACTLF----------GLTPVEAXAGVTRHAARALGEqEQLGQLRVGXLADFLV  373
ident |      |               |   |     ||  |  ||    || |  |  ||   
Sbjct LLGDLRLAALAHrpadpnepekWLSARELLRMATRGSAECLGR-PDLGVLEEGRAADIAC  393
DSSP  HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHHHHHHLLL-LLLLLLLLLLLLLEEE


DSSP  ELL---------LLLLHHHHLLLLLLEEEEEELLEELLL---------------------
Query WNC---------GHPAELSYLIGVDQLVSRVVNGEETLH---------------------  403
ident |                |      |     ||||                          
Sbjct WRLdgvdrvgvhDPAIGLIMTGLSDRASLVVVNGQVLVEnerpvladlerivanttalip  453
DSSP  EELllhhhllllLHHHHHHHLLLLLLLLEEEELLEEEEElleellllhhhhhhhhhhhll


No 4: Query=2oofA Sbjct=2pajA Z-score=35.9

back to top
DSSP  llLLEEEEEE-EELLLLL---LLLLlLLLLlEEEEEELLEEEEEEEHhhLLLLLL-LEEL
Query lnCERVWLNV-TPATLRS---DLADyGLLEpHALGVHEGRIHALVPXqdLKYPAH-WQDX   55
ident         |     |      |                  | |         |     | 
Sbjct --PSTLIRNAaAIMTGGRgtaDDPS-RVPG-PDIRIVGDTIDAIGAL--APRPGEtIVDA   54
DSSP  --LEEEEELLlEELLLLLlllLLLL-LLLL-LLEEEELLEEEEELLL--LLLLLLeEEEL


DSSP  LLLEEEELEEEEEELLLL-LLLLHhhhhhhhhlllhhhhhhllllhhhhhhHHHHLLHHH
Query KGKLVTPGLIDCHTHLIF-AGSRAeefelrqkgvpyaeiarkgggiistvrATRAASEDQ  114
ident       |     | ||                                         |  
Sbjct TDCVIYPAWVNTHHHLFQsLLKGE--------------------------pFRALFDERR   88
DSSP  LLLEEEELEELLLLLHHHhHLLLL--------------------------lLHHHLLHHH


DSSP  HHHHHHHHHHHHHHHLEEEEEEELLLLLLHHhhhHHHHHHHHHHHHLLLEEEEEEEEelL
Query LFELALPRVKSLIREGVTTVEIKSGYGLTLEdelKXLRVARRLGEALPIRVKTTLLAahA  174
ident     |      | | |  ||                        | |  |         |
Sbjct FRLAARIGLIELARSGCATVADHNYVYYPGM-pfDSSAILFEEAEKLGLRFVLLRGG--A  145
DSSP  HHHHHHHHHHHHHLLLEEEEEELLLLLLLLL-llLHHHHHHHHHHHLLLEEEEEELL--L


DSSP  LLHhHLLL-------hhhHHHHHHhLHHHHHHHLLL--------lLEEE-EEELlLLLLH
Query VPPeYRDD-------pdsWVETICqEIIPAAAEAGL--------aDAVD-VFCEhIGFSL  218
ident                            |   |                          | 
Sbjct TQT-RQLEadlptalrpeTLDAYV-ADIERLAARYHdaspramrrVVMApTTVL-YSISP  202
DSSP  LLL-LLLLllllhhhlllLHHHHH-HHHHHHHHHLLllllllleeEEELlLLLL-LLLLH


DSSP  HHHHHHHHHHHHLLLEEEEEEL-llLLLLH-hhHHHHlLLLEEEELLLLLHHHHHHHHHH
Query AQTEQVYLAADQYGLAVKGHXD-qlSNLGG-stLAANfGALSVDHLEYLDPEGIQALAHR  276
ident          |   ||    |                        ||   |   |  ||  
Sbjct REMRETAAVARRLGLRMHSHLSgksPVAFCgehDWLG-SDVWYAHLVKVDADEIALLAQT  261
DSSP  HHHHHHHHHHHHLLLEEEEELLlllHHHHHhhlLLLL-LLEEEELLLLLLHHHHHHHHHH


DSSP  LLEEEELHHHHHHLllllllLHHHHHHLLLLEEELLLLLLlLLLLLLHHHHHHHHHHHHL
Query GVVATLLPTAFYFLketklpPVVALRKAGVPXAVSSDINPgTAPIVSLRXAXNXACTLFG  336
ident |      |     |      ||     ||||     |                       
Sbjct GTGVAHCPQSNGRL------PVREMADAGVPVSIGVDGAA-SNEAADMISEVHMTWLAQR  314
DSSP  LLEEEELHHHHHLL------LLLLHHHHLLLEEELLLHHH-HLLLLLHHHHHHHHHHHHH


DSSP  ---LLHHHHHHHLLHHHHHHLLLLlLLLLLLLLLLLLEEEELL---------LLLLHHHH
Query ---LTPVEAXAGVTRHAARALGEQeQLGQLRVGXLADFLVWNC---------GHPAELSY  384
ident        |     |   ||  |     |   ||  ||  |                    
Sbjct arlASIAEVIHWGTAGGARVMGLD-EVGKVAVGYAADIAVYRLddpryfglhDPAIGPVA  373
DSSP  hllLLHHHHHHHHLHHHHHHHLLL-LLLLLLLLLLLLEEEEELllhhhllllLHHHHHHH


DSSP  LLLLLLEEEEEELLEELLL-----------------------------
Query LIGVDQLVSRVVNGEETLH-----------------------------  403
ident   |          |                                  
Sbjct SGGRPSVMALFSAGKRVVVddliegvdikelggearrvvrellrevvv  421
DSSP  LLLLLEEEEEEELLEEEEEllllllllhhhhhhhhhhhhhhhhhhhhl


No 5: Query=2oofA Sbjct=4cqbA Z-score=35.4

back to top
DSSP  -lLLLEEEEEEEELlllllllllLLLLLEEEEEELLEEEEEEEHhhLLLL-lLLEELLLL
Query -lNCERVWLNVTPAtlrsdladyGLLEPHALGVHEGRIHALVPXqdLKYP-aHWQDXKGK   58
ident          |                     |    ||                 | || 
Sbjct skDFDLIIRNAYLS---------EKDSVYDIGIVGDRIIKIEAK--IEGTvkDEIDAKGN   49
DSSP  llLEEEEEEEEEEL---------LLLEEEEEEEELLEEEEEELL--LLLLeeEEEELLLL


DSSP  EEEELEEEEEELLLL-LLLL----HHHHHHHhhlllhhhhhhllLLHHHHHHHHHHLLHH
Query LVTPGLIDCHTHLIF-AGSR----AEEFELRqkgvpyaeiarkgGGIISTVRATRAASED  113
ident || ||  | |||      |                           |         |   
Sbjct LVSPGFVDAHTHMDKsFTSTgerlPKFWSRP---------ytrdAAIEDGLKYYKNATHE  100
DSSP  LEEELEEEEEELHHHlLLLLllllLLLLLLL---------llhhHHHHHHHHHHHHLLHH


DSSP  HHHHHHHHHHHHHHHHLEEEEEEELlLLLLhHHHHHHHHHHHHHHHHL--LLEEEEEEEe
Query QLFELALPRVKSLIREGVTTVEIKSgYGLTlEDELKXLRVARRLGEAL--PIRVKTTLLa  171
ident                 |                  |         | |   |        
Sbjct EIKRHVIEHAHMQVLHGTLYTRTHV-DVDS-VAKTKAVEAVLEAKEELkdLIDIQVVAF-  157
DSSP  HHHHHHHHHHHHHHHLLEEEEEEEE-ELLL-LLLLHHHHHHHHHHHHLllLLEEEEEEE-


DSSP  ELLLlhhhlllHHHHhHHHHhLHHHHHHHLlLLLEEEEEELLLLL--LHHHHHHHHHHHH
Query AHAVppeyrddPDSWvETICqEIIPAAAEAgLADAVDVFCEHIGF--SLAQTEQVYLAAD  229
ident |                      |         | |                      | 
Sbjct AQSG-------FFVD-LESE-SLIRKSLDM-GCDLVGGVDPATREnnVEGSLDLCFKLAK  207
DSSP  LLLL-------LLLL-LLHH-HHHHHHHHH-LLLEEELLLLLLLLllHHHHHHHHHHHHH


DSSP  HLLLEEEEEElLLLLL---LHHHHHHHLL-------LLEEEELLLL-------LHHHHHH
Query QYGLAVKGHXdQLSNL---GGSTLAANFG-------ALSVDHLEYL-------DPEGIQA  272
ident  |      |                |               |             | |  
Sbjct EYDVDIDYHI-HDIGTvgvYSINRLAQKTiengykgRVTTSHAWCFadapsewLDEAIPL  266
DSSP  HLLLEEEEEE-LLLHHhhhHHHHHHHHHHhhlllllLEEEEELLHHhhllhhhHHHHHHH


DSSP  HHHHLLEEEELHHHHhhllllLLLLHHHHHHLLLLEEELLLLL-LLLL-LLLL-HHHHHH
Query LAHRGVVATLLPTAFyflketKLPPVVALRKAGVPXAVSSDIN-PGTA-PIVS-LRXAXN  329
ident     |                   ||  |  ||      ||                   
Sbjct YKDSGMKFVTCFSST-----pPTMPVIKLLEAGINLGCASDNIrDFWVpFGNGdMVQGAL  321
DSSP  HHHHLLEEEEELLLL-----lLLLLHHHHHHLLLEEEEELLLLlLLLLlLLLLlHHHHHH


DSSP  HHHHHHLL----LHHHHHHHLLHHHHHHLLLLLLLlLLLLLLLLLEEEELLLLLLHHHHL
Query XACTLFGL----TPVEAXAGVTRHAARALGEQEQLgQLRVGXLADFLVWNCGHPAELSYL  385
ident        |             |   || ||         ||  ||  | |   |      
Sbjct IETQRLELktnrDLGLIWKMITSEGARVLGIEKNY-GIEVGKKADLVVLNSLSPQWAIID  380
DSSP  HHHHHHLLllhhHHHHHHHHHLHHHHHHHLLHHHL-LLLLLLLLLEEEELLLLHHHHHHH


DSSP  LllLLEEEEEELLEELLL------
Query IgvDQLVSRVVNGEETLH------  403
ident            ||           
Sbjct Q--AKRLCVIKNGRIIVKdeviva  402
DSSP  L--LLEEEEEELLEEEEElleell


No 6: Query=2oofA Sbjct=3mkvA Z-score=35.3

back to top
DSSP  lLLLEEEEEEEELLLLllllLLLLLLLEEEEEELLEEEEEEEhHHLLLLL-LLEELLLLE
Query lNCERVWLNVTPATLRsdlaDYGLLEPHALGVHEGRIHALVPxQDLKYPA-HWQDXKGKL   59
ident         |              ||         | |         |    |  | ||| 
Sbjct -LTTFLFRNGALLDPD----HPDLLQGFEILIEDGFIREVSD-KPIKSSNaHVIDVKGKT   54
DSSP  -LLEEEEEEEEELLLL----LLLLEEEEEEEEELLEEEEEEL-LLLLLLLlEEEELLLLE


DSSP  EEELEEEEEELLLLLLLlhhhhhhhhhlllhhhhhhllllhhHHHHhHHHLLHHHHHHHH
Query VTPGLIDCHTHLIFAGSraeefelrqkgvpyaeiarkgggiiSTVRaTRAASEDQLFELA  119
ident   ||||| | |                                  |             |
Sbjct IMPGLIDLHVHVVAIEF-------------------------NLPR-VATLPNVLVTLRA   88
DSSP  EEELEEEEEELLLLLLL-------------------------LHHH-HLLLLHHHHHHHH


DSSP  HHHHHHHHHHLEEEEEEELLllllhhhhhhHHHHHHHHHH---HLLLEEEEE-EEEE---
Query LPRVKSLIREGVTTVEIKSGygltledelkXLRVARRLGE---ALPIRVKTT-LLAA---  172
ident  |      | | |||    |                   |       |            
Sbjct VPIMRAMLRRGFTTVRDAGG----------AGYPFKQAVEsglVEGPRLFVSgRALSqtg  138
DSSP  HHHHHHHHHLLEEEEEELLL----------LLHHHHHHHHlllLLLLEEEELlLEEElll


DSSP  -LLLLHH------------------hlllhHHHHHHHHHlHHHHHHHLlLLLEEEEEEL-
Query -HAVPPE------------------yrddpDSWVETICQeIIPAAAEAgLADAVDVFCE-  212
ident  || |                            |                ||        
Sbjct gHADPRArsdymppdspcgccvrvgalgrvADGVDEVRR-AVREELQM-GADQIXIMASg  196
DSSP  lLLLLLLlllllllllllllllllllleeeLLLHHHHHH-HHHHHHHH-LLLLEEEELLl


DSSP  ----------LLLLLHHHHHHHHHHHHHLLLEEEEEELlllLLLHHHHHHHLLLLEEEEL
Query ----------HIGFSLAQTEQVYLAADQYGLAVKGHXDqlsNLGGSTLAANFGALSVDHL  262
ident             | |          |   |  |  |            |   |     | 
Sbjct gvasptdpvgVFGYSEDEIRAIVAEAQGRGTYVLAHAY---TPAAIARAVRCGVRTIEHG  253
DSSP  llllllllllLLLLLHHHHHHHHHHHHLLLLLEEEEEL---LHHHHHHHHHLLLLEEEEL


DSSP  LLLLHHHHHHHHHHLLEEEELHHHHHHLL-------------------LLLL-LLHHHHH
Query EYLDPEGIQALAHRGVVATLLPTAFYFLK-------------------ETKL-PPVVALR  302
ident    | |     |  |            |                                
Sbjct NLIDDETARLVAEHGAYVVPTLVTYDALAsegekyglppesiakiadvHGAGlHSIEIMK  313
DSSP  LLLLHHHHHHHHHHLLEEELLHHHHHHHHhhlllllllhhhhllhhhhHLLHhHHHHHHH


DSSP  HLLLLEEELLLLLLlllLLLLHHHHHHHHHHhhLLLHHHHHHHLLHHHHHHLLLLLLLLL
Query KAGVPXAVSSDINPgtaPIVSLRXAXNXACTlfGLTPVEAXAGVTRHAARALGEQEQLGQ  362
ident  |||      |                       | | |  |  |   |  || |  || 
Sbjct RAGVKMGFGTDLLG--eAQRLQSDEFRILAE--VLSPAEVIASATIVSAEVLGMQDKLGR  369
DSSP  HHLLLLLLLLLLLH--hHHHHLLHHHHHHHL--LLLHHHHHHHLLHHHHHHLLLLLLLLL


DSSP  LLLLLLLLEEEELLlLLLHHHHL-LLLL-LEEEEEELLEELLL---
Query LRVGXLADFLVWNCgHPAELSYL-IGVD-QLVSRVVNGEETLH---  403
ident    |  || ||     |        |           |        
Sbjct IVPGAHADVLVVDG-NPLKSVDClLGQGeHIPLVMKDGRLFVNele  414
DSSP  LLLLLLLLEEEELL-LLLLLLLLlLLLLlLLLEEEELLEEEEElll


No 7: Query=2oofA Sbjct=1k6wA Z-score=35.0

back to top
DSSP  lllLEEEEEEEELlllllllllLLLLLEEEEEELLEEEEEEEHHH-LLLLLLLEELLLLE
Query lncERVWLNVTPAtlrsdladyGLLEPHALGVHEGRIHALVPXQD-LKYPAHWQDXKGKL   59
ident         |             |           | | |               |    |
Sbjct --aLQTIINARLP---------GEEGLWQIHLQDGKISAIDAQSGvMPITENSLDAEQGL   49
DSSP  --lLLEEEEELLL---------LLLLEEEEEEELLEEEEEEEELLlLLLLLLEEELLLLE


DSSP  EEELEEEEEELLLL-lLLLH-HHHHHhhhlllhhhhhhlLLLHHHHHHHHHHLLHHHHHH
Query VTPGLIDCHTHLIF-aGSRA-EEFELrqkgvpyaeiarkGGGIISTVRATRAASEDQLFE  117
ident | |     | ||                             ||            |    
Sbjct VIPPFVEPHIHLDTtqTAGQpNWNQS----------gtlFEGIERWAERKALLTHDDVKQ   99
DSSP  EELLEEEEEELLLLllLLLLlLLLLL----------llhHHHHHHHHLLHHHLLHHHHHH


DSSP  HHHHHHHHHHHHLEEEEEEELLllLLHHhhHHHHHHHHHHHHHL--LLEEEEEEEeELLL
Query LALPRVKSLIREGVTTVEIKSGygLTLEdeLKXLRVARRLGEAL--PIRVKTTLLaAHAV  175
ident  |    |  |  |   |             |  |             |            
Sbjct RAWQTLKWQIANGIQHVRTHVD-vSDAT--LTALKAMLEVKQEVapWIDLQIVAF-PQEG  155
DSSP  HHHHHHHHHHHLLEEEEEEEEE-lLLLL--LHHHHHHHHHHHHHllLLEEEEEEE-LLLL


DSSP  lhhhlllhHHHHhHHHHlHHHHHHHlLLLLEEEEEELLL---lLLHHHHHHHHHHHHHLL
Query ppeyrddpDSWVeTICQeIIPAAAEaGLADAVDVFCEHI---gFSLAQTEQVYLAADQYG  232
ident          |            |     || |                       |  | 
Sbjct -------iLSYP-NGEA-LLEEALR-LGADVVGAIPHFEftreYGVESLHKTFALAQKYD  205
DSSP  -------lLLLL-LHHH-HHHHHHH-LLLLEEEELHHHLllhhHHHHHHHHHHHHHHHHL


DSSP  LEEEEEELLLLL--LLHHHHHHHLL-------LLEEEELLLL-------LHHHHHHHHHH
Query LAVKGHXDQLSN--LGGSTLAANFG-------ALSVDHLEYL-------DPEGIQALAHR  276
ident      | |             |               |                  |   
Sbjct RLIDVHCDEIDDeqSRFVETVAALAhhegmgaRVTASHTTAMhsyngayTSRLFRLLKMS  265
DSSP  LEEEEEELLLLLllLLHHHHHHHHHhhhllhhHEEEEELHHHhhllhhhHHHHHHHHHHH


DSSP  LLEEEELHHHHHHLLL--------LLLLLHHHHHHLLLLEEELLLLL-LLLL-LLLL-HH
Query GVVATLLPTAFYFLKE--------TKLPPVVALRKAGVPXAVSSDIN-PGTA-PIVS-LR  325
ident |      |     |               |      |       |               
Sbjct GINFVANPLVNIHLQGrfdtypkrRGITRVKEMLESGINVCFGHDDVfDPWYpLGTAnML  325
DSSP  LLEEEELHHHHHHHLLllllllllLLLLLHHHHHHLLLLEEELLLLLlLLLLlLLLLlHH


DSSP  HHHHHHHHHHLL----LHHHHHHHLLHHHHHHLLlLLLLlLLLLLLLLLEEEELLLLLLH
Query XAXNXACTLFGL----TPVEAXAGVTRHAARALGeQEQLgQLRVGXLADFLVWNCGHPAE  381
ident            |             | | || |           |  |            
Sbjct QVLHMGLHVCQLmgygQINDGLNLITHHSARTLN-LQDY-GIAAGNSANLIILPAENGFD  383
DSSP  HHHHHHHHHLLLllhhHHHHHHHHHLHHHHHHLL-LLLL-LLLLLLLLLEEEELLLLHHH


DSSP  HHHLLllLLEEEEEELLEELLL--------------------
Query LSYLIgvDQLVSRVVNGEETLH--------------------  403
ident              |  |                         
Sbjct ALRRQ--VPVRYSVRGGKVIAStqpaqttvyleqpeaidykr  423
DSSP  HHHHL--LLLLEEEELLEEEEEllllleeeellleeeellll


No 8: Query=2oofA Sbjct=1j6pA Z-score=34.7

back to top
DSSP  llLLEEEEEEEELLLlllllLLLLLLLEEEEEELLEEEEEEEHHHLlllllLEELLLLEE
Query lnCERVWLNVTPATLrsdlaDYGLLEPHALGVHEGRIHALVPXQDLkypahWQDXKGKLV   60
ident         |                   |     | |                |  ||||
Sbjct --HHXIIGNCLILKD-----FSSEPFWGAVEIENGTIKRVLQGEVK----vDLDLSGKLV   49
DSSP  --LEEEEEEEEELLL-----LLLLLEEEEEEEELLEEEEEEELLLL----lLEELLLEEE


DSSP  EELEEEEEELLLL---llLLHHHHhhhhhlllhhhhhhllLLHH-HHHHHHHHLLHHHHH
Query TPGLIDCHTHLIF---agSRAEEFelrqkgvpyaeiarkgGGII-STVRATRAASEDQLF  116
ident  | |   |||                                             |    
Sbjct XPALFNTHTHAPXtllrgVAEDLS--------------feEWLFsKVLPIEDRLTEKXAY   95
DSSP  EELEEEEEELHHHhhhllLLLLLL--------------hhHHHHlLHHHHHLLLLHHHHH


DSSP  HHHHHHHHHHHHHLEEEEEEELLllllhhhhhhHHHHHHHHHHHLLLEEEEEEEEEllll
Query ELALPRVKSLIREGVTTVEIKSGygltledelkXLRVARRLGEALPIRVKTTLLAAhavp  176
ident            | |                                 |   |        
Sbjct YGTILAQXEXARHGIAGFVDXYF----------HEEWIAKAVRDFGXRALLTRGLV----  141
DSSP  HHHHHHHHHHHLLLEEEEEEEEL----------LHHHHHHHHHHHLLEEEEEEEEL----


DSSP  hhhlllHHHHHHHHHhLHHHHHHHLLL------lLEEE-EEELllLLLHHHHHHHHHHHH
Query peyrddPDSWVETICqEIIPAAAEAGL------aDAVD-VFCEhiGFSLAQTEQVYLAAD  229
ident                 |                              |      |   | 
Sbjct -----dSNGDDGGRL-EENLKLYNEWNgfegrifVGFGpHSPY--LCSEEYLKRVFDTAK  193
DSSP  -----lLLLLLLLHH-HHHHHHHHHHLlhhhleeEEEEeLLLL--LLLHHHHHHHHHHHH


DSSP  HLLLEEEEEELLL--LLLLH---hhhhHHLLLLEEEELLLLLHHHHHHHHHHLLEEEELH
Query QYGLAVKGHXDQL--SNLGG---stlaANFGALSVDHLEYLDPEGIQALAHRGVVATLLP  284
ident      |  |                           |   |       |          |
Sbjct SLNAPVTIHLYETskEEYDLedilnigLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNP  253
DSSP  HHLLLEEEEELLLllLLLLLhhhhlllLLLLLEEEEELLLLLHHHHHHHLLLLEEEEELH


DSSP  HHHHHLLLlLLLLHHHHHHLLLLEEELLLLLLlLLLLLLHHHHHHHHHHHH------LLL
Query TAFYFLKEtKLPPVVALRKAGVPXAVSSDINPgTAPIVSLRXAXNXACTLF------GLT  338
ident      |      ||      |       |          |   |  |  |        | 
Sbjct ASNLKLGN-GIAPVQRXIEHGXKVTLGTDGAA-SNNSLNLFFEXRLASLLQkaqnprNLD  311
DSSP  HHHHHLLL-LLLLHHHHHHLLLEEEELLLLLL-LLLLLLHHHHHHHHHHHHhlllllLLL


DSSP  HHHHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELLL---------LLLHHHHLLLLL
Query PVEAXAGVTRHAARALGEqeQLGQLRVGXLADFLVWNCG---------HPAELSYLIGVD  389
ident        ||   | | |     |    |  ||  |                 |       
Sbjct VNTCLKXVTYDGAQAXGF--KSGKIEEGWNADLVVIDLDlpexfpvqnIKNHLVHAFSGE  369
DSSP  HHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELLlhhhllhhhHHHHHHHLLLLL


DSSP  lEEEEEELLEELLL-------------------------
Query qLVSRVVNGEETLH-------------------------  403
ident       | |                              
Sbjct -VFATXVAGKWIYFdgeyptidseevkrelariekelys  407
DSSP  -LLEEEELLEEEEEllllllllhhhhhhhhhhhhhhhhl


No 9: Query=2oofA Sbjct=3mtwA Z-score=34.6

back to top
DSSP  lLLLEEEEEEEELLLLllllLLLLLLLEEEEEELLEEEEEEEHhHLLLL--lLLEELLLL
Query lNCERVWLNVTPATLRsdlaDYGLLEPHALGVHEGRIHALVPXqDLKYP--aHWQDXKGK   58
ident                                |  |||           |      |  | 
Sbjct -AEIKAVSAARLLDVA----SGKYVDNPLVIVTDGRITSIGKK-GDAVPagaTAVDLPGV   54
DSSP  -LLEEEEEEEEEEELL----LLEEEELEEEEEELLEEEEEEEL-LLLLLlllEEEEEEEE


DSSP  EEEELEEEEEELLLL--lLLLHhhhhhhhhlllhhhhhhllllhhhhhhHHHHLLHHHHH
Query LVTPGLIDCHTHLIF--aGSRAeefelrqkgvpyaeiarkgggiistvrATRAASEDQLF  116
ident    ||||| | ||                                         |     
Sbjct TLLPGLIDMHVHLDSlaeVGGY---------------------------NSLEYSDRFWS   87
DSSP  EEEELEEEEEELLLLlllLLHH---------------------------HHHHLLHHHHH


DSSP  HHHHHHHHHHHHHLEEEEEEELlllllhhhhhhHHHHHHHHHHHL------LLEEEEE-E
Query ELALPRVKSLIREGVTTVEIKSgygltledelkXLRVARRLGEAL------PIRVKTT-L  169
ident        |     | |||                      | ||         |  |   
Sbjct VVQTANAKKTLEAGFTTVRNVG----------aADYDDVGLREAIdagyvpGPRIVTAaI  137
DSSP  HHHHHHHHHHHHLLEEEEEELL----------lLLLHHHHHHHHHhlllllLLEEEELlL


DSSP  EEE-----LLLLHH------hlllhhHHHHHHHhLHHHHHHhLLLLLEEEEEEL------
Query LAA-----HAVPPE------yrddpdSWVETICqEIIPAAAeAGLADAVDVFCE------  212
ident                                              |              
Sbjct SFGatgghCDSTFFppsmdqknpfnsDSPDEAR-KAVRTLK-KYGAQVIXICATggvfsr  195
DSSP  LEElllllLLLLLLlhhhllllllllLLHHHHH-HHHHHHH-HLLLLEEEEELLllllll


DSSP  -----LLLLLHHHHHHHHHHHHHLLLEEEEEELlllLLLHHHHHHHLLLLEEEELLLLLH
Query -----HIGFSLAQTEQVYLAADQYGLAVKGHXDqlsNLGGSTLAANFGALSVDHLEYLDP  267
ident                 |   |   |  |  |        |   |   |     |    | 
Sbjct gnepgQQQLTYEEMKAVVDEAHMAGIKVAAHAH---GASGIREAVRAGVDTIEHASLVDD  252
DSSP  lllllLLLLLHHHHHHHHHHHHHLLLEEEEEEL---LHHHHHHHHHLLLLEEEELLLLLH


DSSP  HHHHHHHHHLLEEEELHHHHHHLL------------------LLLLL--LHHHHHHLLLL
Query EGIQALAHRGVVATLLPTAFYFLK------------------ETKLP--PVVALRKAGVP  307
ident |||      |                                   |         |||| 
Sbjct EGIKLAVQKGAYFSMDIYNTDYTQaegkkngvlednlrkdrdIGELQreNFRKALKAGVK  312
DSSP  HHHHHHHHHLLEEELLLLLHHHHHhhhhhhlllhhhhhhhhhHHHHHhhHHHHHHHHLLE


DSSP  EEELLLLLlllLLLL-LHHHHHHHHHHhHLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLL
Query XAVSSDINpgtAPIV-SLRXAXNXACTlFGLTPVEAXAGVTRHAARALGEQEQLGQLRVG  366
ident      |                       | ||  |    |  || |||     ||  ||
Sbjct MVYGTDAG---IYPHgDNAKQFAVMVR-YGATPLQAIQSATLTAAEALGRSKDVGQVAVG  368
DSSP  EELLLLLL---LLLLlLHHHHHHHHHH-LLLLHHHHHHHLLHHHHHHHLLLLLLLLLLLL


DSSP  LLLLEEEElLLLLLHHHHLlllLLEEEEEELLEELL--l
Query XLADFLVWnCGHPAELSYLigvDQLVSRVVNGEETL--h  403
ident    |      | |            |     |       
Sbjct RYGDMIAV-AGDPLADVTT--lEKPVFVMKGGAVVKapx  404
DSSP  LLLLEEEE-LLLLLLLHHH--hHLLLEEEELLEEEElll


No 10: Query=2oofA Sbjct=4c5yA Z-score=33.5

back to top
DSSP  lLLLEEEEEE-EELLLLlllllLLLLLLEEEEEELLEEEEEEEHHHLL----LLLLLEEL
Query lNCERVWLNV-TPATLRsdladYGLLEPHALGVHEGRIHALVPXQDLK----YPAHWQDX   55
ident                          |   ||      |       |              
Sbjct dEAKVTIIYAgLLIPGD-----GEPLRNAALVISDKIIAFVGSEADIPkkylRSTQSTHR   55
DSSP  lLLLEEEEEEeEELLLL-----LLLEEEEEEEEELLEEEEEEEHHHLLhhhhHHLLLEEE


DSSP  lLLEEEELEEEEEELLLLLLLLhhhhhhhhhlllhhhhhhllllhhHHHHHHHHLLHHHH
Query kGKLVTPGLIDCHTHLIFAGSRaeefelrqkgvpyaeiarkgggiiSTVRATRAASEDQL  115
ident       ||| ||| |                                      |      
Sbjct -VPVLMPGLWDCHMHFGGDDDY-----------------------yNDYTSGLATHPASS   91
DSSP  -EEEEEELEEEEEELLLLLLLL-----------------------lLLLHHHHHLLHHHH


DSSP  HHHHHHHHHHHHHHLEEEEEEELlllllhhhhhhHHHHHHHHHH---HLLLEEEEE-EEE
Query FELALPRVKSLIREGVTTVEIKSgygltledelkXLRVARRLGE---ALPIRVKTT-LLA  171
ident               | |                                   |       
Sbjct GARLARGCWEALQNGYTSYRDLA----------gYGCEVAKAINdgtIVGPNVYSSgAAL  141
DSSP  HHHHHHHHHHHHHLLEEEEEELL----------lLHHHHHHHHHlllLLLLEEEELlLEE


DSSP  E----LLLL------HHHL----------------llhHHHHHHHHhLHHHHHHhLLLLL
Query A----HAVP------PEYR----------------ddpDSWVETICqEIIPAAAeAGLAD  205
ident      |                                   ||               | 
Sbjct SqtagHGDIfalpagEVLGsygvmnprpgywgagplciADGVEEVR-RAVRLQI-RRGAK  199
DSSP  EllllLLLLllllhhHHHHhhlllllllllllllleeeLLLHHHHH-HHHHHHH-HHLLL


DSSP  EEEEEEL-----------LLLLLHHHHHHHHHHHHHLLLEEEEEELllLLLLhHHHHHHL
Query AVDVFCE-----------HIGFSLAQTEQVYLAADQYGLAVKGHXDqlSNLGgSTLAANF  254
ident    |                 ||          |      |  |       |    |   
Sbjct VIXVMASggvmsrddnpnFAQFSPEELKVIVEEAARQNRIVSAHVH--GKAG-IMAAIKA  256
DSSP  LEEEELLlllllllllllLLLLLHHHHHHHHHHHHHLLLLEEEEEL--LHHH-HHHHHHH


DSSP  LLLEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLL-----------------LLLLL-
Query GALSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLK-----------------ETKLP-  296
ident |  |  |  | | |        |                                     
Sbjct GCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLasngeglvkeswaklqaLADSHl  316
DSSP  LLLEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHhhllllllllhhhlllhHHHHHh


DSSP  -LHHHHHHLLLLEEELLLLLllllllLLHHHHHHHHHHHHLLLHHHHHHHLLHHHHHHLL
Query -PVVALRKAGVPXAVSSDINpgtapiVSLRXAXNXACTLFGLTPVEAXAGVTRHAARALG  355
ident        ||||  |   |                 |    | || ||    |  |    |
Sbjct kAYQGAIKAGVTIALGTDTA----pgGPTALELQFAVERGGMTPLEAIKAATANAPLSVG  372
DSSP  hHHHHHHHLLLLEELLLLLL----llLLLHHHHHHHHHLLLLLHHHHHHHHLLLHHHHHH


DSSP  -lLLLLLLLLLLLLLLEEEELLlLLLHHHHL-LLLLLEEEEEELLEELLL----------
Query -eQEQLGQLRVGXLADFLVWNCgHPAELSYL-IGVDQLVSRVVNGEETLH----------  403
ident       |||| |  ||        | |                 |               
Sbjct pqAPLTGQLREGYEADVIALEE-NPLEDIKVfQEPKAVTHVWKGGKLFKGpgigpwgeda  431
DSSP  hhLLLLLLLLLLLLLLEEEELL-LLLLLHHHhHLHHHEEEEEELLEEEELllllllllll


DSSP  -----
Query -----  403
ident      
Sbjct rnpfl  436
DSSP  lllll


No 11: Query=2oofA Sbjct=4rdvB Z-score=29.7

back to top
DSSP  llllEEEEEEEELLLLllllllLLLLLEEEEEE-LLEEEEEEEHHHllllLLLEELLlLE
Query lnceRVWLNVTPATLRsdladyGLLEPHALGVH-EGRIHALVPXQDlkypAHWQDXKgKL   59
ident                       |            |      |                 
Sbjct ----SAIFAERALLPE------GWARNVRFEISaDGVLAEIRPDAN---aDGAERLG-GA   46
DSSP  ----LEEEEEEEEELL------EEEEEEEEEELlLLLEEEEELLLL---lLLLEELL-LL


DSSP  EEELEEEEEELLLL--lllLHHHhhhHHHLLlhhhhhhllLLHHHHHHHhhhLLHHHHHH
Query VTPGLIDCHTHLIF--agsRAEEfelRQKGVpyaeiarkgGGIISTVRAtraASEDQLFE  117
ident | ||    | |         ||                        |      |  |   
Sbjct VLPGMPNLHSHAFQramagLAEV---AGNPN--dsfwtwrELMYRMVAR---LSPEQIEV   98
DSSP  EEELEEEEEELHHHhhhllLLLL---LLLLL--llhhhhhHHHHHHHLL---LLHHHHHH


DSSP  HHHHHHHHHHHHLEEEEEEELLLLL---LHHH--hHHHHHHHHHHHHHLLLEEEEEEEeE
Query LALPRVKSLIREGVTTVEIKSGYGL---TLED--eLKXLRVARRLGEALPIRVKTTLLaA  172
ident  |          | | |                          |   |  |         
Sbjct IACQLYIEMLKAGYTAVAEFHYVHHdldGRSYadpAELSLRISRAASAAGIGLTLLPV-L  157
DSSP  HHHHHHHHHHHHLEEEEEEEELLLLlllLLLLlllLHHHHHHHHHHHHHLLEEEEEEL-L


DSSP  LLL-------LHHHlllhhhhhhHHHHLhHHHHHHLLL--------lLEEE-EEELllLL
Query HAV-------PPEYrddpdswveTICQEiIPAAAEAGL--------aDAVD-VFCEhiGF  216
ident             |                                               
Sbjct YSHagfggqpASEG----qrrfiNGSEA-YLELLQRLRapleaaghsLGLCfHSLR--AV  210
DSSP  LLEeellleeLLHH----hllllLLHHH-HHHHHHHHHhhhhhhlleELEEeLLLL--LL


DSSP  LHHHHHHHHHHhhHLLLE-EEEEELLLL----------llLHHHHHH--HLLL--LEEEE
Query SLAQTEQVYLAadQYGLA-VKGHXDQLS----------nlGGSTLAA--NFGA--LSVDH  261
ident    |   |  |        |  |                                    |
Sbjct TPQQIATVLAA--GHDDLpVHIHIAEQQkevddcqawsgrRPLQWLYenVAVDqrWCLVH  268
DSSP  LHHHHHHHHLL--LLLLLlEEEEELLLHhhhhhhhhhhllLHHHHHHhhLLLLllEEEEE


DSSP  LLLLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHLLLLEEELLLLLllllLL
Query LEYLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKAGVPXAVSSDINpgtaPI  321
ident     ||    | |  | || |       |      |       |      ||        
Sbjct ATHADPAEVAAMARSGAVAGLCLSTEANLGD-GIFPATDFLAQGGRLGIGSDSH----VS  323
DSSP  LLLLLHHHHHHHHHHLLEEEELHHHHHHLLL-LLLLHHHHHHLLLEEEELLLLL----LL


DSSP  LLHHHHHHHHHHHHL---------------lLHHHHHHHLLHHHHHHLLLllLLLLLLLL
Query VSLRXAXNXACTLFG---------------lTPVEAXAGVTRHAARALGEqeQLGQLRVG  366
ident  |                                          | |||     | | ||
Sbjct LSVVEELRWLEYGQRlrdrkrnrlyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVG  381
DSSP  LLHHHHHHHHHHHHHhhhlllllllllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLL


DSSP  LLLLEEEELL-----------lLLLHHHH-LLLLlLEEEEEELLEELLL-----------
Query XLADFLVWNC-----------gHPAELSY-LIGVdQLVSRVVNGEETLH-----------  403
ident   || ||                            |     | |                
Sbjct RRADLLVLDGndpylasaegdaLLNRWLFaGGDR-QVRDVMVAGRWVVRdgrhageersa  440
DSSP  LLLLEEEELLllhhhhllllhhHHHHHHHhLLHH-HEEEEEELLEEEELllllllhhhhh


DSSP  -----------
Query -----------  403
ident            
Sbjct rafvqvlgell  451
DSSP  hhhhhhhhhhl


No 12: Query=2oofA Sbjct=2vunA Z-score=28.4

back to top
DSSP  llLLEEEEEE-EELLLLLLLllLLLLLlEEEEEELLEEEEEEEHHHLL-LLLL-LEELLL
Query lnCERVWLNV-TPATLRSDLadYGLLEpHALGVHEGRIHALVPXQDLK-YPAH-WQDXKG   57
ident         |               |       |  | | |       |        |  |
Sbjct --SKTIIKNIgKIVSGDIKS--PVLQA-DTIVVEDGLIAAIGGEELMKdAGDAtIIDAAG   55
DSSP  --LEEEEELLlEEELLLLLL--LEELL-LEEEEELLEEEEEELHHHHLlLLLLeEEELLL


DSSP  LEEEELEEEEEELLLlllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhHH
Query KLVTPGLIDCHTHLIfagsraeefelrqkgvpyaeiarkgggiistvratraasedqlFE  117
ident   ||||| | | |                                               
Sbjct STVTPGLLDTHVHVS-------------------------------------------GG   72
DSSP  LEEEELEEEEEELLL-------------------------------------------LL


DSSP  HH------HHHHHHHHHHLEEEEEE-ELLL----LLLHHHHHHHH-HHHHHHHHHL--LL
Query LA------LPRVKSLIREGVTTVEI-KSGY----GLTLEDELKXL-RVARRLGEAL--PI  163
ident              |    ||||     |                          |     
Sbjct DYaprqktMDFISSALHGGVTTMISaGSPHfpgrPKDAAGTKALAiTLSKSYYNARpaGV  132
DSSP  LEehhhleELHHHHHHLLLEEEEEElLLLLllllLLLHHHHHHHHhHHHHHHHHLLhhHL


DSSP  EEE-EEEEEEllllhhhlllhhhhHHHHhHLHHHHHHHLLlLLEE-EEEEllllLLHHHH
Query RVK-TTLLAAhavppeyrddpdswVETIcQEIIPAAAEAGlADAV-DVFCehigFSLAQT  221
ident  |                            |        |    |  |            
Sbjct KVHgGAVILE--------------KGLT-EEDFIEMKKEG-VWIVgEVGL-gtiKNPEDA  175
DSSP  EEElLEELLL--------------LLLL-HHHHHHHHHLL-LLEEeEELL-lllLLHHHH


DSSP  HHHHHHHHHLLLEEEEEELLL------LLLL-HHHHHHhllLLEEEEL-----LLLL---
Query EQVYLAADQYGLAVKGHXDQL------SNLG-GSTLAAnfgALSVDHL-----EYLD---  266
ident       |   |  |  |                           | |             
Sbjct APMVEWAHKHGFKVQMHTGGTsipgssTVTAdDVIKTK---PDVVSHInggptAISVqev  232
DSSP  HHHHHHHHHLLLEEEEELLLLllllllLLLHhHHHHHL---LLEEELLlllllLLLHhhh


DSSP  HHHHHHHhhhLLEEEELHHHHhhlllLLLL--LHHHHHHLLL--LEEELLLLLLLlLLLL
Query PEGIQALahrGVVATLLPTAFyflkeTKLP--PVVALRKAGV--PXAVSSDINPGtAPIV  322
ident                            |            |         |   |     
Sbjct DRIMDET---DFAMEIVQCGN-----PKIAdyVARRAAEKGQlgRVIFGNDAPSG-TGLI  283
DSSP  HHHHHHL---LLEEEEELLLL-----HHHHhhHHHHHHHHLLhhHEEEELLLLLL-LLLL


DSSP  --LHHHHHHHHHHHHLLLHHHHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELL----
Query --SLRXAXNXACTLFGLTPVEAXAGVTRHAARALGEqeQLGQLRVGXLADFLVWNC----  376
ident                   |  |    |       |     |    |  ||          
Sbjct plGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADLIIMDTplgs  341
DSSP  llHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELllll


DSSP  ---LLLLHH-hHLLLllLEEEEEELLEELLL---------------
Query ---GHPAEL-sYLIGvdQLVSRVVNGEETLH---------------  403
ident              |           ||                   
Sbjct vaeDAMGAIaaGDIP--GISVVLIDGEAVVTksrntppakraakil  385
DSSP  lllLHHHHHhhLLLL--EEEEEEELLEEEELlllllllllllleel


No 13: Query=2oofA Sbjct=3icjA Z-score=28.1

back to top
DSSP  llLLEEEEEEEELLLLLlllLLLLLllEEEEEELLEEEEEEEHHH---llLLLL--LEEL
Query lnCERVWLNVTPATLRSdlaDYGLLepHALGVHEGRIHALVPXQD---lkYPAH--WQDX   55
ident   |     | |  |  |            |     |                |     | 
Sbjct --CMKALINGTIYTSFS---PVKKV--SGLVISNERVLYAGDSSTalriaELAGgeIIDL   53
DSSP  --LEEEEELLEEEEEEL---LEEEE--LEEEEELLEEEEEELHHHhhhhhHHHLleEEEL


DSSP  LLLEEEELEEEEEELLLL-----------------------------llLLHH-------
Query KGKLVTPGLIDCHTHLIF-----------------------------agSRAE-------   79
ident ||| | |   | | ||                                            
Sbjct KGKFVMPAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriiFGFGwdqdelg  113
DSSP  LLLEEEELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleEEEEelhhhhl


DSSP  ----------------HHHHH--------------------hhlllhhHHHHLLLLhHHH
Query ----------------EFELR--------------------qkgvpyaEIARKGGGiIST  103
ident                                                           | 
Sbjct rwptredldvidrpvfLYRRCfhvavmnskmidllnlkpskdfdestgIVRERALE-ESR  172
DSSP  llllhhhhlllllleeEEELLlleeeelhhhhhhhllllllleellllEEEHHHHH-HHH


DSSP  HHHHH-HLLHHHHHHHHHHHHHHHHHHLEEEEEEELLllllhhhHHHHHHHHHHHH--HH
Query VRATR-AASEDQLFELALPRVKSLIREGVTTVEIKSGygltledELKXLRVARRLG--EA  160
ident                        |   ||  |   |          | |     |     
Sbjct KIINEkILTVKDYKHYIESAQEHLLSLGVHSVGFMSV-------GEKALKALFELEreGR  225
DSSP  HHHHHlLLLHHHHHHHHHHHHHHHHHLLEEEEEEEEE-------LHHHHHHHHHHHhlLL


DSSP  LLLEEEEEEEEellllhhhlllhhhhhhhhhhlHHHHHH--HLLL-------LLEEEEEE
Query LPIRVKTTLLAahavppeyrddpdswveticqeIIPAAA--EAGL-------ADAVDVFC  211
ident |   |   |                                  |           |  | 
Sbjct LKMNVFAYLSP---------------------eLLDKLEelNLGKfegrrlrIWGVXLFV  264
DSSP  LLLEEEEEELH---------------------hHHHHHHhhLLLLeellleeEEEEEEEL


DSSP  L----------------------LLLLLHHHHHHHHHHHHHLLLEEEEEElLLLLL-LHH
Query E----------------------HIGFSLAQTEQVYLAADQYGLAVKGHXdQLSNL-GGS  248
ident                                   |   |   || |  |           
Sbjct DgslgartallsepytdnpttsgELVMNKDEIVEVIERAKPLGLDVAVHA-IGDKAvDVA  323
DSSP  LllllllllllllllllllllllLLLLLHHHHHHHHHHHLLLLLEEEEEE-LLHHHhHHH


DSSP  HHHH---HLLLlEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLL----------LL
Query TLAA---NFGAlSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKET----------KL  295
ident   |     |      |                |     |                     
Sbjct LDAFeeaEFSG-RIEHASLVRDDQLERIKELKVRISAQPHFIVSDWWIvnrvgeerakWA  382
DSSP  HHHHhhhLLLL-EEEELLLLLHHHHHHHHHHLLEEEELLLHHHHLLLHhhhhhhhhhhHL


DSSP  LLHHHHHHlLLLEEELLLLLlllLLLLLHHHHHHHHHHHH------LLLHHHHHHHLLHH
Query PPVVALRKaGVPXAVSSDINpgtAPIVSLRXAXNXACTLF------GLTPVEAXAGVTRH  349
ident      |         | |                 |               ||    |  
Sbjct YRLKTLSS-ITKLGFSTDSP---IEPADPWVSIDAAVNRYvvdpgeRVSREEALHLYTHG  438
DSSP  LLHHHHHH-HLLEEELLLLL---LLLLLHHHHHHHHHHLLlllhhhLLLHHHHHHHLLHH


DSSP  HHHHLLLLlLLLLLLLLLLLLEEEELLlLLLHhhhlllllleeeeeelleelll
Query AARALGEQeQLGQLRVGXLADFLVWNCgHPAElsyligvdqlvsrvvngeetlh  403
ident  |        || |  |  |         |                        
Sbjct SAQVTLAE-DLGKLERGFRAEYIILDR-DPLK----------------------  468
DSSP  HHHHLLLL-LLLLLLLLLLLLEEEELL-LLLL----------------------


No 14: Query=2oofA Sbjct=1yrrB Z-score=25.8

back to top
DSSP  llllEEEEEEEELLLLllllllLLLLLEEEEEELLEEEEEEEHHHLLLLLLLEELLLLEE
Query lnceRVWLNVTPATLRsdladyGLLEPHALGVHEGRIHALVPXQDLKYPAHWQDXKGKLV   60
ident              |          |  ||     | |    |   |          |   
Sbjct ----YALTQGRIFTGH------EFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAIL   50
DSSP  ----LEEELLEEELLL------LEELLEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEE


DSSP  EELEEEEEELL-----LLLLllhhhhhhhhhlllhhhhhhllllhhhhhhhhhHLLHhhH
Query TPGLIDCHTHL-----IFAGsraeefelrqkgvpyaeiarkgggiistvratrAASEdqL  115
ident  || ||                                               |      
Sbjct SPGFIDVQLNGcggvqFNDT---------------------------------AEAV--S   75
DSSP  EELEEEEEELEelleeLLLL---------------------------------LLLL--L


DSSP  HHHHHHHHHHHHHHLEEEEEEELLlLLLHHHHHHHHHHHHHHHHHLLLEEE-EEEEEELL
Query FELALPRVKSLIREGVTTVEIKSGyGLTLEDELKXLRVARRLGEALPIRVK-TTLLAAHA  174
ident  |      |     | |            |      || |      |       |     
Sbjct VETLEIMQKANEKSGCTNYLPTLI-TTSDELMKQGVRVMREYLAKHPNQALgLHLEGPWL  134
DSSP  HHHHHHHHHHHHLLLEEEEEEEEL-LLLHHHHHHHHHHHHHHHHHLLLLLLlEEEELLLL


DSSP  llhhhlllhhhhhHHHHHlHHHHHHhlLLLLEEEEEEllllllHHHHHHHHHHHHHLLLE
Query vppeyrddpdswvETICQeIIPAAAeaGLADAVDVFCehigfsLAQTEQVYLAADQYGLA  234
ident                         |       |                |       |  
Sbjct ------------nAALVD-FLCENA--DVITKVTLAP------EMVPAEVISKLANAGIV  173
DSSP  ------------lLHHHH-HHHHLH--HHEEEEEELH------HHLLHHHHHHHHHHLLE


DSSP  EEEEElllLLLL-HHHHHHHLLLLEEEELL-----------llLHHHHHHHhhhLLEEEE
Query VKGHXdqlSNLG-GSTLAANFGALSVDHLE-----------ylDPEGIQALahrGVVATL  282
ident |                    |     ||                               
Sbjct VSAGH--sNATLkEAKAGFRAGITFATHLYnampyitgrepglAGAILDEA---DIYCGI  228
DSSP  EEELL--lLLLHhHHHHHHHHLEEEELLLLlllllllllllhhHHHHHHLL---LLEEEE


DSSP  LHHhHHHLlLLLLL--LHHHHHhllLLEEELLLLlLLLLlLLLHHHHHHHHHHHHLLLHH
Query LPTaFYFLkETKLP--PVVALRkagVPXAVSSDInPGTApIVSLRXAXNXACTLFGLTPV  340
ident                                 |                      |    
Sbjct IAD-GLHV-DYANIrnAKRLKG---DKLCLVTDA-TSGS-SLTMIEGVRNLVEHCGIALD  281
DSSP  ELL-LLLL-LHHHHhhHHHHHH---HHEEEELLL-LLLL-LLLHHHHHHHHHHHHLLLHH


DSSP  HHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLllllhhhhlllllLEEEEEELLEE
Query EAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCghpaelsyligvdQLVSRVVNGEE  400
ident |     |   ||| |    || |  |  |                          ||| |
Sbjct EVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTP-----------dfKITKTIVNGNE  330
DSSP  HHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELL-----------llLEEEEEELLEE


DSSP  LLL-
Query TLH-  403
ident     
Sbjct VVTq  334
DSSP  EEEl


No 15: Query=2oofA Sbjct=1onxA Z-score=25.7

back to top
DSSP  -----lLLLEEEEEEEELLLlllllllLLLLLEEEEEELLEEEEEEEHhhllLLLL----
Query -----lNCERVWLNVTPATLrsdladyGLLEPHALGVHEGRIHALVPXqdlkYPAH----   51
ident                                     |  | | |                
Sbjct midytaAGFTLLQGAHLYAP-------EDRGICDVLVANGKIIAVASN--ipSDIVpnct   51
DSSP  llllhhHLLEEEEEEEEELL-------LEEEEEEEEEELLEEEEEELL--llLLLLllle


DSSP  LEELLLLEEEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhlllLHHHhHHHHhhll
Query WQDXKGKLVTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkggGIIStVRATraas  111
ident   |  |    || || | |||                          |            
Sbjct VVDLSGQILCPGFIDQHVHLIG-----------------------ggGEAG-PTTR----   83
DSSP  EEELLLLEEEELEEEEEELLLL-----------------------llLLLL-HHHL----


DSSP  hhhhhhHHHHhHHHHHHHLEEEEEEELL-LLLLhhHHHHHHHHHHHHHHHLLLEEEEEEe
Query edqlfeLALPrVKSLIREGVTTVEIKSG-YGLTleDELKXLRVARRLGEALPIRVKTTLl  170
ident               |   ||| |    |            |    |      |       
Sbjct -----tPEVA-LSRLTEAGVTSVVGLLGtDSIS--RHPESLLAKTRALNEEGISAWMLT-  134
DSSP  -----lLLLL-HHHHHHLLEEEEEELLLlLLLL--LLHHHHHHHHHHHHHHLLEEEEEE-


DSSP  EELLllhhhlllhhhhHHHHhhLHHHHH-HHLLLLLEEEEEE-LLLLLLHH--HHHHHHH
Query AAHAvppeyrddpdswVETIcqEIIPAA-AEAGLADAVDVFC-EHIGFSLA--QTEQVYL  226
ident  |                           |       |      |               
Sbjct GAYH-----------vPSRTitGSVEKDvAIIDRVIGVXCAIsDHRSAAPDvyHLANMAA  183
DSSP  ELLL-----------lLLLLllLLHHHHhHHLLLEEEEEEEElLLLLLLLLhhHHHHHHH


DSSP  HHHHLL------LEEEEEElLLLLLLhHHHH--------hHLLLLEEEELLL---LLHHH
Query AADQYG------LAVKGHXdQLSNLGgSTLA--------aNFGALSVDHLEY---LDPEG  269
ident      |           |    |                     |   |      |    
Sbjct ESRVGGllggkpGVTVFHM-GDSKKA-LQPIydllencdvPISKLLPTHVNRnvpLFEQA  241
DSSP  HHHHHHhhhlllLEEEEEE-LLLLLL-LHHHhhhhhllllLHHHEEEELHHHlhhHHHHH


DSSP  HHHHHHHLLeEEELHHHHhhllLLLL--lLHHHHH-HLLL--LEEELLLL-LLLL-----
Query IQALAHRGVvATLLPTAFyflkETKL--pPVVALR-KAGV--PXAVSSDI-NPGT-----  318
ident        |              |                       |||           
Sbjct LEFARKGGT-IDITSSID----EPVApaeGIARAVqAGIPlaRVTLSSDGnGSQPffdde  296
DSSP  HHHHHLLLL-EEEELLLL----LLLLhhhHHHHHHhLLLLhhHEEEELLLlLEEEeelll


DSSP  ------lLLLLhHHHHHHHHH--hhLLLHH-HHHHHLLHHHHHHLLLlLLLLLLLLLLLL
Query ------aPIVSlRXAXNXACT--lfGLTPV-EAXAGVTRHAARALGEqEQLGQLRVGXLA  369
ident                                 |    |   |  |      |    |  |
Sbjct gnlthigVAGF-ETLLETVQVlvkdYDFSIsDALRPLTSSVAGFLNL-TGKGEILPGNDA  354
DSSP  lleeeeeELLL-HHHHHHHHHhhhhHLLLHhHHHHHHLHHHHHHLLL-LLLLLLLLLLLL


DSSP  LEEEElLLLLlhhhhlllllLEEEEEELLEELLL-------------
Query DFLVWnCGHPaelsyligvdQLVSRVVNGEETLH-------------  403
ident | ||                        |                  
Sbjct DLLVM-TPEL----------RIEQVYARGKLMVKdgkacvkgtfetd  390
DSSP  LEEEE-LLLL----------LEEEEEELLEEEEElleelllllllll


No 16: Query=2oofA Sbjct=3nqbA Z-score=25.3

back to top
DSSP  ---------------------LLLLEEEEEEEELLLLllllLLLLLlLEEEEEELLEEEE
Query ---------------------LNCERVWLNVTPATLRsdlaDYGLLePHALGVHEGRIHA   39
ident                                |            |  |   |     |  
Sbjct epadlnddtlraravaaargdQRFDVLITGGTLVDVV----TGELR-PADIGIVGALIAS   55
DSSP  llhhhllhhhhhhhhhhhhllLLEEEEEELLEEELLL----LLLEE-ELEEEEELLEEEE


DSSP  EEEHHhLLLL-lLLEELLLLEEEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhlll
Query LVPXQdLKYP-aHWQDXKGKLVTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgg   98
ident                |  |  | ||||| | |                            
Sbjct VHEPA-SRRDaaQVIDAGGAYVSPGLIDTHXHIES-------------------------   89
DSSP  EELLL-LLLLeeEEEELLLLEEEELEEEEEELHHH-------------------------


DSSP  lhhhhhhhhhhllhhhhhHHHHHHHHHHHHHLEEEEEEELL-LLLLhhHHHHHHHHHHHH
Query giistvratraasedqlfELALPRVKSLIREGVTTVEIKSG-YGLTleDELKXLRVARRL  157
ident                                ||||        |          | |   
Sbjct ----------------sxITPAAYAAAVVARGVTTIVWDPHeFGNV--HGVDGVRWAAKA  131
DSSP  ----------------hlLLHHHHHHHHHLLLEEEEEELLHhHHHH--HLHHHHHHHHHH


DSSP  HHHLLLEEEEEEEEELLLLhhHLLLhhhhhhHHHHlHHHHHHHLLLLLEE-EEEEllllL
Query GEALPIRVKTTLLAAHAVPpeYRDDpdswveTICQeIIPAAAEAGLADAV-DVFCehigF  216
ident  | || |                             |                       
Sbjct IENLPLRAILLAPSCVPSA--PGLE-rggadFDAA-ILADLLSWPEIGGIaEIXN----X  183
DSSP  HLLLLLEEEEEELLLLLLL--LLLL-lllllLLHH-HHHHHHLLLLEEEEeEELL----H


DSSP  LHH-----HHHHHHHHHHHLLLEEEEEELllLLLL-hhHHHHHLLLLEEEELLL--LLHH
Query SLA-----QTEQVYLAADQYGLAVKGHXDqlSNLG-gsTLAANFGALSVDHLEY--LDPE  268
ident                |       | ||                 |  |   |        
Sbjct RGVierdpRXSGIVQAGLAAEKLVCGHAR--GLKNadlNAFXAAGVSSDHELVSgeDLXA  241
DSSP  HHHhlllhHHHHHHHHHHHHLLEEEELLL--LLLHhhhHHHHHLLLLEELLLLLhhHHHH


DSSP  HHHHHhhhlLEEEELHhHHHHlllllLLLHHHHHHL---LLLEEELLLLLLllLLLL---
Query GIQALahrgVVATLLPtAFYFlketkLPPVVALRKA---GVPXAVSSDINPgtAPIV---  322
ident    |         |               | ||              |            
Sbjct KLRAG----LTIELRG-SHDH---llPEFVAALNTLghlPQTVTLCTDDVF--PDDLlqg  291
DSSP  HHHLL----LEEEEEL-LLHH---hhHHHHHHHHHHlllLLLEEEELLLLL--HHHHhhl


DSSP  -LHHHHHHHHHHhHLLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLLEEEELLllLLH
Query -SLRXAXNXACTlFGLTPVEAXAGVTRHAARALGEqEQLGQLRVGXLADFLVWNCghPAE  381
ident   |           || |  |    |  ||  ||    ||    |  ||  |        
Sbjct gGLDDVVRRLVR-YGLKPEWALRAATLNAAQRLGR-SDLGLIAAGRRADIVVFED--LNG  347
DSSP  lLHHHHHHHHHH-LLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEELL--LLL


DSSP  HhhlllllLEEEEEELLEELLL--------------------------------------
Query LsyligvdQLVSRVVNGEETLH--------------------------------------  403
ident                 |                                           
Sbjct F-------SARHVLASGRAVAEggrxlvdiptcdttvlkgsxklplrxandflvksqgak  400
DSSP  L-------LEEEEEELLEEEEElleelllllllllhhhllllllllllhhhhllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct gafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsd  520
DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee


DSSP  -------
Query -------  403
ident        
Sbjct espviev  587
DSSP  llleeel


No 17: Query=2oofA Sbjct=3giqA Z-score=24.8

back to top
DSSP  LLLLEEEEEEEELLLLllllLLLLLlLEEEEEELLEEEEEEEHhhLLLL-lLLEELLLLE
Query LNCERVWLNVTPATLRsdlaDYGLLePHALGVHEGRIHALVPXqdLKYP-aHWQDXKGKL   59
ident                              |||  ||| |         |  |  |  || 
Sbjct EKLDFKITGGWIIDGT----GAPRR-RADLGVRDGRIAAIGEL--GAHParHAWDASGKI   53
DSSP  LLEEEEEELLEELLLL----LLLLE-ELEEEEELLEEEEEELL--LLLLeeEEEELLLLE


DSSP  EEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhHHHH
Query VTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlFELA  119
ident | || || | |                                             |   
Sbjct VAPGFIDVHGHDDL-----------------------------------------mFVEK   72
DSSP  EEELEEELLLLLLL-----------------------------------------hHHHL


DSSP  HHhHHHHHHHLEEEEEEE----LLLLLL----------------hHHHHHHHHHHHHhhH
Query LPrVKSLIREGVTTVEIK----SGYGLT----------------lEDELKXLRVARRlgE  159
ident           | |||       |                               |     
Sbjct PD-LRWKTSQGITTVVVGncgvSAAPAPlpgntaaalallgetplFADVPAYFAALD-aQ  130
DSSP  LL-LHHHHLLLEEEEEELllllLLLLLLllllllhhhhhhlllllLLLHHHHHHHHH-hL


DSSP  HLLLEEEEEEEEELLLL--HHHLLLHH--HHHHHHHhLHHHHHHHlLLLLEEEEEELLLL
Query ALPIRVKTTLLAAHAVP--PEYRDDPD--SWVETICqEIIPAAAEaGLADAVDVFCEHIG  215
ident    | |      |                            || |   |           
Sbjct RPMINVAALVGHANLRLaaMRDPQAAPtaAEQQAMQ-DMLQAALE-AGAVGFSTGLAYQP  188
DSSP  LLLLEEEEEEEHHHHHHhhLLLLLLLLlhHHHHHHH-HHHHHHHH-HLLLEEEEELLLLL


DSSP  L---LHHHHHHHHHHHHHLLLEEEEEELLL---LLLL--HHHHHHH--LLLLEEEELLL-
Query F---SLAQTEQVYLAADQYGLAVKGHXDQL---SNLG--GSTLAAN--FGALSVDHLEY-  264
ident       |  |     |         |                        |  | |    
Sbjct GavaQAAELEGLARVAAERRRLHTSHIRNEadgVEAAveEVLAIGRgtGCATVVSHHKCm  248
DSSP  HhhlLHHHHHHHHHHHHHLLLEEEEELLLLlllHHHHhhHHHHHHHhhLLEEEELLLLLl


DSSP  ----------LLHHHHHHHH-HHLLEEEELHhHHHH------------------------
Query ----------LDPEGIQALA-HRGVVATLLPtAFYF------------------------  289
ident                  |      |     |                             
Sbjct mpqnwgrsraTLANIDRAREqGVEVALDIYP-YPGSstiliperaetiddiritwstphp  307
DSSP  lhhhlllhhhHHHHHHHHHHlLLLEEEEELL-LLEEeeellhhhllllllleeeeelllh


DSSP  -------------------------------LLLLL--LLLHhhhhhlLLLEEELLLLLL
Query -------------------------------LKETK--LPPVvalrkaGVPXAVSSDINP  316
ident                                                      | ||  |
Sbjct ecsgeyladiaarwgcdkttaarrlapagaiYFAMDedEVKR---ifqHPCCMVGSDGLP  364
DSSP  hhllllhhhhhhhhlllhhhhhhhhlleeeeEELLLhhHHHH---hhhLLLEEELLLLLL


DSSP  ---llLLLLL-HHHHH-HHHHhhhLLLHH-HHHHHLLHHHHHHLLLlLLLLLLLLLLLLL
Query ---gtAPIVS-LRXAX-NXACtlfGLTPV-EAXAGVTRHAARALGEqEQLGQLRVGXLAD  370
ident       |                  |     | |  |   ||  |     | |  |  ||
Sbjct ndarpHPRLWgSFTRVlGRYVreaRLMTLeQAVARMTALPARVFGF-AERGVLQPGAWAD  423
DSSP  lllllLLHHHhHHHHHhHHHHhhlLLLLHhHHHHHHLHHHHHHHLL-LLLLLLLLLLLLL


DSSP  EEEELLLlllhhhHLLL---------LLLEEEEEELLEELLL---------------
Query FLVWNCGhpaelsYLIG---------VDQLVSRVVNGEETLH---------------  403
ident   |                               ||| |                  
Sbjct VVVFDPD-----tVADRatwdeptlaSVGIAGVLVNGAEVFPqppadgrpgqvlrax  475
DSSP  EEEELLL-----lLLLLlllllllllLLLEEEEEELLEEEELlllllllllllllll


No 18: Query=2oofA Sbjct=2ogjA Z-score=24.3

back to top
DSSP  llLLEEEEEEEELlLLLLLlllLLLLLEEEEEE-LLEEEEEEEHhhllLLLL-LEELLlL
Query lnCERVWLNVTPAtLRSDLadyGLLEPHALGVH-EGRIHALVPXqdlkYPAH-WQDXKgK   58
ident         || |                       | | |         ||         
Sbjct -qAPILLTNVKPV-GFGKG---ASQSSTDILIGgDGKIAAVGSA--lqAPADtQRIDA-A   52
DSSP  -lLLEEEEEEEEL-LLLLL---LLLLLEEEEELlLLLEEEEELL--llLLLLeEELLL-L


DSSP  EEEELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhHHHH
Query LVTPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedqLFEL  118
ident    ||  | | |                                                
Sbjct FISPGWVDLHVHIWHG----------------------------------------GTDI   72
DSSP  EEEELEEEEEELLLLL----------------------------------------LLLL


DSSP  hhhHHHHHH-HHLEEEEEEELLLlllhhhHHHHhHHHHH-HHHHLLLEEEEEEEEE----
Query alpRVKSLI-REGVTTVEIKSGYgltledELKXlRVARR-LGEALPIRVKTTLLAA----  172
ident    |        ||||             |       |    |    | |  |       
Sbjct -siRPSECGaERGVTTLVDAGSA-----gEANF-HGFREyIIEPSRERIKAFLNLGsigl  125
DSSP  -llLHHHLLhHHLEEEEEEELLL-----lLLLH-HHHHHhLLLLLLLEEEEEEELLllll


DSSP  ------LLLLhhhlllHHHHHhhHHHLHhHHHHHLLL--LLEEEEEELLLLL---LHHHH
Query ------HAVPpeyrddPDSWVetICQEIiPAAAEAGL--ADAVDVFCEHIGF---SLAQT  221
ident                            |                |   |           
Sbjct vacnrvPELR------DIKDI--DLDRI-LECYAENSehIVGLXVRASHVITgswGVTPV  176
DSSP  llllllLLLL------LHHHL--LHHHH-HHHHHLLLllEEEEEEEELHHHHlllLLHHH


DSSP  HHHHHHHHHLLLEEEEEeLLLL---LLLHHHHHhhLLLLEEEELL-----LLLH------
Query EQVYLAADQYGLAVKGHxDQLS---NLGGSTLAanFGALSVDHLE-----YLDP------  267
ident       |         |                       | |                 
Sbjct KLGKKIAKILKVPXXVH-VGEPpalYDEVLEIL--GPGDVVTHCFngksgSSIXededlf  233
DSSP  HHHHHHHHHHLLLEEEE-ELLLlllHHHHHHHL--LLLLEEELLLlllllLLLLllhhhh


DSSP  -HHHHHhhhHLLEEEELHHHHhhlllllllLHHHHH-HLLLLEEELLLLLlLLLL---LL
Query -EGIQAlahRGVVATLLPTAFyflketklpPVVALR-KAGVPXAVSSDINpGTAP---IV  322
ident           |                      |       |   | |   |        
Sbjct nLAERC---EGIRLDIGHGGA----sfsfkVAEAAIaRGLLPFSISTDLH-GHSXnfpVW  285
DSSP  hHHHHL---LLLEEELLLLLL----lllhhHHHHHHhLLLLLLLLLLLLL-LLLLlllLL


DSSP  LHHHHHHHHHHhHLLLHHHHHHHLLHHHHHHLLLLLLllLLLLLLLLLEEEELL------
Query SLRXAXNXACTlFGLTPVEAXAGVTRHAARALGEQEQlgQLRVGXLADFLVWNC------  376
ident  |   |                 |||  |           | ||  ||| |         
Sbjct DLATTXSKLLS-VDXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRADFTVFDLvdadle  343
DSSP  LHHHHHHHHHH-LLLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLLEEEEEEEeeeeee


DSSP  -----llllhhhHLLLlllEEEEEELLEELL-------l
Query -----ghpaelsYLIGvdqLVSRVVNGEETL-------h  403
ident              |         |   |           
Sbjct atdsngdvsrlkRLFE---PRYAVIGAEAIAasryipra  379
DSSP  eellllleeeeeEEEE---EEEEEELLEEEEllllllll


No 19: Query=2oofA Sbjct=1gkpA Z-score=24.1

back to top
DSSP  lllLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEEHhhllLLLL-LEELLLLE
Query lncERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVPXqdlkYPAH-WQDXKGKL   59
ident         |    |                      |           |     |  || 
Sbjct ---PLLIKNGEIITA------DSRY-KADIYAEGETITRIGQN-leaPPGTeVIDATGKY   49
DSSP  ---LEEEELLEEEEL------LEEE-ELEEEELLLLLLEEELL-lllLLLLeEEELLLLE


DSSP  EEELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhHHHHHhhllhhhhhhHH
Query VTPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiisTVRATraasedqlfeLA  119
ident | || || | |                                                 
Sbjct VFPGFIDPHVHIYLP----------------------------FMATF-------akdTH   74
DSSP  EEELEEEEEELLLLE----------------------------ELLEE-------lllLH


DSSP  HHHHHHHHHHLEEEEEEELLLL--LLHHHHHHHHHHHHHhhHHLLLEEEEEEEEEllllh
Query LPRVKSLIREGVTTVEIKSGYG--LTLEDELKXLRVARRlgEALPIRVKTTLLAAhavpp  177
ident     |     | ||                                              
Sbjct ETGSKAALMGGTTTYIEMCCPSrnDDALEGYQLWKSKAE--GNSYCDYTFHMAVS-----  127
DSSP  HHHHHHHHHLLEEEEEEEELLLllLLHHHHHHHHHHHHL--LLLLLEEEEEEELL-----


DSSP  hhlllhhhHHHHHhHLHHHHHHHLLlLLEEEEEELLL---LLLHHHHHHHHHHHHHLLLE
Query eyrddpdsWVETIcQEIIPAAAEAGlADAVDVFCEHI---GFSLAQTEQVYLAADQYGLA  234
ident           |             |       |       |       |    |   |  
Sbjct -------kFDEKT-EGQLREIVADG-ISSFXIFLSYKnffGVDDGEMYQTLRLAKELGVI  178
DSSP  -------lLLLLH-HHHHHHHHHLL-LLEEEEEELLLlllLLLHHHHHHHHHHHHHHLLE


DSSP  EEEEEL----------------------------llLLLLHHHHHHH------LLLLeEE
Query VKGHXD----------------------------qlSNLGGSTLAAN------FGALsVD  260
ident |  |                                    |    |            | 
Sbjct VTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEGTARFATflettgATGY-VV  237
DSSP  EEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHHHHHHHHhhhhhlLEEE-EL


DSSP  ELLL--LLHHHHHHHH-HHLLEEEELHHHHHHLL--------------------LLLL--
Query HLEY--LDPEGIQALA-HRGVVATLLPTAFYFLK--------------------ETKL--  295
ident ||           | |             |   |                          
Sbjct HLSCkpALDAAMAAKArGVPIYIESVIPHFLLDKtyaerggveamkyimspplrDKRNqk  297
DSSP  LLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLHhhhhllhhhhhlllllllllLLHHhh


DSSP  LLHHHHHHlLLLEEELLLLLL-----------------LLLLLL-LHHHHH-HHHHhhhL
Query PPVVALRKaGVPXAVSSDINP-----------------GTAPIV-SLRXAX-NXACtlfG  336
ident     ||   |    |  |  |                    |                  
Sbjct VLWDALAQ-GFIDTVGTDHCPfdteqkllgkeaftaipNGIPAIeDRVNLLyTYGVsrgR  356
DSSP  HHHHHHHL-LLLLEEELLLLLllhhhhhhhlllhhhllLLLLLLlLHHHHHhHHHLlllL


DSSP  LLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL---------------lllh
Query LTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCG---------------hpae  381
ident |            ||   |     |   ||  ||  |                       
Sbjct LDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQyrgtisvktqhvnndyngf  416
DSSP  LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLlleellhhhllllllllll


DSSP  hhhLLLLlLEEEEEELLEELLL---------------------
Query lsyLIGVdQLVSRVVNGEETLH---------------------  403
ident     |         | |                          
Sbjct egfEIDG-RPSVVTVRGKVAVRdgqfvgekgwgkllrrepmyf  458
DSSP  lllEELL-EEEEEEELLEEEEElleelllllllllllllllll


No 20: Query=2oofA Sbjct=3ooqA Z-score=23.9

back to top
DSSP  lllLEEEEEEEELLLLlllllLLLLlLEEEEEELLEEEEEEEHhhlLLLL-LLEELLLLE
Query lncERVWLNVTPATLRsdladYGLLePHALGVHEGRIHALVPXqdlKYPA-HWQDXKGKL   59
ident         | |                    |  |             |     |  || 
Sbjct ---KILFKNATVFPIT-----SRPF-KGDVLVSNGKVEKVGEN--iEDPDaEIVDLTGKF   49
DSSP  ---LEEEEEEEELLLL-----LLLE-EEEEEEELLEEEEEELL--lLLLLlEEEELLLLE


DSSP  EEELEEEEEELLLL--lLLLHhhhhhhhhlllhhhhhhllllhHHHH-------hhhhhl
Query VTPGLIDCHTHLIF--aGSRAeefelrqkgvpyaeiarkgggiISTV-------ratraa  110
ident   ||  | | |      |                                          
Sbjct LFPGFVDAHSHIGLfeeGVGY----------------------YYSDgneatdpvtphvk   87
DSSP  EEELEEEEEELLLLlllLLLH----------------------HHLLlllllllllllll


DSSP  lhhhHHHHhHHHHHHHHHHLEEEEEEELL---llllhhhhhhhhhhhHHHHhhlllEEEE
Query sedqLFELaLPRVKSLIREGVTTVEIKSG---ygltledelkxlrvaRRLGealpiRVKT  167
ident           |        ||| | |  |                            || 
Sbjct aldgFNPQ-DPAIERALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEEC-----IVKD  141
DSSP  hhhhLLLL-LHHHHHHHLLLEEEEEELLLlllleeeeeeeeelllllHHHH-----EEEE


DSSP  eeeeellllhhhlllhhhhhhhhhhlhhhhhhhlllLLEEEEEELLLL------------
Query tllaahavppeyrddpdswveticqeiipaaaeaglADAVDVFCEHIG------------  215
ident                                                             
Sbjct ------------------------------------PAGLKXAFGENPkrvygerkqtps  165
DSSP  ------------------------------------EEEEEEELLHHHhhhhhhllllll


DSSP  ---lLHHHHHH-----------------------------hhHHHHHL-LLEEEEEElLL
Query ---fSLAQTEQ-----------------------------vyLAADQY-GLAVKGHXdQL  242
ident                                                        |    
Sbjct trxgTAGVIRDyftkvknyxkkkelaqkegkeftetdlkxevGEXVLRkKIPARXHA-HR  224
DSSP  lhhhHHHHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhHHHHHLlLLLEEEEE-LL


DSSP  LLL--LHHHHH--hHLLLlEEEELLLLLHhHHHHHHHHLLEEEELHHhHHHLL---LLLL
Query SNL--GGSTLA--aNFGAlSVDHLEYLDPeGIQALAHRGVVATLLPTaFYFLK---ETKL  295
ident           |    |      |           ||         |    |        |
Sbjct ADDilTAIRIAeefGFNL-VIEHGTEAYK-ISKVLAEKKIPVVVGPL-LTFRTkleLKDL  281
DSSP  HHHhhHHHHHHhhhLLLE-EEEELLLHHH-HHHHHHHHLLLEEELLL-LLLLLlhhHLLL


DSSP  L--LHHHHHHLLLLEEELLLLLlllLLLL-LHHHHHHHHHHhHLLLHHHHHHHLLHHHHH
Query P--PVVALRKAGVPXAVSSDINpgtAPIV-SLRXAXNXACTlFGLTPVEAXAGVTRHAAR  352
ident        | | ||  |   |                  |    |          |   | 
Sbjct TxeTIAKLLKDGVLIALXCDHP---VIPLeFATVQAATAXR-YGAKEEDLLKILTVNPAK  337
DSSP  LllHHHHHHHLLLLEEELLLLL---LLLHhHHHHHHHHHHH-HLLLHHHHHHLLLHHHHH


DSSP  HLLLLLLLLLLLLLLLLLEEEELLllllHHHHLllLLLEEEEEELLEELLL--
Query ALGEQEQLGQLRVGXLADFLVWNCghpaELSYLigVDQLVSRVVNGEETLH--  403
ident  ||     |    |  ||  ||                       | |     
Sbjct ILGLEDRIGSIEPGKDADLVVWSG----HPFDX--KSVVERVYIDGVEVFRre  384
DSSP  HLLLLLLLLLLLLLLLLLEEEELL----LLLLL--LLLEEEEEELLEEEEEll


No 21: Query=2oofA Sbjct=3griA Z-score=23.0

back to top
DSSP  lllLEEEEEEEELlllllllLLLLLlLEEEEEELLEEEEEEEHhhLLLL--LLLEELLLL
Query lncERVWLNVTPAtlrsdlaDYGLLePHALGVHEGRIHALVPXqdLKYP--AHWQDXKGK   58
ident         |              |            |    |             | || 
Sbjct ---XKLIKNGKVL------qNGELQ-QADILIDGKVIKQIAPA--IEPSngVDIIDAKGH   48
DSSP  ---LEEEELLEEE------eLLEEE-ELEEEEELLEEEEEELL--LLLLllLEEEELLLL


DSSP  EEEELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhHHHHH
Query LVTPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedQLFEL  118
ident  | ||  | | ||                                               
Sbjct FVSPGFVDVHVHLREP---------------------------------------GGEYK   69
DSSP  EEEELEEEEEELLLLL---------------------------------------LLLLL


DSSP  H--HHHHHHHHHHLEEEEEEELLLLllhhHHHH---HHHHHHHHHH-HLLLEEEEEEEEE
Query A--LPRVKSLIREGVTTVEIKSGYGltleDELK---XLRVARRLGE-ALPIRVKTTLLAA  172
ident        |   | | |||                         |       ||       
Sbjct EtiETGTKAAARGGFTTVCPXPNTR----PVPDsveHFEALQKLIDdNAQVRVLPYASIT  125
DSSP  LlhHHHHHHHHHLLEEEEEELLLLL----LLLLlhhHHHHHHHHHHhHLLLEELLLEELL


DSSP  -LLLLhhhlllhhhhHHHHhhlHHHHHHhLLLLLEEEEEellLLLL-HHHHHHHHHHHHH
Query -HAVPpeyrddpdswVETIcqeIIPAAAeAGLADAVDVFcehIGFS-LAQTEQVYLAADQ  230
ident                 |       ||      | |        |             |  
Sbjct tRQLG----------KELV---DFPALV-KEGAFAFTDD--gVGVQtASXXYEGXIEAAK  169
DSSP  hHHLL----------LLLL---LHHHHH-LLLLLLEEEL--lLLLLlHHHHHHHHHHHHH


DSSP  LLLEEEEEEL-------------------------llLLLLHHHHHH------HLLLlEE
Query YGLAVKGHXD-------------------------qlSNLGGSTLAA------NFGAlSV  259
ident    |   |                                                   |
Sbjct VNKAIVAHCEdnsliyggaxhegkrskelgipgipniCESVQIARDVllaeaaGCHY-HV  228
DSSP  HLLLEEELLLlhhhllllleellhhhhhhllleellhHHHHHHHHHHhhhhhhLLLE-EE


DSSP  EELLL--LLHHHHHHH-hHHLLEEEELHHHHHH----------------LLLL--LLLL-
Query DHLEY--LDPEGIQAL-aHRGVVATLLPTAFYF----------------LKET--KLPP-  297
ident  |            |      | |   |                                
Sbjct CHVSTkeSVRVIRDAKraGIHVTAEVTPHHLLLteddipgnnaiykxnpPLRSteDREAl  288
DSSP  LLLLLhhHHHHHHHHHhlLLLEEEEELHHHHHLlhhhlllllhhhllllLLLLhhHHHHh


DSSP  HHHHHHlLLLEEELLLLLL-------------LLLLLlLHHHHHHHHHHH----hlLLHH
Query VVALRKaGVPXAVSSDINP-------------GTAPIvSLRXAXNXACTL----fgLTPV  340
ident    |   |       |  |                       |     |        |  
Sbjct LEGLLD-GTIDCIATDHAPhardekaqpxekaPFGIV-GSETAFPLLYTHfvkngdWTLQ  346
DSSP  HHHHHL-LLLLEELLLLLLllhhhhlllllllLLLLL-LLLLHHHHHHHHhlllllLLHH


DSSP  HHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELLLlllhhhhLLLL------------
Query EAXAGVTRHAARALGEqeQLGQLRVGXLADFLVWNCGhpaelsyLIGV------------  388
ident       |             | |     ||                              
Sbjct QLVDYLTIKPCETFNL--EYGTLKENGYADLTIIDLD-----seQEIKgedflskadntp  399
DSSP  HHHHHHLHHHHHHLLL--LLLLLLLLLLLLEEEEELL-----llEELLhhhlllllllll


DSSP  -------lLEEEEEELLEELLL-
Query -------dQLVSRVVNGEETLH-  403
ident               | ||     
Sbjct figykvygNPILTXVEGEVKFEg  422
DSSP  lllleellEEEEEEELLEEEEEl


No 22: Query=2oofA Sbjct=4b3zD Z-score=22.6

back to top
DSSP  lllLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEeHHHL-lLLLLLEELLLLE
Query lncERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVpXQDL-kYPAHWQDXKGKL   59
ident                         |         | |                    |  
Sbjct --dRLLIKGGRIIND------DQSL-YADVYLEDGLIKQIG-ENLIvpGGVKTIEANGRM   50
DSSP  --lEEEEEEEEEELL------LLEE-EEEEEEELLEEEEEE-LLLLllLLLEEEELLLLE


DSSP  EEELEEEEEELLLLLLLlhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHH
Query VTPGLIDCHTHLIFAGSraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLA  119
ident | || ||  | |                                                
Sbjct VIPGGIDVNTYLQKTAA----------------------------------------dDF   70
DSSP  EEELEEEEEELLLLLLL----------------------------------------lLH


DSSP  HHHHHHHHHHLEEEEEEELLLLLLHHhHHHHHHHHHH-HHHHLLLEEEEEEEEEllllhh
Query LPRVKSLIREGVTTVEIKSGYGLTLEdELKXLRVARR-LGEALPIRVKTTLLAAhavppe  178
ident           | |               |                               
Sbjct FQGTRAALVGGTTMIIDHVVPEPGSS-LLTSFEKWHEaADTKSCCDYSLHVDIT------  123
DSSP  HHHHHHHHHLLEEEEEEEELLLLLLL-HHHHHHHHHHhHHLLLLLEEEEEEELL------


DSSP  hlllhhhHHHHHhHLHHHHHHHLLLLLEEEEEELLL---LLLHHHHHHHHHHHHHLLLEE
Query yrddpdsWVETIcQEIIPAAAEAGLADAVDVFCEHI---GFSLAQTEQVYLAADQYGLAV  235
ident        |      |               |          |  |           |   
Sbjct ------sWYDGV-REELEVLVQDKGVNSFQVYMAYKdvyQMSDSQLYEAFTFLKGLGAVI  176
DSSP  ------lLLLLH-HHHHHHHHHLLLLLEEEEELLLLlllLLLHHHHHHHHHHHHHHLLEE


DSSP  EEEEL----------------------------llLLLLHHHHHH------HLLLlEEEE
Query KGHXD----------------------------qlSNLGGSTLAA------NFGAlSVDH  261
ident   |                                        |       |        
Sbjct LVHAEngdliaqeqkrilemgitgpeghalsrpeeLEAEAVFRAItiagriNCPV-YITK  235
DSSP  EEELLlhhhhhhhhhhhhhllllllhhhhhhllhhHHHHHHHHHHhhhhhhLLLE-EEEE


DSSP  LLL--LLHHHHHHH-hHHLLEEEELHHHHHHLL----------------------LLLL-
Query LEY--LDPEGIQAL-aHRGVVATLLPTAFYFLK----------------------ETKL-  295
ident             |      |                                        
Sbjct VMSksAADIIALARkkGPLVFGEPIAASLGTDGthywsknwakaaafvtspplspDPTTp  295
DSSP  ELLhhHHHHHHHHHhhLLLEEEEELHHHHHLLLhhhhlllhhhhhhlllllllllLLLHh


DSSP  -LLHHHHHHlLLLEEELLLLLL----------------LLLLLL--LHHHHHH-HHHHhh
Query -PPVVALRKaGVPXAVSSDINP----------------GTAPIV--SLRXAXN-XACTlf  335
ident       |   |      |   |                                 |    
Sbjct dYLTSLLAC-GDLQVTGSGHCPystaqkavgkdnftliPEGVNGieERMTVVWdKAVAtg  354
DSSP  hHHHHHHHH-LLLLLLLLLLLLllhhhhhhhlllhhhlLLLLLLllLHHHHHHhHHLLll


DSSP  LLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLlllhhhHLLL--------
Query GLTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCGhpaelsYLIG--------  387
ident         |     ||         |   ||  ||   |                     
Sbjct KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPD-----kLKTItakshksa  409
DSSP  LLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEE-----eEEELllllllll


DSSP  -----------llLEEEEEELLEELLL---------------------------------
Query -----------vdQLVSRVVNGEETLH---------------------------------  403
ident                      |                                      
Sbjct veynifegmechgSPLVVISQGKIVFEdgninvnkgmgrfiprkafpehlyqrvkirnkv  469
DSSP  llllllllleeeeEEEEEEELLEEEEElleellllllllllllllllhhhhhhhhhhhhh


DSSP  --------
Query --------  403
ident         
Sbjct fglqgvsr  477
DSSP  llllllll


No 23: Query=2oofA Sbjct=3e74A Z-score=22.3

back to top
DSSP  lLLLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEEhhHLLLllLLEELLLLEE
Query lNCERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVPxqDLKYpaHWQDXKGKLV   60
ident         | |                    |  | | |     ||       |  |  |
Sbjct -SFDLIIKNGTVILE------NEAR-VVDIAVKGGKIAAIGQ--DLGDakEVXDASGLVV   50
DSSP  -LEEEEEELLEEELL------LLEE-ELEEEEELLEEEEEEL--LLLLeeEEEELLLLEE


DSSP  EELEEEEEELLllllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query TPGLIDCHTHLifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident  ||  | |||                                                  
Sbjct SPGXVDAHTHI----------------------------------------------GYE   64
DSSP  EELEEEEEELL----------------------------------------------LHH


DSSP  HHHHHHHHHLEEEEEEELLLLllhHHHH----HHHHHHHHHHHHLLLEEEEEEEEEllll
Query PRVKSLIREGVTTVEIKSGYGltlEDEL----KXLRVARRLGEALPIRVKTTLLAAhavp  176
ident          | ||                               | |             
Sbjct TGTRAAAKGGITTXIEXPLNQ---LPATvdraSIELKFDAAKGKLTIDAAQLGGLV----  117
DSSP  HHHHHHHHLLEEEEEELLLLL---LLLLllhhHHHHHHHHHLLLLLLEEEELEELL----


DSSP  hhhlllhhhhhhHHHHlHHHHHHHlLLLLEEEEEElllLLLHHHHHHHHHHHHHLLLEEE
Query peyrddpdswveTICQeIIPAAAEaGLADAVDVFCehiGFSLAQTEQVYLAADQYGLAVK  236
ident                        |         |         |           |  | 
Sbjct -----------sYNID-RLHELDE-VGVVGFXCFV--rDVNDWQFFKGAQKLGELGQPVL  162
DSSP  -----------lLLLL-LHHHHHH-HLLLLEEEEL--lLLLHHHHHHHHHHHHHHLLLEE


DSSP  EEEL------------------------------lLLLL--LHHHHH--hHLLLlEEEEL
Query GHXD------------------------------qLSNL--GGSTLA--aNFGAlSVDHL  262
ident  |                                           ||         | | 
Sbjct VHCEnalicdelgeeakregrvtahdyvasrpvftEVEAirRVLYLAkvaGCRL-HVCHV  221
DSSP  EELLlhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHhhHHHHHHhhhLLLE-EELLL


DSSP  LL--LLHHHHHHH-hHHLLEEEELHHHHHH----------------LLLLL---llLHHH
Query EY--LDPEGIQAL-aHRGVVATLLPTAFYF----------------LKETK---lpPVVA  300
ident        |   |            |  |                                
Sbjct SSpeGVEEVTRARqeGQDITCESCPHYFVLdtdqfeeigtlakcspPIRDLenqkgXWEK  281
DSSP  LLhhHHHHHHHHHhlLLLEEEEELLHHHHLlhhhhhhhlhhhllllLLLLHhhhhhHHHH


DSSP  HHHlLLLEEELLLLLL--------------LLLLLL-LHHHHHHhhhhhhLLLH-HHHHH
Query LRKaGVPXAVSSDINP--------------GTAPIV-SLRXAXNxactlfGLTP-VEAXA  344
ident |   |      ||  |              |      |    |                 
Sbjct LFN-GEIDCLVSDHSPcppexkagnixkawGGIAGLqSCXDVXFdeavqkRGXSlPXFGK  340
DSSP  HHL-LLLLEELLLLLLllllllllllllllLLLLLHhHHHHHHHhhhlllLLLLhHHHHH


DSSP  HLLHHHHHHLLLlLLLLLLLLLLLLLEEEELL---------------llllhhhhLLLLl
Query GVTRHAARALGEqEQLGQLRVGXLADFLVWNC---------------ghpaelsyLIGVd  389
ident      ||   |   | |    |  |||                             ||  
Sbjct LXATNAADIFGL-QQKGRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrTIGA-  398
DSSP  HHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELllleellhhhlllllllllllllEELL-


DSSP  LEEEEEELLEELLL-----------------
Query QLVSRVVNGEETLH-----------------  403
ident         |                      
Sbjct RITKTILRGDVIYDieqgfpvapkgqfilkh  429
DSSP  EEEEEEELLEEEEElllllllllllleelll


No 24: Query=2oofA Sbjct=2imrA Z-score=22.3

back to top
DSSP  lllLEEEeEEEELLLLllllLLLLLlleEEEEELLEEEEE---eEHHHLllllLLEElLL
Query lncERVWlNVTPATLRsdlaDYGLLephALGVHEGRIHAL---vPXQDLkypaHWQDxKG   57
ident                                |      |              |      
Sbjct --hTPRL-LTCDVLYT----GAQSP--gGVVVVGETVAAAghpdELRRQ--ypHAAE-ER   48
DSSP  --lLEEE-EEELEEEL----LEELL--eEEEEELLEEEEEelhhHHHHH--llLLEE-EE


DSSP  LE--EEELEEEEEELLLLLLllhhhhhhhhhlllhhhhhhlllLHHH-------hhhhhh
Query KL--VTPGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkggGIIS-------tvratr  108
ident       |     ||||                                            
Sbjct AGavIAPPPVNAHTHLDMSA-----------------------YEFQalpyfqwipevvi   85
DSSP  LLleELLLLLEEEEELLLLH-----------------------HHHHhlhhhhllhhhhh


DSSP  hllhhhHHHHHHHHHHHHHHHLEEEEEEELLllllhhhHHHHHHHHHHHhhhLLLEEEEE
Query aasedqLFELALPRVKSLIREGVTTVEIKSGygltledELKXLRVARRLgeaLPIRVKTT  168
ident           |      | | |   |                                  
Sbjct rgrhlrGVAAAQAGADTLTRLGAGGVGDIVW-------APEVMDALLAR---EDLSGTLY  135
DSSP  hhllllHHHHHHHHHHHHHHLLLLLEEEEEL-------LHHHHHHHHLL---LLLLEEEE


DSSP  EEeELLLlhhhLLLHHHHHHHHHhLHHHHHHHLL---lLLEEEEEELLlLLLHHHHHHHH
Query LLaAHAVppeyRDDPDSWVETICqEIIPAAAEAG---lADAVDVFCEHiGFSLAQTEQVY  225
ident             |  |                                   |        
Sbjct FE-VLNP---fPDKADEVFAAAR-THLERWRRLErpglRLGLSPHTPF-TVSHRLMRLLS  189
DSSP  EE-ELLL---lHHHHHHHHHHHH-HHHHHHHLLLllleEEEEEELLLL-LLLHHHHHHHH


DSSP  HHHHHLLLEEEEEELLLL------------------------------------llLHHH
Query LAADQYGLAVKGHXDQLS------------------------------------nlGGST  249
ident   |   ||    |                                               
Sbjct DYAAGEGLPLQIHVAEHPtelemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVR  249
DSSP  HHHHHHLLLLEEEELLLHhhhhhhhhlllllhhhllhhhllllhhhhhllllllllLHHH


DSSP  HH-----HHLLLlEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHL
Query LA-----ANFGAlSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKA  304
ident                 |     |  |   |  |      |     |         |   |
Sbjct YLdelgvLAARP-TLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLEC-GTFDWPAFAAA  307
DSSP  HHhhhllHHHLL-EEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLL-LLLLHHHHHHL


DSSP  LLLEEELLLLLLlLLLLLLHHHHHHHHHHHHL-LLHHHHHHHLLHHHHHHLLllllLLLL
Query GVPXAVSSDINPgTAPIVSLRXAXNXACTLFG-LTPVEAXAGVTRHAARALGeqeqLGQL  363
ident ||  |   |           |     |  |   | |            |  |       |
Sbjct GVEVALGTDSVA-SGETLNVREEVTFARQLYPgLDPRVLVRAAVKGGQRVVG----TPFL  362
DSSP  LLLEEELLLLHH-HHLLLLLHHHHHHHHHHLLlLLHHHHHHHHHHHHHHHHL----LLLL


DSSP  LLLLLL-lEEEELLllllhhhhlllLLLEeeeeelleelll
Query RVGXLA-dFLVWNCghpaelsyligVDQLvsrvvngeetlh  403
ident | |        |                |            
Sbjct RRGETWqeGFRWEL-----------SRDL------------  380
DSSP  LLLLLLlhHHLHHH-----------LLLL------------


No 25: Query=2oofA Sbjct=1a4mA Z-score=19.6

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct --------------------------------------------------------tpaf    4
DSSP  --------------------------------------------------------llll


DSSP  EELEEEEEELLL----------------------llllLHHHHhhhhhlllhhhhhhllL
Query TPGLIDCHTHLI----------------------fagsRAEEFelrqkgvpyaeiarkgG   98
ident        | ||                                                 
Sbjct NKPKVELHVHLDgaikpetilyfgkkrgialpadtveeLRNII----gmdkplslpgflA   60
DSSP  LLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhHHHHH----lllllllhhhhhL


DSSP  LHHHHHHHHHhLLHHHHHHHHHHHHHHHHHHLEEEEEEELLLLL---------------l
Query GIISTVRATRaASEDQLFELALPRVKSLIREGVTTVEIKSGYGL---------------t  143
ident                     |   |     |||  ||      |                
Sbjct KFDYYMPVIA-GCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqteg  119
DSSP  LHHHHHHHHL-LLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhllll


DSSP  hhHHHHHHHHHHHHHHHL----LLEEEEEEEeELLLlhhhlllhhhHHHHHHhLHHHHHH
Query leDELKXLRVARRLGEAL----PIRVKTTLLaAHAVppeyrddpdsWVETICqEIIPAAA  199
ident                        | |   |                       |      
Sbjct dvTPDDVVDLVNQGLQEGeqafGIKVRSILC-CMRH----------QPSWSL-EVLELCK  167
DSSP  llLHHHHHHHHHHHHHHHhhhhLLEEEEEEE-EELL----------LHHHHH-HHHHHHH


DSSP  HLLL--LLEEEEE-eLLLLlLHHH--HHHHHHHHHHLLLEEEEEELLLLLLLHHHHHHH-
Query EAGL--ADAVDVF-cEHIGfSLAQ--TEQVYLAADQYGLAVKGHXDQLSNLGGSTLAAN-  253
ident         | |    | |  |         |  |   |     |            |   
Sbjct KYNQktVVAMDLAgdETIEgSSLFpgHVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDi  227
DSSP  HLLLllEEEEEEEllLLLLlHHHLhhHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHHl


DSSP  LLLLEEEELLLLL--HHHHHHHHHHLLEEEELHHHHHHLLLLL---LLLHHHHHHLLLLE
Query FGALSVDHLEYLD--PEGIQALAHRGVVATLLPTAFYFLKETK---LPPVVALRKAGVPX  308
ident      | |             |          |   |            ||         
Sbjct LKTERVGHGYHTIedEALYNRLLKENMHFEVCPWSSYLTGAWDpktTHAVVRFKNDKANY  287
DSSP  LLLLEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHHHLLLLLlllLLHHHHHHHLLLLE


DSSP  EELLLLLLlLLLLlLHHHHHHHHHHHHLLLHHHHHHHlLHHHHHHLLL----LLLLL--L
Query AVSSDINPgTAPIvSLRXAXNXACTLFGLTPVEAXAGvTRHAARALGE----QEQLG--Q  362
ident     |          |           | |  |        ||            |    
Sbjct SLNTDDPL-IFKS-TLDTDYQMTKKDMGFTEEEFKRL-NINAAKSSFLpeeeKKELLerL  344
DSSP  EELLLLLL-LLLL-LHHHHHHHHHHLLLLLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhH


DSSP  LLLllllleeeellllllhhhhlllllleeeeeelleelll
Query LRVgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
ident  |                                       
Sbjct YRE------------------------------------yq  349
DSSP  HHH------------------------------------ll


No 26: Query=2oofA Sbjct=2y1hB Z-score=19.2

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  EELEEEEEELLLLLLllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhHHHHHH
Query TPGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkgggiistvratraasedqLFELAL  120
ident   || ||| ||                                                 
Sbjct GVGLVDCHCHLSAPD---------------------------------------FDRDLD   21
DSSP  LLLEEEEEELLLLHH---------------------------------------HLLLHH


DSSP  HHHHHHHHHLEEEEEEELLLLllhhHHHHHHHHHHHHHHhllLEEEEEEEEELLLLHHHL
Query PRVKSLIREGVTTVEIKSGYGltleDELKXLRVARRLGEalpIRVKTTLLAAHAVPPEYR  180
ident           |               |                 |   |          |
Sbjct DVLEKAKKANVVALVAVAEHS----GEFEKIMQLSERYN---GFVLPCLGVHPVQGLDQR   74
DSSP  HHHHHHHHLLEEEEEELLLLH----HHHHHHHHHHHHLL---LLEEEEELLLLEELLLLE


DSSP  llHHHHHHHHHhLHHHHHHhlLLLLEE-EEEELLL----------llLHHHHHHHHHHHH
Query ddPDSWVETICqEIIPAAAeaGLADAV-DVFCEHI----------gfSLAQTEQVYLAAD  229
ident              ||          |   |                            | 
Sbjct svTLKDLDVAL-PIIENYK--DRLLAIgEVGLDFSprfagtgeqkeeQRQVLIRQIQLAK  131
DSSP  elLHHHHHHHH-HHHHHHL--LLLLEEeEEEEELLllllllhhhhhhHHHHHHHHHHHHH


DSSP  HLLLEEEEEElLLLLLLHHHHHH--HLLLLEEEELLLLLHhHHHHHHHHLLEEEELhHHH
Query QYGLAVKGHXdQLSNLGGSTLAA--NFGALSVDHLEYLDPeGIQALAHRGVVATLLpTAF  287
ident    | |  |           |                            |          
Sbjct RLNLPVNVHS-RSAGRPTINLLQeqGAEKVLLHAFDGRPS-VAMEGVRAGYFFSIP-PSI  188
DSSP  HHLLLEEEEE-ELLHHHHHHHHHhlLLLLEEEELLLLLHH-HHHHHHHLLLEEEEL-HHH


DSSP  HhlLLLL-LLLHHHHHhllLLEEELLLLlLLLL------LLLL-HHHHHHHHHHhHLLL-
Query YflKETK-LPPVVALRkagVPXAVSSDInPGTA------PIVS-LRXAXNXACTlFGLT-  338
ident            |  |           |  |                              
Sbjct I--RSGQkQKLVKQLP--lTSICLETDS-PALGpekqvrNEPWnISISAEYIAQ-VKGIs  242
DSSP  H--LLHHhHHHHHHLL--hHHEEELLLL-LLLLllllllLLHHhHHHHHHHHHH-HHLLl


DSSP  -HHHHHHHlLHHHHHHLL-LLLLllllllllllleeeellllllhhhhlllllleeeeee
Query -PVEAXAGvTRHAARALG-EQEQlgqlrvgxladflvwncghpaelsyligvdqlvsrvv  396
ident          |  |                                               
Sbjct vEEVIEVT-TQNALKLFPkLRHL-------------------------------------  264
DSSP  hHHHHHHH-HHHHHHHLLlHHHH-------------------------------------


DSSP  lleelll
Query ngeetlh  403
ident        
Sbjct ------l  265
DSSP  ------l


No 27: Query=2oofA Sbjct=1a5kC Z-score=18.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  --lLLLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEEH------HHLL----l
Query --lNCERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVPX------QDLK----y   48
ident        |  |             |       ||  ||| |                   
Sbjct aadCVDLVLTNALIVDH------WGIV-KADIGVKDGRIFAIGKAgnpdiqPNVTipiga  113
DSSP  hhhLLLEEEEEEEEEEL------LEEE-EEEEEEELLEEEEEELEelllllLLLLeelll


DSSP  llLLEELLLLEEEELEEEEEELLLlllllhhhhhhhhhlllhhhhhhllllhhhhhhhhh
Query paHWQDXKGKLVTPGLIDCHTHLIfagsraeefelrqkgvpyaeiarkgggiistvratr  108
ident         || || | || | | |                                    
Sbjct atEVIAAEGKIVTAGGIDTHIHWI------------------------------------  137
DSSP  llEEEELLLLEEEELEEEEEEELL------------------------------------


DSSP  hllhhhhhhhHHHHHHHHHHHLEEEEEE------------ELLLlllhhhHHHHHHHHHH
Query aasedqlfelALPRVKSLIREGVTTVEI------------KSGYgltledELKXLRVARR  156
ident                      ||||                                   
Sbjct ----------CPQQAEEALVSGVTTMVGggtgpaagthatTCTP------GPWYISRMLQ  181
DSSP  ----------LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL------HHHHHHHHHH


DSSP  HHHHLLLEEEEEEEEEllllhhhlllhhhhHHHHhhLHHHHHHhLLLLLEEEEEElllLL
Query LGEALPIRVKTTLLAAhavppeyrddpdswVETIcqEIIPAAAeAGLADAVDVFCehiGF  216
ident     ||                        |             |             | 
Sbjct AADSLPVNIGLLGKGN--------------VSQP--DALREQV-AAGVIGLEIHE-dwGA  223
DSSP  HHLLLLLEEEEEEELL--------------LLLH--HHHHHHH-HHLLLEEEEEH-hhLL


DSSP  LHHHHHHHHHHHHHLLLEEEEEE----lllLLLLHHHHHHHLLLlEEEELL--------L
Query SLAQTEQVYLAADQYGLAVKGHX----dqlSNLGGSTLAANFGAlSVDHLE--------Y  264
ident   |        ||     |  |                          | |         
Sbjct TPAAIDCALTVADEMDIQVALHSdtlnesgFVEDTLAAIGGRTI-HTFHTEgaggghapD  282
DSSP  LHHHHHHHHHHHHHHLLEEEEELlllllllLHHHHHHHHLLLLE-EELLLLllllllllL


DSSP  LLHhHHHHhhhHLLEEEELHHH-------------------------------hhhLLLL
Query LDPeGIQAlahRGVVATLLPTA-------------------------------fyfLKET  293
ident                                                             
Sbjct IIT-ACAH---PNILPSSTNPTlpytlntidehldmlmvchhldpdiaedvafaesRIRR  338
DSSP  HHH-HHHL---LLEEEEEEHHHllllllhhhhhhhhhhhhhllllllhhhhhllllLLLH


DSSP  LL--lLHHHHHHlLLLEEELLLLLLllLLLL-LHHHHHHHHHHH---------------h
Query KL--pPVVALRKaGVPXAVSSDINPgtAPIV-SLRXAXNXACTL---------------f  335
ident        |     |     |||        |                             
Sbjct ETiaaEDVLHDL-GAFSLTSSDSQA--MGRVgEVILRTWQVAHRmkvqrgalaeetgdnd  395
DSSP  HHhhhHHHHHHL-LLLLEEELLLLL--LLLLlLHHHHHHHHHHHhhhhhlllllllllll


DSSP  llLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLLLlhhhhllllLLEEEEE
Query glTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCGHPaelsyligvDQLVSRV  395
ident         |  |   |   |     |   || |||  ||                     
Sbjct nfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFF--------gVKPATVI  447
DSSP  hhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHHL--------lLLLLEEE


DSSP  ELLEELLL----------------------------------------------------
Query VNGEETLH----------------------------------------------------  403
ident   |                                                         
Sbjct KGGMIAIApmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlr  507
DSSP  ELLEEEEEeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllll


DSSP  -----------------------------------------------------------
Query -----------------------------------------------------------  403
ident                                                            
Sbjct saiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  leeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 28: Query=2oofA Sbjct=3k2gB Z-score=17.1

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct -----------------------------------slselspchvrsgrixtvdgpipss   25
DSSP  -----------------------------------llllllllllllleeeelleeeehh


DSSP  eeLEEEEEELLLLLLL------------------------------LHHHHhhhhhlllh
Query tpGLIDCHTHLIFAGS------------------------------RAEEFelrqkgvpy   90
ident   |    | ||                                                 
Sbjct alGHTLXHEHLQNDCRcwwnppqeperqylaeapisieilselrqdPFVNK---------   76
DSSP  hlLLEELLLLLLEELHhhllllllhhhhhhhhllllhhhhhhhhllHHHLL---------


DSSP  hhhhhllllhhhhhhhhhhllhhHHHHHHHHHHHHHHHHLEEEEEEELLLLllhhhhhhH
Query aeiarkgggiistvratraasedQLFELALPRVKSLIREGVTTVEIKSGYGltledelkX  150
ident                            ||   ||     |          |         
Sbjct ------------------hnialDDLDLAIAEVKQFAAVGGRSIVDPTCRG-----igrD  113
DSSP  ------------------llleeLLHHHHHHHHHHHHHLLLLEEEELLLLL-----lllL


DSSP  HHHHHHHHHHLLLEEEEEEeEELL---LLHHHlllHHHHHHHHHHlHHHHHHHLL-----
Query LRVARRLGEALPIRVKTTLlAAHA---VPPEYrddPDSWVETICQeIIPAAAEAG-----  202
ident     ||        |             |             |    | | |  |     
Sbjct PVKLRRISAETGVQVVXGA-GYYLassXPETA---ARLSADDIAD-EIVAEALEGtdgtd  168
DSSP  HHHHHHHHHHHLLEEEELL-LLLLhhhLLHHH---HLLLHHHHHH-HHHHHHHLLlllll


DSSP  -LLLEEE-EEELLLL--lLHHHHHHHHHHHHHLLLEEEEEELLLLLLlhHHHHHH-----
Query -LADAVD-VFCEHIG--fSLAQTEQVYLAADQYGLAVKGHXDQLSNLggSTLAAN-----  253
ident                             |    ||    |      |             
Sbjct aRIGLIGeIGVSSDFtaeEEKSLRGAARAQVRTGLPLXVHLPGWFRL--AHRVLDlveee  226
DSSP  lLLLLEEeELLLLLLlhhHHHHHHHHHHHHHHHLLLEEELLLLLLLL--HHHHHHhhhhl


DSSP  ---LLLLEEEELLLL--LHHHHHHHHHHLLEEEE-LHHHhHHLL----LLLL------lL
Query ---FGALSVDHLEYL--DPEGIQALAHRGVVATL-LPTAfYFLK----ETKL------pP  297
ident           |      ||     || ||            |                  
Sbjct gadLRHTVLCHXNPShxDPVYQATLAQRGAFLEFdXIGX-DFFYadqgVQCPsddevarA  285
DSSP  lllHHHEEELLLHHHllLHHHHHHHHHHLLEEEElLLLL-LLEEllllEELLlhhhhhhH


DSSP  HHHHHHLLL--LEEELLLLLLL-----llLLLLhHHHHHHHHHHHL---LLHHHHHHHLL
Query VVALRKAGV--PXAVSSDINPG-----taPIVSlRXAXNXACTLFG---LTPVEAXAGVT  347
ident    |   |       | |                               |          
Sbjct ILGLADHGYldRILLSHDVFVKxxltrygGNGY-AFVTKHFLPRLRrhgLDDAALETLXV  344
DSSP  HHHHHHLLLhhHEEELLLLLLHhhlhhhlLLLL-LHHHHLHHHHHHhllLLHHHHHHHHL


DSSP  HHHHHhLLLLLLllllllllllleeeellllllhhhhlllllleeeeeelleelll
Query RHAARaLGEQEQlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
ident     |                                                   
Sbjct TNPRR-VFDASI-----------------------------------------egh  358
DSSP  HHHHH-HHLLLL-----------------------------------------lll


No 29: Query=2oofA Sbjct=1bf6A Z-score=17.0

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ---------------------------------------------------------sfd    3
DSSP  ---------------------------------------------------------lll


DSSP  eELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhHHHH--hhhllhhHHHHH
Query tPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiisTVRA--traasedQLFEL  118
ident   |    | ||                                                 
Sbjct pTGYTLAHEHLHI-----------------------------DLSGfknnvdcrlDQYAF   34
DSSP  lLLEEEEEELLLE-----------------------------ELHHhhllhhheeLLHHH


DSSP  HHHHHHHHHHHLEEEEEEELLLLLlhhhhhhHHHHHHHHHHHLLLEEEEEEeEELL---L
Query ALPRVKSLIREGVTTVEIKSGYGLtledelkXLRVARRLGEALPIRVKTTLlAAHA---V  175
ident        |   ||  |                            | |             
Sbjct ICQEMNDLMTRGVRNVIEMTNRYM-----grNAQFMLDVMRETGINVVACT-GYYQdafF   88
DSSP  HHHHHHHHHHLLEEEEEELLLHHH-----llLHHHHHHHHHHHLLEEEEEE-LLLLhhhL


DSSP  LHHHlllHHHHHHHHHHlHHHHHHHLL------LLLEEE-EEELL---llLLHHHHHHHH
Query PPEYrddPDSWVETICQeIIPAAAEAG------LADAVD-VFCEH---igFSLAQTEQVY  225
ident |          |    |       | |       |                         
Sbjct PEHV---ATRSVQELAQ-EMVDEIEQGidgtelKAGIIAeIGTSEgkitpLEEKVFIAAA  144
DSSP  LLHH---HHLLHHHHHH-HHHHHHHLLllllllLEEEEEeEELLLllllhHHHHHHHHHH


DSSP  HHHHHLLLEEEEEELLLLL-lLHHHHH----hHLLLLEEEELL-llLHHHHHHHHHHLLE
Query LAADQYGLAVKGHXDQLSN-lGGSTLA----aNFGALSVDHLE-ylDPEGIQALAHRGVV  279
ident ||  | |     |            |            | |         |      |  
Sbjct LAHNQTGRPISTHTSFSTMglEQLALLqahgvDLSRVTVGHCDlkdNLDNILKMIDLGAY  204
DSSP  HHHHHHLLLEEEELHHHLLhhHHHHHHhhlllLHHHEEELLLLlllLHHHHHHHHHLLLE


DSSP  EEE-LHHHhHHLLLLLLL--LHHHHH-HLLL-LEEELLLLLL-----lllLLLLhHHHH-
Query ATL-LPTAfYFLKETKLP--PVVALR-KAGV-PXAVSSDINP-----gtaPIVSlRXAX-  328
ident                        |||          | ||                    
Sbjct VQFdTIGK-NSYYPDEKRiaMLHALRdRGLLnRVMLSMDITRrshlkangGYGY-DYLLt  262
DSSP  EEElLLLL-LLLLLHHHHhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhlLLLL-LHHHh


DSSP  HHHHHH--hLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhll
Query NXACTL--fGLTPVEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsyli  386
ident      |   |                                                  
Sbjct TFIPQLrqsGFSQADVDVMLRENPSQFFQ-------------------------------  291
DSSP  LHHHHHhhlLLLHHHHHHHHLHHHHHHLL-------------------------------


DSSP  lllleeeeeelleelll
Query gvdqlvsrvvngeetlh  403
ident                  
Sbjct -----------------  291
DSSP  -----------------


No 30: Query=2oofA Sbjct=2ob3A Z-score=16.8

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct -----------------------------------------------drintvrgpitis   13
DSSP  -----------------------------------------------lleeelleeelhh


DSSP  eeLEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhHHHHHHHLL-----HHHH
Query tpGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiisTVRATRAAS-----EDQL  115
ident   |    | |                                     ||          |
Sbjct eaGFTLTHEHICGS----------------------------SAGFLRAWPeffgsRKAL   45
DSSP  hhLLEEEEELLEEL----------------------------LLLHHHHLHhhhllHHHH


DSSP  HHHHHHHHHHHHHHLEEEEEEELLLLllhhhhhhHHHHHHHHHHHLLLEEEEEEEeELLL
Query FELALPRVKSLIREGVTTVEIKSGYGltledelkXLRVARRLGEALPIRVKTTLLaAHAV  175
ident  | |          || |    |                     |               
Sbjct AEKAVRGLRRARAAGVRTIVDVSTFD-----igrDVSLLAEVSRAADVHIVAATG-LWFD   99
DSSP  HHHHHHHHHHHHHLLLLEEEELLLHH-----hllLHHHHHHHHHHHLLEEELEEE-LLLL


DSSP  LHHHlllHHHHHHHHHhLHHHHHHHLL------LLLEEEEEELLLL--lLHHHHHHHHHH
Query PPEYrddPDSWVETICqEIIPAAAEAG------LADAVDVFCEHIG--fSLAQTEQVYLA  227
ident ||         ||             |       |    |                   |
Sbjct PPLS--mRLRSVEELT-QFFLREIQYGiedtgiRAGIIXVATTGKAtpfQELVLKAAARA  156
DSSP  LLHH--hHLLLHHHHH-HHHHHHHHLLllllllLLLEEEEELLLLLlhhHHHHHHHHHHH


DSSP  HHHLLLEEEEEELLllLLLHHHHHHH--------LLLLEEEEL-LLLLHHHHHHHHHHLL
Query ADQYGLAVKGHXDQlsNLGGSTLAAN--------FGALSVDHL-EYLDPEGIQALAHRGV  278
ident     |  |  |             |                |     |     ||| || 
Sbjct SLATGVPVTTHTAA--SQRDGEQQAAifeseglsPSRVCIGHSdDTDDLSYLTALAARGY  214
DSSP  HHHHLLLEEEELLH--HHLHHHHHHHhhhhllllHHHEEELLHhHLLLHHHHHHHHHLLL


DSSP  EEEEL-HHHH------------hHLLLL---llLLHHHHHHLLL--LEEELLLLL-----
Query VATLL-PTAF------------yFLKET---klPPVVALRKAGV--PXAVSSDIN-----  315
ident    |                                 ||   |      || |       
Sbjct LIGLDhIPYSaiglednasasalLGIRSwqtraLLIKALIDQGYmkQILVSNDWTfgfss  274
DSSP  EEEELlLLLLlllllllhhhhhhHLLLLhhhhhHHHHHHHHLLLhhHEEELLLLLleell


DSSP  ---------lllllLLLHhHHHHHHHHHH---lLLHHHHHHHLLHHHHHHLLllllllll
Query ---------pgtapIVSLrXAXNXACTLF---gLTPVEAXAGVTRHAARALGeqeqlgql  363
ident                                                || |         
Sbjct yvtnimdvmdrvnpDGMA-FIPLRVIPFLrekgVPQETLAGITVTNPARFLS--------  325
DSSP  llllhhhhhhhhllLHHH-HHHHLHHHHHhhllLLHHHHHHHHLHHHHHHHL--------


DSSP  llllllleeeellllllhhhhlllllleeeeeelleelll
Query rvgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
ident                                         
Sbjct ------------------------------------ptlr  329
DSSP  ------------------------------------llll


No 31: Query=2oofA Sbjct=2vc5A Z-score=16.2

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ----------------------------------------------mriplvgkdsiesk   14
DSSP  ----------------------------------------------llllllllllllhh


DSSP  eeLEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhHHHH----hhHLLHHHHH
Query tpGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiisTVRA----trAASEDQLF  116
ident   |    | ||                                            ||  |
Sbjct diGFTLIHEHLRVF----------------------------SEAVrqqwphLYNEDEEF   46
DSSP  hlLLEELLLLLLLL----------------------------LHHHhhhlhhHLLHHHHH


DSSP  HHHHHHHHHHHHHLEEEEEEELLLLllhhhhhhHHHHHHHHHHHLLLEEEEEEeEELL--
Query ELALPRVKSLIREGVTTVEIKSGYGltledelkXLRVARRLGEALPIRVKTTLlAAHA--  174
ident   |   ||     || |       |          |       |  |             
Sbjct RNAVNEVKRAMQFGVKTIVDPTVMG-----lgrDIRFMEKVVKATGINLVAGT-GIYIyi  100
DSSP  HHHHHHHHHHHHLLLLEEEELLLLL-----lllLHHHHHHHHHLLLLEEEELE-ELLLll


DSSP  LLHHHLlLHHHhhHHHHHlHHHHHHHLL------LLLEEEEEELLL---llLHHHHHHHH
Query VPPEYRdDPDSwvETICQeIIPAAAEAG------LADAVDVFCEHI---gfSLAQTEQVY  225
ident   | |     |    |           |       |  |                     
Sbjct DLPFYF-LNRS-iDEIAD-LFIHDIKEGiqgtlnKAGFVXIAADEPgitkdVEKVIRAAA  157
DSSP  LLLHHH-LLLL-hHHHHH-HHHHHHHLLllllllLLLLEEEELLLLlllhhHHHHHHHHH


DSSP  HHHHHLLLEEEEEELLllLLLHHHHHHHL--------LLLEEEEL-LLLLHHHHHHHHHH
Query LAADQYGLAVKGHXDQlsNLGGSTLAANF--------GALSVDHL-EYLDPEGIQALAHR  276
ident  |          |                        |     ||        |   |  
Sbjct IANKETKVPIITHSNA--HNNTGLEQQRIlteegvdpGKILIGHLgDTDNIDYIKKIADK  215
DSSP  HHHHHHLLLEEEELLL--LLLHHHHHHHHhhhllllhHHEEELLHhHLLLHHHHHHHHHL


DSSP  LLEEEE-LHHHhhHLLL--LLLL-LHHHHHHLLL--LEEELLLLL---------------
Query GVVATL-LPTAfyFLKE--TKLP-PVVALRKAGV--PXAVSSDIN---------------  315
ident |    |        |     |       | | |       | |                 
Sbjct GSFIGLdRYGL--DLFLpvDKRNeTTLRLIKDGYsdKIMISHDYCctidwgtakpeykpk  273
DSSP  LLEEEElLLLL--LLLLlhHHHHhHHHHHHHLLLllLEEELLLLLlllllllllhhhhhh


DSSP  llllLLLLhhHHHHHHHHHHL---LLHHHHHHHLLHHHHHHLLlllllllllllllllee
Query pgtaPIVSlrXAXNXACTLFG---LTPVEAXAGVTRHAARALGeqeqlgqlrvgxladfl  372
ident                                                             
Sbjct laprWSIT--LIFEDTIPFLKrngVNEEVIATIFKENPKKFFS-----------------  314
DSSP  hlllLLLL--HHHHLHHHHHHlllLLHHHHHHHHLHHHHHHLL-----------------


DSSP  eellllllhhhhlllllleeeeeelleelll
Query vwncghpaelsyligvdqlvsrvvngeetlh  403
ident                                
Sbjct -------------------------------  314
DSSP  -------------------------------


No 32: Query=2oofA Sbjct=1v77A Z-score=16.0

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhhhh
Query tPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfelal  120
ident     |                                                       
Sbjct -VKFIEMDIRDKE---------------------------------------------ay   14
DSSP  -LLLEEEEELLHH---------------------------------------------hh


DSSP  HHHHHHhhhlEEEEEEELL--lllLHHHHHHHHHHHhhhhhhllleEEEEeeeellllhh
Query PRVKSLiregVTTVEIKSG--yglTLEDELKXLRVArrlgealpirVKTTllaahavppe  178
ident    |         |            |                    |            
Sbjct ELAKEW----FDEVVVSIKfneevDKEKLREARKEY----------GKVA----------   50
DSSP  HHHHHH----LLEEEEEEEellllLHHHHHHHHHHH----------LLEE----------


DSSP  hlllhhhhhhhhhhlhhhhhhhllllleEEEEEllllLLHHHHHHHHHHHHhlLLEEEEE
Query yrddpdswveticqeiipaaaeagladaVDVFCehigFSLAQTEQVYLAADqyGLAVKGH  238
ident                                                             
Sbjct ----------------------------ILLSN----PKPSLVRDTVQKFK--SYLIYVE   76
DSSP  ----------------------------EEEEL----LLHHHHHHHHHHLL--LLEEEEE


DSSP  ElllLLLLHHHHHHHLLLLEEEELL------LLLHHHHHHHHHHLLEEEELhHHHHHLL-
Query XdqlSNLGGSTLAANFGALSVDHLE------YLDPEGIQALAHRGVVATLLpTAFYFLK-  291
ident       |         |                |           |              
Sbjct S---NDLRVIRYSIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYSn  132
DSSP  L---LLHHHHHHHHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHLl


DSSP  ------LLLLL--LHHHHHHLLLLEEELLLLLLlllLLLL-HHHHHHHHHHhHLLLHHHH
Query ------ETKLP--PVVALRKAGVPXAVSSDINPgtaPIVS-LRXAXNXACTlFGLTPVEA  342
ident                    |  |     |         |   |          |     |
Sbjct pyeranLLRFMmkAWKLVEKYKVRRFLTSSAQE--kWDVRyPRDLISLGVV-IGMEIPQA  189
DSSP  hhhhhhHHHHHhhHHHHHHHHLLLEEEELLLLL--hHHLLlHHHHHHHHHH-LLLLHHHH


DSSP  HHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlllllleeeeeelleell
Query XAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngeetl  402
ident  |         |                                                
Sbjct KASISMYPEIILK-----------------------------------------------  202
DSSP  HHLLLHHHHHHHL-----------------------------------------------


DSSP  l
Query h  403
ident  
Sbjct -  202
DSSP  -


No 33: Query=2oofA Sbjct=3cjpA Z-score=16.0

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query tpGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident     || ||| |                                                
Sbjct --LIIDGHTHVIL--------------------------------------------PVE   14
DSSP  --LLEEEEEELLL--------------------------------------------LHH


DSSP  HHHHHHHHHLEEEEEEELLL------------------------------llLHHHHHHH
Query PRVKSLIREGVTTVEIKSGY------------------------------glTLEDELKX  150
ident    |     ||      |                                        | 
Sbjct KHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkklndvvngktnsmidVRRNSIKE   74
DSSP  HHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhlllllllhhHHHHHHHH


DSSP  HHHHHHHHHhllLEEEEEEEEEllllhhhlllhHHHHHHHHhLHHHHH-HHLLlLLEEE-
Query LRVARRLGEalpIRVKTTLLAAhavppeyrddpDSWVETICqEIIPAA-AEAGlADAVD-  208
ident |            |                              |               
Sbjct LTNVIQAYP---SRYVGFGNVP----------vGLSENDTN-SYIEENiVNNK-LVGIGe  119
DSSP  HHHHHHHLL---LLEEEEELLL----------lLLLHHHHH-HHHHHHlLLLL-LLEEEe


DSSP  EEELLLllLHHHHHHHHHHHHHLL-LEEEEEElLLLLL-----LHHHHH--hHLLLLEEE
Query VFCEHIgfSLAQTEQVYLAADQYG-LAVKGHXdQLSNL-----GGSTLA--aNFGALSVD  260
ident                        | |    |                |            
Sbjct LTPASG--QIKSLKPIFKYSMDSGsLPIWIHA-FNPLVlqdikEIAELCkafPKVPVILG  176
DSSP  ELLLLL--LHHHHHHHHHHHHHLLlLLEEELL-LLLLLhhhhhHHHHHHhhlLLLLEEEH


DSSP  E-LLLLLHHHHHHHHHHL-LEEEELhhHHHHlllllllLHHHHHHLL-lLEEELLLLLll
Query H-LEYLDPEGIQALAHRG-VVATLLptAFYFlketklpPVVALRKAG-vPXAVSSDINpg  317
ident |                          |                           |    
Sbjct HmGGSNWMTAVELAKEIQnLYLDTS--AYFS-----tfVLKIVINELplKCIFGTDMP--  227
DSSP  HhHHHHHHHHHHHHHHLLlEEEELL--LLLL-----hhHHHHHHHHLllLEELLLLLL--


DSSP  llLLLLhHHHHHHHHhhHLLL-HHHHHHHLLHHHHHhLLLLllllllllllllleeeell
Query taPIVSlRXAXNXACtlFGLT-PVEAXAGVTRHAARaLGEQeqlgqlrvgxladflvwnc  376
ident                          | |       | |                      
Sbjct --FGDL-QLSIEAIK--KMSNdSYVANAVLGDNISR-LLNI-------------------  262
DSSP  --LLLH-HHHHHHHH--HHLLlHHHHHHHHLHHHHH-HHLL-------------------


DSSP  llllhhhhlllllleeeeeelleelll
Query ghpaelsyligvdqlvsrvvngeetlh  403
ident                            
Sbjct ---------------------------  262
DSSP  ---------------------------


No 34: Query=2oofA Sbjct=2ffiA Z-score=15.8

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct -----------------------------------------------------------l    1
DSSP  -----------------------------------------------------------l


DSSP  eELEEEEEELlLLLLLlhhhhhhhhhlllhhhhhhllllhHHHHHHhhhllhhhhhhHHH
Query tPGLIDCHTHlIFAGSraeefelrqkgvpyaeiarkgggiISTVRAtraasedqlfeLAL  120
ident     || | |  |                                               
Sbjct hLTAIDSHAH-VFSRG-----------------lnlasqrRYAPNY---------daPLG   34
DSSP  lLLLEELLLL-LLLHH-----------------hhhhlllLLLLLL---------llLHH


DSSP  HHHHHHHHHLEEEEEEELL-LLLLhhhHHHHHHHHHHHHHhllLEEEEEEEEellllhhh
Query PRVKSLIREGVTTVEIKSG-YGLTledELKXLRVARRLGEalpIRVKTTLLAahavppey  179
ident      |   |             |       |  |                         
Sbjct DYLGQLRAHGFSHGVLVQPsFLGT---DNRYLLSALQTVP---GQLRGVVXL--------   80
DSSP  HHHHHHHHLLLLEELLLLLhHHLL---LLHHHHHHHHHLL---LLLLLLLLL--------


DSSP  lllhhhhhhhHHHLhhHHHHHLLL---LLEEEEEELlLLLLHHH----hHHHHHHHHHLL
Query rddpdswvetICQEiiPAAAEAGL---ADAVDVFCEhIGFSLAQ----tEQVYLAADQYG  232
ident                  |            |                            |
Sbjct ----------ERDV-eQATLAEXArlgVRGVRLNLX-GQDXPDLtgaqwRPLLERIGEQG  128
DSSP  ----------LLLL-lHHHHHHHHlllLLEEELLLL-LLLLLLLlllllHHHHHHHHHHL


DSSP  LEEEEEEllLLLL--LHHHHHHHL-LLLEEE-ELLL---------lLHHHHHHhHHHLLE
Query LAVKGHXdqLSNL--GGSTLAANF-GALSVD-HLEY---------lDPEGIQAlAHRGVV  279
ident   |  |                        |                 |         | 
Sbjct WHVELHR--QVADipVLVRALQPYgLDIVIDhFGRPdarrglgqpgFAELLTLsGRGKVW  186
DSSP  LEEEELL--LLLLhhHHHHHHLLLlLLEEELhHHLLllllllllllHHHHLLLlLLLLEE


DSSP  EEELhhHHHHLL-----LLLLL--LHHHHHHLLL--LEEELLLL-LLLL--lLLLLhhHH
Query ATLLptAFYFLK-----ETKLP--PVVALRKAGV--PXAVSSDI-NPGT--aPIVSlrXA  327
ident         | |                ||            ||                |
Sbjct VKVS--GIYRLQgspeeNLAFArqALCALEAHYGaeRLXWGSDWpHTQHeseVSFG--SA  242
DSSP  EEEE--LHHHLLllhhhHHHHHhhHHHHHHHHLLhhHEEEELLLlLLLLlllLLHH--HH


DSSP  HHHHHHhHLLLHHHHHHHLLHHHHHHLlLLLLLlllllllllleeeellllllhhhhlll
Query XNXACTlFGLTPVEAXAGVTRHAARALgEQEQLgqlrvgxladflvwncghpaelsylig  387
ident         |       |     |       |                             
Sbjct VEQFEA-LGCSAQLRQALLLDTARALF-GFELE---------------------------  273
DSSP  HHHHHH-HLLLHHHHHHHHLHHHHHHL-LLLLL---------------------------


DSSP  llleeeeeelleelll
Query vdqlvsrvvngeetlh  403
ident                 
Sbjct ----------------  273
DSSP  ----------------


No 35: Query=2oofA Sbjct=3gg7A Z-score=15.8

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLLLLllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query tpGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident    ||| | ||                                                 
Sbjct --SLIDFHVHLDLYP------------------------------------------DPV   16
DSSP  --LLEEEEELHHHLL------------------------------------------LHH


DSSP  HHHHHHHHHLEeEEEEELLllllhhhHHHHhHHHHHHHHHLlLEEEEEEEEEL-LLLHhh
Query PRVKSLIREGVtTVEIKSGygltledELKXlRVARRLGEALpIRVKTTLLAAH-AVPPey  179
ident             ||                 |    |       | | |      |    
Sbjct AVARACEERQL-TVLSVTT------tPAAW-RGTLALAAGR-PHVWTALGFHPeVVSE--   65
DSSP  HHHHHHHHLLL-EEEELLL------lHHHH-HHHHHHHLLL-LLEEELLLLLHhHLLL--


DSSP  lllhhhHHHHHhhLHHHHHHhlLLLLEEE-EEELLL-------llLHHHHHHHHHHHHHL
Query rddpdsWVETIcqEIIPAAAeaGLADAVD-VFCEHI-------gfSLAQTEQVYLAADQY  231
ident                            |  |                |            
Sbjct ------RAADL--PWFDRYL--PETRFVGeVGLDGSpslrgtwtqQFAVFQHILRRCEDH  115
DSSP  ------LHHHL--HHHHHHH--HHLLEEEeEELLLLhhhhhhhhhHHHHHHHHHHHHHHL


DSSP  LLEEE-EEELllLLLL-HHHHHHHLL---LLEEEELLlLLHHHHHHHHHHLLEEEELhHH
Query GLAVK-GHXDqlSNLG-GSTLAANFG---ALSVDHLEyLDPEGIQALAHRGVVATLLpTA  286
ident |      |                                          |         
Sbjct GGRILsIHSR--RAESeVLNCLEANPrsgTPILHWYS-GSVTELRRAISLGCWFSVG-PT  171
DSSP  LLEEEeEELL--LLHHhHHHHHHHLHhheEEEEELLL-LLHHHHHHHHHLLLEEEEL-HH


DSSP  HHhlLLLLL-lLHHHHHhlllLEEELLLLLLLL---lLLLLHhHHHHHHhHHHL-----l
Query FYflKETKL-pPVVALRkagvPXAVSSDINPGT---aPIVSLrXAXNXAcTLFG-----l  337
ident        |                   |                                
Sbjct MV--RTQKGaaLIRSMP--rdRVLTETDGPFLEldgqAALPW-DVKSVV-EGLSkiwqip  225
DSSP  HH--LLHHHhhHHHHLL--hhHEEELLLLLLLEelleELLHH-HHHHHH-HHHHhhhlll


DSSP  LHHHHHHHlLHHHHHhlLLLLlllllllllllleeeellllllhhhhlllllleeeeeel
Query TPVEAXAGvTRHAARalGEQEqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvn  397
ident               |                                             
Sbjct ASEVERIV-KENVSR--LLGT---------------------------------------  243
DSSP  HHHHHHHH-HHHHHH--HHHL---------------------------------------


DSSP  leelll
Query geetlh  403
ident       
Sbjct ------  243
DSSP  ------


No 36: Query=2oofA Sbjct=4mupB Z-score=15.5

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ----------------------------------------------lvrklsgtapnpaf   14
DSSP  ----------------------------------------------llllllllllllll


DSSP  EELEEEEEELlLLLLllhhhhhhhhhlllhhhhhhllllHHHHhhhhhhllhhhhhhHHH
Query TPGLIDCHTHlIFAGsraeefelrqkgvpyaeiarkgggIISTvratraasedqlfeLAL  120
ident   |  |   |                                                  
Sbjct PRGAVDTQMH-MYLP----------------gypalpggPGLP---------pgalpGPE   48
DSSP  LLLLEELLLL-LLLL----------------llllllllLLLL---------lllllLHH


DSSP  HHHHHHHHHLEEEEEEELL-LLLLhhHHHHHHHHHHHHHHhlllEEEEEEEeellllhhh
Query PRVKSLIREGVTTVEIKSG-YGLTleDELKXLRVARRLGEalpiRVKTTLLaahavppey  179
ident          |   | |  |       |    |      ||                    
Sbjct DYRRLMQWLGIDRVIITQGnAHQR--DNGNTLACVAEMGE----AAHAVVI---------   93
DSSP  HHHHHHHHHLLLEEEEELLhHHLL--LLHHHHHHHHHHHH----HEEEEEL---------


DSSP  lllhhhhhhhHHHLhhHHHHHLLL---LLEEEEEELLLL-LLHHHHHHHHHHHHHLLLEE
Query rddpdswvetICQEiiPAAAEAGL---ADAVDVFCEHIG-FSLAQTEQVYLAADQYGLAV  235
ident                     |                 |   |     |   |      |
Sbjct ---------iDATT-tEKDMEKLTaagTVGARIMDLPGGaVNLSELDAVDERAHAADWMV  143
DSSP  ---------lLLLL-lHHHHHHHHhllEEEEEEELLLLLlLLHHHHHHHHHHHHHLLLEE


DSSP  EEEELllLLLL--hhhHHHHL-LLLEEE-ELLL---------lLHHHHHHHHHHLLEEEE
Query KGHXDqlSNLG--gstLAANF-GALSVD-HLEY---------lDPEGIQALAHRGVVATL  282
ident     |   |                  | |                              
Sbjct AVQFD--GNGLldhlpRLQKIrSRWVFDhHGKFfkgirtdgpeMAALLKLIDRGNLWFKF  201
DSSP  EEELL--HHHHhhhhhHHHLLlLEEEELhHHHLllllllllhhHHHHHHHHHHLLEEEEE


DSSP  LhhHHHHLL-----LLLL-lLHHHHHHLL-lLEEELLLLLLLL-----lLLLLhHHHHHH
Query LptAFYFLK-----ETKL-pPVVALRKAG-vPXAVSSDINPGT-----aPIVSlRXAXNX  330
ident      |                                                      
Sbjct A--GVYESSrkswpYADVaaFSRVIAAHApeRIVWGTNWPHNSvretaaYPDD-ARLAEL  258
DSSP  L--LHHHLLlllllLHHHhhHHHHHHHHLhhHEEELLLLLLLLlllhhhLLLH-HHHHHH


DSSP  HHHhHLLLHHHHHHHLLHHHHHHLLlLLLLlllllllllleeeellllllhhhhllllll
Query ACTlFGLTPVEAXAGVTRHAARALGeQEQLgqlrvgxladflvwncghpaelsyligvdq  390
ident                                                             
Sbjct TLG-WLPDEAARHRALVENPEALFK-LSPV------------------------------  286
DSSP  HHL-LLLLHHHHHHHHLHHHHHHHL-LLLL------------------------------


DSSP  eeeeeelleelll
Query lvsrvvngeetlh  403
ident              
Sbjct -------------  286
DSSP  -------------


No 37: Query=2oofA Sbjct=2a3lA Z-score=15.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------lllleeeeeeeellllllllllLLLLleeeeeelleeeeeeehhhllllllle
Query -------lncervwlnvtpatlrsdladyGLLEphalgvhegrihalvpxqdlkypahwq   53
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------


DSSP  ellLLEE---EELEEEEEELLL--------------------------------------
Query dxkGKLV---TPGLIDCHTHLI--------------------------------------   72
ident                | | |                                        
Sbjct ---APHRdfyNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlrevf  210
DSSP  ---LLLLlllLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhhhhh


DSSP  ------lllllHHHHHHhhhllLHHHhhHLLLL-HHHH------------hhHHHH-lLH
Query ------fagsrAEEFELrqkgvPYAEiaRKGGG-IIST------------vrATRA-aSE  112
ident                                                             
Sbjct esldltgydlnVDLLDV---haDKST--FHRFDkFNLKynpcgqsrlreiflKQDNliQG  265
DSSP  hhhllllllllLLLLLL---llLLLL--LLLLLlLHHHhllllllhhhhhhlLLLLllLL


DSSP  HHHHHHHHHHHHHHH-HHLEeEEEEELL----lllLHHHHHHHHHhhHHHHhhllLEEEE
Query DQLFELALPRVKSLI-REGVtTVEIKSG----yglTLEDELKXLRvaRRLGealpIRVKT  167
ident   | |        |         |                                 |  
Sbjct RFLGEITKQVFSDLEaSKYQ-MAEYRISiygrkmsEWDQLASWIVnnDLYS----ENVVW  320
DSSP  LLHHHHHHHHHHHHLlLLLE-EEEEEEElllllllHHHHHHHHHHllLLLL----LLEEE


DSSP  EEEeELLLLHHHL-----LLHHHHHHHHHHLH--------hhhhhHLLL--LLEEEEE-E
Query TLLaAHAVPPEYR-----DDPDSWVETICQEI--------ipaaaEAGL--ADAVDVF-C  211
ident            |               |                    |      |    
Sbjct LIQ-LPRLYNIYKdmgivTSFQNILDNIFIPLfeatvdpdshpqlHVFLkqVVGFDLVdD  379
DSSP  EEE-EELLHHHHLlllllLLLHHHHHHHLLHHhhhhhlhhhllllHHHHllEEEEEEElL


DSSP  LLL--------------------llLHHHHHHHHHHHHHLL----------LEEEEEELL
Query EHI--------------------gfSLAQTEQVYLAADQYG----------LAVKGHXDQ  241
ident |                                |                      |   
Sbjct ESKperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSGE  439
DSSP  LLLllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLL


DSSP  LLLLLHHHHHHHLlLLEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHLLLL--LLLL
Query LSNLGGSTLAANFgALSVDHLEYL--DPEGIQALAHRGVVATLLPTAFYFLKET--KLPP  297
ident                 |  |   |   |                |     |       | 
Sbjct AGDIDHLAATFLT-CHSIAHGINLrkSPVLQYLYYLAQIGLAMSPLSNNSLFLDyhRNPF  498
DSSP  LLLLHHHHHHHHH-LLLLLLLHHHhhLHHHHHHHHHHLLLEEELHHHHLLLLLLllLLLH


DSSP  HHhHHHLLLLEEELLLLLlllLLLL----LHHHHHHHHHHHHLLLHHHHHHHLlHHHHHH
Query VVaLRKAGVPXAVSSDINpgtAPIV----SLRXAXNXACTLFGLTPVEAXAGVtRHAARA  353
ident  |     |     | |       |      |      |     |          |     
Sbjct PV-FFLRGLNVSLSTDDP---LQIHltkePLVEEYSIAASVWKLSACDLCEIA-RNSVYQ  553
DSSP  HH-HHHLLLLEEELLLLH---HHHLllllHHHHHHHHHHHHHLLLHHHHHHHH-HHHHHH


DSSP  LLL-LLLL--LLLLLLL----------llleeeellllllhhhhlllllleeeeeellee
Query LGE-QEQL--GQLRVGX----------ladflvwncghpaelsyligvdqlvsrvvngee  400
ident  |                                                          
Sbjct SGFsHALKshWIGKDYYkrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisde  613
DSSP  LLLlHHHHhhHLLLLLLlllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllllllll


DSSP  lll
Query tlh  403
ident    
Sbjct vvp  616
DSSP  lll


No 38: Query=2oofA Sbjct=3irsA Z-score=14.7

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELLLL--------LLLLHhhhhhhhhlllhhhhhhllllhhhhhhhhhhllh
Query tPGLIDCHTHLIF--------AGSRAeefelrqkgvpyaeiarkgggiistvratraase  112
ident     ||                                                      
Sbjct -LKIIDFRLRPPAmgflnariYTRPD-------------------irnrftrqlgfepap   40
DSSP  -LLLEELLLLLLLhhhhhlhhHHLHH-------------------hhhhhhhhhlllllh


DSSP  hhhhHHHHHHHHHHHHHLEEEEEEELLL--lllhhHHHHHHHHHHHHHhhllLEEEEEEE
Query dqlfELALPRVKSLIREGVTTVEIKSGY--gltleDELKXLRVARRLGealpIRVKTTLL  170
ident                  |                        ||                
Sbjct saeeKSLELMFEEMAAAGIEQGVCVGRNssvlgsvSNADVAAVAKAYP----DKFHPVGS   96
DSSP  hhhhLLHHHHHHHHHHLLLLEEEEELLEellleelLHHHHHHHHHHLL----LLEEEEEE


DSSP  EEllllhhhlllhhHHHHHHHhLHHHHHHHLLlLLEEEEEELLL--LLLHHH--HHHHHH
Query AAhavppeyrddpdSWVETICqEIIPAAAEAGlADAVDVFCEHI--GFSLAQ--TEQVYL  226
ident                                |    |                     | 
Sbjct IE-----------aATRKEAM-AQMQEILDLG-IRIVNLEPGVWatPMHVDDrrLYPLYA  143
DSSP  LL-----------lLLHHHHH-HHHHHHHHLL-LLLEEELHHHLllLLLLLLhhHHHHHH


DSSP  HHHHLLLEEEEEELLL------LLLL-HHHHHHH---LLLLEEEE-LLLLLHHHHHHHHH
Query AADQYGLAVKGHXDQL------SNLG-GSTLAAN---FGALSVDH-LEYLDPEGIQALAH  275
ident      |  |                                   |       | |     
Sbjct FCEDNGIPVIMMTGGNagpditYTNPeHIDRVLGdfpDLTVVSSHgNWPWVQEIIHVAFR  203
DSSP  HHHHLLLLEEEELLLLllllhhHHLHhHHHHHHHhllLLLEEEEHhHLLLHHHHHHHHHH


DSSP  HL-LEEEELhHHHHhllLLLLL-LHHHHHHLLL--LEEELLLLLllllLLLLhHHHHHHH
Query RG-VVATLLpTAFYflkETKLP-PVVALRKAGV--PXAVSSDINpgtaPIVSlRXAXNXA  331
ident |            |                                              
Sbjct RPnLYLSPD-MYLY---NLPGHaDFIQAANSFLadRMLFGTAYP----MCPL-KEYTEWF  254
DSSP  LLlEEEELH-HHHL---LLLLHhHHHHHHLLHHhhLLLLLLLLL----LLLH-HHHHHHH


DSSP  HHhHLLLHHHHHHHLLHHHHHhlLLLLlllllllllllleeeellllllhhhhlllllle
Query CTlFGLTPVEAXAGVTRHAARalGEQEqlgqlrvgxladflvwncghpaelsyligvdql  391
ident  |     |          | |                                       
Sbjct LT-LPIKPDAMEKILHGNAER--LLAQ---------------------------------  278
DSSP  HL-LLLLHHHHHHHHLHHHHH--HHHH---------------------------------


DSSP  eeeeelleelll
Query vsrvvngeetlh  403
ident             
Sbjct ---------agr  281
DSSP  ---------lll


No 39: Query=2oofA Sbjct=4dlfA Z-score=14.3

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELlLLLLLLhhhhhhhhhlllhhhhhhlllLHHHhhhhhhhllhhhhhhHHH
Query tPGLIDCHTHlIFAGSRaeefelrqkgvpyaeiarkggGIIStvratraasedqlfeLAL  120
ident     || | |                              |                |  
Sbjct -ALRIDSHQH-FWRYRA------------------adyPWIG-----agmgvlardyLPD   35
DSSP  -LLLEEEEEL-LLLLLH------------------hhlLLLL-----lllhhhllllLHH


DSSP  HHHHHHHHHLEEEEEEELLLLLlhHHHHHHHHHHHHHHHhllLEEEEEEEEEllllhhhl
Query PRVKSLIREGVTTVEIKSGYGLtlEDELKXLRVARRLGEalpIRVKTTLLAAhavppeyr  180
ident                          ||   |                             
Sbjct ALHPLMHAQALGASIAVQARAG--RDETAFLLELACDEA---RIAAVVGWED--------   82
DSSP  HHHHHHHHLLLLEEEEELLLLL--HHHHHHHHHHHLLLL---LEEEEEELLL--------


DSSP  llhhhHHHHHhHLHHHHhHHLLlLLEEEEEELLL---llLHHH--hHHHHHHHHHLLLEE
Query ddpdsWVETIcQEIIPAaAEAGlADAVDVFCEHI---gfSLAQ--tEQVYLAADQYGLAV  235
ident             |                                               
Sbjct ----lRAPQL-AERVAE-WRGTkLRGFRHQLQDEadvraFVDDadfARGVAWLQANDYVY  136
DSSP  ----lLLLLH-HHHHHL-LLLLlEEEEEELHHHLllhhhHHHLhhhHHHHHHHHHLLLEE


DSSP  EEEElLLLL-LLHHHHHHHLL--LLEEE-ELLL-----------------LLHHHHHHhh
Query KGHXdQLSN-LGGSTLAANFG--ALSVD-HLEY-----------------LDPEGIQAla  274
ident                  |      |  |                         |      
Sbjct DVLV-FERQlPDVQAFCARHDahWLVLDhAGKPalaefdrddtalarwraALRELAAL--  193
DSSP  EELL-LHHHhHHHHHHHHHLLllLEEEHhHHLLlhhhllllllhhhhhhhHHHHHHLL--


DSSP  hHLLEEEELhhHHHHLL-------------LLLLL--LHHHHHhlllLEEELLLLLllLL
Query hRGVVATLLptAFYFLK-------------ETKLP--PVVALRkagvPXAVSSDINpgTA  319
ident    ||  |                                |           ||      
Sbjct -PHVVCKLS--GLVTEAdwrrglrasdlrhIEQCLdaALDAFG--pqRLMFGSDWP--VC  246
DSSP  -LLEEEEEL--LLLLLLlllllllhhhhhhHHHHHhhHHHHHL--hhHEEELLLLL--HH


DSSP  LL-llHHHHHHHHHHHH--LLLHHHHHHHLLHHHHHHLLLlllllllllllllleeeell
Query PI-vsLRXAXNXACTLF--GLTPVEAXAGVTRHAARALGEqeqlgqlrvgxladflvwnc  376
ident                     |   |  |     |||                        
Sbjct LLaasYDEVASLVERWAesRLSAAERSALWGGTAARCYAL--------------------  286
DSSP  HHlllHHHHHHHHHHHHhhHLLHHHHHHHLLHHHHHHLLL--------------------


DSSP  llllhhhhlllllleeeeeelleelll
Query ghpaelsyligvdqlvsrvvngeetlh  403
ident                            
Sbjct --------------------------p  287
DSSP  --------------------------l


No 40: Query=2oofA Sbjct=1itqA Z-score=13.9

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllleE
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklV   60
ident                                                             
Sbjct ------------------------------------------------dffrdeaerimR   12
DSSP  ------------------------------------------------lhhhhhhhhhhL


DSSP  EELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhHLLHHH------
Query TPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratrAASEDQ------  114
ident     || |  |                                                 
Sbjct DSPVIDGHNDLPWQ-------------------------------lldMFNNRLqderan   41
DSSP  LLLEEEEEELHHHH-------------------------------hhhHHLLLLllhhhl


DSSP  -hhhhhhhHHHH-HHHHLEEEEEEELLLL------lLHHHHHHHHHHHHHHHHHL-----
Query -lfelalpRVKS-LIREGVTTVEIKSGYG------lTLEDELKXLRVARRLGEAL-----  161
ident              |    |                      |    |  |          
Sbjct lttlagthTNIPkLRAGFVGGQFWSVYTPcdtqnkdAVRRTLEQMDVVHRMCRMYpetfl  101
DSSP  llllllllLLHHhHHHLLEEEEEEEELLLhhhllllHHHHHHHHHHHHHHHHHHLlllee


DSSP  ---------------LLEEEEEEEEEllllhhhlllhhhhhhHHHHLHHHHHHHlLLLLE
Query ---------------PIRVKTTLLAAhavppeyrddpdswveTICQEIIPAAAEaGLADA  206
ident                                                   |         
Sbjct yvtssagirqafregKVASLIGVEGG-------------hsiDSSLGVLRALYQ-LGMRY  147
DSSP  elllhhhhhhhhhllLEEEEEEEELH-------------hhlLLLHHHHHHHHH-LLEEE


DSSP  EEEE---------ELLL-------llLHHH--HHHHHHHHHHLLLEEEEEEllllLLLHH
Query VDVF---------CEHI-------gfSLAQ--TEQVYLAADQYGLAVKGHXdqlsNLGGS  248
ident                                    |       |                
Sbjct LTLThscntpwadNWLVdtgdsepqsQGLSpfGQRVVKELNRLGVLIDLAH---vSVATM  204
DSSP  EELLlllllllllLHHHlllllllllLLLLhhHHHHHHHHHHHLLEEELLL---lLHHHH


DSSP  HHHHHL--LLLEE-EELLL--------LLHHHHHHHHHHLLEEEELhHHHHhLLLL----
Query TLAANF--GALSV-DHLEY--------LDPEGIQALAHRGVVATLLpTAFYfLKET----  293
ident                   |                                    |    
Sbjct KATLQLsrAPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN-FYNNyISCTnkan  263
DSSP  HHHHHHllLLLEElLLLLLllllllllLLHHHHHHHHHHLLEEEEL-LLHHhHLLLllll


DSSP  ---lllLHHHHHHLLL--LEEELLLL-LLLLL----LLLL-HHHHHHHhhhhhLLLHHHH
Query ---klpPVVALRKAGV--PXAVSSDI-NPGTA----PIVS-LRXAXNXactlfGLTPVEA  342
ident                         |             ||               |  | 
Sbjct lsqvadHLDHIKEVAGarAVGFGGDFdGVPRVpeglEDVSkYPDLIAE-llrrNWTEAEV  322
DSSP  hhhhhhHHHHHHHHLLhhHEEELLLLlLLLLLllllLLLLlHHHHHHH-hhhlLLLHHHH


DSSP  HHHLLHHHHHHlLLLLlllllllllllleeeellllllhhhhlllllleeeeeelleell
Query XAGVTRHAARAlGEQEqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngeetl  402
ident          |   |                                              
Sbjct KGALADNLLRV-FEAV-------------eqasnltqapeeepipldqlggscrthygys  368
DSSP  HHHHLHHHHHH-HHHH-------------hhllllllllllllllhhhllllllllllll


DSSP  l
Query h  403
ident  
Sbjct s  369
DSSP  l


No 41: Query=2oofA Sbjct=4hk5D Z-score=13.4

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  EELEEEEEELlLLLL----------llhhHHHHhhHLLLhhhhhhllLLHH---------
Query TPGLIDCHTHlIFAG----------sraeEFELrqKGVPyaeiarkgGGII---------  101
ident ||   | |||                                                  
Sbjct TPVVVDIHTH-MYPPsyiamlekrqtiplVRTF--PQAD-----eprLILLsselaalda   52
DSSP  LLLLEEEEEE-ELLHhhhhhhhlllllleEEEE--LLEE-----eeeEELLhhhhhhhhh


DSSP  ---hhhhhhhhllhhhhhHHHHHHHHHHHHHLEEEEEEEL--LLLL------LHHHHHHH
Query ---stvratraasedqlfELALPRVKSLIREGVTTVEIKS--GYGL------TLEDELKX  150
ident                                |     |                      
Sbjct aladpaaklpgrplsthfASLAQKMHFMDTNGIRVSVISLanPWFDflapdeAPGIADAV  112
DSSP  hhhlllllllleellhhhLLHHHHHHHHHHLLLLEEEEEEllLLLLllllllHHHHHHHH


DSSP  HHHHHHHHHHLLLEEEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLlLLEEEEE
Query LRVARRLGEALPIRVKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGlADAVDVF  210
ident              |                      |       |               
Sbjct NAEFSDMCAQHVGRLFFFAAL----------plsAPVDAVK-ASIERVKNLKyCRGIILG  161
DSSP  HHHHHHHHHLLLLLEEEEEEL----------lllLLHHHHH-HHHHHHHLLLlEEEEEEL


DSSP  ELllllLHHH--HHHHHHHHHHLLLEEEEEE-------------------------LLLL
Query CEhigfSLAQ--TEQVYLAADQYGLAVKGHX-------------------------DQLS  243
ident        |       |  |     | |  |                              
Sbjct TSglgkGLDDphLLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgFPME  221
DSSP  LLllllLLLLhhHHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHH


DSSP  -LLLH-------hhhhhHLLLLEEEE-LLLLLH--------------------------H
Query -NLGG-------stlaaNFGALSVDH-LEYLDP--------------------------E  268
ident                          |    |                             
Sbjct tTIAVarmymagvfdhvRNLQMLLAHsGGTLPFlagriescivhdghlvktgkvpkdrrT  281
DSSP  hHHHHhhhhhllhhhhlLLLLEEEHHhHLLHHHhhhhhhhhhhllhhhhhlllllllllL


DSSP  HHHHHHHHlLEEEELHHhhhhlllllllLHHHHHHLLL--LEEELLLLLlllLLLL----
Query GIQALAHRgVVATLLPTafyflketklpPVVALRKAGV--PXAVSSDINpgtAPIV----  322
ident     |                          |              |             
Sbjct IWTVLKEQ-IYLDAVIY--------sevGLQAAIASSGadRLMFGTDHP---FFPPieed  329
DSSP  HHHHHHHL-EEEELLLL--------lhhHHHHHHHHHLhhHEELLLLLL---LLLLllll


DSSP  ------LHHHHHHHHHHhhLLLH--HHHHHHLLHHHHHhLLLLLLlllllllLLLLeeee
Query ------SLRXAXNXACTlfGLTP--VEAXAGVTRHAARaLGEQEQlgqlrvgXLADflvw  374
ident       | |                  | |     | |                      
Sbjct vqgpwdSSRLNAQAVIK--AVGEgsSDAAAVMGLNAVR-VLSLKA------eLEHH----  376
DSSP  lllllhHHHHHHHHHHH--HHLLllHHHHHHHLHHHHH-HLLLHH------hHHHH----


DSSP  llllllhhhhlllllleeeeeeLLEElll
Query ncghpaelsyligvdqlvsrvvNGEEtlh  403
ident                              
Sbjct ----------------------HHHH---  380
DSSP  ----------------------HHHL---


No 42: Query=2oofA Sbjct=2dvtA Z-score=13.3

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELLLLL------LLLHHHHHhhhhlllhhhhhhllllhhhhhhhhhhllhhh
Query tPGLIDCHTHLIFA------GSRAEEFElrqkgvpyaeiarkgggiistvratraasedq  114
ident   |      |                                                  
Sbjct mQGKVALEEHFAIPetlqdsAGFVPGDY--------------------------wkelqh   34
DSSP  lLLEEEEEEEELLHhhhhhhLLLLLLLH--------------------------hhhhhh


DSSP  hhhHHHH-HHHHHHHHLEEEEEEELL---------lllLHHHHHHHHHHHHHHHHHLlLE
Query lfeLALP-RVKSLIREGVTTVEIKSG---------yglTLEDELKXLRVARRLGEALpIR  164
ident         | |     |  |                    |       |          |
Sbjct rllDIQDtRLKLMDAHGIETMILSLNapavqaipdrrkAIEIARRANDVLAEECAKRpDR   94
DSSP  hhhLLLLhHHHHHHHLLEEEEEEEELllhhhhlllhhhHHHHHHHHHHHHHHHHHHLlLL


DSSP  EEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLLLLEEEEEEL-------lLLLL
Query VKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGLADAVDVFCE-------hIGFS  217
ident                             |               |               
Sbjct FLAFAAL-----------plQDPDAAT-EELQRCVNDLGFVGALVNGFsqegdgqtPLYY  142
DSSP  EEEEELL-----------llLLHHHHH-HHHHHHHHLLLLLEEEEELLllllllllLLLL


DSSP  HH-HHHHHHHHHHHLLLEEEEEE----------------------lLLLL-lLHHH----
Query LA-QTEQVYLAADQYGLAVKGHX----------------------dQLSN-lGGST----  249
ident    |                 |                                      
Sbjct DLpQYRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtaVHALrlma  202
DSSP  LLhHHHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhHHHHhhhh


DSSP  ----hhhHLLLLEEEE-LLLLLHH----------------------hhHHHHhHLLEEEE
Query ----laaNFGALSVDH-LEYLDPE----------------------giQALAhRGVVATL  282
ident                |  | |                                     | 
Sbjct sglfdehPRLNIILGHmGEGLPYMmwridhrnawvklpprypakrrfmDYFN-ENFHITT  261
DSSP  llhhhhlLLLLEEELHhHLLHHHHhhhhhhllllllllllllllllhhHHHH-HHEEEEL


DSSP  LhHHHHhlllllllLHHHHHHLLL--LEEELLLLLllllLLLLhHHHHHHHHHhHLLLHH
Query LpTAFYflketklpPVVALRKAGV--PXAVSSDINpgtaPIVSlRXAXNXACTlFGLTPV  340
ident     |                         | |             |             
Sbjct S-GNFR------tqTLIDAILEIGadRILFSTDWP----FENI-DHASDWFNA-TSIAEA  308
DSSP  L-LLLL------hhHHHHHHLLLLhhHEELLLLLL----LLLH-HHHHHHHHH-LLLLHH


DSSP  HHHHHLLHHHHHhLLLLLlllllllllllleeeellllllhhhhlllllleeeeeellee
Query EAXAGVTRHAARaLGEQEqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngee  400
ident          | | |                                              
Sbjct DRVKIGRTNARR-LFKLD------------------------------------------  325
DSSP  HHHHHHLHHHHH-HLLLL------------------------------------------


DSSP  lll
Query tlh  403
ident    
Sbjct ---  325
DSSP  ---


No 43: Query=2oofA Sbjct=4ofcA Z-score=13.2

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eelEEEEEELLLLL-----------------------LLLHhhhhhhhhlllhhhHHHLL
Query tpgLIDCHTHLIFA-----------------------GSRAeefelrqkgvpyaeIARKG   97
ident     || | |                                                | 
Sbjct --mKIDIHSHILPKewpdlkkrfgyggwvqlqhhskgEAKL-------------lKDGKV   45
DSSP  --lLEEEEEELLLLllllhhhhhllllleeeeeeellEEEE-------------eELLEE


DSSP  LLhhhhhhhhhhllhhhhhhHHHHHHHHHHHHLEEEEEEEL-LLLL--------LHHHHH
Query GGiistvratraasedqlfeLALPRVKSLIREGVTTVEIKS-GYGL--------TLEDEL  148
ident                         |       |||                   ||    
Sbjct FR-----------vvrencwDPEVRIREMDQKGVTVQALSTvPVMFsywakpedTLNLCQ   94
DSSP  EE-----------eeehhhlLHHHHHHHHHHHLLLEEEEELlHHHHlllllhhhHHHHHH


DSSP  HHHHHHHHHHHHLLLEEEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLLLLEEE
Query KXLRVARRLGEALPIRVKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGLADAVD  208
ident              | |                       |                  | 
Sbjct LLNNDLASTVVSYPRRFVGLGTL-----------pmQAPELAV-KEMERCVKELGFPGVQ  142
DSSP  HHHHHHHHHHHHLLLLEEEEELL-----------llLLHHHHH-HHHHHHHHLLLLLEEE


DSSP  EEELlllLLHHH--HHHHHHHHHHLLLEEEEEE------------------lLLLL-lLH
Query VFCEhigFSLAQ--TEQVYLAADQYGLAVKGHX------------------dQLSN-lGG  247
ident          |       || ||         |                            
Sbjct IGTHvneWDLNAqeLFPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttIA  202
DSSP  EELEellEELLLhhHHHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhHH


DSSP  HHH--------hhHLLLLEEEE-LLLLLHH----------------------hhHHHHhh
Query STL--------aaNFGALSVDH-LEYLDPE----------------------giQALAhr  276
ident                      |                                  |   
Sbjct ICSmimggvfekfPKLKVCFAHgGGAFPFTvgrishgfsmrpdlcaqdnpmnpkKYLG--  260
DSSP  HHHhhlllhhhhlLLLLEEELHhHLLHHHHhhhhhhhhhhlhhhhlllllllhhHHLL--


DSSP  LLEEEELHHhhhhlllllllLHHHHHHLLL--LEEELLLLLLLLLlLLLHhhhHHHHHHH
Query GVVATLLPTafyflketklpPVVALRKAGV--PXAVSSDINPGTApIVSLrxaXNXACTL  334
ident       |                 |             |                     
Sbjct SFYTDALVH--------dplSLKLLTDVIGkdKVILGTDYPFPLG-ELEP---GKLIESM  308
DSSP  LLEEELLLL--------lhhHHHHHHHHHLllLEELLLLLLLLLL-LLLL---LHHHHHL


DSSP  HLLLHHHHHHHLLHHHHHHLLLLLLLlllllllllleeeellllllhhhhlllllleeee
Query FGLTPVEAXAGVTRHAARALGEQEQLgqlrvgxladflvwncghpaelsyligvdqlvsr  394
ident                |   ||                                       
Sbjct EEFDEETKNKLKAGNALAFLGLERKQ----------------------------------  334
DSSP  LLLLHHHHHHHHLHHHHHHHLLLHHH----------------------------------


DSSP  eelleelll
Query vvngeetlh  403
ident          
Sbjct --------f  335
DSSP  --------l


No 44: Query=2oofA Sbjct=3pnuA Z-score=13.1

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllLEE
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgKLV   60
ident                                                             
Sbjct -------------------------------------------------enlyfqsnAMK   11
DSSP  -------------------------------------------------llllllllLEE


DSSP  EELEEEEEELLLlllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhHHHHHH
Query TPGLIDCHTHLIfagsraeefelrqkgvpyaeiarkgggiistvratraasedqLFELAL  120
ident      | | ||                                                 
Sbjct LKNPLDMHLHLR------------------------------------------DNQMLE   29
DSSP  EELLEEEEELLL------------------------------------------LHHHHH


DSSP  HHHHHHHHHlEEEEEEELL---LLLLhhhhHHHHH-HHHHHHHHL---LLEEEEEEEEEl
Query PRVKSLIREgVTTVEIKSG---YGLTledeLKXLR-VARRLGEAL---PIRVKTTLLAAh  173
ident        |       |              |  |     |   |          ||    
Sbjct LIAPLSARD-FCAAVIMPNlipPLCN----LEDLKaYKMRILKACkdeNFTPLMTLFFK-   83
DSSP  HHHHHHHLL-LLEEEELLLlllLLLL----HHHHHhHHHHHHHHHlllLLEEEEEEELL-


DSSP  lllhhhlllhhhhhhhHHHLHHHHHHhlLLLLEEEEEeLLLL-------LLHH---hhHH
Query avppeyrddpdswvetICQEIIPAAAeaGLADAVDVFcEHIG-------FSLA---qtEQ  223
ident                         |                         |         
Sbjct ---------------nYDEKFLYSAK--DEIFGIXLY-PAGIttnsnggVSSFdieylKP  125
DSSP  ---------------lLLHHHHHHHL--LLLLEEEEL-LLLLlllllllLLLLlhhhhHH


DSSP  HHHHHHHLLLEEEEEEL-------lLLLLL-HHHHHHH---LLLLEEEELLLLLhhhHHH
Query VYLAADQYGLAVKGHXD-------qLSNLG-GSTLAAN---FGALSVDHLEYLDpegIQA  272
ident    |          |           ||        |           |           
Sbjct TLEAMSDLNIPLLVHGEtndfvmdrESNFAkIYEKLAKhfpRLKIVMEHITTKT--lCEL  183
DSSP  HHHHHHHLLLLEEELLLllllhhhlLHHHHhHHHHHHHhllLLLEEELLLLLHH--hHHH


DSSP  HHHHL-LEEEELHHHHHH------------------LLLL--LLLLHHHH-hhlLLLEEE
Query LAHRG-VVATLLPTAFYF------------------LKET--KLPPVVAL-rkaGVPXAV  310
ident |       ||                                       |          
Sbjct LKDYEnLYATITLHHLIItlddviggkmnphlfckpIAKRyeDKEALCELafsgYEKVMF  243
DSSP  HHHLLlEEEEELLHHHLLlhhhhhlllllhhhllllLLLLhhHHHHHHHHhhllLLLEEE


DSSP  LLLLLL------LLLLLLL-HHHHHHHHHHhhLLLHHHHHHHLLHHHHHhlLLLLLLlll
Query SSDINP------GTAPIVS-LRXAXNXACTlfGLTPVEAXAGVTRHAARalGEQEQLgql  363
ident  ||  |                                                      
Sbjct GSDSAPhpkgcaAGVFSAPvILPVLAELFK-qNSSEENLQKFLSDNTCK--IYDLKF---  297
DSSP  LLLLLLllllllLLLLLHHhHHHHHHHHHH-hHLLHHHHHHHHLHHHHH--HHLLLL---


DSSP  lllLLLLEEEEL------------------lllllhhhHLLLLLleeeeeelleelll
Query rvgXLADFLVWN------------------cghpaelsYLIGVDqlvsrvvngeetlh  403
ident         |                                                 
Sbjct ---KEDKILTLEekewqvpnvyedkynqvvpymageilKFQLKH--------------  338
DSSP  ---LLLLEEEEEllleelllleelllleellllllleeLLEELL--------------


No 45: Query=2oofA Sbjct=2gwgA Z-score=13.1

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLLLLllhhhhhhhhhlllhhhhhhllllhhhhhHHHH------------
Query tpGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkgggiistvRATR------------  108
ident     || | |   |                               |              
Sbjct --XIIDIHGHYTTAP-----------------------------KALEdwrnrqiagikd   29
DSSP  --LLEEEEEELLLLL-----------------------------HHHHhhhhhhhhhhhl


DSSP  ----------HLLHHHHHHHHH-HHHHHHHHHLEEEEEEELLL------llLHHHHHHHH
Query ----------AASEDQLFELAL-PRVKSLIREGVTTVEIKSGY------glTLEDELKXL  151
ident             | | |         |     |                           
Sbjct psvxpkvselKISDDELQASIIeNQLKKXQERGSDLTVFSPRAgdfnvsstWAAICNELC   89
DSSP  hhhlllhhhlLLLHHHHHHHHHlLHHHHHHHHLLLEEEEELLLllhhhhhhHHHHHHHHH


DSSP  HHHHHHHHhllLEEEEEEEEellllhhhllLHHHhHHHHHhLHHHHHHHLLLLLEEEEEE
Query RVARRLGEalpIRVKTTLLAahavppeyrdDPDSwVETICqEIIPAAAEAGLADAVDVFC  211
ident      |                               |                |     
Sbjct YRVSQLFP---DNFIGAAXL-------pqsPGVD-PKTCI-PELEKCVKEYGFVAINLNP  137
DSSP  HHHHHHLL---LLEEEEEEL-------lllLLLL-HHHHH-HHHHHHHHLLLLLEEEELL


DSSP  L------lllLLHH-HHHHHHHHHHHLLLEEEEE--------eLLLL-LLLH----hhhh
Query E------higFSLA-QTEQVYLAADQYGLAVKGH--------xDQLS-NLGG----stla  251
ident                     |            |                          
Sbjct DpsgghwtspPLTDrIWYPIYEKXVELEIPAXIHvstgahylnADTTaFXQCvagdlfkd  197
DSSP  LlllllllllLLLLhHHHHHHHHHHHHLLLEEELlllllhhhhHHHHhHHHHhhllhhhh


DSSP  hHLLLLEEEE-LLLL---------------lhHHHHHHHhHLLEEEELHHhhhhllllll
Query aNFGALSVDH-LEYL---------------dpEGIQALAhRGVVATLLPTafyflketkl  295
ident          |                                                  
Sbjct fPELKFVIPHgGGAVpyhwgrfrglaqexkkpLLEDHVL-NNIFFDTCVY----hqpgid  252
DSSP  lLLLLEEELHhHLLLhhhhhhhhhhhhhllllLHHHHLL-LLEEEELLLL----lhhhhh


DSSP  lLHHHHHhllLLEEELLLLLlLLLL------lllhhHHHHHHHHHhLLLHHHHHHHLLHH
Query pPVVALRkagVPXAVSSDINpGTAP------ivslrXAXNXACTLfGLTPVEAXAGVTRH  349
ident                 |    |                         ||| |        
Sbjct lLNTVIP--vDNVLFASEXI-GAVRgidprtgfyydDTKRYIEAStILTPEEKQQIYEGN  309
DSSP  hHHHHLL--hHHEELLLLLL-LLLLleelllleellLLHHHHHHLlLLLHHHHHHHHLHH


DSSP  HHHHLL--LLLLllllllllllleeeellllllhhhhlllllleeeeeeLLEElll
Query AARALG--EQEQlgqlrvgxladflvwncghpaelsyligvdqlvsrvvNGEEtlh  403
ident | |                                                 |   
Sbjct ARRVYPrlDAAL----------------------------------kakGKLE--h  329
DSSP  HHHHLHhhHHHH----------------------------------hhhHHHL--l


No 46: Query=2oofA Sbjct=4qrnA Z-score=12.6

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllleE
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklV   60
ident                                                             
Sbjct ------------------------------------------------smtqdlktggeQ   12
DSSP  ------------------------------------------------lllllllllllL


DSSP  EELEEEEEELlLLLL------------------------lLHHHHHHHHhlllhhhhhhl
Query TPGLIDCHTHlIFAG------------------------sRAEEFELRQkgvpyaeiark   96
ident     |                                    |     |            
Sbjct GYLRIATEEA-FATReiidvylrmirdgtadkgmvslwgfYAQSPSERA-----------   60
DSSP  LLLLEEEEEE-ELLHhhhhhhhhhhhhllllhhhhhhhhhHHHLLLHHH-----------


DSSP  lllhhhhhhhhhhllhhhhhhHHHH-HHHHHHHHLEEEEEEEL--LLLL-------LHHH
Query gggiistvratraasedqlfeLALP-RVKSLIREGVTTVEIKS--GYGL-------TLED  146
ident                           |       |                         
Sbjct -------------tqilerllDLGErRIADMDATGIDKAILALtsPGVQplhdldeARTL  107
DSSP  -------------hhhhhhhhLLLHhHHHHHHHLLLLEEEEEEllLLLLllllhhhHHHH


DSSP  HHHHHHHHHHHHHHLLLEEEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLLLLE
Query ELKXLRVARRLGEALPIRVKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGLADA  206
ident                | |                       |      |   |       
Sbjct ATRANDTLADACQKYPDRFIGMGTV-----------apQDPEWSA-REIHRGARELGFKG  155
DSSP  HHHHHHHHHHHHHHLLLLEEELLLL-----------llLLHHHHH-HHHHHHHHLLLLLL


DSSP  EEEEELlLLLLHHH--hHHHHHHHHHLLLEEEEEE---------------------lLLL
Query VDVFCEhIGFSLAQ--tEQVYLAADQYGLAVKGHX---------------------dQLS  243
ident         |  |          |          |                          
Sbjct IQINSHtQGRYLDEeffDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgFGV  215
DSSP  EEELLLlLLLLLLLhhhHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhHHH


DSSP  L-lLHHH---------hhhHLLLlEEEE-LLLLLHH------------------------
Query N-lGGST---------laaNFGAlSVDH-LEYLDPE------------------------  268
ident                          | |  | |                           
Sbjct EtgMHLLrlitigifdkypSLQI-MVGHmGEALPYWlyrldymhqagvrsqryermkplk  274
DSSP  HhhHHHHhhhhhlhhhhllLLLE-EELHhHHLHHHHhhhhhhhhhhhhhlllllllllll


DSSP  --hhHHHHHHlLEEEELhHHHHhlllllllLHHHHHHLLL--LEEELLLLLllllLLLLh
Query --giQALAHRgVVATLLpTAFYflketklpPVVALRKAGV--PXAVSSDINpgtaPIVSl  324
ident       |    |  |                                 |           
Sbjct ktieGYLKSN-VLVTNS-GVAW------epAIKFCQQVMGedRVMYAMDYP----YQYV-  321
DSSP  llhhHHHHHL-EEEELL-LLLL------hhHHHHHHHHHLhhHEELLLLLL----LLLL-


DSSP  HHHHHHHHHHhLLLHHHHHHHLLHHHHHHLLLlllllllllllllleeeellllllhhhh
Query RXAXNXACTLfGLTPVEAXAGVTRHAARALGEqeqlgqlrvgxladflvwncghpaelsy  384
ident                          |                                  
Sbjct ADEVRAMDAM-DMSAQTKKKFFQTNAEKWFKL----------------------------  352
DSSP  HHHHHHHHLL-LLLHHHHHHHHLHHHHHHLLL----------------------------


DSSP  lllllleeeeeelleelll
Query ligvdqlvsrvvngeetlh  403
ident                    
Sbjct -------------------  352
DSSP  -------------------


No 47: Query=2oofA Sbjct=3qy6A Z-score=12.3

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eelEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhHHHHHHH
Query tpgLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedQLFELAL  120
ident     || | |   |                                              
Sbjct ---MIDIHCHILPA----------------------------------mddgaGDSADSI   23
DSSP  ---LEELLLLLLLL----------------------------------lllllLLHHHHH


DSSP  HHHHHHHHHLEEEEEEELL----lLLLHhhHHHHHHHHHHHHHHL-----LLEEEEEEee
Query PRVKSLIREGVTTVEIKSG----yGLTLedELKXLRVARRLGEAL-----PIRVKTTLla  171
ident        | |  |                        |  |   |     |  |      
Sbjct EMARAAVRQGIRTIIATPHhnngvYKNE--PAAVREAADQLNKRLikediPLHVLPGQ--   79
DSSP  HHHHHHHHLLLLEEELLLEellllLLLL--HHHHHHHHHHHHHHHhhlllLLEEELLL--


DSSP  ellllhhhlllhhhhhhhhhhlhhhhhhhllllleeEEEEllllllhhhHHHHHHHHHHL
Query ahavppeyrddpdswveticqeiipaaaeagladavDVFCehigfslaqTEQVYLAADQY  231
ident                                                     |       
Sbjct ------------------------------------EIRI---------YGEVEQDLAKR   94
DSSP  ------------------------------------EEEL---------LLLHHHHHHLL


DSSP  LL-------EEEEEEllLLLLL-hhHHHHHL-----LLLEEEELL------llLHHHHHH
Query GL-------AVKGHXdqLSNLG-gsTLAANF-----GALSVDHLE------ylDPEGIQA  272
ident  |                                        | |               
Sbjct QLlslndtkYILIEF-pFDHVPryaEQLFYDlqlkgYIPVIAHPErnreirenPSLLYHL  153
DSSP  LLllhhhllEEEEEL-lLLLLLllhHHHHHHhhhllLEEEEELHHhlhhhhhlLHHHHHH


DSSP  HHHHlLEEEELHHHH-HHLLLLL----LLLHHHHhhllLLEEELLLLLLlllLLLLHHHH
Query LAHRgVVATLLPTAF-YFLKETK----LPPVVALrkagVPXAVSSDINPgtaPIVSLRXA  327
ident                            |  | |         | ||             |
Sbjct VEKG-AASQITSGSLaGIFGKQLkafsLRLVEAN----LIHFVASDAHNvktRNFHTQEA  208
DSSP  HHLL-LEEEEEHHHHlLLLLHHHhhhhHHHHHLL----LLLEEELLLLLlllLLLLHHHH


DSSP  HHHHHHhhLLLHHHHHHHLlHHHHHHLLLLLlllllllllllleeeellllllhhhhlll
Query XNXACTlfGLTPVEAXAGVtRHAARALGEQEqlgqlrvgxladflvwncghpaelsylig  387
ident                       |   |  |                              
Sbjct LYVLEK--EFGSELPYMLT-ENAELLLRNQT-----------------------------  236
DSSP  HHHHHH--HHLLHHHHHHH-HHHHHHHLLLL-----------------------------


DSSP  llleeeeeelleelll
Query vdqlvsrvvngeetlh  403
ident                 
Sbjct -----ifrqppqpvkr  247
DSSP  -----lllllllllll


No 48: Query=2oofA Sbjct=4dziC Z-score=12.1

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ----------------------------------------------------------al    2
DSSP  ----------------------------------------------------------ll


DSSP  EELEEEEEELlLLLLllhhhhhhhhhlllhhhhhhllllhhhhhHHHHHL----------
Query TPGLIDCHTHlIFAGsraeefelrqkgvpyaeiarkgggiistvRATRAA----------  110
ident     ||   |                                                  
Sbjct NYRVIDVDNH-YYEP-----------------------------LDSFTRhldkkfkrrg   32
DSSP  LLLEEEEEEE-LLLL-----------------------------LLLLLLlllhhhllll


DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------s  111
ident                                                             
Sbjct vqmlsdgkrtwavigdrvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverla   92
DSSP  eeeeelllleeeeelleellllllllllleelllllhhhhhllllllllhhhllleelhh


DSSP  hhhhhHHHHHHHHHHHHHLEEEEEEEL----------------lllLLHHHHHHHHHHHH
Query edqlfELALPRVKSLIREGVTTVEIKS----------------gygLTLEDELKXLRVAR  155
ident           |          |                              |       
Sbjct dhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhdieatmaSVHAFNLWLDEDWG  152
DSSP  hlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllllhhhhhhHHHHHHHHHHHHLL


DSSP  hhHHHLlLEEEEEEEEEllllhhhlllhhHHHHHHHhLHHHHHHHlLLLLEEEEEELL--
Query rlGEALpIRVKTTLLAAhavppeyrddpdSWVETICqEIIPAAAEaGLADAVDVFCEH--  213
ident         |                            |          |  | |      
Sbjct -fDRPD-HRIIAAPIVS-----------lADPTRAV-EEVDFVLA-RGAKLVLVRPAPvp  197
DSSP  -lLLLL-LLEEELLLLL-----------lLLHHHHH-HHHHHHHH-LLLLLEELLLLLll


DSSP  ----llLLHH-hhHHHHHHHHHLLLEEEEE----------------------ellLLLL-
Query ----igFSLA-qtEQVYLAADQYGLAVKGH----------------------xdqLSNL-  245
ident                |       |  |  |                              
Sbjct glvkprSLGDrshDPVWARLAEAGVPVGFHlsdsgylhiaaawggakdpldqvllDDRAi  257
DSSP  llllllLLLLhhhHHHHHHHHHHLLLEEEEllllllhhhhhhllllllhhhhhhhLLHHh


DSSP  -LHHHH--------hhHLLLLEEE-ELLLLLHHH-------------------hHHHHhH
Query -GGSTL--------aaNFGALSVD-HLEYLDPEG-------------------iQALAhR  276
ident                             |                           |   
Sbjct hDTMASmivhgvftrhPKLKAVSIeNGSYFVHRLikrlkkaantqpqyfpedpvEQLR-N  316
DSSP  hHHHHHhhhllhhhhlLLLLEEEElLLLLHHHHHhhhhhhhhhhlhhhllllhhHHHH-H


DSSP  LLEEEELHhhhhhlllllLLLHHHHHHLLL--LEEELLLLLLLLLlLLLHHHHhHHHHHh
Query GVVATLLPtafyflketkLPPVVALRKAGV--PXAVSSDINPGTApIVSLRXAxNXACTl  334
ident  |                      |            ||   |     |           
Sbjct NVWIAPYY----------EDDLPELARVIGvdKILFGSDWPHGEG-LASPVSF-TAELK-  363
DSSP  HEEELLLL----------LLLHHHHHHHHLhhHLLLLLLLLLLLL-LLLHHHH-HHHHL-


DSSP  hLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlllllleeee
Query fGLTPVEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsyligvdqlvsr  394
ident  |             |   ||                                       
Sbjct -GFSESDIRKIMRDNALDLLG---------------------------------------  383
DSSP  -LLLHHHHHHHHLHHHHHHHL---------------------------------------


DSSP  eelleelll
Query vvngeetlh  403
ident          
Sbjct ----vqvgs  388
DSSP  ----lllll


No 49: Query=2oofA Sbjct=2qpxA Z-score=11.9

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct --------------------------------------------------gxddlsefvd   10
DSSP  --------------------------------------------------lllllhhhhh


DSSP  EELEEEEEELlLLLL----lLHHHHH-----------hhhhlllhhhhhhllllhhhhhh
Query TPGLIDCHTHlIFAG----sRAEEFE-----------lrqkgvpyaeiarkgggiistvr  105
ident    | | | |          |                                       
Sbjct QVPLLDHHCH-FLIDgkvpnRDDRLAqvsteadkdypladtknrlayhgflalakefald   69
DSSP  HLLEEEEEEL-LLLLlllllHHHHHHhhlllllllllhhhhlllhhhhhhhhhhhhhlll


DSSP  hhhhllhhhhhhhhhHHHHHHHHHLEEEEEEELLLLllhhhhhhhhHHHHHHHHHLLLEE
Query atraasedqlfelalPRVKSLIREGVTTVEIKSGYGltledelkxlRVARRLGEALPIRV  165
ident                               |  |                   |   | |
Sbjct annplaaxndpgyatYNHRIFGHFHFKELLIDTGFV-----pddpiLDLDQTAELVGIPV  124
DSSP  lllllllllhhhhhhHHHHHHHHLLEEEEEEELLLL-----lllllLLHHHHHHHHLLLE


DSSP  EEEEEEELLLLHhHLLL--hhHHHHHHHhLHHHHHHHlLLLLEEEEEELLL---------
Query KTTLLAAHAVPPeYRDD--pdSWVETICqEIIPAAAEaGLADAVDVFCEHI---------  214
ident |                     |           |                         
Sbjct KAIYRLETHAEDfXLEHdnfaAWWQAFS-NDVKQAKA-HGFVGFXSIAAYRvglhlepvn  182
DSSP  EEEEEHHHHHHHhHLLLllhhHHHHHHH-HHHHLLLL-LLLLLEEELHHHHlllllllll


DSSP  ----------------------llLHHHHHHHHHHHHHLLLEEEEEELLL-------LLL
Query ----------------------gfSLAQTEQVYLAADQYGLAVKGHXDQL-------SNL  245
ident                                |             |              
Sbjct vieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadtdxyLGN  242
DSSP  hhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllllhhHLL


DSSP  L-------hhhhhhHLLLlEEEELLLLLHHHHHHHHHH-LLEEEEL-HHHHHHlllllll
Query G-------gstlaaNFGAlSVDHLEYLDPEGIQALAHR-GVVATLL-PTAFYFlketklp  296
ident                       |      |                              
Sbjct PllxrdylkaftkkGLKV-VLLHCYPYHREAGYLASVFpNLYFDISlLDNLGP--sgasr  299
DSSP  HhhhhhhhhhhhhhLLLE-EEEELLLLHHHHHHHHHHLlLEEEELLlHHHHLH--hhhhh


DSSP  LHHHHHHLLL--LEEELLLLLLlllLLLL--HHHHHHHH--------hhhhllLHHHHHH
Query PVVALRKAGV--PXAVSSDINPgtaPIVS--LRXAXNXA--------ctlfglTPVEAXA  344
ident                  ||             |                          |
Sbjct VFNEAVELAPytRILFASDAST-ypEXYGlaARQFKQALvahfnqlpfvdlaqKKAWINA  358
DSSP  HHHHHLLLLLhhHEELLLLLLL-lhHHHHhhHHHHHHHHhhhhhllllllhhhHHHHHHH


DSSP  HLLHHHHHHLLLLlLLLLLllllllleeeellllllhhhhlllllleeeeeelleelll
Query GVTRHAARALGEQeQLGQLrvgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
ident       |                                                    
Sbjct ICWQTSAKLYHQE-RELRV----------------------------------------  376
DSSP  HHLHHHHHHLLLH-HHHLL----------------------------------------


No 50: Query=2oofA Sbjct=3dcpA Z-score=11.2

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLLLLLlhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query tpGLIDCHTHLIFAGSraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident      | |||  |                                               
Sbjct --XKRDGHTHTEFCPH-------------------------------------gthdDVE   21
DSSP  --LLEEEEELLLLLLL-------------------------------------llllLHH


DSSP  HHHHHHHHHLEEEEEEELL---------------------LLLLHhHHHHHHHHHHHHHH
Query PRVKSLIREGVTTVEIKSG---------------------YGLTLeDELKXLRVARRLGE  159
ident   |   |        |                              |             
Sbjct EXVLKAIELDFDEYSIVEHaplssefxkntagdkeavttaSXAXS-DLPYYFKKXNHIKK   80
DSSP  HHHHHHHHLLLLEEEEEEEllllhhhhhllllllhhhhllLLLHH-HHHHHHHHHHHHHH


DSSP  HL--LLEEEEEEeeellllhhhlllhhhhhhhhhhlhhhhhhhllllleeEEEElllllL
Query AL--PIRVKTTLlaahavppeyrddpdswveticqeiipaaaeagladavDVFCehigfS  217
ident                                                    |        
Sbjct KYasDLLIHIGF--------------------------------------EVDY-----L   97
DSSP  HLllLLEEEEEE--------------------------------------EEEL-----L


DSSP  HHHhHHHHHHHHHLLL----eeEEEE---------------------------------l
Query LAQtEQVYLAADQYGL----avKGHX---------------------------------d  240
ident     |                                                       
Sbjct IGY-EDFTRDFLNEYGpqtddgVLSLhflegqggfrsidfsaedynegivqfyggfeqaq  156
DSSP  LLL-HHHHHHHHHHHHhhlleeEEELleeeelleeeellllhhhhhhhlhhhhllhhhhh


DSSP  llLLLL---HHHH-hhhlLLLEEEELL---------------------llLHHHHHHHHH
Query qlSNLG---GSTL-aanfGALSVDHLE---------------------ylDPEGIQALAH  275
ident      |                  |                                   
Sbjct laYLEGvkqSIEAdlglfKPRRXGHISlcqkfqqffgedtsdfseevxekFRVILALVKK  216
DSSP  hhHHHHhhhHHHLlllllLLLEELLLLhhhllhhhhlllhhhllhhhhhhHHHHHHHHHH


DSSP  HLLEEEELHhHHHHL-LLLL----llLHHHHHHLLLLEEELLLLLLlllLLLLhhHHHHH
Query RGVVATLLPtAFYFL-KETK----lpPVVALRKAGVPXAVSSDINPgtaPIVSlrXAXNX  330
ident |         |  |             |        |    ||                 
Sbjct RDYELDFNT-AGLFKpLCGEtyppkkIVTLASELQIPFVYGSDSHG--vQDIG--RGYST  271
DSSP  HLLEEEEEL-HHHHLlLLLLllllhhHHHHHHHLLLLEEEELLLLL--hHHLL--LLHHH


DSSP  HHhhHLLLhhhhhhhllhhhhhhllllllllllllllllleeeellllllhhhhllllll
Query ACtlFGLTpveaxagvtrhaaralgeqeqlgqlrvgxladflvwncghpaelsyligvdq  390
ident  |    |                                                     
Sbjct YC--QKLE----------------------------------------------------  277
DSSP  HH--HHLL----------------------------------------------------


DSSP  eeeeeelleelll
Query lvsrvvngeetlh  403
ident              
Sbjct -------------  277
DSSP  -------------


No 51: Query=2oofA Sbjct=1m65A Z-score=11.0

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eelEEEEEElLLLLlllhhhhhhhhhlllhhhhhhllllHHHHhhhhhhllhhhhhhHHH
Query tpgLIDCHThLIFAgsraeefelrqkgvpyaeiarkgggIISTvratraasedqlfeLAL  120
ident      | |     |                                              
Sbjct --yPVDLHM-HTVA-------------------------STHA------------ysTLS   20
DSSP  --lLEELLL-LLLL-------------------------LLLL------------llLHH


DSSP  HHHHHHHHHLEEEEEEELL------LLLLhHHHHHHHHhhHHHHhHLLLEEEEEEEEEll
Query PRVKSLIREGVTTVEIKSG------YGLTlEDELKXLRvaRRLGeALPIRVKTTLLAAha  174
ident          |     |                                        |   
Sbjct DYIAQAKQKGIKLFAITDHgpdmedAPHH-WHFINMRI--WPRV-VDGVGILRGIEAN--   74
DSSP  HHHHHHHHHLLLEEEEEEEllllllLLLL-HHHHHHHH--LLLE-ELLEEEEEEEEEE--


DSSP  llhhhlllhhhhhhhhhhlHHHHHHhlLLLLEEEEEELLLLLLHHhhhhhhhhhhhllle
Query vppeyrddpdswveticqeIIPAAAeaGLADAVDVFCEHIGFSLAqteqvylaadqygla  234
ident                               |          |                  
Sbjct ----------iknvdgeidCSGKMF--DSLDLIIAGFHEPVFAPH---------------  107
DSSP  ----------lllllllllLLHHHH--HHLLEEEEELLLLLLLLL---------------


DSSP  eeeeellllLLLHHHHHHHLL-LLEEEELL-----LLLHHHHHHHHHHLLEEEELHHHhh
Query vkghxdqlsNLGGSTLAANFG-ALSVDHLE-----YLDPEGIQALAHRGVVATLLPTAfy  288
ident          |          |      |               | |   |          
Sbjct -----dkatNTQAMIATIASGnVHIISHPGnpkyeIDVKAVAEAAAKHQVALEINNSS--  160
DSSP  -----lhhhHHHHHHHHHHLLlLLEELLLLlllllLLHHHHHHHHHHHLLEEEEELLL--


DSSP  hllllLLLL-HHHHHHLLLLEEELLLLLLllllLLLHHhhHHHHHHHHL---LLHHHhhH
Query flketKLPP-VVALRKAGVPXAVSSDINPgtapIVSLRxaXNXACTLFG---LTPVEaxA  344
ident             | | ||   |  ||                            |     
Sbjct -----NCREvAAAVRDAGGWVALGSDSHT---aFTMGE--FEECLKILDavdFPPER--I  208
DSSP  -----LHHHhHHHHHHHLLLEEEELLLLL---hHHLLL--LHHHHHHHHhllLLHHH--L


DSSP  HLLHhhhhhLLLL--lllllllllLLLLeeeellllllhhhhlllllleeeeeelleell
Query GVTRhaaraLGEQ--eqlgqlrvgXLADflvwncghpaelsyligvdqlvsrvvngeetl  402
ident          |                                                  
Sbjct LNVS--prrLLNFlesrgmapiaeFADL--------------------------------  234
DSSP  HHHL--hhhHHHHhhhllllllhhHLLL--------------------------------


DSSP  l
Query h  403
ident  
Sbjct -  234
DSSP  -


No 52: Query=2oofA Sbjct=3au2A Z-score=10.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------lllleeeeeeeellllllLLLLllllleeeeeelleeeeeeehhhllllll
Query ---------lncervwlnvtpatlrsdLADYgllephalgvhegrihalvpxqdlkypah   51
ident                            |                                
Sbjct yaalglpwippplredqgeveaalegrLPKL-----------------------------  331
DSSP  hhhlllllllhhhlllllhhhhhhlllLLLL-----------------------------


DSSP  leelllleeEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhll
Query wqdxkgklvTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraas  111
ident               |   |                                         
Sbjct ------lelPQVKGDLQVHSTY--------------------------------------  347
DSSP  ------llhHHLLEEEEELLLL--------------------------------------


DSSP  hhhhhhHHHHHHHHHHHHLEEEEEEELL-------lLLLHHHHHHHHHHHHHHHHHLLL-
Query edqlfeLALPRVKSLIREGVTTVEIKSG-------yGLTLEDELKXLRVARRLGEALPI-  163
ident                   |                 |   |  ||     ||  |     
Sbjct -sdgqnTLEELWEAAKTMGYRYLAVTDHspavrvagGPSPEEALKRVGEIRRFNETHGPp  406
DSSP  -lllllLHHHHHHHHHHHLLLEEEEEEElhhhhlllLLLHHHHHHHHHHHHHHHHHHLLl


DSSP  EEEEEEeeellllhhhlllhhhhhhhhhhlhhhhhhhllllleeEEEEllllllHHHHHh
Query RVKTTLlaahavppeyrddpdswveticqeiipaaaeagladavDVFCehigfsLAQTEq  223
ident                                              |              
Sbjct YLLAGA--------------------------------------EVDI------HPDGT-  421
DSSP  EEEEEE--------------------------------------EEEL------LLLLL-


DSSP  hHHHHHhLLLE----EEEEE------llllLLLHHHHHHHLL-LLEEEELL---------
Query vYLAADqYGLA----VKGHX------dqlsNLGGSTLAANFG-ALSVDHLE---------  263
ident      |   |     |                     |          |           
Sbjct -LDYPD-WVLReldlVLVSVhsrfnlpkadQTKRLLKALENPfVHVLAHPTarllgrrap  479
DSSP  -LLLLH-HHHLllleEEEELlllllllhhhHHHHHHHHHLLLlLLEELLLLlllllllll


DSSP  --llLHHHHHHHHHHLLEEEELHHHHHhlllllLLLHHHHHHLLLLEEELLLLLllllLL
Query --ylDPEGIQALAHRGVVATLLPTAFYflketkLPPVVALRKAGVPXAVSSDINpgtaPI  321
ident          |     ||                          |     | |        
Sbjct ieadWEAVFQKAKEKGVAVEIDGYYDR--mdlpDDLARMAYGMGLWISLSTDAH----QT  533
DSSP  llllHHHHHHHHHHHLLEEEEELLLLL--llllHHHHHHHHHLLLLEEEELLLL----LH


DSSP  LLHhHHHHHHHHhHLLL--hhhhhHHLLHhhhhhllLLLLllllllllllleeeelllll
Query VSLrXAXNXACTlFGLT--pveaxAGVTRhaaralgEQEQlgqlrvgxladflvwncghp  379
ident   |      |                 |                                
Sbjct DHL-RFMELAVG-TAQRawigperVLNTL---dyedLLSW--------------------  568
DSSP  HHH-HHHHHHHH-HHHHlllllllLHHHL---lhhhHHHH--------------------


DSSP  lhhhhlllllleeeeeelleelll
Query aelsyligvdqlvsrvvngeetlh  403
ident                         
Sbjct -----------------lkarrgv  575
DSSP  -----------------hhlllll


No 53: Query=2oofA Sbjct=3iacA Z-score=10.3

back to top
DSSP  lllleeeeeeeelllllllLLLLLllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdlADYGLlephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                      |                                      
Sbjct ---atfxtedfllkndiarTLYHK---------------------------------yaa   24
DSSP  ---llllllllllllhhhhHHHHH---------------------------------lll


DSSP  EELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhHHHH
Query TPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfELAL  120
ident      | | ||                                                 
Sbjct PXPIYDFHCHLSP-------------------------------------------QEIA   41
DSSP  LLLEEELLLLLLH-------------------------------------------HHHH


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  120
ident                                                             
Sbjct ddrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnply  101
DSSP  hllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhh


DSSP  ---------------------------------------hHHHHHHHHLEEEEEEELLll
Query ---------------------------------------pRVKSLIREGVTTVEIKSGyg  141
ident                                                  |  |       
Sbjct hwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTDD--  159
DSSP  hhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLL--


DSSP  llhhhHHHHhHHHHHHHHH--LLLEEEEEEEeELLL-------LHHHLL-----------
Query ltledELKXlRVARRLGEA--LPIRVKTTLLaAHAV-------PPEYRD-----------  181
ident              |         | |         |          |             
Sbjct ----pIDSL-EYHRQIAADdsIDIEVAPSWR-PDKVfkieldgFVDYLRkleaaadvsit  213
DSSP  ----lLLLL-HHHHHHHHLllLLLEEELLLL-LHHHhllllllHHHHHHhhhhhhlllll


DSSP  lhhhHHHHHhHLHHHHHHhLLLLLEEEEEELLL---------------------------
Query dpdsWVETIcQEIIPAAAeAGLADAVDVFCEHI---------------------------  214
ident                  | |    | |   |                             
Sbjct rfddLRQAL-TRRLDHFA-ACGCRASDHGIETLrfapvpddaqldailgkrlagetlsel  271
DSSP  lhhhHHHHH-HHHHHHHH-HLLLLEEEEEELLLlllllllhhhhhhhhhhhhllllllhh


DSSP  ---llLHHHHHHHHHHHHHlLLEEEEEELLL--------------------------lll
Query ---gfSLAQTEQVYLAADQyGLAVKGHXDQL--------------------------snl  245
ident        |               |                                    
Sbjct eiaqfTTAVLVWLGRQYAA-RGWVXQLHIGAirnnntrxfrllgpdtgfdsigdnniswa  330
DSSP  hhhhhHHHHHHHHHHHHHH-HLLEEEEEELEellllhhhhhhhllllllleelllllhhh


DSSP  LHHH-----hhhhLLLLEEeELLL--LLHHHHHHHHHH-------LLEEEElhhHHHHll
Query GGST-----laanFGALSVdHLEY--LDPEGIQALAHR-------GVVATLlptAFYFlk  291
ident                                               |             
Sbjct LSRLldsxdvtneLPKTIL-YCLNprDNEVLATXIGNFqgpgiagKVQFGS--gWWFN-d  386
DSSP  HHHHhhhhhllllLLEEEE-EELLhhHHHHHHHHHHHLlllllllLEEELL--lLHHH-l


DSSP  lLLLL--LHHHHHHLLL---LEEELLLLLlllllLLLHHHHHHHHHHhhLLLH-------
Query eTKLP--PVVALRKAGV---PXAVSSDINpgtapIVSLRXAXNXACTlfGLTP-------  339
ident            |   |          |                       |         
Sbjct qKDGXlrQLEQLSQXGLlsqFVGXLTDSR-----SFLSYTRHEYFRR--ILCNllgqwaq  439
DSSP  lHHHHhhHHHHHHHHLLhhhLLLLLLLLL-----LLLLLHHHHHHHH--HHHHhhhhhhh


DSSP  ------------hHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlll
Query ------------vEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsylig  387
ident                       | |                                   
Sbjct dgeipddeaxlsrXVQDICFNNAQRYFT--------------------------------  467
DSSP  lllllllhhhhhhHHHHHHLHHHHHHLL--------------------------------


DSSP  llleeeeeelleelll
Query vdqlvsrvvngeetlh  403
ident                 
Sbjct --------------ik  469
DSSP  --------------ll


No 54: Query=2oofA Sbjct=1j5sA Z-score=10.2

back to top
DSSP  lllleeeeeeeelllllllLLLLlllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdlADYGllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ---hmflgedylltnraavRLFN----------------------------------evk   23
DSSP  ---llllllllllllhhhhHHHH----------------------------------hhl


DSSP  EELEEEEEELLL-----------------llLLLHHHHHHHHHLLLHHHHHHL-------
Query TPGLIDCHTHLI-----------------faGSRAEEFELRQKGVPYAEIARK-------   96
ident      | | ||                             |  ||    |          
Sbjct DLPIVDPHNHLDakdivenkpwndiwevegaTDHYVWELMRRCGVSEEYITGSrsnkekw   83
DSSP  LLLEEELLLLLLhhhhhhllllllhhhhhllLLHHHHHHHHHLLLLHHHLLLLllhhhhh


DSSP  ----------------------------lllhhhhhhhhhhllhhhhhhhhhHHHHHHHH
Query ----------------------------gggiistvratraasedqlfelalPRVKSLIR  128
ident                                                        | |  
Sbjct lalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRD  143
DSSP  hhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHH


DSSP  HLEEEEEEELLllllhhhHHHHhHHHHHHHHHLL-LEEEEEEEeELLL----lHHHLLL-
Query EGVTTVEIKSGygltledELKXlRVARRLGEALP-IRVKTTLLaAHAV----pPEYRDD-  182
ident   |                       |   ||        |               |   
Sbjct MKVEILCTTDD------pVSTL-EHHRKAKEAVEgVTILPTWR-PDRAmnvdkEGWREYv  195
DSSP  LLEEEEELLLL------lLLLL-HHHHHHHHHLLlLEEELLLL-LHHHhllllLLHHHHh


DSSP  ------------hhhhHHHHHHLHHHHHHhlLLLL-EEEEEELL----------------
Query ------------pdswVETICQEIIPAAAeaGLAD-AVDVFCEH----------------  213
ident                                     | |                     
Sbjct ekmgerygedtstldgFLNALWKSHEHFK--EHGCvASDHALLEpsvyyvdenraravhe  253
DSSP  hhhhhhhllllllhhhHHHHHHHHHHHHH--LLLLlEEEEEELLlllllllhhhhhhhhh


DSSP  -------------lllLHHHHHHHHHHHHHlLLEEEEEELLL------------------
Query -------------igfSLAQTEQVYLAADQyGLAVKGHXDQL------------------  242
ident                       |           |                         
Sbjct kafsgekltqdeindyKAFMMVQFGKMNQE-TNWVTQLHIGAlrdyrdslfktlgpdsgg  312
DSSP  hhlllllllhhhhhhhHHHHHHHHHHHHHH-HLLEEEEEELEellllhhhhhhlllllll


DSSP  ------LLLL-----hhhhhhHLLLLEEeELLL--LLHHHHHHHHHHL-LEEEELhhHHH
Query ------SNLG-----gstlaaNFGALSVdHLEY--LDPEGIQALAHRG-VVATLLptAFY  288
ident                                      |           |        | 
Sbjct distnfLRIAeglryflnefdGKLKIVL-YVLDptHLPTISTIARAFPnVYVGAP-wWFN  370
DSSP  leelllLLHHhhhhhhhhhllLLLLEEE-EELLhhHHHHHHHHHHHLLlEEELLL-lLLL


DSSP  HlllllllLHHHHHHLL---LLEEELLLlllllLLLL-LHHHHHHHHHHhhLLLH-----
Query FlketklpPVVALRKAG---VPXAVSSDinpgtAPIV-SLRXAXNXACTlfGLTP-----  339
ident             |              |          |             |       
Sbjct DspfgmemHLKYLASVDllyNLAGMVTD-----SRKLlSFGSRTEMFRR--VLSNvvgem  423
DSSP  LlhhhhhhHHHHHHLLLlhhHLLLLLLL-----LLLLlHHHHHHHHHHH--HHHHhhhhh


DSSP  ------------HHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlll
Query ------------VEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsylig  387
ident                                                             
Sbjct vekgqipikearELVKHVSYDGPKALFF--------------------------------  451
DSSP  hhlllllhhhhhHHHHHHHLHHHHHHHL--------------------------------


DSSP  llleeeeeelleelll
Query vdqlvsrvvngeetlh  403
ident                 
Sbjct ----------------  451
DSSP  ----------------


No 55: Query=2oofA Sbjct=3f2bA Z-score=9.4

back to top
DSSP  ------------lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllL
Query ------------lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkY   48
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaeL   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhH


DSSP  LLLLE---------------------------------elllleEEELEEEEEELLLLLl
Query PAHWQ---------------------------------dxkgklVTPGLIDCHTHLIFAg   75
ident                                                             
Sbjct MSGVKkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtaPEGEKRVELHLHTPM-  119
DSSP  HHLLLllleeeeeeeeeeelllleeeeeeeeeeeelllllllllLLLLLLLLLLLLLLL-


DSSP  llhhhhhhhhhlllhhhhhhllllhhhhHHHHhhllhhhhhhHHHHHHHHHHHHLEEEEE
Query sraeefelrqkgvpyaeiarkgggiistVRATraasedqlfeLALPRVKSLIREGVTTVE  135
ident                                                       |     
Sbjct ----------------------------SQMD-------avtSVTKLIEQAKKWGHPAIA  144
DSSP  ----------------------------LLLL-------lllLHHHHHHHHHHLLLLLEE


DSSP  EELLllllhhhHHHHHHHHHHHHHHLLLEEEEEEEEE-------------------llll
Query IKSGygltledELKXLRVARRLGEALPIRVKTTLLAA-------------------havp  176
ident                   |          |   | |                        
Sbjct VTDH------aVVQSFPEAYSAAKKHGMKVIYGLEANivddpfhvtllaqnetglknlfk  198
DSSP  ELLL------lLLLLHHHHHHHHHHHLLLEEEEEEEEeellleeeeeeellhhhhhhhhh


DSSP  hhhlllHHHH-hhHHHHlhhhhhhhllllleeeeeellllllhhhhhHHHHHHHhllLEE
Query peyrddPDSW-veTICQeiipaaaeagladavdvfcehigfslaqteQVYLAADqygLAV  235
ident                                                      |      
Sbjct lvslshIQYFhrvPRIP----------------------------rsVLVKHRD---GLL  227
DSSP  hhhhhhLLLLlllLLEE----------------------------hhHHHHLLL---LEE


DSSP  EEE-----ELLLLLLLHHHHHhhlllleeeelllllhhhhhhhhhhlLEEEELHhhHHHL
Query KGH-----XDQLSNLGGSTLAanfgalsvdhleyldpegiqalahrgVVATLLPtaFYFL  290
ident  |                                                   |      
Sbjct VGSgcdkgELFDNVEDIARFY--------------------------DFLEVHP--PDVY  259
DSSP  EELlllllLLLLLLLLLHHHL--------------------------LLEEELL--HHHH


DSSP  L---------LLLLLL--HHHHHHLLLLEEELLLLLL-----------------------
Query K---------ETKLPP--VVALRKAGVPXAVSSDINP-----------------------  316
ident |                 |    |   |                                
Sbjct KplyvkdeemIKNIIRsiVALGEKLDIPVVATGNVHYlnpedkiyrkilihsqgganpln  319
DSSP  LllllllhhhHHHHHHhhHHHHHHLLLLEEELLLLLLllhhhhhhhhhhhhllhhhllll


DSSP  ----LLLLlLLHH-HHHHHHHhhhLLLHHHHHHHLLHHHHHHLLL---------------
Query ----GTAPiVSLR-XAXNXACtlfGLTPVEAXAGVTRHAARALGE---------------  356
ident                          | |  |   |                         
Sbjct rhelPDVY-FRTTnEMLDCFS---FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpr  375
DSSP  llllLLLL-LLLHhHHHHHHH---HHHHHHHHHHHLHHHHHHHHLlllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  356
ident                                                             
Sbjct aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll


DSSP  --------------------------------lllllllllllllleeeellllllhhhh
Query --------------------------------qeqlgqlrvgxladflvwncghpaelsy  384
ident                                                             
Sbjct rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh


DSSP  lllllleeeeeelleelll
Query ligvdqlvsrvvngeetlh  403
ident                    
Sbjct lesrgcldslpdhnqlslf  994
DSSP  hhhllllllllllllllll


No 56: Query=2oofA Sbjct=1bksA Z-score=8.5

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------meryenlfaqln   12
DSSP  ------------------------------------------------lhhhhhhhhhhh


DSSP  EELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhLLHHHHHHHHH
Query TPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraASEDQLFELAL  120
ident                                                      |      
Sbjct DRREGAFVPFVTLG----------------------------------dPGIEQSLKIID   38
DSSP  HLLLLEEEEEEELL----------------------------------lLLHHHHHHHHH


DSSP  HHHHHHhhhleeeEEEELLLLL----------------------LHHHHHHHHHHHHHHH
Query PRVKSLiregvttVEIKSGYGL----------------------TLEDELKXLRVARRLG  158
ident                   |                         |       |   |   
Sbjct TLIDAG------aDALELGVPFsdpladgptiqnanlrafaagvTPAQCFEMLALIREKH   92
DSSP  HHHHLL------lLLEEEELLLlllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHL


DSSP  HhlllEEEEEEEeeLLLLhhhlllhhhHHHHhHHLHHHHHHhLLLLLEEEEEelllLLLH
Query EalpiRVKTTLLaaHAVPpeyrddpdsWVETiCQEIIPAAAeAGLADAVDVFcehiGFSL  218
ident           ||                                  | | |         
Sbjct P----TIPIGLL--MYAN-------lvFNNG-IDAFYARCE-QVGVDSVLVA----DVPV  133
DSSP  L----LLLEEEE--ELHH-------hhHLLL-HHHHHHHHH-HHLLLEEEEL----LLLH


DSSP  HHHHHHHHHHHHLLLEEEEEELlLLLL-lHHHHHHHLLLLEEEELlllLHHHHHHHHHHL
Query AQTEQVYLAADQYGLAVKGHXDqLSNL-gGSTLAANFGALSVDHLeylDPEGIQALAHRG  277
ident         ||     |                  |  |      |       |  |    
Sbjct EESAPFRQAALRHNIAPIFICP-PNADddLLRQVASYGRGYTYLLalpLHHLIEKLKEYH  192
DSSP  HHLHHHHHHHHHLLLEEEEEEL-LLLLhhHHHHHHHHLLLLEEELlllHHHHHHHHHHHL


DSSP  L-EEEELHHHHHhllllllllhhhhhhlllLEEELlLLLLlLLLL---------------
Query V-VATLLPTAFYflketklppvvalrkagvPXAVSsDINPgTAPI---------------  321
ident    |                            |                           
Sbjct AaPALQGFGISS--------peqvsaavraGAAGA-ISGS-AIVKiieknlaspkqmlae  242
DSSP  LlLEEELLLLLL--------hhhhhhhhhhLLLEE-EELL-HHHHhhhhllllhhhhhhh


DSSP  ------lLHHHHHhhhhhhhlllhhhhhhhllhhhhhhllllllllllllllllleeeel
Query ------vSLRXAXnxactlfgltpveaxagvtrhaaralgeqeqlgqlrvgxladflvwn  375
ident                                                             
Sbjct lrsfvsaMKAASR-----------------------------------------------  255
DSSP  hhhhhhhHHHLLL-----------------------------------------------


DSSP  lllllhhhhlllllleeeeeelleelll
Query cghpaelsyligvdqlvsrvvngeetlh  403
ident                             
Sbjct ----------------------------  255
DSSP  ----------------------------


No 57: Query=2oofA Sbjct=2anuA Z-score=7.9

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllleE
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklV   60
ident                                                             
Sbjct -----------------------------------------------------------T    1
DSSP  -----------------------------------------------------------L


DSSP  EELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query TPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident    | | | |                                                  
Sbjct EWLLCDFHVHTNX---------------------------------------sdghlPLG   22
DSSP  EEEEEEEEELLLL---------------------------------------lllllLHH


DSSP  HHHHHHHHHLEEEEEEELL------------------LLLLHhHHHHHHHHHHHHHHHLL
Query PRVKSLIREGVTTVEIKSG------------------YGLTLeDELKXLRVARRLGEALP  162
ident   |      ||  | |                                |    |      
Sbjct EVVDLFGKHGVDVVSITDHivdrrtleqrkrngeplgAITED-KFQDYLKRLWREQKRAW   81
DSSP  HHHHHHHHLLLLEEEEEEEeelhhhhhhhhhllllllLLLLL-LHHHHHHHHHHHHHHHH


DSSP  ----LEEEEEEEeellllhhhlllhhhhhhhhhhlhhhhhhhllllleeeEEELLLL---
Query ----IRVKTTLLaahavppeyrddpdswveticqeiipaaaeagladavdVFCEHIG---  215
ident                                                             
Sbjct eeygXILIPGVE--------------------------------------ITNNTDLyhi  103
DSSP  hhhlLEEEEEEE--------------------------------------EEELLLLeee


DSSP  ----------LLHHhHHHHHHHHHhLLLEEEeeelllllllhhhhhhhllllEEEEL---
Query ----------FSLAqTEQVYLAADqYGLAVKghxdqlsnlggstlaanfgalSVDHL---  262
ident            ||   |           |                          |    
Sbjct vavdvkeyvdPSLP-VEEIVEKLK-EQNALV---------------------IAAHPdrk  140
DSSP  eeelllllllLLLL-HHHHHHHHH-HLLLEE---------------------EELLLlll


DSSP  ----lLLLHhhHHHHHHHlLEEE-ELHHhhhhllllllllHHHHHHLLLLEEELLLLLll
Query ----eYLDPegIQALAHRgVVAT-LLPTafyflketklppVVALRKAGVPXAVSSDINpg  317
ident                                                       ||    
Sbjct klswyLWAN--XERFKDTfDAWEiANRD----------dlFNSVGVKKYRYVANSDFH--  186
DSSP  llllhHHHL--LLLLLLLlLEEEeEELL----------eeLHHHHHLLLLEEEELLLL--


DSSP  llLLLLhHHHHhhhhhhhlllhhhhhhHLLH---hhhhhLLLLllllllllllllleeee
Query taPIVSlRXAXnxactlfgltpveaxaGVTR---haaraLGEQeqlgqlrvgxladflvw  374
ident                                          |                  
Sbjct --ELWH-VYSW----------------KTLVkseknieaIKEA---------------ir  212
DSSP  --LHHH-HLLE----------------EEEEeelllhhhHHHH---------------hh


DSSP  llllllhhHHLLlllleeeeeelleelll
Query ncghpaelSYLIgvdqlvsrvvngeetlh  403
ident                              
Sbjct kntdvaiyLXRK-----------------  224
DSSP  hllleeeeELLL-----------------


No 58: Query=2oofA Sbjct=2yb1A Z-score=6.7

back to top
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eelEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query tpgLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident     || | |                                                  
Sbjct --aNIDLHFHSRT---------------------------------------sdgalTPT   19
DSSP  --lLEELLLLLLL---------------------------------------lllllLHH


DSSP  HHHHHHHHHLEEEEEEELLllllhhhhhHHHHHHHHHHHHLLLEEEEEEeeellllhhhl
Query PRVKSLIREGVTTVEIKSGygltledelKXLRVARRLGEALPIRVKTTLlaahavppeyr  180
ident                               |  |        |                 
Sbjct EVIDRAAARAPALLALTDH------dctGGLAEAAAAAARRGIPFLNGV-----------   62
DSSP  HHHHHHHLLLLLEEEELLL------lllLLHHHHHHHHHHLLLLEEEEE-----------


DSSP  llhhhhhhhhhhlhhhhhhhllllleeEEEEllllLLHHHH--------hhhhhHHHHLL
Query ddpdswveticqeiipaaaeagladavDVFCehigFSLAQT--------eqvylAADQYG  232
ident                             |           |             |     
Sbjct ---------------------------EVSV----SWGRHTvhivglgidpaepALAAGL   91
DSSP  ---------------------------EEEE----EELLEEeeeeeellllllhHHHHHH


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  232
ident                                                             
Sbjct ksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrt  151
DSSP  hhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhh


DSSP  -leeeeeelllllllhhhhhhHLLL---------LEEEELL------llLHHHHHHHHH-
Query -lavkghxdqlsnlggstlaaNFGA---------LSVDHLE------ylDPEGIQALAH-  275
ident                                       |              |      
Sbjct vfrkyltpgkpgyvshqwaslEDAVgwivgaggmAVIAHPGrydmgrtlIERLILDFQAa  211
DSSP  hhhhllllllllllllllllhHHHHhhhhhllleEEELLHHhllllhhhHHHHHHHHHHl


DSSP  HLLEEEELHHHHhhllLLLL--LLHHHHHHLLLLEEELLLLLLLllLLLLHhhHHHHhhh
Query RGVVATLLPTAFyflkETKL--PPVVALRKAGVPXAVSSDINPGtaPIVSLrxAXNXact  333
ident  |                             |      ||        |           
Sbjct GGQGIEVASGSH----SLDDmhKFALHADRHGLYASSGSDFHAP-gEDVGH--TEDL---  261
DSSP  LLLEEEEEELLL----LHHHhhHHHHHHHHHLLEEEEELLLLLL-lLLLLL--LLLL---


DSSP  hHLLLhhhhhhhllHHHHHhllLLLLllllllllllleeeellllllhhhhlllllleee
Query lFGLTpveaxagvtRHAARalgEQEQlgqlrvgxladflvwncghpaelsyligvdqlvs  393
ident                                                             
Sbjct -PPIC--------rPIWRE---LEAR----------------------------------  275
DSSP  -LLLL--------lLHHHH---LHHH----------------------------------


DSSP  eeelleelll
Query rvvngeetlh  403
ident           
Sbjct -ilrpadaen  284
DSSP  -lllllhhhl


No 59: Query=2oofA Sbjct=3e38A Z-score=6.1

back to top
DSSP  lllleeeeeeeeLLLLLlllllllllleeeeeelleeeeeeehhhllllllleellllee
Query lncervwlnvtpATLRSdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
ident               |                                             
Sbjct ---aqrrneiqvPDLDG------------------------------------------y   15
DSSP  ---lllllllllLLLLL------------------------------------------l


DSSP  EELEEEEEElLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH
Query TPGLIDCHThLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
ident |    | |                                                    
Sbjct TTLKCDFHX-HSVF--------------------------------------sdglvWPT   36
DSSP  EEEEEELLL-LLLL--------------------------------------lllllLHH


DSSP  HHHHHHHHHLEEEEEEELLLLL------lhHHHHHHHHHHHHHHHHLLLEEEEEEEeELL
Query PRVKSLIREGVTTVEIKSGYGL------tlEDELKXLRVARRLGEALPIRVKTTLLaAHA  174
ident  ||    | |                     |        |   | | |           
Sbjct VRVDEAYRDGLDAISLTEHIEYrphkqdvvSDHNRSFDLCREQAEKLGILLIKGSE-ITR   95
DSSP  HHHHHHHHLLLLEELLEEELLLllllllllLLLLHHHHHHHHHHHHHLLEELLEEE-EEL


DSSP  LlhhhlllhhhhhhhhhhLHHHhhhhllllleeeeeellllllhhHHHHHHHHHHHLLLE
Query VppeyrddpdswveticqEIIPaaaeagladavdvfcehigfslaQTEQVYLAADQYGLA  234
ident                                                      |   |  
Sbjct A---xapghfnaiflsdsNPLE---------------------qkDYKDAFREAKKQGAF  131
DSSP  L---lllleeeeelllllHHHL---------------------llLHHHHHHHHHHLLLE


DSSP  EEEE-ELLL------LLLL-hHHHHHH-LLLLEEEE----lLLLLhhhHHHHHHHLLEEE
Query VKGH-XDQL------SNLG-gSTLAAN-FGALSVDH----lEYLDpegIQALAHRGVVAT  281
ident                       |                         ||          
Sbjct XFWNhPGWDsqqpdtTKWWpeHTALYQeGCXHGIEVanghlYXPE--aIQWCLDKNLTXI  189
DSSP  EEELlLLLLllllllLLLLhhHHHHHHlLLLLEEEEeelleELLH--hHHHHHHHLLEEE


DSSP  elhhhhhhllllllllhhhhhhlllleeELLLLllllLLLL-------lhHHHHhhhhhh
Query llptafyflketklppvvalrkagvpxaVSSDInpgtAPIV-------slRXAXnxactl  334
ident                               |||                           
Sbjct ----------------------------GTSDI----HQPIqtdydfekgEHRT------  211
DSSP  ----------------------------EELLL----LLLHhhhllhhhlLLLL------


DSSP  hlllhhhhhhHLLH---hhhhhLLLL----------------------------llllll
Query fgltpveaxaGVTR---haaraLGEQ----------------------------eqlgql  363
ident                         |                                   
Sbjct ---------xTFVFakerslqgIREAldnrrtaayfhelligredllrpffekcvkieev  262
DSSP  ---------eEEEEellllhhhHHHHhhllleeeeelleeellhhhhhhhhhhheeeeee


DSSP  llllllleeeelLLLLLH----------------------------------------hh
Query rvgxladflvwnCGHPAE----------------------------------------ls  383
ident                                                             
Sbjct srneqgvtlsitNVTDLVlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvn  322
DSSP  eeelleeeeeeeELLLLLeeeeelllllleellleeeellleeeeeeeeellllllleee


DSSP  hlllllleeeeeelleelll
Query yligvdqlvsrvvngeetlh  403
ident                     
Sbjct fevtnfivapdkglkytisl  342
DSSP  eeeeeeeeelleeeeeeeel