Results: dupa

Query: 2ogjA

MOLECULE: DIHYDROOROTASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2ogj-A 73.0  0.0  379   379  100 PDB  MOLECULE: DIHYDROOROTASE;                                            
   2:  4cqb-A 26.8  3.7  313   402   13 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   3:  2vun-A 26.5  3.4  315   385   21 PDB  MOLECULE: ENAMIDASE;                                                 
   4:  3gri-A 25.9  3.3  312   422   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
   5:  1k6w-A 25.4  3.8  309   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   6:  3mtw-A 25.1  3.8  305   404   16 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   7:  2paj-A 25.0  4.1  314   421   17 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   8:  1gkp-A 24.9  3.4  318   458   17 PDB  MOLECULE: HYDANTOINASE;                                              
   9:  3giq-A 24.8  3.2  312   475   19 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  10:  1onx-A 24.7  3.1  303   390   17 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  11:  3mkv-A 24.6  3.9  302   414   18 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  12:  2oof-A 24.3  3.9  303   403   17 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  13:  3nqb-A 24.3  3.3  298   587   19 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  14:  3e74-A 24.0  3.4  301   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  15:  3ls9-A 23.7  4.0  311   453   14 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  16:  1j6p-A 23.6  4.0  310   407   15 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  17:  4b3z-D 23.2  3.5  319   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  18:  1yrr-B 22.5  3.6  296   334   15 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  19:  4c5y-A 22.1  4.2  298   436   15 PDB  MOLECULE: OCHRATOXINASE;                                             
  20:  2uz9-A 21.3  4.4  309   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  21:  3icj-A 20.3  3.8  274   468   18 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  22:  4rdv-B 19.5  3.7  299   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  23:  3ooq-A 18.6  3.7  267   384   17 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  24:  1a5k-C 18.4  3.3  297   566   18 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  25:  2imr-A 18.3  5.4  294   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  26:  2y1h-B 16.4  2.9  221   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  27:  4mup-B 15.7  3.0  222   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  28:  2ffi-A 15.5  2.9  218   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  29:  3cjp-A 15.5  2.8  213   262   16 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  30:  1bf6-A 15.5  3.1  225   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  31:  4dlf-A 15.3  3.0  226   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  32:  1a4m-A 15.0  3.1  224   349   16 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  33:  3k2g-B 14.9  3.5  227   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  34:  2vc5-A 14.5  3.2  222   314   16 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  35:  2ob3-A 14.3  3.3  216   329   18 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  36:  3gg7-A 14.2  3.1  216   243   15 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  37:  3pnu-A 14.0  3.8  239   338   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  38:  4hk5-D 13.9  3.7  234   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  39:  3irs-A 13.7  3.2  215   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  40:  2dvt-A 13.4  3.5  222   325   16 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  41:  4ofc-A 13.0  3.4  221   335   12 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  42:  2gwg-A 12.5  3.8  228   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  43:  1v77-A 12.4  3.5  181   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  44:  1itq-A 12.2  3.4  219   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  45:  2qpx-A 12.1  3.6  215   376   14 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  46:  3qy6-A 11.9  2.8  186   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  4qrn-A 11.6  3.7  212   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  48:  4dzi-C 11.5  3.7  213   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  1j5s-A 11.2  3.7  224   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  50:  2a3l-A 11.0  3.6  235   616   13 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  3iac-A 10.4  3.7  221   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3au2-A  9.3  7.3  192   575   18 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3dcp-A  8.0  3.4  166   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  7.6  3.7  177   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  6.4  7.9  168   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  5.7  3.8  156   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  5.1  3.8  142   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  4.5  4.1  146   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  4.4  4.7  158   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2ogjA Sbjct=2ogjA Z-score=73.0

back to top
DSSP  LLLEEEEEEEELLLLLLLLLLLEEEEELLLLLEEEEELLLLLLLLEEELLLLEEEELEEE
Query QAPILLTNVKPVGFGKGASQSSTDILIGGDGKIAAVGSALQAPADTQRIDAAFISPGWVD   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QAPILLTNVKPVGFGKGASQSSTDILIGGDGKIAAVGSALQAPADTQRIDAAFISPGWVD   60
DSSP  LLLEEEEEEEELLLLLLLLLLLEEEEELLLLLEEEEELLLLLLLLEEELLLLEEEELEEE


DSSP  EEELLLLLLLLLLLLHHHLLHHHLEEEEEEELLLLLLLHHHHHHHLLLLLLLEEEEEEEL
Query LHVHIWHGGTDISIRPSECGAERGVTTLVDAGSAGEANFHGFREYIIEPSRERIKAFLNL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LHVHIWHGGTDISIRPSECGAERGVTTLVDAGSAGEANFHGFREYIIEPSRERIKAFLNL  120
DSSP  EEELLLLLLLLLLLLHHHLLHHHLEEEEEEELLLLLLLHHHHHHHLLLLLLLEEEEEEEL


DSSP  LLLLLLLLLLLLLLLLHHHLLHHHHHHHHHLLLLLEEEEEEEELHHHHLLLLLHHHHHHH
Query GSIGLVACNRVPELRDIKDIDLDRILECYAENSEHIVGLXVRASHVITGSWGVTPVKLGK  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GSIGLVACNRVPELRDIKDIDLDRILECYAENSEHIVGLXVRASHVITGSWGVTPVKLGK  180
DSSP  LLLLLLLLLLLLLLLLHHHLLHHHHHHHHHLLLLLEEEEEEEELHHHHLLLLLHHHHHHH


DSSP  HHHHHHLLLEEEEELLLLLLHHHHHHHLLLLLEEELLLLLLLLLLLLLLHHHHHHHHHLL
Query KIAKILKVPXXVHVGEPPALYDEVLEILGPGDVVTHCFNGKSGSSIXEDEDLFNLAERCE  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KIAKILKVPXXVHVGEPPALYDEVLEILGPGDVVTHCFNGKSGSSIXEDEDLFNLAERCE  240
DSSP  HHHHHHLLLEEEEELLLLLLHHHHHHHLLLLLEEELLLLLLLLLLLLLLHHHHHHHHHLL


DSSP  LLEEELLLLLLLLLHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHLLLL
Query GIRLDIGHGGASFSFKVAEAAIARGLLPFSISTDLHGHSXNFPVWDLATTXSKLLSVDXP  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GIRLDIGHGGASFSFKVAEAAIARGLLPFSISTDLHGHSXNFPVWDLATTXSKLLSVDXP  300
DSSP  LLEEELLLLLLLLLHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHLLLL


DSSP  HHHHHHLLLHHHHHHLLLLLLLLLLLLLLLEEEEEEEEEEEEEEELLLLLEEEEEEEEEE
Query FENVVEAVTRNPASVIRLDXENRLDVGQRADFTVFDLVDADLEATDSNGDVSRLKRLFEP  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FENVVEAVTRNPASVIRLDXENRLDVGQRADFTVFDLVDADLEATDSNGDVSRLKRLFEP  360
DSSP  HHHHHHLLLHHHHHHLLLLLLLLLLLLLLLEEEEEEEEEEEEEEELLLLLEEEEEEEEEE


DSSP  EEEEELLEEEELLLLLLLL
Query RYAVIGAEAIAASRYIPRA  379
ident |||||||||||||||||||
Sbjct RYAVIGAEAIAASRYIPRA  379
DSSP  EEEEELLEEEELLLLLLLL


No 2: Query=2ogjA Sbjct=4cqbA Z-score=26.8

back to top
DSSP  --lLLEEEEEEEELlllllLLLLLEEEEELlLLLEEEEELLLLLLLLEEELLL-LEEEEL
Query --qAPILLTNVKPVgfgkgASQSSTDILIGgDGKIAAVGSALQAPADTQRIDA-AFISPG   57
ident          |            |  || |     |                      |||
Sbjct skdFDLIIRNAYLS-----EKDSVYDIGIV-GDRIIKIEAKIEGTVKDEIDAKgNLVSPG   54
DSSP  lllEEEEEEEEEEL-----LLLEEEEEEEE-LLEEEEEELLLLLLEEEEEELLlLLEEEL


DSSP  EEEEEELLLL------------------------------------LLLL-llLLHHHlL
Query WVDLHVHIWH------------------------------------GGTD-isIRPSEcG   80
ident  || | |                                                     
Sbjct FVDAHTHMDKsftstgerlpkfwsrpytrdaaiedglkyyknatheEIKRhviEHAHM-Q  113
DSSP  EEEEEELHHHllllllllllllllllllhhhhhhhhhhhhhhllhhHHHHhhhHHHHH-H


DSSP  HHHLEEEEEEeLLLL-----LLLHHHHHHhLLLLL--LLEEEEEEELLlllllllllllL
Query AERGVTTLVDaGSAG-----EANFHGFREyIIEPS--RERIKAFLNLGsiglvacnrvpE  133
ident    |                        |   |       |                   
Sbjct VLHGTLYTRT-HVDVdsvakTKAVEAVLE-AKEELkdLIDIQVVAFAQ-----------S  160
DSSP  HHLLEEEEEE-EEELlllllLHHHHHHHH-HHHHLllLLEEEEEEELL-----------L


DSSP  LLLHHHLLHHHHHHHHHLLlllEEEEEEEELHHHHLlLLLHHHHHHHHHHHHHLLLEEEE
Query LRDIKDIDLDRILECYAENsehIVGLXVRASHVITGsWGVTPVKLGKKIAKILKVPXXVH  193
ident            |                                |  | ||   |    |
Sbjct GFFVDLESESLIRKSLDMG---CDLVGGVDPATREN-NVEGSLDLCFKLAKEYDVDIDYH  216
DSSP  LLLLLLLHHHHHHHHHHHL---LLEEELLLLLLLLL-LHHHHHHHHHHHHHHLLLEEEEE


DSSP  ELLL----llLHHHHHHHL-----LLLLEEELLLlllllLLLLLL-HHHHHHHHHLL--L
Query VGEP----paLYDEVLEIL-----GPGDVVTHCFngksgSSIXED-EDLFNLAERCE--G  241
ident                                |              | |          |
Sbjct IHDIgtvgvySINRLAQKTiengyKGRVTTSHAW-----CFADAPsEWLDEAIPLYKdsG  271
DSSP  ELLLhhhhhhHHHHHHHHHhhlllLLLEEEEELL-----HHHHLLhHHHHHHHHHHHhhL


DSSP  LEEELLLLllLLLHHHHhhhhhLLLL----LLLLLLLLL-LLLLlLLLL-LHHHHHHHHH
Query IRLDIGHGgaSFSFKVAeaaiaRGLL----PFSISTDLH-GHSXnFPVW-DLATTXSKLL  295
ident           |             ||          |             |         
Sbjct MKFVTCFS--STPPTMP----vIKLLeagiNLGCASDNIrDFWV-PFGNgDMVQGALIET  324
DSSP  LEEEEELL--LLLLLLL----hHHHHhlllEEEEELLLLlLLLL-LLLLlLHHHHHHHHH


DSSP  HLL-----lLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLEEEEEEEeeeeeeeelllll
Query SVD-----xPFENVVEAVTRNPASVIRLDXENRLDVGQRADFTVFDLvdadleatdsngd  350
ident                   |   | |          ||  ||  |                
Sbjct QRLelktnrDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNS----------lsp  374
DSSP  HHHllllhhHHHHHHHHHLHHHHHHHLLHHHLLLLLLLLLLEEEELL----------llh


DSSP  eeeeEEEEEEEEEEELLEE-EELLllllll
Query vsrlKRLFEPRYAVIGAEA-IAASryipra  379
ident                               
Sbjct qwaiIDQAKRLCVIKNGRIiVKDE--viva  402
DSSP  hhhhHHLLLEEEEEELLEEeEELL--eell


No 3: Query=2ogjA Sbjct=2vunA Z-score=26.5

back to top
DSSP  lLLEEEEEE-EELLLL-LLLLLLLEEEEELlLLLEEEEE-LLLL--LLLLEEELL-LLEE
Query qAPILLTNV-KPVGFG-KGASQSSTDILIGgDGKIAAVG-SALQ--APADTQRID-AAFI   54
ident        |  | |    |        |    || ||| |   |   |   |         
Sbjct -SKTIIKNIgKIVSGDiKSPVLQADTIVVE-DGLIAAIGgEELMkdAGDATIIDAaGSTV   58
DSSP  -LEEEEELLlEEELLLlLLLEELLLEEEEE-LLEEEEEElHHHHllLLLLEEEELlLLEE


DSSP  EELEEEEEELLLLL-LLLL---llLHHHLlHHHLEEEEEEELL-----------lLLLLH
Query SPGWVDLHVHIWHG-GTDI---siRPSECgAERGVTTLVDAGS-----------aGEANF   99
ident  ||  | |||   |            |      ||||   |||              |  
Sbjct TPGLLDTHVHVSGGdYAPRqktmdFISSA-LHGGVTTMISAGSphfpgrpkdaagTKALA  117
DSSP  EELEEEEEELLLLLlEEHHhleelHHHHH-HLLLEEEEEELLLlllllllllhhhHHHHH


DSSP  HHHHHHLLLLL--LLEEEE-EEELLlllllllllllllllhHHLLHHHHHHHHHLLlllE
Query HGFREYIIEPS--RERIKA-FLNLGsiglvacnrvpelrdiKDIDLDRILECYAENsehI  156
ident                        |                 |        |   |     
Sbjct ITLSKSYYNARpaGVKVHGgAVILE----------------KGLTEEDFIEMKKEG---V  158
DSSP  HHHHHHHHHLLhhHLEEELlEELLL----------------LLLLHHHHHHHHHLL---L


DSSP  EEEEEEElhhhhlllLLHHHHHHHHHHHHHLLLEEEEELLL-----LLLHHHHHHHLLll
Query VGLXVRAshvitgswGVTPVKLGKKIAKILKVPXXVHVGEP-----PALYDEVLEILGpg  211
ident                           |         | |                     
Sbjct WIVGEVG---lgtikNPEDAAPMVEWAHKHGFKVQMHTGGTsipgsSTVTADDVIKTK-p  214
DSSP  LEEEEEL---lllllLHHHHHHHHHHHHHLLLEEEEELLLLlllllLLLLHHHHHHHL-l


DSSP  LEEELLLLllllLLLLLLhhHHHHHHHLLLLEEELLLLlllLLHHHHHHHHH----LLLL
Query DVVTHCFNgksgSSIXEDedLFNLAERCEGIRLDIGHGgasFSFKVAEAAIA----RGLL  267
ident ||| |         |                   |         | |          | |
Sbjct DVVSHING--gpTAISVQ--EVDRIMDETDFAMEIVQC---GNPKIADYVARraaeKGQL  267
DSSP  LEEELLLL--llLLLLHH--HHHHHHHHLLLEEEEELL---LLHHHHHHHHHhhhhHLLH


DSSP  -LLLLLLLLL-LLLLlllLLLH-HHHHHHHHH-LLLLHHHHHHLLLHHHHHHLLLLLllL
Query -PFSISTDLH-GHSXnfpVWDL-ATTXSKLLS-VDXPFENVVEAVTRNPASVIRLDXenR  323
ident        |   |                   |  |   |  |   | |   |  |     
Sbjct gRVIFGNDAPsGTGL---IPLGiLRNMCQIASmSDIDPEVAVCMATGNSTAVYGLNT-gV  323
DSSP  hHEEEELLLLlLLLL---LLLHhHHHHHHHHHhLLLLHHHHHHHHLHHHHHHHLLLL-lL


DSSP  LLLLLLLEEEEEEEE-EEEEeeellllleeeEEEEEEEEEEEELLEE-EELLLL------
Query LDVGQRADFTVFDLV-DADLeatdsngdvsrLKRLFEPRYAVIGAEA-IAASRY------  375
ident    |  ||    |                             |  ||    ||       
Sbjct IAPGKEADLIIMDTPlGSVA---edamgaiaAGDIPGISVVLIDGEAvVTKSRNtppakr  380
DSSP  LLLLLLLLEEEEELLlLLLL---llhhhhhhHLLLLEEEEEEELLEEeELLLLLllllll


DSSP  -llll
Query -ipra  379
ident      
Sbjct aakil  385
DSSP  lleel


No 4: Query=2ogjA Sbjct=3griA Z-score=25.9

back to top
DSSP  llLEEEEEEEELllLLLLlLLLEEEEELlLLLEEEEELLLLLL-LLEEELLL-LEEEELE
Query qaPILLTNVKPVgfGKGAsQSSTDILIGgDGKIAAVGSALQAP-ADTQRIDA-AFISPGW   58
ident     |  | |      |      ||||     |     |               | ||| 
Sbjct --XKLIKNGKVL--QNGE-LQQADILID-GKVIKQIAPAIEPSnGVDIIDAKgHFVSPGF   54
DSSP  --LEEEELLEEE--ELLE-EEELEEEEE-LLEEEEEELLLLLLlLLEEEELLlLEEEELE


DSSP  EEEEELLLLLLLL-LLLL--HHHLLHHHLEEEEEEELL---LLLL--LHHHHHHhLLLL-
Query VDLHVHIWHGGTD-ISIR--PSECGAERGVTTLVDAGS---AGEA--NFHGFREyIIEP-  109
ident || |||    |              |  | ||                |       |   
Sbjct VDVHVHLREPGGEyKETIetGTKAAARGGFTTVCPXPNtrpVPDSveHFEALQK-LIDDn  113
DSSP  EEEEELLLLLLLLlLLLHhhHHHHHHHLLEEEEEELLLlllLLLLhhHHHHHHH-HHHHh


DSSP  LLLEEEEEEELLLLlllllllllLLLLhhHLLHhhHHHHHHLLlllEEEEEEEelhHHHL
Query SRERIKAFLNLGSIglvacnrvpELRDikDIDLdrILECYAENsehIVGLXVRashVITG  169
ident    |                    |                |              |   
Sbjct AQVRVLPYASITTR---------QLGK--ELVD--FPALVKEG---AFAFTDD--gVGVQ  155
DSSP  LLLEELLLEELLHH---------HLLL--LLLL--HHHHHLLL---LLLEEEL--lLLLL


DSSP  llLLHHHHHHHHHHHHHLLLEEEEELLL---------------------------llLHH
Query swGVTPVKLGKKIAKILKVPXXVHVGEP---------------------------paLYD  202
ident          |   |         |                                    
Sbjct --TASXXYEGXIEAAKVNKAIVAHCEDNsliyggaxhegkrskelgipgipnicesvQIA  213
DSSP  --LHHHHHHHHHHHHHHLLLEEELLLLHhhllllleellhhhhhhllleellhhhhhHHH


DSSP  HHHHHLL---lLLEEELLlllllllLLLLlhhHHHHHHHLL----LLEEELLL-------
Query EVLEILG---pGDVVTHCfngksgsSIXEdedLFNLAERCE----GIRLDIGH-------  248
ident               | |        |  |                               
Sbjct RDVLLAEaagcHYHVCHV-------STKE---SVRVIRDAKragiHVTAEVTPhhlllte  263
DSSP  HHHHHHHhhllLEEELLL-------LLHH---HHHHHHHHHhlllLEEEEELHhhhhllh


DSSP  ----------lLLLLLHH-hhHHHHhLLLL----LLLLLLLLLL--------------LL
Query ----------gGASFSFK-vaEAAIaRGLL----PFSISTDLHG--------------HS  279
ident                        |     |       | ||                   
Sbjct ddipgnnaiykXNPPLRStedREAL-LEGLldgtIDCIATDHAPhardekaqpxekapFG  322
DSSP  hhlllllhhhlLLLLLLLhhhHHHH-HHHHhlllLLEELLLLLLllhhhhllllllllLL


DSSP  LLllllLHHHHHHHHHHLL-----LLHHHHHHLLLHHHHHHLLLLLllLLLLLLLLEEEE
Query XNfpvwDLATTXSKLLSVD-----XPFENVVEAVTRNPASVIRLDXenRLDVGQRADFTV  334
ident          |    |               |   |  |     |     |     || | 
Sbjct IV----GSETAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLEY-gTLKENGYADLTI  377
DSSP  LL----LLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLL-lLLLLLLLLLEEE


DSSP  EEE-EEEEE-----eeellllleeEEEEEEEEEEEEELLEEEELLllllll
Query FDL-VDADL-----eatdsngdvsRLKRLFEPRYAVIGAEAIAASryipra  379
ident  ||                       |    |       |           
Sbjct IDLdSEQEIkgedflskadntpfiGYKVYGNPILTXVEGEVKFEG------  422
DSSP  EELlLLEELlhhhlllllllllllLLEELLEEEEEEELLEEEEEL------


No 5: Query=2ogjA Sbjct=1k6wA Z-score=25.4

back to top
DSSP  lLLEEEEEEEELlllllLLLLLEEEEELlLLLEEEEELL--llllLLEEEL-LLLEEEEL
Query qAPILLTNVKPVgfgkgASQSSTDILIGgDGKIAAVGSA--lqapADTQRI-DAAFISPG   57
ident  |     |                |    |||| |                       | 
Sbjct -ALQTIINARLP-----GEEGLWQIHLQ-DGKISAIDAQsgvmpiTENSLDaEQGLVIPP   53
DSSP  -LLLEEEEELLL-----LLLLEEEEEEE-LLEEEEEEEEllllllLLLEEElLLLEEELL


DSSP  EEEEEELLLL--------------------------------LLLL-llLLHHHlLHHHL
Query WVDLHVHIWH--------------------------------GGTD-isIRPSEcGAERG   84
ident  |  | |                                                    |
Sbjct FVEPHIHLDTtqtagqpnwnqsgtlfegierwaerkallthdDVKQrawQTLKW-QIANG  112
DSSP  EEEEEELLLLllllllllllllllhhhhhhhhhllhhhllhhHHHHhhhHHHHH-HHHLL


DSSP  EEEEEEeLLLL----LLLHHHHHHhLLLLL--LLEEEEEEELLllllllllllLLLLLH-
Query VTTLVDaGSAG----EANFHGFREyIIEPS--RERIKAFLNLGsiglvacnrvPELRDI-  137
ident                        |                                    
Sbjct IQHVRT-HVDVsdatLTALKAMLE-VKQEVapWIDLQIVAFPQ----------EGILSYp  160
DSSP  EEEEEE-EEELllllLHHHHHHHH-HHHHHllLLEEEEEEELL----------LLLLLLl


DSSP  HHLLhhHHHHHHHLLlllEEEEEEEELhhHHLL--LLLHHHHHHHHHHHHHLLLEEEEEL
Query KDIDldRILECYAENsehIVGLXVRAShvITGS--WGVTPVKLGKKIAKILKVPXXVHVG  195
ident          |                          ||         |        ||  
Sbjct NGEA--LLEEALRLG---ADVVGAIPH--FEFTreYGVESLHKTFALAQKYDRLIDVHCD  213
DSSP  LHHH--HHHHHHHLL---LLEEEELHH--HLLLhhHHHHHHHHHHHHHHHHLLEEEEEEL


DSSP  ----llLLLHHHHHHHL-----LLLLEEELLLlllllLLLLLLH-HHHHHHHHLL--LLE
Query ----epPALYDEVLEIL-----GPGDVVTHCFngksgSSIXEDE-DLFNLAERCE--GIR  243
ident             |         |      |                   |       || 
Sbjct eiddeqSRFVETVAALAhhegmGARVTASHTT-----AMHSYNGaYTSRLFRLLKmsGIN  268
DSSP  llllllLLHHHHHHHHHhhhllHHHEEEEELH-----HHHHLLHhHHHHHHHHHHhhLLE


DSSP  EELLLLLL------------lllhhHHHHHHhLLLLLLLLLLLLL-LLLLlLLLL-LHHH
Query LDIGHGGA------------sfsfkVAEAAIaRGLLPFSISTDLH-GHSXnFPVW-DLAT  289
ident                                           |                 
Sbjct FVANPLVNihlqgrfdtypkrrgitRVKEML-ESGINVCFGHDDVfDPWY-PLGTaNMLQ  326
DSSP  EEELHHHHhhhllllllllllllllLHHHHH-HLLLLEEELLLLLlLLLL-LLLLlLHHH


DSSP  HHHHHH-HLLL----LHHHHHHLLLHHHHHHLLLLLLlLLLLLLLLEEEEEE------EE
Query TXSKLL-SVDX----PFENVVEAVTRNPASVIRLDXEnRLDVGQRADFTVFD------LV  338
ident      |                  |   |    |        |  |              
Sbjct VLHMGLhVCQLmgygQINDGLNLITHHSARTLNLQDY-GIAAGNSANLIILPaengfdAL  385
DSSP  HHHHHHhHLLLllhhHHHHHHHHHLHHHHHHLLLLLL-LLLLLLLLLEEEELlllhhhHH


DSSP  EEeeeeellllleeeeeeEEEEEEEEELLEEEELL-------------llllll
Query DAdleatdsngdvsrlkrLFEPRYAVIGAEAIAAS-------------ryipra  379
ident                       || | |   ||                     
Sbjct RR----------------QVPVRYSVRGGKVIASTqpaqttvyleqpeaidykr  423
DSSP  HH----------------LLLLLEEEELLEEEEELlllleeeellleeeellll


No 6: Query=2ogjA Sbjct=3mtwA Z-score=25.1

back to top
DSSP  LLLEEEEEEEELLLLLLLLLLLEEEEELlLLLEEEEELL-LLLL-LLEEELLL-LEEEEL
Query QAPILLTNVKPVGFGKGASQSSTDILIGgDGKIAAVGSA-LQAP-ADTQRIDA-AFISPG   57
ident                 |            || |   |      |   |          ||
Sbjct AEIKAVSAARLLDVASGKYVDNPLVIVT-DGRITSIGKKgDAVPaGATAVDLPgVTLLPG   59
DSSP  LLEEEEEEEEEEELLLLEEEELEEEEEE-LLEEEEEEELlLLLLlLLEEEEEEeEEEEEL


DSSP  EEEEEELLLL----------------LLLLlllLHHHlLHHHLEEEEEEELLLllllHHH
Query WVDLHVHIWH----------------GGTDisiRPSEcGAERGVTTLVDAGSAgeanFHG  101
ident   | |||                                 | | ||    | |       
Sbjct LIDMHVHLDSlaevggynsleysdrfWSVVqtaNAKK-TLEAGFTTVRNVGAA----DYD  114
DSSP  EEEEEELLLLlllllhhhhhhllhhhHHHHhhhHHHH-HHHLLEEEEEELLLL----LLH


DSSP  HHHhLLLLL------LLEEEEE-EELLllllllLLLL-----------lLLLLHHHLLHh
Query FREyIIEPS------RERIKAF-LNLGsiglvaCNRV-----------pELRDIKDIDLd  143
ident       |          ||       |      |                          
Sbjct DVG-LREAIdagyvpGPRIVTAaISFG-atgghCDSTffppsmdqknpfNSDSPDEARK-  171
DSSP  HHH-HHHHHhlllllLLEEEELlLLEE-lllllLLLLlllhhhllllllLLLLHHHHHH-


DSSP  HHHHHHHLLlllEEEEEEEEL-----------HHHHlllLLHHHHHHHHHHHHHLLLEEE
Query RILECYAENsehIVGLXVRAS-----------HVITgswGVTPVKLGKKIAKILKVPXXV  192
ident                 |  |                        |     |         
Sbjct AVRTLKKYG---AQVIXICATggvfsrgnepgQQQL---TYEEMKAVVDEAHMAGIKVAA  225
DSSP  HHHHHHHLL---LLEEEEELLlllllllllllLLLL---LHHHHHHHHHHHHHLLLEEEE


DSSP  EELLLllLHHHHHHHLlllLEEELLLlllllLLLLllhHHHHHHHHLlLLEEELLLLLL-
Query HVGEPpaLYDEVLEILgpgDVVTHCFngksgSSIXedeDLFNLAERCeGIRLDIGHGGA-  251
ident |         |        |   |                  ||    |           
Sbjct HAHGA-sGIREAVRAG--vDTIEHAS-----LVDD---EGIKLAVQK-GAYFSMDIYNTd  273
DSSP  EELLH-hHHHHHHHLL--lLEEEELL-----LLLH---HHHHHHHHH-LLEEELLLLLHh


DSSP  -----------------------llLHHHHHHHHHlLLLLLLLLLLLlLLLLlllllLHH
Query -----------------------sfSFKVAEAAIArGLLPFSISTDLhGHSXnfpvwDLA  288
ident                                 |           ||  |        | |
Sbjct ytqaegkkngvlednlrkdrdigelQRENFRKALK-AGVKMVYGTDA-GIYP---hgDNA  328
DSSP  hhhhhhhhhlllhhhhhhhhhhhhhHHHHHHHHHH-HLLEEELLLLL-LLLL---llLHH


DSSP  HHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLL-llLLLLLLLLEEEEEEEEeeeeeeell
Query TTXSKLLSVDXPFENVVEAVTRNPASVIRLDX-enRLDVGQRADFTVFDLVdadleatds  347
ident                     |   |             ||   |                
Sbjct KQFAVMVRYGATPLQAIQSATLTAAEALGRSKdvgQVAVGRYGDMIAVAGD---------  379
DSSP  HHHHHHHHLLLLHHHHHHHLLHHHHHHHLLLLlllLLLLLLLLLEEEELLL---------


DSSP  llleeeeeEEEE---EEEEEELLEEEEllllllll
Query ngdvsrlkRLFE---PRYAVIGAEAIAasryipra  379
ident                |     |             
Sbjct -----plaDVTTlekPVFVMKGGAVVK-----apx  404
DSSP  -----lllLHHHhhlLLEEEELLEEEE-----lll


No 7: Query=2ogjA Sbjct=2pajA Z-score=25.0

back to top
DSSP  lLLEEEEEE-EELLLL-----LLLLLLLEEEEELlLLLEEEEELLLLLLLLEEELL-LLE
Query qAPILLTNV-KPVGFG-----KGASQSSTDILIGgDGKIAAVGSALQAPADTQRID-AAF   53
ident     |  |       |             || |     | | |     |  |        
Sbjct -PSTLIRNAaAIMTGGrgtadDPSRVPGPDIRIV-GDTIDAIGALAPRPGETIVDAtDCV   58
DSSP  -LEEEEELLlEELLLLlllllLLLLLLLLLEEEE-LLEEEEELLLLLLLLLEEEELlLLE


DSSP  EEELEEEEEELLL---------------lLLLLLL-LLHHHLLhHHLEEEEEEELLLL--
Query ISPGWVDLHVHIW---------------hGGTDIS-IRPSECGaERGVTTLVDAGSAG--   95
ident | | ||  | |                         |   |     |  |  |       
Sbjct IYPAWVNTHHHLFqsllkgepfralfderRFRLAArIGLIELA-RSGCATVADHNYVYyp  117
DSSP  EEELEELLLLLHHhhhllllllhhhllhhHHHHHHhHHHHHHH-LLLEEEEEELLLLLll


DSSP  ---lLLHHHHHHhLLLLLLLEEEEEEELllllllllllllLLLL-------------HHH
Query ---eANFHGFREyIIEPSRERIKAFLNLgsiglvacnrvpELRD-------------IKD  139
ident            |   |    |                                       
Sbjct gmpfDSSAILFE-EAEKLGLRFVLLRGG------------ATQTrqleadlptalrpETL  164
DSSP  llllLHHHHHHH-HHHHLLLEEEEEELL------------LLLLllllllllhhhllLLH


DSSP  LL-HHHHHHHHHLLLL------LEEEEE-EEELhHHHLlllLHHHHHHHHHHHHHLLLEE
Query ID-LDRILECYAENSE------HIVGLX-VRAShVITGswgVTPVKLGKKIAKILKVPXX  191
ident       |    |            |                          |  |     
Sbjct DAyVADIERLAARYHDaspramRRVVMApTTVL-YSIS---PREMRETAAVARRLGLRMH  220
DSSP  HHhHHHHHHHHHHLLLllllllEEEEELlLLLL-LLLL---HHHHHHHHHHHHHLLLEEE


DSSP  EEELllllLHHHHHH-HLLL-LLEEELLLllllllLLLLlhHHHHHHHHLlLLEEELL-L
Query VHVGeppaLYDEVLE-ILGP-GDVVTHCFngksgsSIXEdeDLFNLAERCeGIRLDIG-H  248
ident  |            |           |              |   |     |        
Sbjct SHLS-gksPVAFCGEhDWLGsDVWYAHLV------KVDA--DEIALLAQT-GTGVAHCpQ  270
DSSP  EELL-lllHHHHHHHlLLLLlLEEEELLL------LLLH--HHHHHHHHH-LLEEEELhH


DSSP  LLLlllhhHHHHHHhLLLLLLLLLLLLLlLLLLllLLLHHHHHHHHHHLL----LLHHHH
Query GGAsfsfkVAEAAIaRGLLPFSISTDLHgHSXNfpVWDLATTXSKLLSVD----XPFENV  304
ident                    | ||  |    |      |                     |
Sbjct SNG---rlPVREMA-DAGVPVSIGVDGA-ASNE--AADMISEVHMTWLAQrarlASIAEV  323
DSSP  HHH---llLLLLHH-HHLLLEEELLLHH-HHLL--LLLHHHHHHHHHHHHhhllLLHHHH


DSSP  HHLLLHHHHHHLLLLL-llLLLLlLLLEEEEEEE-EEEEeeeellllleeeEEEEEE-EE
Query VEAVTRNPASVIRLDX-enRLDVgQRADFTVFDL-VDADleatdsngdvsrLKRLFE-PR  361
ident     |   | |  ||           ||  |  |                          
Sbjct IHWGTAGGARVMGLDEvgkVAVG-YAADIAVYRLdDPRY-fglhdpaigpvASGGRPsVM  381
DSSP  HHHHLHHHHHHHLLLLlllLLLL-LLLLEEEEELlLHHH-lllllhhhhhhHLLLLLeEE


DSSP  EEEELLEE-EELL---------------------llllll
Query YAVIGAEA-IAAS---------------------ryipra  379
ident                                         
Sbjct ALFSAGKRvVVDDliegvdikelggearrvvrellrevvv  421
DSSP  EEEELLEEeEELLllllllhhhhhhhhhhhhhhhhhhhhl


No 8: Query=2ogjA Sbjct=1gkpA Z-score=24.9

back to top
DSSP  llLEEEEEEEELLLLlllLLLLEEEEELLlLLEEEEELLLLLL-LLEEELLL-LEEEELE
Query qaPILLTNVKPVGFGkgaSQSSTDILIGGdGKIAAVGSALQAP-ADTQRIDA-AFISPGW   58
ident   | |  |          |    ||   |   |   |  | ||              || 
Sbjct --PLLIKNGEIITAD---SRYKADIYAEG-ETITRIGQNLEAPpGTEVIDATgKYVFPGF   54
DSSP  --LEEEELLEEEELL---EEEELEEEELL-LLLLEEELLLLLLlLLEEEELLlLEEEELE


DSSP  EEEEELLLLL--llLLLLL---HHHLLHHHLEEEEEEELLL-----LLLLHHHHHHHLLL
Query VDLHVHIWHG--gtDISIR---PSECGAERGVTTLVDAGSA-----GEANFHGFREYIIE  108
ident  | ||||                |      | ||                          
Sbjct IDPHVHIYLPfmatFAKDThetGSKAALMGGTTTYIEMCCPsrnddALEGYQLWKSKAEG  114
DSSP  EEEEELLLLEelleELLLLhhhHHHHHHHLLEEEEEEEELLlllllHHHHHHHHHHHHLL


DSSP  LLLLEEEEEEELLllllllllllllllLHHHlLHHHHHHhHHLLLllEEEEEEEEL--HH
Query PSRERIKAFLNLGsiglvacnrvpelrDIKDiDLDRILEcYAENSehIVGLXVRAS--HV  166
ident  |                                    |        |   |   |    
Sbjct NSYCDYTFHMAVS-------------kFDEK-TEGQLRE-IVADG--ISSFXIFLSykNF  157
DSSP  LLLLEEEEEEELL-------------lLLLL-HHHHHHH-HHHLL--LLEEEEEELllLL


DSSP  HHlllLLHHHHHHHHHHHHHLLLEEEEELLLL----------------------------
Query ITgswGVTPVKLGKKIAKILKVPXXVHVGEPP----------------------------  198
ident                 || | |    |                                 
Sbjct FG--vDDGEMYQTLRLAKELGVIVTAHCENAElvgrlqqkllsegktgpewhepsrpeav  215
DSSP  LL--lLHHHHHHHHHHHHHHLLEEEEEELLHHhhhhhhhhhhhlllllhhhllllllhhh


DSSP  --lLHHHHHHHLL---lLLEEELLlllllllLLLLlhhHHHHHHHLL----LLEEELLLL
Query --aLYDEVLEILG---pGDVVTHCfngksgsSIXEdedLFNLAERCE----GIRLDIGHG  249
ident            |        | |        |          |         |       
Sbjct eaeGTARFATFLEttgaTGYVVHL-------SCKP---ALDAAMAAKargvPIYIESVIP  265
DSSP  hhhHHHHHHHHHHhhllEEEELLL-------LLHH---HHHHHHHHHhlllLEEEEEEHH


DSSP  --------------------LLLLL--hHHHHHHHHL--LLLLLLLLLLLLL--------
Query --------------------GASFS--fKVAEAAIAR--GLLPFSISTDLHG--------  277
ident                                                ||           
Sbjct hflldktyaerggveamkyiMSPPLrdkRNQKVLWDAlaQGFIDTVGTDHCPfdteqkll  325
DSSP  hhhllhhhhhllhhhhhlllLLLLLlllHHHHHHHHHhhLLLLLEEELLLLLllhhhhhh


DSSP  ----------LLLLlllLLHHHHH-HHHH-HLLLLHHHHHHLLLHHHHHHLLLLLL-lLL
Query ----------HSXNfpvWDLATTX-SKLL-SVDXPFENVVEAVTRNPASVIRLDXE-nRL  324
ident                   |                    | |     |    |       
Sbjct gkeaftaipnGIPA--iEDRVNLLyTYGVsRGRLDIHRFVDAASTKAAKLFGLFPRkgTI  383
DSSP  hlllhhhlllLLLL--lLLHHHHHhHHHLlLLLLLHHHHHHHHLHHHHHHLLLLLLllLL


DSSP  LLLLLLEEEEEEE-EEEEEE-----eellllleeEEEEEEEEEEEEELLEE-EELL----
Query DVGQRADFTVFDL-VDADLE-----atdsngdvsRLKRLFEPRYAVIGAEA-IAAS----  373
ident  ||  ||  | |                             |                  
Sbjct AVGSDADLVVYDPqYRGTISvktqhvnndyngfeGFEIDGRPSVVTVRGKVaVRDGqfvg  443
DSSP  LLLLLLLEEEEELlLLEELLhhhlllllllllllLLEELLEEEEEEELLEEeEELLeell


DSSP  ---------llllll
Query ---------ryipra  379
ident                
Sbjct ekgwgkllrrepmyf  458
DSSP  lllllllllllllll


No 9: Query=2ogjA Sbjct=3giqA Z-score=24.8

back to top
DSSP  -lLLEEEEEEEEL-LLLLLllLLLEEEEELlLLLEEEEELLLLLLLLEEELLL-LEEEEL
Query -qAPILLTNVKPV-GFGKGasQSSTDILIGgDGKIAAVGSALQAPADTQRIDA-AFISPG   57
ident        |      | |        |     || ||| |     ||            ||
Sbjct ekLDFKITGGWIIdGTGAP--RRRADLGVR-DGRIAAIGELGAHPARHAWDASgKIVAPG   57
DSSP  llEEEEEELLEELlLLLLL--LEELEEEEE-LLEEEEEELLLLLLEEEEEELLlLEEEEL


DSSP  EEEEEELLLLlllllllLHHHLLHHHLEEEEEEEL---LLLLL-----------------
Query WVDLHVHIWHggtdisiRPSECGAERGVTTLVDAG---SAGEA-----------------   97
ident   | | |                   | || |      ||  |                 
Sbjct FIDVHGHDDL--mfvekPDLRWKTSQGITTVVVGNcgvSAAPAplpgntaaalallgetp  115
DSSP  EEELLLLLLL--hhhhlLLLHHHHLLLEEEEEELLlllLLLLLlllllllhhhhhhllll


DSSP  ---LHHHHHHHL-lLLLLLEEEEEEELLLllllllllllllllHHHL-------------
Query ---NFHGFREYI-iEPSRERIKAFLNLGSiglvacnrvpelrdIKDI-------------  140
ident                       |                                     
Sbjct lfaDVPAYFAALdaQRPMINVAALVGHAN-------------lRLAAmrdpqaaptaaeq  162
DSSP  lllLHHHHHHHHhhLLLLLEEEEEEEHHH-------------hHHHHlllllllllhhhh


DSSP  --LHHHHHhHHHLLLllEEEEEEEELHHHHLLLLLHHHHHHHHHHHHHLLLEEEEELLL-
Query --DLDRILeCYAENSehIVGLXVRASHVITGSWGVTPVKLGKKIAKILKVPXXVHVGEP-  197
ident     |       |     ||                        |         |     
Sbjct qaMQDMLQ-AALEAG--AVGFSTGLAYQPGAVAQAAELEGLARVAAERRRLHTSHIRNEa  219
DSSP  hhHHHHHH-HHHHHL--LLEEEEELLLLLHHHLLHHHHHHHHHHHHHLLLEEEEELLLLl


DSSP  ---llLHHHHHHHL---LLLLEEELLlLLLLllllLLLHHHHHHHHHLL----LLEEELL
Query ---paLYDEVLEIL---GPGDVVTHCfNGKSgssiXEDEDLFNLAERCE----GIRLDIG  247
ident         ||| |    |   || |                     |         ||| 
Sbjct dgveaAVEEVLAIGrgtGCATVVSHH-KCMMpqnwGRSRATLANIDRAReqgvEVALDIY  278
DSSP  llhhhHHHHHHHHHhhhLLEEEELLL-LLLLhhhlLLHHHHHHHHHHHHhlllLEEEEEL


DSSP  LLLLL-------------------------------------------------------
Query HGGAS-------------------------------------------------------  252
ident     |                                                       
Sbjct PYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
DSSP  LLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee


DSSP  ---lLHHHHHHHhhllLLLLLLLLLLLLL-llLLLL--LLHHHHHHHHH--HLLLLHHHH
Query ---fSFKVAEAAiargLLPFSISTDLHGH-sxNFPV--WDLATTXSKLL--SVDXPFENV  304
ident                         |         |                      |  
Sbjct yfamDEDEVKRI--fqHPCCMVGSDGLPNdarPHPRlwGSFTRVLGRYVreARLMTLEQA  396
DSSP  eellLHHHHHHH--hhLLLEEELLLLLLLlllLLLHhhHHHHHHHHHHHhhLLLLLHHHH


DSSP  HHLLLHHHHHHLLLLLllLLLLLLLLEEEEEEEEE-eeEEEEllllleeeeeeeeEEEEE
Query VEAVTRNPASVIRLDXenRLDVGQRADFTVFDLVD-adLEATdsngdvsrlkrlfEPRYA  363
ident |   |  || |        |  |  ||  |||                            
Sbjct VARMTALPARVFGFAErgVLQPGAWADVVVFDPDTvadRATW-----deptlasvGIAGV  451
DSSP  HHHHLHHHHHHHLLLLllLLLLLLLLLEEEELLLLlllLLLL-----llllllllLEEEE


DSSP  EELLEEEEL--------lllllll
Query VIGAEAIAA--------sryipra  379
ident                         
Sbjct LVNGAEVFPqppadgrpgqvlrax  475
DSSP  EELLEEEELlllllllllllllll


No 10: Query=2ogjA Sbjct=1onxA Z-score=24.7

back to top
DSSP  ------LLLEEEEEEEELLLLlllLLLLEEEEELlLLLEEEEELLLL---LLLLEEELLL
Query ------QAPILLTNVKPVGFGkgaSQSSTDILIGgDGKIAAVGSALQ---APADTQRIDA   51
ident           ||                 | |    ||| || |       |  |     
Sbjct midytaAGFTLLQGAHLYAPE---DRGICDVLVA-NGKIIAVASNIPsdiVPNCTVVDLS   56
DSSP  llllhhHLLEEEEEEEEELLL---EEEEEEEEEE-LLEEEEEELLLLlllLLLLEEEELL


DSSP  -LEEEELEEEEEELLLL-------llLLLLLLHHHlLHHHLEEEEEEELL--llllLHHH
Query -AFISPGWVDLHVHIWH-------ggTDISIRPSEcGAERGVTTLVDAGS--ageaNFHG  101
ident      ||  | |||                   |    | |||  |              
Sbjct gQILCPGFIDQHVHLIGgggeagpttRTPEVALSR-LTEAGVTSVVGLLGtdsisrHPES  115
DSSP  lLEEEELEEEEEELLLLllllllhhhLLLLLLHHH-HHHLLEEEEEELLLllllllLHHH


DSSP  HHHhLLLLL---LLEEEEEEE----LLLLlllllllllllllhhhllhHHHHHHHHLLlL
Query FREyIIEPS---RERIKAFLN----LGSIglvacnrvpelrdikdidlDRILECYAENsE  154
ident                                                        |    
Sbjct LLA-KTRALneeGISAWMLTGayhvPSRT-----------------itGSVEKDVAII-D  156
DSSP  HHH-HHHHHhhhLLEEEEEEEllllLLLL-----------------llLLHHHHHHHL-L


DSSP  LEEEEEEEELHHHHllLLLHHhHHHHHHHHHHL---------LLEEEEELLLLLLHHHHH
Query HIVGLXVRASHVITgsWGVTPvKLGKKIAKILK---------VPXXVHVGEPPALYDEVL  205
ident    | |   |                  |                  | |          
Sbjct RVIGVXCAISDHRS--AAPDV-YHLANMAAESRvggllggkpGVTVFHMGDSKKALQPIY  213
DSSP  LEEEEEEEELLLLL--LLLLH-HHHHHHHHHHHhhhhhhlllLEEEEEELLLLLLLHHHH


DSSP  HH------lLLLLEEELLLLlLLLLLLlllhhhhhHHHHL--LLLEEELLLLLL--lLLH
Query EI------lGPGDVVTHCFNgKSGSSIxededlfnLAERC--EGIRLDIGHGGA--sFSF  255
ident                ||                   |      |   ||           
Sbjct DLlencdvpISKLLPTHVNR-NVPLFE--------QALEFarKGGTIDITSSIDepvAPA  264
DSSP  HHhhlllllHHHEEEELHHH-LHHHHH--------HHHHHhhLLLLEEEELLLLlllLHH


DSSP  HHHHHHHHLLLL--LLLLLLLLL---------------LLLLlllLLLHHHHHHHHH-HL
Query KVAEAAIARGLL--PFSISTDLH---------------GHSXnfpVWDLATTXSKLL-SV  297
ident      |   |        | |                 |         |  |   |    
Sbjct EGIARAVQAGIPlaRVTLSSDGNgsqpffddegnlthiGVAG---FETLLETVQVLVkDY  321
DSSP  HHHHHHHHLLLLhhHEEEELLLLleeeeellllleeeeEELL---LHHHHHHHHHHHhHH


DSSP  LLLHHHHHHLLLHHHHHHLLLLLllLLLLLLLLEEEEEEEEeeeeeeellllleeeeeee
Query DXPFENVVEAVTRNPASVIRLDXenRLDVGQRADFTVFDLVdadleatdsngdvsrlkrl  357
ident |          |   |    |        |  ||  |                       
Sbjct DFSISDALRPLTSSVAGFLNLTGkgEILPGNDADLLVMTPE-------------------  362
DSSP  LLLHHHHHHHHLHHHHHHLLLLLllLLLLLLLLLEEEELLL-------------------


DSSP  EEEEEEEELLEE-EELL-----llllll
Query FEPRYAVIGAEA-IAAS-----ryipra  379
ident                             
Sbjct LRIEQVYARGKLmVKDGkacvkgtfetd  390
DSSP  LLEEEEEELLEEeEELLeelllllllll


No 11: Query=2ogjA Sbjct=3mkvA Z-score=24.6

back to top
DSSP  LLLEEEEEEEELLLLLLLLLLLEEEEELlLLLEEEEEL-LLLLLLLEEELLL-LEEEELE
Query QAPILLTNVKPVGFGKGASQSSTDILIGgDGKIAAVGS-ALQAPADTQRIDA-AFISPGW   58
ident     |  |                |||  || |  |                   | || 
Sbjct LTTFLFRNGALLDPDHPDLLQGFEILIE-DGFIREVSDkPIKSSNAHVIDVKgKTIMPGL   59
DSSP  LLEEEEEEEEELLLLLLLLEEEEEEEEE-LLEEEEEELlLLLLLLLEEEELLlLEEEELE


DSSP  EEEEELLLL---------------LLLLlllLHHHlLHHHLEEEEEEELLLllllhhhHH
Query VDLHVHIWH---------------GGTDisiRPSEcGAERGVTTLVDAGSAgeanfhgFR  103
ident  |||||                                 || ||  ||| |         
Sbjct IDLHVHVVAiefnlprvatlpnvlVTLRavpIMRA-MLRRGFTTVRDAGGA-------GY  111
DSSP  EEEEELLLLllllhhhhllllhhhHHHHhhhHHHH-HHHLLEEEEEELLLL-------LH


DSSP  HHlLLLL------LLEEEEE-EELLllllllLLLL----------------------lLL
Query EYiIEPS------RERIKAF-LNLGsiglvaCNRV----------------------pEL  134
ident                |       |                                    
Sbjct PF-KQAVesglveGPRLFVSgRALS-qtgghADPRarsdymppdspcgccvrvgalgrVA  169
DSSP  HH-HHHHhlllllLLEEEELlLEEE-lllllLLLLllllllllllllllllllllleeEL


DSSP  LLHHHLLHhHHHHHHHLLlllEEEEEEEEL-----------HHHHlllLLHHHHHHHHHH
Query RDIKDIDLdRILECYAENsehIVGLXVRAS-----------HVITgswGVTPVKLGKKIA  183
ident             |            |  ||                             |
Sbjct DGVDEVRR-AVREELQMG---ADQIXIMASggvasptdpvgVFGY---SEDEIRAIVAEA  222
DSSP  LLHHHHHH-HHHHHHHHL---LLLEEEELLlllllllllllLLLL---LHHHHHHHHHHH


DSSP  HHHLLLEEEEELllllLHHHHHHHLlllLEEELLLllllllLLLLLhhHHHHHHHLlLLE
Query KILKVPXXVHVGeppaLYDEVLEILgpgDVVTHCFngksgsSIXEDedLFNLAERCeGIR  243
ident          |                      |         |        |     |  
Sbjct QGRGTYVLAHAY-tpaAIARAVRCG--vRTIEHGN------LIDDE--TARLVAEH-GAY  270
DSSP  HLLLLLEEEEEL-lhhHHHHHHHLL--lLEEEELL------LLLHH--HHHHHHHH-LLE


DSSP  EELL-LLLL-----------------------llLHHHHHHHHhLLLLLLLLLLLLLLLL
Query LDIG-HGGA-----------------------sfSFKVAEAAIaRGLLPFSISTDLHGHS  279
ident                                        |    |        ||| |  
Sbjct VVPTlVTYDalasegekyglppesiakiadvhgaGLHSIEIMK-RAGVKMGFGTDLLGEA  329
DSSP  EELLhHHHHhhhhhlllllllhhhhllhhhhhllHHHHHHHHH-HHLLLLLLLLLLLHHH


DSSP  LlllLLLHhHHHHHHHHLlLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLLEEEEEEEE
Query XnfpVWDLaTTXSKLLSVdXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRADFTVFDLV  338
ident               |  |      |    |   | |        |   |  ||  | |  
Sbjct Q---RLQS-DEFRILAEV-LSPAEVIASATIVSAEVLGMQDKlgRIVPGAHADVLVVDGN  384
DSSP  H---HHLL-HHHHHHHLL-LLHHHHHHHLLHHHHHHLLLLLLllLLLLLLLLLEEEELLL


DSSP  eeeeeeellllleeeeeEEEE------EEEEEELLEEEEllllllll
Query dadleatdsngdvsrlkRLFE------PRYAVIGAEAIAasryipra  379
ident                                                
Sbjct -------------plksVDCLlgqgehIPLVMKDGRLFV----nele  414
DSSP  -------------llllLLLLllllllLLEEEELLEEEE----elll


No 12: Query=2ogjA Sbjct=2oofA Z-score=24.3

back to top
DSSP  -lLLEEEEEEEEL-LLLLL---LLLLLEEEEELlLLLEEEEELL--llLLLLeEELLL-L
Query -qAPILLTNVKPV-GFGKG---ASQSSTDILIGgDGKIAAVGSA--lqAPADtQRIDA-A   52
ident         || |                       | | |         ||         
Sbjct lnCERVWLNVTPAtLRSDLadyGLLEPHALGVH-EGRIHALVPXqdlkYPAH-WQDXKgK   58
DSSP  llLLEEEEEEEELlLLLLLlllLLLLLEEEEEE-LLEEEEEEEHhhllLLLL-LEELLlL


DSSP  EEEELEEEEEELLLLL----------------------------------------LLLL
Query FISPGWVDLHVHIWHG----------------------------------------GTDI   72
ident    ||  | | |                                                
Sbjct LVTPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraasedqLFEL  118
DSSP  EEEELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhHHHH


DSSP  -llLHHHLLhHHLEEEEEEELLL-----lLLLH-HHHHHhLLLLLLLEEEEEEELLllll
Query -siRPSECGaERGVTTLVDAGSA-----gEANF-HGFREyIIEPSRERIKAFLNLGsigl  125
ident    |        ||||             |       |    |    | |  |       
Sbjct alpRVKSLI-REGVTTVEIKSGYgltledELKXlRVARR-LGEALPIRVKTTLLAA----  172
DSSP  hhhHHHHHH-HHLEEEEEEELLLlllhhhHHHHhHHHHH-HHHHLLLEEEEEEEEE----


DSSP  llllllLLLL------LHHHL--LHHHH-HHHHHLLLllEEEEEEEELHHHHlllLLHHH
Query vacnrvPELR------DIKDI--DLDRI-LECYAENSehIVGLXVRASHVITgswGVTPV  176
ident                            |                |   |           
Sbjct ------HAVPpeyrddPDSWVetICQEIiPAAAEAGL--ADAVDVFCEHIGF---SLAQT  221
DSSP  ------LLLLhhhlllHHHHHhhHHHLHhHHHHHLLL--LLEEEEEELLLLL---LHHHH


DSSP  HHHHHHHHHHLLLEEEE-ELLLlllHHHHHHHL--LLLLEEELLLlllllLLLLllhhhh
Query KLGKKIAKILKVPXXVH-VGEPpalYDEVLEIL--GPGDVVTHCFngksgSSIXededlf  233
ident       |         |                       | |                 
Sbjct EQVYLAADQYGLAVKGHxDQLS---NLGGSTLAanFGALSVDHLE-----YLDP------  267
DSSP  HHHHHHHHHLLLEEEEEeLLLL---LLLHHHHHhhLLLLEEEELL-----LLLH------


DSSP  hHHHHL---LLLEEELLLLLL----lllhhHHHHHHhLLLLLLLLLLLLL-LLLLlllLL
Query nLAERC---EGIRLDIGHGGA----sfsfkVAEAAIaRGLLPFSISTDLH-GHSXnfpVW  285
ident           |                      |       |   | |   |        
Sbjct -EGIQAlahRGVVATLLPTAFyflketklpPVVALR-KAGVPXAVSSDINpGTAP---IV  322
DSSP  -HHHHHhhhHLLEEEELHHHHhhlllllllLHHHHH-HLLLLEEELLLLLlLLLL---LL


DSSP  LHHHHHHHHHH-LLLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLLEEEEEEEeeeeee
Query DLATTXSKLLS-VDXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRADFTVFDLvdadle  343
ident  |   |                 |||  |           | ||  ||| |         
Sbjct SLRXAXNXACTlFGLTPVEAXAGVTRHAARALGEQEQlgQLRVGXLADFLVWNC------  376
DSSP  LHHHHHHHHHHhHLLLHHHHHHHLLHHHHHHLLLLLLllLLLLLLLLLEEEELL------


DSSP  eellllleeeeeEEEE---EEEEEELLEEEEllllllll
Query atdsngdvsrlkRLFE---PRYAVIGAEAIAasryipra  379
ident              |         |   |           
Sbjct -----ghpaelsYLIGvdqLVSRVVNGEETL-------h  403
DSSP  -----llllhhhHLLLlllEEEEEELLEELL-------l


No 13: Query=2ogjA Sbjct=3nqbA Z-score=24.3

back to top
DSSP  ----------------------llLEEEEEEEELLLLLllLLLLEEEEELlLLLEEEEEL
Query ----------------------qaPILLTNVKPVGFGKgaSQSSTDILIGgDGKIAAVGS   38
ident                           | |    |           || |     || |  
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDVVT-gELRPADIGIV-GALIASVHE   58
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLL-lLEEELEEEEE-LLEEEEEEL


DSSP  -LLLLLLLEEEL-LLLEEEELEEEEEELLLlllllLLLL--HHHLLHHHLEEEEEEE-LL
Query -ALQAPADTQRI-DAAFISPGWVDLHVHIWhggtdISIR--PSECGAERGVTTLVDA-GS   93
ident  |    |        |  |||  | | ||                   ||||| |     
Sbjct pASRRDAAQVIDaGGAYVSPGLIDTHXHIE---ssXITPaaYAAAVVARGVTTIVWDpHE  115
DSSP  lLLLLLEEEEEElLLLEEEELEEEEEELHH---hhLLLHhhHHHHHHLLLEEEEEELlHH


DSSP  LL----LLLHHHHHHHlLLLLLLEEEEEEELLLllllllllllLLLL-----hhHLLHHH
Query AG----EANFHGFREYiIEPSRERIKAFLNLGSiglvacnrvpELRD-----ikDIDLDR  144
ident  |               ||    |                              | |   
Sbjct FGnvhgVDGVRWAAKA-IENLPLRAILLAPSCV----------PSAPglerggaDFDAAI  164
DSSP  HHhhhlHHHHHHHHHH-HLLLLLEEEEEELLLL----------LLLLlllllllLLLHHH


DSSP  HHHHHHllLLLEEEEEEEElhhhhlllLLHH------HHHHHHHHHHHLLLEEEEELLL-
Query ILECYAenSEHIVGLXVRAshvitgswGVTP------VKLGKKIAKILKVPXXVHVGEP-  197
ident            | |                                        |     
Sbjct LADLLS--WPEIGGIAEIX-------nXRGVierdprXSGIVQAGLAAEKLVCGHARGLk  215
DSSP  HHHHHL--LLLEEEEEEEL-------lHHHHhlllhhHHHHHHHHHHHLLEEEELLLLLl


DSSP  llLHHHHHHHLLllLEEELLlllllllLLLLlhhhhhHHHHLlLLEEELLLLllLLLH-H
Query paLYDEVLEILGpgDVVTHCfngksgsSIXEdedlfnLAERCeGIRLDIGHGgaSFSF-K  256
ident                               |         |  |                
Sbjct naDLNAFXAAGV--SSDHEL-------VSGE---dlxAKLRA-GLTIELRGS--HDHLlP  260
DSSP  hhHHHHHHHLLL--LEELLL-------LLHH---hhhHHHHL-LLEEEEELL--LHHHhH


DSSP  HHHHHHHLL---lllLLLLLLLlllLLLLLL---LLHHHHHHHHHHLLLLHHHHHHLLLH
Query VAEAAIARG---llpFSISTDLhghSXNFPV---WDLATTXSKLLSVDXPFENVVEAVTR  310
ident    ||              ||               |      |       |    | | 
Sbjct EFVAALNTLghlpqtVTLCTDD---VFPDDLlqgGGLDDVVRRLVRYGLKPEWALRAATL  317
DSSP  HHHHHHHHHllllllEEEELLL---LLHHHHhhlLLHHHHHHHHHHLLLLHHHHHHHHLH


DSSP  HHHHHLLLLLllLLLLLLLLEEEEEEEeeeeeeeellllleeeeeEEEEEEEEEELLEE-
Query NPASVIRLDXenRLDVGQRADFTVFDLvdadleatdsngdvsrlkRLFEPRYAVIGAEA-  369
ident | |             | |||  ||                      |  |       | 
Sbjct NAAQRLGRSDlgLIAAGRRADIVVFED-----------------lNGFSARHVLASGRAv  360
DSSP  HHHHHHLLLLllLLLLLLLLLEEEELL-----------------lLLLLEEEEEELLEEe


DSSP  EELL--------------------------------------------------------
Query IAAS--------------------------------------------------------  373
ident                                                             
Sbjct AEGGrxlvdiptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgetead  420
DSSP  EELLeelllllllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  373
ident                                                             
Sbjct vkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggn  480
DSSP  eelleellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeell


DSSP  ----------------------------------------llLLLL--------------
Query ----------------------------------------ryIPRA--------------  379
ident                                                             
Sbjct agdxalaanavigtgggxavasegkvtailplplsglvsdapLEEVarafedlreavgkv  540
DSSP  hhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllHHHHhhhhhhhhhhhhhh


DSSP  -----------------------------------------------
Query -----------------------------------------------  379
ident                                                
Sbjct vewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 14: Query=2ogjA Sbjct=3e74A Z-score=24.0

back to top
DSSP  llLEEEEEEEELlLLLLllLLLEEEEELlLLLEEEEELLLLLLlLEEELLL-LEEEELEE
Query qaPILLTNVKPVgFGKGasQSSTDILIGgDGKIAAVGSALQAPaDTQRIDA-AFISPGWV   59
ident        |               ||     ||||| |  |               ||| |
Sbjct sfDLIIKNGTVI-LENE--ARVVDIAVK-GGKIAAIGQDLGDA-KEVXDASgLVVSPGXV   55
DSSP  leEEEEELLEEE-LLLL--EEELEEEEE-LLEEEEEELLLLLE-EEEEELLlLEEEELEE


DSSP  EEEELLLLlllllllLHHHlLHHHLEEEEEEELL-----LLLL-LHHHHHHHLLLLLLLE
Query DLHVHIWHggtdisiRPSEcGAERGVTTLVDAGS-----AGEA-NFHGFREYIIEPSRER  113
ident | | ||               |  | ||                                
Sbjct DAHTHIGY-----etGTRA-AAKGGITTXIEXPLnqlpaTVDRaSIELKFDAAKGKLTID  109
DSSP  EEEELLLH-----hhHHHH-HHHLLEEEEEELLLlllllLLLHhHHHHHHHHHLLLLLLE


DSSP  EEEEEELLlllllllllllllllhhHLLHHHHHhHHHLLLllEEEEEEEElhhhhlllLL
Query IKAFLNLGsiglvacnrvpelrdikDIDLDRILeCYAENSehIVGLXVRAshvitgswGV  173
ident       |                      ||      |     || |             
Sbjct AAQLGGLV-----------------SYNIDRLH-ELDEVG--VVGFXCFV-----rdvND  144
DSSP  EEELEELL-----------------LLLLLLHH-HHHHHL--LLLEEEEL-----lllLH


DSSP  HHHHHHHHHHHHHLLLEEEEELLLL------------------------------lLHHH
Query TPVKLGKKIAKILKVPXXVHVGEPP------------------------------aLYDE  203
ident      |      |  |  ||                                        
Sbjct WQFFKGAQKLGELGQPVLVHCENALicdelgeeakregrvtahdyvasrpvfteveAIRR  204
DSSP  HHHHHHHHHHHHHLLLEEEELLLHHhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHH


DSSP  HHHHLL---lLLEEELLlllllllLLLLlhhHHHHHHHLL----LLEEELLL--------
Query VLEILG---pGDVVTHCfngksgsSIXEdedLFNLAERCE----GIRLDIGH--------  248
ident ||           | |        |  |         |       |              
Sbjct VLYLAKvagcRLHVCHV-------SSPE---GVEEVTRARqegqDITCESCPhyfvldtd  254
DSSP  HHHHHHhhllLEEELLL-------LLHH---HHHHHHHHHhlllLEEEEELLhhhhllhh


DSSP  ---------lLLLLL-----HHHHHHHHHlLLLLLLLLLLLLL---------------LL
Query ---------gGASFS-----FKVAEAAIArGLLPFSISTDLHG---------------HS  279
ident                      |                 |                    
Sbjct qfeeigtlakCSPPIrdlenQKGXWEKLF-NGEIDCLVSDHSPcppexkagnixkawgGI  313
DSSP  hhhhhlhhhlLLLLLllhhhHHHHHHHHH-LLLLLEELLLLLLlllllllllllllllLL


DSSP  LLlllLLHH-HHHHHHH-HLLLLHHHHHHLLLHHHHHHLLLLLllLLLLLLLLEEEEEEE
Query XNfpvWDLA-TTXSKLL-SVDXPFENVVEAVTRNPASVIRLDXenRLDVGQRADFTVFDL  337
ident                      |           | |    |    |   |  |||     
Sbjct AG--lQSCXdVXFDEAVqKRGXSLPXFGKLXATNAADIFGLQQkgRIAPGKDADFVFIQP  371
DSSP  LL--hHHHHhHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLLLLllLLLLLLLLLEEEEEL


DSSP  -EEEEE-----eeellllleeEEEEEEEEEEEEELLEEEELL----------llllll
Query -VDADL-----eatdsngdvsRLKRLFEPRYAVIGAEAIAAS----------ryipra  379
ident      |                                |                   
Sbjct nSSYVLtnddleyrhkvspyvGRTIGARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
DSSP  lLLEELlhhhlllllllllllLLEELLEEEEEEELLEEEEELllllllllllleelll


No 15: Query=2ogjA Sbjct=3ls9A Z-score=23.7

back to top
DSSP  llLEEEEEE-EELLLLLL-LLLLLEEEEELlLLLEEEEELLLLLLLL-EEEL-LLLEEEE
Query qaPILLTNV-KPVGFGKG-ASQSSTDILIGgDGKIAAVGSALQAPAD-TQRI-DAAFISP   56
ident    ||         |          ||||    || |||  |                 |
Sbjct --MILIRGLtRVITFDDQeRELEDADILID-GPKIVAVGKDLSDRSVsRTIDgRGMIALP   57
DSSP  --LEEEEEEeEEELLLLLlLEEEEEEEEEE-LLEEEEEELLLLLLLLlEEEElLLEEEEE


DSSP  LEEEEEELLL---------------------------------------LLLLllllLHH
Query GWVDLHVHIW---------------------------------------HGGTdisiRPS   77
ident |    | |                                                    
Sbjct GLINSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvIREV-araVLL  116
DSSP  LEEEEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhHHHH-hhhHHH


DSSP  HlLHHHLEEEEEEELLL-----llLLHHHHHHhLLLLLLLEEEEEEELllllllllllll
Query EcGAERGVTTLVDAGSA-----geANFHGFREyIIEPSRERIKAFLNLgsiglvacnrvp  132
ident |     | ||  |                  |        |  |                
Sbjct E-SLLGGITTVADQHLFfpgatadSYIDATIE-AATDLGIRFHAARSS------------  162
DSSP  H-HHHLLEEEEEEEELLlllllllLHHHHHHH-HHHHHLLEEEEEELL------------


DSSP  LLLL------------HHHLL-HHHHHHHHHLLLL------LEEEEEEEELhHHHLlllL
Query ELRD------------IKDID-LDRILECYAENSE------HIVGLXVRAShVITGswgV  173
ident                           |       |          |              
Sbjct MTLGkseggfcddlfvEPVDRvVQHCLGLIDQYHEpepfgmVRIALGPCGV-PYDK---P  218
DSSP  LLLLhhhlllllhhhlLLHHHhHHHHHHHHHHHLLllllllEEEEELLLLL-LLLL---H


DSSP  HHHHHHHHHHHHHLLLEEEEE----LLLLL-------LHHHHHH--HLLLLLEEELLLll
Query TPVKLGKKIAKILKVPXXVHV----GEPPA-------LYDEVLE--ILGPGDVVTHCFng  220
ident          |    |    |                                   |    
Sbjct ELFEAFAQMAADYDVRLHTHFyeplDAGMSdhlygmtPWRFLEKhgWASDRVWLAHAV--  276
DSSP  HHHHHHHHHHHHHLLEEEEEEllllHHHHHhhhhlllHHHHHHHllLLLLLEEEEELL--


DSSP  llllLLLLlhhhhHHHHHL--LLLEEELLLLLL---llLHHHHHHHHhLLLLLLLLLLLL
Query ksgsSIXEdedlfNLAERC--EGIRLDIGHGGA---sfSFKVAEAAIaRGLLPFSISTDL  275
ident                       |                                  |  
Sbjct ----VPPR-----EEIPEFadAGVAIAHLIAPDlrmgwGLAPIREYL-DAGITVGFGTTG  326
DSSP  ----LLLH-----HHHHHHhhHLLEEEELHHHHhhlllLLLLHHHHH-HLLLEEEELLLL


DSSP  LLLLLlllLLLHHHHHHHHHHL-----------LLLHHHHHHLLLHHHHHHLLLLLllLL
Query HGHSXnfpVWDLATTXSKLLSV-----------DXPFENVVEAVTRNPASVIRLDXenRL  324
ident            |                                ||  |          |
Sbjct SASND---GGNLLGDLRLAALAhrpadpnepekWLSARELLRMATRGSAECLGRPDlgVL  383
DSSP  LLLLL---LLLHHHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHHLLLLLllLL


DSSP  LLLLLLEEEEEE-----------------EEEEeeeeellllleeeeeeEEEEEEEEELL
Query DVGQRADFTVFD-----------------LVDAdleatdsngdvsrlkrLFEPRYAVIGA  367
ident   |  ||                                                 |   
Sbjct EEGRAADIACWRldgvdrvgvhdpaigliMTGL----------------SDRASLVVVNG  427
DSSP  LLLLLLLEEEEElllhhhlllllhhhhhhHLLL----------------LLLLLEEEELL


DSSP  EE-EELL-------------llllll
Query EA-IAAS-------------ryipra  379
ident                           
Sbjct QVlVENErpvladlerivanttalip  453
DSSP  EEeEELLeellllhhhhhhhhhhhll


No 16: Query=2ogjA Sbjct=1j6pA Z-score=23.6

back to top
DSSP  lLLEEEE-EEEELLLLllLLLLLEEEEELlLLLEEEEE-LLLLlllleEELLL-LEEEEL
Query qAPILLT-NVKPVGFGkgASQSSTDILIGgDGKIAAVG-SALQapadtQRIDA-AFISPG   57
ident               |            |   | |  |                     | 
Sbjct -HHXIIGnCLILKDFS--SEPFWGAVEIE-NGTIKRVLqGEVK----vDLDLSgKLVXPA   52
DSSP  -LEEEEEeEEELLLLL--LLLEEEEEEEE-LLEEEEEEeLLLL----lLEELLlEEEEEL


DSSP  EEEEEELLLL------------------------------LLLL-llLLHHHlLHHHLEE
Query WVDLHVHIWH------------------------------GGTD-isIRPSEcGAERGVT   86
ident     | |                                            |  |  |  
Sbjct LFNTHTHAPXtllrgvaedlsfeewlfskvlpiedrltekXAYYgtiLAQXE-XARHGIA  111
DSSP  EEEEEELHHHhhhllllllllhhhhhhllhhhhhllllhhHHHHhhhHHHHH-HHLLLEE


DSSP  EEEeELLLlllLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHHHLL-HHHH
Query TLVdAGSAgeaNFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIKDID-LDRI  145
ident   |                       |      |                  |   |   
Sbjct GFV-DXYF---HEEWIAK-AVRDFGXRALLTRGLV------------DSNGDDGGrLEEN  154
DSSP  EEE-EEEL---LHHHHHH-HHHHHLLEEEEEEEEL------------LLLLLLLLhHHHH


DSSP  HHHHHLLLL----LEEEEEEEELhHHHLlllLHHHHHHHHHHHHHLLLEEEEEL---LLL
Query LECYAENSE----HIVGLXVRAShVITGswgVTPVKLGKKIAKILKVPXXVHVG---EPP  198
ident |  | |         ||                  |     || |  |   |        
Sbjct LKLYNEWNGfegrIFVGFGPHSP-YLCS---EEYLKRVFDTAKSLNAPVTIHLYetsKEE  210
DSSP  HHHHHHHLLhhhlEEEEEEELLL-LLLL---HHHHHHHHHHHHHHLLLEEEEELlllLLL


DSSP  LLHHHHHH-HLLL-LLEEELLLlllllLLLLllhHHHHHHHHlLLLEEELLLLL-----L
Query ALYDEVLE-ILGP-GDVVTHCFngksgSSIXedeDLFNLAERcEGIRLDIGHGG-----A  251
ident       |   |        ||               |                       
Sbjct YDLEDILNiGLKEvKTIAAHCV-----HLPE---RYFGVLKD-IPFFVSHNPASnlklgN  261
DSSP  LLLHHHHLlLLLLlLEEEEELL-----LLLH---HHHHHHLL-LLEEEEELHHHhhhllL


DSSP  LLLhhHHHHHHhLLLLLLLLLLLLLLLLLlllLLLHHHHHHHHHHL-------LLLHHHH
Query SFSfkVAEAAIaRGLLPFSISTDLHGHSXnfpVWDLATTXSKLLSV-------DXPFENV  304
ident           |          ||            |   |                    
Sbjct GIA--PVQRXI-EHGXKVTLGTDGAASNN---SLNLFFEXRLASLLqkaqnprNLDVNTC  315
DSSP  LLL--LHHHHH-HLLLEEEELLLLLLLLL---LLLHHHHHHHHHHHhhlllllLLLHHHH


DSSP  HHLLLHHHHHHLLLLLllLLLLLLLLEEEEEE-EEEEeeeeellllleeeEEEEEEEEEE
Query VEAVTRNPASVIRLDXenRLDVGQRADFTVFD-LVDAdleatdsngdvsrLKRLFEPRYA  363
ident    ||   |             |  ||  | |                       |    
Sbjct LKXVTYDGAQAXGFKS-gKIEEGWNADLVVIDlDLPE-xfpvqniknhlvHAFSGEVFAT  373
DSSP  HHHHLHHHHHHHLLLL-lLLLLLLLLLEEEEElLLHH-hllhhhhhhhhhHLLLLLLLEE


DSSP  EELLEE-EELL-----------------llllll
Query VIGAEA-IAAS-----------------ryipra  379
ident                                   
Sbjct XVAGKWiYFDGeyptidseevkrelariekelys  407
DSSP  EELLEEeEELLllllllhhhhhhhhhhhhhhhhl


No 17: Query=2ogjA Sbjct=4b3zD Z-score=23.2

back to top
DSSP  lLLEEEEEEEELLLLLlllLLLEEEEELlLLLEEEEELLLLLL-LLEEELLL-LEEEELE
Query qAPILLTNVKPVGFGKgasQSSTDILIGgDGKIAAVGSALQAP-ADTQRIDA-AFISPGW   58
ident     |                  |     || |   |  |  |              || 
Sbjct -DRLLIKGGRIINDDQ---SLYADVYLE-DGLIKQIGENLIVPgGVKTIEANgRMVIPGG   55
DSSP  -LEEEEEEEEEELLLL---EEEEEEEEE-LLEEEEEELLLLLLlLLEEEELLlLEEEELE


DSSP  EEEEELLLLLllLLLLL--HHHLLHHHLEEEEEEeLLLL------LLLHHHHHHHLLLLL
Query VDLHVHIWHGgtDISIR--PSECGAERGVTTLVDaGSAG------EANFHGFREYIIEPS  110
ident  |                         | |   |              |    |     |
Sbjct IDVNTYLQKT--AADDFfqGTRAALVGGTTMIID-HVVPepgsslLTSFEKWHEAADTKS  112
DSSP  EEEEELLLLL--LLLLHhhHHHHHHHLLEEEEEE-EELLlllllhHHHHHHHHHHHHLLL


DSSP  LLEEEEEEELLllllllllllllLLLHHhlLHHHHHHHHHLLLllEEEEEEEEL--HHHH
Query RERIKAFLNLGsiglvacnrvpeLRDIKdiDLDRILECYAENSehIVGLXVRAS--HVIT  168
ident                                                   |      |  
Sbjct CCDYSLHVDIT------------SWYDG--VREELEVLVQDKG--VNSFQVYMAykDVYQ  156
DSSP  LLEEEEEEELL------------LLLLL--HHHHHHHHHHLLL--LLEEEEELLllLLLL


DSSP  lllLLHHHHHHHHHHHHHLLLEEEEELLLL------------------------------
Query gswGVTPVKLGKKIAKILKVPXXVHVGEPP------------------------------  198
ident                | |     ||                                   
Sbjct --mSDSQLYEAFTFLKGLGAVILVHAENGDliaqeqkrilemgitgpeghalsrpeelea  214
DSSP  --lLHHHHHHHHHHHHHHLLEEEEELLLHHhhhhhhhhhhhllllllhhhhhhllhhhhh


DSSP  lLHHHHHHHLL---LLLEEELLLLLlllLLLLllhhhhhHHHHLL----LLEEELLLL--
Query aLYDEVLEILG---PGDVVTHCFNGksgSSIXededlfnLAERCE----GIRLDIGHG--  249
ident         | |        |        |                               
Sbjct eAVFRAITIAGrinCPVYITKVMSK---SAAD-------IIALARkkgpLVFGEPIAAsl  264
DSSP  hHHHHHHHHHHhhlLLEEEEEELLH---HHHH-------HHHHHHhhllLEEEEELHHhh


DSSP  -------------------LLLL------LHHHHHHHHhlLLLLLLLLLLLLL-------
Query -------------------GASF------SFKVAEAAIarGLLPFSISTDLHG-------  277
ident                                                             
Sbjct gtdgthywsknwakaaafvTSPPlspdptTPDYLTSLL-aCGDLQVTGSGHCPystaqka  323
DSSP  hlllhhhhlllhhhhhhllLLLLllllllHHHHHHHHH-hHLLLLLLLLLLLLllhhhhh


DSSP  -----------LLLLlllLLHH-HHHHHHH-HLLLLHHHHHHLLLHHHHHHLLLLLL-lL
Query -----------HSXNfpvWDLA-TTXSKLL-SVDXPFENVVEAVTRNPASVIRLDXE-nR  323
ident                            |            |     | |    |     |
Sbjct vgkdnftlipeGVNG--iEERMtVVWDKAVaTGKMDENQFVAVTSTNAAKIFNLYPRkgR  381
DSSP  hhlllhhhlllLLLL--lLLHHhHHHHHHLlLLLLLHHHHHHHHLHHHHHHHLLLLLllL


DSSP  LLLLLLLEEEEEEEE-EEEEE-----eellllleeEEEEEEEEEEEEELLEEEEL-----
Query LDVGQRADFTVFDLV-DADLE-----atdsngdvsRLKRLFEPRYAVIGAEAIAA-----  372
ident   ||  ||    |                             |                 
Sbjct IAVGSDADVVIWDPDkLKTITakshksaveynifeGMECHGSPLVVISQGKIVFEdgnin  441
DSSP  LLLLLLLLEEEEEEEeEEELLllllllllllllllLLEEEEEEEEEEELLEEEEElleel


DSSP  -----------------------------lllllll
Query -----------------------------sryipra  379
ident                                     
Sbjct vnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  lllllllllllllllhhhhhhhhhhhhhllllllll


No 18: Query=2ogjA Sbjct=1yrrB Z-score=22.5

back to top
DSSP  lllEEEEEEEELLLLllLLLLLEEEEELlLLLEEEEELL-LLLLLLEEELLL-LEEEELE
Query qapILLTNVKPVGFGkgASQSSTDILIGgDGKIAAVGSA-LQAPADTQRIDA-AFISPGW   58
ident      ||                   |  || |  |       |   ||    |  ||| 
Sbjct ---YALTQGRIFTGH--EFLDDHAVVIA-DGLIKSVCPVaELPPEIEQRSLNgAILSPGF   54
DSSP  ---LEEELLEEELLL--LEELLEEEEEE-LLEEEEEEEHhHLLLLLLEEELLlLEEEELE


DSSP  EEEEELL-----LLLLLL-----lllLHHHLLHHHLEEEEEEELL----llLLLHHHHHH
Query VDLHVHI-----WHGGTD-----isiRPSECGAERGVTTLVDAGS----agEANFHGFRE  104
ident  |                                 | |                      
Sbjct IDVQLNGcggvqFNDTAEavsvetleIMQKANEKSGCTNYLPTLIttsdelMKQGVRVMR  114
DSSP  EEEEELEelleeLLLLLLlllhhhhhHHHHHHHLLLEEEEEEEELlllhhhHHHHHHHHH


DSSP  HLLLLLLLEE-EEEEELLlllllllllllllllhhhllhHHHHHHHHLLLLLEEEEEEEE
Query YIIEPSRERI-KAFLNLGsiglvacnrvpelrdikdidlDRILECYAENSEHIVGLXVRA  163
ident               |                                ||   |       
Sbjct EYLAKHPNQAlGLHLEGP------------------wlnAALVDFLCENADVITKVTLAP  156
DSSP  HHHHHLLLLLlLEEEELL------------------lllLHHHHHHHHLHHHEEEEEELH


DSSP  lhhhhllllLHHHHHHHHHHHHHLLLEEEEELlllLLHH-HHHHHLL-llLEEELLLLll
Query shvitgswgVTPVKLGKKIAKILKVPXXVHVGeppALYD-EVLEILG-pgDVVTHCFNgk  221
ident                                         |            ||  |  
Sbjct ---------EMVPAEVISKLANAGIVVSAGHS---NATLkEAKAGFRagiTFATHLYN--  202
DSSP  ---------HHLLHHHHHHHHHHLLEEEELLL---LLLHhHHHHHHHhleEEELLLLL--


DSSP  llLLLLLLHHH--hHHHHHLLLLEEELLLLLLLLLHHHHHHHHhlLLLL--LLLLLLLLL
Query sgSSIXEDEDL--fNLAERCEGIRLDIGHGGASFSFKVAEAAIarGLLP--FSISTDLHG  277
ident                       |   |   |          |    |        ||   
Sbjct -aMPYITGREPglaGAILDEADIYCGIIADGLHVDYANIRNAK--RLKGdkLCLVTDATS  259
DSSP  -lLLLLLLLLLhhhHHHHHLLLLEEEEELLLLLLLHHHHHHHH--HHHHhhEEEELLLLL


DSSP  LLLllllLLHHHHHHHHHH-LLLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLLEEEEE
Query HSXnfpvWDLATTXSKLLS-VDXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRADFTVF  335
ident  |              |          |    |  ||  |        |  |  |  | |
Sbjct GSS----LTMIEGVRNLVEhCGIALDEVLRMATLYPARAIGVEKRlgTLAAGKVANLTAF  315
DSSP  LLL----LLHHHHHHHHHHhHLLLHHHHHHHHLHHHHHHLLLLLLllLLLLLLLLLEEEE


DSSP  EEEeeeeeeellllleeeeeeeEEEEEEEELLEEEELLllllll
Query DLVdadleatdsngdvsrlkrlFEPRYAVIGAEAIAASryipra  379
ident                       |                     
Sbjct TPD-------------------FKITKTIVNGNEVVTQ------  334
DSSP  LLL-------------------LLEEEEEELLEEEEEL------


No 19: Query=2ogjA Sbjct=4c5yA Z-score=22.1

back to top
DSSP  --LLLEEEEEEEEL-LLLLllLLLLEEEEELLlLLEEEEE--LLLL---LLLL-EEELLl
Query --QAPILLTNVKPV-GFGKgaSQSSTDILIGGdGKIAAVG--SALQ---APAD-TQRIDa   51
ident                | |           |     || ||                    
Sbjct deAKVTIIYAGLLIpGDGE--PLRNAALVISD-KIIAFVGseADIPkkyLRSTqSTHRV-   56
DSSP  llLLEEEEEEEEELlLLLL--LEEEEEEEEEL-LEEEEEEehHHLLhhhHHHLlLEEEE-


DSSP  LEEEELEEEEEELLLLL--------LLLL----------llLHHHlLHHHLEEEEEEELL
Query AFISPGWVDLHVHIWHG--------GTDI----------siRPSEcGAERGVTTLVDAGS   93
ident     ||  | | |                               |     | |   |   
Sbjct PVLMPGLWDCHMHFGGDddyyndytSGLAthpassgarlarGCWE-ALQNGYTSYRDLAG  115
DSSP  EEEEELEEEEEELLLLLlllllllhHHHHllhhhhhhhhhhHHHH-HHHLLEEEEEELLL


DSSP  lllllhhhHHHHLLLLL------LLEEEEE-EELLllllllLLLL---------------
Query ageanfhgFREYIIEPS------RERIKAF-LNLGsiglvaCNRV---------------  131
ident                                  |                          
Sbjct --------YGCEVAKAIndgtivGPNVYSSgAALS-qtaghGDIFalpagevlgsygvmn  166
DSSP  --------LHHHHHHHHhlllllLLEEEELlLEEE-lllllLLLLlllhhhhhhhhllll


DSSP  ----------lLLLLHhhLLHHHHHhHHHLLLllEEEEEEEELHH--------hhlllLL
Query ----------pELRDIkdIDLDRILeCYAENSehIVGLXVRASHV--------itgswGV  173
ident               |                       || ||                 
Sbjct prpgywgagplCIADGveEVRRAVR-LQIRRG--AKVIXVMASGGvmsrddnpnfaqfSP  223
DSSP  lllllllllleEELLLhhHHHHHHH-HHHHHL--LLLEEEELLLLlllllllllllllLH


DSSP  HHHHHHHHHHHHHLLLEEEEELLLLlLHHHHHHHLlllLEEELLLllllllLLLLLhhHH
Query TPVKLGKKIAKILKVPXXVHVGEPPaLYDEVLEILgpgDVVTHCFngksgsSIXEDedLF  233
ident    |     |         ||                     |           |     
Sbjct EELKVIVEEAARQNRIVSAHVHGKA-GIMAAIKAG--cKSLEHVS------YADEE--VW  272
DSSP  HHHHHHHHHHHHLLLLEEEEELLHH-HHHHHHHHL--lLEEEELL------LLLHH--HH


DSSP  HHHHHLlLLEEELLLLLL-----------------------llLHHHHHHHHHlLLLLLL
Query NLAERCeGIRLDIGHGGA-----------------------sfSFKVAEAAIArGLLPFS  270
ident  |     ||                                    |    ||        
Sbjct ELMKEK-GILYVATRSVIeiflasngeglvkeswaklqaladsHLKAYQGAIK-AGVTIA  330
DSSP  HHHHHH-LLEEELLHHHHhhhhhhllllllllhhhlllhhhhhHHHHHHHHHH-LLLLEE


DSSP  LLLLLLllllllllLLHHHHHHHHHHL-LLLHHHHHHLLLHHHHHHL---LLLLllLLLL
Query ISTDLHghsxnfpvWDLATTXSKLLSV-DXPFENVVEAVTRNPASVI---RLDXenRLDV  326
ident   ||             |                   | | |               |  
Sbjct LGTDTA------pgGPTALELQFAVERgGMTPLEAIKAATANAPLSVgpqAPLT-gQLRE  383
DSSP  LLLLLL------llLLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHHhhhLLLL-lLLLL


DSSP  LLLLEEEEEE--EEEEeeeeellllleeeeeEEEE-----EEEEEELLEEEE--------
Query GQRADFTVFD--LVDAdleatdsngdvsrlkRLFE-----PRYAVIGAEAIA--------  371
ident |  ||                                         |             
Sbjct GYEADVIALEenPLED---------------IKVFqepkaVTHVWKGGKLFKgpgigpwg  428
DSSP  LLLLLEEEELllLLLL---------------HHHHhlhhhEEEEEELLEEEEllllllll


DSSP  llllllll
Query asryipra  379
ident         
Sbjct edarnpfl  436
DSSP  llllllll


No 20: Query=2ogjA Sbjct=2uz9A Z-score=21.3

back to top
DSSP  lLLEEEEEEEELLLLLL-lLLLL-EEEEELLLLLEEEEELL-------lLLLL--lEEEL
Query qAPILLTNVKPVGFGKG-aSQSS-TDILIGGDGKIAAVGSA-------lQAPA--dTQRI   49
ident                                 |||     |                 | 
Sbjct pLAHIFRGTFVHSTWTCpmEVLRdHLLGVSDSGKIVFLEEAsqqeklakEWCFkpcEIRE   60
DSSP  lLLEEEEEEEEELLLLLllEEEEeEEEEELLLLLEEEEEEHhhhhhhhhHHLLlhhHEEE


DSSP  LL--LEEEELEEEEEELLL-------------------------------lLLLLLL-LL
Query DA--AFISPGWVDLHVHIW-------------------------------hGGTDIS-IR   75
ident      |  || || | |                                           
Sbjct LShhEFFMPGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidFAEEVYtRV  120
DSSP  LLllLEEEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhHHHHHHhHH


DSSP  HHHLLhHHLEEEEEEeLLLL-LLLHHHHHHhLLLLLLLEEEEEEELLllllllllLLLLl
Query PSECGaERGVTTLVDaGSAG-EANFHGFREyIIEPSRERIKAFLNLGsiglvacnRVPEl  134
ident         | ||                   |      |                     
Sbjct VRRTL-KNGTTTACY-FATIhTDSSLLLAD-ITDKFGQRAFVGKVCM--dlndtfPEYK-  174
DSSP  HHHHH-HLLEEEEEE-ELLLlHHHHHHHHH-HHHHHLLEEEEELEEL--llllllLLLL-


DSSP  LLHHHLLHhHHHHHHHLLL-----lLEEEEE-EEELhhhhlllLLHHHHHHHHHHHHHLL
Query RDIKDIDLdRILECYAENS-----eHIVGLX-VRAShvitgswGVTPVKLGKKIAKILKV  188
ident                 |                            |       |||    
Sbjct ETTEESIK-ETERFVSEMLqknysrVKPIVTpRFSL-----scSETLMGELGNIAKTRDL  228
DSSP  LLHHHHHH-HHHHHHHHHHhhllllEEEEEEeLLHH-----hlLHHHHHHHHHHHHHHLL


DSSP  LEEEEEL-----LLLL---------LHHHHHHH--LLLLLEEELLLllllllLLLLlhhh
Query PXXVHVG-----EPPA---------LYDEVLEI--LGPGDVVTHCFngksgsSIXEdedl  232
ident     |                              |    |  |                
Sbjct HIQSHISenrdeVEAVknlypsyknYTSVYDKNnlLTNKTVMAHGC------YLSA----  278
DSSP  EEEEEELllhhhHHHHhhhllllllHHHHHHHLllLLLLEEEEELL------LLLH----


DSSP  hHHHHHL--LLLEEELLLLL-----LLLLhhHHHHHHhLLLLLLLLLLLLlLLLLlllLL
Query fNLAERC--EGIRLDIGHGG-----ASFSfkVAEAAIaRGLLPFSISTDLhGHSXnfpVW  285
ident           |                |                   ||           
Sbjct -EELNVFheRGASIAHCPNSnlslsSGFL--NVLEVL-KHEVKIGLGTDV-AGGY---SY  330
DSSP  -HHHHHHhhHLLEEEELHHHhhhllLLLL--LHHHHH-HLLLEEEELLLL-LLLL---LL


DSSP  LHHHHHHHHHHLL------------LLHHHHHHLLLHHHHHHLLLLL-llLLLLLLLLEE
Query DLATTXSKLLSVD------------XPFENVVEAVTRNPASVIRLDX-enRLDVGQRADF  332
ident            |                  |    |        ||       ||   | 
Sbjct SMLDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQALGLDGeigNFEVGKEFDA  390
DSSP  LHHHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHHLLLLLlllLLLLLLLLLE


DSSP  EEE------------------------EEEEeeeeeellllleeeeeEEEE---EEEEEE
Query TVF------------------------DLVDadleatdsngdvsrlkRLFE---PRYAVI  365
ident                                                 |           
Sbjct ILInpkasdspidlfygdffgdiseavIQKF---------------lYLGDdrnIEEVYV  435
DSSP  EEElllllllllllllhhhhlllllhhHHHH---------------hHHLLhhhEEEEEE


DSSP  LLEEEEllllllll
Query GAEAIAasryipra  379
ident |             
Sbjct GGKQVV-----pfs  444
DSSP  LLEEEE-----lll


No 21: Query=2ogjA Sbjct=3icjA Z-score=20.3

back to top
DSSP  lLLEEEE-EEEELLLLLlLLLLlEEEEELlLLLEEEEEL---LLLL---LLLEEELL-LL
Query qAPILLT-NVKPVGFGKgASQSsTDILIGgDGKIAAVGS---ALQA---PADTQRID-AA   52
ident      |        |            |         |    ||                
Sbjct -CMKALInGTIYTSFSP-VKKV-SGLVIS-NERVLYAGDsstALRIaelAGGEIIDLkGK   56
DSSP  -LEEEEElLEEEEEELL-EEEE-LEEEEE-LLEEEEEELhhhHHHHhhhHLLEEEELlLL


DSSP  EEEELEEEEEELLlllllLLLL--------------------------------------
Query FISPGWVDLHVHIwhggtDISI--------------------------------------   74
ident |  |   | | |      |                                         
Sbjct FVMPAFFDSHLHL-----DELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqde  111
DSSP  EEEELEEEEEELH-----HHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   74
ident                                                             
Sbjct lgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreralees  171
DSSP  hlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhh


DSSP  --------------------LHHHlLHHHLEEEEEEELlLLLLLHHHHHHHL-lLLLLLE
Query --------------------RPSEcGAERGVTTLVDAGsAGEANFHGFREYI-iEPSRER  113
ident                              ||         ||       |          
Sbjct rkiinekiltvkdykhyiesAQEH-LLSLGVHSVGFMS-VGEKALKALFELEreGRLKMN  229
DSSP  hhhhhhllllhhhhhhhhhhHHHH-HHHLLEEEEEEEE-ELHHHHHHHHHHHhlLLLLLE


DSSP  EEEEEELLLllllllllllllllhhhllHHHHHHhhHLLLL----LEEEEEEEEL-----
Query IKAFLNLGSiglvacnrvpelrdikdidLDRILEcyAENSE----HIVGLXVRAS-----  164
ident   | |                       ||   |      |     | | |         
Sbjct VFAYLSPEL-------------------LDKLEElnLGKFEgrrlRIWGVXLFVDgslga  270
DSSP  EEEEELHHH-------------------HHHHHHhlLLLEEllleEEEEEEEELLlllll


DSSP  -----------------HHHHlllLLHHHHHHHHHHHHHLLLEEEEELLlllLHHHHHHH
Query -----------------HVITgswGVTPVKLGKKIAKILKVPXXVHVGEppaLYDEVLEI  207
ident                                    || |     ||        |  |  
Sbjct rtallsepytdnpttsgELVM---NKDEIVEVIERAKPLGLDVAVHAIG-dkAVDVALDA  326
DSSP  lllllllllllllllllLLLL---LHHHHHHHHHHHLLLLLEEEEEELL-hhHHHHHHHH


DSSP  L---LLLLEEELLLllllllLLLLlhHHHHHHHHLlLLEEELLlllllLLHH--------
Query L---GPGDVVTHCFngksgsSIXEdeDLFNLAERCeGIRLDIGhggasFSFK--------  256
ident            |              |           |         |           
Sbjct FeeaEFSGRIEHAS------LVRD--DQLERIKEL-KVRISAQ---phFIVSdwwivnrv  374
DSSP  HhhhLLLLEEEELL------LLLH--HHHHHHHHH-LLEEEEL---llHHHHlllhhhhh


DSSP  -------HHHHhhhlLLLL----LLLLLLLLllllllLLLL-HHHHHHHHHHL-------
Query -------VAEAaiarGLLP----FSISTDLHghsxnfPVWD-LATTXSKLLSV-------  297
ident                  |        |||                               
Sbjct geerakwAYRL----KTLSsitkLGFSTDSP------IEPAdPWVSIDAAVNRyvvdpge  424
DSSP  hhhhhhhLLLH----HHHHhhllEEELLLLL------LLLLlHHHHHHHHHHLllllhhh


DSSP  LLLHHHHHHLLLHHHHH-HLLLLLllLLLLLLLLEEEEE--EEEEeeeeeellllleeee
Query DXPFENVVEAVTRNPAS-VIRLDXenRLDVGQRADFTVF--DLVDadleatdsngdvsrl  354
ident     |      |   |      |    |  | ||       |                  
Sbjct RVSREEALHLYTHGSAQvTLAEDL-gKLERGFRAEYIILdrDPLK---------------  468
DSSP  LLLHHHHHHHLLHHHHHhLLLLLL-lLLLLLLLLLEEEEllLLLL---------------


DSSP  eeeeeeeeeeelleeeellllllll
Query krlfepryavigaeaiaasryipra  379
ident                          
Sbjct -------------------------  468
DSSP  -------------------------


No 22: Query=2ogjA Sbjct=4rdvB Z-score=19.5

back to top
DSSP  lllEEEEEEEElLLLLlLLLLLEEEEELLLLLEEEEE--LLLLLllleEELLLLEEEELE
Query qapILLTNVKPvGFGKgASQSSTDILIGGDGKIAAVG--SALQApadtQRIDAAFISPGW   58
ident                           |  ||  |                       || 
Sbjct ---SAIFAERA-LLPE-GWARNVRFEISADGVLAEIRpdANADG----AERLGGAVLPGM   51
DSSP  ---LEEEEEEE-EELL-EEEEEEEEEELLLLLEEEEEllLLLLL----LEELLLLEEELE


DSSP  EEEEELLL----------------------------------lLLLL-lllLHHHlLHHH
Query VDLHVHIW----------------------------------hGGTD-isiRPSEcGAER   83
ident   || |                                                |     
Sbjct PNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeQIEViacqLYIE-MLKA  110
DSSP  EEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhHHHHhhhhHHHH-HHHH


DSSP  LEEEEEEELlLLLL---------LHHHHHHhLLLLL---LLEEEEEEELLllllllllll
Query GVTTLVDAGsAGEA---------NFHGFREyIIEPS---RERIKAFLNLGsiglvacnrv  131
ident | |                            |                |           
Sbjct GYTAVAEFH-YVHHdldgrsyadPAELSLR-ISRAAsaaGIGLTLLPVLY----------  158
DSSP  LEEEEEEEE-LLLLlllllllllLLHHHHH-HHHHHhhhLLEEEEEELLL----------


DSSP  lLLLL-----------hhHLLHHHHHHHHHLLLL-------LEEEEEEEELhhhhlllll
Query pELRD-----------ikDIDLDRILECYAENSE-------HIVGLXVRAShvitgswgv  173
ident                          ||                                 
Sbjct -SHAGfggqpasegqrrfINGSEAYLELLQRLRApleaaghSLGLCFHSLR--------a  209
DSSP  -LEEEllleellhhhlllLLLHHHHHHHHHHHHHhhhhhllEELEEELLLL--------l


DSSP  hHHHHHHHHHHHHL--LLEEEEEL----LLLL--------LHHHHHH-HLLL-LLEEELL
Query tPVKLGKKIAKILK--VPXXVHVG----EPPA--------LYDEVLE-ILGP-GDVVTHC  217
ident                  |   |      |                 |           | 
Sbjct vTPQQIATVLAAGHddLPVHIHIAeqqkEVDDcqawsgrrPLQWLYEnVAVDqRWCLVHA  269
DSSP  lLHHHHHHHHLLLLllLLEEEEELllhhHHHHhhhhhlllHHHHHHHhLLLLlLEEEEEL


DSSP  LllllllLLLLlhhhhHHHHHL--LLLEEELLLLLL----LLLHhHHHHHHhLLLLLLLL
Query FngksgsSIXEdedlfNLAERC--EGIRLDIGHGGA----SFSFkVAEAAIaRGLLPFSI  271
ident                          |                 |  |            |
Sbjct T------HADP-----AEVAAMarSGAVAGLCLSTEanlgDGIF-PATDFL-AQGGRLGI  316
DSSP  L------LLLH-----HHHHHHhhHLLEEEELHHHHhhllLLLL-LHHHHH-HLLLEEEE


DSSP  LLLLLllllllLLLLHHHHHHHHHH---------LLLL-------HHHHHHLLLHHHHHH
Query STDLHghsxnfPVWDLATTXSKLLS---------VDXP-------FENVVEAVTRNPASV  315
ident   | |                 |                            |     |  
Sbjct GSDSH------VSLSVVEELRWLEYgqrlrdrkrNRLYrddqpmiGRTLYDAALAGGAQA  370
DSSP  LLLLL------LLLLHHHHHHHHHHhhhhhhlllLLLLllllllhHHHHHHHHHHHHHHH


DSSP  LLLLLllLLLLLLLLEEEEEE--------------EEEEeeeeellllleeeEEEE-eEE
Query IRLDXenRLDVGQRADFTVFD--------------LVDAdleatdsngdvsrLKRL-fEP  360
ident         | || |||  | |              |                        
Sbjct LGQPI-gSLAVGRRADLLVLDgndpylasaegdalLNRW------------lFAGGdrQV  417
DSSP  HLLLL-lLLLLLLLLLEEEELlllhhhhllllhhhHHHH------------hHHLLhhHE


DSSP  EEEEELLEE-EELL--------------llllll
Query RYAVIGAEA-IAAS--------------ryipra  379
ident |                                 
Sbjct RDVMVAGRWvVRDGrhageersarafvqvlgell  451
DSSP  EEEEELLEEeELLLllllhhhhhhhhhhhhhhhl


No 23: Query=2ogjA Sbjct=3ooqA Z-score=18.6

back to top
DSSP  llLEEEEEEEELLLLllLLLLLEEEEELlLLLEEEEELLLLLLLLEEELL-LLEEEELEE
Query qaPILLTNVKPVGFGkgASQSSTDILIGgDGKIAAVGSALQAPADTQRID-AAFISPGWV   59
ident    ||  |               | |    ||   ||     |          |  || |
Sbjct --KILFKNATVFPIT--SRPFKGDVLVS-NGKVEKVGENIEDPDAEIVDLtGKFLFPGFV   55
DSSP  --LEEEEEEEELLLL--LLLEEEEEEEE-LLEEEEEELLLLLLLLEEEELlLLEEEELEE


DSSP  EEEEL-LLLL------LLLL--------------------llLHHHlLHHHLEEEEEEEL
Query DLHVH-IWHG------GTDI--------------------siRPSEcGAERGVTTLVDAG   92
ident | | |             |                                |||      
Sbjct DAHSHiGLFEegvgyyYSDGneatdpvtphvkaldgfnpqdpAIER-ALAGGVTSVXIVP  114
DSSP  EEEELlLLLLllllhhHLLLllllllllllllhhhhlllllhHHHH-HHLLLEEEEEELL


DSSP  L-----lllllhhhhhhHLLLLLlleeeeeeelllllllllllllllllhhhllhhhhhh
Query S-----ageanfhgfreYIIEPSrerikaflnlgsiglvacnrvpelrdikdidldrile  147
ident                   | |                                       
Sbjct GsanpvggqgsvikfrsIIVEEC-------------------------------------  137
DSSP  LlllleeeeeeeeelllLLHHHH-------------------------------------


DSSP  hhhlllLLEEEEEEEELhHHHL-------------LLLLHHHH-----------------
Query cyaensEHIVGLXVRAShVITG-------------SWGVTPVK-----------------  177
ident           ||                                                
Sbjct ----ivKDPAGLKXAFG-ENPKrvygerkqtpstrXGTAGVIRdyftkvknyxkkkelaq  192
DSSP  ----eeEEEEEEEEELL-HHHHhhhhhlllllllhHHHHHHHHhhhhhhhhhhhhhhhhh


DSSP  -------------hhHHHHHHHLLLEEEEELLlllLHHHHHHHLL---lLLEEELLLlll
Query -------------lgKKIAKILKVPXXVHVGEppaLYDEVLEILG---pGDVVTHCFngk  221
ident                       | |   |             |        |  |     
Sbjct kegkeftetdlkxevGEXVLRKKIPARXHAHR-adDILTAIRIAEefgfNLVIEHGT---  248
DSSP  hlllllllllhhhhhHHHHHLLLLLEEEEELL-hhHHHHHHHHHHhhllLEEEEELL---


DSSP  lllLLLLlhhHHHHHHHLLlLEEELLLLLL--------lLLHHHHHHHHhLLLLLLLLLL
Query sgsSIXEdedLFNLAERCEgIRLDIGHGGA--------sFSFKVAEAAIaRGLLPFSIST  273
ident                     |    |                                  
Sbjct ---EAYK---ISKVLAEKK-IPVVVGPLLTfrtklelkdLTXETIAKLL-KDGVLIALXC  300
DSSP  ---LHHH---HHHHHHHHL-LLEEELLLLLllllhhhllLLLLHHHHHH-HLLLLEEELL


DSSP  LLLllllllLLLL--HHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLL
Query DLHghsxnfPVWD--LATTXSKLLSVDXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRA  330
ident |                             |      | |||    |         |  |
Sbjct DHP------VIPLefATVQAATAXRYGAKEEDLLKILTVNPAKILGLEDRigSIEPGKDA  354
DSSP  LLL------LLLHhhHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLLLLLllLLLLLLLL


DSSP  EEEEEE---EEEEeeeeellllleeeeeeeeEEEEEEELLEEEELLllllll
Query DFTVFD---LVDAdleatdsngdvsrlkrlfEPRYAVIGAEAIAASryipra  379
ident |  |                                 |              
Sbjct DLVVWSghpFDXK-----------------sVVERVYIDGVEVFRR-----e  384
DSSP  LEEEELlllLLLL-----------------lLEEEEEELLEEEEEL-----l


No 24: Query=2ogjA Sbjct=1a5kC Z-score=18.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ---llLEEEEEEEELLLLlllLLLLEEEEELlLLLEEEEELL----------LLLL-LLE
Query ---qaPILLTNVKPVGFGkgaSQSSTDILIGgDGKIAAVGSA----------LQAP-ADT   46
ident         |||   |           ||    || | | | |               |  
Sbjct aadcvDLVLTNALIVDHW---GIVKADIGVK-DGRIFAIGKAgnpdiqpnvtIPIGaATE  116
DSSP  hhhllLEEEEEEEEEELL---EEEEEEEEEE-LLEEEEEELEelllllllllEELLlLLE


DSSP  EELL-LLEEEELEEEEEELLllllllLLLL-HHHLlHHHLEEEEEEE-----------LL
Query QRID-AAFISPGWVDLHVHIwhggtdISIR-PSECgAERGVTTLVDA-----------GS   93
ident            |  | | |       |      |     |||| |               
Sbjct VIAAeGKIVTAGGIDTHIHW------ICPQqAEEA-LVSGVTTMVGGgtgpaagthatTC  169
DSSP  EEELlLLEEEELEEEEEEEL------LLLLhHHHH-HHHLEEEEEEElllllhhhhhlLL


DSSP  LLLL-LHHHHHHHlLLLLLLEEEEEEELLlllllllllllllllhhhLLHHHHHHHHHLL
Query AGEA-NFHGFREYiIEPSRERIKAFLNLGsiglvacnrvpelrdikdIDLDRILECYAEN  152
ident                      |                            |   |  |  
Sbjct TPGPwYISRMLQA-ADSLPVNIGLLGKGN-----------------vSQPDALREQVAAG  211
DSSP  LLHHhHHHHHHHH-HLLLLLEEEEEEELL-----------------lLLHHHHHHHHHHL


DSSP  lllEEEEEEEelHHHHlllLLHHHHHHHHHHHHHLLLEEEEELLLL--lLHHHHHHHL-L
Query sehIVGLXVRasHVITgswGVTPVKLGKKIAKILKVPXXVHVGEPP--aLYDEVLEIL-G  209
ident      ||                       |         |             |    |
Sbjct ---VIGLEIH--EDWG--aTPAAIDCALTVADEMDIQVALHSDTLNesgFVEDTLAAIgG  264
DSSP  ---LLEEEEE--HHHL--lLHHHHHHHHHHHHHHLLEEEEELLLLLlllLHHHHHHHHlL


DSSP  LLLEEELLLLL---lLLLLLlllhhhhhHHHHLLLLEEELLLL-----------------
Query PGDVVTHCFNG---kSGSSIxededlfnLAERCEGIRLDIGHG-----------------  249
ident       |            |         |     |                        
Sbjct RTIHTFHTEGAggghAPDII--------TACAHPNILPSSTNPtlpytlntidehldmlm  316
DSSP  LLEEELLLLLLllllLLLHH--------HHHHLLLEEEEEEHHhllllllhhhhhhhhhh


DSSP  -------------------llllLHHHHHHHHhlLLLLLLLLLLLLLLLLllllLLHHHH
Query -------------------gasfSFKVAEAAIarGLLPFSISTDLHGHSXnfpvWDLATT  290
ident                                          | |                
Sbjct vchhldpdiaedvafaesrirreTIAAEDVLH-dLGAFSLTSSDSQAMGR---vGEVILR  372
DSSP  hhhllllllhhhhhlllllllhhHHHHHHHHH-hLLLLLEEELLLLLLLL---lLLHHHH


DSSP  HHHHHHLL----------------lLHHHHHHLLLHHHHHHLLLLL-llLLLLLLLLEEE
Query XSKLLSVD----------------xPFENVVEAVTRNPASVIRLDX-enRLDVGQRADFT  333
ident                                   | |||             ||  ||  
Sbjct TWQVAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAHevgSIEVGKLADLV  432
DSSP  HHHHHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLLlllLLLLLLLLLEE


DSSP  EEEEEeeeeeeellllleeeeeEEEE-EEEEEELLEEEELL-------------------
Query VFDLVdadleatdsngdvsrlkRLFE-PRYAVIGAEAIAAS-------------------  373
ident |                          |     |     |                    
Sbjct VWSPA-----------------FFGVkPATVIKGGMIAIAPmgdinasiptpqpvhyrpm  475
DSSP  EELHH-----------------HLLLlLLEEEELLEEEEEEellllllllllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  373
ident                                                             
Sbjct fgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitv  535
DSSP  hhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleee


DSSP  -------------------------llLLLL
Query -------------------------ryIPRA  379
ident                                
Sbjct daqtyevrvdgelitsepadvlpmaqrYFLF  566
DSSP  lllllleeelleellllllllllllllLLLL


No 25: Query=2ogjA Sbjct=2imrA Z-score=18.3

back to top
DSSP  LLLEEEEeEEELLLLllllLLLEEEEELlLLLEEEEE--LLLL--LLLLEEELLLLEEEE
Query QAPILLTnVKPVGFGkgasQSSTDILIGgDGKIAAVG--SALQ--APADTQRIDAAFISP   56
ident   | |||       |    ||            || |    |    |        | | |
Sbjct HTPRLLT-CDVLYTG---aQSPGGVVVV-GETVAAAGhpDELRrqYPHAAEERAGAVIAP   55
DSSP  LLEEEEE-ELEEELL---eELLEEEEEE-LLEEEEEElhHHHHhhLLLLEEEELLLEELL


DSSP  LEEEEEELLL------------------------LLLLLLL-lLHHHlLHHHLEEEEEEE
Query GWVDLHVHIW------------------------HGGTDIS-iRPSEcGAERGVTTLVDA   91
ident   |  | |                            |               |     | 
Sbjct PPVNAHTHLDmsayefqalpyfqwipevvirgrhLRGVAAAqaGADT-LTRLGAGGVGDI  114
DSSP  LLLEEEEELLllhhhhhhlhhhhllhhhhhhhllLLHHHHHhhHHHH-HHHLLLLLEEEE


DSSP  lLLLLLLHHHHHhhlLLLLlLEEEEEEELllllllllllllLLLL----HHHL--LHHHH
Query gSAGEANFHGFReyiIEPSrERIKAFLNLgsiglvacnrvpELRD----IKDI--DLDRI  145
ident                                                             
Sbjct -VWAPEVMDALL---ARED-LSGTLYFEV------------LNPFpdkaDEVFaaARTHL  157
DSSP  -ELLHHHHHHHH---LLLL-LLEEEEEEE------------LLLLhhhhHHHHhhHHHHH


DSSP  HHHHHLLLL-LEEEEEEEELhHHHLlllLHHHHHHHHHHHHHLLLEEEEEL----LLLL-
Query LECYAENSE-HIVGLXVRAShVITGswgVTPVKLGKKIAKILKVPXXVHVG----EPPA-  199
ident              ||                  |    |     |   ||     |    
Sbjct ERWRRLERPgLRLGLSPHTP-FTVS---HRLMRLLSDYAAGEGLPLQIHVAehptELEMf  213
DSSP  HHHHLLLLLlEEEEEEELLL-LLLL---HHHHHHHHHHHHHHLLLLEEEELllhhHHHHh


DSSP  ---------------------------------LHHHHHH--HLLLLLEEELLLlllllL
Query ---------------------------------LYDEVLE--ILGPGDVVTHCFngksgS  224
ident                                        |   |       |        
Sbjct rtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDElgVLAARPTLVHMV-----N  268
DSSP  hhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHhlLHHHLLEEEELL-----L


DSSP  LLLllhHHHHHHHHLlLLEEELLLLL-----LLLLhhHHHHHHhLLLLLLLLLLLLLLLL
Query SIXedeDLFNLAERCeGIRLDIGHGG-----ASFSfkVAEAAIaRGLLPFSISTDLHGHS  279
ident       |      |  |                       |            ||     
Sbjct VTP---DDIARVARA-GCAVVTCPRSnhhleCGTF--DWPAFA-AAGVEVALGTDSVASG  321
DSSP  LLH---HHHHHHHHH-LLLEEELHHHhhhllLLLL--LHHHHH-HLLLLEEELLLLHHHH


DSSP  LlllLLLHHHHHHHHHHLL--LLHHHHHHLLLHHHHHHLLllLLLLLlLLLLLE-EEEEE
Query XnfpVWDLATTXSKLLSVD--XPFENVVEAVTRNPASVIRldXENRLdVGQRAD-FTVFD  336
ident                            | |       |           |          
Sbjct E---TLNVREEVTFARQLYpgLDPRVLVRAAVKGGQRVVG--TPFLR-RGETWQeGFRWE  375
DSSP  L---LLLLHHHHHHHHHHLllLLHHHHHHHHHHHHHHHHL--LLLLL-LLLLLLhHHLHH


DSSP  eeeeeeeeellllleeeeeeeeeeeeeeelleeeELLLLllll
Query lvdadleatdsngdvsrlkrlfepryavigaeaiAASRYipra  379
ident                                            
Sbjct ----------------------------------LSRDL----  380
DSSP  ----------------------------------HLLLL----


No 26: Query=2ogjA Sbjct=2y1hB Z-score=16.4

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
ident                                                         | ||
Sbjct ------------------------------------------------------GVGLVD    6
DSSP  ------------------------------------------------------LLLEEE


DSSP  EEELLLlllLLLL-----lLHHHlLHHHLEEEEEEELlLLLLLHHHHHHhLLLLLLLEEE
Query LHVHIWhggTDIS-----iRPSEcGAERGVTTLVDAGsAGEANFHGFREyIIEPSRERIK  115
ident  | |                         |  ||         |        |       
Sbjct CHCHLS---APDFdrdlddVLEK-AKKANVVALVAVA-EHSGEFEKIMQ-LSERYNGFVL   60
DSSP  EEELLL---LHHHlllhhhHHHH-HHHLLEEEEEELL-LLHHHHHHHHH-HHHHLLLLEE


DSSP  EEEELLllllllllLLLLLlLHHHLLhhHHHHHHHLLLLLEEEE-EEEELHHH------h
Query AFLNLGsiglvacnRVPELrDIKDIDldRILECYAENSEHIVGL-XVRASHVI------t  168
ident   |                   || |    |               |             
Sbjct PCLGVH---pvqglDQRSV-TLKDLD--VALPIIENYKDRLLAIgEVGLDFSPrfagtge  114
DSSP  EEELLL---leellLLEEL-LHHHHH--HHHHHHHHHLLLLLEEeEEEEELLLlllllhh


DSSP  LLLL-LHHHHHHHHHHHHHLLLEEEEELLlllLHHHHHHHL----LLLLEEELLllllll
Query GSWG-VTPVKLGKKIAKILKVPXXVHVGEppaLYDEVLEIL----GPGDVVTHCfngksg  223
ident                || |  |  ||              |                   
Sbjct QKEEqRQVLIRQIQLAKRLNLPVNVHSRS---AGRPTINLLqeqgAEKVLLHAF------  165
DSSP  HHHHhHHHHHHHHHHHHHHLLLEEEEEEL---LHHHHHHHHhhllLLLEEEELL------


DSSP  LLLLLlhhHHHHHHHLlLLEEELlLLLL---llLHHHHHHHHhlllLLLLLLLLLL----
Query SSIXEdedLFNLAERCeGIRLDIgHGGA---sfSFKVAEAAIarglLPFSISTDLH----  276
ident               |  |    |            |                ||      
Sbjct DGRPS---VAMEGVRA-GYFFSI-PPSIirsgqKQKLVKQLP---lTSICLETDSPalgp  217
DSSP  LLLHH---HHHHHHHL-LLEEEE-LHHHhllhhHHHHHHHLL---hHHEEELLLLLllll


DSSP  ---LLLLllllLLHHHHHHHHHHLLLLH--HHHHHLlLHHHHH-HLLLLlllllllllll
Query ---GHSXnfpvWDLATTXSKLLSVDXPF--ENVVEAvTRNPAS-VIRLDxenrldvgqra  330
ident            |           |      |      | |       |            
Sbjct ekqVRNE---pWNISISAEYIAQVKGISveEVIEVT-TQNALKlFPKLR-----------  262
DSSP  lllLLLL---hHHHHHHHHHHHHHHLLLhhHHHHHH-HHHHHHhLLLHH-----------


DSSP  eeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query dftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                  
Sbjct ----------------------------------------------hll  265
DSSP  ----------------------------------------------hhl


No 27: Query=2ogjA Sbjct=4mupB Z-score=15.7

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
ident                                                         | ||
Sbjct ----------------------------------------lvrklsgtapnpafPRGAVD   20
DSSP  ----------------------------------------llllllllllllllLLLLEE


DSSP  EEELLLL-LLLL----------llLLHHHL---LHHHLEEEEEEELL-lllLLHHHHHhH
Query LHVHIWH-GGTD----------isIRPSEC---GAERGVTTLVDAGS-ageANFHGFReY  105
ident    |    |                 |          |                      
Sbjct TQMHMYLpGYPAlpggpglppgalPGPEDYrrlMQWLGIDRVIITQGnahqRDNGNTL-A   79
DSSP  LLLLLLLlLLLLllllllllllllLLHHHHhhhHHHHLLLEEEEELLhhhlLLLHHHH-H


DSSP  LLLLLLLEEEEEEELLlllllllllllllllhhhLLHHhhHHHHHLLL-LLEEEEEEEEL
Query IIEPSRERIKAFLNLGsiglvacnrvpelrdikdIDLDriLECYAENS-EHIVGLXVRAS  164
ident       |   |                                         ||      
Sbjct CVAEMGEAAHAVVIID------------------ATTT--EKDMEKLTaAGTVGARIMDL  119
DSSP  HHHHHHHHEEEEELLL------------------LLLL--HHHHHHHHhLLEEEEEEELL


DSSP  HHHhllllLHHHHHHHHHHHHHLLLEEEEEL-llllLHHHHHHHLLLLLEEELLLLLLLl
Query HVItgswgVTPVKLGKKIAKILKVPXXVHVG-eppaLYDEVLEILGPGDVVTHCFNGKSg  223
ident                   |        |             |       |  |       
Sbjct PGG--avnLSELDAVDERAHAADWMVAVQFDgngllDHLPRLQKIRSRWVFDHHGKFFK-  176
DSSP  LLL--lllHHHHHHHHHHHHHLLLEEEEELLhhhhhHHHHHHHLLLLEEEELHHHHLLL-


DSSP  llLLLL-HHHHHHHHHLL---LLEEELLLllLLLL-----HHHHHHHHhLLLL-----lL
Query ssIXED-EDLFNLAERCE---GIRLDIGHggASFS-----FKVAEAAIaRGLL-----pF  269
ident                                   |          |   |          
Sbjct --GIRTdGPEMAALLKLIdrgNLWFKFAG-vYESSrkswpYADVAAFS-RVIAahaperI  232
DSSP  --LLLLlLHHHHHHHHHHhhlLEEEEELL-hHHLLlllllLHHHHHHH-HHHHhhlhhhE


DSSP  LLLLLLLllLLLL-----LLLLhHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLLLlll
Query SISTDLHghSXNF-----PVWDlATTXSKLLSVDXPFENVVEAVTRNPASVIRLDXEnrl  324
ident    |                 | |      |           |   ||     |      
Sbjct VWGTNWP--HNSVretaaYPDD-ARLAELTLGWLPDEAARHRALVENPEALFKLSPV---  286
DSSP  EELLLLL--LLLLllhhhLLLH-HHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL---


DSSP  lllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query dvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                        
Sbjct -------------------------------------------------------  286
DSSP  -------------------------------------------------------


No 28: Query=2ogjA Sbjct=2ffiA Z-score=15.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
ident                                                            |
Sbjct -----------------------------------------------------lhLTAID    7
DSSP  -----------------------------------------------------llLLLEE


DSSP  EEElLLLL------------llLLLL--LHHHLLHHHLEEEEEEELL--LLLLlHHHHHH
Query LHVhIWHG------------gtDISI--RPSECGAERGVTTLVDAGS--AGEAnFHGFRE  104
ident  |                                   |    |       |         
Sbjct SHA-HVFSrglnlasqrryapnYDAPlgDYLGQLRAHGFSHGVLVQPsfLGTD-NRYLLS   65
DSSP  LLL-LLLLhhhhhhllllllllLLLLhhHHHHHHHHLLLLEELLLLLhhHLLL-LHHHHH


DSSP  hLLLLLllEEEEEEELLlllllllllllllllhhhLLHHhhHHHHHLLL-LLEEEEEEEE
Query yIIEPSreRIKAFLNLGsiglvacnrvpelrdikdIDLDriLECYAENS-EHIVGLXVRA  163
ident                |                    |        ||       |     
Sbjct -ALQTVpgQLRGVVXLE------------------RDVE--QATLAEXArLGVRGVRLNL  104
DSSP  -HHHHLllLLLLLLLLL------------------LLLL--HHHHHHHHlLLLLEEELLL


DSSP  LHHhhllLLLHH----hHHHHHHHHHHLLLEEEEELllllLHHHHHHHLL---LLLEEEL
Query SHVitgsWGVTP----vKLGKKIAKILKVPXXVHVGeppaLYDEVLEILG---PGDVVTH  216
ident                                  |              |       |  |
Sbjct XGQ----DXPDLtgaqwRPLLERIGEQGWHVELHRQ--vaDIPVLVRALQpygLDIVIDH  158
DSSP  LLL----LLLLLlllllHHHHHHHHHHLLEEEELLL--llLHHHHHHHHLlllLLEEELH


DSSP  LLLLLlllllLLLHHHHHHHH--HLLL-LEEELLLLLLL-----lLHHHHHHHHhLLLL-
Query CFNGKsgssiXEDEDLFNLAE--RCEG-IRLDIGHGGAS-----fSFKVAEAAIaRGLL-  267
ident                 |         |                      |  |    |  
Sbjct FGRPD--arrGLGQPGFAELLtlSGRGkVWVKVSGIYRLqgspeeNLAFARQAL-CALEa  215
DSSP  HHLLL--lllLLLLLLHHHHLllLLLLlEEEEEELHHHLlllhhhHHHHHHHHH-HHHHh


DSSP  -----lLLLLLLL-LLLLlLLLLLL--HHHHHHHHHhllLLHHHHHHLLLHHHHHHLLLL
Query -----pFSISTDL-HGHSxNFPVWD--LATTXSKLLsvdXPFENVVEAVTRNPASVIRLD  319
ident            |  |       |           |                         
Sbjct hygaerLXWGSDWpHTQH-ESEVSFgsAVEQFEALG---CSAQLRQALLLDTARALFGFE  271
DSSP  hllhhhEEEELLLlLLLL-LLLLLHhhHHHHHHHHL---LLHHHHHHHHLHHHHHHLLLL


DSSP  LLllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query XEnrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident  |                                                          
Sbjct LE----------------------------------------------------------  273
DSSP  LL----------------------------------------------------------


No 29: Query=2ogjA Sbjct=3cjpA Z-score=15.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                            |
Sbjct --------------------------------------------------------LIID    4
DSSP  --------------------------------------------------------LLEE


DSSP  EEELLLLLlllllllHHHLLHHHLEEEEEEELL---------------------------
Query LHVHIWHGgtdisirPSECGAERGVTTLVDAGS---------------------------   93
ident  | |                 | ||                                   
Sbjct GHTHVILP----vekHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkklndvvngk   60
DSSP  EEEELLLL----hhhHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhhhhhlll


DSSP  ------lLLLLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHhhLLHHHHHH
Query ------aGEANFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIkdIDLDRILE  147
ident                    |     |   | |                         | |
Sbjct tnsmidvRRNSIKELTN-VIQAYPSRYVGFGNVP------------VGLSenDTNSYIEE  107
DSSP  llllhhhHHHHHHHHHH-HHHHLLLLEEEEELLL------------LLLLhhHHHHHHHH


DSSP  HHHLLLllEEEEE-EEELHhhhllLLLHHHHHHHHHHHHHL-LLEEEEE-LLLL-lLHHH
Query CYAENSehIVGLX-VRASHvitgsWGVTPVKLGKKIAKILK-VPXXVHV-GEPP-aLYDE  203
ident     |    ||                   |   |        |   |           |
Sbjct NIVNNK--LVGIGeLTPAS-----GQIKSLKPIFKYSMDSGsLPIWIHAfNPLVlqDIKE  160
DSSP  HLLLLL--LLEEEeELLLL-----LLHHHHHHHHHHHHHLLlLLEEELLlLLLLhhHHHH


DSSP  HHHHL----LLLLEEELLLLllllLLLLllhHHHHHHHHLLLLEEELLLlllLLLHHHHH
Query VLEIL----GPGDVVTHCFNgksgSSIXedeDLFNLAERCEGIRLDIGHggaSFSFKVAE  259
ident   |             |       |          ||       ||       ||  |  
Sbjct IAELCkafpKVPVILGHMGG----SNWM---TAVELAKEIQNLYLDTSA---YFSTFVLK  210
DSSP  HHHHHhhllLLLEEEHHHHH----HHHH---HHHHHHHHLLLEEEELLL---LLLHHHHH


DSSP  HHHHlLLLL-LLLLLLLLllllllLLLLhHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLL
Query AAIArGLLP-FSISTDLHghsxnfPVWDlATTXSKLLSVDXPFENVVEAVTRNPASVIRL  318
ident   |   |       ||                                    |       
Sbjct IVIN-ELPLkCIFGTDMP------FGDL-QLSIEAIKKMSNDSYVANAVLGDNISRLLNI  262
DSSP  HHHH-HLLLlEELLLLLL------LLLH-HHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL


DSSP  lllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeelllllll
Query dxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipr  378
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  l
Query a  379
ident  
Sbjct -  262
DSSP  -


No 30: Query=2ogjA Sbjct=1bf6A Z-score=15.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
ident                                                         |   
Sbjct ---------------------------------------------------sfdpTGYTL    9
DSSP  ---------------------------------------------------llllLLEEE


DSSP  EEELLLLL--------lLLLL---lLHHHlLHHHL---EEEEEEeLLLLlllhhhHHHHL
Query LHVHIWHG--------gTDIS---iRPSEcGAERG---VTTLVDaGSAGeanfhgFREYI  106
ident  | |                        |         |                     
Sbjct AHEHLHIDlsgfknnvdCRLDqyafICQE-MNDLMtrgVRNVIE-MTNR--ymgrNAQFM   65
DSSP  EEELLLEElhhhhllhhHEELlhhhHHHH-HHHHHhllEEEEEE-LLLH--hhllLHHHH


DSSP  LLLL---LLEEEEEEELLllllllllllLLLL--LHHH---lLHHHHHHHHHLL----lL
Query IEPS---RERIKAFLNLGsiglvacnrvPELR--DIKD---iDLDRILECYAEN----sE  154
ident             |                                               
Sbjct LDVMretGINVVACTGYY--------qdAFFPehVATRsvqeLAQEMVDEIEQGidgteL  117
DSSP  HHHHhhhLLEEEEEELLL--------lhHHLLlhHHHLlhhhHHHHHHHHHHLLlllllL


DSSP  LEEEEE-EEELHhhHLLLLLHHHHHHHHHHHHHLLLEEEEELLlllLHHHHHHHL-----
Query HIVGLX-VRASHviTGSWGVTPVKLGKKIAKILKVPXXVHVGEppaLYDEVLEIL-----  208
ident           |                        |   |         | |  |     
Sbjct KAGIIAeIGTSEgkITPLEEKVFIAAALAHNQTGRPISTHTSF-stMGLEQLALLqahgv  176
DSSP  LEEEEEeEELLLllLLHHHHHHHHHHHHHHHHHLLLEEEELHH-hlLHHHHHHHHhhlll


DSSP  -LLLLEEELLLLLllllLLLLlhhHHHHHHHLLlLEEELLLLLL------llLHHHHHHH
Query -GPGDVVTHCFNGksgsSIXEdedLFNLAERCEgIRLDIGHGGA------sfSFKVAEAA  261
ident       | ||                                |               | 
Sbjct dLSRVTVGHCDLK----DNLD---NILKMIDLG-AYVQFDTIGKnsyypdekRIAMLHAL  228
DSSP  lHHHEEELLLLLL----LLHH---HHHHHHHLL-LEEEELLLLLlllllhhhHHHHHHHH


DSSP  HHLLLL-LLLLLLLLL-LLLL---LLLL-LLHH-HHHHHHHHLLLLHHHHHHLLLHHHHH
Query IARGLL-PFSISTDLH-GHSX---NFPV-WDLA-TTXSKLLSVDXPFENVVEAVTRNPAS  314
ident   ||||     | |                 |  |    |         |      ||  
Sbjct RDRGLLnRVMLSMDITrRSHLkanGGYGyDYLLtTFIPQLRQSGFSQADVDVMLRENPSQ  288
DSSP  HHLLLHhHEEELLLLLlHHHLhhhLLLLlLHHHhLHHHHHHHLLLLHHHHHHHHLHHHHH


DSSP  HLLllllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeelll
Query VIRldxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasr  374
ident                                                             
Sbjct FFQ---------------------------------------------------------  291
DSSP  HLL---------------------------------------------------------


DSSP  lllll
Query yipra  379
ident      
Sbjct -----  291
DSSP  -----


No 31: Query=2ogjA Sbjct=4dlfA Z-score=15.3

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
ident                                                            |
Sbjct -------------------------------------------------------ALRID    5
DSSP  -------------------------------------------------------LLLEE


DSSP  EEELlLLLL--------------llllLLHHHL---LHHHLEEEEEEELLLLLLL-HHHH
Query LHVHiWHGG--------------tdisIRPSEC---GAERGVTTLVDAGSAGEAN-FHGF  102
ident  | |                         |                              
Sbjct SHQH-FWRYraadypwigagmgvlardYLPDALhplMHAQALGASIAVQARAGRDeTAFL   64
DSSP  EEEL-LLLLlhhhllllllllhhhlllLLHHHHhhhHHHLLLLEEEEELLLLLHHhHHHH


DSSP  HHhLLLLLLLEEEEEEELLlllllllllllllllhhhLLHHhHHHHHHLLL-LLEEEEEE
Query REyIIEPSRERIKAFLNLGsiglvacnrvpelrdikdIDLDrILECYAENS-EHIVGLXV  161
ident  |                                          |  ||       |   
Sbjct LE-LACDEARIAAVVGWED-----------------lRAPQ-LAERVAEWRgTKLRGFRH  105
DSSP  HH-HHLLLLLEEEEEELLL-----------------lLLLL-HHHHHHLLLlLLEEEEEE


DSSP  EELhhHHLLlLLHHHHH--HHHHHHHHL---LLEEEEELLLllLHHHHHHHLL----LLL
Query RAShvITGSwGVTPVKL--GKKIAKILK---VPXXVHVGEPpaLYDEVLEILG----PGD  212
ident               |           |        | | |       |            
Sbjct QLQ--DEAD-VRAFVDDadFARGVAWLQandYVYDVLVFER--QLPDVQAFCArhdaHWL  160
DSSP  LHH--HLLL-HHHHHHLhhHHHHHHHHHhllLEEEELLLHH--HHHHHHHHHHhlllLLE


DSSP  EEELLlLLLL-----llllLLLH-HHHHHHHHLLLLEEELLLLLLLL-------------
Query VVTHCfNGKS-----gssiXEDE-DLFNLAERCEGIRLDIGHGGASF-------------  253
ident |  |                                                        
Sbjct VLDHAgKPALaefdrddtaLARWrAALRELAALPHVVCKLSGLVTEAdwrrglrasdlrh  220
DSSP  EEHHHhLLLHhhllllllhHHHHhHHHHHHHLLLLEEEEELLLLLLLlllllllhhhhhh


DSSP  LHHHHHHHHhLLLL--LLLLLLLLLlLLLLLLLL--LHHHHHHHHHHlLLLHHHHHHLLL
Query SFKVAEAAIaRGLL--PFSISTDLHgHSXNFPVW--DLATTXSKLLSvDXPFENVVEAVT  309
ident       ||              |                       |             
Sbjct IEQCLDAAL-DAFGpqRLMFGSDWP-VCLLAASYdeVASLVERWAES-RLSAAERSALWG  277
DSSP  HHHHHHHHH-HHHLhhHEEELLLLL-HHHHLLLHhhHHHHHHHHHHH-HLLHHHHHHHLL


DSSP  HHHHHHLLLLllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeellee
Query RNPASVIRLDxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaea  369
ident    |    |                                                   
Sbjct GTAARCYALP--------------------------------------------------  287
DSSP  HHHHHHLLLL--------------------------------------------------


DSSP  eellllllll
Query iaasryipra  379
ident           
Sbjct ----------  287
DSSP  ----------


No 32: Query=2ogjA Sbjct=1a4mA Z-score=15.0

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
ident                                                           | 
Sbjct --------------------------------------------------tpafNKPKVE   10
DSSP  --------------------------------------------------llllLLLEEE


DSSP  EEELLlllllLLLL----------------------------------------------
Query LHVHIwhggtDISI----------------------------------------------   74
ident ||||      |  |                                              
Sbjct LHVHL-----DGAIkpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyy   65
DSSP  EEEEH-----HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhh


DSSP  -----------------LHHHlLHHHLEEEEEEEllLLLL--------------------
Query -----------------RPSEcGAERGVTTLVDAgsAGEA--------------------   97
ident                        |  ||                                
Sbjct mpviagcreaikriayeFVEM-KAKEGVVYVEVR--YSPHllanskvdpmpwnqtegdvt  122
DSSP  hhhhlllhhhhhhhhhhHHHH-HHHLLEEEEEEE--ELLHhhllllllllhhhlllllll


DSSP  ---LHHHHHHHlLLLL----LLEEEEEEELLllllllllllllLLLHHHLLHhhHHHHHH
Query ---NFHGFREYiIEPS----RERIKAFLNLGsiglvacnrvpeLRDIKDIDLdrILECYA  150
ident                            |                           ||   
Sbjct pddVVDLVNQG-LQEGeqafGIKVRSILCCM------------RHQPSWSLE--VLELCK  167
DSSP  hhhHHHHHHHH-HHHHhhhhLLEEEEEEEEE------------LLLHHHHHH--HHHHHH


DSSP  LLLL-LEEEEEEE-ELHHhhlLLLLHH--HHHHHHHHHHHLLLEEEEE-LLLL-lLHHHH
Query ENSE-HIVGLXVR-ASHVitgSWGVTP--VKLGKKIAKILKVPXXVHV-GEPP-aLYDEV  204
ident        |                            |        ||           | 
Sbjct KYNQkTVVAMDLAgDETI---EGSSLFpgHVEAYEGAVKNGIHRTVHAgEVGSpeVVREA  224
DSSP  HLLLlLEEEEEEElLLLL---LLHHHLhhHHHHHHHHHHHLLEEEEEElLLLLhhHHHHH


DSSP  HHHLLllLEEELLLllllllLLLLLHHHHHHHHHLLlLEEELLLLLLL-------llHHH
Query LEILGpgDVVTHCFngksgsSIXEDEDLFNLAERCEgIRLDIGHGGAS-------fsFKV  257
ident   ||     | |           ||| | |                              
Sbjct VDILK-tERVGHGY------HTIEDEALYNRLLKEN-MHFEVCPWSSYltgawdpktTHA  276
DSSP  HHLLL-lLEEEELH------HHHHLHHHHHHHHHLL-LEEEELHHHHHhllllllllLLH


DSSP  HHHHHHlLLLLLLLLLLLLLLLLllllLLHHHHHHHHH-HLLLLHHHHHHLlLHHHHH-H
Query AEAAIArGLLPFSISTDLHGHSXnfpvWDLATTXSKLL-SVDXPFENVVEAvTRNPAS-V  315
ident             |  ||            | |             |        | |   
Sbjct VVRFKN-DKANYSLNTDDPLIFK----STLDTDYQMTKkDMGFTEEEFKRL-NINAAKsS  330
DSSP  HHHHHH-LLLLEEELLLLLLLLL----LLHHHHHHHHHhLLLLLHHHHHHH-HHHHHHlL


DSSP  LLL------LLLLlllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeellee
Query IRL------DXENrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaea  369
ident            |                                                
Sbjct FLPeeekkeLLER-----------------------------------------------  343
DSSP  LLLhhhhhhHHHH-----------------------------------------------


DSSP  eellllllll
Query iaasryipra  379
ident           
Sbjct ----lyreyq  349
DSSP  ----hhhhll


No 33: Query=2ogjA Sbjct=3k2gB Z-score=14.9

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                         |   
Sbjct -----------------------------slselspchvrsgrixtvdgpipssalGHTL   31
DSSP  -----------------------------llllllllllllleeeelleeeehhhlLLEE


DSSP  EEELLLllLLLL----------------------------------------------ll
Query LHVHIWhgGTDI----------------------------------------------si   74
ident  | |                                                        
Sbjct XHEHLQ--NDCRcwwnppqeperqylaeapisieilselrqdpfvnkhnialddldlaia   89
DSSP  LLLLLL--EELHhhllllllhhhhhhhhllllhhhhhhhhllhhhllllleellhhhhhh


DSSP  LHHHlLHHHLEEEEEEeLLLLlllhhhHHHHlLLLL----LLEEEEEEELLlllllllll
Query RPSEcGAERGVTTLVDaGSAGeanfhgFREYiIEPS----RERIKAFLNLGsiglvacnr  130
ident       |  |    ||                                            
Sbjct EVKQ-FAAVGGRSIVD-PTCR--gigrDPVK-LRRIsaetGVQVVXGAGYY--------l  136
DSSP  HHHH-HHHLLLLEEEE-LLLL--llllLHHH-HHHHhhhhLLEEEELLLLL--------l


DSSP  lLLLL--LHHH---LLHHHHHHHHHLLL----LLEEEEE-EEELHHhHLLLLLHHHHHHH
Query vPELR--DIKD---IDLDRILECYAENS----EHIVGLX-VRASHViTGSWGVTPVKLGK  180
ident                  | |     |        |        |                
Sbjct aSSXPetAARLsadDIADEIVAEALEGTdgtdARIGLIGeIGVSSD-FTAEEEKSLRGAA  195
DSSP  hHHLLhhHHLLlhhHHHHHHHHHHHLLLllllLLLLLEEeELLLLL-LLHHHHHHHHHHH


DSSP  HHHHHHLLLEEEEELllllLHHHHHHHL------LLLLEEELLLLlllllLLLLLHhHHH
Query KIAKILKVPXXVHVGeppaLYDEVLEIL------GPGDVVTHCFNgksgsSIXEDEdLFN  234
ident         | |||      |   ||             |  |        | |       
Sbjct RAQVRTGLPLXVHLPgwfrLAHRVLDLVeeegadLRHTVLCHXNP-----SHXDPV-YQA  249
DSSP  HHHHHHLLLEEELLLllllLHHHHHHHHhhllllHHHEEELLLHH-----HLLLHH-HHH


DSSP  HHHHLlLLEEELLLLLL--------------llLHHHHHHHHHLLLL-LLLLLLLLL-LL
Query LAERCeGIRLDIGHGGA--------------sfSFKVAEAAIARGLL-PFSISTDLH-GH  278
ident       |  |     |                            | |     | |     
Sbjct TLAQR-GAFLEFDXIGXdffyadqgvqcpsddeVARAILGLADHGYLdRILLSHDVFvKX  308
DSSP  HHHHH-LLEEEELLLLLlleelllleelllhhhHHHHHHHHHHLLLHhHEEELLLLLlHH


DSSP  LL---LLLL-LLHH-HHHHHHHHLLLLHHHHHHLLLHHHHHHLLLLLlllllllllleee
Query SX---NFPV-WDLA-TTXSKLLSVDXPFENVVEAVTRNPASVIRLDXenrldvgqradft  333
ident                     |                ||  |                  
Sbjct XLtryGGNGyAFVTkHFLPRLRRHGLDDAALETLXVTNPRRVFDASI-------------  355
DSSP  HLhhhLLLLlLHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLL-------------


DSSP  eeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query vfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                               
Sbjct -------------------------------------------egh  358
DSSP  -------------------------------------------lll


No 34: Query=2ogjA Sbjct=2vc5A Z-score=14.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                         |   
Sbjct ----------------------------------------mriplvgkdsieskdiGFTL   20
DSSP  ----------------------------------------llllllllllllhhhlLLEE


DSSP  EEELLlLLLL------------------llllLHHHlLHHHLEEEEEEeLLLLllLHHHh
Query LHVHIwHGGT------------------disiRPSEcGAERGVTTLVDaGSAGeaNFHGf  102
ident  | |                                     || | ||            
Sbjct IHEHL-RVFSeavrqqwphlynedeefrnavnEVKR-AMQFGVKTIVD-PTVMglGRDI-   76
DSSP  LLLLL-LLLLhhhhhhlhhhllhhhhhhhhhhHHHH-HHHLLLLEEEE-LLLLllLLLH-


DSSP  hHHLLLLL---LLEEEEEEELLlllllllllllLLLLHH--------hlLHHHHHHHHHL
Query rEYIIEPS---RERIKAFLNLGsiglvacnrvpELRDIK--------diDLDRILECYAE  151
ident                 |                   |              |       |
Sbjct -RFMEKVVkatGINLVAGTGIY-----------IYIDLPfyflnrsideIADLFIHDIKE  124
DSSP  -HHHHHHHhllLLEEEELEELL-----------LLLLLLhhhllllhhhHHHHHHHHHHL


DSSP  LL----LLEEEEEEEELHHhHLLL-LLHHHHHHHHHHHHHLLLEEEEEL-LLLLlHHHHH
Query NS----EHIVGLXVRASHViTGSW-GVTPVKLGKKIAKILKVPXXVHVG-EPPAlYDEVL  205
ident             |  |                     |  |||   |          |  
Sbjct GIqgtlNKAGFVXIAADEP-GITKdVEKVIRAAAIANKETKVPIITHSNaHNNT-GLEQQ  182
DSSP  LLllllLLLLLEEEELLLL-LLLHhHHHHHHHHHHHHHHHLLLEEEELLlLLLH-HHHHH


DSSP  HHL------LLLLEEELLLLLllllLLLLlhhHHHHHHHLlLLEEELLLLLL------ll
Query EIL------GPGDVVTHCFNGksgsSIXEdedLFNLAERCeGIRLDIGHGGA------sf  253
ident  ||             |                        |        |         
Sbjct RILteegvdPGKILIGHLGDT----DNID---YIKKIADK-GSFIGLDRYGLdlflpvdk  234
DSSP  HHHhhllllHHHEEELLHHHL----LLHH---HHHHHHHL-LLEEEELLLLLlllllhhh


DSSP  LHHHHHHHHHLLLL-LLLLLLLLLL------------lllLLLLL--LHHH-HHHHHHHL
Query SFKVAEAAIARGLL-PFSISTDLHG------------hsxNFPVW--DLAT-TXSKLLSV  297
ident         |  |      || |                              |   |   
Sbjct RNETTLRLIKDGYSdKIMISHDYCCtidwgtakpeykpklAPRWSitLIFEdTIPFLKRN  294
DSSP  HHHHHHHHHHLLLLlLEEELLLLLLllllllllhhhhhhhLLLLLllHHHHlHHHHHHLL


DSSP  LLLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeeellllleeeeeee
Query DXPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleatdsngdvsrlkrl  357
ident     |        ||                                             
Sbjct GVNEEVIATIFKENPKKFFS----------------------------------------  314
DSSP  LLLHHHHHHHHLHHHHHHLL----------------------------------------


DSSP  eeeeeeeelleeeellllllll
Query fepryavigaeaiaasryipra  379
ident                       
Sbjct ----------------------  314
DSSP  ----------------------


No 35: Query=2ogjA Sbjct=2ob3A Z-score=14.3

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                         |   
Sbjct -----------------------------------------drintvrgpitiseaGFTL   19
DSSP  -----------------------------------------lleeelleeelhhhhLLEE


DSSP  EEELLlLLLL-------------------llllLHHHlLHHHLEEEEEEeLLLLlllhhh
Query LHVHIwHGGT-------------------disiRPSEcGAERGVTTLVDaGSAGeanfhg  101
ident  | ||  |                                  || | ||  |        
Sbjct THEHI-CGSSagflrawpeffgsrkalaekavrGLRR-ARAAGVRTIVD-VSTF--digr   74
DSSP  EEELL-EELLllhhhhlhhhhllhhhhhhhhhhHHHH-HHHLLLLEEEE-LLLH--hhll


DSSP  HHHHLLLLL---LLEEEEEEELLllllllllllLLLL--LHHH---lLHHHHHHHHHLL-
Query FREYIIEPS---RERIKAFLNLGsiglvacnrvPELR--DIKD---iDLDRILECYAEN-  152
ident       | |      | |   |                              |       
Sbjct DVSLLAEVSraaDVHIVAATGLW----------FDPPlsMRLRsveeLTQFFLREIQYGi  124
DSSP  LHHHHHHHHhhhLLEEELEEELL----------LLLLhhHHLLlhhhHHHHHHHHHHLLl


DSSP  ---lLLEEEEEEEELHhhHLLLLLHHHHHHHHHHHHHLLLEEEEELllllLHHHHHHHL-
Query ---sEHIVGLXVRASHviTGSWGVTPVKLGKKIAKILKVPXXVHVGeppaLYDEVLEIL-  208
ident           ||               |          ||   |             |  
Sbjct edtgIRAGIIXVATTG-kATPFQELVLKAAARASLATGVPVTTHTAasqrDGEQQAAIFe  183
DSSP  llllLLLLEEEEELLL-lLLHHHHHHHHHHHHHHHHHLLLEEEELLhhhlHHHHHHHHHh


DSSP  -----LLLLEEELLLlllllLLLLllhhhHHHHHHL--LLLEEELLLLLL----------
Query -----GPGDVVTHCFngksgSSIXededlFNLAERC--EGIRLDIGHGGA----------  251
ident             |                          |      |             
Sbjct seglsPSRVCIGHSD-----DTDD-----LSYLTALaaRGYLIGLDHIPYsaiglednas  233
DSSP  hllllHHHEEELLHH-----HLLL-----HHHHHHHhhLLLEEEELLLLLllllllllhh


DSSP  ----------llLHHHHHHHHHLLLL-LLLLLLLLLL-----------lLLLLL---lLL
Query ----------sfSFKVAEAAIARGLL-PFSISTDLHG-----------hSXNFP---vWD  286
ident                   | |  |       | |                          
Sbjct asallgirswqtRALLIKALIDQGYMkQILVSNDWTFgfssyvtnimdvMDRVNpdgmAF  293
DSSP  hhhhhllllhhhHHHHHHHHHHLLLHhHEEELLLLLLeellllllhhhhHHHHLllhhHH


DSSP  HH-HHHHHHHHLLLLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeee
Query LA-TTXSKLLSVDXPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleat  345
ident         |     | |        |||                                
Sbjct IPlRVIPFLREKGVPQETLAGITVTNPARFLS----------------------------  325
DSSP  HHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL----------------------------


DSSP  llllleeeeeeeeeeeeeeelleeeellllllll
Query dsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                   
Sbjct ------------------------------ptlr  329
DSSP  ------------------------------llll


No 36: Query=2ogjA Sbjct=3gg7A Z-score=14.2

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                            |
Sbjct --------------------------------------------------------SLID    4
DSSP  --------------------------------------------------------LLEE


DSSP  EEELLLlllLLLLL--LHHHlLHHHLEeEEEEELlLLLLLHHHHHHhLLLLLlLEEEEEE
Query LHVHIWhggTDISI--RPSEcGAERGVtTLVDAGsAGEANFHGFREyIIEPSrERIKAFL  118
ident  |||                   ||   |         |   |                |
Sbjct FHVHLD---LYPDPvaVARA-CEERQL-TVLSVT-TTPAAWRGTLA-LAAGR-PHVWTAL   56
DSSP  EEELHH---HLLLHhhHHHH-HHHLLL-EEEELL-LLHHHHHHHHH-HHLLL-LLEEELL


DSSP  ELLllllllllllLLLLL-HHHLLhhHHHHHHHLllllEEEEE-EEELHH---hhLLLL-
Query NLGsiglvacnrvPELRD-IKDIDldRILECYAEnsehIVGLX-VRASHV---itGSWG-  172
ident                      |           |          |               
Sbjct GFH---------pEVVSErAADLP--WFDRYLPE----TRFVGeVGLDGSpslrgTWTQq  101
DSSP  LLL---------hHHLLLlHHHLH--HHHHHHHH----LLEEEeEELLLLhhhhhHHHHh


DSSP  LHHHHHHHHHHHHH-LLLEEEEELLlllLHHHHHHHLL-----lLLEEELLllllllLLL
Query VTPVKLGKKIAKIL-KVPXXVHVGEppaLYDEVLEILG-----pGDVVTHCfngksgSSI  226
ident                      |         |||  |                    |  
Sbjct FAVFQHILRRCEDHgGRILSIHSRR---AESEVLNCLEanprsgTPILHWY------SGS  152
DSSP  HHHHHHHHHHHHHLlLEEEEEELLL---LHHHHHHHHHhlhhheEEEEELL------LLL


DSSP  LllhHHHHHHHHLlLLEEELLLlllLLLH-HHHHHHHhLLLL--LLLLLLLLLlLLLL--
Query XedeDLFNLAERCeGIRLDIGHggaSFSF-KVAEAAIaRGLL--PFSISTDLHgHSXN--  281
ident          |    |     |             | | |          ||         
Sbjct V---TELRRAISL-GCWFSVGP---TMVRtQKGAALI-RSMPrdRVLTETDGP-FLELdg  203
DSSP  H---HHHHHHHHL-LLEEEELH---HHHLlHHHHHHH-HHLLhhHEEELLLLL-LLEEll


DSSP  LLLL--LHHHHHHHHHHLL-LLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeee
Query FPVW--DLATTXSKLLSVD-XPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlv  338
ident       |       |      |   |   |  |                           
Sbjct QAALpwDVKSVVEGLSKIWqIPASEVERIVKENVSRLLG---------------------  242
DSSP  EELLhhHHHHHHHHHHHHHlLLHHHHHHHHHHHHHHHHH---------------------


DSSP  eeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query dadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                          
Sbjct ----------------------------------------t  243
DSSP  ----------------------------------------l


No 37: Query=2ogjA Sbjct=3pnuA Z-score=14.0

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeeLLLLEEEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqrIDAAFISPGWVD   60
ident                                                    |       |
Sbjct -------------------------------------------enlyfQSNAMKLKNPLD   17
DSSP  -------------------------------------------lllllLLLLEEEELLEE


DSSP  EEELLLLLllllllLHHHLLHhhLEEEEEEELL----LLLL-LHHHHHHHlLLLL----L
Query LHVHIWHGgtdisiRPSECGAerGVTTLVDAGS----AGEA-NFHGFREYiIEPS----R  111
ident  | |                        |                      |        
Sbjct MHLHLRDN-qmlelIAPLSAR--DFCAAVIMPNlippLCNLeDLKAYKMR-ILKAckdeN   73
DSSP  EEELLLLH-hhhhhHHHHHHL--LLLEEEELLLllllLLLHhHHHHHHHH-HHHHhlllL


DSSP  LEEEEEEELLlllllllllllllllhhHLLHHHHHHhHHLLlllEEEEEEEEL------h
Query ERIKAFLNLGsiglvacnrvpelrdikDIDLDRILEcYAENsehIVGLXVRAS------h  165
ident       |                      |              | | |           
Sbjct FTPLMTLFFK-----------------NYDEKFLYS-AKDE---IFGIXLYPAgittnsn  112
DSSP  LEEEEEEELL-----------------LLLHHHHHH-HLLL---LLEEEELLLlllllll


DSSP  HHHLlLLLH-hhHHHHHHHHHHLLLEEEEELLL-------llLHHHHHHHL----lLLLE
Query VITGsWGVT-pvKLGKKIAKILKVPXXVHVGEP-------paLYDEVLEIL----gPGDV  213
ident             |        |  |  ||                              |
Sbjct GGVS-SFDIeylKPTLEAMSDLNIPLLVHGETNdfvmdresnFAKIYEKLAkhfprLKIV  171
DSSP  LLLL-LLLHhhhHHHHHHHHHLLLLEEELLLLLllhhhllhhHHHHHHHHHhhlllLLEE


DSSP  EELLlllllllLLLLlhhhHHHHHHLLLLEEELLL-------------------lLLLLL
Query VTHCfngksgsSIXEdedlFNLAERCEGIRLDIGH-------------------gGASFS  254
ident   |                  |    |     |                           
Sbjct MEHI-------TTKT---lCELLKDYENLYATITLhhliitlddviggkmnphlfCKPIA  221
DSSP  ELLL-------LLHH---hHHHHHHLLLEEEEELLhhhlllhhhhhlllllhhhlLLLLL


DSSP  HH-hhHHHHhlLLLL------LLLLLLLLL-------LLLLlllLLHHHHHHHHHHLLLL
Query FK-vaEAAIarGLLP------FSISTDLHG-------HSXNfpvWDLATTXSKLLSVDXP  300
ident        |     |            |                          |      
Sbjct KRyedKEAL--CELAfsgyekVMFGSDSAPhpkgcaaGVFS--aPVILPVLAELFKQNSS  277
DSSP  LLhhhHHHH--HHHHhlllllEEELLLLLLlllllllLLLL--hHHHHHHHHHHHHHHLL


DSSP  HHHHHHLLLHHHHHHLLLLLlllllllLLLEEEEEEEEEEEE------eeellllleeee
Query FENVVEAVTRNPASVIRLDXenrldvgQRADFTVFDLVDADL------eatdsngdvsrl  354
ident  ||       |      |                                          
Sbjct EENLQKFLSDNTCKIYDLKF-------KEDKILTLEEKEWQVpnvyedkynqvvpymage  330
DSSP  HHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELLLEELllleelllleelllllll


DSSP  EEEEEEEEeeelleeeellllllll
Query KRLFEPRYavigaeaiaasryipra  379
ident    |                     
Sbjct ILKFQLKH-----------------  338
DSSP  EELLEELL-----------------


No 38: Query=2ogjA Sbjct=4hk5D Z-score=13.9

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
ident                                                        |  ||
Sbjct ------------------------------------------------------TPVVVD    6
DSSP  ------------------------------------------------------LLLLEE


DSSP  EEELLLLLLLL-------------------------------------------------
Query LHVHIWHGGTD-------------------------------------------------   71
ident  | |                                                        
Sbjct IHTHMYPPSYIamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgrpl   66
DSSP  EEEEELLHHHHhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllleel


DSSP  ---LLLL--HHHLLHHHLEEEEEEELL--------------lLLLLHHHHHHhLLLLLLL
Query ---ISIR--PSECGAERGVTTLVDAGS--------------aGEANFHGFREyIIEPSRE  112
ident                  |    |                     |    |          
Sbjct sthFASLaqKMHFMDTNGIRVSVISLAnpwfdflapdeapgiADAVNAEFSD-MCAQHVG  125
DSSP  lhhHLLHhhHHHHHHHLLLLEEEEEELlllllllllllhhhhHHHHHHHHHH-HHHLLLL


DSSP  EEEEEEELLllllllllllllLLLHHhLLHHHHHhHHHLLlLLEEEEEEEElhhHHLLLL
Query RIKAFLNLGsiglvacnrvpeLRDIKdIDLDRILeCYAENsEHIVGLXVRAshvITGSWG  172
ident |   |  |             |          |            |             |
Sbjct RLFFFAALP------------LSAPVdAVKASIE-RVKNL-KYCRGIILGT---SGLGKG  168
DSSP  LEEEEEELL------------LLLLHhHHHHHHH-HHHLL-LLEEEEEELL---LLLLLL


DSSP  LH--hhHHHHHHHHHHLLLEEEEELLL---------------------------llLHHH
Query VT--pvKLGKKIAKILKVPXXVHVGEP---------------------------paLYDE  203
ident                 |     |                                     
Sbjct LDdphlLPVFEAVADAKLLVFLHPHYGlpnevygprseeyghvlplalgfpmettiAVAR  228
DSSP  LLlhhhHHHHHHHHHLLLEEEELLLLLllhhhhlllhhhlllhhhhhlhhhhhhhhHHHH


DSSP  HH--HHLL----LLLEEELLLLLllllLLLLLHHH-------------------hhHHHH
Query VL--EILG----PGDVVTHCFNGksgsSIXEDEDL-------------------fnLAER  238
ident                   |                                         
Sbjct MYmaGVFDhvrnLQMLLAHSGGT----LPFLAGRIescivhdghlvktgkvpkdrrTIWT  284
DSSP  HHhlLHHHhlllLLEEEHHHHLL----HHHHHHHHhhhhhllhhhhhlllllllllLHHH


DSSP  L--LLLEEELLLllllLLHHHHHHHHhLLLL--LLLLLLLLLllLLLL--------LLLL
Query C--EGIRLDIGHggasFSFKVAEAAIaRGLL--PFSISTDLHghSXNF--------PVWD  286
ident    | | ||        |     |||            ||                    
Sbjct VlkEQIYLDAVI----YSEVGLQAAI-ASSGadRLMFGTDHP--FFPPieedvqgpWDSS  337
DSSP  HhhHLEEEELLL----LLHHHHHHHH-HHHLhhHEELLLLLL--LLLLllllllllLHHH


DSSP  hHHHHHHHHHLLLL-HHHHHHLLLHHHHHHLLLL--LLLLLLLlllleeeeeeeeeeeee
Query lATTXSKLLSVDXP-FENVVEAVTRNPASVIRLD--XENRLDVgqradftvfdlvdadle  343
ident                          |   |  |    |                      
Sbjct -RLNAQAVIKAVGEgSSDAAAVMGLNAVRVLSLKaeLEHHHHH-----------------  379
DSSP  -HHHHHHHHHHHLLlLHHHHHHHLHHHHHHLLLHhhHHHHHHH-----------------


DSSP  eellllleeeeeeeeeeeeeeelleeeellllllll
Query atdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                     
Sbjct -----------------------------------h  380
DSSP  -----------------------------------l


No 39: Query=2ogjA Sbjct=3irsA Z-score=13.7

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
ident                                                            |
Sbjct -------------------------------------------------------LKIID    5
DSSP  -------------------------------------------------------LLLEE


DSSP  EEELLLLL-LLLL----------------------------lllHHHLLHHHLEEEEEEE
Query LHVHIWHG-GTDI----------------------------sirPSECGAERGVTTLVDA   91
ident                                               |  |  |    |  
Sbjct FRLRPPAMgFLNAriytrpdirnrftrqlgfepapsaeekslelMFEEMAAAGIEQGVCV   65
DSSP  LLLLLLLHhHHHLhhhhlhhhhhhhhhhhlllllhhhhhllhhhHHHHHHHLLLLEEEEE


DSSP  LL----llllLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHHHLlHHHHHH
Query GS----ageaNFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIKDIdLDRILE  147
ident |                                                 |        |
Sbjct GRnssvlgsvSNADVAA-VAKAYPDKFHPVGSIE------------AATRKEA-MAQMQE  111
DSSP  LLeellleelLHHHHHH-HHHHLLLLEEEEEELL------------LLLHHHH-HHHHHH


DSSP  HHHLLlllEEEEEEEELhhHHLLLLL---HHHHHHHHHHHHHLLLEEEEE---LLLL--L
Query CYAENsehIVGLXVRAShvITGSWGV---TPVKLGKKIAKILKVPXXVHV---GEPP--A  199
ident         |                                   |          |    
Sbjct ILDLG---IRIVNLEPG--VWATPMHvddRRLYPLYAFCEDNGIPVIMMTggnAGPDitY  166
DSSP  HHHLL---LLLEEELHH--HLLLLLLlllHHHHHHHHHHHHLLLLEEEELlllLLLLhhH


DSSP  LHH-HHHHHL----LLLLEEELLllllllLLLLllhHHHHHHHHLLLLEEELLLlllLLL
Query LYD-EVLEIL----GPGDVVTHCfngksgSSIXedeDLFNLAERCEGIRLDIGHggaSFS  254
ident          |        |  |                   | |     |          
Sbjct TNPeHIDRVLgdfpDLTVVSSHG----nwPWVQ---EIIHVAFRRPNLYLSPDM---YLY  216
DSSP  HLHhHHHHHHhhllLLLEEEEHH----hlLLHH---HHHHHHHHLLLEEEELHH---HHL


DSSP  H-HHHHHHHH--LLLL--LLLLLLLLLllllllLLLL--HHHHHHHHhhlLLLHHHHHHL
Query F-KVAEAAIA--RGLL--PFSISTDLHghsxnfPVWD--LATTXSKLlsvDXPFENVVEA  307
ident         |      |       |                      |             
Sbjct NlPGHADFIQaaNSFLadRMLFGTAYP------MCPLkeYTEWFLTL---PIKPDAMEKI  267
DSSP  LlLLHHHHHHhhLLHHhhLLLLLLLLL------LLLHhhHHHHHHLL---LLLHHHHHHH


DSSP  LLHHHHHHLLllllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeell
Query VTRNPASVIRldxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryaviga  367
ident    |                                                        
Sbjct LHGNAERLLA--------------------------------------------------  277
DSSP  HLHHHHHHHH--------------------------------------------------


DSSP  eeeellllllll
Query eaiaasryipra  379
ident             
Sbjct --------qagr  281
DSSP  --------hlll


No 40: Query=2ogjA Sbjct=2dvtA Z-score=13.4

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
ident                                                         | | 
Sbjct ------------------------------------------------------MQGKVA    6
DSSP  ------------------------------------------------------LLLEEE


DSSP  EEELLLlLLLL------------------LLLL---HHHLLHHHLEEEEEEELL------
Query LHVHIWhGGTD------------------ISIR---PSECGAERGVTTLVDAGS------   93
ident |  |     |                                  |  |            
Sbjct LEEHFAiPETLqdsagfvpgdywkelqhrLLDIqdtRLKLMDAHGIETMILSLNapavqa   66
DSSP  EEEEELlHHHHhhhlllllllhhhhhhhhHHLLllhHHHHHHHLLEEEEEEEELllhhhh


DSSP  ---------lLLLLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHHHLlHHH
Query ---------aGEANFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIKDIdLDR  144
ident                    |        |  ||  |             | |        
Sbjct ipdrrkaieiARRANDVLAE-ECAKRPDRFLAFAALP------------LQDPDAA-TEE  112
DSSP  lllhhhhhhhHHHHHHHHHH-HHHHLLLLEEEEELLL------------LLLHHHH-HHH


DSSP  HHHHHHLLLllEEEEEEEElhhHHLL-----LLLH---hhHHHHHHHHHHLLLEEEEE--
Query ILECYAENSehIVGLXVRAshvITGS-----WGVT---pvKLGKKIAKILKVPXXVHV--  194
ident    |        ||  |                                | ||   |   
Sbjct LQRCVNDLG--FVGALVNG---FSQEgdgqtPLYYdlpqyRPFWGEVEKLDVPFYLHPrn  167
DSSP  HHHHHHLLL--LLEEEEEL---LLLLlllllLLLLllhhhHHHHHHHHHHLLLEEEELll


DSSP  ---------------------LLLLlLHHHHHHH---------lLLLLEEELLLLllllL
Query ---------------------GEPPaLYDEVLEI---------lGPGDVVTHCFNgksgS  224
ident                                |                   |        
Sbjct plpqdsriydghpwllgptwaFAQE-TAVHALRLmasglfdehpRLNIILGHMGE----G  222
DSSP  llhhhlhhhlllhhhlhhhlhHHHH-HHHHHHHHhhllhhhhllLLLEEELHHHL----L


DSSP  LLLLLHHH---------------hhhHHHL--LLLEEELLLlllLLLHHHHHHHHhLLLL
Query SIXEDEDL---------------fnlAERC--EGIRLDIGHggaSFSFKVAEAAIaRGLL  267
ident                                 |            |       ||     
Sbjct LPYMMWRIdhrnawvklpprypakrrFMDYfnENFHITTSG---NFRTQTLIDAI-LEIG  278
DSSP  HHHHHHHHhhllllllllllllllllHHHHhhHHEEEELLL---LLLHHHHHHHH-LLLL


DSSP  --LLLLLLLLlLLLLlllLLLHHHHHHHHhhlLLLHHHHHHLLLHHHHHHLLLLllllll
Query --PFSISTDLhGHSXnfpVWDLATTXSKLlsvDXPFENVVEAVTRNPASVIRLDxenrld  325
ident       |||                              |     |      ||      
Sbjct adRILFSTDW-PFEN---IDHASDWFNAT---SIAEADRVKIGRTNARRLFKLD------  325
DSSP  hhHEELLLLL-LLLL---HHHHHHHHHHL---LLLHHHHHHHHLHHHHHHLLLL------


DSSP  llllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query vgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                       
Sbjct ------------------------------------------------------  325
DSSP  ------------------------------------------------------


No 41: Query=2ogjA Sbjct=4ofcA Z-score=13.0

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
ident                                                            |
Sbjct --------------------------------------------------------mKID    4
DSSP  --------------------------------------------------------lLEE


DSSP  EEELLLLL------------------------------------llLLLL----LHHHlL
Query LHVHIWHG------------------------------------gtDISI----RPSEcG   80
ident  | ||                                                 |  |  
Sbjct IHSHILPKewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrENCWdpevRIRE-M   63
DSSP  EEEELLLLllllhhhhhllllleeeeeeelleeeeeelleeeeeeeHHHLlhhhHHHH-H


DSSP  HHHLEEEEEEELL---------------lLLLLHHHHHHhLLLLLlLEEEEEEELLllll
Query AERGVTTLVDAGS---------------aGEANFHGFREyIIEPSrERIKAFLNLGsigl  125
ident    |||                                         |      |     
Sbjct DQKGVTVQALSTVpvmfsywakpedtlnlCQLLNNDLAS-TVVSYpRRFVGLGTLP----  118
DSSP  HHHLLLEEEEELLhhhhlllllhhhhhhhHHHHHHHHHH-HHHHLlLLEEEEELLL----


DSSP  llllllllLLLHHHLlHHHHHHHHHLLLllEEEEEEEELhhhHLLLLL--HHHHHHHHHH
Query vacnrvpeLRDIKDIdLDRILECYAENSehIVGLXVRAShviTGSWGV--TPVKLGKKIA  183
ident                       |  |      |            |             |
Sbjct --------MQAPELA-VKEMERCVKELG--FPGVQIGTH---VNEWDLnaQELFPVYAAA  164
DSSP  --------LLLHHHH-HHHHHHHHHLLL--LLEEEEELE---ELLEELllHHHHHHHHHH


DSSP  HHHLLLEEEEE-------------------LLLL--lLHHHHH--HHLL----lLLEEEL
Query KILKVPXXVHV-------------------GEPP--aLYDEVL--EILG----pGDVVTH  216
ident   ||    ||                                                 |
Sbjct ERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttiAICSMImgGVFEkfpklKVCFAH  224
DSSP  HHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhhHHHHHHllLHHHhllllLEEELH


DSSP  LLLllllLLLLLLHHH------------------hHHHHhlLLLEEELLllllLLLHHHH
Query CFNgksgSSIXEDEDL------------------fNLAErcEGIRLDIGhggaSFSFKVA  258
ident                                               |             
Sbjct GGG----AFPFTVGRIshgfsmrpdlcaqdnpmnpKKYL--GSFYTDAL----VHDPLSL  274
DSSP  HHL----LHHHHHHHHhhhhhhlhhhhlllllllhHHHL--LLLEEELL----LLLHHHH


DSSP  HHHHhLLLL--LLLLLLLLLLLLLlllLLLHHHHHHHHHhlLLLHHHHHHLLLHHHHHHL
Query EAAIaRGLL--PFSISTDLHGHSXnfpVWDLATTXSKLLsvDXPFENVVEAVTRNPASVI  316
ident                 ||                           |        |     
Sbjct KLLT-DVIGkdKVILGTDYPFPLG---ELEPGKLIESME--EFDEETKNKLKAGNALAFL  328
DSSP  HHHH-HHHLllLEELLLLLLLLLL---LLLLLHHHHHLL--LLLHHHHHHHHLHHHHHHH


DSSP  LLLLLllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeelllll
Query RLDXEnrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryi  376
ident  |                                                          
Sbjct GLERK-------------------------------------------------------  333
DSSP  LLLHH-------------------------------------------------------


DSSP  lll
Query pra  379
ident    
Sbjct -qf  335
DSSP  -hl


No 42: Query=2ogjA Sbjct=2gwgA Z-score=12.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                            |
Sbjct --------------------------------------------------------XIID    4
DSSP  --------------------------------------------------------LLEE


DSSP  EEELLLLLL----------------------------------lllllLHHHLLHHHLEE
Query LHVHIWHGG----------------------------------tdisiRPSECGAERGVT   86
ident  | |                                                   |||  
Sbjct IHGHYTTAPkaledwrnrqiagikdpsvxpkvselkisddelqasiieNQLKKXQERGSD   64
DSSP  EEEELLLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHHHHHHHLLL


DSSP  EEEEELL---------lLLLLHHHHHHhLLLLLLLEEEEEEELLlllllllllllLLLLH
Query TLVDAGS---------aGEANFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpELRDI  137
ident   |                                       |                 
Sbjct LTVFSPRagdfnvsstwAAICNELCYR-VSQLFPDNFIGAAXLP-----------QSPGV  112
DSSP  EEEEELLlllhhhhhhhHHHHHHHHHH-HHHHLLLLEEEEEELL-----------LLLLL


DSSP  HH-LLHHHHHHHHHLLLllEEEEEEEELhhHHLL---LLLH---hhHHHHHHHHHHLLLE
Query KD-IDLDRILECYAENSehIVGLXVRAShvITGS---WGVT---pvKLGKKIAKILKVPX  190
ident            |  |     |           |                      |  | 
Sbjct DPkTCIPELEKCVKEYG--FVAINLNPD--PSGGhwtSPPLtdriwYPIYEKXVELEIPA  168
DSSP  LHhHHHHHHHHHHHLLL--LLEEEELLL--LLLLlllLLLLllhhhHHHHHHHHHHLLLE


DSSP  EEE------eLLLLlLHHHHHH-------hlLLLLEEELLLLllllLLLLLLHHH-----
Query XVH------vGEPPaLYDEVLE-------ilGPGDVVTHCFNgksgSSIXEDEDL-----  232
ident | |                                |  |                     
Sbjct XIHvstgahyLNADtTAFXQCVagdlfkdfpELKFVIPHGGG----AVPYHWGRFrglaq  224
DSSP  EELlllllhhHHHHhHHHHHHHhllhhhhllLLLEEELHHHL----LLHHHHHHHhhhhh


DSSP  ----hHHHHHL-LLLEEELLLllllLLHHHHHHHHhLLLL--LLLLLLLLLLLLLL----
Query ----fNLAERC-EGIRLDIGHggasFSFKVAEAAIaRGLL--PFSISTDLHGHSXN----  281
ident       |       |  |                                 |        
Sbjct exkkpLLEDHVlNNIFFDTCV----YHQPGIDLLN-TVIPvdNVLFASEXIGAVRGidpr  279
DSSP  hllllLHHHHLlLLEEEELLL----LLHHHHHHHH-HHLLhhHEELLLLLLLLLLLeell


DSSP  ---LLLLlHHHHHHHhhHLLLLHHHHHHLLLHHHHHHL--LLLL-lllLLLLLlleeeee
Query ---FPVWdLATTXSKllSVDXPFENVVEAVTRNPASVI--RLDX-enrLDVGQradftvf  335
ident                  |     |        |   |                       
Sbjct tgfYYDD-TKRYIEA--STILTPEEKQQIYEGNARRVYprLDAAlkakGKLEH-------  329
DSSP  lleELLL-LHHHHHH--LLLLLHHHHHHHHLHHHHHHLhhHHHHhhhhHHHLL-------


DSSP  eeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query dlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                             
Sbjct --------------------------------------------  329
DSSP  --------------------------------------------


No 43: Query=2ogjA Sbjct=1v77A Z-score=12.4

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
ident                                                             
Sbjct -------------------------------------------------------VKFIE    5
DSSP  -------------------------------------------------------LLLEE


DSSP  EEELLLlllllllLLHHHLLHhhLEEEEEEELllllllhhhhhhhllllllleeeeeEEL
Query LHVHIWhggtdisIRPSECGAerGVTTLVDAGsageanfhgfreyiiepsrerikafLNL  120
ident                             |                               
Sbjct MDIRDK-------EAYELAKE--WFDEVVVSI-------------------------KFN   31
DSSP  EEELLH-------HHHHHHHH--HLLEEEEEE-------------------------EEL


DSSP  LLllllllllllllllhhhllhhhHHHHHHLLLL--LEEEEEEEElhhhhlllLLHHHHH
Query GSiglvacnrvpelrdikdidldrILECYAENSE--HIVGLXVRAshvitgswGVTPVKL  178
ident                           |   |       |                  |  
Sbjct EE---------------------vDKEKLREARKeyGKVAILLSN-------pKPSLVRD   63
DSSP  LL---------------------lLHHHHHHHHHhhLLEEEEEEL-------lLHHHHHH


DSSP  HHHHHHhhLLLEEEEELLLLlLHHHHHHHLLllLEEELLlLLLL-LLLLllLHHHHHHHH
Query GKKIAKilKVPXXVHVGEPPaLYDEVLEILGpgDVVTHCfNGKS-GSSIxeDEDLFNLAE  237
ident      |       |             |     |              |  |  |  |  
Sbjct TVQKFK--SYLIYVESNDLR-VIRYSIEKGV--DAIISP-WVNRkDPGI--DHVLAKLMV  115
DSSP  HHHHLL--LLEEEEELLLHH-HHHHHHHLLL--LEEELL-LLLLlLLLL--LHHHHHHHH


DSSP  HLlLLEEELLLLLL--------llLHHHHHHHHhLLLL----lLLLLLLLLLLLLllllL
Query RCeGIRLDIGHGGA--------sfSFKVAEAAIaRGLL----pFSISTDLHGHSXnfpvW  285
ident       |                        |                            
Sbjct KK-NVALGFSLRPLlysnpyeranLLRFMMKAW-KLVEkykvrRFLTSSAQEKWD---vR  170
DSSP  HH-LLEEEEELHHHhhllhhhhhhHHHHHHHHH-HHHHhhlllEEEELLLLLHHH---lL


DSSP  LHHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeee
Query DLATTXSKLLSVDXPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleat  345
ident       |                   |                                 
Sbjct YPRDLISLGVVIGMEIPQAKASISMYPEIILK----------------------------  202
DSSP  LHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHL----------------------------


DSSP  llllleeeeeeeeeeeeeeelleeeellllllll
Query dsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                   
Sbjct ----------------------------------  202
DSSP  ----------------------------------


No 44: Query=2ogjA Sbjct=1itqA Z-score=12.2

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleEEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafISPGWVD   60
ident                                                            |
Sbjct ------------------------------------------dffrdeaerimRDSPVID   18
DSSP  ------------------------------------------lhhhhhhhhhhLLLLEEE


DSSP  EEELLL-LLLLL---------------llLLHHH-lLHHHLEEEEEEELLL--------l
Query LHVHIW-HGGTD---------------isIRPSE-cGAERGVTTLVDAGSA--------g   95
ident  |                                       |                  
Sbjct GHNDLPwQLLDMfnnrlqderanlttlagTHTNIpkLRAGFVGGQFWSVYTpcdtqnkda   78
DSSP  EEELHHhHHHHHhllllllhhhlllllllLLLLHhhHHHLLEEEEEEEELLlhhhllllh


DSSP  LLLHHHHHHHLLLLL-----------------------llEEEEEE-ELLLlllllllll
Query EANFHGFREYIIEPS-----------------------reRIKAFL-NLGSiglvacnrv  131
ident                                                   |         
Sbjct VRRTLEQMDVVHRMCrmypetflyvtssagirqafregkvASLIGVeGGHS---------  129
DSSP  HHHHHHHHHHHHHHHhhlllleeelllhhhhhhhhhllleEEEEEEeLHHH---------


DSSP  lllllhhHLLHHHHHHHHHLLlllEEEEEEE---------ELHH----hhlLLLLH--hh
Query pelrdikDIDLDRILECYAENsehIVGLXVR---------ASHV----itgSWGVT--pv  176
ident        |  |      |         |               |                
Sbjct ------iDSSLGVLRALYQLG---MRYLTLThscntpwadNWLVdtgdsepQSQGLspfg  180
DSSP  ------lLLLHHHHHHHHHLL---EEEEELLlllllllllLHHHlllllllLLLLLlhhh


DSSP  HHHHHHHHHHLLLEEEEEllllllHHHHHHHLL----LLLEE-ELLL-lLLLLLlllllh
Query KLGKKIAKILKVPXXVHVgeppalYDEVLEILG----PGDVV-THCF-nGKSGSsixede  230
ident     |    | |                                                
Sbjct QRVVKELNRLGVLIDLAH-----vSVATMKATLqlsrAPVIFsHSSAysVCASR----rn  231
DSSP  HHHHHHHHHHLLEEELLL-----lLHHHHHHHHhhllLLLEElLLLLllLLLLL----ll


DSSP  hHHHHHHHL--LLLEEELLLLLLLL----------LHHHHHHHHhLLLL--LLLLLLLLL
Query dLFNLAERC--EGIRLDIGHGGASF----------SFKVAEAAIaRGLL--PFSISTDLH  276
ident                                                          |  
Sbjct vPDDVLRLVkqTDSLVMVNFYNNYIsctnkanlsqVADHLDHIK-EVAGarAVGFGGDFD  290
DSSP  lLHHHHHHHhhHLLEEEELLLHHHHlllllllhhhHHHHHHHHH-HHLLhhHEEELLLLL


DSSP  -LLLLLLLLL---LHHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLlllllllllllllee
Query -GHSXNFPVW---DLATTXSKLLSVDXPFENVVEAVTRNPASVIRldxenrldvgqradf  332
ident                      ||        |  |   |   |                 
Sbjct gVPRVPEGLEdvsKYPDLIAELLRRNWTEAEVKGALADNLLRVFE---------------  335
DSSP  lLLLLLLLLLlllLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHH---------------


DSSP  eeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query tvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                
Sbjct -------------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  -------------hhhhllllllllllllllhhhlllllllllllll


No 45: Query=2ogjA Sbjct=2qpxA Z-score=12.1

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleEEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafISPGWVD   60
ident                                                            |
Sbjct --------------------------------------------gxddlsefvDQVPLLD   16
DSSP  --------------------------------------------lllllhhhhHHLLEEE


DSSP  EEELLLLL----------------------------------------------------
Query LHVHIWHG----------------------------------------------------   68
ident  | |                                                        
Sbjct HHCHFLIDgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaa   76
DSSP  EEELLLLLlllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllll


DSSP  --lllllllhhhlLHHHLEEEEEEELLLllllhhHHHHHLLLLLLLEEEEEEELLLLlll
Query --gtdisirpsecGAERGVTTLVDAGSAgeanfhGFREYIIEPSRERIKAFLNLGSIglv  126
ident                      |                   |      ||   |      
Sbjct xndpgyatynhriFGHFHFKELLIDTGFvpddpiLDLDQTAELVGIPVKAIYRLETH---  133
DSSP  llhhhhhhhhhhhHHHLLEEEEEEELLLllllllLLHHHHHHHHLLLEEEEEEHHHH---


DSSP  lllllllllLHHH------------lLHHHHHhHHHLLLllEEEEEEEELHHH-------
Query acnrvpelrDIKD------------iDLDRILeCYAENSehIVGLXVRASHVI-------  167
ident                                           || |  |           
Sbjct ---------AEDFxlehdnfaawwqaFSNDVK-QAKAHG--FVGFXSIAAYRVglhlepv  181
DSSP  ---------HHHHhlllllhhhhhhhHHHHHH-LLLLLL--LLLEEELHHHHLlllllll


DSSP  -------------------hLLLL--LHHHHHHHHHHHHHLLLEEEEEL-------LLLL
Query -------------------tGSWG--VTPVKLGKKIAKILKVPXXVHVG-------EPPA  199
ident                      |                    |   |||           
Sbjct nvieaaagfdtwkhsgekrlTSKPliDYXLYHVAPFIIAQDXPLQFHVGygdadtdXYLG  241
DSSP  lhhhhhhhhhhhhhhlllllLLHHhhHHHHHHHHHHHHHHLLLEEEEELlllllllHHHL


DSSP  LHHHHHHHL------LLLLEEELLLlllllLLLLllhhhhHHHHHLLLLEEELL--LLLL
Query LYDEVLEIL------GPGDVVTHCFngksgSSIXededlfNLAERCEGIRLDIG--HGGA  251
ident         |      |   |  ||                 ||        ||       
Sbjct NPLLXRDYLkaftkkGLKVVLLHCY-----PYHR---eagYLASVFPNLYFDISllDNLG  293
DSSP  LHHHHHHHHhhhhhhLLLEEEEELL-----LLHH---hhhHHHHHLLLEEEELLlhHHHL


DSSP  -llLHHHHHHHHhLLLL--LLLLLLLLL--LLLLllllLLHHHHHHHHHHLL--------
Query -sfSFKVAEAAIaRGLL--PFSISTDLH--GHSXnfpvWDLATTXSKLLSVD--------  298
ident       |   |              |                     |            
Sbjct psgASRVFNEAV-ELAPytRILFASDAStyPEXY---gLAARQFKQALVAHFnqlpfvdl  349
DSSP  hhhHHHHHHHHL-LLLLhhHEELLLLLLllHHHH---hHHHHHHHHHHHHHHhllllllh


DSSP  -llHHHHHHLLLHHHHHHLLL--LLLLlllllllleeeeeeeeeeeeeeellllleeeee
Query -xpFENVVEAVTRNPASVIRL--DXENrldvgqradftvfdlvdadleatdsngdvsrlk  355
ident                |                                            
Sbjct aqkKAWINAICWQTSAKLYHQerELRV---------------------------------  376
DSSP  hhhHHHHHHHHLHHHHHHLLLhhHHLL---------------------------------


DSSP  eeeeeeeeeelleeeellllllll
Query rlfepryavigaeaiaasryipra  379
ident                         
Sbjct ------------------------  376
DSSP  ------------------------


No 46: Query=2ogjA Sbjct=3qy6A Z-score=11.9

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
ident                                                            |
Sbjct ---------------------------------------------------------MID    3
DSSP  ---------------------------------------------------------LEE


DSSP  EEELLLLlLLLLLL--------LHHHlLHHHLEEEEEEELL-------LLLLLHHHHHHH
Query LHVHIWHgGTDISI--------RPSEcGAERGVTTLVDAGS-------AGEANFHGFREY  105
ident  | ||     |                    |  |                |        
Sbjct IHCHILP-AMDDGAgdsadsieMARA-AVRQGIRTIIATPHhnngvykNEPAAVREAADQ   61
DSSP  LLLLLLL-LLLLLLllhhhhhhHHHH-HHHLLLLEEELLLEellllllLLHHHHHHHHHH


DSSP  LLLLL-----LLEEEEEEelllllllllllllllllhhhllhhhhhhhhhllllleeeeE
Query IIEPS-----RERIKAFLnlgsiglvacnrvpelrdikdidldrilecyaensehivglX  160
ident                                                             
Sbjct LNKRLikediPLHVLPGQ-----------------------------------------E   80
DSSP  HHHHHhhlllLLEEELLL-----------------------------------------E


DSSP  EEElhhhhlllllhhHHHHHHHHHHH-------lLLEEEEELLLllLHHH-HHHHLL---
Query VRAshvitgswgvtpVKLGKKIAKIL-------kVPXXVHVGEPpaLYDE-VLEILG---  209
ident  |                                                          
Sbjct IRI------------YGEVEQDLAKRqllslndtKYILIEFPFD--HVPRyAEQLFYdlq  126
DSSP  EEL------------LLLHHHHHHLLllllhhhlLEEEEELLLL--LLLLlHHHHHHhhh


DSSP  ---LLLEEELLLLllllLLLLLLhhhHHHHHHL--LLLEEELLLL-----llllLHHHHH
Query ---PGDVVTHCFNgksgSSIXEDedlFNLAERC--EGIRLDIGHG-----gasfSFKVAE  259
ident       |  |         | |      |       |    |  |               
Sbjct lkgYIPVIAHPER---nREIREN---PSLLYHLveKGAASQITSGslagifgkqLKAFSL  180
DSSP  hllLEEEEELHHH---lHHHHHL---LHHHHHHhhLLLEEEEEHHhhlllllhhHHHHHH


DSSP  HHHHlLLLLLLLLLLLL--LLLLllllLLHHHHHHHHHHlLLLHHHHHHLLlHHHHHHLL
Query AAIArGLLPFSISTDLH--GHSXnfpvWDLATTXSKLLSvDXPFENVVEAVtRNPASVIR  317
ident        |      | |                   |       |        |     |
Sbjct RLVE-ANLIHFVASDAHnvKTRN----FHTQEALYVLEK-EFGSELPYMLT-ENAELLLR  233
DSSP  HHHH-LLLLLEEELLLLllLLLL----LLHHHHHHHHHH-HHLLHHHHHHH-HHHHHHHL


DSSP  LLllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllll
Query LDxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryip  377
ident                                                             
Sbjct NQ------------------------------------------------tifrqppqpv  245
DSSP  LL------------------------------------------------llllllllll


DSSP  ll
Query ra  379
ident   
Sbjct kr  247
DSSP  ll


No 47: Query=2ogjA Sbjct=4qrnA Z-score=11.6

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeellllEEEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaaFISPGWVD   60
ident                                                             
Sbjct ------------------------------------------smtqdlktggEQGYLRIA   18
DSSP  ------------------------------------------llllllllllLLLLLLEE


DSSP  EEELlLLLL-------------------------------------lLLLL-----LHHH
Query LHVHiWHGG-------------------------------------tDISI-----RPSE   78
ident                                                         |   
Sbjct TEEA-FATReiidvylrmirdgtadkgmvslwgfyaqspseratqilERLLdlgerRIAD   77
DSSP  EEEE-ELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhHHHHlllhhHHHH


DSSP  lLHHHLEEEEEEELL---------------lLLLLHHHHHHhLLLLLLLEEEEEEELLll
Query cGAERGVTTLVDAGS---------------aGEANFHGFREyIIEPSRERIKAFLNLGsi  123
ident      |      |                                    |          
Sbjct -MDATGIDKAILALTspgvqplhdldeartlATRANDTLAD-ACQKYPDRFIGMGTVA--  133
DSSP  -HHHLLLLEEEEEELlllllllllhhhhhhhHHHHHHHHHH-HHHHLLLLEEELLLLL--


DSSP  lllllllllllllhhhLLHHHHHHHHHLLL--LLEEEEEEEElhhHHLLlllHHHH----
Query glvacnrvpelrdikdIDLDRILECYAENS--EHIVGLXVRAshvITGSwgvTPVK----  177
ident                  |                  |         |             
Sbjct ---------------pQDPEWSAREIHRGAreLGFKGIQINS---HTQG---RYLDeeff  172
DSSP  ---------------lLLHHHHHHHHHHHHhlLLLLLEEELL---LLLL---LLLLlhhh


DSSP  -hhhhHHHHHLLLEEEEELLL--------------------lLLHHHHHHHL--------
Query -lgkkIAKILKVPXXVHVGEP--------------------pALYDEVLEIL--------  208
ident             |   |                               |  |        
Sbjct dpifrALVEVDQPLYIHPATSpdsmidpmleagldgaifgfgVETGMHLLRLitigifdk  232
DSSP  hhhhhHHHHHLLLEEELLLLLlllllhhhhhhlllllllhhhHHHHHHHHHHhhhlhhhh


DSSP  --lLLLEEELLLlllllLLLLLLHHH-------------------hhhHHHL--LLLEEE
Query --gPGDVVTHCFngksgSSIXEDEDL-------------------fnlAERC--EGIRLD  245
ident        | |               |                       |          
Sbjct ypsLQIMVGHMG----eALPYWLYRLdymhqagvrsqryermkplkktIEGYlkSNVLVT  288
DSSP  lllLLEEELHHH----hLHHHHHHHHhhhhhhhhhlllllllllllllHHHHhhHLEEEE


DSSP  LLLlllLLLHHHHHHHHhLLLL--LLLLLLLLLlLLLLlllLLHHHHHHHHhhlLLLHHH
Query IGHggaSFSFKVAEAAIaRGLL--PFSISTDLHgHSXNfpvWDLATTXSKLlsvDXPFEN  303
ident                               |           |           |     
Sbjct NSG---VAWEPAIKFCQ-QVMGedRVMYAMDYP-YQYV---ADEVRAMDAM---DMSAQT  337
DSSP  LLL---LLLHHHHHHHH-HHHLhhHEELLLLLL-LLLL---HHHHHHHHLL---LLLHHH


DSSP  HHHLLLHHHHHHLLLlllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeee
Query VVEAVTRNPASVIRLdxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfeprya  363
ident        |      |                                             
Sbjct KKKFFQTNAEKWFKL---------------------------------------------  352
DSSP  HHHHHLHHHHHHLLL---------------------------------------------


DSSP  eelleeeellllllll
Query vigaeaiaasryipra  379
ident                 
Sbjct ----------------  352
DSSP  ----------------


No 48: Query=2ogjA Sbjct=4dziC Z-score=11.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeellllEEEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaaFISPGWVD   60
ident                                                            |
Sbjct ----------------------------------------------------ALNYRVID    8
DSSP  ----------------------------------------------------LLLLLEEE


DSSP  EEELLLLL----------------------------------------------------
Query LHVHIWHG----------------------------------------------------   68
ident    |                                                        
Sbjct VDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcl   68
DSSP  EEEELLLLlllllllllhhhlllleeeeelllleeeeelleellllllllllleelllll


DSSP  ----------------------------llllllLHHHlLHHHLEEEEEEELL-------
Query ----------------------------gtdisiRPSEcGAERGVTTLVDAGS-------   93
ident                                   |      |    |             
Sbjct dllfrgeipdgvdpaslmkverladhpeyqnrdaRIAV-MDEQDIETAFMLPTfgcgvee  127
DSSP  hhhhhllllllllhhhllleelhhhlhhhllhhhHHHH-HHHHLEEEEEEELLhhhhhhh


DSSP  -----------lLLLLHHHHHHHLL-lllLLEEEEEEELLllllllllllllLLLHHhLL
Query -----------aGEANFHGFREYII-epsRERIKAFLNLGsiglvacnrvpeLRDIKdID  141
ident               |      |         || |                 | |     
Sbjct alkhdieatmasVHAFNLWLDEDWGfdrpDHRIIAAPIVS------------LADPT-RA  174
DSSP  hllllhhhhhhhHHHHHHHHHHHLLllllLLLEEELLLLL------------LLLHH-HH


DSSP  HHHHHHHHHLLlllEEEEEEEELhhHHLL----LLLH--hhHHHHHHHHHHLLLEEEE--
Query LDRILECYAENsehIVGLXVRAShvITGS----WGVT--pvKLGKKIAKILKVPXXVH--  193
ident         |          ||                               ||   |  
Sbjct VEEVDFVLARG---AKLVLVRPA--PVPGlvkpRSLGdrshDPVWARLAEAGVPVGFHls  229
DSSP  HHHHHHHHHLL---LLLEELLLL--LLLLllllLLLLlhhhHHHHHHHHHHLLLEEEEll


DSSP  --------------------------ELLLllLHHHHH--HHLL----lLLEEELLLLLl
Query --------------------------VGEPpaLYDEVL--EILG----pGDVVTHCFNGk  221
ident                                                    |        
Sbjct dsgylhiaaawggakdpldqvllddrAIHD--TMASMIvhGVFTrhpklKAVSIENGSY-  286
DSSP  llllhhhhhhllllllhhhhhhhllhHHHH--HHHHHHhlLHHHhllllLEEEELLLLL-


DSSP  lllLLLL-LHHH------------hhHHHHL-LLLEEELlllllLLLHHhHHHHHhLLLL
Query sgsSIXE-DEDL------------fnLAERC-EGIRLDIghggaSFSFKvAEAAIaRGLL  267
ident            |                |                           |   
Sbjct ---FVHRlIKRLkkaantqpqyfpedPVEQLrNNVWIAP-----YYEDD-LPELA-RVIG  336
DSSP  ---HHHHhHHHHhhhhhhlhhhllllHHHHHhHHEEELL-----LLLLL-HHHHH-HHHL


DSSP  --LLLLLLLLLLLLLlllLLLHHHHHHHHHhlLLLHHHHHHLLLHHHHHHLLllllllll
Query --PFSISTDLHGHSXnfpVWDLATTXSKLLsvDXPFENVVEAVTRNPASVIRldxenrld  325
ident         |                   |                |              
Sbjct vdKILFGSDWPHGEG---LASPVSFTAELK--GFSESDIRKIMRDNALDLLG--------  383
DSSP  hhHLLLLLLLLLLLL---LLLHHHHHHHHL--LLLHHHHHHHHLHHHHHHHL--------


DSSP  llllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query vgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                       
Sbjct -------------------------------------------------vqvgs  388
DSSP  -------------------------------------------------lllll


No 49: Query=2ogjA Sbjct=1j5sA Z-score=11.2

back to top
DSSP  ---------llleeeeeeeELLLlllllllleeeeellllleeeeelllllllleeelll
Query ---------qapilltnvkPVGFgkgasqsstdiliggdgkiaavgsalqapadtqrida   51
ident                                                             
Sbjct hmflgedylltnraavrlfNEVK-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------


DSSP  leeEELEEEEEELLLLL-------------------------------------------
Query afiSPGWVDLHVHIWHG-------------------------------------------   68
ident        || | |                                               
Sbjct ---DLPIVDPHNHLDAKdivenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnk   80
DSSP  ---LLLEEELLLLLLHHhhhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhh


DSSP  -------------------------------------------------lllllllhHHL
Query -------------------------------------------------gtdisirpSEC   79
ident                                                             
Sbjct ekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKL  140
DSSP  hhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHH


DSSP  LHHHLEEEEEEelLLLLLLHHHHHHHLLLLLL-LEEEEEEELLllllllllllLLLLLHH
Query GAERGVTTLVDagSAGEANFHGFREYIIEPSR-ERIKAFLNLGsiglvacnrvPELRDIK  138
ident      |  |                   |      |                       |
Sbjct LRDMKVEILCT--TDDPVSTLEHHRKAKEAVEgVTILPTWRPD----------RAMNVDK  188
DSSP  HHHLLEEEEEL--LLLLLLLLHHHHHHHHHLLlLEEELLLLLH----------HHHLLLL


DSSP  ---------------------hlLHHHHHHHHHLLL-LLEEEEEEEELH-----------
Query ---------------------diDLDRILECYAENS-EHIVGLXVRASH-----------  165
ident                         |               |                   
Sbjct egwreyvekmgerygedtstldgFLNALWKSHEHFKeHGCVASDHALLEpsvyyvdenra  248
DSSP  llhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHlLLLLEEEEEELLlllllllhhhh


DSSP  ---------------hhhLLLLLHHHHHHHHHHHHHLLLEEEEELL--------------
Query ---------------vitGSWGVTPVKLGKKIAKILKVPXXVHVGE--------------  196
ident                               |           | |               
Sbjct ravhekafsgekltqdeiNDYKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgp  308
DSSP  hhhhhhhlllllllhhhhHHHHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlll


DSSP  --------llLLHH-HHHHHL-----LLLLEEELllLLLLlLLLLllhhHHHHHHHLLLL
Query --------ppALYD-EVLEIL-----GPGDVVTHcfNGKSgSSIXededLFNLAERCEGI  242
ident                     |         |                      |      
Sbjct dsggdistnfLRIAeGLRYFLnefdgKLKIVLYV--LDPT-HLPT----ISTIARAFPNV  361
DSSP  llllleelllLLHHhHHHHHHhhlllLLLEEEEE--LLHH-HHHH----HHHHHHHLLLE


DSSP  EEELlLLLLL---LLHHHHHHHHHLLLL--LLLLLLLLLLlllllllLLHHHHHHHHHHL
Query RLDIgHGGAS---FSFKVAEAAIARGLL--PFSISTDLHGhsxnfpvWDLATTXSKLLSV  297
ident                           ||       ||                   |  |
Sbjct YVGApWWFNDspfGMEMHLKYLASVDLLynLAGMVTDSRK--llsfgSRTEMFRRVLSNV  419
DSSP  EELLlLLLLLlhhHHHHHHHHHHLLLLHhhLLLLLLLLLL--llhhhHHHHHHHHHHHHH


DSSP  L------------lLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeee
Query D------------xPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleat  345
ident                 | |       |                                 
Sbjct VgemvekgqipikeARELVKHVSYDGPKALFF----------------------------  451
DSSP  HhhhhhlllllhhhHHHHHHHHHLHHHHHHHL----------------------------


DSSP  llllleeeeeeeeeeeeeeelleeeellllllll
Query dsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                   
Sbjct ----------------------------------  451
DSSP  ----------------------------------


No 50: Query=2ogjA Sbjct=2a3lA Z-score=11.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------llleeeeeeeellllLLLLLLLeeeeellllleeeeelllllllle
Query --------------qapilltnvkpvgfgKGASQSStdiliggdgkiaavgsalqapadt   46
ident                                 |                           
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKSAPH------------------------  156
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHHLLL------------------------


DSSP  eelllleEEELEEEEEELLlllllLLLL--------------------------------
Query qridaafISPGWVDLHVHIwhggtDISI--------------------------------   74
ident             || |||                                          
Sbjct ----rdfYNVRKVDTHVHH-----SACMnqkhllrfiksklrkepdevvifrdgtyltlr  207
DSSP  ----lllLLLLEEEEEEEL-----LLLLlhhhhhhhhhhhhhllllllleeelleeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   74
ident                                                             
Sbjct evfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrf  267
DSSP  hhhhhhlllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllll


DSSP  -------LHHHlLHHHLEEEEEEeLLLL-------LLLHHHHH--HHLLlllLLEEEEEE
Query -------RPSEcGAERGVTTLVDaGSAG-------EANFHGFR--EYIIepsRERIKAFL  118
ident          |                                           |      
Sbjct lgeitkqVFSD-LEASKYQMAEY-RISIygrkmseWDQLASWIvnNDLY---SENVVWLI  322
DSSP  hhhhhhhHHHH-HLLLLLEEEEE-EEELllllllhHHHHHHHHhlLLLL---LLLEEEEE


DSSP  ELllllllllllllLLLL------------HHHL--LHHHHHH---------hhHLLLLL
Query NLgsiglvacnrvpELRD------------IKDI--DLDRILE---------cyAENSEH  155
ident  |                                        |                 
Sbjct QL------------PRLYniykdmgivtsfQNILdnIFIPLFEatvdpdshpqlHVFLKQ  370
DSSP  EE------------ELLHhhhlllllllllHHHHhhHLLHHHHhhhlhhhllllHHHHLL


DSSP  EEEEEEE-ELHH-----------------hhLLLLLHHHHHHHHHHHHHL----------
Query IVGLXVR-ASHV-----------------itGSWGVTPVKLGKKIAKILK----------  187
ident  ||                                   |         |           
Sbjct VVGFDLVdDESKperrptkhmptpaqwtnafNPAFSYYVYYCYANLYVLNklreskgmtt  430
DSSP  EEEEEEElLLLLlllllllllllllllllllLLLHHHHHHHHHHHHHHHHhhhlllllll


DSSP  LLEEEEE-LLLL-lLHHHHHHHLlllLEEELLLllllllLLLLLHHHHHHHHHLLlLEEE
Query VPXXVHV-GEPP-aLYDEVLEILgpgDVVTHCFngksgsSIXEDEDLFNLAERCEgIRLD  245
ident      |                        |               |  |      | | 
Sbjct ITLRPHSgEAGDidHLAATFLTC---HSIAHGI------NLRKSPVLQYLYYLAQ-IGLA  480
DSSP  LEELLLLlLLLLlhHHHHHHHHL---LLLLLLH------HHHHLHHHHHHHHHHL-LLEE


DSSP  LLLLLLL-----lLHHHHHHHHHlLLLLLLLLLLLLLLLLLLllLLHHHHHHHHHH-LLL
Query IGHGGAS-----fSFKVAEAAIArGLLPFSISTDLHGHSXNFpvWDLATTXSKLLS-VDX  299
ident                           |  | |||            |    |   |    
Sbjct MSPLSNNslfldyHRNPFPVFFL-RGLNVSLSTDDPLQIHLT-kEPLVEEYSIAASvWKL  538
DSSP  ELHHHHLllllllLLLLHHHHHH-LLLLEEELLLLHHHHLLL-lLHHHHHHHHHHHhHLL


DSSP  LHHHHHHLLlHHHHH-HLLLL------LLLLllllllleeeeeeeeeeeeeeelllllee
Query PFENVVEAVtRNPAS-VIRLD------XENRldvgqradftvfdlvdadleatdsngdvs  352
ident       |   ||                                                
Sbjct SACDLCEIA-RNSVYqSGFSHalkshwIGKD--------yykrgpdgndihktnvphirv  589
DSSP  LHHHHHHHH-HHHHHhLLLLHhhhhhhLLLL--------lllllhhhllhhhhlllhhhh


DSSP  eeeeeeeeeeeeelleeeellllllll
Query rlkrlfepryavigaeaiaasryipra  379
ident                            
Sbjct efrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhlllllllllllll


No 51: Query=2ogjA Sbjct=3iacA Z-score=10.4

back to top
DSSP  ----------llleeeeeeEELLllllllllleeeeellllleeeeelllllllleeell
Query ----------qapilltnvKPVGfgkgasqsstdiliggdgkiaavgsalqapadtqrid   50
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  lleEEELEEEEEELLLLLL-----------------------------------------
Query aafISPGWVDLHVHIWHGG-----------------------------------------   69
ident          | | |                                              
Sbjct ---APXPIYDFHCHLSPQEiaddrrfdnlgqiwlegdhykwralrsagvdeslitgkets   80
DSSP  ---LLLLEEELLLLLLHHHhhhllllllhhhhhhllllhhhhhhhhllllhhhlllllll


DSSP  --------------------------------------------------------llll
Query --------------------------------------------------------tdis   73
ident                                                             
Sbjct dyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpaf  140
DSSP  hhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhh


DSSP  lLHHHlLHHHLEEEEEEEllLLLLLHHHHHHHLLLL--LLLEEEEEEELLllllllllll
Query iRPSEcGAERGVTTLVDAgsAGEANFHGFREYIIEP--SRERIKAFLNLGsiglvacnrv  131
ident            |                    |                           
Sbjct sARGI-XQQXNVRXVGTT--DDPIDSLEYHRQIAADdsIDIEVAPSWRPD----------  187
DSSP  lHHHH-HHHLLEEEEELL--LLLLLLLHHHHHHHHLllLLLEEELLLLLH----------


DSSP  LLLLLHH------------------------hlLHHHHHHHHHLLllLEEEEEEEELH--
Query PELRDIK------------------------diDLDRILECYAENseHIVGLXVRASH--  165
ident                                   | | |   |                 
Sbjct KVFKIELdgfvdylrkleaaadvsitrfddlrqALTRRLDHFAAC--GCRASDHGIETlr  245
DSSP  HHHLLLLllhhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHL--LLLEEEEEELLll


DSSP  -------------------------hhhLLLLLHHHHHHHHHHHHHLLLEEEEELL----
Query -------------------------vitGSWGVTPVKLGKKIAKILKVPXXVHVGE----  196
ident                                                  |  | |     
Sbjct fapvpddaqldailgkrlagetlseleiAQFTTAVLVWLGRQYAARGWVXQLHIGAirnn  305
DSSP  llllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHHHHHHLLEEEEEELEelll


DSSP  ---------------------lllLHHHHHHH-----lLLLLEEElllLLLLllLLLLlh
Query ---------------------ppaLYDEVLEI-----lGPGDVVThcfNGKSgsSIXEde  230
ident                              |         |                    
Sbjct ntrxfrllgpdtgfdsigdnniswALSRLLDSxdvtneLPKTILY--cLNPR--DNEV--  359
DSSP  lhhhhhhhllllllleelllllhhHHHHHHHHhhllllLLEEEEE--eLLHH--HHHH--


DSSP  hhHHHHHHLL------LLEEELlLLLLLL----LHHHHHHHHHLLLL--LLLLLLLLLLl
Query dlFNLAERCE------GIRLDIgHGGASF----SFKVAEAAIARGLL--PFSISTDLHGh  278
ident                                       |     |||       ||    
Sbjct -lATXIGNFQgpgiagKVQFGS-GWWFNDqkdgXLRQLEQLSQXGLLsqFVGXLTDSRS-  416
DSSP  -hHHHHHHLLllllllLEEELL-LLHHHLlhhhHHHHHHHHHHHLLHhhLLLLLLLLLL-


DSSP  llllllLLHHHHHHHHHHLL--------------lLHHHHHHLLLHHHHHHLLlllllll
Query sxnfpvWDLATTXSKLLSVD--------------xPFENVVEAVTRNPASVIRldxenrl  324
ident                |                       |      |             
Sbjct --flsyTRHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-------  467
DSSP  --llllHHHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-------


DSSP  lllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query dvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                        
Sbjct -----------------------------------------------------ik  469
DSSP  -----------------------------------------------------ll


No 52: Query=2ogjA Sbjct=3au2A Z-score=9.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  -----------------llleeeeeeeellllllllllleeeeellllleeeeELLLLL-
Query -----------------qapilltnvkpvgfgkgasqsstdiliggdgkiaavGSALQA-   42
ident                                                        ||   
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   42
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   42
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------llleeelllleeEELEEEEEELLLlllLLLLL-----L
Query ----------------------padtqridaafiSPGWVDLHVHIWhggTDISI-----R   75
ident                                        || ||                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHST---YSDGQntleeL  357
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLL---LLLLLllhhhH


DSSP  HHHlLHHHLEEEEEEEL-------------llLLLLHHHHHhHLLL-LLLLEEEEEeell
Query PSEcGAERGVTTLVDAG-------------saGEANFHGFReYIIE-PSRERIKAFlnlg  121
ident         |   |                           |    |        |     
Sbjct WEA-AKTMGYRYLAVTDhspavrvaggpspeeALKRVGEIR-RFNEtHGPPYLLAG----  411
DSSP  HHH-HHHHLLLEEEEEEelhhhhllllllhhhHHHHHHHHH-HHHHhHLLLEEEEE----


DSSP  lllllllllllllllhhhllhhhhhhhhhllllleeeEEEEELHhhhlllLLHHHhHHHH
Query siglvacnrvpelrdikdidldrilecyaensehivgLXVRASHvitgswGVTPVkLGKK  181
ident                                        |            |       
Sbjct -------------------------------------AEVDIHP------DGTLD-YPDW  427
DSSP  -------------------------------------EEEELLL------LLLLL-LLHH


DSSP  HHHhhlllEEEEELLLL--------lLHHHHHHHLLllLEEELLLLL------LLLLlll
Query IAKilkvpXXVHVGEPP--------aLYDEVLEILGpgDVVTHCFNG------KSGSsix  227
ident           | |                  ||      |  |                 
Sbjct VLR-eldlVLVSVHSRFnlpkadqtkRLLKALENPF-vHVLAHPTARllgrraPIEA---  482
DSSP  HHL-llleEEEELLLLLlllhhhhhhHHHHHHLLLL-lLEELLLLLLllllllLLLL---


DSSP  LLHHHHHHHHHLlLLEEELLLL-LLLL-LHHHHHHHHHLLLLLlLLLLLLLLLLLllllL
Query EDEDLFNLAERCeGIRLDIGHG-GASF-SFKVAEAAIARGLLPfSISTDLHGHSXnfpvW  285
ident   |  |  |    |    |             |  |   ||   | ||| |         
Sbjct DWEAVFQKAKEK-GVAVEIDGYyDRMDlPDDLARMAYGMGLWI-SLSTDAHQTDH---lR  537
DSSP  LHHHHHHHHHHH-LLEEEEELLlLLLLlLHHHHHHHHHLLLLE-EEELLLLLHHH---hH


DSSP  LHHHHHHHHHHLLLLHHHhhHLLLHhhhHHLLllllllllllllleeeeeeeeeeeeeee
Query DLATTXSKLLSVDXPFENvvEAVTRnpaSVIRldxenrldvgqradftvfdlvdadleat  345
ident                 |      |                                    
Sbjct FMELAVGTAQRAWIGPER--VLNTLdyeDLLS----------------------------  567
DSSP  HHHHHHHHHHHLLLLLLL--LHHHLlhhHHHH----------------------------


DSSP  llllleeeeeeeeeeeeeeelleeeellllllll
Query dsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                   
Sbjct --------------------------wlkarrgv  575
DSSP  --------------------------hhhlllll


No 53: Query=2ogjA Sbjct=3dcpA Z-score=8.0

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
ident                                                            |
Sbjct --------------------------------------------------------XKRD    4
DSSP  --------------------------------------------------------LLEE


DSSP  EEELllLLLL----LLLL--LHHHlLHHHLEEEEEEEL----------------------
Query LHVHiwHGGT----DISI--RPSEcGAERGVTTLVDAG----------------------   92
ident  | |                       |                                
Sbjct GHTH--TEFCphgtHDDVeeXVLK-AIELDFDEYSIVEhaplssefxkntagdkeavtta   61
DSSP  EEEL--LLLLllllLLLHhhHHHH-HHHLLLLEEEEEEellllhhhhhllllllhhhhll


DSSP  ---lllLLLH-HHHHHhLLLLL--LLEEEEEEelllllllllllllllllhhhllhhhhh
Query ---sagEANF-HGFREyIIEPS--RERIKAFLnlgsiglvacnrvpelrdikdidldril  146
ident                  |         |                                
Sbjct sxaxsdLPYYfKKXNH-IKKKYasDLLIHIGF----------------------------   92
DSSP  lllhhhHHHHhHHHHH-HHHHLllLLEEEEEE----------------------------


DSSP  hhhhllllleeeeEEEElhhhhlllLLHHHHHHHHHHHHHLL---leEEEELLLL-----
Query ecyaensehivglXVRAshvitgswGVTPVKLGKKIAKILKV---pxXVHVGEPP-----  198
ident               |                                             
Sbjct -------------EVDY--------LIGYEDFTRDFLNEYGPqtddgVLSLHFLEgqggf  131
DSSP  -------------EEEL--------LLLLHHHHHHHHHHHHHhlleeEEELLEEEellee


DSSP  -----------------------------lLHHHHHHHL---llLLEEELLLLLL-----
Query -----------------------------aLYDEVLEIL---gpGDVVTHCFNGK-----  221
ident                                     |            |          
Sbjct rsidfsaedynegivqfyggfeqaqlayleGVKQSIEADlglfkPRRXGHISLCQkfqqf  191
DSSP  eellllhhhhhhhlhhhhllhhhhhhhhhhHHHHHHHLLlllllLLEELLLLHHHllhhh


DSSP  --------llllllLLHHHHHHHHHLLlLEEELLLLL--------lLLLHHHHHHHHHLL
Query --------sgssixEDEDLFNLAERCEgIRLDIGHGG--------aSFSFKVAEAAIARG  265
ident                      |        ||    |             |    |    
Sbjct fgedtsdfseevxeKFRVILALVKKRD-YELDFNTAGlfkplcgetYPPKKIVTLASELQ  250
DSSP  hlllhhhllhhhhhHHHHHHHHHHHHL-LEEEEELHHhhlllllllLLLHHHHHHHHHLL


DSSP  LLLlLLLLLLLLLLLllllLLHHHHHHHHHHllllhhhhhhlllhhhhhhllllllllll
Query LLPfSISTDLHGHSXnfpvWDLATTXSKLLSvdxpfenvveavtrnpasvirldxenrld  325
ident         | ||            |    |                              
Sbjct IPF-VYGSDSHGVQD---iGRGYSTYCQKLE-----------------------------  277
DSSP  LLE-EEELLLLLHHH---lLLLHHHHHHHLL-----------------------------


DSSP  llllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query vgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                       
Sbjct ------------------------------------------------------  277
DSSP  ------------------------------------------------------


No 54: Query=2ogjA Sbjct=1m65A Z-score=7.6

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
ident                                                           ||
Sbjct --------------------------------------------------------yPVD    4
DSSP  --------------------------------------------------------lLEE


DSSP  EEELllLLLL-LLLL---LHHHLLHHHLEEEEEEEL-----------lLLLLlHHHHHhh
Query LHVHiwHGGT-DISI---RPSECGAERGVTTLVDAG-----------sAGEAnFHGFRey  105
ident || |                       |                                
Sbjct LHMH--TVAStHAYStlsDYIAQAKQKGIKLFAITDhgpdmedaphhwHFIN-MRIWP--   59
DSSP  LLLL--LLLLlLLLLlhhHHHHHHHHHLLLEEEEEEellllllllllhHHHH-HHHLL--


DSSP  lLLLLLLEEEEEeelllllllllllllllllhhhllhhhhhhhhhllllleeeEEEEElh
Query iIEPSRERIKAFlnlgsiglvacnrvpelrdikdidldrilecyaensehivgLXVRAsh  165
ident         |                                                   
Sbjct -RVVDGVGILRG-----------------------------------------IEANI--   75
DSSP  -LEELLEEEEEE-----------------------------------------EEEEL--


DSSP  hhhlllLLHHHHHHhhhHHHHLL----lEEEEELLLLL-------LHHHHHHHL-LLLL-
Query vitgswGVTPVKLGkkiAKILKV----pXXVHVGEPPA-------LYDEVLEIL-GPGD-  212
ident                                   ||                        
Sbjct ------KNVDGEID---CSGKMFdsldlIIAGFHEPVFaphdkatNTQAMIATIaSGNVh  126
DSSP  ------LLLLLLLL---LLHHHHhhlleEEEELLLLLLllllhhhHHHHHHHHHhLLLLl


DSSP  EEELLLLLllLLLLlllhhHHHHHHHL---LLLEEELLLLLllllhhHHHHHHhLLLL--
Query VVTHCFNGksGSSIxededLFNLAERC---EGIRLDIGHGGasfsfkVAEAAIaRGLL--  267
ident    |  |      |                    | |                       
Sbjct IISHPGNP--KYEI-----DVKAVAEAaakHQVALEINNSS------NCREVA-AAVRda  172
DSSP  EELLLLLL--LLLL-----LHHHHHHHhhhHLLEEEEELLL------LHHHHH-HHHHhh


DSSP  --LLLLLLLLLLlllllllLLHH-HHHHHHHHLL-LLHHHhhHLLLH--HHHHHLLllll
Query --PFSISTDLHGhsxnfpvWDLA-TTXSKLLSVD-XPFENvvEAVTR--NPASVIRldxe  321
ident         | |                 | |     | |                     
Sbjct ggWVALGSDSHT-----afTMGEfEECLKILDAVdFPPER--ILNVSprRLLNFLE----  221
DSSP  llLEEEELLLLL-----hhHLLLlHHHHHHHHHLlLLHHH--LHHHLhhHHHHHHH----


DSSP  llllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query nrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                                           
Sbjct ---------------------------------------------srgmapiaefadl  234
DSSP  ---------------------------------------------hllllllhhhlll


No 55: Query=2ogjA Sbjct=3f2bA Z-score=6.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------LLLEeeeeeeellllllllllleeeeellllleeeeellLLLLLLE--eellll
Query ------QAPIlltnvkpvgfgkgasqsstdiliggdgkiaavgsaLQAPADT--qridaa   52
ident                                                             
Sbjct msgvkkGMWV----------------kvrgsvqndtfvrdlviiaNDLNEIAanerqdta  104
DSSP  hhllllLLEE----------------eeeeeeeeelllleeeeeeEEEEEELllllllll


DSSP  EEEELEEEEEELllLLLL-LLLL-----LHHHlLHHHLEEEEEEELLLLlllhhHHHHHL
Query FISPGWVDLHVHiwHGGT-DISI-----RPSEcGAERGVTTLVDAGSAGeanfhGFREYI  106
ident       | || |                         |         |            
Sbjct PEGEKRVELHLH--TPMSqMDAVtsvtkLIEQ-AKKWGHPAIAVTDHAV----vQSFPEA  157
DSSP  LLLLLLLLLLLL--LLLLlLLLLllhhhHHHH-HHHLLLLLEEELLLLL----lLLHHHH


DSSP  LLLL---LLEEEEEEelllllllllllllllllhhhllhhhhhhhhhllllleeeeEEEE
Query IEPS---RERIKAFLnlgsiglvacnrvpelrdikdidldrilecyaensehivglXVRA  163
ident               |                                             
Sbjct YSAAkkhGMKVIYGL-----------------------------------------EANI  176
DSSP  HHHHhhhLLLEEEEE-----------------------------------------EEEE


DSSP  ------------------------lhhhhlllllhhhhhHHHHHHHHLLLEeeeelllll
Query ------------------------shvitgswgvtpvklGKKIAKILKVPXxvhvgeppa  199
ident                                             |               
Sbjct vddpfhvtllaqnetglknlfklvslshiqyfhrvpripRSVLVKHRDGLL---------  227
DSSP  ellleeeeeeellhhhhhhhhhhhhhhhllllllllleeHHHHHHLLLLEE---------


DSSP  lhhhhhhhllllLEEELLllllllllllllhhHHHHhhHLLLL-EEELLLllLLLL----
Query lydevleilgpgDVVTHCfngksgssixededLFNLaeRCEGI-RLDIGHggASFS----  254
ident                                              |              
Sbjct ------------VGSGCD---------kgelfDNVE-dIARFYdFLEVHP-pDVYKplyv  264
DSSP  ------------EELLLL---------lllllLLLL-lLHHHLlLEEELL-hHHHLllll


DSSP  --HHHHHHHHhLLLL--------lLLLLLLLLllLLLL----------------------
Query --FKVAEAAIaRGLL--------pFSISTDLHghSXNF----------------------  282
ident          | |                   |    |                       
Sbjct kdEEMIKNII-RSIValgekldipVVATGNVH--YLNPedkiyrkilihsqgganplnrh  321
DSSP  llHHHHHHHH-HHHHhhhhhllllEEELLLLL--LLLHhhhhhhhhhhhllhhhllllll


DSSP  ----LLLLHH-HHHHHHHhlLLLHHHHHHLLLHHHHHHLLL-------------------
Query ----PVWDLA-TTXSKLLsvDXPFENVVEAVTRNPASVIRL-------------------  318
ident                         |   | |  |      |                   
Sbjct elpdVYFRTTnEMLDCFS--FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriega  379
DSSP  llllLLLLLHhHHHHHHH--HHHHHHHHHHHLHHHHHHHHLllllllllllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct deeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgyl  439
DSSP  hhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct vgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgt  499
DSSP  leelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct kykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtva  559
DSSP  lleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct dktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpi  619
DSSP  hhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct qypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdv  679
DSSP  elhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct mgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtd  739
DSSP  hhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct vwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefea  799
DSSP  lllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct emrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedf  859
DSSP  hhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  318
ident                                                             
Sbjct dldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqa  919
DSSP  lhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllll


DSSP  --------------lllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeee
Query --------------dxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryav  364
ident                                                             
Sbjct tefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesr  979
DSSP  llleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhl


DSSP  elleeeellllllll
Query igaeaiaasryipra  379
ident                
Sbjct gcldslpdhnqlslf  994
DSSP  lllllllllllllll


No 56: Query=2ogjA Sbjct=1bksA Z-score=5.7

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeleEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgwVD   60
ident                                                             
Sbjct -----------------------------------------meryenlfaqlndrregAF   19
DSSP  -----------------------------------------lhhhhhhhhhhhhllllEE


DSSP  EEELLLllLLLL----llLHHHLLHhhLEEEEEeELLL----------------------
Query LHVHIWhgGTDI----siRPSECGAerGVTTLVdAGSA----------------------   94
ident         |                                                   
Sbjct VPFVTL--GDPGieqslkIIDTLID--AGADAL-ELGVpfsdpladgptiqnanlrafaa   74
DSSP  EEEEEL--LLLLhhhhhhHHHHHHH--LLLLLE-EEELlllllllllhhhhhhhhhhhhh


DSSP  ---lllLHHHHHHhLLLLLllEEEEEEELLlllllllllllllllhhHLLH----HHHHH
Query ---geaNFHGFREyIIEPSreRIKAFLNLGsiglvacnrvpelrdikDIDL----DRILE  147
ident        |      | |     |   |                            |    
Sbjct gvtpaqCFEMLAL-IREKH-pTIPIGLLMY----------------aNLVFnngiDAFYA  116
DSSP  lllhhhHHHHHHH-HHHHL-lLLLEEEEEL----------------hHHHHlllhHHHHH


DSSP  HHHLLLllEEEEEEEelhhhhlllLLHHHHHHHHHHHHHLLLEEEEELLL--llLHHHHH
Query CYAENSehIVGLXVRashvitgswGVTPVKLGKKIAKILKVPXXVHVGEP--paLYDEVL  205
ident              |           |         |                  |   | 
Sbjct RCEQVG--VDSVLVA-------dvPVEESAPFRQAALRHNIAPIFICPPNadddLLRQVA  167
DSSP  HHHHHL--LLEEEEL-------llLHHHLHHHHHHHHHLLLEEEEEELLLllhhHHHHHH


DSSP  HHLllLLEEELllllllLLLLLllhhHHHHHHHLLlLEEELLLLLllllhhhhhhhhhll
Query EILgpGDVVTHcfngksGSSIXededLFNLAERCEgIRLDIGHGGasfsfkvaeaaiarg  265
ident                           |              | |                
Sbjct SYG--RGYTYL-----lALPLH---hLIEKLKEYHaAPALQGFGI----sspeqvsaavr  213
DSSP  HHL--LLLEEE-----lLLLHH---hHHHHHHHHLlLLEEELLLL----llhhhhhhhhh


DSSP  LLLLLLLLL-lLLLL---------------lllllLLHHHHHhhhhhllllhhhhhhlll
Query LLPFSISTD-lHGHS---------------xnfpvWDLATTXskllsvdxpfenvveavt  309
ident                                       |                     
Sbjct AGAAGAISGsaIVKIieknlaspkqmlaelrsfvsAMKAASR------------------  255
DSSP  HLLLEEEELlhHHHHhhhllllhhhhhhhhhhhhhHHHHLLL------------------


DSSP  hhhhhhllllllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeellee
Query rnpasvirldxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaea  369
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  eellllllll
Query iaasryipra  379
ident           
Sbjct ----------  255
DSSP  ----------


No 57: Query=2ogjA Sbjct=2anuA Z-score=5.1

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleEEELEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafISPGWVD   60
ident                                                            |
Sbjct -----------------------------------------------------TEWLLCD    7
DSSP  -----------------------------------------------------LEEEEEE


DSSP  EEELLllllLLLLL-----LHHHlLHHHLEEEEEEEL----------------------l
Query LHVHIwhggTDISI-----RPSEcGAERGVTTLVDAG----------------------s   93
ident  |||                        ||                              
Sbjct FHVHT---nXSDGHlplgeVVDL-FGKHGVDVVSITDhivdrrtleqrkrngeplgaite   63
DSSP  EEELL---lLLLLLllhhhHHHH-HHHLLLLEEEEEEeeelhhhhhhhhhllllllllll


DSSP  llLLLH-HHHHHhLLLLLL----LEEEEEEelllllllllllllllllhhhllhhhhhhh
Query agEANF-HGFREyIIEPSR----ERIKAFLnlgsiglvacnrvpelrdikdidldrilec  148
ident                                                             
Sbjct dkFQDYlKRLWR-EQKRAWeeygXILIPGV------------------------------   92
DSSP  llHHHHhHHHHH-HHHHHHhhhlLEEEEEE------------------------------


DSSP  hhllllleeeeEEEELHHH---------hlllllHHHHHHHHHHHHHLLLEeeeelllll
Query yaensehivglXVRASHVI---------tgswgvTPVKLGKKIAKILKVPXxvhvgeppa  199
ident                                    ||       |               
Sbjct -----------EITNNTDLyhivavdvkeyvdpsLPVEEIVEKLKEQNALV---------  132
DSSP  -----------EEEELLLLeeeeeelllllllllLLHHHHHHHHHHLLLEE---------


DSSP  lhhhhhhhlllllEEELLlLLLLLLlllllhhhhhHHHH-LLLL-EEELLLLLllllhhh
Query lydevleilgpgdVVTHCfNGKSGSsixededlfnLAER-CEGI-RLDIGHGGasfsfkv  257
ident                 |    |               ||         |           
Sbjct -------------IAAHPdRKKLSW------ylwaNXERfKDTFdAWEIANRD-----dl  168
DSSP  -------------EELLLlLLLLLL------hhhhLLLLlLLLLlEEEEEELL-----ee


DSSP  HHHHHHlLLLLLLLLLLLLLLLllllLLLHhhhhhhhhhllllhhhhhhLLLH----hhh
Query AEAAIArGLLPFSISTDLHGHSxnfpVWDLattxskllsvdxpfenvveAVTR----npa  313
ident                 | |                                         
Sbjct FNSVGV-KKYRYVANSDFHELW----HVYS------------------wKTLVkseknie  205
DSSP  LHHHHH-LLLLEEEELLLLLHH----HHLL------------------eEEEEeelllhh


DSSP  HHLLLlllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeell
Query SVIRLdxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaas  373
ident                                                             
Sbjct AIKEA-----------------------------------------------irkntdva  218
DSSP  HHHHH-----------------------------------------------hhhlllee


DSSP  llllll
Query ryipra  379
ident       
Sbjct iylxrk  224
DSSP  eeelll


No 58: Query=2ogjA Sbjct=2yb1A Z-score=4.5

back to top
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE
Query qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
ident                                                            |
Sbjct --------------------------------------------------------aNID    4
DSSP  --------------------------------------------------------lLEE


DSSP  EEELLllllLLLLL-----LHHHLlHHHLEEEEEEELllllllHHHHHHhLLLLLLLEEE
Query LHVHIwhggTDISI-----RPSECgAERGVTTLVDAGsageanFHGFREyIIEPSRERIK  115
ident || |     |               | |    |                           
Sbjct LHFHS---rTSDGAltpteVIDRA-AARAPALLALTDhdctggLAEAAA-AAARRGIPFL   59
DSSP  LLLLL---lLLLLLllhhhHHHHH-HLLLLLEEEELLllllllHHHHHH-HHHHLLLLEE


DSSP  EEeelllllllllllllllllhhhllhhhhhhhhhllllleeeEEEEEL--hhhhlllll
Query AFlnlgsiglvacnrvpelrdikdidldrilecyaensehivgLXVRAS--hvitgswgv  173
ident                                              |  |           
Sbjct NG-----------------------------------------VEVSVSwgrhtvhivgl   78
DSSP  EE-----------------------------------------EEEEEEelleeeeeeee


DSSP  hhhhhhhHHHH-------------------------------------------------
Query tpvklgkKIAK-------------------------------------------------  184
ident          |                                                  
Sbjct gidpaepALAAglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfar  138
DSSP  llllllhHHHHhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhh


DSSP  ----------------hhllleeeeelLLLLlhhhHHHHLL-------lLLEEELLLLLL
Query ----------------ilkvpxxvhvgEPPAlydeVLEILG-------pGDVVTHCFNGK  221
ident                                     ||             |  |     
Sbjct hlvdsgavkdmrtvfrkyltpgkpgyvSHQW---aSLEDAVgwivgaggMAVIAHPGRYD  195
DSSP  hhhhllllllhhhhhhhllllllllllLLLL---lLHHHHHhhhhhlllEEEELLHHHLL


DSSP  lllllLLLHHHHHHHHHLL---LLEEE-LLLLlllLLHHHHHHHHhLLLL----lLLLLL
Query sgssiXEDEDLFNLAERCE---GIRLD-IGHGgasFSFKVAEAAIaRGLL----pFSIST  273
ident              |        |             |                   |   
Sbjct -----MGRTLIERLILDFQaagGQGIEvASGS---HSLDDMHKFA-LHADrhglyASSGS  246
DSSP  -----LLHHHHHHHHHHHHhllLLEEEeEELL---LLHHHHHHHH-HHHHhhlleEEEEL


DSSP  LLLLlllLLLLllhhhHHHHHhhllllHHHHhhlllhHHHHhlLLLLlllllllllleee
Query DLHGhsxNFPVwdlatTXSKLlsvdxpFENVveavtrNPASviRLDXenrldvgqradft  333
ident | |             |                                           
Sbjct DFHA---PGED--vghTEDLP------PICR-----pIWRE--LEAR-------------  275
DSSP  LLLL---LLLL--lllLLLLL------LLLL-----lHHHH--LHHH-------------


DSSP  eeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll
Query vfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
ident                                               
Sbjct -------------------------------------ilrpadaen  284
DSSP  -------------------------------------lllllhhhl


No 59: Query=2ogjA Sbjct=3e38A Z-score=4.4

back to top
DSSP  llleeeeeeeeLLLLLlllllleeeeellllleeeeelllllllleeelllleeEELEEE
Query qapilltnvkpVGFGKgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
ident                                                            |
Sbjct --aqrrneiqvPDLDG-------------------------------------yTTLKCD   21
DSSP  --lllllllllLLLLL-------------------------------------lEEEEEE


DSSP  EEELllLLLLLLLL----LHHHlLHHHLEEEEEEeLLLL---------lLLHHHHHHHlL
Query LHVHiwHGGTDISI----RPSEcGAERGVTTLVDaGSAG---------eANFHGFREYiI  107
ident  | |      |       |  |     |                                
Sbjct FHXH--SVFSDGLVwptvRVDE-AYRDGLDAISL-TEHIeyrphkqdvvSDHNRSFDL-C   76
DSSP  LLLL--LLLLLLLLlhhhHHHH-HHHLLLLEELL-EEELllllllllllLLLLHHHHH-H


DSSP  LLL----LLEEEEEEELLllllllllllllLLLHhhllhhhhhhhhhlllllEEEEeeee
Query EPS----RERIKAFLNLGsiglvacnrvpeLRDIkdidldrilecyaensehIVGLxvra  163
ident                                                     |       
Sbjct REQaeklGILLIKGSEIT------------RAXA------------pghfnaIFLS----  108
DSSP  HHHhhhhLLEELLEEEEE------------LLLL------------lleeeeELLL----


DSSP  lhhhhlllllhHHHHHHHHHHHHlLLEEEE-----------elLLLLLHHHHHHHLlllL
Query shvitgswgvtPVKLGKKIAKILkVPXXVH-----------vgEPPALYDEVLEILgpgD  212
ident              |     ||      |                                
Sbjct ---dsnpleqkDYKDAFREAKKQ-GAFXFWnhpgwdsqqpdttKWWPEHTALYQEG--cX  162
DSSP  ---llhhhlllLHHHHHHHHHHL-LLEEEElllllllllllllLLLHHHHHHHHLL--lL


DSSP  EEELL-----LLLLllllllllhhhhhhhhhLLLLEeelllllllllhhhhhhhhhllll
Query VVTHC-----FNGKsgssixededlfnlaerCEGIRldighggasfsfkvaeaaiargll  267
ident                                                             
Sbjct HGIEVanghlYXPE-----------aiqwclDKNLT------------------------  187
DSSP  LEEEEeelleELLH-----------hhhhhhHHLLE------------------------


DSSP  lLLLLLLLLLLlLLLLL------LLHHhhhhhhhhllllhhhhhhLLLH---hhhhhLLL
Query pFSISTDLHGHsXNFPV------WDLAttxskllsvdxpfenvveAVTR---npasvIRL  318
ident       | |                                                || 
Sbjct -XIGTSDIHQP-IQTDYdfekgeHRTX------------------TFVFakerslqgIRE  227
DSSP  -EEEELLLLLL-HHHHLlhhhllLLLE------------------EEEEellllhhhHHH


DSSP  L---------------------------------llllllllllleeeeEEEEEEE----
Query D---------------------------------xenrldvgqradftvFDLVDAD----  341
ident                                                   |||       
Sbjct AldnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvTDLVLKLkkta  287
DSSP  HhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeelLLLLEEEeell


DSSP  -------------------------eeeellllleeEEEEeeeeeeeeelleeeelllll
Query -------------------------leatdsngdvsRLKRlfepryavigaeaiaasryi  376
ident                                                             
Sbjct hdtllvyfrdxtlkphtrytvrigfkqgikggdvnfEVTN--------fivapdkglkyt  339
DSSP  lllleellleeeellleeeeeeeeellllllleeeeEEEE--------eeeelleeeeee


DSSP  lll
Query pra  379
ident    
Sbjct isl  342
DSSP  eel