Results: dupa

Query: 2ob3A

MOLECULE: PARATHION HYDROLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2ob3-A 64.7  0.0  329   329  100 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   2:  2vc5-A 42.9  1.8  306   314   33 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
   3:  3k2g-B 39.4  2.0  292   358   30 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   4:  1bf6-A 36.8  2.1  276   291   30 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   5:  2y1h-B 19.3  3.2  232   265   17 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   6:  1onx-A 19.1  3.1  236   390   17 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   7:  3mkv-A 19.1  3.7  249   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   8:  1gkp-A 18.9  3.1  249   458   15 PDB  MOLECULE: HYDANTOINASE;                                              
   9:  4b3z-D 18.5  3.3  252   477   13 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  10:  3mtw-A 18.4  3.7  245   404   14 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  11:  4c5y-A 18.1  3.7  247   436   15 PDB  MOLECULE: OCHRATOXINASE;                                             
  12:  3giq-A 17.8  3.1  244   475   16 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  13:  1k6w-A 17.7  4.0  248   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  14:  4cqb-A 17.5  3.9  244   402   13 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  15:  3cjp-A 17.4  2.6  213   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  16:  3ls9-A 17.3  4.2  244   453   16 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  17:  2qpx-A 17.0  3.2  235   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  18:  2paj-A 17.0  3.3  228   421   14 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  19:  2oof-A 16.8  4.1  239   403   18 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  20:  4dlf-A 16.7  3.3  235   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  21:  3gg7-A 16.7  3.4  220   243   18 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  22:  3irs-A 16.6  3.4  226   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  23:  2ffi-A 16.6  3.4  234   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  24:  4mup-B 16.6  3.1  221   286   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  25:  3gri-A 16.3  3.6  237   422    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  26:  3nqb-A 16.2  3.2  219   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  27:  2vun-A 16.2  3.0  215   385   13 PDB  MOLECULE: ENAMIDASE;                                                 
  28:  3e74-A 16.2  3.4  232   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  29:  1itq-A 16.0  3.3  239   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  30:  3pnu-A 15.2  3.6  234   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  31:  1j6p-A 15.2  3.9  230   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  1a5k-C 15.1  3.1  217   566   18 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  33:  4rdv-B 15.0  3.7  233   451   16 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  34:  2dvt-A 14.9  3.4  220   325   15 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  35:  2gwg-A 14.9  3.3  227   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  36:  1a4m-A 14.9  4.2  237   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  37:  2uz9-A 14.6  4.4  236   444   12 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  38:  3icj-A 14.5  3.7  222   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  39:  4ofc-A 14.4  3.3  218   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  40:  2ogj-A 14.3  3.3  216   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  41:  3iac-A 14.2  3.3  236   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  42:  2imr-A 14.2  3.9  227   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  43:  4hk5-D 14.1  3.6  228   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  44:  4qrn-A 14.1  3.5  220   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  45:  1j5s-A 13.8  3.2  232   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  46:  3qy6-A 13.2  3.1  198   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  3ooq-A 13.2  3.1  188   384   21 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  48:  1yrr-B 13.0  3.5  204   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  49:  4dzi-C 12.6  3.3  208   388   13 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  50:  1v77-A 11.7  3.5  179   202    6 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A 10.9  4.1  247   616    8 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3au2-A  8.5  3.6  186   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3dcp-A  8.4  3.6  167   277    8 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  8.3  3.5  173   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  7.6  4.2  178   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.6  3.9  176   255   11 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.0  3.8  153   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.2  3.4  144   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  5.1  3.7  137   224    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2ob3A Sbjct=2ob3A Z-score=64.7

back to top
DSSP  LLEEELLEEELHHHHLLEEEEELLEELLLLHHHHLHHHHLLHHHHHHHHHHHHHHHHHLL
Query DRINTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRRARAAG   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DRINTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFGSRKALAEKAVRGLRRARAAG   60
DSSP  LLEEELLEEELHHHHLLEEEEELLEELLLLHHHHLHHHHLLHHHHHHHHHHHHHHHHHLL


DSSP  LLEEEELLLHHHLLLHHHHHHHHHHHLLEEELEEELLLLLLHHHHLLLHHHHHHHHHHHH
Query VRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREI  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELTQFFLREI  120
DSSP  LLEEEELLLHHHLLLHHHHHHHHHHHLLEEELEEELLLLLLHHHHLLLHHHHHHHHHHHH


DSSP  HLLLLLLLLLLLEEEEELLLLLLHHHHHHHHHHHHHHHHHLLLEEEELLHHHLHHHHHHH
Query QYGIEDTGIRAGIIXVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAA  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QYGIEDTGIRAGIIXVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAA  180
DSSP  HLLLLLLLLLLLEEEEELLLLLLHHHHHHHHHHHHHHHHHLLLEEEELLHHHLHHHHHHH


DSSP  HHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLLLLLLLLHHHHHHHLL
Query IFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPYSAIGLEDNASASALLGI  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPYSAIGLEDNASASALLGI  240
DSSP  HHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLLLLLLLLHHHHHHHLL


DSSP  LLHHHHHHHHHHHHHLLLHHHEEELLLLLLEELLLLLLHHHHHHHHLLLHHHHHHHLHHH
Query RSWQTRALLIKALIDQGYMKQILVSNDWTFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIP  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RSWQTRALLIKALIDQGYMKQILVSNDWTFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIP  300
DSSP  LLHHHHHHHHHHHHHLLLHHHEEELLLLLLEELLLLLLHHHHHHHHLLLHHHHHHHLHHH


DSSP  HHHHLLLLHHHHHHHHLHHHHHHHLLLLL
Query FLREKGVPQETLAGITVTNPARFLSPTLR  329
ident |||||||||||||||||||||||||||||
Sbjct FLREKGVPQETLAGITVTNPARFLSPTLR  329
DSSP  HHHHLLLLHHHHHHHHLHHHHHHHLLLLL


No 2: Query=2ob3A Sbjct=2vc5A Z-score=42.9

back to top
DSSP  LLEEELLE-EELHHHHLLEEEEELLEELLLLHHHHLHHHHlLHHHHHHHHHHHHHHHHHL
Query DRINTVRG-PITISEAGFTLTHEHICGSSAGFLRAWPEFFgSRKALAEKAVRGLRRARAA   59
ident  ||  |    |     |||| |||    |      ||            ||    ||   
Sbjct MRIPLVGKdSIESKDIGFTLIHEHLRVFSEAVRQQWPHLY-NEDEEFRNAVNEVKRAMQF   59
DSSP  LLLLLLLLlLLLHHHLLLEELLLLLLLLLHHHHHHLHHHL-LHHHHHHHHHHHHHHHHHL


DSSP  LLLEEEELLLHHHLLLHHHHHHHHHHHLLEEELEEELLL--lLLHHHHLLLHHHHHHHHH
Query GVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWF--dPPLSMRLRSVEELTQFFL  117
ident || ||||      |||      |  |     || ||       |     ||  |    | 
Sbjct GVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIyidLPFYFLNRSIDEIADLFI  119
DSSP  LLLEEEELLLLLLLLLHHHHHHHHHLLLLEEEELEELLLlllLLHHHLLLLHHHHHHHHH


DSSP  HHHHLLLLLLLLLLLEEEEELLL-LLLHHHHHHHHHHHHHHHHHLLLEEEELLHHHLHHH
Query REIQYGIEDTGIRAGIIXVATTG-KATPFQELVLKAAARASLATGVPVTTHTAASQRDGE  176
ident   |  ||  |   ||  | |      |   | |  ||| |   | ||  ||  |    | 
Sbjct HDIKEGIQGTLNKAGFVXIAADEpGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGL  179
DSSP  HHHHLLLLLLLLLLLLEEEELLLlLLLHHHHHHHHHHHHHHHHHLLLEEEELLLLLLHHH


DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLlllllllhhhhh
Query QQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPYSaiglednasasa  236
ident  |  |   ||  |    |||  |||   |    |  |  ||||                 
Sbjct EQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLD------------  227
DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLL------------


DSSP  hhLLLLHHHHHHHHHHHHHLLLHHHEEELLLLLLEELlLLLLHHHHH--hHHLLlHHHHH
Query llGIRSWQTRALLIKALIDQGYMKQILVSNDWTFGFSsYVTNIMDVM--dRVNPdGMAFI  294
ident          |      ||  ||   |  | |         |                  |
Sbjct --LFLPVDKRNETTLRLIKDGYSDKIMISHDYCCTID-WGTAKPEYKpklAPRW-SITLI  283
DSSP  --LLLLHHHHHHHHHHHHHLLLLLLEEELLLLLLLLL-LLLLLHHHHhhhLLLL-LLLHH


DSSP  HHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLllll
Query PLRVIPFLREKGVPQETLAGITVTNPARFLSptlr  329
ident     ||||   ||  |  | |   ||  | |    
Sbjct FEDTIPFLKRNGVNEEVIATIFKENPKKFFS----  314
DSSP  HHLHHHHHHLLLLLHHHHHHHHLHHHHHHLL----


No 3: Query=2ob3A Sbjct=3k2gB Z-score=39.4

back to top
DSSP  ------------LLEEELLEEELHHHHLLEEEEELLEELL--------------------
Query ------------DRINTVRGPITISEAGFTLTHEHICGSS--------------------   28
ident              || || |||  |  | || |||                         
Sbjct slselspchvrsGRIXTVDGPIPSSALGHTLXHEHLQNDCrcwwnppqeperqylaeapi   60
DSSP  llllllllllllLEEEELLEEEEHHHLLLEELLLLLLEELhhhllllllhhhhhhhhlll


DSSP  ------llhhhhlhHHHLlhhhHHHHHHHHHHHHHHLLLLEEEELLLHHHLLLHHHHHHH
Query ------agflrawpEFFGsrkaLAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEV   82
ident                           |        | | | |||     ||||   |   
Sbjct sieilselrqdpfvNKHNialdDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRI  120
DSSP  lhhhhhhhhllhhhLLLLleelLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHHH


DSSP  HHHHLLEEELEEELLL--LLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLEEE-EELL
Query SRAADVHIVAATGLWF--DPPLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIX-VATT  139
ident |    |  |   |       |      |          |   |   |  | | |      
Sbjct SAETGVQVVXGAGYYLasSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGeIGVS  180
DSSP  HHHHLLEEEELLLLLLhhHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEeELLL


DSSP  LLLLHHHHHHHHHHHHHHHHHLLLEEEELLHHHLHHHHHHHHHHHLLLLHHHEEELLHHH
Query GKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDD  199
ident    |   |  |  ||||   || |   |     |         | ||         |   
Sbjct SDFTAEEEKSLRGAARAQVRTGLPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHXNP  240
DSSP  LLLLHHHHHHHHHHHHHHHHHLLLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLLHH


DSSP  L-LLHHHHHHHHHLLLEEEELLLLLLlllllllhhHHHH---hLLLLHHHHHHHHHHHHH
Query T-DDLSYLTALAARGYLIGLDHIPYSaiglednasASAL---lGIRSWQTRALLIKALID  255
ident    |  |   || ||     | |                       |    |  |  | |
Sbjct ShXDPVYQATLAQRGAFLEFDXIGXD---------FFYAdqgvQCPSDDEVARAILGLAD  291
DSSP  HlLLHHHHHHHHHHLLEEEELLLLLL---------LEELllleELLLHHHHHHHHHHHHH


DSSP  LLLHHHEEELLLLLleellllllhHHHH---HHHLllHHHHHHHLHHHHHHHLLLLHHHH
Query QGYMKQILVSNDWTfgfssyvtniMDVM---DRVNpdGMAFIPLRVIPFLREKGVPQETL  312
ident  ||   || | |                      |  | ||      | ||  |     |
Sbjct HGYLDRILLSHDVF----------VKXXltrYGGN--GYAFVTKHFLPRLRRHGLDDAAL  339
DSSP  LLLHHHEEELLLLL----------LHHHlhhHLLL--LLLHHHHLHHHHHHHLLLLHHHH


DSSP  HHHHLHHHHHHHLL--lll
Query AGITVTNPARFLSP--tlr  329
ident     |||| |         
Sbjct ETLXVTNPRRVFDAsiegh  358
DSSP  HHHHLHHHHHHHLLlllll


No 4: Query=2ob3A Sbjct=1bf6A Z-score=36.8

back to top
DSSP  lleeelleEELHHhhLLEEEEELLEELLllhhhhlHHHHllhhhHHHHHHHHHHHHHHLL
Query drintvrgPITISeaGFTLTHEHICGSSagflrawPEFFgsrkaLAEKAVRGLRRARAAG   60
ident                | || |||                                    |
Sbjct --------SFDPT--GYTLAHEHLHIDL----sgfKNNVdcrldQYAFICQEMNDLMTRG   46
DSSP  --------LLLLL--LEEEEEELLLEEL----hhhHLLHhheelLHHHHHHHHHHHHHLL


DSSP  LLEEEELLLHHHLLLHHHHHHHHHHHLLEEELEEELLL--LLLHHHHLLLHHHHHHHHHH
Query VRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWF--DPPLSMRLRSVEELTQFFLR  118
ident ||          ||       | |      || ||       |     ||| || |    
Sbjct VRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQdaFFPEHVATRSVQELAQEMVD  106
DSSP  EEEEEELLLHHHLLLHHHHHHHHHHHLLEEEEEELLLLhhHLLLHHHHLLHHHHHHHHHH


DSSP  HHHLLLLLLLLLLLEEE-EELLL-LLLHHHHHHHHHHHHHHHHHLLLEEEELLHHhLHHH
Query EIQYGIEDTGIRAGIIX-VATTG-KATPFQELVLKAAARASLATGVPVTTHTAASqRDGE  176
ident ||  ||  |   ||||    |   | ||  | |  ||| |   || |  |||  |   | 
Sbjct EIEQGIDGTELKAGIIAeIGTSEgKITPLEEKVFIAAALAHNQTGRPISTHTSFS-TMGL  165
DSSP  HHHLLLLLLLLLEEEEEeEELLLlLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH-LLHH


DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLlllllllhhhhh
Query QQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPYSaiglednasasa  236
ident  | |     |   |||  || |  | |         |     | |               
Sbjct EQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKN------------  213
DSSP  HHHHHHHHLLLLHHHEEELLLLLLLLHHHHHHHHHLLLEEEELLLLLL------------


DSSP  hhLLLLHHHHHHHHHHHHHLLLHHHEEELLLLLleellllllhHHHH---HHHLllHHHH
Query llGIRSWQTRALLIKALIDQGYMKQILVSNDWTfgfssyvtniMDVM---DRVNpdGMAF  293
ident          |     || | |       | | |                       |   
Sbjct --SYYPDEKRIAMLHALRDRGLLNRVMLSMDIT----------RRSHlkaNGGY--GYDY  259
DSSP  --LLLLHHHHHHHHHHHHHLLLHHHEEELLLLL----------LHHHlhhHLLL--LLLH


DSSP  HHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLllll
Query IPLRVIPFLREKGVPQETLAGITVTNPARFLSptlr  329
ident      || ||  |  |         ||  |      
Sbjct LLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ----  291
DSSP  HHHLHHHHHHHLLLLHHHHHHHHLHHHHHHLL----


No 5: Query=2ob3A Sbjct=2y1hB Z-score=19.3

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEELlllhhhhlhhhhllhhhHHHHHHHHHHHHHHLL
Query drintvrgpitiseaGFTLTHEHICGSsagflrawpeffgsrkaLAEKAVRGLRRARAAG   60
ident                |    | |                             |  |  | 
Sbjct -------------gvGLVDCHCHLSAP----------------dFDRDLDDVLEKAKKAN   31
DSSP  -------------llLEEEEEELLLLH----------------hHLLLHHHHHHHHHHLL


DSSP  LLEEEELLLHHHLL-LHHHHHHHHHhhlLEEELEEELLLLLL---hhHHLLlhhhHHHHH
Query VRTIVDVSTFDIGR-DVSLLAEVSRaadVHIVAATGLWFDPP---lsMRLRsveeLTQFF  116
ident |   | |            | |             |             |     |    
Sbjct VVALVAVAEHSGEFeKIMQLSERYN---GFVLPCLGVHPVQGldqrsVTLK---dLDVAL   85
DSSP  EEEEEELLLLHHHHhHHHHHHHHLL---LLEEEEELLLLEELllleeLLHH---hHHHHH


DSSP  HHHhHLLLllllLLLLEE-EEELLLL--------lLHHHHHHHHHHHHHHHHHLLLEEEE
Query LREiQYGIedtgIRAGII-XVATTGK--------aTPFQELVLKAAARASLATGVPVTTH  167
ident              |   |  |                 |  ||            ||  |
Sbjct PII-ENYK----DRLLAIgEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVH  140
DSSP  HHH-HHHL----LLLLEEeEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEE


DSSP  LLhhhLHHHHHHHHHHHLLLLhhHEEELLHhHLLLhHHHHHHHHLLLEEEElLLLLLlll
Query TAasqRDGEQQAAIFESEGLSpsRVCIGHSdDTDDlSYLTALAARGYLIGLdHIPYSaig  227
ident        |          |     |      |    |        ||             
Sbjct SR---SAGRPTINLLQEQGAE--KVLLHAF-DGRP-SVAMEGVRAGYFFSI-PPSII---  189
DSSP  EE---LLHHHHHHHHHHLLLL--LEEEELL-LLLH-HHHHHHHHLLLEEEE-LHHHH---


DSSP  llllhhhhhhhlllLHHHHHHHHHHHhhllLHHHEEELLLLLleellllllhhHHHHhhl
Query lednasasallgirSWQTRALLIKALidqgYMKQILVSNDWTfgfssyvtnimDVMDrvn  287
ident                      | | |        |    |                    
Sbjct --------------RSGQKQKLVKQL----PLTSICLETDSP------algpeKQVR---  222
DSSP  --------------LLHHHHHHHHHL----LHHHEEELLLLL------lllllLLLL---


DSSP  llHHHHHHhLHHHHHHHL-LLLHHHH-HHHHlHHHHHHHLL--lll
Query pdGMAFIPlRVIPFLREK-GVPQETL-AGITvTNPARFLSP--tlr  329
ident       |            |   |      |  |            
Sbjct -nEPWNIS-ISAEYIAQVkGISVEEViEVTT-QNALKLFPKlrhll  265
DSSP  -lLHHHHH-HHHHHHHHHhLLLHHHHhHHHH-HHHHHHLLLhhhhl


No 6: Query=2ob3A Sbjct=1onxA Z-score=19.1

back to top
DSSP  -----------------------------------------------lleeelleeelhh
Query -----------------------------------------------drintvrgpitis   13
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  hhLLEEEEELLEELlllhhhhlHHHHllhhhhhhHHHHhHHHHHHLLLLEEEELL---lh
Query eaGFTLTHEHICGSsagflrawPEFFgsrkalaeKAVRgLRRARAAGVRTIVDVS---tf   70
ident   ||   | |  |                       |  | |   |||   |        
Sbjct cpGFIDQHVHLIGG----ggeaGPTT------rtPEVA-LSRLTEAGVTSVVGLLgtdsi  109
DSSP  eeLEEEEEELLLLL----llllLHHH------llLLLL-HHHHHHLLEEEEEELLlllll


DSSP  hHLLL--HHHHHHHHHHhLLEEELEEELLLLLlhhhhlllhhhhhHHHHHHHHLLlllll
Query dIGRD--VSLLAEVSRAaDVHIVAATGLWFDPplsmrlrsveeltQFFLREIQYGiedtg  128
ident                          ||    |                            
Sbjct sRHPEslLAKTRALNEE-GISAWMLTGAYHVP--------srtitGSVEKDVAII-----  155
DSSP  lLLHHhhHHHHHHHHHH-LLEEEEEEELLLLL--------lllllLLHHHHHHHL-----


DSSP  LLLLEEEEELLLL-LLHHHHHHHHHHHHHHHHHL------LLEEEELLHHHLHHHHHHHH
Query IRAGIIXVATTGK-ATPFQELVLKAAARASLATG------VPVTTHTAASQRDGEQQAAI  181
ident  |    | |             |   |  |   |           |   |          
Sbjct DRVIGVXCAISDHrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDSKKALQPIYDL  215
DSSP  LLEEEEEEEELLLlLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLLLLLLHHHHHH


DSSP  HHHLLLLHHHEEELLHHHLLL-HHHHHHHHHLLLEEEELlLLLLlllllllhhhhhhhlL
Query FESEGLSPSRVCIGHSDDTDD-LSYLTALAARGYLIGLDhIPYSaiglednasasallgI  240
ident  |      |     |              |  |  |                        
Sbjct LENCDVPISKLLPTHVNRNVPlFEQALEFARKGGTIDIT-SSID---------------E  259
DSSP  HHLLLLLHHHEEEELHHHLHHhHHHHHHHHHLLLLEEEE-LLLL---------------L


DSSP  LLHhhHHHHHHHHHHLLL-HHHEEELLLLL--leellllllhhHHHHhhlllHHHHHHhL
Query RSWqtRALLIKALIDQGY-MKQILVSNDWT--fgfssyvtnimDVMDrvnpdGMAFIPlR  297
ident       |  |      |        | |                        |       
Sbjct PVA--PAEGIARAVQAGIpLARVTLSSDGNgsqpffddegnltHIGV----aGFETLL-E  312
DSSP  LLL--HHHHHHHHHHLLLlHHHEEEELLLLleeeeellllleeEEEE----lLLHHHH-H


DSSP  HHHHHHH-LLLLHHHHHHHHLHHHHHHHL-------------------------------
Query VIPFLRE-KGVPQETLAGITVTNPARFLS-------------------------------  325
ident     |                   | ||                                
Sbjct TVQVLVKdYDFSISDALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyarg  372
DSSP  HHHHHHHhHLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeell


DSSP  --------------llll
Query --------------ptlr  329
ident                   
Sbjct klmvkdgkacvkgtfetd  390
DSSP  eeeeelleelllllllll


No 7: Query=2ob3A Sbjct=3mkvA Z-score=19.1

back to top
DSSP  ------------------------------------------lleeelleeelhhhhLLE
Query ------------------------------------------drintvrgpitiseaGFT   18
ident                                                          |  
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  EEEELLEE---lLLLHHHhlhhhhLLHHHHHHHHHHHHHHHHHLLLLEEEELLLhhhlLL
Query LTHEHICG---sSAGFLRawpeffGSRKALAEKAVRGLRRARAAGVRTIVDVSTfdigRD   75
ident   | |                            ||   |     |  |  |         
Sbjct DLHVHVVAiefnLPRVAT------LPNVLVTLRAVPIMRAMLRRGFTTVRDAGG----AG  110
DSSP  EEEELLLLllllHHHHLL------LLHHHHHHHHHHHHHHHHHLLEEEEEELLL----LL


DSSP  HHHHHHHH--HHHLLEEELE-EELL----LLLL---------------------hhhhlL
Query VSLLAEVS--RAADVHIVAA-TGLW----FDPP---------------------lsmrlR  107
ident       |                |        |                           
Sbjct YPFKQAVEsgLVEGPRLFVSgRALSqtggHADPrarsdymppdspcgccvrvgalgrvaD  170
DSSP  HHHHHHHHllLLLLLEEEELlLEEEllllLLLLlllllllllllllllllllllleeelL


DSSP  LHHHHHHHHHHHHHlllllllLLLLEEEEELL-----------LLLLhhHHHHHHHHHHH
Query SVEELTQFFLREIQygiedtgIRAGIIXVATT-----------GKATpfQELVLKAAARA  156
ident  | |       | |         |  ||                      |    |    
Sbjct GVDEVRRAVREELQ-------MGADQIXIMASggvasptdpvgVFGY--SEDEIRAIVAE  221
DSSP  LHHHHHHHHHHHHH-------HLLLLEEEELLlllllllllllLLLL--LHHHHHHHHHH


DSSP  HHHHLLLEEEELlHHHLHHHHHHHHHhhllllhhhEEELLHHhLLLHHHHHHHHHLLLEE
Query SLATGVPVTTHTaASQRDGEQQAAIFeseglspsrVCIGHSDdTDDLSYLTALAARGYLI  216
ident     |  |  |                          | |     |       |  |   
Sbjct AQGRGTYVLAHA-YTPAAIARAVRCG--------vRTIEHGN-LIDDETARLVAEHGAYV  271
DSSP  HHLLLLLEEEEE-LLHHHHHHHHHLL--------lLEEEELL-LLLHHHHHHHHHHLLEE


DSSP  EELLLLLL--LLLLL---lLHHHHHHHLLLLHhHHHHHHHHHHHLLLhhHEEELLLLLLe
Query GLDHIPYS--AIGLE---dNASASALLGIRSWqTRALLIKALIDQGYmkQILVSNDWTFg  271
ident       |   |   |         |             |      |         |    
Sbjct VPTLVTYDalASEGEkyglPPESIAKIADVHG-AGLHSIEIMKRAGV--KMGFGTDLLG-  327
DSSP  ELLHHHHHhhHHHLLllllLHHHHLLHHHHHL-LHHHHHHHHHHHLL--LLLLLLLLLH-


DSSP  ellllllhhhhhhhhLLLHHHHHHhLHHHHHhhllLLHHHHHHHHLHHHHHHHL------
Query fssyvtnimdvmdrvNPDGMAFIPlRVIPFLrekgVPQETLAGITVTNPARFLS------  325
ident                          |                       |  |       
Sbjct --------------eAQRLQSDEF-RILAEV----LSPAEVIASATIVSAEVLGmqdklg  368
DSSP  --------------hHHHHLLHHH-HHHHLL----LLHHHHHHHLLHHHHHHLLllllll


DSSP  ------------------------------------------llll
Query ------------------------------------------ptlr  329
ident                                               
Sbjct rivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllleeeellllllllllllllllllleeeelleeeeelll


No 8: Query=2ob3A Sbjct=1gkpA Z-score=18.9

back to top
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL
Query -------------------------------------drintvrgpitiseaGFTLTHEH   23
ident                                                     ||   | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LEELLllhhhhlHHHHllhhhhhhHHHHHHHHHHHLLLLEEEELLLHH--------hllL
Query ICGSSagflrawPEFFgsrkalaeKAVRGLRRARAAGVRTIVDVSTFD--------igrD   75
ident |              |            |   |   |  |                    
Sbjct IYLPF-------MATF-----akdTHETGSKAALMGGTTTYIEMCCPSrnddalegyqlW  108
DSSP  LLLEE-------LLEE-----lllLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhH


DSSP  HHHHHHHHhhhLLEEELEEELLllllhhHHLLlhhHHHHHHHHHHHLlllllllLLLEEE
Query VSLLAEVSraaDVHIVAATGLWfdpplsMRLRsveELTQFFLREIQYgiedtgiRAGIIX  135
ident  |     |                                                   |
Sbjct KSKAEGNS---YCDYTFHMAVS------KFDE---KTEGQLREIVAD-------GISSFX  149
DSSP  HHHHLLLL---LLEEEEEEELL------LLLL---LHHHHHHHHHHL-------LLLEEE


DSSP  EELL-llllhHHHHHHHHHHHHHHHHLLLEEEELL-------------------------
Query VATT-gkatpFQELVLKAAARASLATGVPVTTHTA-------------------------  169
ident                     |     || || |                           
Sbjct IFLSyknffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhep  209
DSSP  EEELllllllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhlll


DSSP  -----HHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEElLL
Query -----ASQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLdHI  221
ident               |   |  |         |       |    |  |      |    |
Sbjct srpeaVEAEGTARFATFLETTGA---TGYVVHL-SCKPaLDAAMAAKArgVPIYIES-VI  264
DSSP  lllhhHHHHHHHHHHHHHHHHLL---EEEELLL-LLHHhHHHHHHHHHllLLEEEEE-EH


DSSP  LL---LLLLLLL---LHHHHHH--HLLLLhhHHHHHHHHHHHLllHHHEEELLLLLLEel
Query PY---SAIGLED---NASASAL--LGIRSwqTRALLIKALIDQgyMKQILVSNDWTFGfs  273
ident |         |     |                         |       |  |      
Sbjct PHfllDKTYAERggvEAMKYIMspPLRDK--RNQKVLWDALAQ--GFIDTVGTDHCPF--  318
DSSP  HHhhlLHHHHHLlhhHHHLLLLllLLLLL--HHHHHHHHHHHL--LLLLEEELLLLLL--


DSSP  llLLLH-----hhhhhhhlllHHHHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL--
Query syVTNI-----mdvmdrvnpdGMAFIPLRVIPFLR-EKGVPQETLAGITVTNPARFLS--  325
ident                                                   |  |      
Sbjct -dTEQKllgkeaftaipngipAIEDRVNLLYTYGVsRGRLDIHRFVDAASTKAAKLFGlf  377
DSSP  -lHHHHhhhlllhhhllllllLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct prkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavr  437
DSSP  llllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeee


DSSP  -----------------LLLL
Query -----------------PTLR  329
ident                  |   
Sbjct dgqfvgekgwgkllrrePMYF  458
DSSP  lleelllllllllllllLLLL


No 9: Query=2ob3A Sbjct=4b3zD Z-score=18.5

back to top
DSSP  --------------------------------------lleeelleeelhhhhLLEEEEE
Query --------------------------------------drintvrgpitiseaGFTLTHE   22
ident                                                      |      
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  LLEEllllhhhhlhhhhllhhHHHHHHHHHHHHHHHLLLLEEEELLLHH--------hll
Query HICGssagflrawpeffgsrkALAEKAVRGLRRARAAGVRTIVDVSTFD--------igr   74
ident                        |     | | |   |   | |                
Sbjct YLQK-----------------TAADDFFQGTRAALVGGTTMIIDHVVPEpgsslltsfek  103
DSSP  LLLL-----------------LLLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhh


DSSP  LHHHHHHHHhhhLLEEELEEELLllllhhHHLLlhhHHHHHHHHHHHLLllllllLLLEE
Query DVSLLAEVSraaDVHIVAATGLWfdpplsMRLRsveELTQFFLREIQYGiedtgiRAGII  134
ident         |                                     |             
Sbjct WHEAADTKS---CCDYSLHVDIT------SWYD---GVREELEVLVQDK------GVNSF  145
DSSP  HHHHHHLLL---LLEEEEEEELL------LLLL---LHHHHHHHHHHLL------LLLEE


DSSP  EEELLLL-llhHHHHHHHHHHHHHHHHLLLEEEELL------------------------
Query XVATTGK-atpFQELVLKAAARASLATGVPVTTHTA------------------------  169
ident  |    |         |  |       |     |                          
Sbjct QVYMAYKdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpegha  205
DSSP  EEELLLLllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhh


DSSP  ------hHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEELL
Query ------aSQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLDH  220
ident                  |          | |                             
Sbjct lsrpeelEAEAVFRAITIAGRINC---PVYITKV-MSKSaADIIALARKkgPLVFGEPIA  261
DSSP  hhllhhhHHHHHHHHHHHHHHHLL---LEEEEEE-LLHHhHHHHHHHHHhlLLEEEEELH


DSSP  L--LLLLLLLLL----LHHHHH---HHLLLLhHHHHHHHHHHHHlllHHHEEELLLLLLE
Query I--PYSAIGLED----NASASA---LLGIRSwQTRALLIKALIDqgyMKQILVSNDWTFG  271
ident                  | |      |      |   |   |                  
Sbjct AslGTDGTHYWSknwaKAAAFVtspPLSPDP-TTPDYLTSLLAC---GDLQVTGSGHCPY  317
DSSP  HhhHLLLHHHHLllhhHHHHLLlllLLLLLL-LHHHHHHHHHHH---LLLLLLLLLLLLL


DSSP  --------ellLLLLHHhhhhhhlllHHHHHHHLHHHHHHHLL-LLHHHHHHHHLHHHHH
Query --------fssYVTNIMdvmdrvnpdGMAFIPLRVIPFLREKG-VPQETLAGITVTNPAR  322
ident                           |       |       |          | || | 
Sbjct staqkavgkdnFTLIPE------gvnGIEERMTVVWDKAVATGkMDENQFVAVTSTNAAK  371
DSSP  lhhhhhhhlllHHHLLL------lllLLLLHHHHHHHHHLLLLlLLHHHHHHHHLHHHHH


DSSP  HHL---------------------------------------------------------
Query FLS---------------------------------------------------------  325
ident                                                             
Sbjct IFNlyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqg  431
DSSP  HHLllllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeell


DSSP  ----------------------LLLL--------------------
Query ----------------------PTLR--------------------  329
ident                                               
Sbjct kivfedgninvnkgmgrfiprkAFPEhlyqrvkirnkvfglqgvsr  477
DSSP  eeeeelleelllllllllllllLLLHhhhhhhhhhhhhllllllll


No 10: Query=2ob3A Sbjct=3mtwA Z-score=18.4

back to top
DSSP  -------------------------------------------lleeelleeelhhhhLL
Query -------------------------------------------drintvrgpitiseaGF   17
ident                                                           | 
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EEEEELLEEllllhhhhLHHHhLLHHHHHHHHHHHHHHHHHLLLLEEEELLlhhhlLLHH
Query TLTHEHICGssagflraWPEFfGSRKALAEKAVRGLRRARAAGVRTIVDVStfdigRDVS   77
ident    | |                 |                 ||  |   |          
Sbjct IDMHVHLDS-laevggyNSLE-YSDRFWSVVQTANAKKTLEAGFTTVRNVG-----AADY  113
DSSP  EEEEELLLL-lllllhhHHHH-LLHHHHHHHHHHHHHHHHHLLEEEEEELL-----LLLL


DSSP  HHHHHHH------HHLLEEELE-EELL-----LLLL---------hhhhlLLHHHHHHHH
Query LLAEVSR------AADVHIVAA-TGLW-----FDPP---------lsmrlRSVEELTQFF  116
ident                   || |           |                 |  |     
Sbjct DDVGLREaidagyVPGPRIVTAaISFGatgghCDSTffppsmdqknpfnsDSPDEARKAV  173
DSSP  HHHHHHHhhhlllLLLLEEEELlLLEElllllLLLLlllhhhllllllllLLHHHHHHHH


DSSP  HHHHHlllllllLLLLEEEEELL------------LLLLhhhHHHHHHHHHHHHHHLLLE
Query LREIQygiedtgIRAGIIXVATT------------GKATpfqELVLKAAARASLATGVPV  164
ident               |  ||   |               |       ||        |  |
Sbjct RTLKK-------YGAQVIXICATggvfsrgnepgqQQLT---YEEMKAVVDEAHMAGIKV  223
DSSP  HHHHH-------LLLLEEEEELLllllllllllllLLLL---HHHHHHHHHHHHHLLLEE


DSSP  EEELLHHhLHHHHHHHHHhhllllhhhEEELLHHhLLLHHHHHHHHHLLLEEEELLLLL-
Query TTHTAASqRDGEQQAAIFeseglspsrVCIGHSDdTDDLSYLTALAARGYLIGLDHIPY-  223
ident   |                          | |     |          |     |     
Sbjct AAHAHGA-SGIREAVRAG--------vDTIEHAS-LVDDEGIKLAVQKGAYFSMDIYNTd  273
DSSP  EEEELLH-HHHHHHHHLL--------lLEEEELL-LLLHHHHHHHHHHLLEEELLLLLHh


DSSP  -LLLLLL---lLHHHHHHHLLLlHHHHHHHHHHHHHLLLhhHEEELLLLLleellllllh
Query -SAIGLE---dNASASALLGIRsWQTRALLIKALIDQGYmkQILVSNDWTfgfssyvtni  279
ident                                      |         |            
Sbjct yTQAEGKkngvLEDNLRKDRDI-GELQRENFRKALKAGV--KMVYGTDAG----------  320
DSSP  hHHHHHHhhllLHHHHHHHHHH-HHHHHHHHHHHHHHLL--EEELLLLLL----------


DSSP  hhhhhhhlllHHHHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL--------------
Query mdvmdrvnpdGMAFIPlRVIPFLREKGVPQETLAGITVTNPARFLS--------------  325
ident                           |              |  |               
Sbjct --------iyPHGDNA-KQFAVMVRYGATPLQAIQSATLTAAEALGrskdvgqvavgryg  371
DSSP  --------llLLLLHH-HHHHHHHHLLLLHHHHHHHLLHHHHHHHLllllllllllllll


DSSP  -----------------------------llll
Query -----------------------------ptlr  329
ident                                  
Sbjct dmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  leeeelllllllhhhhhllleeeelleeeelll


No 11: Query=2ob3A Sbjct=4c5yA Z-score=18.1

back to top
DSSP  ----------------------------------------------lleeelleeelhhh
Query ----------------------------------------------drintvrgpitise   14
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  hLLEEEEELLE--------elLLLHHHhlhhhhllHHHHHHHHHHHHHHHHHLLLLEEEE
Query aGFTLTHEHIC--------gsSAGFLRawpeffgsRKALAEKAVRGLRRARAAGVRTIVD   66
ident  |    | |            |                      ||   |   |     |
Sbjct pGLWDCHMHFGgdddyyndytSGLATH--------PASSGARLARGCWEALQNGYTSYRD  112
DSSP  eLEEEEEELLLlllllllllhHHHHLL--------HHHHHHHHHHHHHHHHHLLEEEEEE


DSSP  LLlhhhlLLHHHHHHH--hHHHLLEEELE-EELL----LLLL---------HHHH-----
Query VStfdigRDVSLLAEV--sRAADVHIVAA-TGLW----FDPP---------LSMR-----  105
ident                                 |                   |       
Sbjct LA----gYGCEVAKAIndgTIVGPNVYSSgAALSqtagHGDIfalpagevlGSYGvmnpr  168
DSSP  LL----lLHHHHHHHHhllLLLLLEEEELlLEEEllllLLLLllllhhhhhHHHLlllll


DSSP  -----------lLLHHHHHHHHHHHHHlllllllLLLLEEEEELL-----------LLLL
Query -----------lRSVEELTQFFLREIQygiedtgIRAGIIXVATT-----------GKAT  143
ident               |||        |          |  |||                  
Sbjct pgywgagplciaDGVEEVRRAVRLQIR-------RGAKVIXVMASggvmsrddnpnFAQF  221
DSSP  lllllllleeelLLHHHHHHHHHHHHH-------HLLLLEEEELLlllllllllllLLLL


DSSP  hhHHHHHHHHHHHHHHHLLLEEEELLHhHLHHHHHHHHHhhllllhhhEEELLHhHLLLH
Query pfQELVLKAAARASLATGVPVTTHTAAsQRDGEQQAAIFeseglspsrVCIGHSdDTDDL  203
ident       ||            |  |                            |     | 
Sbjct --SPEELKVIVEEAARQNRIVSAHVHG-KAGIMAAIKAG--------cKSLEHV-SYADE  269
DSSP  --LHHHHHHHHHHHHHLLLLEEEEELL-HHHHHHHHHHL--------lLEEEEL-LLLLH


DSSP  HHHHHHHHLLLEEEELLLLL--LLLLLL--lLHHHHHhHLLLlHHHHHHHHHHHHHLLLh
Query SYLTALAARGYLIGLDHIPY--SAIGLE--dNASASAlLGIRsWQTRALLIKALIDQGYm  259
ident          | |                        |                 |  |  
Sbjct EVWELMKEKGILYVATRSVIeiFLASNGeglVKESWA-KLQAlADSHLKAYQGAIKAGV-  327
DSSP  HHHHHHHHHLLEEELLHHHHhhHHHHLLlllLLLHHH-LLLHhHHHHHHHHHHHHHLLL-


DSSP  hHEEELLLLLleellllllhhhhhhhhllLHHHHHhHLHH-HHHHhllLLHHHHHHHHLH
Query kQILVSNDWTfgfssyvtnimdvmdrvnpDGMAFIpLRVI-PFLRekgVPQETLAGITVT  318
ident   |    |                        |   |                       
Sbjct -TIALGTDTA-----------------pgGPTALE-LQFAvERGG---MTPLEAIKAATA  365
DSSP  -LEELLLLLL-----------------llLLLHHH-HHHHhHLLL---LLHHHHHHHHLL


DSSP  HHHHHHLLL---------------------------------------------------
Query NPARFLSPT---------------------------------------------------  327
ident |      |                                                    
Sbjct NAPLSVGPQapltgqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgig  425
DSSP  LHHHHHHHHlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeeelllll


DSSP  ---------ll
Query ---------lr  329
ident            
Sbjct pwgedarnpfl  436
DSSP  lllllllllll


No 12: Query=2ob3A Sbjct=3giqA Z-score=17.8

back to top
DSSP  -----------------------------------------lleeelleeelhhhhLLEE
Query -----------------------------------------drintvrgpitiseaGFTL   19
ident                                                         ||  
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  EEELLEellllhhhhlhhhhllhhhhHHHHHHhHHHHHHLLLLEEEEL----LLHH----
Query THEHICgssagflrawpeffgsrkalAEKAVRgLRRARAAGVRTIVDV----STFD----   71
ident  | |                             ||     |  | |      |       
Sbjct VHGHDD------------------lmFVEKPD-LRWKTSQGITTVVVGncgvSAAPaplp  101
DSSP  LLLLLL------------------lhHHHLLL-LHHHHLLLEEEEEELllllLLLLllll


DSSP  ------------------hllLHHHH-HHHHhhhLLEEELEEELL-lLLLHH-----hHL
Query ------------------igrDVSLL-AEVSraaDVHIVAATGLW-fDPPLS-----mRL  106
ident                          | |           |  |                 
Sbjct gntaaalallgetplfadvpaYFAALdAQRP---MINVAALVGHAnlRLAAMrdpqaaPT  158
DSSP  llllhhhhhhllllllllhhhHHHHHhHLLL---LLEEEEEEEHHhhHHHHLllllllLL


DSSP  LL-HHHHHHHHHHHHHLlllllllLLLEEEEELLL--lLLHHhHHHHHHHHHHHHHHLLL
Query RS-VEELTQFFLREIQYgiedtgiRAGIIXVATTG--kATPFqELVLKAAARASLATGVP  163
ident                          |            |       |   ||        
Sbjct AAeQQAMQDMLQAALEA-------GAVGFSTGLAYqpgAVAQ-AAELEGLARVAAERRRL  210
DSSP  HHhHHHHHHHHHHHHHH-------LLLEEEEELLLllhHHLL-HHHHHHHHHHHHHLLLE


DSSP  EEEEL-LHHH---LHHHHHHHHHHHLLLlhhHEEELLHHHL------LLHHHHHHHHHLL
Query VTTHT-AASQ---RDGEQQAAIFESEGLspsRVCIGHSDDT------DDLSYLTALAARG  213
ident  | |            |   ||    |         |               |       
Sbjct HTSHIrNEADgveAAVEEVLAIGRGTGC---ATVVSHHKCMmpqnwgRSRATLANIDRAR  267
DSSP  EEEELlLLLLlhhHHHHHHHHHHHHHLL---EEEELLLLLLlhhhllLHHHHHHHHHHHH


DSSP  -----LEEEElLLLLL--------llllLLLHHH--------------------------
Query -----YLIGLdHIPYS--------aiglEDNASA--------------------------  234
ident                              |                              
Sbjct eqgveVALDI-YPYPGsstiliperaetIDDIRItwstphpecsgeyladiaarwgcdkt  326
DSSP  hllllEEEEE-LLLLEeeeellhhhlllLLLLEEeeelllhhhllllhhhhhhhhlllhh


DSSP  ---------hHHHLLLLHHHHHHHHHhhhhlllHHHEEELLLLLLEellllllhHHHHhh
Query ---------sALLGIRSWQTRALLIKalidqgyMKQILVSNDWTFGfssyvtniMDVMdr  285
ident           |                           |  |                  
Sbjct taarrlapagAIYFAMDEDEVKRIFQ-------HPCCMVGSDGLPN--------DARP--  369
DSSP  hhhhhhlleeEEEELLLHHHHHHHHH-------LLLEEELLLLLLL--------LLLL--


DSSP  hLLLHhHHHHHLHHHHH-HHLL-LLHHHHHHHHLHHHHHHHL------------------
Query vNPDGmAFIPLRVIPFL-REKG-VPQETLAGITVTNPARFLS------------------  325
ident   |        ||     ||      |         |||                     
Sbjct -HPRL-WGSFTRVLGRYvREARlMTLEQAVARMTALPARVFGfaergvlqpgawadvvvf  427
DSSP  -LLHH-HHHHHHHHHHHhHHLLlLLHHHHHHHHLHHHHHHHLlllllllllllllleeee


DSSP  --------------------------------------------llll
Query --------------------------------------------ptlr  329
ident                                                 
Sbjct dpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  lllllllllllllllllllleeeeeelleeeellllllllllllllll


No 13: Query=2ob3A Sbjct=1k6wA Z-score=17.7

back to top
DSSP  -------------------------------------lleeelleeelhhhHLLEEEEEL
Query -------------------------------------drintvrgpitiseAGFTLTHEH   23
ident                                                      |   | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LEE---------------llllhhhHLHHHHLLHHHHHHHHHHHHHHHHHLLLLEEEELL
Query ICG---------------ssagflrAWPEFFGSRKALAEKAVRGLRRARAAGVRTIVDVS   68
ident                          |              |   |    | |        
Sbjct LDTtqtagqpnwnqsgtlfegierwAERKALLTHDDVKQRAWQTLKWQIANGIQHVRTHV  120
DSSP  LLLllllllllllllllhhhhhhhhHLLHHHLLHHHHHHHHHHHHHHHHHLLEEEEEEEE


DSSP  LHH--hllLHHHHHHHHHHH--LLEEELEEELLLL--LLHHHhlllhhhhHHHHHHHHHl
Query TFD--igrDVSLLAEVSRAA--DVHIVAATGLWFD--PPLSMrlrsveelTQFFLREIQy  122
ident               ||                                            
Sbjct DVSdatltALKAMLEVKQEVapWIDLQIVAFPQEGilSYPNG--------EALLEEALR-  171
DSSP  ELLllllhHHHHHHHHHHHHllLLEEEEEEELLLLllLLLLH--------HHHHHHHHH-


DSSP  llllllLLLLEEEEELL-lllLHHHHHHHHHHHHHHHHHLLLEEEELLHH----HLHHHH
Query giedtgIRAGIIXVATT-gkaTPFQELVLKAAARASLATGVPVTTHTAAS----QRDGEQ  177
ident         |                   |                |         |  | 
Sbjct ------LGADVVGAIPHfeftREYGVESLHKTFALAQKYDRLIDVHCDEIddeqSRFVET  225
DSSP  ------LLLLEEEELHHhlllHHHHHHHHHHHHHHHHHHLLEEEEEELLLllllLLHHHH


DSSP  HHHHHHHlLLLHHHEEELLHHHLL------LHHHHHHHHHLLLEEEElLLLLllllllll
Query QAAIFESeGLSPSRVCIGHSDDTD------DLSYLTALAARGYLIGLdHIPYsaigledn  231
ident  ||          ||   |                  |   |                  
Sbjct VAALAHH-EGMGARVTASHTTAMHsyngayTSRLFRLLKMSGINFVA-NPLV--------  275
DSSP  HHHHHHH-HLLHHHEEEEELHHHHhllhhhHHHHHHHHHHHLLEEEE-LHHH--------


DSSP  hhhhhHHLLL-----lHHHHhhHHHHHHHLLLhhHEEELLLLLleellllllhHHHHHhh
Query asasaLLGIR-----sWQTRalLIKALIDQGYmkQILVSNDWTfgfssyvtniMDVMDrv  286
ident       |  |              |     |         |                   
Sbjct ---niHLQGRfdtypkRRGI-tRVKEMLESGI--NVCFGHDDV---------fDPWYP--  318
DSSP  ---hhHHLLLllllllLLLL-lLHHHHHHLLL--LEEELLLLL---------lLLLLL--


DSSP  lLLHHH--HHHHLHHH--HHHHlLLLHhHHHHHHLHHHHHHHL-----------------
Query nPDGMA--FIPLRVIP--FLREkGVPQeTLAGITVTNPARFLS-----------------  325
ident                    |   |              || |                  
Sbjct -LGTANmlQVLHMGLHvcQLMGyGQIN-DGLNLITHHSARTLNlqdygiaagnsanliil  376
DSSP  -LLLLLhhHHHHHHHHhlLLLLhHHHH-HHHHHHLHHHHHHLLllllllllllllleeee


DSSP  -------------------------------------------llll
Query -------------------------------------------ptlr  329
ident                                                
Sbjct paengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  llllhhhhhhhllllleeeelleeeeellllleeeellleeeellll


No 14: Query=2ob3A Sbjct=4cqbA Z-score=17.5

back to top
DSSP  --------------------------------------lleeelleeelhhhhLLEEEEE
Query --------------------------------------drintvrgpitiseaGFTLTHE   22
ident                                                      ||   | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  LLEE------------------------lLLLHhHHLHhhhlLHHHHHHHHHHHHHHHHH
Query HICG------------------------sSAGFlRAWPeffgSRKALAEKAVRGLRRARA   58
ident |                                                           
Sbjct HMDKsftstgerlpkfwsrpytrdaaiedGLKY-YKNA----THEEIKRHVIEHAHMQVL  115
DSSP  LHHHllllllllllllllllllhhhhhhhHHHH-HHHL----LHHHHHHHHHHHHHHHHH


DSSP  LLLLEEEELLLHH---hllLHHHHHHHHHHH--LLEEELEEELLLL--LLHHhhlllhhh
Query AGVRTIVDVSTFD---igrDVSLLAEVSRAA--DVHIVAATGLWFD--PPLSmrlrsvee  111
ident  |          |       |    |          |             |         
Sbjct HGTLYTRTHVDVDsvaktkAVEAVLEAKEELkdLIDIQVVAFAQSGffVDLE--------  167
DSSP  LLEEEEEEEEELLlllllhHHHHHHHHHHHLllLLEEEEEEELLLLllLLLL--------


DSSP  hHHHHHHHHHlllllllLLLLEEEEELLLLLLHHHHHHHHHHHHHHHHHLLLEEEEL-LH
Query lTQFFLREIQygiedtgIRAGIIXVATTGKATPFQELVLKAAARASLATGVPVTTHT-AA  170
ident                                    |  |           |    |    
Sbjct sESLIRKSLD-------MGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIhDI  220
DSSP  hHHHHHHHHH-------HLLLEEELLLLLLLLLLHHHHHHHHHHHHHHLLLEEEEEElLL


DSSP  HH---LHHHHHHHHHHHLLLLhHHEEELLHHHLL-----LHHHHHHHHHL-LLEEEElLL
Query SQ---RDGEQQAAIFESEGLSpSRVCIGHSDDTD-----DLSYLTALAAR-GYLIGLdHI  221
ident            |      |    ||   |           |     |    |        
Sbjct GTvgvYSINRLAQKTIENGYK-GRVTTSHAWCFAdapseWLDEAIPLYKDsGMKFVT-CF  278
DSSP  HHhhhHHHHHHHHHHHHLLLL-LLEEEEELLHHHhllhhHHHHHHHHHHHhLLEEEE-EL


DSSP  LLllllllllhhhhhhhllllHHHHhhHHHHHHHLLLhhHEEELLLLLLEEllllllhhh
Query PYsaiglednasasallgirsWQTRalLIKALIDQGYmkQILVSNDWTFGFssyvtnimd  281
ident                        |       |   |         |    |         
Sbjct SS------------------tPPTM--PVIKLLEAGI--NLGCASDNIRDF---------  307
DSSP  LL------------------lLLLL--LHHHHHHLLL--EEEEELLLLLLL---------


DSSP  hhhhhLLLHHHhHHHLHHHHH--HHLL--lLHHHHHHHHLHHHHHHHL------------
Query vmdrvNPDGMAfIPLRVIPFL--REKG--vPQETLAGITVTNPARFLS------------  325
ident                         |                  || |             
Sbjct ---wvPFGNGD-MVQGALIETqrLELKtnrDLGLIWKMITSEGARVLGieknygievgkk  363
DSSP  ---llLLLLLL-HHHHHHHHHhhHLLLlhhHHHHHHHHHLHHHHHHHLlhhhllllllll


DSSP  -----------------------------------llll
Query -----------------------------------ptlr  329
ident                                        
Sbjct adlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  lleeeellllhhhhhhhllleeeeeelleeeeelleell


No 15: Query=2ob3A Sbjct=3cjpA Z-score=17.4

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhhhHHHHHHHHHHHHLL
Query drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkalaEKAVRGLRRARAAG   60
ident                     | |                                   ||
Sbjct ---------------LIIDGHTHVI---------------------LPVEKHIKIMDEAG   24
DSSP  ---------------LLEEEEEELL---------------------LLHHHHHHHHHHHL


DSSP  LLEEEELL----------------------------------lHHHLL--LHHHHHHHHh
Query VRTIVDVS----------------------------------tFDIGR--DVSLLAEVSr   84
ident |      |                                                    
Sbjct VDKTILFStsihpetavnlrdvkkemkklndvvngktnsmidvRRNSIkeLTNVIQAYP-   83
DSSP  LLEEEEELllllhhhlllhhhhhhhhhhhhhhhlllllllhhhHHHHHhhHHHHHHHLL-


DSSP  hhlLEEELEEELLLlllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEEE-EELLLLLl
Query aadVHIVAATGLWFdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGIIX-VATTGKAt  143
ident       |                |           |             |          
Sbjct ---SRYVGFGNVPV-------gLSENDTNSYIEENIVNN------KLVGIGeLTPASGQ-  126
DSSP  ---LLEEEEELLLL-------lLLHHHHHHHHHHHLLLL------LLLEEEeELLLLLL-


DSSP  hhHHHHhHHHHHHHH-HHLLLEEEELlHHHL---HHHHHHHHHHHLLLLhhHEEELLHhh
Query pfQELVlKAAARASL-ATGVPVTTHTaASQR---DGEQQAAIFESEGLSpsRVCIGHSdd  199
ident        |     |      |   |         |    |            |  ||   
Sbjct --IKSL-KPIFKYSMdSGSLPIWIHA-FNPLvlqDIKEIAELCKAFPKV--PVILGHM-g  179
DSSP  --HHHH-HHHHHHHHhLLLLLEEELL-LLLLlhhHHHHHHHHHHHLLLL--LEEEHHH-h


DSSP  LLLHHHHHHHHHLL--LEEEELLLllllllllllhhhhhhhllllhhHHHHHHHHHHHlL
Query TDDLSYLTALAARG--YLIGLDHIpysaiglednasasallgirswqTRALLIKALIDqG  257
ident          ||                                          |  |   
Sbjct GSNWMTAVELAKEIqnLYLDTSAY-----------------------FSTFVLKIVIN-E  215
DSSP  HHHHHHHHHHHHHLllEEEELLLL-----------------------LLHHHHHHHHH-H


DSSP  LHHHEEELLLLLleellllllhhhhhhhhlllHHHHHHhLHHHHHHhllLLHHHHHHHHL
Query YMKQILVSNDWTfgfssyvtnimdvmdrvnpdGMAFIPlRVIPFLRekgVPQETLAGITV  317
ident          |                               |                  
Sbjct LPLKCIFGTDMP------------------fgDLQLSI-EAIKKMS---NDSYVANAVLG  253
DSSP  LLLLEELLLLLL------------------llLHHHHH-HHHHHHL---LLHHHHHHHHL


DSSP  HHHHHHHLllll
Query TNPARFLSptlr  329
ident  |  | |     
Sbjct DNISRLLN---i  262
DSSP  HHHHHHHL---l


No 16: Query=2ob3A Sbjct=3ls9A Z-score=17.3

back to top
DSSP  ------------------------------------------lleeelleeelhhhhLLE
Query ------------------------------------------drintvrgpitiseaGFT   18
ident                                                          |  
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  EEEELLEE-------------------lLLLHHHHL--HHHHlLHHHHHHHHHHHHHHHH
Query LTHEHICG-------------------sSAGFLRAW--PEFFgSRKALAEKAVRGLRRAR   57
ident   | |                              |     |       | |   |    
Sbjct NSHQHLYEgamraipqlervtmaswlegVLTRSAGWwrDGKF-GPDVIREVARAVLLESL  119
DSSP  EEEELHHHhhhlllhhhllllhhhhhhhHHHHHHHHhhLLLL-LHHHHHHHHHHHHHHHH


DSSP  HLLLLEEEELLL----hhhllLHHHHHHHHHHHLLEEELEEELLL-------LLLHHhhl
Query AAGVRTIVDVST----fdigrDVSLLAEVSRAADVHIVAATGLWF-------DPPLSmrl  106
ident   |  |  |                  |          ||                    
Sbjct LGGITTVADQHLffpgatadsYIDATIEAATDLGIRFHAARSSMTlgkseggFCDDL-fv  178
DSSP  HLLEEEEEEEELlllllllllHHHHHHHHHHHHLLEEEEEELLLLllhhhllLLLHH-hl


DSSP  LLHHHHHHHHHHHHHllllllLLLL--------LEEE-EELLllllhhHHHHHHHHHHHH
Query RSVEELTQFFLREIQygiedtGIRA--------GIIX-VATTgkatpfQELVLKAAARAS  157
ident   |    |  |  |                                        | |   
Sbjct EPVDRVVQHCLGLID------QYHEpepfgmvrIALGpCGVP----ydKPELFEAFAQMA  228
DSSP  LLHHHHHHHHHHHHH------HHLLlllllleeEEELlLLLL----llLHHHHHHHHHHH


DSSP  HHHLLLEEEELLHHH-----------LHHHHHHHHHhhllLLHHHEEELLHhHLLLHHHH
Query LATGVPVTTHTAASQ-----------RDGEQQAAIFesegLSPSRVCIGHSdDTDDLSYL  206
ident     |   ||                                  ||   |          
Sbjct ADYDVRLHTHFYEPLdagmsdhlygmTPWRFLEKHG----WASDRVWLAHA-VVPPREEI  283
DSSP  HHHLLEEEEEELLLLhhhhhhhhhllLHHHHHHHLL----LLLLLEEEEEL-LLLLHHHH


DSSP  HHHHHLLLEEEELLLLLLlllllllhhhhhhHLLLLhhhhHHHHHHHHHLLLhhHEEELL
Query TALAARGYLIGLDHIPYSaiglednasasalLGIRSwqtrALLIKALIDQGYmkQILVSN  266
ident    |  |  |     |                           |    | |         
Sbjct PEFADAGVAIAHLIAPDL-------------RMGWG----LAPIREYLDAGI--TVGFGT  324
DSSP  HHHHHHLLEEEELHHHHH-------------HLLLL----LLLHHHHHHLLL--EEEELL


DSSP  LLLleellllllhhhhhhhhllLHHHhHHHLHHHHHHHL----------LLLHHHHHHHH
Query DWTfgfssyvtnimdvmdrvnpDGMAfIPLRVIPFLREK----------GVPQETLAGIT  316
ident                       ||                               |    
Sbjct TGS----------------asnDGGN-LLGDLRLAALAHrpadpnepekWLSARELLRMA  367
DSSP  LLL----------------lllLLLL-HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHL


DSSP  LHHHHHHHL---------------------------------------------------
Query VTNPARFLS---------------------------------------------------  325
ident     |  |                                                    
Sbjct TRGSAECLGrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvng  427
DSSP  LHHHHHHLLlllllllllllllleeeeelllhhhlllllhhhhhhhlllllllleeeell


DSSP  ----------------------llll
Query ----------------------ptlr  329
ident                           
Sbjct qvlvenerpvladlerivanttalip  453
DSSP  eeeeelleellllhhhhhhhhhhhll


No 17: Query=2ob3A Sbjct=2qpxA Z-score=17.0

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhHLLH------------------
Query drintvrgpitiseaGFTLTHEHICgssagflrawpefFGSR------------------   42
ident                     | |                  |                  
Sbjct ---gxddlsefvdqvPLLDHHCHFL---------idgkVPNRddrlaqvsteadkdypla   48
DSSP  ---lllllhhhhhhlLEEEEEELLL---------llllLLLHhhhhhhhlllllllllhh


DSSP  ----------------------------hhhhhHHHHHHHHHHHLLLLEEEELLlhHHLL
Query ----------------------------kalaeKAVRGLRRARAAGVRTIVDVStfDIGR   74
ident                                   |    |                    
Sbjct dtknrlayhgflalakefaldannplaaxndpgYATYNHRIFGHFHFKELLIDT--GFVP  106
DSSP  hhlllhhhhhhhhhhhhhllllllllllllhhhHHHHHHHHHHHLLEEEEEEEL--LLLL


DSSP  --lhHHHHHHHHHHLLEEELEEELLL-lLLHH----hhllLHHHHHHHHHHHHHLlllll
Query --dvSLLAEVSRAADVHIVAATGLWF-dPPLS----mrlrSVEELTQFFLREIQYgiedt  127
ident       |            |   |                                    
Sbjct ddpiLDLDQTAELVGIPVKAIYRLEThaEDFXlehdnfaaWWQAFSNDVKQAKAH-----  161
DSSP  llllLLHHHHHHHHLLLEEEEEEHHHhhHHHHlllllhhhHHHHHHHHHHLLLLL-----


DSSP  llLLLEEEEEL-LLLL----------------------------LHHHHHHHHHHHHHHH
Query giRAGIIXVAT-TGKA----------------------------TPFQELVLKAAARASL  158
ident        |                                     |     |   |    
Sbjct --GFVGFXSIAaYRVGlhlepvnvieaaagfdtwkhsgekrltsKPLIDYXLYHVAPFII  219
DSSP  --LLLLEEELHhHHLLlllllllhhhhhhhhhhhhhhlllllllHHHHHHHHHHHHHHHH


DSSP  HHLLLEEEELLH-------HHLHHHHhHHHHHHLLLL-hhHEEELLHhhLLLHHHHHHHH
Query ATGVPVTTHTAA-------SQRDGEQqAAIFESEGLS-psRVCIGHSddTDDLSYLTALA  210
ident |   |   |                                |   |            ||
Sbjct AQDXPLQFHVGYgdadtdxYLGNPLL-XRDYLKAFTKkglKVVLLHC--YPYHREAGYLA  276
DSSP  HHLLLEEEEELLllllllhHHLLHHH-HHHHHHHHHHhllLEEEEEL--LLLHHHHHHHH


DSSP  HLL--LEEEELL-LLLLlllllllhhhhhhhllllHHHHHHHHHHHHHLLLHHHEEELLL
Query ARG--YLIGLDH-IPYSaiglednasasallgirsWQTRALLIKALIDQGYMKQILVSND  267
ident                                                       ||   |
Sbjct SVFpnLYFDISLlDNLG------------------PSGASRVFNEAVELAPYTRILFASD  318
DSSP  HHLllEEEELLLhHHHL------------------HHHHHHHHHHHLLLLLHHHEELLLL


DSSP  LLLEellllllhhhhhhhhllLHHHHHHHLHHHHHHHLL---------lLHHHHHHHHLH
Query WTFGfssyvtnimdvmdrvnpDGMAFIPLRVIPFLREKG---------vPQETLAGITVT  318
ident                                   |                     |   
Sbjct ASTY----------------pEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQ  362
DSSP  LLLL----------------hHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLH


DSSP  HHHHHHL---llll
Query NPARFLS---ptlr  329
ident   |           
Sbjct TSAKLYHqerelrv  376
DSSP  HHHHHLLlhhhhll


No 18: Query=2ob3A Sbjct=2pajA Z-score=17.0

back to top
DSSP  ----------------------------------------------lleeelleeelhhh
Query ----------------------------------------------drintvrgpitise   14
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  hLLEEEEELLE------elllLHHHhlhhhhllHHHHHHHHHHHHHHHHHLLLLEEEELL
Query aGFTLTHEHIC------gssaGFLRawpeffgsRKALAEKAVRGLRRARAAGVRTIVDVS   68
ident      || |                               |  ||      |  |  |  
Sbjct pAWVNTHHHLFqsllkgepfrALFD--------ERRFRLAARIGLIELARSGCATVADHN  112
DSSP  eLEELLLLLHHhhhllllllhHHLL--------HHHHHHHHHHHHHHHHLLLEEEEEELL


DSSP  LHH----hllLHHHHHHHHHHHLLEEELEEELlLLLL-----------HHHHlllhHHHH
Query TFD----igrDVSLLAEVSRAADVHIVAATGLwFDPP-----------LSMRlrsvEELT  113
ident               | |         |   |                             
Sbjct YVYypgmpfdSSAILFEEAEKLGLRFVLLRGG-ATQTrqleadlptalRPET---lDAYV  168
DSSP  LLLlllllllHHHHHHHHHHHLLLEEEEEELL-LLLLllllllllhhhLLLL---hHHHH


DSSP  HHHHHHHHllllllLLLL--------LEEEE-ELLLlllhHHHHHHHHHHHHHHHHLLLE
Query QFFLREIQygiedtGIRA--------GIIXV-ATTGkatpFQELVLKAAARASLATGVPV  164
ident     |                                            |      |   
Sbjct ADIERLAA------RYHDaspramrrVVMAPtTVLY---sISPREMRETAAVARRLGLRM  219
DSSP  HHHHHHHH------HLLLlllllleeEEELLlLLLL---lLLHHHHHHHHHHHHHLLLEE


DSSP  EEELLhhhLHHHHHHHHHhhllllHHHEEELLHhHLLLHHHHHHHHHLLLEEEELLLLLL
Query TTHTAasqRDGEQQAAIFeseglsPSRVCIGHSdDTDDLSYLTALAARGYLIGLDHIPYS  224
ident   |                      | |   |     |      ||  |           
Sbjct HSHLS-gkSPVAFCGEHD----wlGSDVWYAHL-VKVDADEIALLAQTGTGVAHCPQSNG  273
DSSP  EEELL-llLHHHHHHHLL----llLLLEEEELL-LLLLHHHHHHHHHHLLEEEELHHHHH


DSSP  LllllllhhhhhhhllllhhhhhhHHHHHHHLLLhhHEEELLLLLleellllllhhhhhh
Query AiglednasasallgirswqtralLIKALIDQGYmkQILVSNDWTfgfssyvtnimdvmd  284
ident                               | |         |                 
Sbjct R----------------------lPVREMADAGV--PVSIGVDGA---------------  294
DSSP  L----------------------lLLLLHHHHLL--LEEELLLHH---------------


DSSP  hhLLLHHH-HHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHL------------------
Query rvNPDGMA-FIPLRVIPFLREKGVPQETLAGITVTNPARFLS------------------  325
ident   |                |                 ||                     
Sbjct asNEAADMiSEVHMTWLAQRARLASIAEVIHWGTAGGARVMGldevgkvavgyaadiavy  354
DSSP  hhLLLLLHhHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct rlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvre  414
DSSP  elllhhhlllllhhhhhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhh


DSSP  ---llll
Query ---ptlr  329
ident        
Sbjct llrevvv  421
DSSP  hhhhhhl


No 19: Query=2ob3A Sbjct=2oofA Z-score=16.8

back to top
DSSP  -----------------------------------------------lleeelleeelhh
Query -----------------------------------------------drintvrgpitis   13
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  hhLLEEEEELLEEL----------------------------LLLHHHHLHhhhllHHHH
Query eaGFTLTHEHICGS----------------------------SAGFLRAWPeffgsRKAL   45
ident   |    | |                                     ||          |
Sbjct tpGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiisTVRATRAAS-----EDQL  115
DSSP  eeLEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhHHHHHHHLL-----HHHH


DSSP  HHHHHHHHHHHHHLLLLEEEELLLHH-----hllLHHHHHHHHHHHLLEEELEEE-LLLL
Query AEKAVRGLRRARAAGVRTIVDVSTFD-----igrDVSLLAEVSRAADVHIVAATG-LWFD   99
ident  | |          || |    |                     |               
Sbjct FELALPRVKSLIREGVTTVEIKSGYGltledelkXLRVARRLGEALPIRVKTTLLaAHAV  175
DSSP  HHHHHHHHHHHHHHLEEEEEEELLLLllhhhhhhHHHHHHHHHHHLLLEEEEEEEeELLL


DSSP  LLHH--hHLLLHHHHH-HHHHHHHHLLllllllLLLEEEEELLLLLlhhHHHHHHHHHHH
Query PPLS--mRLRSVEELT-QFFLREIQYGiedtgiRAGIIXVATTGKAtpfQELVLKAAARA  156
ident ||         ||             |       |    |                   |
Sbjct PPEYrddPDSWVETICqEIIPAAAEAG------LADAVDVFCEHIG--fSLAQTEQVYLA  227
DSSP  LHHHlllHHHHHHHHHhLHHHHHHHLL------LLLEEEEEELLLL--lLHHHHHHHHHH


DSSP  HHHHLLLEEEELLH--HHLHHHHHHHhhhhllllHHHEEELLHhHLLLHHHHHHHHHLLL
Query SLATGVPVTTHTAA--SQRDGEQQAAifeseglsPSRVCIGHSdDTDDLSYLTALAARGY  214
ident     |  |  |             |                |     |     ||| || 
Sbjct ADQYGLAVKGHXDQlsNLGGSTLAAN--------FGALSVDHL-EYLDPEGIQALAHRGV  278
DSSP  HHHLLLEEEEEELLllLLLHHHHHHH--------LLLLEEEEL-LLLLHHHHHHHHHHLL


DSSP  EEEELlLLLLlllllllhhhhhhHLLLLhhhhhHHHHHHHHLLLhhHEEELLLLLleell
Query LIGLDhIPYSaiglednasasalLGIRSwqtraLLIKALIDQGYmkQILVSNDWTfgfss  274
ident    |                                 ||   |      || |       
Sbjct VATLL-PTAF------------yFLKET---klPPVVALRKAGV--PXAVSSDIN-----  315
DSSP  EEEEL-HHHH------------hHLLLL---llLLHHHHHHLLL--LEEELLLLL-----


DSSP  llllhhhhhhhhllLHHH-HHHHLHHHHHhhllLLHHHHHHHHLHHHHHHHL--------
Query yvtnimdvmdrvnpDGMA-FIPLRVIPFLrekgVPQETLAGITVTNPARFLS--------  325
ident                                                || |         
Sbjct ---------pgtapIVSLrXAXNXACTLF---gLTPVEAXAGVTRHAARALGeqeqlgql  363
DSSP  ---------lllllLLLHhHHHHHHHHHH---lLLHHHHHHHLLHHHHHHLLllllllll


DSSP  ------------------------------------llll
Query ------------------------------------ptlr  329
ident                                         
Sbjct rvgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
DSSP  llllllleeeellllllhhhhlllllleeeeeelleelll


No 20: Query=2ob3A Sbjct=4dlfA Z-score=16.7

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlHHHH--------llhhHHHHhHHHH
Query drintvrgpitiseaGFTLTHEHICgssagflrawPEFF--------gsrkALAEkAVRG   52
ident                     | |                                     
Sbjct --------------aLRIDSHQHFW--------ryRAADypwigagmgvlaRDYL-PDAL   37
DSSP  --------------lLLEEEEELLL--------llLHHHllllllllhhhlLLLL-HHHH


DSSP  HHHHHHLLLLEEEELL--lHHHL--LLHHHHHHHHhhhlLEEELEEELlllllhhhhlll
Query LRRARAAGVRTIVDVS--tFDIG--RDVSLLAEVSraadVHIVAATGLwfdpplsmrlrs  108
ident      |        |              |                              
Sbjct HPLMHAQALGASIAVQaraGRDEtaFLLELACDEA----RIAAVVGWE---------dlr   84
DSSP  HHHHHHLLLLEEEEELlllLHHHhhHHHHHHLLLL----LEEEEEELL---------lll


DSSP  HHHHHHHHhhhhHLLLlllLLLLLEEEEELL----LLLLhhHHHHHHHhHHHHHHHLLLE
Query VEELTQFFlreiQYGIedtGIRAGIIXVATT----GKATpfQELVLKAaARASLATGVPV  164
ident    |               |                 |                |     
Sbjct APQLAERV----AEWR---GTKLRGFRHQLQdeadVRAFvdDADFARG-VAWLQANDYVY  136
DSSP  LLLHHHHH----HLLL---LLLEEEEEELHHhlllHHHHhhLHHHHHH-HHHHHHLLLEE


DSSP  EEELLHHHL-HHHHHHHHHhhllLLHHhEEELLHHHLL-------------LHHHHHHHH
Query TTHTAASQR-DGEQQAAIFesegLSPSrVCIGHSDDTD-------------DLSYLTALA  210
ident        |  |     |               |                      |  ||
Sbjct DVLVFERQLpDVQAFCARH----DAHW-LVLDHAGKPAlaefdrddtalarWRAALRELA  191
DSSP  EELLLHHHHhHHHHHHHHL----LLLL-EEEHHHHLLLhhhllllllhhhhHHHHHHHHH


DSSP  HLL-LEEEELLLLL-LLLLLLllhhhhhhhllLLHHHHHHHHHHHHHLLLHHHEEELLLL
Query ARG-YLIGLDHIPY-SAIGLEdnasasallgiRSWQTRALLIKALIDQGYMKQILVSNDW  268
ident |       |                                  |  |           ||
Sbjct ALPhVVCKLSGLVTeADWRRG--------lraSDLRHIEQCLDAALDAFGPQRLMFGSDW  243
DSSP  LLLlEEEEELLLLLlLLLLLL--------llhHHHHHHHHHHHHHHHHHLHHHEEELLLL


DSSP  LleellllllhhhhhHHHLLLhhHHHHHLHHHHHHHLlLLHHHHHHHHLHHHHHHHLlll
Query TfgfssyvtnimdvmDRVNPDgmAFIPLRVIPFLREKgVPQETLAGITVTNPARFLSptl  328
ident                              |                      ||      
Sbjct P------------vcLLAASY--DEVASLVERWAESR-LSAAERSALWGGTAARCYA--l  286
DSSP  L------------hhHHLLLH--HHHHHHHHHHHHHH-LLHHHHHHHLLHHHHHHLL--l


DSSP  l
Query r  329
ident  
Sbjct p  287
DSSP  l


No 21: Query=2ob3A Sbjct=3gg7A Z-score=16.7

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEEllllhhhhlhhhhllhhhhhHHHHHHHHHHHHLL
Query drintvrgpitiseaGFTLTHEHICGssagflrawpeffgsrkalaEKAVRGLRRARAAG   60
ident                     | |                          |   |      
Sbjct ---------------SLIDFHVHLDL-------------------yPDPVAVARACEERQ   26
DSSP  ---------------LLEEEEELHHH-------------------lLLHHHHHHHHHHLL


DSSP  LlEEEELLLHHHLL-LHHHHHHHHhhhlLEEELEEELL-LLLLhHHHLllhhhhhHHHHH
Query VrTIVDVSTFDIGR-DVSLLAEVSraadVHIVAATGLW-FDPPlSMRLrsveeltQFFLR  118
ident   |   | |          ||        |   | |                     | |
Sbjct L-TVLSVTTTPAAWrGTLALAAGR----PHVWTALGFHpEVVS-ERAA-----dlPWFDR   75
DSSP  L-EEEELLLLHHHHhHHHHHHLLL----LLEEELLLLLhHHLL-LLHH-----hlHHHHH


DSSP  HHHllllllllLLLEEE-EELLLL-----lLHHHHHHHHHHHHHHHHH-LLLEEEELLhh
Query EIQygiedtgiRAGIIX-VATTGK-----aTPFQELVLKAAARASLAT-GVPVTTHTAas  171
ident                   |   |          |  |     |      |     |    
Sbjct YLP--------ETRFVGeVGLDGSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR--  125
DSSP  HHH--------HLLEEEeEELLLLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL--


DSSP  hLHHHHHHHHHHHLLLlhhHEEELLHhHLLLhHHHHHHHHLLLEEEeLLLLlllllllll
Query qRDGEQQAAIFESEGLspsRVCIGHSdDTDDlSYLTALAARGYLIGlDHIPysaigledn  231
ident  |         |                      |      |                  
Sbjct -RAESEVLNCLEANPR-sgTPILHWY-SGSV-TELRRAISLGCWFS-VGPT---------  171
DSSP  -LLHHHHHHHHHHLHH-heEEEEELL-LLLH-HHHHHHHHLLLEEE-ELHH---------


DSSP  hhhhhhhlllLHHHHHHHHHHHhhllLHHHEEELLLLLleellllllhhhhHHHHLllHH
Query asasallgirSWQTRALLIKALidqgYMKQILVSNDWTfgfssyvtnimdvMDRVNpdGM  291
ident             |  | ||            |   |                |       
Sbjct --------mvRTQKGAALIRSM----PRDRVLTETDGP----------fleLDGQA-aLP  208
DSSP  --------hhLLHHHHHHHHHL----LHHHEEELLLLL----------lleELLEE-lLH


DSSP  HHHHhLHHHHHHH-LLLL-HHHHHHHhLHHHHHHHLLlll
Query AFIPlRVIPFLRE-KGVP-QETLAGItVTNPARFLSPtlr  329
ident       |   |      |  |        |  | |     
Sbjct WDVK-SVVEGLSKiWQIPaSEVERIV-KENVSRLLGT---  243
DSSP  HHHH-HHHHHHHHhHLLLhHHHHHHH-HHHHHHHHHL---


No 22: Query=2ob3A Sbjct=3irsA Z-score=16.6

back to top
DSSP  lleeelleeelhhhhLLEEEEELLE---ELLLlhhhhlhHHHL-------------lhhh
Query drintvrgpitiseaGFTLTHEHIC---GSSAgflrawpEFFG-------------srka   44
ident                                |                            
Sbjct --------------lKIIDFRLRPPamgFLNA----riyTRPDirnrftrqlgfepapsa   42
DSSP  --------------lLLEELLLLLLlhhHHHL----hhhHLHHhhhhhhhhhlllllhhh


DSSP  HHHHHHHHHHHHHHLLLLEEEELLLH-----HHLL--LHHHHHHHHhhhlLEEELEEELl
Query LAEKAVRGLRRARAAGVRTIVDVSTF-----DIGR--DVSLLAEVSraadVHIVAATGLw   97
ident              |||    | |                                     
Sbjct EEKSLELMFEEMAAAGIEQGVCVGRNssvlgSVSNadVAAVAKAYP----DKFHPVGSI-   97
DSSP  HHLLHHHHHHHHHHLLLLEEEEELLEellleELLHhhHHHHHHHLL----LLEEEEEEL-


DSSP  llllhhhhlLLHHHHHHHHHHHHHlllllllLLLLEEEEELL---llllhhHHHHhHHHH
Query fdpplsmrlRSVEELTQFFLREIQygiedtgIRAGIIXVATT---gkatpfQELVlKAAA  154
ident              |                     |                        
Sbjct -------eaATRKEAMAQMQEILD-------LGIRIVNLEPGvwatpmhvdDRRL-YPLY  142
DSSP  -------llLLHHHHHHHHHHHHH-------LLLLLEEELHHhllllllllLHHH-HHHH


DSSP  HHHHHHLLLEEEELLH-----HHLH-HHHHHHHHHHLLLLhhHEEELLHHHLlLHHHHHH
Query RASLATGVPVTTHTAA-----SQRD-GEQQAAIFESEGLSpsRVCIGHSDDTdDLSYLTA  208
ident       | ||   |             |               |   |            
Sbjct AFCEDNGIPVIMMTGGnagpdITYTnPEHIDRVLGDFPDL--TVVSSHGNWP-WVQEIIH  199
DSSP  HHHHHLLLLEEEELLLlllllHHHHlHHHHHHHHHHLLLL--LEEEEHHHLL-LHHHHHH


DSSP  HHHLL--LEEEELLLllllllllllhhhhhhhllllHHHH-HHHHHHHHHLLLHHHEEEL
Query LAARG--YLIGLDHIpysaiglednasasallgirsWQTR-ALLIKALIDQGYMKQILVS  265
ident  | |        |                                            |  
Sbjct VAFRRpnLYLSPDMY--------------------lYNLPgHADFIQAANSFLADRMLFG  239
DSSP  HHHHLllEEEELHHH--------------------hLLLLlHHHHHHHHLLHHHHLLLLL


DSSP  LLLLleellllllhhhhhhhhlllHHHHHHHLHHHHHhhllLLHHHHHHHHLHHHHHHH-
Query NDWTfgfssyvtnimdvmdrvnpdGMAFIPLRVIPFLrekgVPQETLAGITVTNPARFL-  324
ident                                                  |   |  | | 
Sbjct TAYP------------------mcPLKEYTEWFLTLP----IKPDAMEKILHGNAERLLa  277
DSSP  LLLL------------------llLHHHHHHHHHLLL----LLHHHHHHHHLHHHHHHHh


DSSP  LLLLl
Query SPTLr  329
ident      
Sbjct QAGR-  281
DSSP  HLLL-


No 23: Query=2ob3A Sbjct=2ffiA Z-score=16.6

back to top
DSSP  lleeelleeelhhHHLLEEEEELLEellllHHHHLHHHhllhhHHHHhHHHHHHHHHHLL
Query drintvrgpitisEAGFTLTHEHICgssagFLRAWPEFfgsrkALAEkAVRGLRRARAAG   60
ident                     | |          |           |      |   || |
Sbjct ------------lHLTAIDSHAHVF--srgLNLASQRR-yapnYDAP-LGDYLGQLRAHG   44
DSSP  ------------lLLLLEELLLLLL--lhhHHHHLLLL-llllLLLL-HHHHHHHHHHLL


DSSP  LLEEEELL--lHHHLL-LHHHHHHHHHhhllEEELEEELlllllhhhhlllhhhHHHHhH
Query VRTIVDVS--tFDIGR-DVSLLAEVSRaadvHIVAATGLwfdpplsmrlrsveeLTQFfL  117
ident     | |                               |                     
Sbjct FSHGVLVQpsfLGTDNrYLLSALQTVP---gQLRGVVXL--------------eRDVE-Q   86
DSSP  LLEELLLLlhhHLLLLhHHHHHHHHLL---lLLLLLLLL--------------lLLLL-H


DSSP  HHHHLLllllLLLLLEEEEELL-LLLLhHHHH-hhHHHHHHHHHHLLLEEEELLHhhLHH
Query REIQYGiedtGIRAGIIXVATT-GKATpFQEL-vlKAAARASLATGVPVTTHTAAsqRDG  175
ident                                              |  |  |      | 
Sbjct ATLAEX---aRLGVRGVRLNLXgQDXP-DLTGaqwRPLLERIGEQGWHVELHRQV--ADI  140
DSSP  HHHHHH---hLLLLLEEELLLLlLLLL-LLLLlllHHHHHHHHHHLLEEEELLLL--LLH


DSSP  HHHHHHHHhLLLLhhHEEELLHHHLL--------LHHHHHHH-hhLLLEEEELLLLllll
Query EQQAAIFEsEGLSpsRVCIGHSDDTD--------DLSYLTAL-aaRGYLIGLDHIPysai  226
ident                   | |    |            |  |            |     
Sbjct PVLVRALQ-PYGL--DIVIDHFGRPDarrglgqpGFAELLTLsgrGKVWVKVSGIY----  193
DSSP  HHHHHHHL-LLLL--LEEELHHHLLLllllllllLHHHHLLLlllLLEEEEEELHH----


DSSP  lllllhhhhhHHLL---LLHHHHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhHH
Query glednasasaLLGI---RSWQTRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdVM  283
ident            |                ||             ||               
Sbjct ----------RLQGspeENLAFARQALCALEAHYGAERLXWGSDWP----------htQH  233
DSSP  ----------HLLLlhhHHHHHHHHHHHHHHHHLLHHHEEEELLLL----------llLL


DSSP  HHHLllHHHHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHHLllll
Query DRVNpdGMAFIPlRVIPFLRekgVPQETLAGITVTNPARFLSptlr  329
ident                   |                           
Sbjct ESEV--SFGSAV-EQFEALG---CSAQLRQALLLDTARALFGfele  273
DSSP  LLLL--LHHHHH-HHHHHHL---LLHHHHHHHHLHHHHHHLLllll


No 24: Query=2ob3A Sbjct=4mupB Z-score=16.6

back to top
DSSP  -lleeelleeelhhhhLLEEEEELLEelllLHHHhlhhhhllhHHHHhHHHHHHHHHHHL
Query -drintvrgpitiseaGFTLTHEHICgssaGFLRawpeffgsrKALAeKAVRGLRRARAA   59
ident                 |   |  |                    ||        |     
Sbjct lvrklsgtapnpafprGAVDTQMHMY-lpgYPAL-pggpglppGALP-GPEDYRRLMQWL   57
DSSP  llllllllllllllllLLEELLLLLL-lllLLLL-llllllllLLLL-LHHHHHHHHHHH


DSSP  LLLEEEELL----lHHHLLLHHHHHHHHhhhllEEELEEELlllllhhhhlllhhhHHHH
Query GVRTIVDVS----tFDIGRDVSLLAEVSraadvHIVAATGLwfdpplsmrlrsveeLTQF  115
ident |              | |      ||          |                       
Sbjct GIDRVIITQgnahqRDNGNTLACVAEMG----eAAHAVVII---------------DATT   98
DSSP  LLLEEEEELlhhhlLLLHHHHHHHHHHH----hHEEEEELL---------------LLLL


DSSP  hHHHHHLLllllLLLLLEEEEELLllllhhHHHHHHHHHHHHHHHLLLEEEELLHHHL-h
Query fLREIQYGiedtGIRAGIIXVATTgkatpfQELVLKAAARASLATGVPVTTHTAASQR-d  174
ident                                   | |      |    |           
Sbjct tEKDMEKL---tAAGTVGARIMDL-pggavNLSELDAVDERAHAADWMVAVQFDGNGLld  154
DSSP  lHHHHHHH---hHLLEEEEEEELL-lllllLHHHHHHHHHHHHHLLLEEEEELLHHHHhh


DSSP  hHHHHHHHHhllllhhHEEELLHHHL--------lLHHHHHHHHHLL-LEEEELLLLLll
Query gEQQAAIFEseglspsRVCIGHSDDT--------dDLSYLTALAARG-YLIGLDHIPYsa  225
ident                 |    |                 |  |  ||             
Sbjct hLPRLQKIR------sRWVFDHHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAGVYE--  206
DSSP  hHHHHHLLL------lEEEELHHHHLllllllllhHHHHHHHHHHHLlEEEEELLHHH--


DSSP  llllllhhhhhhHLLL--LHHHHHHHHHHHHHlLLHHHEEELLLLLleellllllHHHHh
Query iglednasasalLGIR--SWQTRALLIKALIDqGYMKQILVSNDWTfgfssyvtnIMDVm  283
ident                        |              |     |               
Sbjct ------------SSRKswPYADVAAFSRVIAA-HAPERIVWGTNWP-------hnSVREt  246
DSSP  ------------LLLLllLLHHHHHHHHHHHH-HLHHHEEELLLLL-------llLLLLh


DSSP  hHHLLLhhHHHHhLHHHHHhhllLLHHHHHHHHLHHHHHHHLllll
Query dRVNPDgmAFIPlRVIPFLrekgVPQETLAGITVTNPARFLSptlr  329
ident      |            |              | ||         
Sbjct aAYPDD-aRLAE-LTLGWL----PDEAARHRALVENPEALFKlspv  286
DSSP  hHLLLH-hHHHH-HHHLLL----LLHHHHHHHHLHHHHHHHLllll


No 25: Query=2ob3A Sbjct=3griA Z-score=16.3

back to top
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL
Query -------------------------------------drintvrgpitiseaGFTLTHEH   23
ident                                                     ||   | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  LEellllhhhhlhhhhllhhHHHHHH-HHHHHHHHHLLLLEEEELLLhHHLL--------
Query ICgssagflrawpeffgsrkALAEKA-VRGLRRARAAGVRTIVDVSTfDIGR--------   74
ident                              |   |   |  |                   
Sbjct LR---------------epgGEYKETiETGTKAAARGGFTTVCPXPNtRPVPdsvehfea  105
DSSP  LL---------------lllLLLLLLhHHHHHHHHHLLEEEEEELLLlLLLLllhhhhhh


DSSP  LHHHHHHHHhhhLLEEELEEEL--lLLLLhhhhlllhhhHHHHHHHHHHlllllllLLLL
Query DVSLLAEVSraaDVHIVAATGL--wFDPPlsmrlrsveeLTQFFLREIQygiedtgIRAG  132
ident    |         |                             |              | 
Sbjct LQKLIDDNA---QVRVLPYASIttrQLGK----------ELVDFPALVK-------EGAF  145
DSSP  HHHHHHHHL---LLEELLLEELlhhHLLL----------LLLLHHHHHL-------LLLL


DSSP  EEEEEllllllhHHHHHHHHHHHHHHHHLLLEEEELL-----------------------
Query IIXVAttgkatpFQELVLKAAARASLATGVPVTTHTA-----------------------  169
ident                                   |                         
Sbjct AFTDD---gvgvQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipg  202
DSSP  LEEEL---llllLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllle


DSSP  ----hHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEElLLL
Query ----aSQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLdHIP  222
ident                  |  |         |   |                         
Sbjct ipnicESVQIARDVLLAEAAGC---HYHVCHV-STKEsVRVIRDAKRagIHVTAEV-TPH  257
DSSP  ellhhHHHHHHHHHHHHHHHLL---LEEELLL-LLHHhHHHHHHHHHllLLEEEEE-LHH


DSSP  L---LLLLLLLLHHHHHH--HLLLL--HHHHHHHHHHHhhlllhhHEEELLLLLLE----
Query Y---SAIGLEDNASASAL--LGIRS--WQTRALLIKALidqgymkQILVSNDWTFG----  271
ident            |                                       |        
Sbjct HlllTEDDIPGNNAIYKXnpPLRSTedREALLEGLLDG------tIDCIATDHAPHarde  311
DSSP  HhhlLHHHLLLLLHHHLLllLLLLHhhHHHHHHHHHLL------lLLEELLLLLLLlhhh


DSSP  -elllLLLHHhhhhhhlllHHHHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL----
Query -fssyVTNIMdvmdrvnpdGMAFIPLRVIPFLR-EKGVPQETLAGITVTNPARFLS----  325
ident                    |                      |       |         
Sbjct kaqpxEKAPF------givGSETAFPLLYTHFVkNGDWTLQQLVDYLTIKPCETFNleyg  365
DSSP  hllllLLLLL------lllLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLllll


DSSP  -----------------------------------------------------llll
Query -----------------------------------------------------ptlr  329
ident                                                          
Sbjct tlkengyadltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  llllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel


No 26: Query=2ob3A Sbjct=3nqbA Z-score=16.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ---lleeelleeelhhhhLLEEEEELLEEllllhhhhlhhhhllhhhhhhHHHHHHHHHH
Query ---drintvrgpitiseaGFTLTHEHICGssagflrawpeffgsrkalaeKAVRGLRRAR   57
ident                   |   || ||                                 
Sbjct srrdaaqvidaggayvspGLIDTHXHIES------------------sxiTPAAYAAAVV  102
DSSP  lllleeeeeelllleeeeLEEEEEELHHH------------------hllLHHHHHHHHH


DSSP  HLLLLEEEELLlhHHLL------LHHHHHHHHHHHLLEEELEE-ELLLLLLHHhhlllhh
Query AAGVRTIVDVStfDIGR------DVSLLAEVSRAADVHIVAAT-GLWFDPPLSmrlrsve  110
ident | || |||                |   |                     |         
Sbjct ARGVTTIVWDP--HEFGnvhgvdGVRWAAKAIENLPLRAILLApSCVPSAPGL-erggad  159
DSSP  LLLEEEEEELL--HHHHhhhlhhHHHHHHHHHLLLLLEEEEEElLLLLLLLLL-llllll


DSSP  hHHHHHHHHHHLllllllLLLLEEE-EELLL-lLLHHhhHHHHHHHHHHHHHLLLEEEEL
Query eLTQFFLREIQYgiedtgIRAGIIX-VATTG-kATPFqeLVLKAAARASLATGVPVTTHT  168
ident                      | |                       | ||    |  | 
Sbjct fDAAILADLLSW------PEIGGIAeIXNXRgvIERD--PRXSGIVQAGLAAEKLVCGHA  211
DSSP  lLHHHHHHHHLL------LLEEEEEeELLHHhhHLLL--HHHHHHHHHHHHHLLEEEELL


DSSP  lHHHL--HHHHHHHHHhhllllhhhEEELLHhhLLLHhHHHHHHHLLLEEEElLLLLlll
Query aASQR--DGEQQAAIFeseglspsrVCIGHSddTDDLsYLTALAARGYLIGLdHIPYsai  226
ident        |     |                         | |    |  | |        
Sbjct -RGLKnaDLNAFXAAG--------vSSDHEL--VSGE-DLXAKLRAGLTIEL-RGSH---  255
DSSP  -LLLLhhHHHHHHHLL--------lLEELLL--LLHH-HHHHHHHLLLEEEE-ELLL---


DSSP  lllllhhhhhhhllllhHHHHHHHHHHHHLL--LHHHEEELLLLlleellllllhhhhHH
Query glednasasallgirswQTRALLIKALIDQG--YMKQILVSNDWtfgfssyvtnimdvMD  284
ident                          |                |                 
Sbjct -----------------DHLLPEFVAALNTLghLPQTVTLCTDD-------------vFP  285
DSSP  -----------------HHHHHHHHHHHHHHllLLLLEEEELLL-------------lLH


DSSP  HHLLLhhHHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL-------------------
Query RVNPDgmAFIPlRVIPFLREKGVPQETLAGITVTNPARFLS-------------------  325
ident              |   |   |   |        | |  |                    
Sbjct DDLLQ-gGGLD-DVVRRLVRYGLKPEWALRAATLNAAQRLGrsdlgliaagrradivvfe  343
DSSP  HHHHH-lLLHH-HHHHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct dlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrl  403
DSSP  lllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct atidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngaf  463
DSSP  eeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeelllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct attvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapl  523
DSSP  eelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct eevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxesp  583
DSSP  hhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeelll


DSSP  llll
Query ptlr  329
ident     
Sbjct viev  587
DSSP  eeel


No 27: Query=2ob3A Sbjct=2vunA Z-score=16.2

back to top
DSSP  ---------------------------------------------lleeelleeelhhhh
Query ---------------------------------------------drintvrgpitisea   15
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEEEEELLEellllhhhhlhhhhllhhhhHHHH-----hHHHHHHHHLLLLEEEELLlH
Query GFTLTHEHICgssagflrawpeffgsrkalAEKA-----vRGLRRARAAGVRTIVDVStF   70
ident |   || |                         |           |   || |       
Sbjct GLLDTHVHVS-------------------gGDYAprqktmDFISSALHGGVTTMISAG-S  100
DSSP  LEEEEEELLL-------------------lLLEEhhhleeLHHHHHHLLLEEEEEELL-L


DSSP  HHL---------------lLHHHHHHHHHhHLLEEE-LEEELlllllhhhhlllHHHHHH
Query DIG---------------rDVSLLAEVSRaADVHIV-AATGLwfdpplsmrlrsVEELTQ  114
ident                               | |     |  |                  
Sbjct PHFpgrpkdaagtkalaitLSKSYYNARP-AGVKVHgGAVIL-----------eKGLTEE  148
DSSP  LLLllllllhhhhhhhhhhHHHHHHHLLH-HHLEEElLEELL-----------lLLLLHH


DSSP  HHHHhHHLLllllllLLLEEEEELlllllHHHH--HHHHHhHHHHHHHLLLEEEELLH--
Query FFLReIQYGiedtgiRAGIIXVATtgkatPFQE--LVLKAaARASLATGVPVTTHTAA--  170
ident  |                |                             |  |  ||    
Sbjct DFIE-MKKE------GVWIVGEVG---lgTIKNpeDAAPM-VEWAHKHGFKVQMHTGGts  197
DSSP  HHHH-HHHL------LLLEEEEEL---llLLLLhhHHHHH-HHHHHHLLLEEEEELLLll


DSSP  ----hHLHHHHHHHHHhhllllhhHEEELLHHH---LLLHHHHHHHHH-LLLEEEElLLL
Query ----sQRDGEQQAAIFeseglspsRVCIGHSDD---TDDLSYLTALAA-RGYLIGLdHIP  222
ident                              |                              
Sbjct ipgssTVTADDVIKTK--------PDVVSHINGgptAISVQEVDRIMDeTDFAMEI-VQC  248
DSSP  lllllLLLHHHHHHHL--------LLEEELLLLlllLLLHHHHHHHHHhLLLEEEE-ELL


DSSP  LllllllllhhhhhhhllllHHHHHH-HHHHHHHLLLHHHEEELLLLLleellllllhhh
Query YsaiglednasasallgirsWQTRAL-LIKALIDQGYMKQILVSNDWTfgfssyvtnimd  281
ident                         |          |        ||              
Sbjct G-------------------NPKIADyVARRAAEKGQLGRVIFGNDAP------------  277
DSSP  L-------------------LHHHHHhHHHHHHHHLLHHHEEEELLLL------------


DSSP  hhhhHLLLHHHHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHHL---------------
Query vmdrVNPDGMAFIPlRVIPFLREK-GVPQETLAGITVTNPARFLS---------------  325
ident             |  |             |        |                     
Sbjct ---sGTGLIPLGIL-RNMCQIASMsDIDPEVAVCMATGNSTAVYGlntgviapgkeadli  333
DSSP  ---lLLLLLLLHHH-HHHHHHHHHlLLLHHHHHHHHLHHHHHHHLlllllllllllllee


DSSP  ------------------------------------------------llll
Query ------------------------------------------------ptlr  329
ident                                                     
Sbjct imdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  eeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 28: Query=2ob3A Sbjct=3e74A Z-score=16.2

back to top
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL
Query -------------------------------------drintvrgpitiseaGFTLTHEH   23
ident                                                     |    | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LeellllhhhhlhhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLlhhHLLL--------
Query IcgssagflrawpeffgsrkalaeKAVRGLRRARAAGVRTIVDVStfdIGRD--------   75
ident |                           | | |   |  |                    
Sbjct I-----------------------GYETGTRAAAKGGITTXIEXP---LNQLpatvdras   94
DSSP  L-----------------------LHHHHHHHHHHLLEEEEEELL---LLLLlllllhhh


DSSP  -HHHHHHHHHHHLLEEELEEELLLlllhhhhlllhhHHHHHHHHHHHlllllllLLLLEE
Query -VSLLAEVSRAADVHIVAATGLWFdpplsmrlrsveELTQFFLREIQygiedtgIRAGII  134
ident                     ||                                      
Sbjct iELKFDAAKGKLTIDAAQLGGLVS------------YNIDRLHELDE-------VGVVGF  135
DSSP  hHHHHHHHLLLLLLEEEELEELLL------------LLLLLHHHHHH-------HLLLLE


DSSP  EEELlllllhhHHHHHHHHHHHHHHHLLLEEEELL-------------------------
Query XVATtgkatpfQELVLKAAARASLATGVPVTTHTA-------------------------  169
ident |                  |      | ||  |                           
Sbjct XCFV----rdvNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyva  191
DSSP  EEEL----lllLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhh


DSSP  -----hHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEElLL
Query -----aSQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLdHI  221
ident                      |    |    |           |                
Sbjct srpvftEVEAIRRVLYLAKVAGC---RLHVCHV-SSPEgVEEVTRARQegQDITCES-CP  246
DSSP  lllhhhHHHHHHHHHHHHHHHLL---LEEELLL-LLHHhHHHHHHHHHllLLEEEEE-LL


DSSP  LL--LLLLL-LLLHHHHHH--HLLLL--HHHHHHHHHHHhhlllhhHEEELLLLLLE---
Query PY--SAIGL-EDNASASAL--LGIRS--WQTRALLIKALidqgymkQILVSNDWTFG---  271
ident  |        |                                         |       
Sbjct HYfvLDTDQfEEIGTLAKCspPIRDLenQKGXWEKLFNG------eIDCLVSDHSPCppe  300
DSSP  HHhhLLHHHhHHHLHHHLLllLLLLHhhHHHHHHHHHLL------lLLEELLLLLLLlll


DSSP  --elllLLLHHhhhhhhlllHHHHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL---
Query --fssyVTNIMdvmdrvnpdGMAFIPLRVIPFLR-EKGVPQETLAGITVTNPARFLS---  325
ident                     |                |           || |       
Sbjct xkagniXKAWG------giaGLQSCXDVXFDEAVqKRGXSLPXFGKLXATNAADIFGlqq  354
DSSP  llllllLLLLL------lllLHHHHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct kgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydie  414
DSSP  llllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeell


DSSP  -----------llll
Query -----------ptlr  329
ident                
Sbjct qgfpvapkgqfilkh  429
DSSP  lllllllllleelll


No 29: Query=2ob3A Sbjct=1itqA Z-score=16.0

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEELllLHHHhlhhhhlLHHH--HHHH----hhhHHH
Query drintvrgpitiseaGFTLTHEHICGSsaGFLRawpeffgSRKA--LAEK----avrGLR   54
ident                     |                                       
Sbjct -dffrdeaerimrdsPVIDGHNDLPWQllDMFN------nRLQDerANLTtlagthtNIP   53
DSSP  -lhhhhhhhhhhlllLEEEEEELHHHHhhHHHL------lLLLLhhHLLLlllllllLHH


DSSP  HHHHLLLLEEEELLLHH-----------hllLHHHHHHHH---HHHL-------------
Query RARAAGVRTIVDVSTFD-----------igrDVSLLAEVS---RAAD-------------   87
ident   ||  |                                                     
Sbjct KLRAGFVGGQFWSVYTPcdtqnkdavrrtleQMDVVHRMCrmyPETFlyvtssagirqaf  113
DSSP  HHHHLLEEEEEEEELLLhhhllllhhhhhhhHHHHHHHHHhhlLLLEeelllhhhhhhhh


DSSP  ----LEEELEEELLLlllhhhhlllhhHHHHHHHHHHHlllllllLLLLEEEEE------
Query ----VHIVAATGLWFdpplsmrlrsveELTQFFLREIQygiedtgIRAGIIXVA------  137
ident     |                                |                      
Sbjct regkVASLIGVEGGH---------sidSSLGVLRALYQ-------LGMRYLTLThscntp  157
DSSP  hlllEEEEEEEELHH---------hllLLHHHHHHHHH-------LLEEEEELLllllll


DSSP  ---LLLL------lLHHHH-hhHHHHHHHHHHHLLLEEEELlhhhlHHHHHHHHHHHlLL
Query ---TTGK------aTPFQE-lvLKAAARASLATGVPVTTHTaasqrDGEQQAAIFESeGL  187
ident                                  ||                         
Sbjct wadNWLVdtgdsepQSQGLspfGQRVVKELNRLGVLIDLAH-----VSVATMKATLQ-LS  211
DSSP  lllLHHHlllllllLLLLLlhhHHHHHHHHHHHLLEEELLL-----LLHHHHHHHHH-HL


DSSP  LHHhEEELLHHHLL-------lHHHHHHHHHLL-LEEEElLLLL----LLLLllllhhhh
Query SPSrVCIGHSDDTD-------dLSYLTALAARG-YLIGLdHIPY----SAIGlednasas  235
ident     |   ||                  |      |                        
Sbjct RAP-VIFSHSSAYSvcasrrnvPDDVLRLVKQTdSLVMV-NFYNnyisCTNK--------  261
DSSP  LLL-LEELLLLLLLllllllllLHHHHHHHHHHlLEEEE-LLLHhhhlLLLL--------


DSSP  hhhllLLHHHHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhhhHHHL---lLHHH
Query allgiRSWQTRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdvmDRVN---pDGMA  292
ident            |                   |                            
Sbjct -----ANLSQVADHLDHIKEVAGARAVGFGGDFD-------------gVPRVpeglEDVS  303
DSSP  -----LLHHHHHHHHHHHHHHLLHHHEEELLLLL-------------lLLLLllllLLLL


DSSP  HhHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHL-LLLL----------------------
Query FiPLRVIPFLREKGVPQETLAGITVTNPARFLS-PTLR----------------------  329
ident       |  |           |    |  |                              
Sbjct K-YPDLIAELLRRNWTEAEVKGALADNLLRVFEaVEQAsnltqapeeepipldqlggscr  362
DSSP  L-HHHHHHHHHHLLLLHHHHHHHHLHHHHHHHHhHHHLlllllllllllllhhhllllll


DSSP  -------
Query -------  329
ident        
Sbjct thygyss  369
DSSP  lllllll


No 30: Query=2ob3A Sbjct=3pnuA Z-score=15.2

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhHHHHHHHHHHHHHHlL
Query drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkaLAEKAVRGLRRARAaG   60
ident                     | |                                     
Sbjct --enlyfqsnamklkNPLDMHLHLR-------------------DNQMLELIAPLSAR-D   38
DSSP  --llllllllleeeeLLEEEEELLL-------------------LHHHHHHHHHHHHL-L


DSSP  LLEEEELLLhHHLL-----LHHHHHHHHHHH---LLEEELEEELLllllhhhhlllhhhH
Query VRTIVDVSTfDIGR-----DVSLLAEVSRAA---DVHIVAATGLWfdpplsmrlrsveeL  112
ident     |                        |                              
Sbjct FCAAVIMPNlIPPLcnledLKAYKMRILKACkdeNFTPLMTLFFK------------nyD   86
DSSP  LLEEEELLLlLLLLllhhhHHHHHHHHHHHHlllLLEEEEEEELL------------llL


DSSP  HHHHHHHHHllllllllLLLEEEEELL--------llLLHHhHHHHHHHHHHHHHHLLLE
Query TQFFLREIQygiedtgiRAGIIXVATT--------gkATPFqELVLKAAARASLATGVPV  164
ident   |                  ||                      ||    |      | 
Sbjct EKFLYSAKD--------EIFGIXLYPAgittnsnggvSSFD-IEYLKPTLEAMSDLNIPL  137
DSSP  HHHHHHHLL--------LLLEEEELLLllllllllllLLLL-HHHHHHHHHHHHHLLLLE


DSSP  EEELL--------HHHLHhHHHHHHHHHLLLLhhHEEELLHhHLLLhhHHHHHHHLL-LE
Query TTHTA--------ASQRDgEQQAAIFESEGLSpsRVCIGHSdDTDDlsYLTALAARG-YL  215
ident   |           |                        |   |        |       
Sbjct LVHGEtndfvmdrESNFA-KIYEKLAKHFPRL--KIVMEHI-TTKT--LCELLKDYEnLY  191
DSSP  EELLLllllhhhlLHHHH-HHHHHHHHHLLLL--LEEELLL-LLHH--HHHHHHHLLlEE


DSSP  EEElLLLL--LLLLLLL---LHHHHHH--HLLLL--hhHHHHHHHHhhhlllHHHEEELL
Query IGLdHIPY--SAIGLED---NASASAL--LGIRS--wqTRALLIKAlidqgyMKQILVSN  266
ident                                 |         |                 
Sbjct ATI-TLHHliITLDDVIggkMNPHLFCkpIAKRYedkeALCELAFS-----gYEKVMFGS  245
DSSP  EEE-LLHHhlLLHHHHHlllLLHHHLLllLLLLHhhhhHHHHHHHL-----lLLLEEELL


DSSP  LLLLEellllLLHHhhhhhhlllHHHHHHHLHHHHHHHLlLLHHHHHHHHLHHHHHHHL-
Query DWTFGfssyvTNIMdvmdrvnpdGMAFIPLRVIPFLREKgVPQETLAGITVTNPARFLS-  325
ident |                          |               | |      |       
Sbjct DSAPH---pkGCAA------gvfSAPVILPVLAELFKQN-SSEENLQKFLSDNTCKIYDl  295
DSSP  LLLLL---llLLLL------lllLHHHHHHHHHHHHHHH-LLHHHHHHHHLHHHHHHHLl


DSSP  ---------------------------------------llll
Query ---------------------------------------ptlr  329
ident                                            
Sbjct kfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  lllllleeeeellleelllleelllleellllllleelleell


No 31: Query=2ob3A Sbjct=1j6pA Z-score=15.2

back to top
DSSP  ------------------------------------lleeelleeelhhhhLLEEEEELL
Query ------------------------------------drintvrgpitiseaGFTLTHEHI   24
ident                                                        || | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH


DSSP  EE---------------------lLLLHHHhlhhhhllHHHHHHHHHHHHHHHHHLLLLE
Query CG---------------------sSAGFLRawpeffgsRKALAEKAVRGLRRARAAGVRT   63
ident                             |          |                |   
Sbjct PXtllrgvaedlsfeewlfskvlpIEDRLT--------EKXAYYGTILAQXEXARHGIAG  112
DSSP  HHhhhllllllllhhhhhhllhhhHHLLLL--------HHHHHHHHHHHHHHHHLLLEEE


DSSP  EEELLlhhhlLLHHHHHHHHHHHLLEEELEEELLllllhhHHLLLhhhhhHHHHHHhHLL
Query IVDVStfdigRDVSLLAEVSRAADVHIVAATGLWfdpplsMRLRSveeltQFFLREiQYG  123
ident  ||             |   |          ||                           
Sbjct FVDXY-----FHEEWIAKAVRDFGXRALLTRGLV------DSNGD---dgGRLEEN-LKL  157
DSSP  EEEEE-----LLHHHHHHHHHHHLLEEEEEEEEL------LLLLL---llLHHHHH-HHH


DSSP  LllLLLL------LLEEE-EELLllllhhHHHHHHHHHHHHHHHLLLEEEELLH----HH
Query IedTGIR------AGIIX-VATTgkatpfQELVLKAAARASLATGVPVTTHTAA----SQ  172
ident                               |  ||           ||| |         
Sbjct Y--NEWNgfegriFVGFGpHSPY----lcSEEYLKRVFDTAKSLNAPVTIHLYEtskeEY  211
DSSP  H--HHHLlhhhleEEEEEeLLLL----llLHHHHHHHHHHHHHHLLLEEEEELLllllLL


DSSP  LHhHHHHHHhhhllLLHH-HEEELLHHHLlLHHHHHHHHHLLLEEEELlLLLLlllllll
Query RDgEQQAAIfesegLSPS-RVCIGHSDDTdDLSYLTALAARGYLIGLDhIPYSaigledn  231
ident    |    |               |        |   |                      
Sbjct DL-EDILNI-----GLKEvKTIAAHCVHL-PERYFGVLKDIPFFVSHN-PASN-------  256
DSSP  LL-HHHHLL-----LLLLlLEEEEELLLL-LHHHHHHHLLLLEEEEEL-HHHH-------


DSSP  hhhhhhHLLLlhhHHHHhHHHHHHLLLhhHEEELLLLLleellllllhhhhhhhhllLHH
Query asasalLGIRswqTRALlIKALIDQGYmkQILVSNDWTfgfssyvtnimdvmdrvnpDGM  291
ident                |      |  |         |                        
Sbjct -----lKLGN---GIAP-VQRXIEHGX--KVTLGTDGA----------------asnNSL  289
DSSP  -----hHLLL---LLLL-HHHHHHLLL--EEEELLLLL----------------lllLLL


DSSP  H--HHHHLHHHHHH---HLLLLHHHHHHHHLHHHHHHHL---------------------
Query A--FIPLRVIPFLR---EKGVPQETLAGITVTNPARFLS---------------------  325
ident    |                    |         |                         
Sbjct NlfFEXRLASLLQKaqnPRNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidldl  349
DSSP  LhhHHHHHHHHHHHlllLLLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeelll


DSSP  ------------------------------------------------------llll
Query ------------------------------------------------------ptlr  329
ident                                                           
Sbjct pexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  hhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 32: Query=2ob3A Sbjct=1a5kC Z-score=15.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----------------------------------------------------lleeelle
Query ----------------------------------------------------drintvrg    8
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  eelhhhhLLEEEEELLEellllhhhhlhhhhllhhhhhhhHHHHHHHHHHLLLLEEEE--
Query pitiseaGFTLTHEHICgssagflrawpeffgsrkalaekAVRGLRRARAAGVRTIVD--   66
ident        |   || |                                |   || | |   
Sbjct egkivtaGGIDTHIHWI-----------------------CPQQAEEALVSGVTTMVGgg  157
DSSP  llleeeeLEEEEEEELL-----------------------LLLHHHHHHHHLEEEEEEel


DSSP  ----------LLLHhhlLLHHHHHHhHHHHLLEEELEEELLllllhhhhlllhhHHHHHH
Query ----------VSTFdigRDVSLLAEvSRAADVHIVAATGLWfdpplsmrlrsveELTQFF  116
ident             |         |        | |                          
Sbjct tgpaagthatTCTPgpwYISRMLQA-ADSLPVNIGLLGKGN------------vSQPDAL  204
DSSP  llllhhhhhlLLLLhhhHHHHHHHH-HLLLLLEEEEEEELL------------lLLHHHH


DSSP  HHHHHlllllllLLLLEEEEELLllllhhHHHHHHHHHHHHHHHLLLEEEELLHHH--lH
Query LREIQygiedtgIRAGIIXVATTgkatpfQELVLKAAARASLATGVPVTTHTAASQ--rD  174
ident                                     |          |  |         
Sbjct REQVA-------AGVIGLEIHED---wgaTPAAIDCALTVADEMDIQVALHSDTLNesgF  254
DSSP  HHHHH-------HLLLEEEEEHH---hllLHHHHHHHHHHHHHHLLEEEEELLLLLlllL


DSSP  HHHHHHHHhhLLLLhhhEEELLHHHL---llHHHHhHHHHLL-LEEEElLLLL-----lL
Query GEQQAAIFesEGLSpsrVCIGHSDDT---ddLSYLtALAARG-YLIGLdHIPY-----sA  225
ident  |   |     |         |                 |    |      |        
Sbjct VEDTLAAI--GGRT---IHTFHTEGAggghaPDII-TACAHPnILPSS-TNPTlpytlnT  307
DSSP  HHHHHHHH--LLLL---EEELLLLLLlllllLLHH-HHHHLLlEEEEE-EHHHllllllH


DSSP  LLLlllhhHHHH------------------hLLLLhhHHHHHhHHHHHLLLHhhEEELLL
Query IGLednasASAL------------------lGIRSwqTRALLiKALIDQGYMkqILVSND  267
ident |          |                    ||   | |     | | |     | | |
Sbjct IDE----hLDMLmvchhldpdiaedvafaesRIRR-eTIAAE-DVLHDLGAF--SLTSSD  359
DSSP  HHH----hHHHHhhhhllllllhhhhhllllLLLH-hHHHHH-HHHHHLLLL--LEEELL


DSSP  LLleellllllhhhhhhhhlllHHHHHHhLHHHHHHHLL----------------lLHHH
Query WTfgfssyvtnimdvmdrvnpdGMAFIPlRVIPFLREKG----------------vPQET  311
ident                                                             
Sbjct SQ-----------------amgRVGEVI-LRTWQVAHRMkvqrgalaeetgdndnfRVKR  401
DSSP  LL-----------------lllLLLLHH-HHHHHHHHHHhhhhlllllllllllhhHHHH


DSSP  HHHHHLHHHHHHHL----------------------------------------------
Query LAGITVTNPARFLS----------------------------------------------  325
ident        |||                                                  
Sbjct YIAKYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdin  461
DSSP  HHHLLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeellll


DSSP  -----------------------------------------------------LLLL---
Query -----------------------------------------------------PTLR---  329
ident                                                             
Sbjct asiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkGCRTvqk  521
DSSP  llllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellLLLLllh


DSSP  ---------------------------------------------
Query ---------------------------------------------  329
ident                                              
Sbjct admvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  hhllllllllleeelllllleeelleellllllllllllllllll


No 33: Query=2ob3A Sbjct=4rdvB Z-score=15.0

back to top
DSSP  ----------------------------------lleeelleeelhhhhLLEEEEELLEE
Query ----------------------------------drintvrgpitiseaGFTLTHEHICG   26
ident                                                  |    | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFQ   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHH


DSSP  ----------------------lllLHHHHlhhhhlLHHHHHHHHHHHHHHHHHLLLLEE
Query ----------------------ssaGFLRAwpeffgSRKALAEKAVRGLRRARAAGVRTI   64
ident                                     |       |         ||    
Sbjct ramaglaevagnpndsfwtwrelmyRMVAR-----lSPEQIEVIACQLYIEMLKAGYTAV  115
DSSP  hhhlllllllllllllhhhhhhhhhHHHLL-----lLHHHHHHHHHHHHHHHHHHLEEEE


DSSP  EELLLH----------hhllLHHHHHHHHHHHLLEEELEEELLLL-------LLHHhhll
Query VDVSTF----------digrDVSLLAEVSRAADVHIVAATGLWFD-------PPLSmrlr  107
ident                               ||         |                  
Sbjct AEFHYVhhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHagfggqpASEG--qr  173
DSSP  EEEELLlllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEeellleeLLHH--hl


DSSP  lhhhHHHHHHHHHHLLLllLLLL----lLEEE-EELLllllhhHHHHHHHHHHHhHHHLL
Query sveeLTQFFLREIQYGIedTGIR----aGIIX-VATTgkatpfQELVLKAAARAsLATGV  162
ident          |   |                                       |      
Sbjct rfinGSEAYLELLQRLR--APLEaaghsLGLCfHSLR----avTPQQIATVLAA-GHDDL  226
DSSP  llllLHHHHHHHHHHHH--HHHHhhlleELEEeLLLL----llLHHHHHHHHLL-LLLLL


DSSP  LEEEELLHHH------------LHHHHHHHHHHhlllLHHHEEELLHHhLLLHHHHHHHH
Query PVTTHTAASQ------------RDGEQQAAIFEseglSPSRVCIGHSDdTDDLSYLTALA  210
ident ||  | |  |            |                 | |  |     |     | |
Sbjct PVHIHIAEQQkevddcqawsgrRPLQWLYENVA----VDQRWCLVHAT-HADPAEVAAMA  281
DSSP  LEEEEELLLHhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEELL-LLLHHHHHHHH


DSSP  HLLLEEEELLLLLLlllllllhhhhhhHLLLlhhhhHHHHHHHHHLLLhhHEEELLLLLl
Query ARGYLIGLDHIPYSaiglednasasalLGIRswqtrALLIKALIDQGYmkQILVSNDWTf  270
ident   |   ||                   ||                ||         |   
Sbjct RSGAVAGLCLSTEA------------nLGDG-----IFPATDFLAQGG--RLGIGSDSH-  321
DSSP  HHLLEEEELHHHHH------------hLLLL-----LLLHHHHHHLLL--EEEELLLLL-


DSSP  eellllllhhhhhhhhlllHHHHhHHLHHHHHH---------HLLL-------LHHHHHH
Query gfssyvtnimdvmdrvnpdGMAFiPLRVIPFLR---------EKGV-------PQETLAG  314
ident                                |                        ||  
Sbjct -------------------VSLS-VVEELRWLEygqrlrdrkRNRLyrddqpmIGRTLYD  361
DSSP  -------------------LLLL-HHHHHHHHHhhhhhhhllLLLLlllllllHHHHHHH


DSSP  HHLHHHHHHHL-------------------------------------------------
Query ITVTNPARFLS-------------------------------------------------  325
ident       |  |                                                  
Sbjct AALAGGAQALGqpigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvm  421
DSSP  HHHHHHHHHHLllllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeee


DSSP  --------------------------llll
Query --------------------------ptlr  329
ident                               
Sbjct vagrwvvrdgrhageersarafvqvlgell  451
DSSP  elleeeelllllllhhhhhhhhhhhhhhhl


No 34: Query=2ob3A Sbjct=2dvtA Z-score=14.9

back to top
DSSP  lleeelleeelhhhhLLEEEEELlEELLLLHH----hhlhHHHL-lhhhhhhhHHHHHHH
Query drintvrgpitiseaGFTLTHEHiCGSSAGFL----rawpEFFG-srkalaekAVRGLRR   55
ident                |     ||                                  |  
Sbjct -------------mqGKVALEEH-FAIPETLQdsagfvpgDYWKelqhrlldiQDTRLKL   46
DSSP  -------------llLEEEEEEE-ELLHHHHHhhllllllLHHHhhhhhhhllLLHHHHH


DSSP  HHHLLLLEEEELL-----------------LHHH-lLLHHHHHHHHhhhlLEEELEEELl
Query ARAAGVRTIVDVS-----------------TFDI-gRDVSLLAEVSraadVHIVAATGLw   97
ident   | |  |                                  |           |   | 
Sbjct MDAHGIETMILSLnapavqaipdrrkaieiARRAndVLAEECAKRP----DRFLAFAAL-  101
DSSP  HHHLLEEEEEEEElllhhhhlllhhhhhhhHHHHhhHHHHHHHHLL----LLEEEEELL-


DSSP  llllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEEEEELL----llllHHHH--hhhH
Query fdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGIIXVATT----gkatPFQE--lvlK  151
ident                |    |                 |           |         
Sbjct -------plQDPDAATEELQRCVNDL------GFVGALVNGFsqegdgqtPLYYdlpqyR  148
DSSP  -------llLLHHHHHHHHHHHHHLL------LLLEEEEELLllllllllLLLLllhhhH


DSSP  HHHHHHHHHLLLEEEEL-----------------------LHHH--LHHHHHH-HHHHHL
Query AAARASLATGVPVTTHT-----------------------AASQ--RDGEQQA-AIFESE  185
ident           ||   |                         |                 |
Sbjct PFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtaVHALRLMaSGLFDE  208
DSSP  HHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLLHHHH


DSSP  LLLHhHEEELLHHHLLLHHH---------------------hHHHHHLLLEEEELLLLll
Query GLSPsRVCIGHSDDTDDLSY---------------------lTALAARGYLIGLDHIPys  224
ident          ||                                        |        
Sbjct HPRL-NIILGHMGEGLPYMMwridhrnawvklpprypakrrfMDYFNENFHITTSGNF--  265
DSSP  LLLL-LEEELHHHLLHHHHHhhhhhllllllllllllllllhHHHHHHHEEEELLLLL--


DSSP  lllllllhhhhhhhllllhhhHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhhhh
Query aiglednasasallgirswqtRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdvmd  284
ident                      |       |       || | ||                
Sbjct ---------------------RTQTLIDAILEIGADRILFSTDWP---------------  289
DSSP  ---------------------LHHHHHHHHLLLLHHHEELLLLLL---------------


DSSP  hhlllHHHHHHHLHHHHHhhllLLHHHHHHHHLHHHHHHHLllll
Query rvnpdGMAFIPLRVIPFLrekgVPQETLAGITVTNPARFLSptlr  329
ident                               |  ||  |       
Sbjct ---feNIDHASDWFNATS----IAEADRVKIGRTNARRLFK--ld  325
DSSP  ---llLHHHHHHHHHHLL----LLHHHHHHHHLHHHHHHLL--ll


No 35: Query=2ob3A Sbjct=2gwgA Z-score=14.9

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEellllhHHHL-----------------------hh
Query drintvrgpitiseaGFTLTHEHICgssagfLRAW-----------------------pe   37
ident                     | |          |                          
Sbjct ---------------XIIDIHGHYT----taPKALedwrnrqiagikdpsvxpkvselki   41
DSSP  ---------------LLEEEEEELL----llLHHHhhhhhhhhhhhhlhhhlllhhhlll


DSSP  hhLLHHHHHHHH-HHHHHHHHhllLLEEEELL----------lHHHLL--LHHHHHHHHh
Query ffGSRKALAEKA-VRGLRRARaagVRTIVDVS----------tFDIGR--DVSLLAEVSr   84
ident       |                     |                |              
Sbjct sdDELQASIIENqLKKXQERG---SDLTVFSPragdfnvsstwAAICNelCYRVSQLFP-   97
DSSP  lhHHHHHHHHLLhHHHHHHHL---LLEEEEELllllhhhhhhhHHHHHhhHHHHHHHLL-


DSSP  hhlLEEELEEELlllllhhHHLLLHHHHHHHHHHHHHLllllllLLLLEEEEELL----l
Query aadVHIVAATGLwfdpplsMRLRSVEELTQFFLREIQYgiedtgIRAGIIXVATT----g  140
ident         |  |                                     |          
Sbjct ---DNFIGAAXL-----pqSPGVDPKTCIPELEKCVKE------YGFVAINLNPDpsggh  143
DSSP  ---LLEEEEEEL-----llLLLLLHHHHHHHHHHHHHL------LLLLEEEELLLlllll


DSSP  LLLH--hHHHHhHHHHHHHHHHLLLEEEE--------lLHHHlHHHHH-hHHHHHLLLLH
Query KATP--fQELVlKAAARASLATGVPVTTH--------tAASQrDGEQQ-aAIFESEGLSP  189
ident    |                    |   |         |       |             
Sbjct WTSPpltDRIW-YPIYEKXVELEIPAXIHvstgahylnADTT-AFXQCvaGDLFKDFPEL  201
DSSP  LLLLlllLHHH-HHHHHHHHHHLLLEEELlllllhhhhHHHH-HHHHHhhLLHHHHLLLL


DSSP  hHEEELLHHHL--LLHH-------------hhhHHHHlLLEEEeLLLLlllllllllhhh
Query sRVCIGHSDDT--DDLS-------------yltALAArGYLIGlDHIPysaiglednasa  234
ident     | |                                                     
Sbjct -KFVIPHGGGAvpYHWGrfrglaqexkkplledHVLN-NIFFD-TCVY------------  246
DSSP  -LEEELHHHLLlhHHHHhhhhhhhhlllllhhhHLLL-LEEEE-LLLL------------


DSSP  hhhhllllHHHHHHHHHHHHhllLHHHEEELLLLLleellllllhhhhHHHH-----LLL
Query sallgirsWQTRALLIKALIdqgYMKQILVSNDWTfgfssyvtnimdvMDRV-----NPD  289
ident          |    |    |        |                               
Sbjct --------HQPGIDLLNTVI---PVDNVLFASEXI-----------gaVRGIdprtgFYY  284
DSSP  --------LHHHHHHHHHHL---LHHHEELLLLLL-----------llLLLEellllEEL


DSSP  HhhHHHHlHHHHHhhLLLLHHHHHHHHLHHHHHHHLL----------lll
Query GmaFIPLrVIPFLreKGVPQETLAGITVTNPARFLSP----------tlr  329
ident          |          |    |   |  |                 
Sbjct D--DTKR-YIEAS--TILTPEEKQQIYEGNARRVYPRldaalkakgkleh  329
DSSP  L--LLHH-HHHHL--LLLLHHHHHHHHLHHHHHHLHHhhhhhhhhhhhll


No 36: Query=2ob3A Sbjct=1a4mA Z-score=14.9

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEE----------------------------------
Query drintvrgpitiseaGFTLTHEHICG----------------------------------   26
ident                     | |  |                                  
Sbjct ---------tpafnkPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmdk   51
DSSP  ---------llllllLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhllll


DSSP  ---------llllHHHHLHHhhlLHHHHHHHHHHHHHHHHHLLLLEEEELLLHH------
Query ---------ssagFLRAWPEffgSRKALAEKAVRGLRRARAAGVRTIVDVSTFD------   71
ident                         | |    |          ||                
Sbjct plslpgflakfdyYMPVIAG---CREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllansk  108
DSSP  lllhhhhhllhhhHHHHHLL---LHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhllll


DSSP  ------------------hllLHHHHHHHHHHHLLEEELEEELLLLLlhhhhlllhhHHH
Query ------------------igrDVSLLAEVSRAADVHIVAATGLWFDPplsmrlrsveELT  113
ident                          | |   |                            
Sbjct vdpmpwnqtegdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMRHQ---------pSWS  159
DSSP  llllhhhlllllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEELLL---------hHHH


DSSP  HHHHHHHHLLLllllLLLLEEEEE-lLLLLLhHHHH-HHHHHHHHHHHHLLLEEEELL-H
Query QFFLREIQYGIedtgIRAGIIXVA-tTGKATpFQEL-VLKAAARASLATGVPVTTHTA-A  170
ident    |                   |                 |       |   | |    
Sbjct LEVLELCKKYN---qKTVVAMDLAgdETIEG-SSLFpGHVEAYEGAVKNGIHRTVHAGeV  215
DSSP  HHHHHHHHHLL---lLLEEEEEEEllLLLLL-HHHLhHHHHHHHHHHHHLLEEEEEELlL


DSSP  HHL-HHHHHHHHHHhllllhhhEEELLHHHLLL-HHHHHHHHHLLLEEEElLLLLlllll
Query SQR-DGEQQAAIFEseglspsrVCIGHSDDTDD-LSYLTALAARGYLIGLdHIPYsaigl  228
ident            |             ||   |         |                   
Sbjct GSPeVVREAVDILK-------tERVGHGYHTIEdEALYNRLLKENMHFEV-CPWS-----  262
DSSP  LLHhHHHHHHHLLL-------lLEEEELHHHHHlHHHHHHHHHLLLEEEE-LHHH-----


DSSP  lllhhhhHHHL-lLLHHHhhHHHHHHHHLLLhhHEEELLLLlleellllllhhhhhhhHL
Query ednasasALLG-iRSWQTraLLIKALIDQGYmkQILVSNDWtfgfssyvtnimdvmdrVN  287
ident         | |      |                     |                    
Sbjct ------sYLTGawDPKTT--HAVVRFKNDKA--NYSLNTDD---------------plIF  297
DSSP  ------hHHLLllLLLLL--LHHHHHHHLLL--LEEELLLL---------------llLL


DSSP  LLhhhHHHHlHHHHHHHL-LLLHHHHHHHHlHHHHH-HHLL-------------lll
Query PDgmaFIPLrVIPFLREK-GVPQETLAGITvTNPAR-FLSP-------------tlr  329
ident                    |   |        | |     |                
Sbjct KS---TLDT-DYQMTKKDmGFTEEEFKRLN-INAAKsSFLPeeekkellerlyreyq  349
DSSP  LL---LHHH-HHHHHHHLlLLLHHHHHHHH-HHHHHlLLLLhhhhhhhhhhhhhhll


No 37: Query=2ob3A Sbjct=2uz9A Z-score=14.6

back to top
DSSP  ------------------------------------------------------lleeel
Query ------------------------------------------------------drintv    6
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  leeelhhhhLLEEEEELLEE---------------------lLLLHHHhlhhhhlLHHHH
Query rgpitiseaGFTLTHEHICG---------------------sSAGFLRawpeffgSRKAL   45
ident          |   || |                                           
Sbjct lshheffmpGLVDTHIHASQysfagssidlpllewltkytfpAEHRFQ-------NIDFA  113
DSSP  llllleeeeLEEEEEEEHHHhhhllllllllhhhhhhhlhhhHHHHHH-------LHHHH


DSSP  HHHHHHHHHHHHHLLLLEEEELLLHhhllLHHHHHHHHHHHLLEEELEEELLllLLHH--
Query AEKAVRGLRRARAAGVRTIVDVSTFdigrDVSLLAEVSRAADVHIVAATGLWfdPPLS--  103
ident  |   |  ||    |  |     |        |||                         
Sbjct EEVYTRVVRRTLKNGTTTACYFATI-htdSSLLLADITDKFGQRAFVGKVCM-dLNDTfp  171
DSSP  HHHHHHHHHHHHHLLEEEEEEELLL-lhhHHHHHHHHHHHHLLEEEEELEEL-lLLLLll


DSSP  hhlLLHHHHHHHHHHHHHLLLlLLLL--lLLEEE-EELLllllhhHHHHHHHHHHHHHHH
Query mrlRSVEELTQFFLREIQYGIeDTGI--rAGIIX-VATTgkatpfQELVLKAAARASLAT  160
ident       ||      |                |              |             
Sbjct eykETTEESIKETERFVSEML-QKNYsrvKPIVTpRFSL----scSETLMGELGNIAKTR  226
DSSP  lllLLHHHHHHHHHHHHHHHH-HHLLlleEEEEEeLLHH----hlLHHHHHHHHHHHHHH


DSSP  LLLEEEELLHH--------------hLHHHHHHHHHhhllllHHHEEELLHHhLLLHHHH
Query GVPVTTHTAAS--------------qRDGEQQAAIFeseglsPSRVCIGHSDdTDDLSYL  206
ident       |                                          |         |
Sbjct DLHIQSHISENrdeveavknlypsykNYTSVYDKNN----llTNKTVMAHGC-YLSAEEL  281
DSSP  LLEEEEEELLLhhhhhhhhhhlllllLHHHHHHHLL----llLLLEEEEELL-LLLHHHH


DSSP  HHHHHLLLEEEElLLLLllllllllhhhhhhHLLLlhhHHHHhHHHHHHLLLhhHEEELL
Query TALAARGYLIGLdHIPYsaiglednasasalLGIRswqTRALlIKALIDQGYmkQILVSN  266
ident      ||  |                                             |    
Sbjct NVFHERGASIAH-CPNS------------nlSLSS---GFLN-VLEVLKHEV--KIGLGT  322
DSSP  HHHHHHLLEEEE-LHHH------------hhHLLL---LLLL-HHHHHHLLL--EEEELL


DSSP  LLLleellllllhhhhhhhhllLHHH--HHHHlHHHHHHH---------LLLLHHHHHHH
Query DWTfgfssyvtnimdvmdrvnpDGMA--FIPLrVIPFLRE---------KGVPQETLAGI  315
ident |                                                |          
Sbjct DVA-----------------ggYSYSmlDAIR-RAVMVSNillinkvneKSLTLKEVFRL  364
DSSP  LLL-----------------llLLLLhhHHHH-HHHHHHHhhhhlllllLLLLHHHHHHH


DSSP  HLHHHHHHHL--------------------------------------------------
Query TVTNPARFLS--------------------------------------------------  325
ident         |                                                   
Sbjct ATLGGSQALGldgeignfevgkefdailinpkasdspidlfygdffgdiseaviqkflyl  424
DSSP  HLHHHHHHLLllllllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhh


DSSP  ----------------llll
Query ----------------ptlr  329
ident                     
Sbjct gddrnieevyvggkqvvpfs  444
DSSP  llhhheeeeeelleeeelll


No 38: Query=2ob3A Sbjct=3icjA Z-score=14.5

back to top
DSSP  ---------------------------------------------lleeelleeelhhhh
Query ---------------------------------------------drintvrgpitisea   15
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEEEEELLEE-------------------------------------------------
Query GFTLTHEHICG-------------------------------------------------   26
ident  |   | |                                                    
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  --------------------------------------------------lLLLHHHHLH
Query --------------------------------------------------sSAGFLRAWP   36
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIINEKIL  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHHHLLL


DSSP  hhhlLHHHHHHHHHHHHHHHHHLLLLEEEELLLHhhllLHHHHHHHH--HHHLLEEELEE
Query effgSRKALAEKAVRGLRRARAAGVRTIVDVSTFdigrDVSLLAEVS--RAADVHIVAAT   94
ident       |                ||      |          | |            |  
Sbjct ----TVKDYKHYIESAQEHLLSLGVHSVGFMSVG--ekALKALFELEreGRLKMNVFAYL  234
DSSP  ----LHHHHHHHHHHHHHHHHHLLEEEEEEEEEL--hhHHHHHHHHHhlLLLLLEEEEEE


DSSP  ELlllllhhhhlllhhhhhhHHHHHHHL----llllllllLLEEEEELL-----------
Query GLwfdpplsmrlrsveeltqFFLREIQY----giedtgirAGIIXVATT-----------  139
ident                       |                     |               
Sbjct SP------------------ELLDKLEElnlgkfegrrlrIWGVXLFVDgslgartalls  276
DSSP  LH------------------HHHHHHHHhlllleellleeEEEEEEELLlllllllllll


DSSP  -----------LLLLhhHHHHHHHHHHHHHHHLLLEEEELLHHhLHHHHHHHHHHHlLLL
Query -----------GKATpfQELVLKAAARASLATGVPVTTHTAASqRDGEQQAAIFESeGLS  188
ident                                 |  |  |              ||     
Sbjct epytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAIGD-KAVDVALDAFEE-AEF  332
DSSP  lllllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEELLH-HHHHHHHHHHHH-HLL


DSSP  HhhEEELLHhHLLLHHHHHHHHHLLLEEEElLLLLllllllllhhhhhhHLLL------l
Query PsrVCIGHSdDTDDLSYLTALAARGYLIGLdHIPYsaiglednasasalLGIR------s  242
ident      | |         |         |                                
Sbjct S--GRIEHA-SLVRDDQLERIKELKVRISA-QPHF-----------ivsDWWIvnrvgee  377
DSSP  L--LEEEEL-LLLLHHHHHHHHHHLLEEEE-LLLH-----------hhhLLLHhhhhhhh


DSSP  hhhhhHHHHHHHhllLHHHEEELLLLLleellllllhhhhhhhhlllHHHHhhHLHHHHH
Query wqtraLLIKALIdqgYMKQILVSNDWTfgfssyvtnimdvmdrvnpdGMAFipLRVIPFL  302
ident         | |           | |                               |   
Sbjct rakwaYRLKTLS---SITKLGFSTDSP------------------iePADP--WVSIDAA  414
DSSP  hhhhlLLHHHHH---HHLLEEELLLLL------------------llLLLH--HHHHHHH


DSSP  HHL-------LLLHHHHHHHHLHHHHHHHL--------------------llll
Query REK-------GVPQETLAGITVTNPARFLS--------------------ptlr  329
ident            |  |          |                            
Sbjct VNRyvvdpgeRVSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
DSSP  HHLllllhhhLLLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll


No 39: Query=2ob3A Sbjct=4ofcA Z-score=14.4

back to top
DSSP  lleeelleeelhhhhlLEEEEELLEEllllhHHHL---------hhHHLL----------
Query drintvrgpitiseagFTLTHEHICGssagfLRAW---------peFFGS----------   41
ident                     | ||                                    
Sbjct ---------------mKIDIHSHILP----kEWPDlkkrfgyggwvQLQHhskgeakllk   41
DSSP  ---------------lLEEEEEELLL----lLLLLhhhhhllllleEEEEeelleeeeee


DSSP  ----hhhHHHH---HHHHHHHHHHLLLLEEEELL----------------lhHHLL-LHH
Query ----rkaLAEK---AVRGLRRARAAGVRTIVDVS----------------tfDIGR-DVS   77
ident          |         |     ||                              |  
Sbjct dgkvfrvVRENcwdPEVRIREMDQKGVTVQALSTvpvmfsywakpedtlnlcQLLNnDLA  101
DSSP  lleeeeeEEHHhllHHHHHHHHHHHLLLEEEEELlhhhhlllllhhhhhhhhHHHHhHHH


DSSP  HH-HHHHhhhlLEEELEEELlllllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEEEE
Query LL-AEVSraadVHIVAATGLwfdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGIIXV  136
ident               |    |             |       |                  
Sbjct STvVSYP----RRFVGLGTL--------pmQAPELAVKEMERCVKEL------GFPGVQI  143
DSSP  HHhHHLL----LLEEEEELL--------llLLHHHHHHHHHHHHHLL------LLLEEEE


DSSP  ELLllLLHH---HHHHhHHHHHHHHHHLLLEEEEL-------------------LHHH--
Query ATTgkATPF---QELVlKAAARASLATGVPVTTHT-------------------AASQ--  172
ident  |                    |          |                          
Sbjct GTH--VNEWdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEtt  200
DSSP  ELE--ELLEellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhh


DSSP  LHHHHHH-HHHHHLLLLHhHEEELLHHHLLLHHH--------------------hhhhhH
Query RDGEQQA-AIFESEGLSPsRVCIGHSDDTDDLSY--------------------ltalaA  211
ident                     ||  |                                   
Sbjct IAICSMImGGVFEKFPKL-KVCFAHGGGAFPFTVgrishgfsmrpdlcaqdnpmnpkkyL  259
DSSP  HHHHHHHlLLHHHHLLLL-LEEELHHHLLHHHHHhhhhhhhhhlhhhhlllllllhhhhL


DSSP  LLLEEEELLLllllllllllhhhhhhhllllhhhHHHHHHHHHHLlLHHHEEELLLLLle
Query RGYLIGLDHIpysaiglednasasallgirswqtRALLIKALIDQgYMKQILVSNDWTfg  271
ident                                     |  | | |           |    
Sbjct GSFYTDALVH------------------------DPLSLKLLTDViGKDKVILGTDYP--  293
DSSP  LLLEEELLLL------------------------LHHHHHHHHHHhLLLLEELLLLLL--


DSSP  ellllllhhhhhhhhlllhhHHHHhLHHHHHhhLLLLHHHHHHHHLHHHHHHHL--llll
Query fssyvtnimdvmdrvnpdgmAFIPlRVIPFLreKGVPQETLAGITVTNPARFLS--ptlr  329
ident                            |          ||       |   ||       
Sbjct ---------------fplgeLEPG-KLIESM--EEFDEETKNKLKAGNALAFLGlerkqf  335
DSSP  ---------------lllllLLLL-HHHHHL--LLLLHHHHHHHHLHHHHHHHLllhhhl


No 40: Query=2ob3A Sbjct=2ogjA Z-score=14.3

back to top
DSSP  -----------------------------------------lleeelleeelhhhhLLEE
Query -----------------------------------------drintvrgpitiseaGFTL   19
ident                                                         |   
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  EEELL-EELLllhhhhlhhhhllhhhhhhhhhhHHHH-HHHLLLLEEEE-LLLH--hhll
Query THEHI-CGSSagflrawpeffgsrkalaekavrGLRR-ARAAGVRTIVD-VSTF--digr   74
ident  | ||  |                                  || | ||  |        
Sbjct LHVHIwHGGT-------------------disiRPSEcGAERGVTTLVDaGSAGeanfhg  101
DSSP  EEELLlLLLL-------------------llllLHHHlLHHHLEEEEEEeLLLLlllhhh


DSSP  LHHHHHHHHhhhLLEEELEEELL----------LLLLhhHHLLlhhhHHHHHHHHHHLLl
Query DVSLLAEVSraaDVHIVAATGLW----------FDPPlsMRLRsveeLTQFFLREIQYGi  124
ident       | |      | |   |                              |       
Sbjct FREYIIEPS---RERIKAFLNLGsiglvacnrvPELR--DIKD---iDLDRILECYAEN-  152
DSSP  HHHHLLLLL---LLEEEEEEELLllllllllllLLLL--LHHH---lLHHHHHHHHHLL-


DSSP  llllLLLLEEEEELLL-lLLHHHHHHHHHHHHHHHHHLLLEEEELLhhhlHHHHHHHHHh
Query edtgIRAGIIXVATTG-kATPFQELVLKAAARASLATGVPVTTHTAasqrDGEQQAAIFe  183
ident           ||               |          ||   |             |  
Sbjct ---sEHIVGLXVRASHviTGSWGVTPVKLGKKIAKILKVPXXVHVGeppaLYDEVLEIL-  208
DSSP  ---lLLEEEEEEEELHhhHLLLLLHHHHHHHHHHHHHLLLEEEEELllllLHHHHHHHL-


DSSP  hllllHHHEEELLHH-----HLLL-----HHHHHHHhhLLLEEEELLLLLllllllllhh
Query seglsPSRVCIGHSD-----DTDD-----LSYLTALaaRGYLIGLDHIPYsaiglednas  233
ident             |                          |      |             
Sbjct -----GPGDVVTHCFngksgSSIXededlFNLAERC--EGIRLDIGHGGA----------  251
DSSP  -----LLLLEEELLLlllllLLLLllhhhHHHHHHL--LLLEEELLLLLL----------


DSSP  hhhhhllllhhhHHHHHHHHHHLLLHhHEEELLLLLLeellllllhhhhHHHHLllhhHH
Query asallgirswqtRALLIKALIDQGYMkQILVSNDWTFgfssyvtnimdvMDRVNpdgmAF  293
ident                   | |  |       | |                          
Sbjct ----------sfSFKVAEAAIARGLL-PFSISTDLHG-----------hSXNFP---vWD  286
DSSP  ----------llLHHHHHHHHHLLLL-LLLLLLLLLL-----------lLLLLL---lLL


DSSP  HHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL----------------------------
Query IPlRVIPFLREKGVPQETLAGITVTNPARFLS----------------------------  325
ident         |     | |        |||                                
Sbjct LA-TTXSKLLSVDXPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleat  345
DSSP  HH-HHHHHHHHLLLLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeee


DSSP  ------------------------------llll
Query ------------------------------ptlr  329
ident                                   
Sbjct dsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeelleeeellllllll


No 41: Query=2ob3A Sbjct=3iacA Z-score=14.2

back to top
DSSP  -----------lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhHHHH-
Query -----------drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkaLAEK-   48
ident                                | |                          
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLS---------------pqeiADDRr   45
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL---------------hhhhHHLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   48
ident                                                             
Sbjct fdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwth  105
DSSP  lllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhh


DSSP  ---------------------------------hhHHHHHHHHLLLLEEEELLLHhhLLL
Query ---------------------------------avRGLRRARAAGVRTIVDVSTFdiGRD   75
ident                                              ||             
Sbjct lelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDP--IDS  163
DSSP  hhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLL--LLL


DSSP  HHHHHHHHHH--HLLEEELEEELLLL------lLHHHHL--------------lLHHHHH
Query VSLLAEVSRA--ADVHIVAATGLWFD------pPLSMRL--------------rSVEELT  113
ident              |                                            ||
Sbjct LEYHRQIAADdsIDIEVAPSWRPDKVfkieldgFVDYLRkleaaadvsitrfddLRQALT  223
DSSP  LHHHHHHHHLllLLLEEELLLLLHHHhllllllHHHHHHhhhhhhllllllhhhHHHHHH


DSSP  HHHHHHHHlllllllLLLLEEEEELLLLL----------------------------LHH
Query QFFLREIQygiedtgIRAGIIXVATTGKA----------------------------TPF  145
ident                                                            |
Sbjct RRLDHFAA-------CGCRASDHGIETLRfapvpddaqldailgkrlagetlseleiAQF  276
DSSP  HHHHHHHH-------LLLLEEEEEELLLLllllllhhhhhhhhhhhhllllllhhhhHHH


DSSP  HHHHHHHHHHHHHHHLLLEEEELL----------------------hHHLHHHHHHHHHH
Query QELVLKAAARASLATGVPVTTHTA----------------------aSQRDGEQQAAIFE  183
ident    ||    |   | |     |                                      
Sbjct TTAVLVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigDNNISWALSRLLD  336
DSSP  HHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleelLLLLHHHHHHHHH


DSSP  HL---LLLHhHEEELLhhHLLL-HHHHHHHHHL--------LLEEEElLLLLllllllll
Query SE---GLSPsRVCIGHsdDTDD-LSYLTALAAR--------GYLIGLdHIPYsaigledn  231
ident |       |                 |                  |              
Sbjct SXdvtNELP-KTILYC--LNPRdNEVLATXIGNfqgpgiagKVQFGS-GWWF--------  384
DSSP  HHhllLLLL-EEEEEE--LLHHhHHHHHHHHHHllllllllLEEELL-LLHH--------


DSSP  hhhhhhhllllHHHHHH-HHHHHHHLLLH-HHEEELLLLLLeellllllhhhhhhhhlll
Query asasallgirsWQTRAL-LIKALIDQGYM-KQILVSNDWTFgfssyvtnimdvmdrvnpd  289
ident                 |     |   |          |                      
Sbjct ---------ndQKDGXLrQLEQLSQXGLLsQFVGXLTDSRS------------------f  417
DSSP  ---------hlLHHHHHhHHHHHHHHLLHhHLLLLLLLLLL------------------l


DSSP  HHHHHHHLHHHHHHHLL--------------lLHHHHHHHHLHHHHHHHLLLll
Query GMAFIPLRVIPFLREKG--------------vPQETLAGITVTNPARFLSPTlr  329
ident             |                          |   |  |       
Sbjct LSYTRHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTIK--  469
DSSP  LLLHHHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLLL--


No 42: Query=2ob3A Sbjct=2imrA Z-score=14.2

back to top
DSSP  ----------------------------------------lleeelleeelhhhhLLEEE
Query ----------------------------------------drintvrgpitiseaGFTLT   20
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  EELLEELLL-------lhhhhlhhhhllhhhHHHHHHHHHHHHHHLLLLEEEELLlhhHL
Query HEHICGSSA-------gflrawpeffgsrkaLAEKAVRGLRRARAAGVRTIVDVStfdIG   73
ident | |   |                            |  |       |     |       
Sbjct HTHLDMSAYefqalpyfqwipevvirgrhlrGVAAAQAGADTLTRLGAGGVGDIV---WA  117
DSSP  EEELLLLHHhhhhlhhhhllhhhhhhhllllHHHHHHHHHHHHHHLLLLLEEEEE---LL


DSSP  LL-HHHHHHHHhhhLLEEELEEELLllllhhhHLLLHHHHHHHHHHHHHlLLLLLLL--l
Query RD-VSLLAEVSraaDVHIVAATGLWfdpplsmRLRSVEELTQFFLREIQyGIEDTGI--r  130
ident       |       |                       |                     
Sbjct PEvMDALLARE---DLSGTLYFEVL-----npFPDKADEVFAAARTHLE-RWRRLERpgl  168
DSSP  HHhHHHHHLLL---LLLEEEEEEEL-----llLHHHHHHHHHHHHHHHH-HHHLLLLlle


DSSP  lLEEE-EELLllllhHHHHHHHHHHHHHHHHLLLEEEELLHHH-----------------
Query aGIIX-VATTgkatpFQELVLKAAARASLATGVPVTTHTAASQ-----------------  172
ident                                | |   | |                    
Sbjct rLGLSpHTPF----tVSHRLMRLLSDYAAGEGLPLQIHVAEHPtelemfrtgggplwdnr  224
DSSP  eEEEEeLLLL----lLLHHHHHHHHHHHHHHLLLLEEEELLLHhhhhhhhhlllllhhhl


DSSP  ---------------------LHHHHHHHHHHhlLLLHhhEEELLHhHLLLHHHHHHHHH
Query ---------------------RDGEQQAAIFEseGLSPsrVCIGHSdDTDDLSYLTALAA  211
ident                                             |             | 
Sbjct mpalyphtlaevigrepgpdlTPVRYLDELGV--LAAR--PTLVHM-VNVTPDDIARVAR  279
DSSP  lhhhllllhhhhhllllllllLHHHHHHHHLL--HHHL--LEEEEL-LLLLHHHHHHHHH


DSSP  LLLEEEELLLLLLlllllllhhhhhHHLLLlhhhhhhHHHHHHHLLLhhHEEELLLLLle
Query RGYLIGLDHIPYSaiglednasasaLLGIRswqtralLIKALIDQGYmkQILVSNDWTfg  271
ident  |                        |             |    |         |    
Sbjct AGCAVVTCPRSNH------------HLECG-----tfDWPAFAAAGV--EVALGTDSV--  318
DSSP  HLLLEEELHHHHH------------HLLLL-----llLHHHHHHLLL--LEEELLLLH--


DSSP  ellllllhhhhhhhhllLHHHhHHHL--HHHHHHhLLLLHHHHHHHHLHHHHHHHL----
Query fssyvtnimdvmdrvnpDGMAfIPLR--VIPFLReKGVPQETLAGITVTNPARFLS----  325
ident                                 |   |     |    |    |       
Sbjct --------------asgETLN-VREEvtFARQLY-PGLDPRVLVRAAVKGGQRVVGtpfl  362
DSSP  --------------hhhLLLL-LHHHhhHHHHHL-LLLLHHHHHHHHHHHHHHHHLllll


DSSP  --------------llll
Query --------------ptlr  329
ident                   
Sbjct rrgetwqegfrwelsrdl  380
DSSP  lllllllhhhlhhhllll


No 43: Query=2ob3A Sbjct=4hk5D Z-score=14.1

back to top
DSSP  lleeelleeelhhhhLLEEEEELlEELLlLHHHHLH------------------------
Query drintvrgpitiseaGFTLTHEHiCGSSaGFLRAWP------------------------   36
ident                     | |                                     
Sbjct -------------tpVVVDIHTH-MYPP-SYIAMLEkrqtiplvrtfpqadeprlillss   45
DSSP  -------------llLLEEEEEE-ELLH-HHHHHHHlllllleeeeelleeeeeeellhh


DSSP  ------------------hhhllhhhHHHHHHHHHHHHHhllLLEEEELL----------
Query ------------------effgsrkaLAEKAVRGLRRARaagVRTIVDVS----------   68
ident                                            |  |             
Sbjct elaaldaaladpaaklpgrplsthfaSLAQKMHFMDTNG---IRVSVISLanpwfdflap  102
DSSP  hhhhhhhhhhlllllllleellhhhlLHHHHHHHHHHLL---LLEEEEEEllllllllll


DSSP  -----lHHHL--LLHHHHHHHHhhhlLEEELEEELlllllhhHHLLlHHHHHHHHHHHHH
Query -----tFDIG--RDVSLLAEVSraadVHIVAATGLwfdpplsMRLRsVEELTQFFLREIQ  121
ident        |          |               |            |        |   
Sbjct deapgiADAVnaEFSDMCAQHV----GRLFFFAAL------pLSAP-VDAVKASIERVKN  151
DSSP  llhhhhHHHHhhHHHHHHHLLL----LLEEEEEEL------lLLLL-HHHHHHHHHHHHL


DSSP  lllllllLLLLEEEEELL---lLLLHhhHHHHHHhHHHHHHHLLLEEEEL----------
Query ygiedtgIRAGIIXVATT---gKATPfqELVLKAaARASLATGVPVTTHT----------  168
ident             |   |              |     |       |  |           
Sbjct ------lKYCRGIILGTSglgkGLDD--PHLLPV-FEAVADAKLLVFLHPhyglpnevyg  202
DSSP  ------lLLEEEEEELLLllllLLLL--HHHHHH-HHHHHHLLLEEEELLlllllhhhhl


DSSP  ---------------LHHH--LHHHHHH--HHHHHLLLLhhHEEELLHHHLLLHHH----
Query ---------------AASQ--RDGEQQA--AIFESEGLSpsRVCIGHSDDTDDLSY----  205
ident                                 |             ||  |         
Sbjct prseeyghvlplalgFPMEttIAVARMYmaGVFDHVRNL--QMLLAHSGGTLPFLAgrie  260
DSSP  llhhhlllhhhhhlhHHHHhhHHHHHHHhlLHHHHLLLL--LEEEHHHHLLHHHHHhhhh


DSSP  ---------------------hHHHHHLLLEEEELLLllllllllllhhhhhhhllllhh
Query ---------------------lTALAARGYLIGLDHIpysaiglednasasallgirswq  244
ident                                                             
Sbjct scivhdghlvktgkvpkdrrtiWTVLKEQIYLDAVIY-----------------------  297
DSSP  hhhhllhhhhhllllllllllhHHHHHHLEEEELLLL-----------------------


DSSP  hHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhhHHHH------lLLHHHHHHhLH
Query tRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdvMDRV------nPDGMAFIPlRV  298
ident        | |            |                           |         
Sbjct -SEVGLQAAIASSGADRLMFGTDHP------------fFPPIeedvqgpWDSSRLNA-QA  343
DSSP  -LHHHHHHHHHHHLHHHEELLLLLL------------lLLLLlllllllLHHHHHHH-HH


DSSP  HHHHHHlllLHHHHHHHHLHHHHHHHL--------llll
Query IPFLREkgvPQETLAGITVTNPARFLS--------ptlr  329
ident               |     |  | ||            
Sbjct VIKAVG--eGSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  HHHHHL--lLLHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 44: Query=2ob3A Sbjct=4qrnA Z-score=14.1

back to top
DSSP  lleeelleeelhhhhLLEEEEELleELLLLHHHHL-------------------------
Query drintvrgpitiseaGFTLTHEHicGSSAGFLRAW-------------------------   35
ident                    | |                                      
Sbjct -smtqdlktggeqgyLRIATEEA--FATREIIDVYlrmirdgtadkgmvslwgfyaqsps   57
DSSP  -llllllllllllllLLEEEEEE--ELLHHHHHHHhhhhhhllllhhhhhhhhhhhhlll


DSSP  ---hhhhllhhhhHHHHHHHHHHHHhllLLEEEELL-----------------LHHH-lL
Query ---peffgsrkalAEKAVRGLRRARaagVRTIVDVS-----------------TFDI-gR   74
ident               |                                             
Sbjct eratqilerlldlGERRIADMDATG---IDKAILALtspgvqplhdldeartlATRAndT  114
DSSP  hhhhhhhhhhhllLHHHHHHHHHLL---LLEEEEEEllllllllllhhhhhhhHHHHhhH


DSSP  LHHHHHHHHhhhlLEEELEEELlllllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEE
Query DVSLLAEVSraadVHIVAATGLwfdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGII  134
ident                                    |       |               |
Sbjct LADACQKYP----DRFIGMGTV--------apQDPEWSAREIHRGAREL------GFKGI  156
DSSP  HHHHHHHLL----LLEEELLLL--------llLLHHHHHHHHHHHHHLL------LLLLE


DSSP  EEELLllLLHHHH--hhhHHHHHHHHHHLLLEEEEL----------------------LH
Query XVATTgkATPFQE--lvlKAAARASLATGVPVTTHT----------------------AA  170
ident                       ||      |   |                         
Sbjct QINSH--TQGRYLdeeffDPIFRALVEVDQPLYIHPatspdsmidpmleagldgaifgFG  214
DSSP  EELLL--LLLLLLllhhhHHHHHHHHHHLLLEEELLllllllllhhhhhhlllllllhHH


DSSP  HH--LHHHHHH-HHHHHLLLLHhHEEELLHHHLLLHHH----------------------
Query SQ--RDGEQQA-AIFESEGLSPsRVCIGHSDDTDDLSY----------------------  205
ident                     |      ||                               
Sbjct VEtgMHLLRLItIGIFDKYPSL-QIMVGHMGEALPYWLyrldymhqagvrsqryermkpl  273
DSSP  HHhhHHHHHHHhHLHHHHLLLL-LEEELHHHHLHHHHHhhhhhhhhhhhhllllllllll


DSSP  ---hHHHHHLLLEEEELLLLlllllllllhhhhhhhllllhhhHHHHHHHHHHLLLHHHE
Query ---lTALAARGYLIGLDHIPysaiglednasasallgirswqtRALLIKALIDQGYMKQI  262
ident             |                                  ||           
Sbjct kktiEGYLKSNVLVTNSGVA-----------------------WEPAIKFCQQVMGEDRV  310
DSSP  lllhHHHHHHLEEEELLLLL-----------------------LHHHHHHHHHHHLHHHE


DSSP  EELLLLLleellllllhhhhhhhhlllHHHHHHHLHHHHhhhlLLLHHHHHHHHLHHHHH
Query LVSNDWTfgfssyvtnimdvmdrvnpdGMAFIPLRVIPFlrekGVPQETLAGITVTNPAR  322
ident     |                        |                  |      ||   
Sbjct MYAMDYP------------------yqYVADEVRAMDAM----DMSAQTKKKFFQTNAEK  348
DSSP  ELLLLLL------------------llLLHHHHHHHHLL----LLLHHHHHHHHLHHHHH


DSSP  HHLllll
Query FLSptlr  329
ident        
Sbjct WFK---l  352
DSSP  HLL---l


No 45: Query=2ob3A Sbjct=1j5sA Z-score=13.8

back to top
DSSP  ----------lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhHHHHH--
Query ----------drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkALAEK--   48
ident                               | |                       |   
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLD----------------akDIVENkp   44
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL----------------hhHHHHLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   48
ident                                                             
Sbjct wndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihl  104
DSSP  lllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhh


DSSP  --------------------------------HHHHHHHHHhllLLEEEELLLHhhlLLH
Query --------------------------------AVRGLRRARaagVRTIVDVSTFdigRDV   76
ident                                     ||      |               
Sbjct dlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMK---VEILCTTDDP--vSTL  159
DSSP  hhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLL---EEEEELLLLL--lLLL


DSSP  HHHHHHHH-HHLLEEELEEELLLLL------LHHHHL--------------lLHHHHHHH
Query SLLAEVSR-AADVHIVAATGLWFDP------PLSMRL--------------rSVEELTQF  115
ident             | |                                         |   
Sbjct EHHRKAKEaVEGVTILPTWRPDRAMnvdkegWREYVEkmgerygedtstldgFLNALWKS  219
DSSP  HHHHHHHHhLLLLEEELLLLLHHHHllllllHHHHHHhhhhhhllllllhhhHHHHHHHH


DSSP  HHHHHHlllllllLLLLEEEEELLLLL---------------------------LHHHHH
Query FLREIQygiedtgIRAGIIXVATTGKA---------------------------TPFQEL  148
ident                      |                                      
Sbjct HEHFKE-------HGCVASDHALLEPSvyyvdenraravhekafsgekltqdeiNDYKAF  272
DSSP  HHHHHL-------LLLLEEEEEELLLLlllllhhhhhhhhhhhlllllllhhhhHHHHHH


DSSP  HHHHHHHHHHHHLLLEEEELL-----------------------hhHLHHHHhHHHHHHL
Query VLKAAARASLATGVPVTTHTA-----------------------asQRDGEQqAAIFESE  185
ident            |      |                            |  |     |  |
Sbjct MMVQFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnfLRIAEG-LRYFLNE  331
DSSP  HHHHHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllLLHHHH-HHHHHHH


DSSP  LLLhhHEEELLhhHLLL-HHHHHHHHHLL--LEEEElLLLLllllllllhhhhhhhllll
Query GLSpsRVCIGHsdDTDD-LSYLTALAARG--YLIGLdHIPYsaiglednasasallgirs  242
ident                   |      |        |                         
Sbjct FDGklKIVLYV--LDPThLPTISTIARAFpnVYVGA-PWWF-----------------nd  371
DSSP  LLLllLEEEEE--LLHHhHHHHHHHHHHLllEEELL-LLLL-----------------ll


DSSP  HHHHHH-HHHHHHHLLLHHHE-EELLLLLLeellllllhhhhhhhhllLHHHHHHHLHHH
Query WQTRAL-LIKALIDQGYMKQI-LVSNDWTFgfssyvtnimdvmdrvnpDGMAFIPLRVIP  300
ident          | |              |                                 
Sbjct SPFGMEmHLKYLASVDLLYNLaGMVTDSRK-----------------lLSFGSRTEMFRR  414
DSSP  LHHHHHhHHHHHHLLLLHHHLlLLLLLLLL-----------------lLHHHHHHHHHHH


DSSP  HHHHLL------------lLHHHHHHHHLHHHHHHHLllll
Query FLREKG------------vPQETLAGITVTNPARFLSptlr  329
ident  |                   |         |         
Sbjct VLSNVVgemvekgqipikeARELVKHVSYDGPKALFF----  451
DSSP  HHHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL----


No 46: Query=2ob3A Sbjct=3qy6A Z-score=13.2

back to top
DSSP  lleeelleeelhhhhlLEEEEELLEELLllhhhhlhhhhllhhhHHHHHHHHHHHHHHLL
Query drintvrgpitiseagFTLTHEHICGSSagflrawpeffgsrkaLAEKAVRGLRRARAAG   60
ident                     | ||                             | |   |
Sbjct ----------------MIDIHCHILPAM-----------ddgagDSADSIEMARAAVRQG   33
DSSP  ----------------LEELLLLLLLLL-----------lllllLHHHHHHHHHHHHHLL


DSSP  LLEEEELLL-----HHHL-----lLHHHHHHHHH--HHLLEEELEEellllllhhhhlll
Query VRTIVDVST-----FDIG-----rDVSLLAEVSR--AADVHIVAATglwfdpplsmrlrs  108
ident  |||                        |           |                   
Sbjct IRTIIATPHhnngvYKNEpaavreAADQLNKRLIkeDIPLHVLPGQ--------------   79
DSSP  LLEEELLLEellllLLLLhhhhhhHHHHHHHHHHhlLLLLEEELLL--------------


DSSP  hhhhhhhhhhhhhllllllllllleeEEELlllllhhHHHHHHHHHHH---hhhhLLLEE
Query veeltqfflreiqygiedtgiragiiXVATtgkatpfQELVLKAAARA---slatGVPVT  165
ident                                         |    |              
Sbjct --------------------------EIRI-------YGEVEQDLAKRqllslndTKYIL  106
DSSP  --------------------------EEEL-------LLLHHHHHHLLllllhhhLLEEE


DSSP  EELLHHHLHhHHHHHHHHH--LLLLhhHEEELLHHHL----LLHHHHHHHHHLLLEEEEl
Query THTAASQRDgEQQAAIFES--EGLSpsRVCIGHSDDT----DDLSYLTALAARGYLIGLd  219
ident                 |             | |           | |  |   |      
Sbjct IEFPFDHVP-RYAEQLFYDlqLKGY--IPVIAHPERNreirENPSLLYHLVEKGAASQI-  162
DSSP  EELLLLLLL-LLHHHHHHHhhHLLL--EEEEELHHHLhhhhHLLHHHHHHHHLLLEEEE-


DSSP  LLLLllllllllhhhhhhHLLLLHHHHHHHHHHHhhlllhhhEEELLLLLLeellllllh
Query HIPYsaiglednasasalLGIRSWQTRALLIKALidqgymkqILVSNDWTFgfssyvtni  279
ident                    |         |  |           |  |            
Sbjct TSGS----------lagiFGKQLKAFSLRLVEAN------liHFVASDAHN---------  197
DSSP  EHHH----------hlllLLHHHHHHHHHHHHLL------llLEEELLLLL---------


DSSP  hhhhHHHLllhHHHHHhLHHHHHHHLlLLHHHHHHHHlHHHHHHHLLL----------ll
Query mdvmDRVNpdgMAFIPlRVIPFLREKgVPQETLAGITvTNPARFLSPT----------lr  329
ident                       |       |     |  |    |               
Sbjct ----VKTR---NFHTQ-EALYVLEKE-FGSELPYMLT-ENAELLLRNQtifrqppqpvkr  247
DSSP  ----LLLL---LLLHH-HHHHHHHHH-HLLHHHHHHH-HHHHHHHLLLllllllllllll


No 47: Query=2ob3A Sbjct=3ooqA Z-score=13.2

back to top
DSSP  -------------------------------------lleeelleeelhhhHLLEEEEEL
Query -------------------------------------drintvrgpitiseAGFTLTHEH   23
ident                                                     ||   | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  L------------EELLLLhhhhlhhhhllhhhhHHHHhHHHHHHHHLLLLEEEELLL-h
Query I------------CGSSAGflrawpeffgsrkalAEKAvRGLRRARAAGVRTIVDVST-f   70
ident |             |  |                         || | ||     |    
Sbjct IglfeegvgyyysDGNEAT--dpvtphvkaldgfNPQD-PAIERALAGGVTSVXIVPGsa  117
DSSP  LllllllllhhhlLLLLLL--llllllllhhhhlLLLL-HHHHHHHLLLEEEEEELLLll


DSSP  hhlllhhhhhhHHHHhlleeeleeellllllhhhhlllhhhhhhhhhhhhhllllllllL
Query digrdvsllaeVSRAadvhivaatglwfdpplsmrlrsveeltqfflreiqygiedtgiR  130
ident                                                             
Sbjct npvggqgsvikFRSI------------------------------------iveecivkD  141
DSSP  lleeeeeeeeeLLLL------------------------------------lhhhheeeE


DSSP  LLEEEEELLL-----------------lLLHHHHHH------------------------
Query AGIIXVATTG-----------------kATPFQELV------------------------  149
ident       |                                                     
Sbjct PAGLKXAFGEnpkrvygerkqtpstrxgTAGVIRDYftkvknyxkkkelaqkegkeftet  201
DSSP  EEEEEEELLHhhhhhhhhlllllllhhhHHHHHHHHhhhhhhhhhhhhhhhhllllllll


DSSP  --hhhhHHHHHHHLLLEEEELlHHHLHHHHHHHHHHHLLLlhhHEEELLHHHlllHHHHH
Query --lkaaARASLATGVPVTTHTaASQRDGEQQAAIFESEGLspsRVCIGHSDDtddLSYLT  207
ident           |    |   |      |      | |  |       | |           
Sbjct dlkxevGEXVLRKKIPARXHA-HRADDILTAIRIAEEFGF---NLVIEHGTE--aYKISK  255
DSSP  lhhhhhHHHHHLLLLLEEEEE-LLHHHHHHHHHHHHHHLL---LEEEEELLL--hHHHHH


DSSP  HHHHLLLEEEELLLLLLlllllllhhhhhhHLLL-lhhHHHHHHHHHHHLLLhhHEEELL
Query ALAARGYLIGLDHIPYSaiglednasasalLGIR-swqTRALLIKALIDQGYmkQILVSN  266
ident  ||                                        |  |   |    |    
Sbjct VLAEKKIPVVVGPLLTF-------------RTKLelkdLTXETIAKLLKDGV--LIALXC  300
DSSP  HHHHHLLLEEELLLLLL-------------LLLHhhllLLLLHHHHHHHLLL--LEEELL


DSSP  LLLleellllllhhhhhhhhlllHHHHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHHL-
Query DWTfgfssyvtnimdvmdrvnpdGMAFIPlRVIPFLREKGVPQETLAGITVTNPARFLS-  325
ident |                         |            |   | |  |   |||  |  
Sbjct DHP------------------viPLEFAT-VQAATAXRYGAKEEDLLKILTVNPAKILGl  341
DSSP  LLL------------------llLHHHHH-HHHHHHHHHLLLHHHHHHLLLHHHHHHLLl


DSSP  ---------------------------------------llll
Query ---------------------------------------ptlr  329
ident                                            
Sbjct edrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  lllllllllllllleeeelllllllllleeeeeelleeeeell


No 48: Query=2ob3A Sbjct=1yrrB Z-score=13.0

back to top
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL
Query -------------------------------------drintvrgpitiseaGFTLTHEH   23
ident                                                     ||      
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  L----EELLlLHHHhlhhhhllhhhhhHHHHHHHHHHHHLLLLEEEELLLHH----hllL
Query I----CGSSaGFLRawpeffgsrkalaEKAVRGLRRARAAGVRTIVDVSTFD----igrD   75
ident                            |            |                   
Sbjct GcggvQFND-TAEA----------vsvETLEIMQKANEKSGCTNYLPTLITTsdelmkqG  109
DSSP  EelleELLL-LLLL----------llhHHHHHHHHHHHLLLEEEEEEEELLLlhhhhhhH


DSSP  HHHHHHHHHHHL-LEEELEEELLLlllhhhhlllhHHHHHHHHHHHhlllllllLLLLEE
Query VSLLAEVSRAAD-VHIVAATGLWFdpplsmrlrsvEELTQFFLREIqygiedtgIRAGII  134
ident |    |                               |  |                   
Sbjct VRVMREYLAKHPnQALGLHLEGPW---------lnAALVDFLCENA--------DVITKV  152
DSSP  HHHHHHHHHHLLlLLLLEEEELLL---------llLHHHHHHHHLH--------HHEEEE


DSSP  EEELlllllhhHHHHhHHHHHHHHhHLLLEEEELLhhhLHHH-HHHHHHHHllllhhhEE
Query XVATtgkatpfQELVlKAAARASLaTGVPVTTHTAasqRDGE-QQAAIFESeglspsrVC  193
ident   |                       |  |                | |           
Sbjct TLAP------eMVPA-EVISKLAN-AGIVVSAGHS---NATLkEAKAGFRA-----giTF  196
DSSP  EELH------hHLLH-HHHHHHHH-HLLEEEELLL---LLLHhHHHHHHHH-----leEE


DSSP  ELLHHH---------lllhHHHHHHHhlLLEEEeLLLLlllllllllhhhhhhhllllHH
Query IGHSDD---------tddlSYLTALAarGYLIGlDHIPysaiglednasasallgirsWQ  244
ident   |                      |      |                           
Sbjct ATHLYNampyitgrepglaGAILDEA--DIYCG-IIAD--------------------GL  233
DSSP  ELLLLLllllllllllhhhHHHHHLL--LLEEE-EELL--------------------LL


DSSP  HHHH-HHHHHHHLlLHHHEEELLLLLleellllllhhhhhhhhlllhhHHHHhLHHHHHH
Query TRAL-LIKALIDQgYMKQILVSNDWTfgfssyvtnimdvmdrvnpdgmAFIPlRVIPFLR  303
ident       |                | |                                | 
Sbjct HVDYaNIRNAKRL-KGDKLCLVTDAT------------------sgssLTMI-EGVRNLV  273
DSSP  LLLHhHHHHHHHH-HHHHEEEELLLL------------------llllLLHH-HHHHHHH


DSSP  HL-LLLHHHHHHHHLHHHHHHHL----------------------------------lll
Query EK-GVPQETLAGITVTNPARFLS----------------------------------ptl  328
ident |  |             |||                                        
Sbjct EHcGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktivngnevvt  333
DSSP  HHhLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeeelleeeee


DSSP  l
Query r  329
ident  
Sbjct q  334
DSSP  l


No 49: Query=2ob3A Sbjct=4dziC Z-score=12.6

back to top
DSSP  lleeelleeelhhhhLLEEEEELlEELL--LLHHH-------------------------
Query drintvrgpitiseaGFTLTHEHiCGSS--AGFLR-------------------------   33
ident                       |                                     
Sbjct -----------alnyRVIDVDNH-YYEPldSFTRHldkkfkrrgvqmlsdgkrtwavigd   48
DSSP  -----------llllLEEEEEEE-LLLLllLLLLLllhhhlllleeeeelllleeeeell


DSSP  -------------------------------------hlhhHHLL--hhhHHHHHHHHHH
Query -------------------------------------awpeFFGS--rkaLAEKAVRGLR   54
ident                                                             
Sbjct rvnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkveRLADhpeyqNRDARIAVMD  108
DSSP  eellllllllllleelllllhhhhhllllllllhhhllleeLHHHlhhhlLHHHHHHHHH


DSSP  HHHhllLLEEEELL---------------------lhhhlLLHHHHHhhhhhhLLEEELE
Query RARaagVRTIVDVS---------------------tfdigRDVSLLAevsraaDVHIVAA   93
ident         |                                            |  | ||
Sbjct EQD---IETAFMLPtfgcgveealkhdieatmasvhafnlWLDEDWG--fdrpDHRIIAA  163
DSSP  HHL---EEEEEEELlhhhhhhhhllllhhhhhhhhhhhhhHHHHHLL--llllLLLEEEL


DSSP  EELlllllhhhhlLLHHHHHHHHHHHHHlllllllLLLLEEEEELLllLLHH-------h
Query TGLwfdpplsmrlRSVEELTQFFLREIQygiedtgIRAGIIXVATTgkATPF-------q  146
ident                                      |    |       |         
Sbjct PIV--------slADPTRAVEEVDFVLA-------RGAKLVLVRPA--PVPGlvkprslg  206
DSSP  LLL--------llLLHHHHHHHHHHHHH-------LLLLLEELLLL--LLLLllllllll


DSSP  hhhhHHHHHHHHHHLLLEEEEL------------------------lHHHL--HHHHHH-
Query elvlKAAARASLATGVPVTTHT------------------------aASQR--DGEQQA-  179
ident               ||||  |                                       
Sbjct drshDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldqvlldDRAIhdTMASMIv  266
DSSP  lhhhHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhhhhhlLHHHhhHHHHHHh


DSSP  HHHHHLLLLhhHEEELLHHHLLLHHH------------------hhhhHHLLLEEEElll
Query AIFESEGLSpsRVCIGHSDDTDDLSY------------------ltalAARGYLIGLdhi  221
ident                                                       |     
Sbjct HGVFTRHPK-lKAVSIENGSYFVHRLikrlkkaantqpqyfpedpveqLRNNVWIAP---  322
DSSP  LLHHHHLLL-lLEEEELLLLLHHHHHhhhhhhhhhhlhhhllllhhhhHHHHEEELL---


DSSP  llllllllllhhhhhhhllllhhhHHHH-HHHHHHLLLHHHEEELLLLLleellllllhh
Query pysaiglednasasallgirswqtRALL-IKALIDQGYMKQILVSNDWTfgfssyvtnim  280
ident                                 |        ||   ||            
Sbjct ------------------------YYEDdLPELARVIGVDKILFGSDWP-----------  347
DSSP  ------------------------LLLLlHHHHHHHHLHHHLLLLLLLL-----------


DSSP  hhhhhhlllhHHHHHhLHHHHHHhlLLLHHHHHHHHLHHHHHHHLLL-ll
Query dvmdrvnpdgMAFIPlRVIPFLRekGVPQETLAGITVTNPARFLSPT-lr  329
ident            |         |   |        |   |    |      
Sbjct ------hgegLASPV-SFTAELK--GFSESDIRKIMRDNALDLLGVQvgs  388
DSSP  ------llllLLLHH-HHHHHHL--LLLHHHHHHHHLHHHHHHHLLLlll


No 50: Query=2ob3A Sbjct=1v77A Z-score=11.7

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhhhhhhhhHHHHHHHlL
Query drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkalaekavrGLRRARAaG   60
ident                 |                                      |    
Sbjct --------------vKFIEMDIRDK-------------------------eAYELAKE-W   20
DSSP  --------------lLLEEEEELLH-------------------------hHHHHHHH-H


DSSP  LLEEEELLLhhhlllhhhhhhhhhhhlleeeleeeLLLLllhhhhlllhhhhhhhHHHHH
Query VRTIVDVSTfdigrdvsllaevsraadvhivaatgLWFDpplsmrlrsveeltqfFLREI  120
ident     |                                                       
Sbjct FDEVVVSIK--------------------------FNEE---------------vDKEKL   39
DSSP  LLEEEEEEE--------------------------ELLL---------------lLHHHH


DSSP  hllllllLLLL-----LEEEEELlllllhhHHHHHHHHHHHHHhhLLLEEEELLhhHLHH
Query qygiedtGIRA-----GIIXVATtgkatpfQELVLKAAARASLatGVPVTTHTAasQRDG  175
ident                   |                                      |  
Sbjct -------REARkeygkVAILLSN------pKPSLVRDTVQKFK--SYLIYVESN-dLRVI   83
DSSP  -------HHHHhhhllEEEEEEL------lLHHHHHHHHHHLL--LLEEEEELL-lHHHH


DSSP  HHHHHHHhhllllhhhEEELLHHH----LLLH-HHHHHHHHLLLEEEELlLLLL--LLLL
Query EQQAAIFeseglspsrVCIGHSDD----TDDL-SYLTALAARGYLIGLDhIPYS--AIGL  228
ident                   |                           |             
Sbjct RYSIEKG--------vDAIISPWVnrkdPGIDhVLAKLMVKKNVALGFS-LRPLlySNPY  134
DSSP  HHHHHLL--------lLEEELLLLllllLLLLhHHHHHHHHHLLEEEEE-LHHHhhLLHH


DSSP  lllhhhhhhhLLLLHHHHHHHHHHHHHLLLhhHEEELLLLLLeellllllhhhhhhhhll
Query ednasasallGIRSWQTRALLIKALIDQGYmkQILVSNDWTFgfssyvtnimdvmdrvnp  288
ident                       |                                     
Sbjct ---------eRANLLRFMMKAWKLVEKYKV--RRFLTSSAQE-----------------k  166
DSSP  ---------hHHHHHHHHHHHHHHHHHHLL--LEEEELLLLL-----------------h


DSSP  LHHH---HHHHlHHHHHHhllLLHHHHHHHHLHHHHHHHLllll
Query DGMA---FIPLrVIPFLRekgVPQETLAGITVTNPARFLSptlr  329
ident                                   |   |     
Sbjct WDVRyprDLIS-LGVVIG---MEIPQAKASISMYPEIILK----  202
DSSP  HHLLlhhHHHH-HHHHLL---LLHHHHHHLLLHHHHHHHL----


No 51: Query=2ob3A Sbjct=2a3lA Z-score=10.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------lleeelleeelhhhhLLEEEEELLE--------
Query ---------------------------drintvrgpitiseaGFTLTHEHIC--------   25
ident                                               || |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   25
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  --ELLLLhhhHLHHHHLL--------HHHHHHHHHHHHHHHH-HLLLlEEEELLLHH---
Query --GSSAGflrAWPEFFGS--------RKALAEKAVRGLRRAR-AAGVrTIVDVSTFD---   71
ident                              | |                            
Sbjct nlKYNPC--gQSRLREIFlkqdnliqGRFLGEITKQVFSDLEaSKYQ-MAEYRISIYgrk  297
DSSP  hhHHLLL--lLLHHHHHHllllllllLLLHHHHHHHHHHHHLlLLLE-EEEEEEELLlll


DSSP  ---hllLHHHHH--HHHHhhLLEEELEeeLLLLL--LHHH--HLLLhHHHHHHHHHHHHL
Query ---igrDVSLLA--EVSRaaDVHIVAAtgLWFDP--PLSM--RLRSvEELTQFFLREIQY  122
ident         |                    |         |                    
Sbjct msewdqLASWIVnnDLYS--ENVVWLI-qLPRLYniYKDMgiVTSF-QNILDNIFIPLFE  353
DSSP  llhhhhHHHHHHllLLLL--LLEEEEE-eEELLHhhHLLLllLLLL-HHHHHHHLLHHHH


DSSP  L-------llLLLLL--LLEEEEE-LLLL------------------lLHHHHHHHHHHH
Query G-------ieDTGIR--AGIIXVA-TTGK------------------aTPFQELVLKAAA  154
ident                             |                    |          
Sbjct AtvdpdshpqLHVFLkqVVGFDLVdDESKperrptkhmptpaqwtnafNPAFSYYVYYCY  413
DSSP  HhhlhhhlllLHHHHllEEEEEEElLLLLlllllllllllllllllllLLLHHHHHHHHH


DSSP  HHHHHHL----------LLEEEELLHHHL--HHHHHHHHhhhllllhhHEEELLHhHLLL
Query RASLATG----------VPVTTHTAASQR--DGEQQAAIfeseglspsRVCIGHSdDTDD  202
ident                       |                            | |      
Sbjct ANLYVLNklreskgmttITLRPHSGEAGDidHLAATFLT---------CHSIAHG-INLR  463
DSSP  HHHHHHHhhhlllllllLEELLLLLLLLLlhHHHHHHHH---------LLLLLLL-HHHH


DSSP  HH--HHHHHHHLLLEEEElLLLLllllllllhhhhhhHLLLLHHHHhhHHHHHHHLLLhh
Query LS--YLTALAARGYLIGLdHIPYsaiglednasasalLGIRSWQTRalLIKALIDQGYmk  260
ident  |                                                      |   
Sbjct KSpvLQYLYYLAQIGLAM-SPLS------------nnSLFLDYHRN--PFPVFFLRGL--  506
DSSP  HLhhHHHHHHHHLLLEEE-LHHH------------hlLLLLLLLLL--LHHHHHHLLL--


DSSP  HEEELLLLlleellllllhhhhhHHHLLLhhHHHHhLHHHHHHHL-LLLHHHHHHHHlHH
Query QILVSNDWtfgfssyvtnimdvmDRVNPDgmAFIPlRVIPFLREK-GVPQETLAGITvTN  319
ident     | |                                             |  |   |
Sbjct NVSLSTDD--------------pLQIHLT-kEPLV-EEYSIAASVwKLSACDLCEIA-RN  549
DSSP  LEEELLLL--------------hHHHLLL-lLHHH-HHHHHHHHHhLLLHHHHHHHH-HH


DSSP  HHHHHL------------------------------------------------------
Query PARFLS------------------------------------------------------  325
ident                                                             
Sbjct SVYQSGfshalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkav  609
DSSP  HHHHLLllhhhhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllll


DSSP  ---llll
Query ---ptlr  329
ident        
Sbjct isdevvp  616
DSSP  lllllll


No 52: Query=2ob3A Sbjct=3au2A Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------lleeelleeelhhhHLLE-EEEELleellllhhhhlhhhh
Query --------------------drintvrgpitiseAGFT-LTHEHicgssagflrawpeff   39
ident                                            |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKgDLQVH----------------  344
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLeEEEEL----------------


DSSP  llhhhhhhhhhhhhhhhhhlllleeeelllHHHL-LLHHHHHHHHHHHLLE-EELEeeLL
Query gsrkalaekavrglrraraagvrtivdvstFDIG-RDVSLLAEVSRAADVH-IVAAtgLW   97
ident                                  |      | |                 
Sbjct ----------------------------stYSDGqNTLEELWEAAKTMGYRyLAVTdhSP  376
DSSP  ----------------------------llLLLLlLLHHHHHHHHHHHLLLeEEEEeeLH


DSSP  LLLLHHHhlllhhhHHHHHHHHHHLLlllLLLL--------lLEEEEELLLLLlhhhHHH
Query FDPPLSMrlrsveeLTQFFLREIQYGiedTGIR--------aGIIXVATTGKAtpfqELV  149
ident                    |                          |             
Sbjct AVRVAGG------pSPEEALKRVGEI---RRFNethgppyllAGAEVDIHPDG---tLDY  424
DSSP  HHHLLLL------lLHHHHHHHHHHH---HHHHhhhllleeeEEEEEELLLLL---lLLL


DSSP  HHHHHHHHhhhlLLEEEEL--------lhHHLHHHHHHHHHhhllllhhHEEELLHHH--
Query LKAAARASlatgVPVTTHT--------aaSQRDGEQQAAIFeseglspsRVCIGHSDD--  199
ident      |        |                                       |     
Sbjct PDWVLREL----DLVLVSVhsrfnlpkadQTKRLLKALENP-------fVHVLAHPTArl  473
DSSP  LHHHHLLL----LEEEEELlllllllhhhHHHHHHHHHLLL-------lLLEELLLLLll


DSSP  --------LLLHHHHHHHHHLLLEEEELlLLLLlllllllhhhhhhhllllhhhHHHHHH
Query --------TDDLSYLTALAARGYLIGLDhIPYSaiglednasasallgirswqtRALLIK  251
ident          |           |     |   |                         |  
Sbjct lgrrapieADWEAVFQKAKEKGVAVEID-GYYD-----------------rmdlPDDLAR  515
DSSP  llllllllLLHHHHHHHHHHHLLEEEEE-LLLL-----------------llllLHHHHH


DSSP  HHHHLLLhhHEEELLLLLLeellllllhhhhhhhhllLHHHHHHhLHHHHHHhllllhhH
Query ALIDQGYmkQILVSNDWTFgfssyvtnimdvmdrvnpDGMAFIPlRVIPFLRekgvpqeT  311
ident      |    |  | |                       |                    
Sbjct MAYGMGL--WISLSTDAHQ--------------tdhlRFMELAV-GTAQRAW------iG  552
DSSP  HHHHLLL--LEEEELLLLL--------------hhhhHHHHHHH-HHHHHLL------lL


DSSP  HHHH-HLHHhhHHHL-LLLL---
Query LAGI-TVTNpaRFLS-PTLR---  329
ident              ||    |   
Sbjct PERVlNTLDyeDLLSwLKARrgv  575
DSSP  LLLLhHHLLhhHHHHhHHLLlll


No 53: Query=2ob3A Sbjct=3dcpA Z-score=8.4

back to top
DSSP  lleeelleeelhhhhLLEEEEELLEELLllhhhhlhhhhllhhhhhhHHHHHHHHHHHLL
Query drintvrgpitiseaGFTLTHEHICGSSagflrawpeffgsrkalaeKAVRGLRRARAAG   60
ident                     | |                                |    
Sbjct ---------------XKRDGHTHTEFCP--------------hgthdDVEEXVLKAIELD   31
DSSP  ---------------LLEEEEELLLLLL--------------lllllLHHHHHHHHHHLL


DSSP  LLEEEELLLHH-------------------------hllLHHHHHHHHHHHL--LEEELE
Query VRTIVDVSTFD-------------------------igrDVSLLAEVSRAAD--VHIVAA   93
ident       |                                                 |   
Sbjct FDEYSIVEHAPlssefxkntagdkeavttasxaxsdlpyYFKKXNHIKKKYAsdLLIHIG   91
DSSP  LLEEEEEEELLllhhhhhllllllhhhhlllllhhhhhhHHHHHHHHHHHLLllLEEEEE


DSSP  eellllllhhhhllLHHHHHHHHHHHHHllllllllLLLEEeeellllllhhhhhhhhhh
Query tglwfdpplsmrlrSVEELTQFFLREIQygiedtgiRAGIIxvattgkatpfqelvlkaa  153
ident                      |                                      
Sbjct ------fevdyligYEDFTRDFLNEYGP--------QTDDG-------------------  118
DSSP  ------eeeellllLHHHHHHHHHHHHH--------HLLEE-------------------


DSSP  hhhhhhhllleEEELL----------------------------------hHHLHHHHHH
Query araslatgvpvTTHTA----------------------------------aSQRDGEQQA  179
ident                                                          |  
Sbjct -----------VLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSI  167
DSSP  -----------EEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHH


DSSP  HHHhhllllhhhEEELLHHHL--------------------lLHHHHHHHHHLLLEEEEL
Query AIFeseglspsrVCIGHSDDT--------------------dDLSYLTALAARGYLIGLD  219
ident                ||                             |     | |     
Sbjct EAD---lglfkpRRXGHISLCqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFN  224
DSSP  HLL---llllllLEELLLLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEE


DSSP  LL-LLLLllllllhhhhhhhlLLLH-hhHHHHHHHHHHLLLhhHEEELLLLLLeelllll
Query HI-PYSAiglednasasallgIRSW-qtRALLIKALIDQGYmkQILVSNDWTFgfssyvt  277
ident                                                  |          
Sbjct TAgLFKP--------------LCGEtypPKKIVTLASELQI--PFVYGSDSHG-------  261
DSSP  LHhHHLL--------------LLLLlllLHHHHHHHHHLLL--LEEEELLLLL-------


DSSP  lhhhhhhhhllLHHHHHHHLHHHHHHhllllhhhhhhhhlhhhhhhhlllll
Query nimdvmdrvnpDGMAFIPLRVIPFLRekgvpqetlagitvtnparflsptlr  329
ident                         |                           
Sbjct ----------vQDIGRGYSTYCQKLE--------------------------  277
DSSP  ----------hHHLLLLHHHHHHHLL--------------------------


No 54: Query=2ob3A Sbjct=1m65A Z-score=8.3

back to top
DSSP  lleeelleeelhhhhlleeeeelleellllhhhhlhhhhllhhhhhhhhhhhhhhhhhll
Query drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  LLEEEELL-lHHHLL--LHHHHHHHHHHHLLE-EELEEEL-LLLLlhhhhlllhhhHHHH
Query VRTIVDVS-tFDIGR--DVSLLAEVSRAADVH-IVAATGL-WFDPplsmrlrsveeLTQF  115
ident                    |                                        
Sbjct YPVDLHMHtvASTHAysTLSDYIAQAKQKGIKlFAITDHGpDMED---------apHHWH   51
DSSP  LLEELLLLllLLLLLllLHHHHHHHHHHHLLLeEEEEEELlLLLL---------llLLHH


DSSP  HHHhHHLL--llllllllLEEEEELLLLLlhhhhhHHHHhhHHHHHhlLLEEEEL-----
Query FLReIQYG--iedtgiraGIIXVATTGKAtpfqelVLKAaaRASLAtgVPVTTHT-----  168
ident |                   |                                       
Sbjct FIN-MRIWprvvdgvgilRGIEANIKNVD---geiDCSG--KMFDS-lDLIIAGFhepvf  104
DSSP  HHH-HHHLlleelleeeeEEEEEELLLLL---lllLLLH--HHHHH-lLEEEEELlllll


DSSP  -----lhHHLHHHHH-HHHHhhllllhhhEEELLHHH----LLLHHHHHHHHHLLLEEEE
Query -----aaSQRDGEQQ-AAIFeseglspsrVCIGHSDD----TDDLSYLTALAARGYLIGL  218
ident                 |              | |        |      | |        
Sbjct aphdkatNTQAMIATiASGN--------vHIISHPGNpkyeIDVKAVAEAAAKHQVALEI  156
DSSP  llllhhhHHHHHHHHhHLLL--------lLEELLLLLllllLLHHHHHHHHHHHLLEEEE


DSSP  LllllllllllllhhhhhhhllllhhHHHHHHHHHHHLLLhhHEEELLLLLLeellllll
Query DhipysaiglednasasallgirswqTRALLIKALIDQGYmkQILVSNDWTFgfssyvtn  278
ident                                  |  | |         |           
Sbjct N----------------------nssNCREVAAAVRDAGG--WVALGSDSHT--------  184
DSSP  E----------------------lllLHHHHHHHHHHHLL--LEEEELLLLL--------


DSSP  hhhhhhhhlllHHHHHHhLHHHHHHhllllhhHHHHHHLH---HHHHHHL--LLLL----
Query imdvmdrvnpdGMAFIPlRVIPFLRekgvpqeTLAGITVT---NPARFLS--PTLR----  329
ident                                     |          ||           
Sbjct ------aftmgEFEECL-KILDAVD------fPPERILNVsprRLLNFLEsrGMAPiaef  231
DSSP  ------hhhllLLHHHH-HHHHHLL------lLHHHLHHHlhhHHHHHHHhlLLLLlhhh


DSSP  ---
Query ---  329
ident    
Sbjct adl  234
DSSP  lll


No 55: Query=2ob3A Sbjct=3f2bA Z-score=7.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ---------------------------------lleeelleeelhhhhLLEEEEELLEEL
Query ---------------------------------drintvrgpitiseaGFTLTHEHICGS   27
ident                                                      | |   |
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL


DSSP  LllhhhhlhhhhllhhhhhhhhHHHHHHHHHLLLLEEEELLLhHHLLLHHHHHHHHHHHL
Query SagflrawpeffgsrkalaekaVRGLRRARAAGVRTIVDVSTfDIGRDVSLLAEVSRAAD   87
ident                             |   |   |                       
Sbjct Q--------------mdavtsvTKLIEQAKKWGHPAIAVTDH-AVVQSFPEAYSAAKKHG  165
DSSP  L--------------llllllhHHHHHHHHHLLLLLEEELLL-LLLLLHHHHHHHHHHHL


DSSP  LEEELEEellllllhhhhlllhhhhhhhhhhhhhllllllllllleeEEELL--------
Query VHIVAATglwfdpplsmrlrsveeltqfflreiqygiedtgiragiiXVATT--------  139
ident                                                             
Sbjct MKVIYGL----------------------------------------EANIVddpfhvtl  185
DSSP  LLEEEEE----------------------------------------EEEEEllleeeee


DSSP  ----------------lllLHHH----hhHHHHHHHHHhhHLLLEeeellhhhlhhhhhh
Query ----------------gkaTPFQ----elVLKAAARASlaTGVPVtthtaasqrdgeqqa  179
ident                                          |  |               
Sbjct laqnetglknlfklvslshIQYFhrvpriPRSVLVKHR--DGLLV---------------  228
DSSP  eellhhhhhhhhhhhhhhhLLLLllllleEHHHHHHLL--LLEEE---------------


DSSP  hhhhhllllhhheEELLH--hhLLLHhhhHHHHHLLLEEEEL-llLLLLllllllhhhhh
Query aifeseglspsrvCIGHS--ddTDDLsylTALAARGYLIGLD-hiPYSAiglednasasa  236
ident                |       |        |             |             
Sbjct -------------GSGCDkgelFDNV---EDIARFYDFLEVHppdVYKP-----------  261
DSSP  -------------ELLLLllllLLLL---LLLHHHLLLEEELlhhHHLL-----------


DSSP  hhLLLL-hHHHHHHHHHHHHLLL--hHHEEELLLLLLeelllllLHHH------------
Query llGIRS-wQTRALLIKALIDQGY--mKQILVSNDWTFgfssyvtNIMD------------  281
ident               |      |                                      
Sbjct --LYVKdeEMIKNIIRSIVALGEkldIPVVATGNVHY-lnpedkIYRKilihsqgganpl  318
DSSP  --LLLLlhHHHHHHHHHHHHHHHhllLLEEELLLLLL-llhhhhHHHHhhhhllhhhlll


DSSP  hhhHHLLlHHHHhHHLHHHHHHhlLLLHHHHHHHHLHHHHHHHLL---------------
Query vmdRVNPdGMAFiPLRVIPFLRekGVPQETLAGITVTNPARFLSP---------------  326
ident                             |    | | |     |                
Sbjct nrhELPDvYFRT-TNEMLDCFS--FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpr  375
DSSP  lllLLLLlLLLL-HHHHHHHHH--HHHHHHHHHHHLHHHHHHHHLlllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh


DSSP  ----------------lll
Query ----------------tlr  329
ident                    
Sbjct lesrgcldslpdhnqlslf  994
DSSP  hhhllllllllllllllll


No 56: Query=2ob3A Sbjct=1bksA Z-score=6.6

back to top
DSSP  lleeelleeelhhHHLL-----eeeEELLEellllhhhhlhhhHLLHHHHHHHHHHHHHH
Query drintvrgpitisEAGF-----tltHEHICgssagflrawpefFGSRKALAEKAVRGLRR   55
ident               |                                             
Sbjct ------meryenlFAQLndrregafVPFVT-----------lgDPGIEQSLKIIDTLIDA   43
DSSP  ------lhhhhhhHHHHhhlllleeEEEEE-----------llLLLHHHHHHHHHHHHHL


DSSP  HHhlllleEEELLLHH---------------------------hllLHHHHHHHHhhhll
Query ARaagvrtIVDVSTFD---------------------------igrDVSLLAEVSraadv   88
ident                                                  |  |       
Sbjct GA------DALELGVPfsdpladgptiqnanlrafaagvtpaqcfeMLALIREKH----p   93
DSSP  LL------LLEEEELLllllllllhhhhhhhhhhhhhlllhhhhhhHHHHHHHHL----l


DSSP  EEELEEELLLLLlhhhhlllhhHHHHHHHHHHHlllllllLLLLEEEEELlllllhHHHH
Query HIVAATGLWFDPplsmrlrsveELTQFFLREIQygiedtgIRAGIIXVATtgkatpFQEL  148
ident  |                        |  |  |              ||         | 
Sbjct TIPIGLLMYANL------vfnnGIDAFYARCEQ-------VGVDSVLVAD-----vPVEE  135
DSSP  LLLEEEEELHHH------hhllLHHHHHHHHHH-------HLLLEEEELL-----lLHHH


DSSP  hHHHHHHHHHHHLLLEEEELlHHHL---HHHHHHHHhhhllllhhHEEELLHhhlLLHHH
Query vLKAAARASLATGVPVTTHTaASQR---DGEQQAAIfeseglspsRVCIGHSddtDDLSY  205
ident        | |                     | |           |              
Sbjct -SAPFRQAALRHNIAPIFIC-PPNAdddLLRQVASY--------gRGYTYLL-alPLHHL  184
DSSP  -LHHHHHHHHHLLLEEEEEE-LLLLlhhHHHHHHHH--------lLLLEEEL-llLHHHH


DSSP  HHHHHHLLL-EEEEL-LLLLllllllllhhhhhhhllllhHHHHHHHHHHhhlllhhhEE
Query LTALAARGY-LIGLD-HIPYsaiglednasasallgirswQTRALLIKALidqgymkqIL  263
ident    |             |                              |           
Sbjct IEKLKEYHAaPALQGfGISS-------------------pEQVSAAVRAG-------aAG  218
DSSP  HHHHHHHLLlLEEELlLLLL-------------------hHHHHHHHHHL-------lLE


DSSP  ELLLLlleellllllHHHH-------hhhhlLLHHHHHHHLHHhhhhhllllhhhhhhhh
Query VSNDWtfgfssyvtnIMDV-------mdrvnPDGMAFIPLRVIpflrekgvpqetlagit  316
ident                |                                            
Sbjct AISGS------aivkIIEKnlaspkqmlaelRSFVSAMKAASR-----------------  255
DSSP  EEELL------hhhhHHHHllllhhhhhhhhHHHHHHHHHLLL-----------------


DSSP  lhhhhhhhlllll
Query vtnparflsptlr  329
ident              
Sbjct -------------  255
DSSP  -------------


No 57: Query=2ob3A Sbjct=2yb1A Z-score=6.0

back to top
DSSP  lleeelleeelhhhhlLEEEEELlEELLllhhhhlhhhhllhhhhHHHHHHHHHHHhhll
Query drintvrgpitiseagFTLTHEHiCGSSagflrawpeffgsrkalAEKAVRGLRRAraag   60
ident                     | |    |                  |   |   ||    
Sbjct ---------------aNIDLHFH-SRTS-----------dgaltpTEVIDRAAARA----   29
DSSP  ---------------lLEELLLL-LLLL-----------lllllhHHHHHHHHLLL----


DSSP  LLEEEELLLhhHLLLHHHHHHHHHHHLLEEELEeellllllhhhhlllhhhhhhhhhhhh
Query VRTIVDVSTfdIGRDVSLLAEVSRAADVHIVAAtglwfdpplsmrlrsveeltqfflrei  120
ident                    |                                        
Sbjct PALLALTDH-dCTGGLAEAAAAAARRGIPFLNG---------------------------   61
DSSP  LLEEEELLL-lLLLLHHHHHHHHHHLLLLEEEE---------------------------


DSSP  hllllllllllleeEEELLLL---------------------------------------
Query qygiedtgiragiiXVATTGK---------------------------------------  141
ident                |                                            
Sbjct -------------vEVSVSWGrhtvhivglgidpaepalaaglksiregrlerarqmgas  108
DSSP  -------------eEEEEEELleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhh


DSSP  --------------------------------------------------------lLHH
Query --------------------------------------------------------aTPF  145
ident                                                             
Sbjct leaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQ  168
DSSP  hhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLL


DSSP  HhhhHHHHHHHHhhHLLLeeeellhhhlhhhhhhhhhhhllllhhHEEELLHHHLL-LHH
Query QelvLKAAARASlaTGVPvtthtaasqrdgeqqaaifeseglspsRVCIGHSDDTD-DLS  204
ident     |  |                                        | |    |    
Sbjct W-asLEDAVGWI-vGAGG---------------------------MAVIAHPGRYDmGRT  199
DSSP  L-llHHHHHHHH-hHLLL---------------------------EEEELLHHHLLlLHH


DSSP  HHHHHHHL-----lLEEE-ELLLllllllllllhhhhhhhllllHHHHHHHHHHHHHLLL
Query YLTALAAR-----gYLIG-LDHIpysaiglednasasallgirsWQTRALLIKALIDQGY  258
ident     |           |                                       |   
Sbjct LIERLILDfqaaggQGIEvASGS--------------------hSLDDMHKFALHADRHG  239
DSSP  HHHHHHHHhhhlllLEEEeEELL--------------------lLHHHHHHHHHHHHHHL


DSSP  HhhEEELLLLLleellllllhHHHHhhhlllHHHHHHhlhhhhhhhllllhhHHHHHhlh
Query MkqILVSNDWTfgfssyvtniMDVMdrvnpdGMAFIPlrvipflrekgvpqeTLAGItvt  318
ident         |                                                   
Sbjct L-yASSGSDFH----------APGE-----dVGHTED-------------lpPICRP---  267
DSSP  L-eEEEELLLL----------LLLL-----lLLLLLL-------------llLLLLL---


DSSP  HHHHHHL------llll
Query NPARFLS------ptlr  329
ident                  
Sbjct IWRELEArilrpadaen  284
DSSP  HHHHLHHhlllllhhhl


No 58: Query=2ob3A Sbjct=3e38A Z-score=5.2

back to top
DSSP  --lleeelleeelhhhhLLEEEEELLEELlllhhhhlhhhhllhhhhhhhhHHHHHHHHH
Query --drintvrgpitiseaGFTLTHEHICGSsagflrawpeffgsrkalaekaVRGLRRARA   58
ident                       | |   |                            |  
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVFS----------------dglvwpTVRVDEAYR   44
DSSP  llllllllllllllleeEEEELLLLLLLL----------------lllllhHHHHHHHHH


DSSP  LLLLEEEELLL----------hhhLLLH-HHHHHHHHHHLLEEELEEELLLlllhhhhll
Query AGVRTIVDVST----------fdiGRDV-SLLAEVSRAADVHIVAATGLWFdpplsmrlr  107
ident  |   |                        |  |                          
Sbjct DGLDAISLTEHieyrphkqdvvsdHNRSfDLCREQAEKLGILLIKGSEITR---------   95
DSSP  LLLLEELLEEElllllllllllllLLHHhHHHHHHHHHHLLEELLEEEEEL---------


DSSP  lhhhhhhhhhhhhhllllllllllleeeeelLLLL---------------lHHHHHHHHH
Query sveeltqfflreiqygiedtgiragiixvatTGKA---------------tPFQELVLKA  152
ident                                                             
Sbjct -------------------------------AXAPghfnaiflsdsnpleqKDYKDAFRE  124
DSSP  -------------------------------LLLLleeeeelllllhhhllLLHHHHHHH


DSSP  HHHHHhhhlLLEEEELLH--------HHLH--HHHHHHHHhhllllhhhEEELL----hH
Query AARASlatgVPVTTHTAA--------SQRD--GEQQAAIFeseglspsrVCIGH----sD  198
ident |                                                  |        
Sbjct AKKQG----AFXFWNHPGwdsqqpdtTKWWpeHTALYQEG-------cxHGIEVanghlY  173
DSSP  HHHLL----LEEEELLLLllllllllLLLLhhHHHHHHLL-------llLEEEEeelleE


DSSP  HLLlhhhHHHHHHLLLEEEelllllllllllllhhhhhhhllllhhhhhhhhhhhhhlll
Query DTDdlsyLTALAARGYLIGldhipysaiglednasasallgirswqtrallikalidqgy  258
ident                                                             
Sbjct XPE---aIQWCLDKNLTXI-----------------------------------------  189
DSSP  LLH---hHHHHHHHLLEEE-----------------------------------------


DSSP  hhheeELLLLLLeellllllhhhhhHHHLLL--hhHHHHhlhhhhhhhllllhhhhhhhH
Query mkqilVSNDWTFgfssyvtnimdvmDRVNPD--gmAFIPlrvipflrekgvpqetlagiT  316
ident         |                                                   
Sbjct -----GTSDIHQ-----------piQTDYDFekgeHRTX-------------------tF  214
DSSP  -----EELLLLL-----------lhHHHLLHhhllLLLE-------------------eE


DSSP  LHH--------HHHHH--------------------------------------------
Query VTN--------PARFL--------------------------------------------  324
ident |                                                           
Sbjct VFAkerslqgiREALDnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsit  274
DSSP  EEEllllhhhhHHHHHllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct nvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdk  334
DSSP  ellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelle


DSSP  ---lllll
Query ---sptlr  329
ident         
Sbjct glkytisl  342
DSSP  eeeeeeel


No 59: Query=2ob3A Sbjct=2anuA Z-score=5.1

back to top
DSSP  lleeelleeelHHHHlLEEEEELLEELlllhhhhlhhhhllhhhhhhHHHHHHHHHHHLL
Query drintvrgpitISEAgFTLTHEHICGSsagflrawpeffgsrkalaeKAVRGLRRARAAG   60
ident                     | |   |                                |
Sbjct -----------TEWL-LCDFHVHTNXS----------------dghlPLGEVVDLFGKHG   32
DSSP  -----------LEEE-EEEEEELLLLL----------------llllLHHHHHHHHHHLL


DSSP  LLEEEELLLHH----------------------hllLHHHHHHHHHHHL----LEEE-LE
Query VRTIVDVSTFD----------------------igrDVSLLAEVSRAAD----VHIV-AA   93
ident |                                       |      |            
Sbjct VDVVSITDHIVdrrtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIpGV   92
DSSP  LLEEEEEEEEElhhhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEeEE


DSSP  EElLLLLlhhhhlllhhhhhhhhhhhhhllllllllllleeeeellllllhhhhHHHHHH
Query TGlWFDPplsmrlrsveeltqfflreiqygiedtgiragiixvattgkatpfqeLVLKAA  153
ident                                                       |     
Sbjct EI-TNNT------------------------------dlyhivavdvkeyvdpsLPVEEI  121
DSSP  EE-EELL------------------------------lleeeeeelllllllllLLHHHH


DSSP  HHHHHHHLLLEEEELL---hHHLHHHHHHHHHHHllllhhHEEELlhhhlllhhhHHHHH
Query ARASLATGVPVTTHTA---aSQRDGEQQAAIFESeglspsRVCIGhsddtddlsyLTALA  210
ident           |                    |                            
Sbjct VEKLKEQNALVIAAHPdrkkLSWYLWANXERFKD-----tFDAWE---ianrddlFNSVG  173
DSSP  HHHHHHLLLEEEELLLllllLLLHHHHLLLLLLL-----lLLEEE---eeelleeLHHHH


DSSP  HLLLEEeelllllllllllllhhhhhhhllllhhhhhhhhhhhhhlllhhheEELLLLLl
Query ARGYLIgldhipysaiglednasasallgirswqtrallikalidqgymkqiLVSNDWTf  270
ident    |                                                    |   
Sbjct VKKYRY----------------------------------------------VANSDFH-  186
DSSP  HLLLLE----------------------------------------------EEELLLL-


DSSP  eellllllhhhhhhhhllLHHHHHhhlhhhhhhhllllhhhhhhhHLHH----hhHHHL-
Query gfssyvtnimdvmdrvnpDGMAFIplrvipflrekgvpqetlagiTVTN----paRFLS-  325
ident                                              |              
Sbjct -----------------eLWHVYS-------------------wkTLVKseknieAIKEa  210
DSSP  -----------------lHHHHLL-------------------eeEEEEelllhhHHHHh


DSSP  ----------llll
Query ----------ptlr  329
ident               
Sbjct irkntdvaiylxrk  224
DSSP  hhhllleeeeelll