Results: dupa

Query: 2imrA

MOLECULE: HYPOTHETICAL PROTEIN DR_0824;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2imr-A 69.7  0.0  380   380  100 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
   2:  2uz9-A 29.5  4.3  319   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   3:  1j6p-A 28.3  4.1  297   407   18 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   4:  3ls9-A 28.2  3.8  306   453   21 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   5:  4rdv-B 26.0  5.0  316   451   21 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   6:  2paj-A 26.0  4.8  298   421   26 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   7:  1k6w-A 23.5  4.3  298   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   8:  2oof-A 22.3  5.0  300   403   15 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   9:  4cqb-A 21.9  4.9  290   402   14 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  10:  3icj-A 21.0  5.6  279   468   17 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  11:  4c5y-A 20.3  5.7  294   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  12:  3mkv-A 20.3  4.1  267   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  13:  3mtw-A 20.3  4.3  275   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  14:  2vun-A 18.9  5.9  291   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  2ogj-A 18.3  5.4  294   379   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  16:  1a4m-A 17.6  3.1  245   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  17:  1gkp-A 17.1  5.4  294   458   14 PDB  MOLECULE: HYDANTOINASE;                                              
  18:  2y1h-B 16.6  3.0  222   265   14 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  19:  1onx-A 16.3  4.6  279   390   14 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  20:  3giq-A 16.3  4.1  267   475   13 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  21:  1yrr-B 16.2  4.4  258   334    9 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  22:  3nqb-A 15.9  5.1  273   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  23:  3k2g-B 15.7  3.7  243   358   16 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  24:  3gg7-A 15.6  3.2  202   243   14 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  25:  3e74-A 15.6  5.0  270   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  26:  1bf6-A 15.5  3.8  235   291   14 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  27:  3gri-A 15.5  4.4  266   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  28:  4b3z-D 15.4  5.7  290   477   11 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  29:  3cjp-A 14.9  3.3  213   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  30:  3ooq-A 14.9  5.4  249   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  31:  4dlf-A 14.8  3.5  224   287    8 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  32:  3irs-A 14.7  3.8  230   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  33:  2ob3-A 14.2  3.9  227   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  34:  2ffi-A 13.6  3.5  219   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  2vc5-A 13.6  4.0  224   314   10 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  36:  2a3l-A 13.6  3.6  247   616   13 PDB  MOLECULE: AMP DEAMINASE;                                             
  37:  4mup-B 13.4  3.5  224   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  38:  1v77-A 13.3  2.7  179   202    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  39:  2dvt-A 13.3  3.6  227   325   11 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  40:  4qrn-A 13.1  4.1  237   352    9 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  41:  4ofc-A 12.7  3.8  215   335   10 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  42:  4hk5-D 12.7  4.0  227   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  43:  4dzi-C 12.5  3.6  216   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  44:  1a5k-C 12.3  3.7  244   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  3pnu-A 12.2  3.7  228   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  46:  2qpx-A 11.6  4.1  217   376    8 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  47:  1itq-A 11.3  3.6  213   369   13 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  48:  1j5s-A 11.0  3.4  218   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  2gwg-A 10.9  3.7  203   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  50:  3iac-A 10.9  3.5  219   469   14 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  3dcp-A 10.5  3.6  186   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  52:  3qy6-A 10.1  3.5  180   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  53:  3au2-A  9.6  4.9  197   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3f2b-A  8.9  7.3  170   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1m65-A  8.1  3.3  170   234   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  7.7  3.6  179   255   11 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.8  3.7  146   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.3  3.7  153   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  5.3  3.4  132   224    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2imrA Sbjct=2imrA Z-score=69.7

back to top
DSSP  LLEEEEEELEEELLEELLEEEEEELLEEEEEELHHHHHHHLLLLEEEELLLEELLLLLEE
Query HTPRLLTCDVLYTGAQSPGGVVVVGETVAAAGHPDELRRQYPHAAEERAGAVIAPPPVNA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HTPRLLTCDVLYTGAQSPGGVVVVGETVAAAGHPDELRRQYPHAAEERAGAVIAPPPVNA   60
DSSP  LLEEEEEELEEELLEELLEEEEEELLEEEEEELHHHHHHHLLLLEEEELLLEELLLLLEE


DSSP  EEELLLLHHHHHHLHHHHLLHHHHHHHLLLLHHHHHHHHHHHHHHLLLLLEEEEELLHHH
Query HTHLDMSAYEFQALPYFQWIPEVVIRGRHLRGVAAAQAGADTLTRLGAGGVGDIVWAPEV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HTHLDMSAYEFQALPYFQWIPEVVIRGRHLRGVAAAQAGADTLTRLGAGGVGDIVWAPEV  120
DSSP  EEELLLLHHHHHHLHHHHLLHHHHHHHLLLLHHHHHHHHHHHHHHLLLLLEEEEELLHHH


DSSP  HHHHHLLLLLLEEEEEEELLLLHHHHHHHHHHHHHHHHHHHLLLLLLEEEEEEELLLLLL
Query MDALLAREDLSGTLYFEVLNPFPDKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MDALLAREDLSGTLYFEVLNPFPDKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTV  180
DSSP  HHHHHLLLLLLEEEEEEELLLLHHHHHHHHHHHHHHHHHHHLLLLLLEEEEEEELLLLLL


DSSP  LHHHHHHHHHHHHHHLLLLEEEELLLHHHHHHHHHLLLLLHHHLLHHHLLLLHHHHHLLL
Query SHRLMRLLSDYAAGEGLPLQIHVAEHPTELEMFRTGGGPLWDNRMPALYPHTLAEVIGRE  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SHRLMRLLSDYAAGEGLPLQIHVAEHPTELEMFRTGGGPLWDNRMPALYPHTLAEVIGRE  240
DSSP  LHHHHHHHHHHHHHHLLLLEEEELLLHHHHHHHHHLLLLLHHHLLHHHLLLLHHHHHLLL


DSSP  LLLLLLHHHHHHHHLLHHHLLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLL
Query PGPDLTPVRYLDELGVLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFD  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PGPDLTPVRYLDELGVLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFD  300
DSSP  LLLLLLHHHHHHHHLLHHHLLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLL


DSSP  HHHHHHLLLLEEELLLLHHHHLLLLLHHHHHHHHHHLLLLLHHHHHHHHHHHHHHHHLLL
Query WPAFAAAGVEVALGTDSVASGETLNVREEVTFARQLYPGLDPRVLVRAAVKGGQRVVGTP  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct WPAFAAAGVEVALGTDSVASGETLNVREEVTFARQLYPGLDPRVLVRAAVKGGQRVVGTP  360
DSSP  HHHHHHLLLLEEELLLLHHHHLLLLLHHHHHHHHHHLLLLLHHHHHHHHHHHHHHHHLLL


DSSP  LLLLLLLLLHHHLHHHLLLL
Query FLRRGETWQEGFRWELSRDL  380
ident ||||||||||||||||||||
Sbjct FLRRGETWQEGFRWELSRDL  380
DSSP  LLLLLLLLLHHHLHHHLLLL


No 2: Query=2imrA Sbjct=2uz9A Z-score=29.5

back to top
DSSP  --llEEEEEEleEELL---EELLEE-EEEELL-----EEEEeelhhhHHHHLL-------
Query --htPRLLTCdvLYTG---AQSPGG-VVVVGE-----TVAAaghpdeLRRQYP-------   42
ident         |                                         |         
Sbjct plahIFRGTF--VHSTwtcPMEVLRdHLLGVSdsgkiVFLE------EASQQEklakewc   52
DSSP  llleEEEEEE--EELLlllLLEEEEeEEEEELlllleEEEE------EHHHHHhhhhhhl


DSSP  ----lLEEEEllleELLLLLEEEEELLL-----lhhhhhhLHHHhllhhhHHHH-LLLL-
Query ----hAAEERagavIAPPPVNAHTHLDM-----sayefqaLPYFqwipevVIRG-RHLR-   91
ident        |        |  |  | |               |                   
Sbjct fkpceIRELShhefFMPGLVDTHIHASQysfagssidlplLEWL------TKYTfPAEHr  106
DSSP  llhhhEEELLllleEEELEEEEEEEHHHhhhllllllllhHHHH------HHLHhHHHHh


DSSP  ------HHHHHHHHHHHHHHLLLLLEEEEEL-LHHHHHHHHLL---LLLLEEEEEEELLL
Query ------GVAAAQAGADTLTRLGAGGVGDIVW-APEVMDALLAR---EDLSGTLYFEVLNP  141
ident                      |                 |                    
Sbjct fqnidfAEEVYTRVVRRTLKNGTTTACYFATiHTDSSLLLADItdkFGQRAFVGKVCMDL  166
DSSP  hhlhhhHHHHHHHHHHHHHHLLEEEEEEELLlLHHHHHHHHHHhhhHLLEEEEELEELLL


DSSP  ------lhhHHHHHHHHHHHHHHHHHLLLLLLEEEEEEELLLLLLLHHHHHHHHHHHHHH
Query ------fpdKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTVSHRLMRLLSDYAAGE  195
ident             |                         |      |  ||  |   |   
Sbjct ndtfpeykeTTEESIKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTR  226
DSSP  lllllllllLHHHHHHHHHHHHHHHHHHLLLLEEEEEEELLHHHLLHHHHHHHHHHHHHH


DSSP  LLLLEEEELLLHHHHHHHHHLllllhhhllhhhllllhhhhhlllLLLLLLHHHHHHHHL
Query GLPLQIHVAEHPTELEMFRTGggplwdnrmpalyphtlaevigrePGPDLTPVRYLDELG  255
ident  |  | |  |   | |                                        |   
Sbjct DLHIQSHISENRDEVEAVKNL------------------------YPSYKNYTSVYDKNN  262
DSSP  LLEEEEEELLLHHHHHHHHHH------------------------LLLLLLHHHHHHHLL


DSSP  LHHHLLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLLHHHHHHLLLLEEELL
Query VLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGVEVALGT  315
ident  |       |               |     || ||  |  |           |   |||
Sbjct LLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGT  322
DSSP  LLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELL


DSSP  LLHhHHLLLLLHHHHHHHHHHLL----------LLLHHHHHHHHHHHHHHHHL----LLL
Query DSVaSGETLNVREEVTFARQLYP----------GLDPRVLVRAAVKGGQRVVG----TPF  361
ident |    |           |                |      | |  ||    |       
Sbjct DVA-GGYSYSMLDAIRRAVMVSNillinkvnekSLTLKEVFRLATLGGSQALGldgeIGN  381
DSSP  LLL-LLLLLLHHHHHHHHHHHHHhhhhllllllLLLHHHHHHHHLHHHHHHLLllllLLL


DSSP  LLLLllllhHHLHHH-----------------------------LLLL------------
Query LRRGetwqeGFRWEL-----------------------------SRDL------------  380
ident    |                                          |             
Sbjct FEVG-kefdAILINPkasdspidlfygdffgdiseaviqkflylGDDRnieevyvggkqv  440
DSSP  LLLL-llllEEEELLlllllllllllhhhhlllllhhhhhhhhhLLHHheeeeeelleee


DSSP  ----
Query ----  380
ident     
Sbjct vpfs  444
DSSP  elll


No 3: Query=2imrA Sbjct=1j6pA Z-score=28.3

back to top
DSSP  --lleEEEEeleeeLLEELLEEEEE------elLEEEEeelhhhHHHHllllEEEELlle
Query --htpRLLTcdvlyTGAQSPGGVVV------vgETVAAaghpdeLRRQyphaAEERAgav   52
ident                   |                |                        
Sbjct hhxiiGNCL---ilKDFSSEPFWGAveiengtiKRVLQ------GEVK-vdlDLSGK--l   48
DSSP  leeeeEEEE---elLLLLLLLEEEEeeeelleeEEEEE------LLLL-lleELLLE--e


DSSP  ELLLLLEEEEELLL-lhhhhhhlhHHHLL--HHHHH---hhlllLHHHHHHHHHHHHHHL
Query IAPPPVNAHTHLDM-sayefqalpYFQWI--PEVVI---rgrhlRGVAAAQAGADTLTRL  106
ident   |   | |||              |       |                        | 
Sbjct VXPALFNTHTHAPXtllrgvaedlSFEEWlfSKVLPiedrltekXAYYGTILAQXEXARH  108
DSSP  EEELEEEEEELHHHhhhlllllllLHHHHhhLLHHHhhllllhhHHHHHHHHHHHHHHLL


DSSP  LLLLEEEEELL-HHHHHHHHLLlLLLEEEEEEELLLLHhHHHHHHHHHHHHHHHHHlLLL
Query GAGGVGDIVWA-PEVMDALLAReDLSGTLYFEVLNPFPdKADEVFAAARTHLERWRrLER  165
ident |  |  |          |          |                         |     
Sbjct GIAGFVDXYFHeEWIAKAVRDF-GXRALLTRGLVDSNG-DDGGRLEENLKLYNEWN-GFE  165
DSSP  LEEEEEEEELLhHHHHHHHHHH-LLEEEEEEEELLLLL-LLLLHHHHHHHHHHHHL-LHH


DSSP  LLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLLEEEELLLHHHHhhhhhlllllhhhll
Query PGLRLGLSPHTPFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTELemfrtgggplwdnrm  225
ident      |  || |   |        | |     |  ||  |   |                
Sbjct GRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEE---------------  210
DSSP  HLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLEEEEELLLLLLL---------------


DSSP  hhhllllhhhhhllllllllLHHHHHHHhLLHH-HLLEEEELLLLLHHHHHHHHHHLLLE
Query palyphtlaevigrepgpdlTPVRYLDElGVLA-ARPTLVHMVNVTPDDIARVARAGCAV  284
ident                                |        | |                |
Sbjct --------------------YDLEDILN-IGLKeVKTIAAHCVHLPERYFGVLKDIPFFV  249
DSSP  --------------------LLLHHHHL-LLLLlLLEEEEELLLLLHHHHHHHLLLLEEE


DSSP  EELHHHHHHLLLLLLLHHHHHHLLLLEEELLLLHHHHLLLLLHHHHHHHHHHLL-----L
Query VTCPRSNHHLECGTFDWPAFAAAGVEVALGTDSVASGETLNVREEVTFARQLYP-----G  339
ident    | ||  |  |          |  | ||||  ||   ||   |   |  |        
Sbjct SHNPASNLKLGNGIAPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASLLQKaqnprN  309
DSSP  EELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHHHlllllL


DSSP  LLHHHHHHHHHHHHHHHHL--LLLLLLlllllhHHLH--------------------HHL
Query LDPRVLVRAAVKGGQRVVG--TPFLRRgetwqeGFRW--------------------ELS  377
ident ||           |    |                                         
Sbjct LDVNTCLKXVTYDGAQAXGfkSGKIEE-gwnadLVVIdldlpexfpvqniknhlvhaFSG  368
DSSP  LLHHHHHHHHLHHHHHHHLllLLLLLL-lllllEEEEelllhhhllhhhhhhhhhhlLLL


DSSP  LL------------------------------------l
Query RD------------------------------------l  380
ident                                        
Sbjct EVfatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  LLleeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 4: Query=2imrA Sbjct=3ls9A Z-score=28.2

back to top
DSSP  -lleEEEEEleEELL---EELLE-EEEE-elleeEEEElhhhHHHHL----llleeEELL
Query -htpRLLTCdvLYTG---AQSPG-GVVV-vgetvAAAGhpdeLRRQY----phaaeERAG   50
ident     | ||     |                     | |                      
Sbjct miliRGLTR--VITFddqERELEdADILidgpkiVAVG----KDLSDrsvsrtidgRGMI   54
DSSP  leeeEEEEE--EELLlllLLEEEeEEEEeelleeEEEE----LLLLLlllleeeelLLEE


DSSP  leELLLLLEEEEELLL---lhhhhhhlHHHHLLhhHHHHHLL------------llHHHH
Query avIAPPPVNAHTHLDM---sayefqalPYFQWIpeVVIRGRH------------lrGVAA   95
ident     |   | | ||                                              
Sbjct --ALPGLINSHQHLYEgamraipqlerVTMASW--LEGVLTRsagwwrdgkfgpdvIREV  110
DSSP  --EEELEEEEEELHHHhhhlllhhhllLLHHHH--HHHHHHHhhhhhhlllllhhhHHHH


DSSP  HHHHHHHHHHLLLLLEEEEELL------HHHHHHHHLL---LLLLEEEEEEELLLL----
Query AQAGADTLTRLGAGGVGDIVWA------PEVMDALLAR---EDLSGTLYFEVLNPF----  142
ident | |        |   | |              ||                          
Sbjct ARAVLLESLLGGITTVADQHLFfpgataDSYIDATIEAatdLGIRFHAARSSMTLGkseg  170
DSSP  HHHHHHHHHHLLEEEEEEEELLllllllLLHHHHHHHHhhhHLLEEEEEELLLLLLhhhl


DSSP  ---hhhhhhHHHHHHHHHHHHH-LLLL----LLEEEEEEELLLLLLLHHHHHHHHHHHHH
Query ---pdkadeVFAAARTHLERWR-RLER----PGLRLGLSPHTPFTVSHRLMRLLSDYAAG  194
ident                 |                 |  | |         |       || 
Sbjct gfcddlfvePVDRVVQHCLGLIdQYHEpepfGMVRIALGPCGVPYDKPELFEAFAQMAAD  230
DSSP  llllhhhllLHHHHHHHHHHHHhHHLLllllLLEEEEELLLLLLLLLHHHHHHHHHHHHH


DSSP  HLLLLEEEELLLhHHHHHHHhlllllhhhllhhhllllhhhhhlLLLLllLLHHHHHHHH
Query EGLPLQIHVAEHpTELEMFRtgggplwdnrmpalyphtlaevigREPGpdLTPVRYLDEL  254
ident     |  |  |      |                             |   || | |   
Sbjct YDVRLHTHFYEP-LDAGMSD------------------------HLYG--MTPWRFLEKH  263
DSSP  HLLEEEEEELLL-LHHHHHH------------------------HHHL--LLHHHHHHHL


DSSP  LLHHHLLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLLHHHHHHLLLLEEEL
Query GVLAARPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGVEVALG  314
ident |    |  | | |      |   | || |             |         ||  |  |
Sbjct GWASDRVWLAHAVVPPREEIPEFADAGVAIAHLIAPDLRMGWGLAPIREYLDAGITVGFG  323
DSSP  LLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEEL


DSSP  LLLHHHHLLLLLHHHHHHHHHHLL---------LLLHHHHHHHHHHHHHHHHL----LLL
Query TDSVASGETLNVREEVTFARQLYP---------GLDPRVLVRAAVKGGQRVVG----TPF  361
ident |   ||    |       |               |  | | | |  |     |       
Sbjct TTGSASNDGGNLLGDLRLAALAHRpadpnepekWLSARELLRMATRGSAECLGrpdlGVL  383
DSSP  LLLLLLLLLLLHHHHHHHHHHHLHhhllllhhhLLLHHHHHHHLLHHHHHHLLllllLLL


DSSP  LLllllllhHHLHH---------------------HLLL---------------------
Query LRrgetwqeGFRWE---------------------LSRD---------------------  379
ident             |                        |                      
Sbjct EE--graadIACWRldgvdrvgvhdpaiglimtglSDRAslvvvngqvlvenerpvladl  441
DSSP  LL--lllllEEEEElllhhhlllllhhhhhhhlllLLLLleeeelleeeeelleellllh


DSSP  -----------l
Query -----------l  380
ident             
Sbjct erivanttalip  453
DSSP  hhhhhhhhhhll


No 5: Query=2imrA Sbjct=4rdvB Z-score=26.0

back to top
DSSP  lLEEEEEEleEELLeELLEEEEEELL-----EEEEeelHHHHhhhLLLLEEEELLleELL
Query hTPRLLTCdvLYTGaQSPGGVVVVGE-----TVAAaghPDELrrqYPHAAEERAGavIAP   55
ident           |         |                 ||        |          |
Sbjct -SAIFAER-aLLPE-GWARNVRFEISadgvlAEIR---PDAN---ADGAERLGGA--VLP   49
DSSP  -LEEEEEE-eEELL-EEEEEEEEEELlllleEEEE---LLLL---LLLLEELLLL--EEE


DSSP  LLLEEEEELLL-------lhhhhhhlHHHHLLHHHHHHHLL---lLHHHHHHHHHHHHHH
Query PPVNAHTHLDM-------sayefqalPYFQWIPEVVIRGRH---lRGVAAAQAGADTLTR  105
ident    | | |                      |                   |         
Sbjct GMPNLHSHAFQramaglaevagnpndSFWTWRELMYRMVARlspeQIEVIACQLYIEMLK  109
DSSP  LEEEEEELHHHhhhllllllllllllLHHHHHHHHHHHHLLllhhHHHHHHHHHHHHHHH


DSSP  LLLLLEEEEELLH------------HHHHHHHLLL---LLLEEEEEEELLL----LHHH-
Query LGAGGVGDIVWAP------------EVMDALLARE---DLSGTLYFEVLNP----FPDK-  145
ident  |   |                   |                ||                
Sbjct AGYTAVAEFHYVHhdldgrsyadpaELSLRISRAAsaaGIGLTLLPVLYSHagfgGQPAs  169
DSSP  HLEEEEEEEELLLllllllllllllHHHHHHHHHHhhhLLEEEEEELLLLEeellLEELl


DSSP  -----hhhHHHHHHHHHHHHHLLLL-LLEEEEEEELLLLLLLHHHHHHHHHHhHHHLLLL
Query -----adeVFAAARTHLERWRRLER-PGLRLGLSPHTPFTVSHRLMRLLSDYaAGEGLPL  199
ident            |    | | |      |  |||  |    |                || 
Sbjct egqrrfinGSEAYLELLQRLRAPLEaAGHSLGLCFHSLRAVTPQQIATVLAA-GHDDLPV  228
DSSP  hhhlllllLHHHHHHHHHHHHHHHHhHLLEELEEELLLLLLLHHHHHHHHLL-LLLLLLE


DSSP  EEEELLLHHHHHHHHhlllllhhhllhhhllllhhhhhllLLLLlLLHHHHHHHHLlHHH
Query QIHVAEHPTELEMFRtgggplwdnrmpalyphtlaevigrEPGPdLTPVRYLDELGvLAA  259
ident  || ||   |                                     |   | |      
Sbjct HIHIAEQQKEVDDCQ-------------------------AWSG-RRPLQWLYENV-AVD  261
DSSP  EEEELLLHHHHHHHH-------------------------HHHL-LLHHHHHHHHL-LLL


DSSP  L-LEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLLLLLLHHHHHHLLLLEEELLLLH
Query R-PTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLECGTFDWPAFAAAGVEVALGTDSV  318
ident     |||     |   |  || |     |      |  | |    | | |     | || 
Sbjct QrWCLVHATHADPAEVAAMARSGAVAGLCLSTEANLGDGIFPATDFLAQGGRLGIGSDSH  321
DSSP  LlEEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLL


DSSP  hhhLLLLLHHHHHHHHHHL-------LLLL-------HHHHHHHHHHHHHHHHL---LLL
Query asgETLNVREEVTFARQLY-------PGLD-------PRVLVRAAVKGGQRVVG---TPF  361
ident      | | ||                 |         | |  ||  ||    |      
Sbjct ---VSLSVVEELRWLEYGQrlrdrkrNRLYrddqpmiGRTLYDAALAGGAQALGqpiGSL  378
DSSP  ---LLLLHHHHHHHHHHHHhhhhlllLLLLllllllhHHHHHHHHHHHHHHHHLlllLLL


DSSP  LLllllllhHHLH-------------------------HHLL------------------
Query LRrgetwqeGFRW-------------------------ELSR------------------  378
ident                                          |                  
Sbjct AV--grradLLVLdgndpylasaegdallnrwlfaggdRQVRdvmvagrwvvrdgrhage  436
DSSP  LL--lllllEEEEllllhhhhllllhhhhhhhhhhllhHHEEeeeelleeeelllllllh


DSSP  -------------ll
Query -------------dl  380
ident                
Sbjct ersarafvqvlgell  451
DSSP  hhhhhhhhhhhhhhl


No 6: Query=2imrA Sbjct=2pajA Z-score=26.0

back to top
DSSP  LLEE-EEEELEEELL-------EELLEE-EEEELlEEEEEElhhHHHHH-llLLEE-EEL
Query HTPR-LLTCDVLYTG-------AQSPGG-VVVVGeTVAAAGhpdELRRQ-ypHAAE-ERA   49
ident               |          ||     || |  | |    |              
Sbjct PSTLiRNAAAIMTGGrgtaddpSRVPGPdIRIVGdTIDAIG---ALAPRpgeTIVDaTDC   57
DSSP  LEEEeELLLEELLLLlllllllLLLLLLlEEEELlEEEEEL---LLLLLlllEEEElLLL


DSSP  LleELLLLLEEEEELLLlhhhhhhlhhhhllhhHHHHHLL-----lLHHHHHHHHHHHHH
Query GavIAPPPVNAHTHLDMsayefqalpyfqwipeVVIRGRH-----lRGVAAAQAGADTLT  104
ident    | |  || | ||                               |   ||  |   | 
Sbjct V--IYPAWVNTHHHLFQ--------------slLKGEPFRalfderRFRLAARIGLIELA  101
DSSP  E--EEELEELLLLLHHH--------------hhLLLLLLHhhllhhHHHHHHHHHHHHHH


DSSP  HLLLLLEEEEELLH------HHHHHHHLLLL---LLEEEEEEELLLL--------hhhhh
Query RLGAGGVGDIVWAP------EVMDALLARED---LSGTLYFEVLNPF--------pdkad  147
ident | |   | |                |        |   |                     
Sbjct RSGCATVADHNYVYypgmpfDSSAILFEEAEklgLRFVLLRGGATQTrqleadlptalrp  161
DSSP  LLLEEEEEELLLLLllllllLHHHHHHHHHHhllLEEEEEELLLLLLllllllllhhhll


DSSP  HHHHHHHHHHHHHHLLLL-----LLEEEEEEELL-LLLLLHHHHHHHHHHHHHHLLLLEE
Query EVFAAARTHLERWRRLER-----PGLRLGLSPHT-PFTVSHRLMRLLSDYAAGEGLPLQI  201
ident |   |     ||              |    | |     | | ||     |   ||    
Sbjct ETLDAYVADIERLAARYHdasprAMRRVVMAPTTvLYSISPREMRETAAVARRLGLRMHS  221
DSSP  LLHHHHHHHHHHHHHHLLlllllLLEEEEELLLLlLLLLLHHHHHHHHHHHHHLLLEEEE


DSSP  EELllhhhhhhhhhlllllhhhllhhhllllhhhhhllllllLLLHHHHHHHHLLHHHLL
Query HVAehptelemfrtgggplwdnrmpalyphtlaevigrepgpDLTPVRYLDELGVLAARP  261
ident |                                            ||    |   |    
Sbjct HLS---------------------------------------GKSPVAFCGEHDWLGSDV  242
DSSP  ELL---------------------------------------LLLHHHHHHHLLLLLLLE


DSSP  EEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLlllllLHHHHHHLLLLEEELLLLHHHH
Query TLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLecgtfDWPAFAAAGVEVALGTDSVASG  321
ident    | | |  | ||  |  |  |  || ||  |          | ||| |  | |  || 
Sbjct WYAHLVKVDADEIALLAQTGTGVAHCPQSNGRL-----PVREMADAGVPVSIGVDGAASN  297
DSSP  EEELLLLLLHHHHHHHHHHLLEEEELHHHHHLL-----LLLLHHHHLLLEEELLLHHHHL


DSSP  LLLLLHHHHHHHHHHLL--LLLHHHHHHHHHHHHHHHHL----LLLLLLlllllhHHLH-
Query ETLNVREEVTFARQLYP--GLDPRVLVRAAVKGGQRVVG----TPFLRRgetwqeGFRW-  374
ident |      ||                       || || |                     
Sbjct EAADMISEVHMTWLAQRarLASIAEVIHWGTAGGARVMGldevGKVAVG--yaadIAVYr  355
DSSP  LLLLHHHHHHHHHHHHHhlLLLHHHHHHHHLHHHHHHHLllllLLLLLL--llllEEEEe


DSSP  ----------------------HHLL----------------------------------
Query ----------------------ELSR----------------------------------  378
ident                                                             
Sbjct lddpryfglhdpaigpvasggrPSVMalfsagkrvvvddliegvdikelggearrvvrel  415
DSSP  lllhhhlllllhhhhhhhllllLEEEeeeelleeeeellllllllhhhhhhhhhhhhhhh


DSSP  ----ll
Query ----dl  380
ident       
Sbjct lrevvv  421
DSSP  hhhhhl


No 7: Query=2imrA Sbjct=1k6wA Z-score=23.5

back to top
DSSP  -lLEEEEEEleeellEELL-eEEEEEL-LEEEEEELHHHhhhHLLL---leeEELLleEL
Query -hTPRLLTCdvlytgAQSP-gGVVVVG-ETVAAAGHPDElrrQYPH---aaeERAGavIA   54
ident                                 |                   |       
Sbjct alQTIINAR-----lPGEEglWQIHLQdGKISAIDAQSG--vMPITensldaEQGL--VI   51
DSSP  llLEEEEEL-----lLLLLleEEEEEElLEEEEEEEELL--lLLLLlleeelLLLE--EE


DSSP  LLLLEEEEELLL-lhhhhhhlhhhHLLHHHHHHHL-------llLHHHHHHHHHHHHHHL
Query PPPVNAHTHLDM-sayefqalpyfQWIPEVVIRGR-------hlRGVAAAQAGADTLTRL  106
ident || |  | |||                 |   |                |          
Sbjct PPFVEPHIHLDTtqtagqpnwnqsGTLFEGIERWAerkallthdDVKQRAWQTLKWQIAN  111
DSSP  LLEEEEEELLLLllllllllllllLLHHHHHHHHHllhhhllhhHHHHHHHHHHHHHHHL


DSSP  LLLLEEEEEL-------LHHHHHHHHLLL--LLLEEEEEEE--LLLLhhhHHHHHHHHHH
Query GAGGVGDIVW-------APEVMDALLARE--DLSGTLYFEV--LNPFpdkADEVFAAART  155
ident |   |   |        |   |                                 |    
Sbjct GIQHVRTHVDvsdatltALKAMLEVKQEVapWIDLQIVAFPqeGILS---YPNGEALLEE  168
DSSP  LEEEEEEEEEllllllhHHHHHHHHHHHHllLLEEEEEEELllLLLL---LLLHHHHHHH


DSSP  HHHHHhlllllleeEEEEElLLLLL-----LHHHHHHHHHHHHHHLLLLEEEELLLHhhH
Query HLERWrrlerpglrLGLSPhTPFTV-----SHRLMRLLSDYAAGEGLPLQIHVAEHPteL  210
ident  |                   |                   |         |  |     
Sbjct ALRLG--------aDVVGA-IPHFEftreyGVESLHKTFALAQKYDRLIDVHCDEID--D  217
DSSP  HHHLL--------lLEEEE-LHHHLllhhhHHHHHHHHHHHHHHHLLEEEEEELLLL--L


DSSP  HHHhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhLLHH-----hLLEEEE
Query EMFrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelGVLA-----aRPTLVH  265
ident |                                    |                | |  |
Sbjct EQS--------------------------------RFVETVA--ALAHhegmgaRVTASH  243
DSSP  LLL--------------------------------LHHHHHH--HHHHhhllhhHEEEEE


DSSP  LLLL-------LHHHHHHHHHHLLLEEELHHHHHHLLL---------LLLLHHHHHHLLL
Query MVNV-------TPDDIARVARAGCAVVTCPRSNHHLEC---------GTFDWPAFAAAGV  309
ident            |          |   |  |  | ||           |          | 
Sbjct TTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHLQGrfdtypkrrGITRVKEMLESGI  303
DSSP  LHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHHLLlllllllllLLLLHHHHHHLLL


DSSP  LEEELLLLH---HHHLL-LLLHHHHHHHHH--HLLL-LLHHHHHHHHHHHHHHHHL--LL
Query EVALGTDSV---ASGET-LNVREEVTFARQ--LYPG-LDPRVLVRAAVKGGQRVVG--TP  360
ident  |  | | |          |               |                |       
Sbjct NVCFGHDDVfdpWYPLGtANMLQVLHMGLHvcQLMGyGQINDGLNLITHHSARTLNlqDY  363
DSSP  LEEELLLLLlllLLLLLlLLHHHHHHHHHHhlLLLLhHHHHHHHHHHLHHHHHHLLllLL


DSSP  LLLLLLLLLhHHLH------------HHLL-----------------------------l
Query FLRRGETWQeGFRW------------ELSR-----------------------------d  379
ident     |                        |                              
Sbjct GIAAGNSAN-LIILpaengfdalrrqVPVRysvrggkviastqpaqttvyleqpeaidyk  422
DSSP  LLLLLLLLL-EEEEllllhhhhhhhlLLLLeeeelleeeeellllleeeellleeeelll


DSSP  l
Query l  380
ident  
Sbjct r  423
DSSP  l


No 8: Query=2imrA Sbjct=2oofA Z-score=22.3

back to top
DSSP  --lLEEE-EEELEEEL----LEELL--eEEEEELLEEEEEelhhHHHHH--llLLEE-EE
Query --hTPRL-LTCDVLYT----GAQSP--gGVVVVGETVAAAghpdELRRQ--ypHAAE-ER   48
ident                                |      |              |      
Sbjct lncERVWlNVTPATLRsdlaDYGLLephALGVHEGRIHAL---vPXQDLkypaHWQDxKG   57
DSSP  lllLEEEeEEEELLLLllllLLLLLlleEEEEELLEEEEE---eEHHHLllllLLEElLL


DSSP  LLleELLLLLEEEEELLLLH-----------------------HHHHhlhhhhllhhhhh
Query AGavIAPPPVNAHTHLDMSA-----------------------YEFQalpyfqwipevvi   85
ident       |     ||||                                            
Sbjct KL--VTPGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkggGIIS-------tvratr  108
DSSP  LE--EEELEEEEEELLLLLLllhhhhhhhhhlllhhhhhhlllLHHH-------hhhhhh


DSSP  hhllllHHHHHHHHHHHHHHLLLLLEEEEEL-------LHHHHHHHHLL---LLLLEEEE
Query rgrhlrGVAAAQAGADTLTRLGAGGVGDIVW-------APEVMDALLAR---EDLSGTLY  135
ident           |      | | |   |                                  
Sbjct aasedqLFELALPRVKSLIREGVTTVEIKSGygltledELKXLRVARRLgeaLPIRVKTT  168
DSSP  hllhhhHHHHHHHHHHHHHHHLEEEEEEELLllllhhhHHHHHHHHHHHhhhLLLEEEEE


DSSP  EE-ELLL---lHHHHHHHHHHHH-HHHHHHHLLLllleEEEEEELLLL-LLLHHHHHHHH
Query FE-VLNP---fPDKADEVFAAAR-THLERWRRLErpglRLGLSPHTPF-TVSHRLMRLLS  189
ident             |  |                                   |        
Sbjct LLaAHAVppeyRDDPDSWVETICqEIIPAAAEAG---lADAVDVFCEHiGFSLAQTEQVY  225
DSSP  EEeELLLlhhhLLLHHHHHHHHHhLHHHHHHHLL---lLLEEEEEELLlLLLHHHHHHHH


DSSP  HHHHHHLLLLEEEELLLHhhhhhhhhlllllhhhllhhhllllhhhhhllllllllLHHH
Query DYAAGEGLPLQIHVAEHPtelemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVR  249
ident   |   ||    |                                               
Sbjct LAADQYGLAVKGHXDQLS------------------------------------nlGGST  249
DSSP  HHHHHLLLEEEEEELLLL------------------------------------llLHHH


DSSP  HHhhhllHHHLL-EEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLLL-LLLLHHHHHHL
Query YLdelgvLAARP-TLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLEC-GTFDWPAFAAA  307
ident                 |     |  |   |  |      |     |         |   |
Sbjct LA-----ANFGAlSVDHLEYLDPEGIQALAHRGVVATLLPTAFYFLKEtKLPPVVALRKA  304
DSSP  HH-----HHLLLlEEEELLLLLHHHHHHHHHHLLEEEELHHHHHHLLLlLLLLHHHHHHL


DSSP  LLLEEELLLLHH-HHLLLLLHHHHHHHHHHLLlLLHHHHHHHHHHHHHHHHL----LLLL
Query GVEVALGTDSVA-SGETLNVREEVTFARQLYPgLDPRVLVRAAVKGGQRVVG----TPFL  362
ident ||  |   |           |     |  |   | |            |  |       |
Sbjct GVPXAVSSDINPgTAPIVSLRXAXNXACTLFG-LTPVEAXAGVTRHAARALGeqeqLGQL  363
DSSP  LLLEEELLLLLLlLLLLLLHHHHHHHHHHHHL-LLHHHHHHHLLHHHHHHLLllllLLLL


DSSP  LLLLLLlhHHLHHH-----------LLLL------------
Query RRGETWqeGFRWEL-----------SRDL------------  380
ident | |        |                |            
Sbjct RVGXLA-dFLVWNCghpaelsyligVDQLvsrvvngeetlh  403
DSSP  LLLLLL-lEEEELLllllhhhhlllLLLEeeeeelleelll


No 9: Query=2imrA Sbjct=4cqbA Z-score=21.9

back to top
DSSP  ---lLEEEE-EELEeellEELLEE-EEEELLEEEEEelhhHHHHhlLLLE---eeELLLe
Query ---hTPRLL-TCDVlytgAQSPGG-VVVVGETVAAAghpdELRRqyPHAA---eeRAGAv   52
ident                             ||                              
Sbjct skdfDLIIRnAYLS----EKDSVYdIGIVGDRIIKI---eAKIE--GTVKdeidaKGNL-   50
DSSP  llleEEEEEeEEEL----LLLEEEeEEEELLEEEEE---eLLLL--LLEEeeeelLLLL-


DSSP  ELLLLLEEEEELLL-----------lhhhhHHLHHH-hllhhhhhhhlllLHHHHHHHHH
Query IAPPPVNAHTHLDM-----------sayefQALPYF-qwipevvirgrhlRGVAAAQAGA  100
ident   |  | |||| |                                              |
Sbjct VSPGFVDAHTHMDKsftstgerlpkfwsrpYTRDAAiedglkyyknatheEIKRHVIEHA  110
DSSP  EEELEEEEEELHHHllllllllllllllllLLHHHHhhhhhhhhhhllhhHHHHHHHHHH


DSSP  HHHHHLLLLLEEEEEL--------LHHHHHH-HHLLL-LLLEEEEEEE--LLLLhhhhHH
Query DTLTRLGAGGVGDIVW--------APEVMDA-LLARE-DLSGTLYFEV--LNPFpdkaDE  148
ident       |       |         | |                                |
Sbjct HMQVLHGTLYTRTHVDvdsvaktkAVEAVLEaKEELKdLIDIQVVAFAqsGFFV---dLE  167
DSSP  HHHHHLLEEEEEEEEElllllllhHHHHHHHhHHHLLlLLEEEEEEELllLLLL---lLL


DSSP  HHHHHHHHHHHHhlllllleeEEEEELLL-LLLL--HHHHHHHHHHHHHHLLLLEEEElL
Query VFAAARTHLERWrrlerpglrLGLSPHTP-FTVS--HRLMRLLSDYAAGEGLPLQIHVaE  205
ident      |  |                   |            |    |         |   
Sbjct SESLIRKSLDMG--------cDLVGGVDPaTRENnvEGSLDLCFKLAKEYDVDIDYHI-H  218
DSSP  HHHHHHHHHHHL--------lLEEELLLLlLLLLlhHHHHHHHHHHHHHLLLEEEEEE-L


DSSP  LHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHHHL---lHHHLLE
Query HPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDELG---vLAARPT  262
ident                                              |           | |
Sbjct DIGTV---------------------------------gvYSINRLAQKTiengYKGRVT  245
DSSP  LLHHH---------------------------------hhHHHHHHHHHHhhllLLLLEE


DSSP  EEELLLL-------LHHHHHHHHHHLLLEEELHHHHhhllLLLLLHHHHHHLLLLEEELL
Query LVHMVNV-------TPDDIARVARAGCAVVTCPRSNhhleCGTFDWPAFAAAGVEVALGT  315
ident   |               |      |   |||  |       |        ||       
Sbjct TSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSST----PPTMPVIKLLEAGINLGCAS  301
DSSP  EEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLL----LLLLLHHHHHHLLLEEEEEL


DSSP  LLHH---HHLL-LLLHHHHHHHHHHLLL---LLHHHHHHHHHHHHHHHHL---LLLLLLL
Query DSVA---SGET-LNVREEVTFARQLYPG---LDPRVLVRAAVKGGQRVVG---TPFLRRG  365
ident |                      |        |           | || |         |
Sbjct DNIRdfwVPFGnGDMVQGALIETQRLELktnRDLGLIWKMITSEGARVLGiekNYGIEVG  361
DSSP  LLLLlllLLLLlLLHHHHHHHHHHHHLLllhHHHHHHHHHHLHHHHHHHLlhhHLLLLLL


DSSP  LLLlhHHLH------------HHLL---------------ll
Query ETWqeGFRW------------ELSR---------------dl  380
ident                                           
Sbjct KKA-dLVVLnslspqwaiidqAKRLcvikngriivkdeviva  402
DSSP  LLL-lEEEEllllhhhhhhhlLLEEeeeelleeeeelleell


No 10: Query=2imrA Sbjct=3icjA Z-score=21.0

back to top
DSSP  lLEEEEEeleEELLE---ELLEEEEEELLEEEEEELHHHHHHHLL--LLEEEEL-lLEEL
Query hTPRLLTcdvLYTGA---QSPGGVVVVGETVAAAGHPDELRRQYP--HAAEERA-gAVIA   54
ident      |     ||         | |   | |  ||      |                  
Sbjct -CMKALIngtIYTSFspvKKVSGLVISNERVLYAGDSSTALRIAElaGGEIIDLkgKFVM   59
DSSP  -LEEEEElleEEEEElleEEELEEEEELLEEEEEELHHHHHHHHHhhLLEEEELllLEEE


DSSP  LLLLEEEEELLL------------------------------------------------
Query PPPVNAHTHLDM------------------------------------------------   66
ident |     | |||                                                 
Sbjct PAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  --lhhhhhhlhhhHLLH--------------------------------------hhhhh
Query --sayefqalpyfQWIP--------------------------------------evvir   86
ident                                                             
Sbjct dldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreraleesrkiineki  179
DSSP  hhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhll


DSSP  hllllHHHHHHHHHHHHHHLLLLLEEEEELLHHHHHHHHLL-----LLLLEEEEEEElll
Query grhlrGVAAAQAGADTLTRLGAGGVGDIVWAPEVMDALLAR-----EDLSGTLYFEVlnp  141
ident                 |  ||   ||          ||               |      
Sbjct ltvkdYKHYIESAQEHLLSLGVHSVGFMSVGEKALKALFELeregrLKMNVFAYLSP---  236
DSSP  llhhhHHHHHHHHHHHHHHLLEEEEEEEEELHHHHHHHHHHhhlllLLLEEEEEELH---


DSSP  lhhhhhhhhhhHHHH--hHHHHlLLLLLEE-EEEEeLLLL--------------------
Query fpdkadevfaaARTH--lERWRrLERPGLR-LGLSpHTPF--------------------  178
ident                         |   ||  |                           
Sbjct ---------elLDKLeelNLGK-FEGRRLRiWGVX-LFVDgslgartallsepytdnptt  285
DSSP  ---------hhHHHHhhhLLLL-EELLLEEeEEEE-EELLllllllllllllllllllll


DSSP  ----LLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhh
Query ----TVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyphtla  234
ident                  |   ||    |                                
Sbjct sgelVMNKDEIVEVIERAKPLGLDVAVHAI------------------------------  315
DSSP  llllLLLHHHHHHHHHHHLLLLLEEEEEEL------------------------------


DSSP  hhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLLHHHHHHHHHHLLLEEELHHHH
Query evigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVTPDDIARVARAGCAVVTCPRSN  291
ident              |                   |   |  |   |           |   
Sbjct ---------gdKAVDVAL--DAFEeaeFSGRIEHASLVRDDQLERIKELKVRISAQPHFI  364
DSSP  ---------lhHHHHHHH--HHHHhhlLLLEEEELLLLLHHHHHHHHHHLLEEEELLLHH


DSSP  HHLL-----------llLLLHHHHHHlLLLEEELLLLHhHHLLlLLHHHHHHHHHHL---
Query HHLE-----------cgTFDWPAFAAaGVEVALGTDSVaSGETlNVREEVTFARQLY---  337
ident                                   |||               |   |   
Sbjct VSDWwivnrvgeerakwAYRLKTLSS-ITKLGFSTDSP-IEPA-DPWVSIDAAVNRYvvd  421
DSSP  HHLLlhhhhhhhhhhhhLLLHHHHHH-HLLEEELLLLL-LLLL-LHHHHHHHHHHLLlll


DSSP  --llLLHHHHHHHHHHHHHHHHL---LLLLLLLLlllhHHLHHHllll
Query --pgLDPRVLVRAAVKGGQRVVG---TPFLRRGEtwqeGFRWELsrdl  380
ident                 |   |        | ||               
Sbjct pgerVSREEALHLYTHGSAQVTLaedLGKLERGF-raeYIILDRdplk  468
DSSP  hhhlLLHHHHHHHLLHHHHHHLLlllLLLLLLLL-lllEEEELLllll


No 11: Query=2imrA Sbjct=4c5yA Z-score=20.3

back to top
DSSP  --LLEEEEEELEEEL---LEELLEEEEEELLEEEEEELHHHHHHH-LLLL-EEEELLlEE
Query --HTPRLLTCDVLYT---GAQSPGGVVVVGETVAAAGHPDELRRQ-YPHA-AEERAGaVI   53
ident             |             |      |  |                 |   | 
Sbjct deAKVTIIYAGLLIPgdgEPLRNAALVISDKIIAFVGSEADIPKKyLRSTqSTHRVP-VL   59
DSSP  llLLEEEEEEEEELLlllLLEEEEEEEEELLEEEEEEEHHHLLHHhHHHLlLEEEEE-EE


DSSP  LLLLLEEEEELLllhhhhhhlhhhhllhhhHHHHLL------llHHHHHHHHHHHHHHLL
Query APPPVNAHTHLDmsayefqalpyfqwipevVIRGRH------lrGVAAAQAGADTLTRLG  107
ident  |     | |                                    |    |       |
Sbjct MPGLWDCHMHFG-------------gdddyYNDYTSglathpasSGARLARGCWEALQNG  106
DSSP  EELEEEEEELLL-------------lllllLLLLHHhhhllhhhHHHHHHHHHHHHHHLL


DSSP  LLLEEEEELLhhhHHHHHLLL-----LLLEEEE-EEELLLL-------------------
Query AGGVGDIVWApevMDALLARE-----DLSGTLY-FEVLNPF-------------------  142
ident      |            |                                         
Sbjct YTSYRDLAGY--gCEVAKAINdgtivGPNVYSSgAALSQTAghgdifalpagevlgsygv  164
DSSP  EEEEEELLLL--hHHHHHHHHlllllLLEEEELlLEEELLLlllllllllhhhhhhhhll


DSSP  --------------hhHHHHHHHHHHHHHHHHHlllllleEEEEEELLL-----------
Query --------------pdKADEVFAAARTHLERWRrlerpglRLGLSPHTP-----------  177
ident                    |    |     |                             
Sbjct mnprpgywgagplciaDGVEEVRRAVRLQIRRG-------AKVIXVMASggvmsrddnpn  217
DSSP  lllllllllllleeelLLHHHHHHHHHHHHHHL-------LLLEEEELLlllllllllll


DSSP  -LLLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhh
Query -FTVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyphtlaev  236
ident     |          ||        ||                                 
Sbjct fAQFSPEELKVIVEEAARQNRIVSAHVH--------------------------------  245
DSSP  lLLLLHHHHHHHHHHHHHLLLLEEEEEL--------------------------------


DSSP  hllllllllLHHHHHHhHLLHhhlLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLL-
Query igrepgpdlTPVRYLDeLGVLaarPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLE-  295
ident                           | |               |   |           
Sbjct -------gkAGIMAAI-KAGC---KSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLa  294
DSSP  -------lhHHHHHHH-HHLL---LEEEELLLLLHHHHHHHHHHLLEEELLHHHHHHHHh


DSSP  -----------------LLLL--LHHHHHHLLLLEEELLLLHhhhllLLLHHHHHHHHHH
Query -----------------CGTF--DWPAFAAAGVEVALGTDSVasgetLNVREEVTFARQL  336
ident                               |||  |||||            |  ||   
Sbjct sngeglvkeswaklqalADSHlkAYQGAIKAGVTIALGTDTA---pgGPTALELQFAVER  351
DSSP  hllllllllhhhlllhhHHHHhhHHHHHHHLLLLEELLLLLL---llLLLHHHHHHHHHL


DSSP  LLlLLHHHHHHHHHHHHHHHH-----lLLLLLLLLLLLhHHLHHH---------LLLL--
Query YPgLDPRVLVRAAVKGGQRVV-----gTPFLRRGETWQeGFRWEL---------SRDL--  380
ident      |     ||       |      |  || |         |                
Sbjct GG-MTPLEAIKAATANAPLSVgpqaplTGQLREGYEAD-VIALEEnpledikvfQEPKav  409
DSSP  LL-LLHHHHHHHHLLLHHHHHhhhlllLLLLLLLLLLL-EEEELLlllllhhhhHLHHhe


DSSP  ---------------------------
Query ---------------------------  380
ident                            
Sbjct thvwkggklfkgpgigpwgedarnpfl  436
DSSP  eeeeelleeeellllllllllllllll


No 12: Query=2imrA Sbjct=3mkvA Z-score=20.3

back to top
DSSP  --lleEEEEEleeELLEELLEE--EEEE-----lLEEEEeelhhhhhhHLLL-----lee
Query --htpRLLTCdvlYTGAQSPGG--VVVV-----gETVAAaghpdelrrQYPH-----aae   46
ident                                     |                       
Sbjct lttflFRNGA--lLDPDHPDLLqgFEILiedgfiREVSD--------kPIKSsnahvidv   50
DSSP  lleeeEEEEE--eLLLLLLLLEeeEEEEeelleeEEEEL--------lLLLLllleeeel


DSSP  EELLleELLLLLEEEEELLLlhhhhhhlhhhhllhhhhhHHLL--------llHHHHHHH
Query ERAGavIAPPPVNAHTHLDMsayefqalpyfqwipevviRGRH--------lrGVAAAQA   98
ident       | |     | |                                        |  
Sbjct KGKT--IMPGLIDLHVHVVA------------------iEFNLprvatlpnvlVTLRAVP   90
DSSP  LLLE--EEELEEEEEELLLL------------------lLLLHhhhllllhhhHHHHHHH


DSSP  HHHHHHHLLLLLEEEEELlhhHHHHHHLLL------LLLEEEE-EEELLLL---------
Query GADTLTRLGAGGVGDIVWapeVMDALLARE------DLSGTLY-FEVLNPF---------  142
ident       | |   | |                                             
Sbjct IMRAMLRRGFTTVRDAGG---AGYPFKQAVesglveGPRLFVSgRALSQTGghadprars  147
DSSP  HHHHHHHLLEEEEEELLL---LLHHHHHHHhlllllLLEEEELlLEEELLLlllllllll


DSSP  ---------------------hhHHHHHHHHHHHHHHHHhlllllleeEEEEELLLL---
Query ---------------------pdKADEVFAAARTHLERWrrlerpglrLGLSPHTPF---  178
ident                          |||  | |  |                        
Sbjct dymppdspcgccvrvgalgrvadGVDEVRRAVREELQMG--------aDQIXIMASGgva  199
DSSP  lllllllllllllllllleeellLHHHHHHHHHHHHHHL--------lLLEEEELLLlll


DSSP  ---------LLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhl
Query ---------TVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpaly  229
ident            |    |     | | |     |                           
Sbjct sptdpvgvfGYSEDEIRAIVAEAQGRGTYVLAHAY-------------------------  234
DSSP  lllllllllLLLHHHHHHHHHHHHLLLLLEEEEEL-------------------------


DSSP  lllhhhhhllllllllLHHHHHHhHLLHhhlLEEEELLLLLHHHHHHHHHHLLLEEELHH
Query phtlaevigrepgpdlTPVRYLDeLGVLaarPTLVHMVNVTPDDIARVARAGCAVVTCPR  289
ident                                 |  |           ||  |  ||    
Sbjct --------------tpAAIARAV-RCGV---RTIEHGNLIDDETARLVAEHGAYVVPTLV  276
DSSP  --------------lhHHHHHHH-HLLL---LEEEELLLLLHHHHHHHHHHLLEEELLHH


DSSP  HHHHLL-------------------LLLL--LHHHHHHLLLLEEELLLLHH-HHLLLLlh
Query SNHHLE-------------------CGTF--DWPAFAAAGVEVALGTDSVA-SGETLNvr  327
ident     |                     |           |||    |||            
Sbjct TYDALAsegekyglppesiakiadvHGAGlhSIEIMKRAGVKMGFGTDLLGeAQRLQS--  334
DSSP  HHHHHHhhlllllllhhhhllhhhhHLLHhhHHHHHHHHLLLLLLLLLLLHhHHHHLL--


DSSP  HHHHHHHHHlllLLHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLHHH------
Query EEVTFARQLypgLDPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRWEL------  376
ident  |          | |      |      | |                             
Sbjct DEFRILAEV---LSPAEVIASATIVSAEVLGmqdklGRIVP--gahadVLVVDGnplksv  389
DSSP  HHHHHHHLL---LLHHHHHHHLLHHHHHHLLlllllLLLLL--lllllEEEELLllllll


DSSP  ----LLLL-----------------
Query ----SRDL-----------------  380
ident                          
Sbjct dcllGQGEhiplvmkdgrlfvnele  414
DSSP  llllLLLLllleeeelleeeeelll


No 13: Query=2imrA Sbjct=3mtwA Z-score=20.3

back to top
DSSP  --LLEEEEEEleEELLEELLEE-EEEE-----lLEEEEeelhhhhhhHLLL------lee
Query --HTPRLLTCdvLYTGAQSPGG-VVVV-----gETVAAaghpdelrrQYPH------aae   46
ident             |            |                                  
Sbjct aeIKAVSAAR-lLDVASGKYVDnPLVIvtdgriTSIGK--------kGDAVpagatavdl   51
DSSP  llEEEEEEEE-eEELLLLEEEElEEEEeelleeEEEEE--------lLLLLlllleeeee


DSSP  EELLleELLLLLEEEEELLLlhhhhhhlhhhhllhhhhhHHLL--------llHHHHHHH
Query ERAGavIAPPPVNAHTHLDMsayefqalpyfqwipevviRGRH--------lrGVAAAQA   98
ident         |     | |||                                        |
Sbjct PGVT--LLPGLIDMHVHLDS-----------------laEVGGynsleysdrfWSVVQTA   92
DSSP  EEEE--EEELEEEEEELLLL-----------------llLLLHhhhhhllhhhHHHHHHH


DSSP  HHHHHHHLLLLLEEEEELLHHHHHHHHLLL------LLLEEEE-EEELLLL---------
Query GADTLTRLGAGGVGDIVWAPEVMDALLARE------DLSGTLY-FEVLNPF---------  142
ident  |      |   |     |      |                                  
Sbjct NAKKTLEAGFTTVRNVGAADYDDVGLREAIdagyvpGPRIVTAaISFGATGghcdstffp  152
DSSP  HHHHHHHLLEEEEEELLLLLLHHHHHHHHHhlllllLLEEEELlLLEELLLlllllllll


DSSP  ---------hhHHHHHHHHHHHHHHHHHlllllleeEEEEELLL------------LLLL
Query ---------pdKADEVFAAARTHLERWRrlerpglrLGLSPHTP------------FTVS  181
ident                    |   |                                    
Sbjct psmdqknpfnsDSPDEARKAVRTLKKYG-------aQVIXICATggvfsrgnepgqQQLT  205
DSSP  hhhllllllllLLHHHHHHHHHHHHHLL-------lLEEEEELLllllllllllllLLLL


DSSP  HHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhhhllll
Query HRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyphtlaevigrep  241
ident    |    | |   |     |                                       
Sbjct YEEMKAVVDEAHMAGIKVAAHAH-------------------------------------  228
DSSP  HHHHHHHHHHHHHLLLEEEEEEL-------------------------------------


DSSP  llllLHHHHHHhHLLHhhlLEEEELLLLLHHHHHHHHHHLLLEEELHHHHHHLL------
Query gpdlTPVRYLDeLGVLaarPTLVHMVNVTPDDIARVARAGCAVVTCPRSNHHLE------  295
ident        |            |  |   |    |      |                    
Sbjct --gaSGIREAV-RAGV---DTIEHASLVDDEGIKLAVQKGAYFSMDIYNTDYTQaegkkn  282
DSSP  --lhHHHHHHH-HLLL---LEEEELLLLLHHHHHHHHHHLLEEELLLLLHHHHHhhhhhh


DSSP  -------------LLLL--LHHHHHHLLLLEEELLLLHHHhLLLLLHHHHHHHHHHLllL
Query -------------CGTF--DWPAFAAAGVEVALGTDSVASgETLNVREEVTFARQLYpgL  340
ident                           |||    |||                        
Sbjct gvlednlrkdrdiGELQreNFRKALKAGVKMVYGTDAGIY-PHGDNAKQFAVMVRYG--A  339
DSSP  lllhhhhhhhhhhHHHHhhHHHHHHHHLLEEELLLLLLLL-LLLLHHHHHHHHHHLL--L


DSSP  LHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLH-------------HHLL----
Query DPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRW-------------ELSR----  378
ident  |      |        |                                          
Sbjct TPLQAIQSATLTAAEALGrskdvGQVAV--grygdMIAVagdpladvttlekPVFVmkgg  397
DSSP  LHHHHHHHLLHHHHHHHLlllllLLLLL--lllllEEEElllllllhhhhhlLLEEeell


DSSP  -----ll
Query -----dl  380
ident        
Sbjct avvkapx  404
DSSP  eeeelll


No 14: Query=2imrA Sbjct=2vunA Z-score=18.9

back to top
DSSP  lLEEEEE-ELEEEL----LEEL-LEEEEEELLEEEEEELhHHHHHHLLLLEEEEL-LLEE
Query hTPRLLT-CDVLYT----GAQS-PGGVVVVGETVAAAGHpDELRRQYPHAAEERA-GAVI   53
ident                            ||     || |   ||      |    | |   
Sbjct -SKTIIKnIGKIVSgdikSPVLqADTIVVEDGLIAAIGG-EELMKDAGDATIIDAaGSTV   58
DSSP  -LEEEEElLLEEELllllLLEElLLEEEEELLEEEEEEL-HHHHLLLLLLEEEELlLLEE


DSSP  LLLLLEEEEELLllhhhhhhlhhhhllhhhhhHHLLLlhhhhhhHHHHHHHHLLLLLEEE
Query APPPVNAHTHLDmsayefqalpyfqwipevviRGRHLrgvaaaqAGADTLTRLGAGGVGD  113
ident  |     | |                                           |      
Sbjct TPGLLDTHVHVS---------------ggdyaPRQKT------mDFISSALHGGVTTMIS   97
DSSP  EELEEEEEELLL---------------llleeHHHLE------eLHHHHHHLLLEEEEEE


DSSP  EEL----------------LHHHHHHHHLLL--LLLEEE-EEEELlllhhhhhHHHHhhH
Query IVW----------------APEVMDALLARE--DLSGTL-YFEVLnpfpdkadEVFAaaR  154
ident                    |                                        
Sbjct AGSphfpgrpkdaagtkalAITLSKSYYNARpaGVKVHGgAVILE--------KGLT--E  147
DSSP  LLLlllllllllhhhhhhhHHHHHHHHHHLLhhHLEEELlEELLL--------LLLL--H


DSSP  HHHHHHHLLLllleeEEEEELL-llLLLHHHHHHHHHHHHHHLLLLEEEELlLHHHhHHH
Query THLERWRRLErpglrLGLSPHT-pfTVSHRLMRLLSDYAAGEGLPLQIHVAeHPTElEMF  213
ident                                       |   |   | |           
Sbjct EDFIEMKKEG----vWIVGEVGlgtIKNPEDAAPMVEWAHKHGFKVQMHTG-GTSI-PGS  201
DSSP  HHHHHHHHLL----lLEEEEELlllLLLHHHHHHHHHHHHHLLLEEEEELL-LLLL-LLL


DSSP  HhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHLLHhhLLEEEELL----LL
Query RtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLGVLaaRPTLVHMV----NV  269
ident                                 |                  |        
Sbjct S-------------------------------TVTADDV-IKTK--PDVVSHINggptAI  227
DSSP  L-------------------------------LLLHHHH-HHHL--LLEEELLLllllLL


DSSP  LHHHHHHHH-HHLLLEEELhHHHHhllLLLL--LHHHHHHLLL--LEEELLLLHH-HHLL
Query TPDDIARVA-RAGCAVVTCpRSNHhleCGTF--DWPAFAAAGV--EVALGTDSVA-SGET  323
ident       |       |                       |  |    |  | |     |  
Sbjct SVQEVDRIMdETDFAMEIV-QCGN---PKIAdyVARRAAEKGQlgRVIFGNDAPSgTGLI  283
DSSP  LHHHHHHHHhHLLLEEEEE-LLLL---HHHHhhHHHHHHHHLLhhHEEEELLLLLlLLLL


DSSP  LL-LHHHHHHHHHHLLlLLHHHHHHHHHHHHHHHHL--LLLLLLLLLLlhHHLHH-----
Query LN-VREEVTFARQLYPgLDPRVLVRAAVKGGQRVVG--TPFLRRGETWqeGFRWE-----  375
ident                   || | |  |      | |  |     |               
Sbjct PLgILRNMCQIASMSD-IDPEVAVCMATGNSTAVYGlnTGVIAPGKEA-dLIIMDtplgs  341
DSSP  LLhHHHHHHHHHHHLL-LLHHHHHHHHLHHHHHHHLllLLLLLLLLLL-lEEEEElllll


DSSP  -----------------------------HLLLL----------
Query -----------------------------LSRDL----------  380
ident                               ||            
Sbjct vaedamgaiaagdipgisvvlidgeavvtKSRNTppakraakil  385
DSSP  llllhhhhhhhlllleeeeeeelleeeelLLLLLllllllleel


No 15: Query=2imrA Sbjct=2ogjA Z-score=18.3

back to top
DSSP  LLEEEEE-ELEEELL---eELLEEEEEE-LLEEEEEElhHHHHhhLLLLEEEELLLEELL
Query HTPRLLT-CDVLYTG---aQSPGGVVVV-GETVAAAGhpDELRrqYPHAAEERAGAVIAP   55
ident   | |||       |    ||            || |    |    |        | | |
Sbjct QAPILLTnVKPVGFGkgasQSSTDILIGgDGKIAAVG--SALQ--APADTQRIDAAFISP   56
DSSP  LLLEEEEeEEELLLLllllLLLEEEEELlLLLEEEEE--LLLL--LLLLEEELLLLEEEE


DSSP  LLLEEEEELLllhhhhhhlhhhhllhhhhhhhllLLHHHHHhhHHHH-HHHLLLLLEEEE
Query PPVNAHTHLDmsayefqalpyfqwipevvirgrhLRGVAAAqaGADT-LTRLGAGGVGDI  114
ident   |  | |                            |               |     | 
Sbjct GWVDLHVHIW------------------------HGGTDIS-iRPSEcGAERGVTTLVDA   91
DSSP  LEEEEEELLL------------------------LLLLLLL-lLHHHlLHHHLEEEEEEE


DSSP  -ELLHHHHHHHH---LLLL-LLEEEEEEE------------LLLLhhhhHHHHhhHHHHH
Query -VWAPEVMDALL---ARED-LSGTLYFEV------------LNPFpdkaDEVFaaARTHL  157
ident                                                             
Sbjct gSAGEANFHGFReyiIEPSrERIKAFLNLgsiglvacnrvpELRD----IKDI--DLDRI  145
DSSP  lLLLLLLHHHHHhhlLLLLlLEEEEEEELllllllllllllLLLL----HHHL--LHHHH


DSSP  HHHHLLLLLlEEEEEEELLL-LLLL---HHHHHHHHHHHHHHLLLLEEEELllhhHHHHh
Query ERWRRLERPgLRLGLSPHTP-FTVS---HRLMRLLSDYAAGEGLPLQIHVAehptELEMf  213
ident              ||                  |    |     |   ||     |    
Sbjct LECYAENSE-HIVGLXVRAShVITGswgVTPVKLGKKIAKILKVPXXVHVG----EPPA-  199
DSSP  HHHHHLLLL-LEEEEEEEELhHHHLlllLHHHHHHHHHHHHHLLLEEEEEL----LLLL-


DSSP  hhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHhlLHHHLLEEEELL-----L
Query rtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDElgVLAARPTLVHMV-----N  268
ident                                        |   |       |        
Sbjct ---------------------------------LYDEVLE--ILGPGDVVTHCFngksgS  224
DSSP  ---------------------------------LHHHHHH--HLLLLLEEELLLlllllL


DSSP  LLH---HHHHHHHHH-LLLEEELHHHhhhllLLLL--LHHHHH-HLLLLEEELLLLHHHH
Query VTP---DDIARVARA-GCAVVTCPRSnhhleCGTF--DWPAFA-AAGVEVALGTDSVASG  321
ident       |      |  |                       |            ||     
Sbjct SIXedeDLFNLAERCeGIRLDIGHGG-----ASFSfkVAEAAIaRGLLPFSISTDLHGHS  279
DSSP  LLLllhHHHHHHHHLlLLEEELLLLL-----LLLLhhHHHHHHhLLLLLLLLLLLLLLLL


DSSP  L---LLLLHHHHHHHHHHLllLLHHHHHHHHHHHHHHHHL--LLLLL-LLLLLLhHHLHH
Query E---TLNVREEVTFARQLYpgLDPRVLVRAAVKGGQRVVG--TPFLR-RGETWQeGFRWE  375
ident                            | |       |           |          
Sbjct XnfpVWDLATTXSKLLSVD--XPFENVVEAVTRNPASVIRldXENRLdVGQRAD-FTVFD  336
DSSP  LlllLLLHHHHHHHHHHLL--LLHHHHHHLLLHHHHHHLLllLLLLLlLLLLLE-EEEEE


DSSP  ----------------------------------HLLLL----
Query ----------------------------------LSRDL----  380
ident                                            
Sbjct lvdadleatdsngdvsrlkrlfepryavigaeaiAASRYipra  379
DSSP  eeeeeeeeellllleeeeeeeeeeeeeeelleeeELLLLllll


No 16: Query=2imrA Sbjct=1a4mA Z-score=17.6

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelLLEELLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeraGAVIAPPPVNA   60
ident                                                        | |  
Sbjct -------------------------------------------------TPAFNKPKVEL   11
DSSP  -------------------------------------------------LLLLLLLEEEE


DSSP  EEELLL---------------------------lhhhhhhlhHHHLlhhHHHHHLL----
Query HTHLDM---------------------------sayefqalpYFQWipeVVIRGRH----   89
ident | |||                                                       
Sbjct HVHLDGaikpetilyfgkkrgialpadtveelrniigmdkplSLPG---FLAKFDYympv   68
DSSP  EEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhllllllLHHH---HHLLHHHhhhh


DSSP  -----llHHHHHHHHHHHHHHLLLLLEEEEELL----------------------HHHHH
Query -----lrGVAAAQAGADTLTRLGAGGVGDIVWA----------------------PEVMD  122
ident            |          |   |                              | |
Sbjct iagcreaIKRIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqtegdvtpDDVVD  128
DSSP  hlllhhhHHHHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlllllllhHHHHH


DSSP  HHHL--LLLL-----LEEEEEEELLLlhhhHHHHHHHHHHHHHHHHLLllllEEEEEEEL
Query ALLA--REDL-----SGTLYFEVLNPfpdkADEVFAAARTHLERWRRLerpgLRLGLSPH  175
ident        |                                                    
Sbjct LVNQglQEGEqafgiKVRSILCCMRH----QPSWSLEVLELCKKYNQK----TVVAMDLA  180
DSSP  HHHHhhHHHHhhhllEEEEEEEEELL----LHHHHHHHHHHHHHLLLL----LEEEEEEE


DSSP  ----llLLLLHHHHHHHHHHHHHHLLLLEEEELLLHHhhhhhhhlllllhhhllhhhlll
Query ----tpFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTelemfrtgggplwdnrmpalyph  231
ident                     |   |     |  |                          
Sbjct gdetieGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGS-----------------------  217
DSSP  llllllLHHHLHHHHHHHHHHHHHLLEEEEEELLLLL-----------------------


DSSP  lhhhhhllllllllLHHHHHHhHLLHhhLLEEEELLLL--LHHHHHHHHHHLLLEEELHH
Query tlaevigrepgpdlTPVRYLDeLGVLaaRPTLVHMVNV--TPDDIARVARAGCAVVTCPR  289
ident                 ||               |            |          || 
Sbjct -------------pEVVREAV-DILK--TERVGHGYHTieDEALYNRLLKENMHFEVCPW  261
DSSP  -------------hHHHHHHH-HLLL--LLEEEELHHHhhLHHHHHHHHHLLLEEEELHH


DSSP  HHHHLLLL----lLLHHHHHHLLLLEEELLLLHHHHLLlLLHHHHHHHHHHLLlLLHHHH
Query SNHHLECG----tFDWPAFAAAGVEVALGTDSVASGETlNVREEVTFARQLYPgLDPRVL  345
ident |                 |        | ||                             
Sbjct SSYLTGAWdpkttHAVVRFKNDKANYSLNTDDPLIFKS-TLDTDYQMTKKDMG-FTEEEF  319
DSSP  HHHHLLLLlllllLHHHHHHHLLLLEEELLLLLLLLLL-LHHHHHHHHHHLLL-LLHHHH


DSSP  HHHhHHHHHHHHL------------LLLLlllllllhhhlhhhllll
Query VRAaVKGGQRVVG------------TPFLrrgetwqegfrwelsrdl  380
ident  |                                             
Sbjct KRL-NINAAKSSFlpeeekkellerLYRE----------------yq  349
DSSP  HHH-HHHHHHLLLllhhhhhhhhhhHHHH----------------ll


No 17: Query=2imrA Sbjct=1gkpA Z-score=17.1

back to top
DSSP  llEEEEE-ELEEElLEELLEEEEEELLEEEEEelHHHHhhHLLL-LEEEELL-LEELLLL
Query htPRLLT-CDVLYtGAQSPGGVVVVGETVAAAghPDELrrQYPH-AAEERAG-AVIAPPP   57
ident   | |                    |||         |    |       |      |  
Sbjct --PLLIKnGEIITaDSRYKADIYAEGETITRI--GQNL--EAPPgTEVIDATgKYVFPGF   54
DSSP  --LEEEElLEEEElLEEEELEEEELLLLLLEE--ELLL--LLLLlLEEEELLlLEEEELE


DSSP  LEEEEELLLLHHhhhhlhhhhllhhhhhhhLLLLhhhHHHHHHHHHHHLLLLLEEEEEL-
Query VNAHTHLDMSAYefqalpyfqwipevvirgRHLRgvaAAQAGADTLTRLGAGGVGDIVW-  116
ident    | |                                   |       |          
Sbjct IDPHVHIYLPFM-----------------aTFAK--dTHETGSKAALMGGTTTYIEMCCp   95
DSSP  EEEEELLLLEEL-----------------lEELL--lLHHHHHHHHHHLLEEEEEEEELl


DSSP  ---------LHHHHHHHHLLLLLLEEEEEEELLllhhhhhhHHHHHHHHHHHHHLLLlll
Query ---------APEVMDALLAREDLSGTLYFEVLNpfpdkadeVFAAARTHLERWRRLErpg  167
ident                          |    |                  |          
Sbjct srnddalegYQLWKSKAEGNSYCDYTFHMAVSK--------FDEKTEGQLREIVADG---  144
DSSP  lllllhhhhHHHHHHHHLLLLLLEEEEEEELLL--------LLLLHHHHHHHHHHLL---


DSSP  eEEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllLLHH
Query lRLGLSpHTPF-----TVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggPLWD  222
ident                  |    |      |   |     |                    
Sbjct -ISSFX-IFLSyknffGVDDGEMYQTLRLAKELGVIVTAHCE-----------naeLVGR  191
DSSP  -LLEEE-EEELlllllLLLHHHHHHHHHHHHHHLLEEEEEEL-----------lhhHHHH


DSSP  HLLH---hhllllhhhhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLL-hHHHH
Query NRMP---alyphtlaevigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVT-pDDIA  275
ident                                      |    |    ||       |   
Sbjct LQQKllsegktgpewhepsrpeaveaEGTARFA--TFLEttgATGYVVHLSCKPalDAAM  249
DSSP  HHHHhhhlllllhhhllllllhhhhhHHHHHHH--HHHHhhlLEEEELLLLLHHhhHHHH


DSSP  HHHH--HLLLEEELHHHHHH-------------------LLLL----llLHHHHHHlLLL
Query RVAR--AGCAVVTCPRSNHH-------------------LECG----tfDWPAFAAaGVE  310
ident                                                   | | |  |  
Sbjct AAKArgVPIYIESVIPHFLLdktyaerggveamkyimspPLRDkrnqkvLWDALAQ-GFI  308
DSSP  HHHHllLLEEEEEEHHHHHLlhhhhhllhhhhhllllllLLLLlhhhhhHHHHHHL-LLL


DSSP  EEELLLLHH------------------HHLLL-LLHHHHHH-HHHHlLLLLHHHHHHHHH
Query VALGTDSVA------------------SGETL-NVREEVTF-ARQLyPGLDPRVLVRAAV  350
ident    |||                                           ||    | || 
Sbjct DTVGTDHCPfdteqkllgkeaftaipnGIPAIeDRVNLLYTyGVSR-GRLDIHRFVDAAS  367
DSSP  LEEELLLLLllhhhhhhhlllhhhlllLLLLLlLHHHHHHHhHLLL-LLLLHHHHHHHHL


DSSP  HHHHHHHL-----LLLLLlLLLLlhHHLH------------------------------H
Query KGGQRVVG-----TPFLRrGETWqeGFRW------------------------------E  375
ident        |           |                                        
Sbjct TKAAKLFGlfprkGTIAV-GSDA-dLVVYdpqyrgtisvktqhvnndyngfegfeidgrP  425
DSSP  HHHHHHLLlllllLLLLL-LLLL-lEEEEelllleellhhhllllllllllllleelleE


DSSP  HLL----------------------------ll
Query LSR----------------------------dl  380
ident                                  
Sbjct SVVtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  EEEeelleeeeelleelllllllllllllllll


No 18: Query=2imrA Sbjct=2y1hB Z-score=16.6

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleeLLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviAPPPVNA   60
ident                                                          |  
Sbjct -----------------------------------------------------GVGLVDC    7
DSSP  -----------------------------------------------------LLLEEEE


DSSP  EEELLLlhhhhhhlhhhhllhhhhhhhLLLLhhHHHHHHHHHHHHLLLLLEEEEEL---L
Query HTHLDMsayefqalpyfqwipevvirgRHLRgvAAAQAGADTLTRLGAGGVGDIVW---A  117
ident | ||                                                        
Sbjct HCHLSA---------------------PDFD--RDLDDVLEKAKKANVVALVAVAEhsgE   44
DSSP  EELLLL---------------------HHHL--LLHHHHHHHHHHLLEEEEEELLLlhhH


DSSP  HHHHHHHHLLLLLLEEEEEEELLL----lhhHHHHHHHHHHHHHHHHHLLlllleEEEE-
Query PEVMDALLAREDLSGTLYFEVLNP----fpdKADEVFAAARTHLERWRRLerpglRLGL-  172
ident  |    |  |          |                  |    |           |   
Sbjct FEKIMQLSERYNGFVLPCLGVHPVqgldqrsVTLKDLDVALPIIENYKDR-----LLAIg   99
DSSP  HHHHHHHHHHLLLLEEEEELLLLEelllleeLLHHHHHHHHHHHHHHLLL-----LLEEe


DSSP  EELLLL-----------llLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllh
Query SPHTPF-----------tvSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplw  221
ident      |                        |    ||   |                   
Sbjct EVGLDFsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR-----------------  142
DSSP  EEEEELlllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE-----------------


DSSP  hhllhhhllllhhhhhllllllllLHHHHHHHhLLHH---HLLEEEELLLLLHhHHHHHH
Query dnrmpalyphtlaevigrepgpdlTPVRYLDElGVLA---ARPTLVHMVNVTPdDIARVA  278
ident                            |                |               
Sbjct ------------------------SAGRPTIN-LLQEqgaEKVLLHAFDGRPS-VAMEGV  176
DSSP  ------------------------LLHHHHHH-HHHHlllLLEEEELLLLLHH-HHHHHH


DSSP  HHLLLEEELhHHHHhlLLLLL--LHHHHHhllLLEEELLLLHHHH------LLLL-LHHH
Query RAGCAVVTCpRSNHhlECGTF--DWPAFAaagVEVALGTDSVASG------ETLN-VREE  329
ident |||        |      |                 | ||| | |               
Sbjct RAGYFFSIP-PSII--RSGQKqkLVKQLP--lTSICLETDSPALGpekqvrNEPWnISIS  231
DSSP  HLLLEEEEL-HHHH--LLHHHhhHHHHLL--hHHEEELLLLLLLLllllllLLHHhHHHH


DSSP  HHHHHHHLLlLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query VTFARQLYPgLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident      |                                             
Sbjct AEYIAQVKG-ISVEEVIEVTTQNALKLFP----------------klrhll  265
DSSP  HHHHHHHHL-LLHHHHHHHHHHHHHHHLL----------------lhhhhl


No 19: Query=2imrA Sbjct=1onxA Z-score=16.3

back to top
DSSP  --------llEEEEEEleEELLEELLEEEEEE--llEEEEEElhhhHHHHLLL----lEE
Query --------htPRLLTCdvLYTGAQSPGGVVVV--geTVAAAGhpdeLRRQYPH----aAE   46
ident                   ||         | |      | |                   
Sbjct midytaagftLLQGAH--LYAPEDRGICDVLVangkIIAVAS----NIPSDIVpnctvVD   54
DSSP  llllhhhlleEEEEEE--EELLLEEEEEEEEEelleEEEEEL----LLLLLLLllleeEE


DSSP  EELLlEELLLLLEEEEEL-LLLHHhhhhlhhhhllhhhhhhhLLLLhhhhHHHHhHHHHH
Query ERAGaVIAPPPVNAHTHL-DMSAYefqalpyfqwipevvirgRHLRgvaaAQAGaDTLTR  105
ident         |     | ||                                  |    || 
Sbjct LSGQ-ILCPGFIDQHVHLiGGGGE--------------agptTRTP----EVAL-SRLTE   94
DSSP  LLLL-EEEELEEEEEELLlLLLLL--------------llhhHLLL----LLLH-HHHHH


DSSP  LLLLLEEEEE------LLHHHHHHHHLL---LLLLEEEEE-EELLllhhhhhhhHHHH-H
Query LGAGGVGDIV------WAPEVMDALLAR---EDLSGTLYF-EVLNpfpdkadevFAAA-R  154
ident  |   |            ||   |       |  |                         
Sbjct AGVTSVVGLLgtdsisRHPESLLAKTRAlneEGISAWMLTgAYHV---------PSRTiT  145
DSSP  LLEEEEEELLllllllLLHHHHHHHHHHhhhHLLEEEEEEeLLLL---------LLLLlL


DSSP  HHH-HHHHLLLlllEEEEEEELLLL----LLLHHHHHHHHHHHHHHL------LLLEEEE
Query THL-ERWRRLErpgLRLGLSPHTPF----TVSHRLMRLLSDYAAGEG------LPLQIHV  203
ident                  |                            |           | 
Sbjct GSVeKDVAIID---RVIGVXCAISDhrsaAPDVYHLANMAAESRVGGllggkpGVTVFHM  202
DSSP  LLHhHHHHHLL---LEEEEEEEELLllllLLLHHHHHHHHHHHHHHHhhhlllLEEEEEE


DSSP  LllhhHHHHhhhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHHL---lHHHL
Query AehptELEMfrtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDELG---vLAAR  260
ident                                                   |         
Sbjct G----DSKK----------------------------------ALQPIYDLLencdVPIS  224
DSSP  L----LLLL----------------------------------LLHHHHHHHhlllLLHH


DSSP  -LEEEEL-LLLL--HHHHHHHHHhLLLEEELhHHHHhlLLLLL--LHHHHH-HLLL--LE
Query -PTLVHM-VNVT--PDDIARVARaGCAVVTCpRSNHhlECGTF--DWPAFA-AAGV--EV  311
ident      |   ||             |        |    |             |      |
Sbjct kLLPTHVnRNVPlfEQALEFARK-GGTIDIT-SSID--EPVAPaeGIARAVqAGIPlaRV  280
DSSP  hEEEELHhHLHHhhHHHHHHHHL-LLLEEEE-LLLL--LLLLHhhHHHHHHhLLLLhhHE


DSSP  EELLLLHHH--------------hLLLL-LHHHHHHHHHHLLlLLHHHHHHHHHHHHHHH
Query ALGTDSVAS--------------gETLN-VREEVTFARQLYPgLDPRVLVRAAVKGGQRV  356
ident  |  |   |                      | |      |         |         
Sbjct TLSSDGNGSqpffddegnlthigvAGFEtLLETVQVLVKDYD-FSISDALRPLTSSVAGF  339
DSSP  EEELLLLLEeeeellllleeeeeeLLLHhHHHHHHHHHHHHL-LLHHHHHHHHLHHHHHH


DSSP  HL----LLLLLllllllhHHLH---HHLL----------------------ll
Query VG----TPFLRrgetwqeGFRW---ELSR----------------------dl  380
ident          |                                           
Sbjct LNltgkGEILP--gndadLLVMtpeLRIEqvyargklmvkdgkacvkgtfetd  390
DSSP  LLllllLLLLL--lllllEEEElllLLEEeeeelleeeeelleelllllllll


No 20: Query=2imrA Sbjct=3giqA Z-score=16.3

back to top
DSSP  ---lleeEEEEleEELLEELLEEEEE----ellEEEEeelhhhHHHH-lllleEEELLlE
Query ---htprLLTCdvLYTGAQSPGGVVV----vgeTVAAaghpdeLRRQ-yphaaEERAGaV   52
ident                                            |                
Sbjct ekldfkiTGGW-iIDGTGAPRRRADLgvrdgriAAIG-----eLGAHparhawDASGK-I   53
DSSP  lleeeeeELLE-eLLLLLLLLEELEEeeelleeEEEE-----lLLLLleeeeeELLLL-E


DSSP  ELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllHHHHhhHHHHHHHHLLLLLEE
Query IAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrGVAAaqAGADTLTRLGAGGVG  112
ident  ||     | | |                           |          |  |   | 
Sbjct VAPGFIDVHGHDD------------------------lmFVEK--PDLRWKTSQGITTVV   87
DSSP  EEELEEELLLLLL------------------------lhHHHL--LLLHHHHLLLEEEEE


DSSP  EE----ELLH--------------------HHHHHHHL-----lLLLLEEEEEEEL----
Query DI----VWAP--------------------EVMDALLA-----rEDLSGTLYFEVL----  139
ident         ||                        |  |                      
Sbjct VGncgvSAAPaplpgntaaalallgetplfADVPAYFAaldaqrPMINVAALVGHAnlrl  147
DSSP  ELllllLLLLllllllllhhhhhhllllllLLHHHHHHhhhhllLLLEEEEEEEHHhhhh


DSSP  ----llLHHHHHHHHHHHHHHHHHHHLLLllleEEEEEELLL----LLLLHHHHHHHHHH
Query ----npFPDKADEVFAAARTHLERWRRLErpglRLGLSPHTP----FTVSHRLMRLLSDY  191
ident                 |    |             | |                  |   
Sbjct aamrdpQAAPTAAEQQAMQDMLQAALEAG----AVGFSTGLAyqpgAVAQAAELEGLARV  203
DSSP  hhllllLLLLLHHHHHHHHHHHHHHHHHL----LLEEEEELLlllhHHLLHHHHHHHHHH


DSSP  HHHHLLLLEEEEllLHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHH
Query AAGEGLPLQIHVaeHPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYL  251
ident ||        |                                             |   
Sbjct AAERRRLHTSHIrnEADGV----------------------------------eAAVEEV  229
DSSP  HHHLLLEEEEELllLLLLH----------------------------------hHHHHHH


DSSP  HhhLLHH---HLLEEEELLL-------LLHHHHHHHHHHL-----LLEEELHhhHHHL--
Query DelGVLA---ARPTLVHMVN-------VTPDDIARVARAG-----CAVVTCPrsNHHL--  294
ident                 |                |   ||       |    |        
Sbjct L--AIGRgtgCATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDIYP--YPGSst  285
DSSP  H--HHHHhhlLEEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEELL--LLEEee


DSSP  -------------------------------------------------------LLLL-
Query -------------------------------------------------------ECGT-  298
ident                                                             
Sbjct iliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfAMDEd  345
DSSP  ellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeeLLLHh


DSSP  ---LLHHHhhhllLLEEELLLLH------HHHLLlLLHHHHHHHH-HHLLlLLHHHHHHH
Query ---FDWPAfaaagVEVALGTDSV------ASGETlNVREEVTFAR-QLYPgLDPRVLVRA  348
ident                   | |                                    |  
Sbjct evkRIFQH-----PCCMVGSDGLpndarpHPRLWgSFTRVLGRYVrEARL-MTLEQAVAR  399
DSSP  hhhHHHHL-----LLEEELLLLLllllllLLHHHhHHHHHHHHHHhHLLL-LLHHHHHHH


DSSP  HHHHHHHHHL----LLLLLllllllhHHLH--------------------HHLL------
Query AVKGGQRVVG----TPFLRrgetwqeGFRW--------------------ELSR------  378
ident       || |                                                  
Sbjct MTALPARVFGfaerGVLQP--gawadVVVFdpdtvadratwdeptlasvgIAGVlvngae  457
DSSP  HLHHHHHHHLllllLLLLL--lllllEEEEllllllllllllllllllllEEEEeellee


DSSP  ----------------ll
Query ----------------dl  380
ident                   
Sbjct vfpqppadgrpgqvlrax  475
DSSP  eellllllllllllllll


No 21: Query=2imrA Sbjct=1yrrB Z-score=16.2

back to top
DSSP  lleeEEEEleEELLEELLEEEE----eellEEEEeelhhHHHHHL-LLLEEE-ELLLeEL
Query htprLLTCdvLYTGAQSPGGVV----vvgeTVAAaghpdELRRQY-PHAAEE-RAGAvIA   54
ident             ||                                              
Sbjct -yalTQGR--IFTGHEFLDDHAvviadgliKSVC-----PVAELPpEIEQRSlNGAI-LS   51
DSSP  -leeELLE--EELLLLEELLEEeeeelleeEEEE-----EHHHLLlLLLEEElLLLE-EE


DSSP  LLLLEEEEEL-----LLLHhhhhhlhhhhllhhhhhhhlllLHHH-HHHHHHHHHHHLLL
Query PPPVNAHTHL-----DMSAyefqalpyfqwipevvirgrhlRGVA-AAQAGADTLTRLGA  108
ident |                                                         | 
Sbjct PGFIDVQLNGcggvqFNDT--------------------aeAVSVeTLEIMQKANEKSGC   91
DSSP  ELEEEEEELEelleeLLLL--------------------llLLLHhHHHHHHHHHHLLLE


DSSP  LLEEEEEL------LHHHHHHHHLL----LLLLEEEEEEELLllhhhhhhhhHHHHHHHH
Query GGVGDIVW------APEVMDALLAR----EDLSGTLYFEVLNpfpdkadevfAAARTHLE  158
ident                                    |  |             ||    | 
Sbjct TNYLPTLIttsdelMKQGVRVMREYlakhPNQALGLHLEGPW--------lnAALVDFLC  143
DSSP  EEEEEEELlllhhhHHHHHHHHHHHhhhlLLLLLLEEEELLL--------llLHHHHHHH


DSSP  HHHlllllleEEEEEElLLLLllhhHHHHHHHHHHHHLLLLEEEElllhhhhhhhhhlll
Query RWRrlerpglRLGLSPhTPFTvshrLMRLLSDYAAGEGLPLQIHVaehptelemfrtggg  218
ident                   |               |  |                      
Sbjct ENA-----dvITKVTL-APEM----VPAEVISKLANAGIVVSAGH---------------  178
DSSP  HLH-----hhEEEEEE-LHHH----LLHHHHHHHHHHLLEEEELL---------------


DSSP  llhhhllhhhllllhhhhhllllllllLHHHHHHHhLLHH-HLLEEEELL--LLLH----
Query plwdnrmpalyphtlaevigrepgpdlTPVRYLDElGVLA-ARPTLVHMV--NVTP----  271
ident                                                |            
Sbjct --------------------------sNATLKEAK-AGFRaGITFATHLYnaMPYItgre  211
DSSP  --------------------------lLLLHHHHH-HHHHhLEEEELLLLllLLLLllll


DSSP  -hHHHHHHHH-LLLEEELHHhhhhlLLLL-lLHHHHHHLLL-LEEELLLLHhHHLLlLLH
Query -dDIARVARA-GCAVVTCPRsnhhlECGT-fDWPAFAAAGV-EVALGTDSVaSGETlNVR  327
ident                                              | ||           
Sbjct pgLAGAILDEaDIYCGIIAD----gLHVDyaNIRNAKRLKGdKLCLVTDATsGSSL-TMI  266
DSSP  lhHHHHHHHLlLLEEEEELL----lLLLLhhHHHHHHHHHHhHEEEELLLLlLLLL-LHH


DSSP  HHHHHHHHHLLlLLHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLH-----HHL
Query EEVTFARQLYPgLDPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRW-----ELS  377
ident | |                | |     |  |                             
Sbjct EGVRNLVEHCG-IALDEVLRMATLYPARAIGvekrlGTLAA--gkvanLTAFtpdfkITK  323
DSSP  HHHHHHHHHHL-LLHHHHHHHHLHHHHHHLLlllllLLLLL--lllllEEEElllllEEE


DSSP  L--------ll
Query R--------dl  380
ident            
Sbjct Tivngnevvtq  334
DSSP  Eeelleeeeel


No 22: Query=2imrA Sbjct=3nqbA Z-score=15.9

back to top
DSSP  ----------------------lLEEEEE-ELEEELL-EELLEE-EEEELLEEEEEelhh
Query ----------------------hTPRLLT-CDVLYTG-AQSPGG-VVVVGETVAAAghpd   35
ident                           | |                   ||   |      
Sbjct epadlnddtlraravaaargdqrFDVLITgGTLVDVVtGELRPAdIGIVGALIASV---h   57
DSSP  llhhhllhhhhhhhhhhhhllllEEEEEElLEEELLLlLLEEELeEEEELLEEEEE---e


DSSP  HHHHhLLLL-EEEELL-LEELLLLLEEEEELLLlhhhhhhlhhhhllhhhhhhhllllhh
Query ELRRqYPHA-AEERAG-AVIAPPPVNAHTHLDMsayefqalpyfqwipevvirgrhlrgv   93
ident |       |     || |   |     | |                              
Sbjct EPAS-RRDAaQVIDAGgAYVSPGLIDTHXHIES-------------------------sx   91
DSSP  LLLL-LLLEeEEEELLlLEEEELEEEEEELHHH-------------------------hl


DSSP  HHHHHHHHHHHHLLLLLEEEEELL------HHHHHHHH--LLLL-LLEEEEEEEL--LLL
Query AAAQAGADTLTRLGAGGVGDIVWA------PEVMDALL--ARED-LSGTLYFEVL--NPF  142
ident     | |      |                               |   |          
Sbjct ITPAAYAAAVVARGVTTIVWDPHEfgnvhgVDGVRWAAkaIENLpLRAILLAPSCvpSAP  151
DSSP  LLHHHHHHHHHLLLEEEEEELLHHhhhhhlHHHHHHHHhhHLLLlLEEEEEELLLllLLL


DSSP  HH---hhhhHHHHHHHHHHHHHlllllleeEEEEELLLL---lllHHHHHHHHHHHHHHL
Query PD---kadeVFAAARTHLERWRrlerpglrLGLSPHTPF---tvsHRLMRLLSDYAAGEG  196
ident            |     |             |                            
Sbjct GLerggadfDAAILADLLSWPE-------iGGIAEIXNXrgvierDPRXSGIVQAGLAAE  204
DSSP  LLlllllllLHHHHHHHHLLLL-------eEEEEEELLHhhhhllLHHHHHHHHHHHHHL


DSSP  LLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhhhlllllllLLHHHHHHhHLL
Query LPLQIHVAehptelemfrtgggplwdnrmpalyphtlaevigrepgpdLTPVRYLDeLGV  256
ident      |                                                      
Sbjct KLVCGHAR-------------------------------------glkNADLNAFX-AAG  226
DSSP  LEEEELLL-------------------------------------lllHHHHHHHH-HLL


DSSP  HhhlLEEEELLL--LLHHHHHHHhhhlLLEEELhHHHHhllLLLL-LHHHHHHL---LLL
Query LaarPTLVHMVN--VTPDDIARVaragCAVVTCpRSNHhleCGTF-DWPAFAAA---GVE  310
ident           |                        |             |          
Sbjct V---SSDHELVSgeDLXAKLRAG----LTIELR-GSHD---HLLPeFVAALNTLghlPQT  275
DSSP  L---LEELLLLLhhHHHHHHHLL----LEEEEE-LLLH---HHHHhHHHHHHHHlllLLL


DSSP  EEELLLLHH---hhLLLLLHHHHHHHHHHLllLLHHHHHHHHHHHHHHHHL---LLLLLL
Query VALGTDSVA---sgETLNVREEVTFARQLYpgLDPRVLVRAAVKGGQRVVG---TPFLRR  364
ident | | || |              |         | |    |||        |         
Sbjct VTLCTDDVFpddllQGGGLDDVVRRLVRYG--LKPEWALRAATLNAAQRLGrsdLGLIAA  333
DSSP  EEEELLLLLhhhhhHLLLHHHHHHHHHHLL--LLHHHHHHHHLHHHHHHHLlllLLLLLL


DSSP  LLLllhHHLHH------------------HLLLL--------------------------
Query GETwqeGFRWE------------------LSRDL--------------------------  380
ident |         |                                                 
Sbjct GRR-adIVVFEdlngfsarhvlasgravaEGGRXlvdiptcdttvlkgsxklplrxandf  392
DSSP  LLL-llEEEELlllllleeeeeelleeeeELLEElllllllllhhhllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  380
ident                                                             
Sbjct lvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgf  452
DSSP  llllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  380
ident                                                             
Sbjct ltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailpl  512
DSSP  eellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  380
ident                                                             
Sbjct plsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgia  572
DSSP  llllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellllee


DSSP  ---------------
Query ---------------  380
ident                
Sbjct dvltgkvxespviev  587
DSSP  elllleeellleeel


No 23: Query=2imrA Sbjct=3k2gB Z-score=15.7

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct ----------------------------slselspchvrsgrixtvdgpipssalGHTLX   32
DSSP  ----------------------------llllllllllllleeeelleeeehhhlLLEEL


DSSP  EEELLLLHHHHH------------------hlhhhHLLHHH--hHHHLlLLHHHHHHHHH
Query HTHLDMSAYEFQ------------------alpyfQWIPEV--vIRGRhLRGVAAAQAGA  100
ident | ||                                             |     | |  
Sbjct HEHLQNDCRCWWnppqeperqylaeapisieilseLRQDPFvnkHNIA-LDDLDLAIAEV   91
DSSP  LLLLLEELHHHLlllllhhhhhhhhllllhhhhhhHHLLHHhllLLLE-ELLHHHHHHHH


DSSP  HHHHHLLLLLEEEEE---LLHHhHHHHHLLL---LLLEEEEEeELLL------LHHH-HH
Query DTLTRLGAGGVGDIV---WAPEvMDALLARE---DLSGTLYFeVLNP------FPDK-AD  147
ident       |     |             |                               ||
Sbjct KQFAAVGGRSIVDPTcrgIGRD-PVKLRRISaetGVQVVXGAgYYLAssxpetAARLsAD  150
DSSP  HHHHHLLLLEEEELLlllLLLL-HHHHHHHHhhhLLEEEELLlLLLHhhllhhHHLLlHH


DSSP  HHHHHHHHHHHHH---HLLLllleEEEEEELLLL----llLHHHHHHHHHHHHHHLLLLE
Query EVFAAARTHLERW---RRLErpglRLGLSPHTPF----tvSHRLMRLLSDYAAGEGLPLQ  200
ident                                              |         |||| 
Sbjct DIADEIVAEALEGtdgTDAR----IGLIGEIGVSsdftaeEEKSLRGAARAQVRTGLPLX  206
DSSP  HHHHHHHHHHHLLlllLLLL----LLLEEEELLLllllhhHHHHHHHHHHHHHHHLLLEE


DSSP  EEELLLHhhhhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHLLH---
Query IHVAEHPtelemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLGVL---  257
ident  |                                                     |    
Sbjct VHLPGWF--------------------------------------RLAHRVL-DLVEeeg  227
DSSP  ELLLLLL--------------------------------------LLHHHHH-HHHHhll


DSSP  --HHLLEEEELLLL--LHHHHHHHHHHLLLEE-ELHHhHHHL------LLLL-----lLH
Query --AARPTLVHMVNV--TPDDIARVARAGCAVV-TCPRsNHHL------ECGT-----fDW  301
ident        | |       |   |  |  |                     |          
Sbjct adLRHTVLCHXNPShxDPVYQATLAQRGAFLEfDXIG-XDFFyadqgvQCPSddevarAI  286
DSSP  llHHHEEELLLHHHllLHHHHHHHHHHLLEEEeLLLL-LLLEelllleELLLhhhhhhHH


DSSP  HHHHHLLL--LEEELLLLHH-------hhLLLLlhHHHH-HHHHHLL-LLLHHHHHHHHH
Query PAFAAAGV--EVALGTDSVA-------sgETLNvrEEVT-FARQLYP-GLDPRVLVRAAV  350
ident    |  |      |  |                       |   |   |||   |    |
Sbjct LGLADHGYldRILLSHDVFVkxxltryggNGYA--FVTKhFLPRLRRhGLDDAALETLXV  344
DSSP  HHHHHLLLhhHEEELLLLLLhhhlhhhllLLLL--HHHHlHHHHHHHlLLLHHHHHHHHL


DSSP  HHHHHHHLlllllllllllhhhlhhhllll
Query KGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident     ||                        
Sbjct TNPRRVFD----------------asiegh  358
DSSP  HHHHHHHL----------------llllll


No 24: Query=2imrA Sbjct=3gg7A Z-score=15.6

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct -------------------------------------------------------SLIDF    5
DSSP  -------------------------------------------------------LLEEE


DSSP  EEELLLlhhhhhhlhhhhllhhhhhhhllllhhHHHHHHHHHHHHLlLLLEEEEE----L
Query HTHLDMsayefqalpyfqwipevvirgrhlrgvAAAQAGADTLTRLgAGGVGDIV----W  116
ident | |||                                | |          |         
Sbjct HVHLDL--------------------------yPDPVAVARACEER-QLTVLSVTttpaA   38
DSSP  EELHHH--------------------------lLLHHHHHHHHHHL-LLEEEELLllhhH


DSSP  LHHHHhHHHLlLLLLeEEEEEEL--LLLHhHHHHHhHHHHHHHHHhhlllllleEEEEEE
Query APEVMdALLArEDLSgTLYFEVL--NPFPdKADEVfAAARTHLERwrrlerpglRLGLSP  174
ident       || |                     |          |                 
Sbjct WRGTL-ALAA-GRPHvWTALGFHpeVVSE-RAADL-PWFDRYLPE---------TRFVGE   85
DSSP  HHHHH-HHHL-LLLLeEELLLLLhhHLLL-LHHHL-HHHHHHHHH---------LLEEEE


DSSP  LLLL---------llLHHHHHHHHHHHHHH-LLLLEEEELllhhhhhhhhhlllllhhhl
Query HTPF---------tvSHRLMRLLSDYAAGE-GLPLQIHVAehptelemfrtgggplwdnr  224
ident                                |  | ||                      
Sbjct VGLDgspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR--------------------  125
DSSP  EELLllhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL--------------------


DSSP  lhhhllllhhhhhlllllllllHHHHHHhhLLHH-----HLLEEEELLlLLHHHHHHHHH
Query mpalyphtlaevigrepgpdltPVRYLDelGVLA-----ARPTLVHMVnVTPDDIARVAR  279
ident                                 |        | |            |   
Sbjct ---------------------rAESEVL--NCLEanprsGTPILHWYS-GSVTELRRAIS  161
DSSP  ---------------------lLHHHHH--HHHHhlhhhEEEEEELLL-LLHHHHHHHHH


DSSP  HLLLEEELhHHHHhllLLLL--LHHHHHhlllLEEELLLLHHH-----hLLLL-LHHHHH
Query AGCAVVTCpRSNHhleCGTF--DWPAFAaagvEVALGTDSVAS-----gETLN-VREEVT  331
ident  ||                              |   ||               |   | 
Sbjct LGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETDGPFLeldgqaALPWdVKSVVE  216
DSSP  LLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLLLLLLeelleeLLHHhHHHHHH


DSSP  HHHHHLLlLLHHHHHHHHHHHHHHHhllllllllllllhhhlhhhllll
Query FARQLYPgLDPRVLVRAAVKGGQRVvgtpflrrgetwqegfrwelsrdl  380
ident                |       |                         
Sbjct GLSKIWQ-IPASEVERIVKENVSRL---------------------lgt  243
DSSP  HHHHHHL-LLHHHHHHHHHHHHHHH---------------------hhl


No 25: Query=2imrA Sbjct=3e74A Z-score=15.6

back to top
DSSP  -lleEEEEELeEELLEELLE-EEEEellEEEEEElhHHHHHHlllleeEELL-LEELLLL
Query -htpRLLTCDvLYTGAQSPG-GVVVvgeTVAAAGhpDELRRQyphaaeERAG-AVIAPPP   57
ident                         |     || |    |           |   |  |  
Sbjct sfdlIIKNGT-VILENEARVvDIAVkggKIAAIG--QDLGDA---kevXDASgLVVSPGX   54
DSSP  leeeEEELLE-EELLLLEEElEEEEellEEEEEE--LLLLLE---eeeEELLlLEEEELE


DSSP  LEEEEELlllhhhhhhlhhhhllhhhhhhhllllhhhHHHHHHHHHHHLLLLLEEEEEL-
Query VNAHTHLdmsayefqalpyfqwipevvirgrhlrgvaAAQAGADTLTRLGAGGVGDIVW-  116
ident | ||||                                   |       |          
Sbjct VDAHTHI------------------------------GYETGTRAAAKGGITTXIEXPLn   84
DSSP  EEEEELL------------------------------LHHHHHHHHHHLLEEEEEELLLl


DSSP  ------lHHHHHHHHL----lLLLLEEEEEEELLllhhhhhhHHHHHHhHHHHHHlllll
Query ------aPEVMDALLA----rEDLSGTLYFEVLNpfpdkadeVFAAARtHLERWRrlerp  166
ident                                                   |         
Sbjct qlpatvdRASIELKFDaakgkLTIDAAQLGGLVS-------yNIDRLH-ELDEVG-----  131
DSSP  lllllllHHHHHHHHHhhlllLLLEEEELEELLL-------lLLLLHH-HHHHHL-----


DSSP  leEEEEEElLLLLLLHHHHHHHHHHHHHHLLLLEEEELllhhHHHHhhhllllLHHHLL-
Query glRLGLSPhTPFTVSHRLMRLLSDYAAGEGLPLQIHVAehptELEMfrtgggpLWDNRM-  225
ident     |        |               | |   |                        
Sbjct --VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVLVHCE----NALI-------CDELGEe  177
DSSP  --LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEEEELL----LHHH-------HHHHHHh


DSSP  --hhhllllhhhhhllllllllLHHHHHHhHLLH--HHLLEEEELLLLLhhHHHHHHHHL
Query --palyphtlaevigrepgpdlTPVRYLDeLGVL--AARPTLVHMVNVTpdDIARVARAG  281
ident                          |            |    |           | || 
Sbjct akregrvtahdyvasrpvftevEAIRRVL-YLAKvaGCRLHVCHVSSPE--GVEEVTRAR  234
DSSP  hhhhllllhhhhhhlllhhhhhHHHHHHH-HHHHhhLLLEEELLLLLHH--HHHHHHHHH


DSSP  -----LLEEELHHHHHH---------------LLLL--------llLHHHHhhllLLEEE
Query -----CAVVTCPRSNHH---------------LECG--------tfDWPAFaaagVEVAL  313
ident           ||                                               |
Sbjct qegqdITCESCPHYFVLdtdqfeeigtlakcsPPIRdlenqkgxweKLFNG----EIDCL  290
DSSP  hllllEEEEELLHHHHLlhhhhhhhlhhhlllLLLLlhhhhhhhhhHHHLL----LLLEE


DSSP  LLLLHH---------------HHLLL-LLHHHHH-HHHHHLLlLLHHHHHHHHHHHHHHH
Query GTDSVA---------------SGETL-NVREEVT-FARQLYPgLDPRVLVRAAVKGGQRV  356
ident   |                      |          | |                     
Sbjct VSDHSPcppexkagnixkawgGIAGLqSCXDVXFdEAVQKRG-XSLPXFGKLXATNAADI  349
DSSP  LLLLLLlllllllllllllllLLLLHhHHHHHHHhHHLLLLL-LLHHHHHHHHLHHHHHH


DSSP  HL----LLLLLlLLLLlhHHLH------------------------------HHLL----
Query VG----TPFLRrGETWqeGFRW------------------------------ELSR----  378
ident  |          |                                               
Sbjct FGlqqkGRIAP-GKDA-dFVFIqpnssyvltnddleyrhkvspyvgrtigarITKTilrg  407
DSSP  LLllllLLLLL-LLLL-lEEEEelllleellhhhllllllllllllleelleEEEEeell


DSSP  --------------------ll
Query --------------------dl  380
ident                       
Sbjct dviydieqgfpvapkgqfilkh  429
DSSP  eeeeelllllllllllleelll


No 26: Query=2imrA Sbjct=1bf6A Z-score=15.5

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
ident                                                            |
Sbjct --------------------------------------------------sfdpTGYTLA   10
DSSP  --------------------------------------------------llllLLEEEE


DSSP  EEELLLLhhHHHHlhhhhllhhhHHHHLlLLHHHHHHHHHHHHHHLLLLLEEEEELL--h
Query HTHLDMSayEFQAlpyfqwipevVIRGRhLRGVAAAQAGADTLTRLGAGGVGDIVWA--p  118
ident | ||                       | |   |        |   |   |         
Sbjct HEHLHID--LSGF--------knNVDCR-LDQYAFICQEMNDLMTRGVRNVIEMTNRymg   59
DSSP  EELLLEE--LHHH--------hlLHHHE-ELLHHHHHHHHHHHHHLLEEEEEELLLHhhl


DSSP  hHHHHHHLLL---LLLEEEEEEELLL------LHHH-HHHHHHHHHHHHHHHH--LLLLl
Query eVMDALLARE---DLSGTLYFEVLNP------FPDK-ADEVFAAARTHLERWR--RLERp  166
ident       |                                |         |          
Sbjct rNAQFMLDVMretGINVVACTGYYQDaffpehVATRsVQELAQEMVDEIEQGIdgTELK-  118
DSSP  lLHHHHHHHHhhhLLEEEEEELLLLHhhlllhHHHLlHHHHHHHHHHHHHLLLllLLLL-


DSSP  leeEEEEELLLL-----llLHHHHHHHHHHHHHHLLLLEEEELLlhhhhhhhhhlllllh
Query glrLGLSPHTPF-----tvSHRLMRLLSDYAAGEGLPLQIHVAEhptelemfrtgggplw  221
ident                                   | |   |                   
Sbjct --aGIIAEIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF----------------  160
DSSP  --eEEEEEEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH----------------


DSSP  hhllhhhllllhhhhhllllllllLHHHHHHHHLL----hHHLLEEEELL-LLLHHHHHH
Query dnrmpalyphtlaevigrepgpdlTPVRYLDELGV----lAARPTLVHMV-NVTPDDIAR  276
ident                         |       |         | |  |       | |  
Sbjct -----------------------sTMGLEQLALLQahgvdLSRVTVGHCDlKDNLDNILK  197
DSSP  -----------------------hLLHHHHHHHHHhllllHHHEEELLLLlLLLHHHHHH


DSSP  HHHHLLLEE-ELHHhhHHLLLLL----lLHHHHH-HLLL-LEEELLLLHH-------hhL
Query VARAGCAVV-TCPRsnHHLECGT----fDWPAFA-AAGV-EVALGTDSVA-------sgE  322
ident     |  |                       |         | |  |             
Sbjct MIDLGAYVQfDTIG--KNSYYPDekriaMLHALRdRGLLnRVMLSMDITRrshlkanggY  255
DSSP  HHHLLLEEEeLLLL--LLLLLLHhhhhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhllL


DSSP  LLLlhHHHH-HHHHHL-LLLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query TLNvrEEVT-FARQLY-PGLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident         | |  ||   |                                         
Sbjct GYD--YLLTtFIPQLRqSGFSQADVDVMLRENPSQFFQ----------------------  291
DSSP  LLL--HHHHlHHHHHHhLLLLHHHHHHHHLHHHHHHLL----------------------


No 27: Query=2imrA Sbjct=3griA Z-score=15.5

back to top
DSSP  lleeEEEEleeelleELLEEEEEE-----lLEEEEEelhhhhhhHLLL----leeeELLL
Query htprLLTCdvlytgaQSPGGVVVV-----gETVAAAghpdelrrQYPH----aaeeRAGA   51
ident                                  | |          |             
Sbjct xkliKNGK---vlqnGELQQADILidgkviKQIAPA--------IEPSngvdiidaKGHF   49
DSSP  leeeELLE---eeelLEEEELEEEeelleeEEEELL--------LLLLllleeeelLLLE


DSSP  eELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllLLHHH---HHHHHHHHHHHLLL
Query vIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhLRGVA---AAQAGADTLTRLGA  108
ident    |  |  | ||                           |         |     | | 
Sbjct -VSPGFVDVHVHLR------------------------EPGGEykeTIETGTKAAARGGF   84
DSSP  -EEELEEEEEELLL------------------------LLLLLlllLHHHHHHHHHHLLE


DSSP  LLEEEEELLHH------hHHHHH-LLLL---LLEEEEEEE---LLLLhhhhhhhhHHHHh
Query GGVGDIVWAPE------vMDALL-ARED---LSGTLYFEV---LNPFpdkadevfAAARt  155
ident   |                 ||     |        |                       
Sbjct TTVCPXPNTRPvpdsvehFEALQkLIDDnaqVRVLPYASIttrQLGK--------ELVD-  135
DSSP  EEEEELLLLLLllllhhhHHHHHhHHHHhllLEELLLEELlhhHLLL--------LLLL-


DSSP  hHHHHHLLLllleEEEEEELLlLLLL-HHHHHHHHHHHHHHLLLLEEEELllhhHHHHhh
Query hLERWRRLErpglRLGLSPHTpFTVS-HRLMRLLSDYAAGEGLPLQIHVAehptELEMfr  214
ident                         |            ||        |            
Sbjct -FPALVKEG----AFAFTDDG-VGVQtASXXYEGXIEAAKVNKAIVAHCE----DNSL--  183
DSSP  -HHHHHLLL----LLLEEELL-LLLLlHHHHHHHHHHHHHHLLLEEELLL----LHHH--


DSSP  hllllLHHHllhhhllllhhhhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLL-
Query tgggpLWDNrmpalyphtlaevigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVT-  270
ident                                                      |      
Sbjct -----IYGGaxhegkrskelgipgipnicesVQIARDV--LLAEaagCHYHVCHVSTKEs  236
DSSP  -----LLLLleellhhhhhhllleellhhhhHHHHHHH--HHHHhhlLLEEELLLLLHHh


DSSP  hHHHHHHHH--HLLLEEELHHHHHH---------------LLLL-----llLHHHHHHlL
Query pDDIARVAR--AGCAVVTCPRSNHH---------------LECG-----tfDWPAFAAaG  308
ident    |    |          |                                       |
Sbjct vRVIRDAKRagIHVTAEVTPHHLLLteddipgnnaiykxnPPLRstedreaLLEGLLD-G  295
DSSP  hHHHHHHHHllLLEEEEELHHHHHLlhhhlllllhhhlllLLLLlhhhhhhHHHHHHL-L


DSSP  LLEEELLLLHH---------------HHLLLLlhHHHHHHHHHL---LLLLHHHHHHHHH
Query VEVALGTDSVA---------------SGETLNvrEEVTFARQLY---PGLDPRVLVRAAV  350
ident       ||                                              ||    
Sbjct TIDCIATDHAPhardekaqpxekapfGIVGSE--TAFPLLYTHFvknGDWTLQQLVDYLT  353
DSSP  LLLEELLLLLLllhhhhlllllllllLLLLLL--LHHHHHHHHHlllLLLLHHHHHHHHL


DSSP  HHHHHHHL---LLLLLllllllhHHLHH------------------------------HL
Query KGGQRVVG---TPFLRrgetwqeGFRWE------------------------------LS  377
ident                                                             
Sbjct IKPCETFNleyGTLKE--ngyadLTIIDldseqeikgedflskadntpfigykvygnpIL  411
DSSP  HHHHHHLLlllLLLLL--lllllEEEEElllleellhhhllllllllllllleelleeEE


DSSP  LL--------l
Query RD--------l  380
ident            
Sbjct TXvegevkfeg  422
DSSP  EEelleeeeel


No 28: Query=2imrA Sbjct=4b3zD Z-score=15.4

back to top
DSSP  lLEEE-EEELeEELLE-ELLEEEEEELLEEEEEelHHHHhhHLLL-LEEEEL-LLEELLL
Query hTPRL-LTCDvLYTGA-QSPGGVVVVGETVAAAghPDELrrQYPH-AAEERA-GAVIAPP   56
ident     |                 |               |    |       | |    | 
Sbjct -DRLLiKGGR-IINDDqSLYADVYLEDGLIKQI--GENL--IVPGgVKTIEAnGRMVIPG   54
DSSP  -LEEEeEEEE-EELLLlEEEEEEEEELLEEEEE--ELLL--LLLLlLEEEELlLLEEEEL


DSSP  LLEEEEELLLlhhhhhhlhhhhllhhhhhhHLLLlhhhHHHHHHHHHHHLLLLLEEEEEL
Query PVNAHTHLDMsayefqalpyfqwipevvirGRHLrgvaAAQAGADTLTRLGAGGVGDIVW  116
ident      | |                                  |       |     | | 
Sbjct GIDVNTYLQK--------------------TAAD----DFFQGTRAALVGGTTMIIDHVV   90
DSSP  EEEEEELLLL--------------------LLLL----LHHHHHHHHHHLLEEEEEEEEL


DSSP  ---------LHHHHHH-HHLLLLLLEEEEEEELLllhhhHHHHHHHHHHHHHHHHlllll
Query ---------APEVMDA-LLAREDLSGTLYFEVLNpfpdkADEVFAAARTHLERWRrlerp  166
ident            |               |            | |                 
Sbjct pepgsslltSFEKWHEaADTKSCCDYSLHVDITS----wYDGVREELEVLVQDKG-----  141
DSSP  llllllhhhHHHHHHHhHHLLLLLEEEEEEELLL----lLLLHHHHHHHHHHLLL-----


DSSP  leEEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLLEEEEL-----------------
Query glRLGLSpHTPF-----TVSHRLMRLLSDYAAGEGLPLQIHVA-----------------  204
ident                    |            | |     |                   
Sbjct --VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgi  198
DSSP  --LLEEE-EELLlllllLLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhlll


DSSP  ---------llHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHL
Query ---------ehPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLG  255
ident                                                     |       
Sbjct tgpeghalsrpEELE----------------------------------aEAVFRAI-TI  223
DSSP  lllhhhhhhllHHHH----------------------------------hHHHHHHH-HH


DSSP  LH--HHLLEEEELLL--LLHHHHHHHH-HHLLLEEELHHHHHH-----------------
Query VL--AARPTLVHMVN--VTPDDIARVA-RAGCAVVTCPRSNHH-----------------  293
ident                                        |                    
Sbjct AGriNCPVYITKVMSksAADIIALARKkGPLVFGEPIAASLGTdgthywsknwakaaafv  283
DSSP  HHhhLLLEEEEEELLhhHHHHHHHHHHhLLLEEEEELHHHHHLllhhhhlllhhhhhhll


DSSP  --LLLL------llLHHHHHHlLLLEEELLLLHH------------------HHLLL-LL
Query --LECG------tfDWPAFAAaGVEVALGTDSVA------------------SGETL-NV  326
ident                    |  |     |                               
Sbjct tsPPLSpdpttpdyLTSLLAC-GDLQVTGSGHCPystaqkavgkdnftlipeGVNGIeER  342
DSSP  llLLLLllllhhhhHHHHHHH-LLLLLLLLLLLLllhhhhhhhlllhhhlllLLLLLlLH


DSSP  HHHHHH-HHHHlLLLLHHHHHHHHHHHHHHHHL-----LLLLLlLLLLlhHHLH------
Query REEVTF-ARQLyPGLDPRVLVRAAVKGGQRVVG-----TPFLRrGETWqeGFRW------  374
ident    |   |       |    |                       |        |      
Sbjct MTVVWDkAVAT-GKMDENQFVAVTSTNAAKIFNlyprkGRIAV-GSDA-dVVIWdpdklk  399
DSSP  HHHHHHhHLLL-LLLLHHHHHHHHLHHHHHHHLlllllLLLLL-LLLL-lEEEEeeeeee


DSSP  ------------------------HHLL--------------------------------
Query ------------------------ELSR--------------------------------  378
ident                          |                                  
Sbjct titakshksaveynifegmechgsPLVVisqgkivfedgninvnkgmgrfiprkafpehl  459
DSSP  elllllllllllllllllleeeeeEEEEeelleeeeelleellllllllllllllllhhh


DSSP  ----------------ll
Query ----------------dl  380
ident                   
Sbjct yqrvkirnkvfglqgvsr  477
DSSP  hhhhhhhhhhllllllll


No 29: Query=2imrA Sbjct=3cjpA Z-score=14.9

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct -------------------------------------------------------LIIDG    5
DSSP  -------------------------------------------------------LLEEE


DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllllhhHHHHHHHHHHHHLLLLLEEEEEL----
Query HTHLDmsayefqalpyfqwipevvirgrhlrgvAAAQAGADTLTRLGAGGVGDIVW----  116
ident |||                                           |             
Sbjct HTHVI----------------------------LPVEKHIKIMDEAGVDKTILFSTsihp   37
DSSP  EEELL----------------------------LLHHHHHHHHHHHLLLEEEEELLlllh


DSSP  ---------------------------------LHHHHHHHHL-LLLLLeEEEEEELLLL
Query ---------------------------------APEVMDALLA-REDLSgTLYFEVLNPF  142
ident                                                        |    
Sbjct etavnlrdvkkemkklndvvngktnsmidvrrnSIKELTNVIQaYPSRY-VGFGNVPVGL   96
DSSP  hhlllhhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHhLLLLE-EEEELLLLLL


DSSP  hhHHHHHHHHHHHHHHHHHlllllleEEEEEELLLL-lLLHHhHHHHHHHHHHH-LLLLE
Query pdKADEVFAAARTHLERWRrlerpglRLGLSPHTPF-tVSHRlMRLLSDYAAGE-GLPLQ  200
ident                             |    ||              |      ||  
Sbjct --SENDTNSYIEENIVNNK-------LVGIGELTPAsgQIKS-LKPIFKYSMDSgSLPIW  146
DSSP  --LHHHHHHHHHHHLLLLL-------LLEEEEELLLllLHHH-HHHHHHHHHHLlLLLEE


DSSP  EEELllHHHHhhhhhlllllhhhllhhhllllhhhhhlllllllLLHHHHHHhhLLHH--
Query IHVAehPTELemfrtgggplwdnrmpalyphtlaevigrepgpdLTPVRYLDelGVLA--  258
ident ||                                          |               
Sbjct IHAF--NPLV----------------------------------LQDIKEIA--ELCKaf  168
DSSP  ELLL--LLLL----------------------------------HHHHHHHH--HHHHhl


DSSP  --HLLEEEE-LLLLLHHHHHHHHHHL-LLEEELhhHHHHllllLLLHHHHHHLL-lLEEE
Query --ARPTLVH-MVNVTPDDIARVARAG-CAVVTCprSNHHlecgTFDWPAFAAAG-vEVAL  313
ident       | |                      |           ||               
Sbjct pkVPVILGHmGGSNWMTAVELAKEIQnLYLDTS--AYFS----TFVLKIVINELplKCIF  222
DSSP  llLLEEEHHhHHHHHHHHHHHHHHLLlEEEELL--LLLL----HHHHHHHHHHLllLEEL


DSSP  LLLLHhHHLLlllHHHHHHHHHHLllLLHHHHHHHHHHHHHHHHLLllllllllllhhhl
Query GTDSVaSGETlnvREEVTFARQLYpgLDPRVLVRAAVKGGQRVVGTpflrrgetwqegfr  373
ident |||    |                   |  |          |                  
Sbjct GTDMP-FGDL---QLSIEAIKKMS--NDSYVANAVLGDNISRLLNI--------------  262
DSSP  LLLLL-LLLH---HHHHHHHHHHL--LLHHHHHHHHLHHHHHHHLL--------------


DSSP  hhhllll
Query welsrdl  380
ident        
Sbjct -------  262
DSSP  -------


No 30: Query=2imrA Sbjct=3ooqA Z-score=14.9

back to top
DSSP  llEEEEEELEEELL--eELLEEEEEELLEEEEEElhHHHHhhLLLLEEEEL-lLEELLLL
Query htPRLLTCDVLYTG--aQSPGGVVVVGETVAAAGhpDELRrqYPHAAEERA-gAVIAPPP   57
ident     |               | | |    |   |         | |           |  
Sbjct --KILFKNATVFPItsrPFKGDVLVSNGKVEKVG--ENIE--DPDAEIVDLtgKFLFPGF   54
DSSP  --LEEEEEEEELLLlllLEEEEEEEELLEEEEEE--LLLL--LLLLEEEELllLEEEELE


DSSP  LEEEEELLLlhhhhhhlhhhhllhhhhHHHLLLL----------------HHHHhHHHHH
Query VNAHTHLDMsayefqalpyfqwipevvIRGRHLR----------------GVAAaQAGAD  101
ident | || |                                            |         
Sbjct VDAHSHIGL--------------feegVGYYYSDgneatdpvtphvkaldGFNPqDPAIE  100
DSSP  EEEEELLLL--------------llllLLHHHLLlllllllllllllhhhHLLLlLHHHH


DSSP  HHHHLLLLLEEEEEL----------lhhhhhhhHLLLllleeeeeeellllhhhhhhhhh
Query TLTRLGAGGVGDIVW----------apevmdalLAREdlsgtlyfevlnpfpdkadevfa  151
ident      |   |                                                  
Sbjct RALAGGVTSVXIVPGsanpvggqgsvikfrsiiVEEC-----------------------  137
DSSP  HHHLLLEEEEEELLLlllleeeeeeeeelllllHHHH-----------------------


DSSP  hhhhhhhhhhllllLLEEE-EEEElLLLL-----------------llHHHHH-------
Query aarthlerwrrlerPGLRL-GLSPhTPFT-----------------vsHRLMR-------  186
ident                     ||                              |       
Sbjct --------------IVKDPaGLKX-AFGEnpkrvygerkqtpstrxgtAGVIRdyftkvk  182
DSSP  --------------EEEEEeEEEE-ELLHhhhhhhhhlllllllhhhhHHHHHhhhhhhh


DSSP  -----------------------hhhHHHHHHLLLLEEEELllhhhhhhhhhlllllhhh
Query -----------------------llsDYAAGEGLPLQIHVAehptelemfrtgggplwdn  223
ident                                   |   |                     
Sbjct nyxkkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAH-------------------  223
DSSP  hhhhhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEEL-------------------


DSSP  llhhhllllhhhhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLLHhHHHHHHHH
Query rmpalyphtlaevigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVTPdDIARVARA  280
ident                                             |            |  
Sbjct --------------------raDDILTAI--RIAEefgFNLVIEHGTEAYK-ISKVLAEK  260
DSSP  --------------------lhHHHHHHH--HHHHhhlLLEEEEELLLHHH-HHHHHHHH


DSSP  LLLEE-ELHHhhHHLL-----LLLL-LHHHHHHLLLLEEELLLLHhhHLLL-LLHHHHHH
Query GCAVV-TCPRsnHHLE-----CGTF-DWPAFAAAGVEVALGTDSVasGETL-NVREEVTF  332
ident    ||                  |          ||  ||  |       |         
Sbjct KIPVVvGPLL--TFRTklelkDLTXeTIAKLLKDGVLIALXCDHP--VIPLeFATVQAAT  316
DSSP  LLLEEeLLLL--LLLLlhhhlLLLLlHHHHHHHLLLLEEELLLLL--LLLHhHHHHHHHH


DSSP  HHHHLllLLHHHHHHHHHHHHHHHHL----LLLLLLLLLLLhHHLH--------HHLL--
Query ARQLYpgLDPRVLVRAAVKGGQRVVG----TPFLRRGETWQeGFRW--------ELSR--  378
ident |           |            |          |        |              
Sbjct AXRYG--AKEEDLLKILTVNPAKILGledrIGSIEPGKDAD-LVVWsghpfdxkSVVErv  373
DSSP  HHHHL--LLHHHHHHLLLHHHHHHLLllllLLLLLLLLLLL-EEEEllllllllLLEEee


DSSP  ---------ll
Query ---------dl  380
ident            
Sbjct yidgvevfrre  384
DSSP  eelleeeeell


No 31: Query=2imrA Sbjct=4dlfA Z-score=14.8

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
ident                                                             
Sbjct ------------------------------------------------------ALRIDS    6
DSSP  ------------------------------------------------------LLLEEE


DSSP  EEELL---llHHHHHhlhhhhLLHHhhHHHLLLlhhhHHHHHHHHHHHL-LLLLEEEEE-
Query HTHLD---msAYEFQalpyfqWIPEvvIRGRHLrgvaAAQAGADTLTRL-GAGGVGDIV-  115
ident | |        |                                 |      |       
Sbjct HQHFWryraaDYPWI------GAGM--GVLARD----YLPDALHPLMHAqALGASIAVQa   54
DSSP  EELLLlllhhHLLLL------LLLL--HHHLLL----LLHHHHHHHHHHlLLLEEEEELl


DSSP  -----LLHHHHHHHHLLlLLLEEEEEEEllllhhhhhhHHHHHHHHHHHhHLLLlllEEE
Query -----WAPEVMDALLAReDLSGTLYFEVlnpfpdkadeVFAAARTHLERwRRLErpgLRL  170
ident                                                    |        
Sbjct ragrdETAFLLELACDE-ARIAAVVGWE--------dlRAPQLAERVAE-WRGT---KLR  101
DSSP  lllhhHHHHHHHHHLLL-LLEEEEEELL--------llLLLLHHHHHHL-LLLL---LEE


DSSP  EEEELLLLL-----LLHH-HHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhl
Query GLSPHTPFT-----VSHR-LMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnr  224
ident |                                     |                     
Sbjct GFRHQLQDEadvraFVDDaDFARGVAWLQANDYVYDVLVF--------------------  141
DSSP  EEEELHHHLllhhhHHHLhHHHHHHHHHHHLLLEEEELLL--------------------


DSSP  lhhhllllhhhhhllllllllLHHHHHHhhLLHH----HLLEEE-ELLL-----------
Query mpalyphtlaevigrepgpdlTPVRYLDelGVLA----ARPTLV-HMVN-----------  268
ident                                  |        |                 
Sbjct --------------------eRQLPDVQ--AFCArhdaHWLVLDhAGKPalaefdrddta  179
DSSP  --------------------hHHHHHHH--HHHHhlllLLEEEHhHHLLlhhhllllllh


DSSP  --lLHHHHHHHHHHL-LLEEELhhHHHHLL-----------lLLLL-HHHHHHLLL--LE
Query --vTPDDIARVARAG-CAVVTCprSNHHLE-----------cGTFD-WPAFAAAGV--EV  311
ident            |                                     |   |      
Sbjct larWRAALRELAALPhVVCKLS--GLVTEAdwrrglrasdlrHIEQcLDAALDAFGpqRL  237
DSSP  hhhHHHHHHHHHLLLlEEEEEL--LLLLLLlllllllhhhhhHHHHhHHHHHHHHLhhHE


DSSP  EELLLLHhHHLL-lllHHHHHHHHHHLLLLLH-HHHHHHHHHHHHHHHLlllllllllll
Query ALGTDSVaSGET-lnvREEVTFARQLYPGLDP-RVLVRAAVKGGQRVVGtpflrrgetwq  369
ident   | |            |                           |              
Sbjct MFGSDWP-VCLLaasyDEVASLVERWAESRLSaAERSALWGGTAARCYA-----------  285
DSSP  EELLLLL-HHHHlllhHHHHHHHHHHHHHHLLhHHHHHHLLHHHHHHLL-----------


DSSP  hhhlhhhllll
Query egfrwelsrdl  380
ident            
Sbjct ---------lp  287
DSSP  ---------ll


No 32: Query=2imrA Sbjct=3irsA Z-score=14.7

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
ident                                                             
Sbjct ------------------------------------------------------LKIIDF    6
DSSP  ------------------------------------------------------LLLEEL


DSSP  EEEL---lLLHHHHhhlhhhhllHHHHH-----------hHLLLlhhhHHHHHHHHHHHL
Query HTHL---dMSAYEFqalpyfqwiPEVVI-----------rGRHLrgvaAAQAGADTLTRL  106
ident                                                             
Sbjct RLRPpamgFLNARI-----ytrpDIRNRftrqlgfepapsAEEK----SLELMFEEMAAA   57
DSSP  LLLLllhhHHHLHH-----hhlhHHHHHhhhhhlllllhhHHHL----LHHHHHHHHHHL


DSSP  LLLLEEEEE--------LLHHHHHHHHLLLLLLEEEEEEELLllhhHHHHHHHHHHHHHH
Query GAGGVGDIV--------WAPEVMDALLAREDLSGTLYFEVLNpfpdKADEVFAAARTHLE  158
ident |                       |                            |      
Sbjct GIEQGVCVGrnssvlgsVSNADVAAVAKAYPDKFHPVGSIEA----ATRKEAMAQMQEIL  113
DSSP  LLLEEEEELleellleeLLHHHHHHHHHHLLLLEEEEEELLL----LLHHHHHHHHHHHH


DSSP  HHHlllllleEEEEEElLLLLL------lHHHHHHHHHHHHHHLLLLEEEELLLhhHHHH
Query RWRrlerpglRLGLSPhTPFTV------sHRLMRLLSDYAAGEGLPLQIHVAEHptELEM  212
ident                   |           |    |       | |              
Sbjct DLG-------IRIVNL-EPGVWatpmhvdDRRLYPLYAFCEDNGIPVIMMTGGN-aGPDI  164
DSSP  HLL-------LLLEEE-LHHHLlllllllLHHHHHHHHHHHHLLLLEEEELLLL-lLLLH


DSSP  HhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhLLHH----HLLEEEEL-L
Query FrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelGVLA----ARPTLVHM-V  267
ident                                  |     |   ||           |   
Sbjct T-------------------------------yTNPEHID--RVLGdfpdLTVVSSHGnW  191
DSSP  H-------------------------------hHLHHHHH--HHHHhlllLLEEEEHHhL


DSSP  LLLHHHHHHHHHHL-LLEEELhhHHHHlLLLLL-LHHHHHHLLL--LEEELLLLHhHHLL
Query NVTPDDIARVARAG-CAVVTCprSNHHlECGTF-DWPAFAAAGV--EVALGTDSVaSGET  323
ident       |    |                      |    |          ||        
Sbjct PWVQEIIHVAFRRPnLYLSPD--MYLY-NLPGHaDFIQAANSFLadRMLFGTAYP-MCPL  247
DSSP  LLHHHHHHHHHHLLlEEEELH--HHHL-LLLLHhHHHHHHLLHHhhLLLLLLLLL-LLLH


DSSP  lllhHHHHHHHHHLllLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query lnvrEEVTFARQLYpgLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident     |       |     |            |                         
Sbjct ---kEYTEWFLTLP--IKPDAMEKILHGNAERLLA------------------qagr  281
DSSP  ---hHHHHHHHLLL--LLHHHHHHHHLHHHHHHHH------------------hlll


No 33: Query=2imrA Sbjct=2ob3A Z-score=14.2

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct ----------------------------------------drintvrgpitiseaGFTLT   20
DSSP  ----------------------------------------lleeelleeelhhhhLLEEE


DSSP  EEELLLLHHhhhhlhhhhllhhhhhhhllllHHHHHHHHHHHHHHLLLLLEEEEE---LL
Query HTHLDMSAYefqalpyfqwipevvirgrhlrGVAAAQAGADTLTRLGAGGVGDIV---WA  117
ident | |   |                            |  |       |     |       
Sbjct HEHICGSSA-------gflrawpeffgsrkaLAEKAVRGLRRARAAGVRTIVDVStfdIG   73
DSSP  EELLEELLL-------lhhhhlhhhhllhhhHHHHHHHHHHHHHHLLLLEEEELLlhhHL


DSSP  HHhHHHHHLLL---LLLEEEEEEEL-----llLHHHHHHHHHHHHHHHH-HHHLLLLlle
Query PEvMDALLARE---DLSGTLYFEVL-----npFPDKADEVFAAARTHLE-RWRRLERpgl  168
ident       |       |                       |                     
Sbjct RD-VSLLAEVSraaDVHIVAATGLWfdpplsmRLRSVEELTQFFLREIQyGIEDTGI--r  130
DSSP  LL-HHHHHHHHhhhLLEEELEEELLllllhhhHLLLHHHHHHHHHHHHHlLLLLLLL--l


DSSP  eEEEEeLLLL----lLLHHHHHHHHHHHHHHLLLLEEEELLLHhhhhhhhhlllllhhhl
Query rLGLSpHTPF----tVSHRLMRLLSDYAAGEGLPLQIHVAEHPtelemfrtgggplwdnr  224
ident                                | |   | |                    
Sbjct aGIIX-VATTgkatpFQELVLKAAARASLATGVPVTTHTAASQ-----------------  172
DSSP  lLEEE-EELLllllhHHHHHHHHHHHHHHHHLLLEEEELLHHH-----------------


DSSP  lhhhllllhhhhhllllllllLHHHHHHHHLL--HHHL--LEEEEL-LLLLHHHHHHHHH
Query mpalyphtlaevigrepgpdlTPVRYLDELGV--LAAR--PTLVHM-VNVTPDDIARVAR  279
ident                                             |             | 
Sbjct ---------------------RDGEQQAAIFEseGLSPsrVCIGHSdDTDDLSYLTALAA  211
DSSP  ---------------------LHHHHHHHHHHhlLLLHhhEEELLHhHLLLHHHHHHHHH


DSSP  HLLLEEELHHHHH------------HLLLL-----llLHHHHHHLLL--LEEELLLLH--
Query AGCAVVTCPRSNH------------HLECG-----tfDWPAFAAAGV--EVALGTDSV--  318
ident  |                        |             |    |         |    
Sbjct RGYLIGLDHIPYSaiglednasasaLLGIRswqtralLIKALIDQGYmkQILVSNDWTfg  271
DSSP  LLLEEEELLLLLLlllllllhhhhhHHLLLlhhhhhhHHHHHHHLLLhhHEEELLLLLle


DSSP  --------------hhhLLLL-LHHHhhHHHHHL-LLLLHHHHHHHHHHHHHHHHLllll
Query --------------asgETLN-VREEvtFARQLY-PGLDPRVLVRAAVKGGQRVVGtpfl  362
ident                                 |   |     |    |    |       
Sbjct fssyvtnimdvmdrvnpDGMAfIPLR--VIPFLReKGVPQETLAGITVTNPARFLS----  325
DSSP  ellllllhhhhhhhhllLHHHhHHHL--HHHHHHhLLLLHHHHHHHHLHHHHHHHL----


DSSP  lllllllhhhlhhhllll
Query rrgetwqegfrwelsrdl  380
ident                   
Sbjct --------------ptlr  329
DSSP  --------------llll


No 34: Query=2imrA Sbjct=2ffiA Z-score=13.6

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
ident                                                             
Sbjct ----------------------------------------------------lhLTAIDS    8
DSSP  ----------------------------------------------------llLLLEEL


DSSP  EEELLllhhhhhhlhhhhllhhhhHHHLLLLhhhHHHHHHHHHHHLLLLLEEEEEL----
Query HTHLDmsayefqalpyfqwipevvIRGRHLRgvaAAQAGADTLTRLGAGGVGDIVW----  116
ident | |                                       |   |             
Sbjct HAHVF--------srglnlasqrrYAPNYDA---PLGDYLGQLRAHGFSHGVLVQPsflg   57
DSSP  LLLLL--------lhhhhhhllllLLLLLLL---LHHHHHHHHHHLLLLEELLLLLhhhl


DSSP  -LHHHHHHHHLLLLLLEEEEEEEllllhhhhhhHHHHHHHHHHHHHLLllllEEEEEEEL
Query -APEVMDALLAREDLSGTLYFEVlnpfpdkadeVFAAARTHLERWRRLerpgLRLGLSPH  175
ident          |                               |    ||       |    
Sbjct tDNRYLLSALQTVPGQLRGVVXL----------ERDVEQATLAEXARL----GVRGVRLN  103
DSSP  lLLHHHHHHHHHLLLLLLLLLLL----------LLLLLHHHHHHHHLL----LLLEEELL


DSSP  L---lLLLLHH-HHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhlll
Query T---pFTVSHR-LMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyph  231
ident               | |       |     |                             
Sbjct LxgqdXPDLTGaQWRPLLERIGEQGWHVELHRQ---------------------------  136
DSSP  LllllLLLLLLlLLHHHHHHHHHHLLEEEELLL---------------------------


DSSP  lhhhhhllllllllLHHHHHHhHLLH--HHLLEEE-ELLL---------LLHHHHHHhHH
Query tlaevigrepgpdlTPVRYLDeLGVL--AARPTLV-HMVN---------VTPDDIARvAR  279
ident                    |                                       |
Sbjct -------------vADIPVLV-RALQpyGLDIVIDhFGRPdarrglgqpGFAELLTLsGR  182
DSSP  -------------lLLHHHHH-HHHLllLLLEEELhHHLLlllllllllLHHHHLLLlLL


DSSP  HLLLEEELhhHHHHLL-------lLLLL-HHHHHHLLL--LEEELLLLHHH----hLLLL
Query AGCAVVTCprSNHHLE-------cGTFD-WPAFAAAGV--EVALGTDSVAS----gETLN  325
ident     |         |                |  |         | |             
Sbjct GKVWVKVS--GIYRLQgspeenlaFARQaLCALEAHYGaeRLXWGSDWPHTqheseVSFG  240
DSSP  LLEEEEEE--LHHHLLllhhhhhhHHHHhHHHHHHHLLhhHEEEELLLLLLlllllLLHH


DSSP  lhHHHHHHHHHLllLLHHHHHHHHHHHHHHHH-LLLLllllllllhhhlhhhllll
Query vrEEVTFARQLYpgLDPRVLVRAAVKGGQRVV-GTPFlrrgetwqegfrwelsrdl  380
ident     |     |                                             
Sbjct --SAVEQFEALG--CSAQLRQALLLDTARALFgFELE-------------------  273
DSSP  --HHHHHHHHHL--LLHHHHHHHHLHHHHHHLlLLLL-------------------


No 35: Query=2imrA Sbjct=2vc5A Z-score=13.6

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct ---------------------------------------mriplvgkdsieskdiGFTLI   21
DSSP  ---------------------------------------llllllllllllhhhlLLEEL


DSSP  EEELLLLHHhhhhlhhhhllhhhhhhhllllHHHHHHHHHHHHHHLLLLLEEEEE-----
Query HTHLDMSAYefqalpyfqwipevvirgrhlrGVAAAQAGADTLTRLGAGGVGDIV-----  115
ident | ||                               |          |     |       
Sbjct HEHLRVFSE--------avrqqwphlynedeEFRNAVNEVKRAMQFGVKTIVDPTvmglg   73
DSSP  LLLLLLLLH--------hhhhhlhhhllhhhHHHHHHHHHHHHHHLLLLEEEELLlllll


DSSP  LLHHHHHHHhLLLLLLEEEEEEELL-LLHH------HHHHHHHHHHHHHHHH---HLLLl
Query WAPEVMDALlAREDLSGTLYFEVLN-PFPD------KADEVFAAARTHLERW---RRLEr  165
ident      |                                ||                    
Sbjct RDIRFMEKVvKATGINLVAGTGIYIyIDLPfyflnrSIDEIADLFIHDIKEGiqgTLNK-  132
DSSP  LLHHHHHHHhHLLLLEEEELEELLLlLLLLhhhlllLHHHHHHHHHHHHHLLlllLLLL-


DSSP  lleeEEEEeLLLL-----llLHHHHHHHHHHHHHHLLLLEEEELLLhhhhhhhhhlllll
Query pglrLGLSpHTPF-----tvSHRLMRLLSDYAAGEGLPLQIHVAEHptelemfrtgggpl  220
ident                          |           |   |   |              
Sbjct ---aGFVX-IAADepgitkdVEKVIRAAAIANKETKVPIITHSNAH--------------  174
DSSP  ---lLLEE-EELLlllllhhHHHHHHHHHHHHHHHLLLEEEELLLL--------------


DSSP  hhhllhhhllllhhhhhlllllllLLHHHHHHhHLLH-----HHLLEEEEL-LLLLHHHH
Query wdnrmpalyphtlaevigrepgpdLTPVRYLDeLGVL-----AARPTLVHM-VNVTPDDI  274
ident                                                  |       | |
Sbjct ------------------------NNTGLEQQ-RILTeegvdPGKILIGHLgDTDNIDYI  209
DSSP  ------------------------LLHHHHHH-HHHHhllllHHHEEELLHhHLLLHHHH


DSSP  HHHHHHLLLEEE-LHHHhhHLLL---LLLL-HHHHHHLLL--LEEELLLLH---------
Query ARVARAGCAVVT-CPRSnhHLEC---GTFD-WPAFAAAGV--EVALGTDSV---------  318
ident    |  |             |                 |         |           
Sbjct KKIADKGSFIGLdRYGL--DLFLpvdKRNEtTLRLIKDGYsdKIMISHDYCctidwgtak  267
DSSP  HHHHHLLLEEEElLLLL--LLLLlhhHHHHhHHHHHHLLLllLEEELLLLLlllllllll


DSSP  -------hhhLLLLlhHHHHHHHHHL--LLLLHHHHHHHHHHHHHHHhllllllllllll
Query -------asgETLNvrEEVTFARQLY--PGLDPRVLVRAAVKGGQRVvgtpflrrgetwq  369
ident                              |    |                         
Sbjct peykpklaprWSIT--LIFEDTIPFLkrNGVNEEVIATIFKENPKKF-------------  312
DSSP  hhhhhhhlllLLLL--HHHHLHHHHHhlLLLLHHHHHHHHLHHHHHH-------------


DSSP  hhhlhhhllll
Query egfrwelsrdl  380
ident            
Sbjct ---------fs  314
DSSP  ---------ll


No 36: Query=2imrA Sbjct=2a3lA Z-score=13.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------lleeeeeeleeelleeLLEEeeeelleeeeeelhhhhhhhlllleeeeL
Query -----------htprlltcdvlytgaqSPGGvvvvgetvaaaghpdelrrqyphaaeerA   49
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeFLAQ-------------------------ksaP  155
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH-------------------------hhlL


DSSP  LLEEL-LLLLEEEEELL-------------------------------------------
Query GAVIA-PPPVNAHTHLD-------------------------------------------   65
ident          |  | |                                             
Sbjct HRDFYnVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldl  215
DSSP  LLLLLlLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhhll


DSSP  ------------------------llHHHHHhlhhhhllhhhhhhhLLLL---------H
Query ------------------------msAYEFQalpyfqwipevvirgRHLR---------G   92
ident                                                 |           
Sbjct tgydlnvdlldvhadkstfhrfdkfnLKYNP-------cgqsrlreIFLKqdnliqgrfL  268
DSSP  lllllllllllllllllllllllllhHHHLL-------llllhhhhHHLLlllllllllH


DSSP  HHHHHHHHHHHHHLLLLLEEEEEL--------lhhHHHHH--hLLLLLLEEEEEEELLLL
Query VAAAQAGADTLTRLGAGGVGDIVW--------apeVMDAL--lAREDLSGTLYFEVLNPF  142
ident           |                                                 
Sbjct GEITKQVFSDLEASKYQMAEYRISiygrkmsewdqLASWIvnnDLYSENVVWLIQLPRLY  328
DSSP  HHHHHHHHHHHLLLLLEEEEEEEElllllllhhhhHHHHHhllLLLLLLEEEEEEEELLH


DSSP  --------hHHHHHHHHHHHHHHHH----------HHLLLLllEEEEEEELLLL------
Query --------pDKADEVFAAARTHLER----------WRRLERpgLRLGLSPHTPF------  178
ident                       |                       |             
Sbjct niykdmgivTSFQNILDNIFIPLFEatvdpdshpqLHVFLK--QVVGFDLVDDEskperr  386
DSSP  hhhllllllLLLHHHHHHHLLHHHHhhhlhhhlllLHHHHL--LEEEEEEELLLllllll


DSSP  ----------------llLHHHHHHHHHHHHHH----------LLLLEEEELLlHHHHhh
Query ----------------tvSHRLMRLLSDYAAGE----------GLPLQIHVAEhPTELem  212
ident                                               |  |  |       
Sbjct ptkhmptpaqwtnafnpaFSYYVYYCYANLYVLnklreskgmtTITLRPHSGE-AGDI--  443
DSSP  llllllllllllllllllHHHHHHHHHHHHHHHhhhhllllllLLEELLLLLL-LLLL--


DSSP  hhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhllhHHLLEEEELLLL--L
Query frtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelgvlAARPTLVHMVNV--T  270
ident                                                     |  |    
Sbjct ---------------------------------DHLAATF-----LTCHSIAHGINLrkS  465
DSSP  ---------------------------------HHHHHHH-----HHLLLLLLLHHHhhL


DSSP  HHHHHHHHHHLLLEEELHHHHHhLLLL---LLLHHHHHHLLLLEEELLLLHHHHL--llL
Query PDDIARVARAGCAVVTCPRSNHhLECG---TFDWPAFAAAGVEVALGTDSVASGE--tlN  325
ident |        |       | ||             | |   |  | | ||           
Sbjct PVLQYLYYLAQIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDPLQIHltkeP  524
DSSP  HHHHHHHHHHLLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLHHHHLllllH


DSSP  LHHHHHHHHHHLLlLLHHHHHHHHhHHHHHHHL--------LLLLL--------------
Query VREEVTFARQLYPgLDPRVLVRAAvKGGQRVVG--------TPFLR--------------  363
ident   ||   |      |    |   |        |                           
Sbjct LVEEYSIAASVWK-LSACDLCEIA-RNSVYQSGfshalkshWIGKDyykrgpdgndihkt  582
DSSP  HHHHHHHHHHHHL-LLHHHHHHHH-HHHHHHLLllhhhhhhHLLLLlllllhhhllhhhh


DSSP  -----------------llllllhhhlhhhllll
Query -----------------rgetwqegfrwelsrdl  380
ident                                   
Sbjct nvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllhhhhhhhhhhhhhhhhhhlllllllllllll


No 37: Query=2imrA Sbjct=4mupB Z-score=13.4

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellLEEL-LLLLE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragAVIA-PPPVN   59
ident                                                           | 
Sbjct ----------------------------------------lvrklsgtapNPAFpRGAVD   20
DSSP  ----------------------------------------llllllllllLLLLlLLLEE


DSSP  EEEELL-----llHHHHHhlhhhhllhhhhhhHLLLLhhhHHHHHHHHHHHL-LLLLEEE
Query AHTHLD-----msAYEFQalpyfqwipevvirGRHLRgvaAAQAGADTLTRL-GAGGVGD  113
ident    |                                            |    |   |  
Sbjct TQMHMYlpgypalPGGPG-------------lPPGAL---PGPEDYRRLMQWlGIDRVII   64
DSSP  LLLLLLlllllllLLLLL-------------lLLLLL---LLHHHHHHHHHHhLLLEEEE


DSSP  EEL-----LHHHHHHHHLLLLLLEEEEEEEllllhhhhhhHHHHHHHHHHHHHLLLllle
Query IVW-----APEVMDALLAREDLSGTLYFEVlnpfpdkadeVFAAARTHLERWRRLErpgl  168
ident               |  |                               |          
Sbjct TQGnahqrDNGNTLACVAEMGEAAHAVVII----------DATTTEKDMEKLTAAG----  110
DSSP  ELLhhhllLLHHHHHHHHHHHHHEEEEELL----------LLLLLHHHHHHHHHLL----


DSSP  EEEEEELL---llLLLHhHHHHHHHHHHHHLLLLEEEELllHHHHhhhhhlllllhhhll
Query RLGLSPHT---pfTVSHrLMRLLSDYAAGEGLPLQIHVAehPTELemfrtgggplwdnrm  225
ident   |                       |                 |               
Sbjct TVGARIMDlpggaVNLS-ELDAVDERAHAADWMVAVQFD--GNGL---------------  152
DSSP  EEEEEEELlllllLLHH-HHHHHHHHHHHLLLEEEEELL--HHHH---------------


DSSP  hhhllllhhhhhlllllllLLHHHHHHHhllHHHLLEEE-ELLL--------lLHHHHHH
Query palyphtlaevigrepgpdLTPVRYLDElgvLAARPTLV-HMVN--------vTPDDIAR  276
ident                    |     |        |     |                   
Sbjct -------------------LDHLPRLQK---IRSRWVFDhHGKFfkgirtdgpEMAALLK  190
DSSP  -------------------HHHHHHHHL---LLLEEEELhHHHLllllllllhHHHHHHH


DSSP  HHHHL-LLEEELhhHHHHLL-------lLLLLHHHHHHLL-lLEEELLL-LHHH----hl
Query VARAG-CAVVTCprSNHHLE-------cGTFDWPAFAAAG-vEVALGTD-SVAS----ge  322
ident     |                               ||        ||     |      
Sbjct LIDRGnLWFKFA--GVYESSrkswpyadVAAFSRVIAAHApeRIVWGTNwPHNSvretaa  248
DSSP  HHHHLlEEEEEL--LHHHLLllllllhhHHHHHHHHHHHLhhHEEELLLlLLLLlllhhh


DSSP  lllLHHHHHHHHHHLllLLHHHHHHHHHHHHHHHH-LLLLllllllllhhhlhhhllll
Query tlnVREEVTFARQLYpgLDPRVLVRAAVKGGQRVV-GTPFlrrgetwqegfrwelsrdl  380
ident                   |     || |          |                    
Sbjct ypdDARLAELTLGWL--PDEAARHRALVENPEALFkLSPV-------------------  286
DSSP  lllHHHHHHHHHLLL--LLHHHHHHHHLHHHHHHHlLLLL-------------------


No 38: Query=2imrA Sbjct=1v77A Z-score=13.3

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
ident                                                             
Sbjct ------------------------------------------------------VKFIEM    6
DSSP  ------------------------------------------------------LLLEEE


DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllllhhhhhhHHHHHHHHLlLLLEEEEellhhh
Query HTHLDmsayefqalpyfqwipevvirgrhlrgvaaaqAGADTLTRLgAGGVGDIvwapev  120
ident                                                   |         
Sbjct DIRDK--------------------------------EAYELAKEW-FDEVVVS------   27
DSSP  EELLH--------------------------------HHHHHHHHH-LLEEEEE------


DSSP  hhhhhlllllleeeeEEELLllhhhhhhhhhhHHHHHHHHHLLllllEEEEEEELLlllL
Query mdallaredlsgtlyFEVLNpfpdkadevfaaARTHLERWRRLerpgLRLGLSPHTpftV  180
ident                                     |   |                   
Sbjct ---------------IKFNE----------evDKEKLREARKE---yGKVAILLSN---P   56
DSSP  ---------------EEELL----------llLHHHHHHHHHH---hLLEEEEEEL---L


DSSP  LHHHHHHHHHHHHhhLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhhhlll
Query SHRLMRLLSDYAAgeGLPLQIHVAehptelemfrtgggplwdnrmpalyphtlaevigre  240
ident    | |                                                      
Sbjct KPSLVRDTVQKFK--SYLIYVESN------------------------------------   78
DSSP  LHHHHHHHHHHLL--LLEEEEELL------------------------------------


DSSP  lllllLHHHHHHhhllHHHLLEEEELL------LLLHHHHHHHHHHLLLEEELhHHHHHL
Query pgpdlTPVRYLDelgvLAARPTLVHMV------NVTPDDIARVARAGCAVVTCpRSNHHL  294
ident         ||                                      |           
Sbjct ---dlRVIRYSI----EKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLY  130
DSSP  ---lhHHHHHHH----HLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHH


DSSP  L--------LLLL--LHHHHHHLLLLEEELLLLHHhhLLLLLHHHHHHHHHHLllLLHHH
Query E--------CGTF--DWPAFAAAGVEVALGTDSVAsgETLNVREEVTFARQLYpgLDPRV  344
ident                 |       |   |             |                 
Sbjct SnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQEkwDVRYPRDLISLGVVIG--MEIPQ  188
DSSP  LlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLLhhHLLLHHHHHHHHHHLL--LLHHH


DSSP  HHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query LVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident                                     
Sbjct AKASISMYPEIILK----------------------  202
DSSP  HHHLLLHHHHHHHL----------------------


No 39: Query=2imrA Sbjct=2dvtA Z-score=13.3

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleeLLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviAPPPVNA   60
ident                                                          |  
Sbjct -----------------------------------------------------MQGKVAL    7
DSSP  -----------------------------------------------------LLLEEEE


DSSP  EEELLL--LHHHHHhlhhhHLLH-HHHHHHLLLLHhhHHHH-HHHHHHHLLLLLEEEEE-
Query HTHLDM--SAYEFQalpyfQWIP-EVVIRGRHLRGvaAAQA-GADTLTRLGAGGVGDIV-  115
ident   |                   |        |       |          |         
Sbjct EEHFAIpeTLQDSA-----GFVPgDYWKELQHRLL--DIQDtRLKLMDAHGIETMILSLn   60
DSSP  EEEELLhhHHHHHL-----LLLLlLHHHHHHHHHH--LLLLhHHHHHHHLLEEEEEEEEl


DSSP  ------------------lLHHHHHHHHL-LLLLLeEEEEEELLLlhhhHHHHHHHHHHH
Query ------------------wAPEVMDALLA-REDLSgTLYFEVLNPfpdkADEVFAAARTH  156
ident                    |  |     | | |                           
Sbjct apavqaipdrrkaieiarrANDVLAEECAkRPDRF-LAFAALPLQ----DPDAATEELQR  115
DSSP  llhhhhlllhhhhhhhhhhHHHHHHHHHHhLLLLE-EEEELLLLL----LHHHHHHHHHH


DSSP  H-HHHHlllllleEEEEEeLLLLL-----------lLHHHhHHHHHHHHHHLLLLEEEE-
Query L-ERWRrlerpglRLGLSpHTPFT-----------vSHRLmRLLSDYAAGEGLPLQIHV-  203
ident                |      |                  |           |   |  
Sbjct CvNDLG-------FVGAL-VNGFSqegdgqtplyydLPQY-RPFWGEVEKLDVPFYLHPr  166
DSSP  HhHLLL-------LLEEE-EELLLllllllllllllLHHH-HHHHHHHHHHLLLEEEELl


DSSP  -----------------llLHHHHHHhhhlllllhhhllhhhllllhhhhhllllllllL
Query -----------------aeHPTELEMfrtgggplwdnrmpalyphtlaevigrepgpdlT  246
ident                                                             
Sbjct nplpqdsriydghpwllgpTWAFAQE-------------------------------taV  195
DSSP  lllhhhlhhhlllhhhlhhHLHHHHH-------------------------------hhH


DSSP  HHHHHH-HHLL---hHHLLEEEE-LLLLLHHH----------------------HHHHHh
Query PVRYLD-ELGV---lAARPTLVH-MVNVTPDD----------------------IARVAr  279
ident     |               | |                                     
Sbjct HALRLMaSGLFdehpRLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfMDYFN-  254
DSSP  HHHHHHhLLHHhhllLLLEEELHhHLLHHHHHhhhhhllllllllllllllllhHHHHH-


DSSP  HLLLEEELHhhhhhllllllLHHHHHHLLL--LEEELLLLHhHHLLlLLHHHHHHHHhhl
Query AGCAVVTCPrsnhhlecgtfDWPAFAAAGV--EVALGTDSVaSGETlNVREEVTFARqly  337
ident       |                              ||                     
Sbjct ENFHITTSG------nfrtqTLIDAILEIGadRILFSTDWP-FENIdHASDWFNATS---  304
DSSP  HHEEEELLL------lllhhHHHHHHLLLLhhHEELLLLLL-LLLHhHHHHHHHHLL---


DSSP  llLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query pgLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident         |        |                         
Sbjct --IAEADRVKIGRTNARRLFK--------------------ld  325
DSSP  --LLHHHHHHHHLHHHHHHLL--------------------ll


No 40: Query=2imrA Sbjct=4qrnA Z-score=13.1

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeELLL------EEL
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeRAGA------VIA   54
ident                                                             
Sbjct -----------------------------------------------SMTQdlktggEQG   13
DSSP  -----------------------------------------------LLLLllllllLLL


DSSP  LLLLEEEEElLLLHH--------------hhhhlHHHHLL----HHHHHHHLLLLHhhHH
Query PPPVNAHTHlDMSAY--------------efqalPYFQWI----PEVVIRGRHLRGvaAA   96
ident                                              |              
Sbjct YLRIATEEA-FATREiidvylrmirdgtadkgmvSLWGFYaqspSERATQILERLL--DL   70
DSSP  LLLEEEEEE-ELLHHhhhhhhhhhhhllllhhhhHHHHHHhhllLHHHHHHHHHHH--LL


DSSP  HH-HHHHHHHLLLLLEEEEE-------------------lLHHHHHHHHL-LLLLLeEEE
Query QA-GADTLTRLGAGGVGDIV-------------------wAPEVMDALLA-REDLSgTLY  135
ident            |                            |            |      
Sbjct GErRIADMDATGIDKAILALtspgvqplhdldeartlatrANDTLADACQkYPDRF-IGM  129
DSSP  LHhHHHHHHHLLLLEEEEEEllllllllllhhhhhhhhhhHHHHHHHHHHhLLLLE-EEL


DSSP  EEELLllhhhhhHHHHHHHHHHHHH-HLLLllleEEEEEELLLL----llLHHHhHHHHH
Query FEVLNpfpdkadEVFAAARTHLERW-RRLErpglRLGLSPHTPF----tvSHRLmRLLSD  190
ident   |                    |  | |       |                       
Sbjct GTVAP-------QDPEWSAREIHRGaRELG----FKGIQINSHTqgryldEEFF-DPIFR  177
DSSP  LLLLL-------LLHHHHHHHHHHHhHLLL----LLLEEELLLLllllllLHHH-HHHHH


DSSP  HHHHHLLLLEEEElllhhhhhhhhHLLLLLHHHLlhhhllllhhhhhllllllllLHHHH
Query YAAGEGLPLQIHVaehptelemfrTGGGPLWDNRmpalyphtlaevigrepgpdlTPVRY  250
ident        || ||                |                               
Sbjct ALVEVDQPLYIHP------atspdSMIDPMLEAG--------ldgaifgfgvetgMHLLR  223
DSSP  HHHHHLLLEEELL------lllllLLLHHHHHHL--------llllllhhhhhhhHHHHH


DSSP  HHHHLLH----HHLLEEEE-LLLLLHHH--------------------------HHHHHh
Query LDELGVL----AARPTLVH-MVNVTPDD--------------------------IARVAr  279
ident |   |             |                                         
Sbjct LITIGIFdkypSLQIMVGHmGEALPYWLyrldymhqagvrsqryermkplkktiEGYLK-  282
DSSP  HHHHLHHhhllLLLEEELHhHHLHHHHHhhhhhhhhhhhhlllllllllllllhHHHHH-


DSSP  HLLLEEELHHhhhhllllllLHHHHHHLLL--LEEELLLLHhHHLLlllhHHHHHHHHHl
Query AGCAVVTCPRsnhhlecgtfDWPAFAAAGV--EVALGTDSVaSGETlnvrEEVTFARQLy  337
ident     |                            |    |            ||       
Sbjct SNVLVTNSGV------awepAIKFCQQVMGedRVMYAMDYP-YQYV---aDEVRAMDAM-  331
DSSP  HLEEEELLLL------llhhHHHHHHHHHLhhHEELLLLLL-LLLL---hHHHHHHHLL-


DSSP  lLLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query pGLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident                                            
Sbjct -DMSAQTKKKFFQTNAEKWFK---------------------l  352
DSSP  -LLLHHHHHHHHLHHHHHHLL---------------------l


No 41: Query=2imrA Sbjct=4ofcA Z-score=12.7

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct -------------------------------------------------------MKIDI    5
DSSP  -------------------------------------------------------LLEEE


DSSP  EEELL-------------------llhhhhhhlhhhhllHHHHhhHLLLLHhhHHHHHHH
Query HTHLD-------------------msayefqalpyfqwiPEVVirGRHLRGvaAAQAGAD  101
ident | |                                       |   |             
Sbjct HSHILpkewpdlkkrfgyggwvqlqhhskgeakllkdgkVFRV--VRENCW--DPEVRIR   61
DSSP  EEELLllllllhhhhhllllleeeeeeelleeeeeelleEEEE--EEHHHL--LHHHHHH


DSSP  HHHHLLLLLEEEEE-------------------lLHHHHHHHHLLLLLLEEEEEEELLLl
Query TLTRLGAGGVGDIV-------------------wAPEVMDALLAREDLSGTLYFEVLNPf  142
ident      |                                                      
Sbjct EMDQKGVTVQALSTvpvmfsywakpedtlnlcqlLNNDLASTVVSYPRRFVGLGTLPMQ-  120
DSSP  HHHHHLLLEEEEELlhhhhlllllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEELLLLL-


DSSP  hhhHHHHHHHHHHHH-HHHHlllllleEEEEEElLLLL-----lLHHHhHHHHHHHHHHL
Query pdkADEVFAAARTHL-ERWRrlerpglRLGLSPhTPFT-----vSHRLmRLLSDYAAGEG  196
ident    | |                       |                 |       |    
Sbjct ---APELAVKEMERCvKELG-------FPGVQI-GTHVnewdlnAQEL-FPVYAAAERLK  168
DSSP  ---LHHHHHHHHHHHhHLLL-------LLEEEE-ELEElleellLHHH-HHHHHHHHHHL


DSSP  LLLEEEE--------------llLHHHHHhhhhlllllhhhllhhhllllhhhhhlllll
Query LPLQIHV--------------aeHPTELEmfrtgggplwdnrmpalyphtlaevigrepg  242
ident   |  |                                                      
Sbjct CSLFVHPwdmqmdgrmakywlpwLVGMPA-------------------------------  197
DSSP  LEEEEELllllllhhhhlllhhhHLHHHH-------------------------------


DSSP  lllLHHHHHHHHLLHH----HLLEEE-ELLL-LLHH---------------------hhH
Query pdlTPVRYLDELGVLA----ARPTLV-HMVN-VTPD---------------------diA  275
ident             ||                                              
Sbjct ettIAICSMIMGGVFEkfpkLKVCFAhGGGAfPFTVgrishgfsmrpdlcaqdnpmnpkK  257
DSSP  hhhHHHHHHHLLLHHHhlllLLEEELhHHLLhHHHHhhhhhhhhhlhhhhlllllllhhH


DSSP  HHHhhLLLEEELHHhhhhllllllLHHHHHHLLL--LEEELLLL-HHHHlllLLHHhhhH
Query RVAraGCAVVTCPRsnhhlecgtfDWPAFAAAGV--EVALGTDS-VASGetlNVREevtF  332
ident                                      | ||||     |           
Sbjct YLG--SFYTDALVH-------dplSLKLLTDVIGkdKVILGTDYpFPLG-elEPGK---L  304
DSSP  HLL--LLEEELLLL-------lhhHHHHHHHHHLllLEELLLLLlLLLL-llLLLH---H


DSSP  HHHhLLLLLHHHHHHHHHHHHHHHH-LLLLllllllllhhhlhhhllll
Query ARQlYPGLDPRVLVRAAVKGGQRVV-GTPFlrrgetwqegfrwelsrdl  380
ident         |                                        
Sbjct IES-MEEFDEETKNKLKAGNALAFLgLERK-----------------qf  335
DSSP  HHH-LLLLLHHHHHHHHLHHHHHHHlLLHH-----------------hl


No 42: Query=2imrA Sbjct=4hk5D Z-score=12.7

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleeLLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviAPPPVNA   60
ident                                                       |  |  
Sbjct -----------------------------------------------------TPVVVDI    7
DSSP  -----------------------------------------------------LLLLEEE


DSSP  EEELL-------------------llhhhhhhlhHHHLL-------------hhhHHHHL
Query HTHLD-------------------msayefqalpYFQWI-------------pevVIRGR   88
ident |||                                                         
Sbjct HTHMYppsyiamlekrqtiplvrtfpqadeprliLLSSElaaldaaladpaaklpGRPLS   67
DSSP  EEEELlhhhhhhhhlllllleeeeelleeeeeeeLLHHHhhhhhhhhhlllllllLEELL


DSSP  LLLHhhHHHHHHHHHHHLLLLLEEEEE---------------lLHHHHHHHHL--LLLL-
Query HLRGvaAAQAGADTLTRLGAGGVGDIV---------------wAPEVMDALLA--REDL-  130
ident                   |                        |  |             
Sbjct THFA--SLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiADAVNAEFSDmcAQHVg  125
DSSP  HHHL--LHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhHHHHHHHHHHhhHLLLl


DSSP  LEEEEEEELLllhhhhhHHHHHHHHHHHHHHLLLlllEEEEEEElLLLLLL----HHHHH
Query SGTLYFEVLNpfpdkadEVFAAARTHLERWRRLErpgLRLGLSPhTPFTVS----HRLMR  186
ident                      |     ||   |       |                   
Sbjct RLFFFAALPL------sAPVDAVKASIERVKNLK---YCRGIIL-GTSGLGkgldDPHLL  175
DSSP  LEEEEEELLL------lLLHHHHHHHHHHHHLLL---LEEEEEE-LLLLLLllllLHHHH


DSSP  HHHHHHHHHLLLLEEEElllhhhhhhhhhllllLHHHLL--hhhllllhhhhhlllllll
Query LLSDYAAGEGLPLQIHVaehptelemfrtgggpLWDNRM--palyphtlaevigrepgpd  244
ident       |   |    |                 |                          
Sbjct PVFEAVADAKLLVFLHP-------------hygLPNEVYgprseeyghvlplalgfpmet  222
DSSP  HHHHHHHHLLLEEEELL-------------lllLLHHHHlllhhhlllhhhhhlhhhhhh


DSSP  lLHHHHHH-HHLL---hHHLLEEE-ELLL--LLHH------------------------H
Query lTPVRYLD-ELGV---lAARPTLV-HMVN--VTPD------------------------D  273
ident    |                  |                                     
Sbjct tIAVARMYmAGVFdhvrNLQMLLAhSGGTlpFLAGriescivhdghlvktgkvpkdrrtI  282
DSSP  hHHHHHHHhLLHHhhllLLLEEEHhHHLLhhHHHHhhhhhhhllhhhhhllllllllllH


DSSP  HHHHHhHLLLEEELHHhhhhllllllLHHHHHHLLL--LEEELLLLHHH--------hll
Query IARVArAGCAVVTCPRsnhhlecgtfDWPAFAAAGV--EVALGTDSVAS--------get  323
ident                              |  |         |||               
Sbjct WTVLK-EQIYLDAVIY-------sevGLQAAIASSGadRLMFGTDHPFFppieedvqgpw  334
DSSP  HHHHH-HLEEEELLLL-------lhhHHHHHHHHHLhhHEELLLLLLLLlllllllllll


DSSP  llLHHHHHHHHHHLLllLHHHHHHHHHHHHHHHHL----LLLLlllllllhhhlhhhlll
Query lnVREEVTFARQLYPglDPRVLVRAAVKGGQRVVG----TPFLrrgetwqegfrwelsrd  379
ident    |                           ||                           
Sbjct dsSRLNAQAVIKAVG-eGSSDAAAVMGLNAVRVLSlkaeLEHH--------------hhh  379
DSSP  hhHHHHHHHHHHHHL-lLLHHHHHHHLHHHHHHLLlhhhHHHH--------------hhh


DSSP  l
Query l  380
ident  
Sbjct h  380
DSSP  l


No 43: Query=2imrA Sbjct=4dziC Z-score=12.5

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelllEELLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaVIAPPPVNA   60
ident                                                             
Sbjct ---------------------------------------------------ALNYRVIDV    9
DSSP  ---------------------------------------------------LLLLLEEEE


DSSP  EEElLLLH-----------------------------hhhhhlhhhhllhhhHHHH----
Query HTHlDMSA-----------------------------yefqalpyfqwipevVIRG----   87
ident   |                                                  |      
Sbjct DNH-YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdPIIVpgcl   68
DSSP  EEE-LLLLlllllllllhhhlllleeeeelllleeeeelleellllllllllLEELllll


DSSP  -----------------------llllhhHHHHHHHHHHHHLLLLLEEEEE---------
Query -----------------------rhlrgvAAAQAGADTLTRLGAGGVGDIV---------  115
ident                                  |                          
Sbjct dllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveea  128
DSSP  hhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhh


DSSP  --------------lLHHHHHHHH-lLLLLLEEEEEEELLLlhhHHHHHHHHHHHHHHHH
Query --------------wAPEVMDALL-aREDLSGTLYFEVLNPfpdKADEVFAAARTHLERW  160
ident                           | |        |                  | | 
Sbjct lkhdieatmasvhafNLWLDEDWGfdRPDHRIIAAPIVSLA---DPTRAVEEVDFVLARG  185
DSSP  llllhhhhhhhhhhhHHHHHHHLLllLLLLLEEELLLLLLL---LHHHHHHHHHHHHHLL


DSSP  hlllllleEEEEEELLLLL---------lLHHHhHHHHHHHHHHLLLLEEEE--------
Query rrlerpglRLGLSPHTPFT---------vSHRLmRLLSDYAAGEGLPLQIHV--------  203
ident                                          |  | |   |         
Sbjct --------AKLVLVRPAPVpglvkprslgDRSH-DPVWARLAEAGVPVGFHLsdsgylhi  236
DSSP  --------LLLEELLLLLLllllllllllLHHH-HHHHHHHHHHLLLEEEELlllllhhh


DSSP  ------------lllHHHHhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHH
Query ------------aehPTELemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYL  251
ident                                                             
Sbjct aaawggakdpldqvlLDDR--------------------------------aihDTMASM  264
DSSP  hhhllllllhhhhhhHLLH--------------------------------hhhHHHHHH


DSSP  HHHLLHH----HLLEEEELL-LLLHHH-------------------hHHHHhHLLLEEEL
Query DELGVLA----ARPTLVHMV-NVTPDD-------------------iARVArAGCAVVTC  287
ident    ||                                                       
Sbjct IVHGVFTrhpkLKAVSIENGsYFVHRLikrlkkaantqpqyfpedpvEQLR-NNVWIAPY  323
DSSP  HHLLHHHhlllLLEEEELLLlLHHHHHhhhhhhhhhhlhhhllllhhHHHH-HHEEELLL


DSSP  HhhhhhllllLLLHHHHHHLLL--LEEELLLLHH-HHLLlLLHHHHhHHHHhllLLLHHH
Query PrsnhhlecgTFDWPAFAAAGV--EVALGTDSVA-SGETlNVREEVtFARQlypGLDPRV  344
ident             | |  |          | |     |                 |     
Sbjct Y---------EDDLPELARVIGvdKILFGSDWPHgEGLA-SPVSFT-AELK---GFSESD  369
DSSP  L---------LLLHHHHHHHHLhhHLLLLLLLLLlLLLL-LHHHHH-HHHL---LLLHHH


DSSP  HHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query LVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident              |                      
Sbjct IRKIMRDNALDLLG-----------------vqvgs  388
DSSP  HHHHHLHHHHHHHL-----------------lllll


No 44: Query=2imrA Sbjct=1a5kC Z-score=12.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------lleEEEEEleEELLeeLLEEEEEE-----lLEEEE-------eelhhhhhhhll
Query ------htpRLLTCdvLYTGaqSPGGVVVV-----gETVAA-------aghpdelrrqyp   42
ident                                                             
Sbjct aadcvdlvlTNALI--VDHW--GIVKADIGvkdgriFAIGKagnpdiqpnvtipigaate  116
DSSP  hhhllleeeEEEEE--EELL--EEEEEEEEeelleeEEEELeellllllllleellllle


DSSP  lleeEELLleELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllhhhhHHHHHHH
Query haaeERAGavIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrgvaaAQAGADT  102
ident     |             | |                                    |  
Sbjct viaaEGKI--VTAGGIDTHIHWI------------------------------CPQQAEE  144
DSSP  eeelLLLE--EEELEEEEEEELL------------------------------LLLHHHH


DSSP  HHHLLLLLEEE------------EELLH-HHHHHHH-LLLL--LLEEEEEEELLllhhhh
Query LTRLGAGGVGD------------IVWAP-EVMDALL-ARED--LSGTLYFEVLNpfpdka  146
ident     |                              | |         |            
Sbjct ALVSGVTTMVGggtgpaagthatTCTPGpWYISRMLqAADSlpVNIGLLGKGNV------  198
DSSP  HHHHLEEEEEEelllllhhhhhlLLLLHhHHHHHHHhHHLLllLEEEEEEELLL------


DSSP  hhHHHHHHHHHHHHhlllllleeEEEEELLlLLLLHHHHHHHHHHHHHHLLLLEEEElll
Query deVFAAARTHLERWrrlerpglrLGLSPHTpFTVSHRLMRLLSDYAAGEGLPLQIHVaeh  206
ident      | |                ||  |                |         |    
Sbjct -sQPDALREQVAAG--------vIGLEIHEdWGATPAAIDCALTVADEMDIQVALHS---  246
DSSP  -lLHHHHHHHHHHL--------lLEEEEEHhHLLLHHHHHHHHHHHHHHLLEEEEEL---


DSSP  hhHHHHhhhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHHlLHHHLLEEEEL
Query ptELEMfrtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDELgVLAARPTLVHM  266
ident    |                                     |                | 
Sbjct -dTLNE--------------------------------sgFVEDTLAA-IGGRTIHTFHT  272
DSSP  -lLLLL--------------------------------llLHHHHHHH-HLLLLEEELLL


DSSP  LL----llhhHHHHHHHHLLLEEELhHHHH------------------------------
Query VN----vtpdDIARVARAGCAVVTCpRSNH------------------------------  292
ident            |   |                                            
Sbjct EGaggghapdIITACAHPNILPSST-NPTLpytlntidehldmlmvchhldpdiaedvaf  331
DSSP  LLllllllllHHHHHHLLLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhhhhhl


DSSP  ------hllLLLL--LHHHHHhlllLEEELLLLHHHHLLLLLHHHHHHHHHHLLL-----
Query ------hleCGTF--DWPAFAaagvEVALGTDSVASGETLNVREEVTFARQLYPG-----  339
ident                     |          || | |    |                  
Sbjct aesrirretIAAEdvLHDLGA----FSLTSSDSQAMGRVGEVILRTWQVAHRMKVqrgal  387
DSSP  llllllhhhHHHHhhHHHLLL----LLEEELLLLLLLLLLLHHHHHHHHHHHHHHhhlll


DSSP  ---------lLHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLH--------HHL
Query ---------lDPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRW--------ELS  377
ident                            |                    |           
Sbjct aeetgdndnfRVKRYIAKYTINPALTHGiahevGSIEV--gkladLVVWspaffgvkPAT  445
DSSP  llllllllhhHHHHHHHLLLHHHHHHLLlllllLLLLL--lllllEEEElhhhllllLLE


DSSP  L-----------------------------------------------------------
Query R-----------------------------------------------------------  378
ident                                                             
Sbjct Vikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerln  505
DSSP  Eeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhll


DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------d  379
ident                                                             
Sbjct lrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryfl  565
DSSP  llleeeellllllllhhhllllllllleeelllllleeelleelllllllllllllllll


DSSP  l
Query l  380
ident  
Sbjct f  566
DSSP  l


No 45: Query=2imrA Sbjct=3pnuA Z-score=12.2

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeEELLLEELLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeERAGAVIAPPPVNA   60
ident                                                   |     |   
Sbjct ------------------------------------------enlyFQSNAMKLKNPLDM   18
DSSP  ------------------------------------------llllLLLLLEEEELLEEE


DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllllHHHHHHHHHHHHHHLlLLLEEEEELL---
Query HTHLDmsayefqalpyfqwipevvirgrhlrGVAAAQAGADTLTRLgAGGVGDIVWA---  117
ident | ||                                   |    |               
Sbjct HLHLR--------------------------DNQMLELIAPLSARD-FCAAVIMPNLipp   51
DSSP  EELLL--------------------------LHHHHHHHHHHHHLL-LLEEEELLLLlll


DSSP  ---HHHHHHHHLLLL-------LLEEEEEEEllllhhhhhhHHHHhHHHHHHHHLLllll
Query ---PEVMDALLARED-------LSGTLYFEVlnpfpdkadeVFAAaRTHLERWRRLerpg  167
ident     |   |   |                                    |          
Sbjct lcnLEDLKAYKMRILkackdenFTPLMTLFF----------KNYD-EKFLYSAKDE----   96
DSSP  lllHHHHHHHHHHHHhhhllllLEEEEEEEL----------LLLL-HHHHHHHLLL----


DSSP  eEEEEEELL--------llLLLHH--HHHHHHHHHHHHLLLLEEEEL---llHHHHhhhh
Query lRLGLSPHT--------pfTVSHR--LMRLLSDYAAGEGLPLQIHVA---ehPTELemfr  214
ident    |                 |                  ||  |               
Sbjct -IFGIXLYPagittnsnggVSSFDieYLKPTLEAMSDLNIPLLVHGEtndfvMDRE----  151
DSSP  -LLEEEELLllllllllllLLLLLhhHHHHHHHHHHHLLLLEEELLLllllhHHLL----


DSSP  hlllllhhhllhhhllllhhhhhlllllllllHHHHHHhhLLHH----HLLEEEELLLLL
Query tgggplwdnrmpalyphtlaevigrepgpdltPVRYLDelGVLA----ARPTLVHMVNVT  270
ident                                                       |    |
Sbjct ------------------------------snFAKIYE--KLAKhfprLKIVMEHITTKT  179
DSSP  ------------------------------hhHHHHHH--HHHHhlllLLEEELLLLLHH


DSSP  hhHHHHHHHHL-LLEEELHHHHHH-----------------lLLLL-----lLHHHhhhl
Query pdDIARVARAG-CAVVTCPRSNHH-----------------lECGT-----fDWPAfaaa  307
ident                                                             
Sbjct --LCELLKDYEnLYATITLHHLIItlddviggkmnphlfckpIAKRyedkeaLCELafsg  237
DSSP  --HHHHHHHLLlEEEEELLHHHLLlhhhhhlllllhhhllllLLLLhhhhhhHHHHhhll


DSSP  LLLEEELLLLHH-------HHLLL-LLHHHHHHHHHhlLLLLHHHHHHHHHHHHHHH-hL
Query GVEVALGTDSVA-------SGETL-NVREEVTFARQlyPGLDPRVLVRAAVKGGQRV-vG  358
ident    |  | ||                                   |              
Sbjct YEKVMFGSDSAPhpkgcaaGVFSApVILPVLAELFK--QNSSEENLQKFLSDNTCKIydL  295
DSSP  LLLEEELLLLLLlllllllLLLLHhHHHHHHHHHHH--HHLLHHHHHHHHLHHHHHHhlL


DSSP  LLLLlllllllhHHLH-----------------------------HHLLll
Query TPFLrrgetwqeGFRW-----------------------------ELSRdl  380
ident                                               |    
Sbjct KFKE------dkILTLeekewqvpnvyedkynqvvpymageilkfQLKH--  338
DSSP  LLLL------llEEEEellleelllleelllleellllllleellEELL--


No 46: Query=2imrA Sbjct=2qpxA Z-score=11.6

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelLLEELLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeraGAVIAPPPVNA   60
ident                                                    |   |    
Sbjct -------------------------------------------gxddlsEFVDQVPLLDH   17
DSSP  -------------------------------------------lllllhHHHHHLLEEEE


DSSP  EEELLllhhhhhhlhhhhllhhHHHHH---------------------------------
Query HTHLDmsayefqalpyfqwipeVVIRG---------------------------------   87
ident | |                                                         
Sbjct HCHFL-------idgkvpnrddRLAQVsteadkdypladtknrlayhgflalakefalda   70
DSSP  EELLL-------lllllllhhhHHHHHlllllllllhhhhlllhhhhhhhhhhhhhllll


DSSP  ----llllhhhhhhhhhHHHHHLLLLLEEEEELL--hhhhHHHHLLL---LLLEEEEEEE
Query ----rhlrgvaaaqagaDTLTRLGAGGVGDIVWA--pevmDALLARE---DLSGTLYFEV  138
ident                                           |                 
Sbjct nnplaaxndpgyatynhRIFGHFHFKELLIDTGFvpddpiLDLDQTAelvGIPVKAIYRL  130
DSSP  llllllllhhhhhhhhhHHHHHLLEEEEEEELLLllllllLLHHHHHhhhLLLEEEEEEH


DSSP  L----------lllhHHHHHHHHHHHHhHHHHHlllllleEEEEEELLLLL---------
Query L----------npfpDKADEVFAAARThLERWRrlerpglRLGLSPHTPFT---------  179
ident                                           |                 
Sbjct EthaedfxlehdnfaAWWQAFSNDVKQ-AKAHG-------FVGFXSIAAYRvglhlepvn  182
DSSP  HhhhhhhhlllllhhHHHHHHHHHHHL-LLLLL-------LLLEEELHHHHlllllllll


DSSP  -----------------------lLHHHHHHHHHHHHHHLLLLEEEELLL-----HHHHh
Query -----------------------vSHRLMRLLSDYAAGEGLPLQIHVAEH-----PTELe  211
ident                                          ||| ||             
Sbjct vieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadtdXYLG-  241
DSSP  hhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllllHHHL-


DSSP  hhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhHLLH--HHLLEEEELLLL
Query mfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDeLGVL--AARPTLVHMVNV  269
ident                                      |               | |    
Sbjct --------------------------------npLLXRDYL-KAFTkkGLKVVLLHCYPY  268
DSSP  --------------------------------lhHHHHHHH-HHHHhhLLLEEEEELLLL


DSSP  lhhHHHHHHHHL-LLEEEL-HHHHHHllllllLHHHHHHLLL--LEEELLLLHHhhLLLL
Query tpdDIARVARAG-CAVVTC-PRSNHHlecgtfDWPAFAAAGV--EVALGTDSVAsgETLN  325
ident                                                   |     |   
Sbjct hreAGYLASVFPnLYFDISlLDNLGP-sgasrVFNEAVELAPytRILFASDASTypEXYG  327
DSSP  hhhHHHHHHHLLlEEEELLlHHHHLH-hhhhhHHHHHLLLLLhhHEELLLLLLLlhHHHH


DSSP  --LHHHHHHHHHHLLLL-------lHHHHHHHHHHHHHHHH----LLLLllllllllhhh
Query --VREEVTFARQLYPGL-------dPRVLVRAAVKGGQRVV----GTPFlrrgetwqegf  372
ident    |            |                                           
Sbjct laARQFKQALVAHFNQLpfvdlaqkKAWINAICWQTSAKLYhqerELRV-----------  376
DSSP  hhHHHHHHHHHHHHHLLllllhhhhHHHHHHHHLHHHHHHLllhhHHLL-----------


DSSP  lhhhllll
Query rwelsrdl  380
ident         
Sbjct --------  376
DSSP  --------


No 47: Query=2imrA Sbjct=1itqA Z-score=11.3

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelLLEE----LLL
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeraGAVI----APP   56
ident                                                            |
Sbjct ---------------------------------------------dffrDEAErimrDSP   15
DSSP  ---------------------------------------------lhhhHHHHhhhlLLL


DSSP  LLEEEEELLLlhhhhhhlhhhhllhhhhhhhllLLHHH---------------hhhHHHH
Query PVNAHTHLDMsayefqalpyfqwipevvirgrhLRGVA---------------aaqAGAD  101
ident     |  |                                                    
Sbjct VIDGHNDLPW-----------------------QLLDMfnnrlqderanlttlagtHTNI   52
DSSP  EEEEEELHHH-----------------------HHHHHhllllllhhhllllllllLLLH


DSSP  -HHHHLLLLLEEEEEL-------------LHHHHHHHHLLL-------------------
Query -TLTRLGAGGVGDIVW-------------APEVMDALLARE-------------------  128
ident   |     ||    |                | ||                         
Sbjct pKLRAGFVGGQFWSVYtpcdtqnkdavrrTLEQMDVVHRMCrmypetflyvtssagirqa  112
DSSP  hHHHHLLEEEEEEEELllhhhllllhhhhHHHHHHHHHHHHhhlllleeelllhhhhhhh


DSSP  ----LLLEEEEEEELLllhhhhhHHHHHHHHHHHHHhlllllleeEEEEELLlLLLLH--
Query ----DLSGTLYFEVLNpfpdkadEVFAAARTHLERWrrlerpglrLGLSPHTpFTVSH--  182
ident             |                |                 |            
Sbjct fregKVASLIGVEGGH----sidSSLGVLRALYQLG--------mRYLTLTHsCNTPWad  160
DSSP  hhllLEEEEEEEELHH----hllLLHHHHHHHHHLL--------eEEEELLLlLLLLLll


DSSP  -----------------HHHHHHHHHHHHHLLLLEEEElllhhhhhhhhhlllllhhhll
Query -----------------RLMRLLSDYAAGEGLPLQIHVaehptelemfrtgggplwdnrm  225
ident                               |                             
Sbjct nwlvdtgdsepqsqglsPFGQRVVKELNRLGVLIDLAH----------------------  198
DSSP  lhhhlllllllllllllHHHHHHHHHHHHHLLEEELLL----------------------


DSSP  hhhllllhhhhhlllllllllhHHHHHHhLLHH---HLLEEE-ELLL--------LLHHH
Query palyphtlaevigrepgpdltpVRYLDElGVLA---ARPTLV-HMVN--------VTPDD  273
ident                                |    |                  |  | 
Sbjct ---------------------vSVATMK-ATLQlsrAPVIFShSSAYsvcasrrnVPDDV  236
DSSP  ---------------------lLHHHHH-HHHHhllLLLEELlLLLLllllllllLLHHH


DSSP  HHHHHHHLLLEEELhhHHHHLLLL---------lLLHHHHHHLLL--LEEELLLLHHH--
Query IARVARAGCAVVTCprSNHHLECG---------tFDWPAFAAAGV--EVALGTDSVAS--  320
ident    |      |                                     |  | |      
Sbjct LRLVKQTDSLVMVN--FYNNYISCtnkanlsqvaDHLDHIKEVAGarAVGFGGDFDGVpr  294
DSSP  HHHHHHHLLEEEEL--LLHHHHLLlllllhhhhhHHHHHHHHHLLhhHEEELLLLLLLll


DSSP  ----hLLLL-LHHHHHHHHHhlLLLLHHHHHHHHHHHHHHH------------hllllll
Query ----gETLN-VREEVTFARQlyPGLDPRVLVRAAVKGGQRV------------vgtpflr  363
ident      |                          |      ||                   
Sbjct vpeglEDVSkYPDLIAELLR--RNWTEAEVKGALADNLLRVfeaveqasnltqapeeepi  352
DSSP  lllllLLLLlHHHHHHHHHH--LLLLHHHHHHHHLHHHHHHhhhhhhlllllllllllll


DSSP  llllllhhhlhhhllll
Query rgetwqegfrwelsrdl  380
ident                  
Sbjct pldqlggscrthygyss  369
DSSP  lhhhlllllllllllll


No 48: Query=2imrA Sbjct=1j5sA Z-score=11.0

back to top
DSSP  ----------lleeeeeeLEEElleelleeeeeelleeeeeelhhhhhhhlllleeeell
Query ----------htprlltcDVLYtgaqspggvvvvgetvaaaghpdelrrqyphaaeerag   50
ident                                                             
Sbjct hmflgedylltnraavrlFNEV--------------------------------------   22
DSSP  llllllllllllhhhhhhHHHH--------------------------------------


DSSP  leELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllhhhhHHHH-----------
Query avIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrgvaaAQAG-----------   99
ident      | |  | |||                              |              
Sbjct --KDLPIVDPHNHLD------------------------------AKDIvenkpwndiwe   50
DSSP  --LLLLEEELLLLLL------------------------------HHHHhhllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   99
ident                                                             
Sbjct vegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrf  110
DSSP  hhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhl


DSSP  ---------------------------hhHHHHLLLLLEEEEEL-LHHHhHHHHLLL---
Query ---------------------------adTLTRLGAGGVGDIVW-APEVmDALLARE---  128
ident                               |                             
Sbjct nikkviseetaeeiweetkkklpemtpqkLLRDMKVEILCTTDDpVSTL-EHHRKAKeav  169
DSSP  lllllllhhhhhhhhhhhhhhlllllhhhHHHHLLEEEEELLLLlLLLL-HHHHHHHhhl


DSSP  -LLLEEEEEEEL--LLLH-------------------hhhHHHHHHHHHHHHHHHLLLll
Query -DLSGTLYFEVL--NPFP-------------------dkaDEVFAAARTHLERWRRLErp  166
ident                                         |    |     |        
Sbjct eGVTILPTWRPDraMNVDkegwreyvekmgerygedtstlDGFLNALWKSHEHFKEHG--  227
DSSP  lLLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllllllhHHHHHHHHHHHHHHHLLL--


DSSP  leEEEEEeLLLL-------------------------------llLHHHHHHHHHHHHHH
Query glRLGLSpHTPF-------------------------------tvSHRLMRLLSDYAAGE  195
ident         |                                        |          
Sbjct --CVASD-HALLepsvyyvdenraravhekafsgekltqdeindyKAFMMVQFGKMNQET  284
DSSP  --LLEEE-EEELllllllllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHH


DSSP  LLLLEEEELLL-----------------hHHHHHHhhlllllhhhllhhhllllhhhhhl
Query GLPLQIHVAEH-----------------pTELEMFrtgggplwdnrmpalyphtlaevig  238
ident     | |                                                     
Sbjct NWVTQLHIGALrdyrdslfktlgpdsggdISTNFL-------------------------  319
DSSP  LLEEEEEELEEllllhhhhhhllllllllEELLLL-------------------------


DSSP  llllllllHHHHHhHHLL----hHHLLEEeELLL--LLHHHHHHHHHHL-LLEEElhhhh
Query repgpdltPVRYLdELGV----lAARPTLvHMVN--VTPDDIARVARAG-CAVVTcprsn  291
ident             |               |         |             |       
Sbjct -------rIAEGL-RYFLnefdgKLKIVL-YVLDptHLPTISTIARAFPnVYVGA-----  365
DSSP  -------lHHHHH-HHHHhhlllLLLEEE-EELLhhHHHHHHHHHHHLLlEEELL-----


DSSP  hhlLLLL------lLHHHHHHLLL---LEEELLLLHHhhLLLL--LHHHHHHHHHHLLL-
Query hhlECGT------fDWPAFAAAGV---EVALGTDSVAsgETLN--VREEVTFARQLYPG-  339
ident                    |            |||                         
Sbjct -pwWFNDspfgmemHLKYLASVDLlynLAGMVTDSRK-lLSFGsrTEMFRRVLSNVVGEm  423
DSSP  -llLLLLlhhhhhhHHHHHHLLLLhhhLLLLLLLLLL-lLHHHhhHHHHHHHHHHHHHHh


DSSP  ---------lLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll
Query ---------lDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
ident                      |                            
Sbjct vekgqipikeARELVKHVSYDGPKALFF----------------------  451
DSSP  hhlllllhhhHHHHHHHHHLHHHHHHHL----------------------


No 49: Query=2imrA Sbjct=2gwgA Z-score=10.9

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct -------------------------------------------------------XIIDI    5
DSSP  -------------------------------------------------------LLEEE


DSSP  EEELL---------llhhhhhhlhhhhllhhhhhhhllllHHHHHH-HHHHHHHHLLLLL
Query HTHLD---------msayefqalpyfqwipevvirgrhlrGVAAAQ-AGADTLTRLGAGG  110
ident | |                                       |             |   
Sbjct HGHYTtapkaledwrnrqiagikdpsvxpkvselkisddeLQASIIeNQLKKXQERGSDL   65
DSSP  EEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhHHHHHHlLHHHHHHHHLLLE


DSSP  EEEEEL-------------LHHHHHHHHL-LLLLleEEEEEELLLLHHHHHHHHHHHHHH
Query VGDIVW-------------APEVMDALLA-REDLsgTLYFEVLNPFPDKADEVFAAARTH  156
ident                      |          |                           
Sbjct TVFSPRagdfnvsstwaaiCNELCYRVSQlFPDN-fIGAAXLPQSPGVDPKTCIPELEKC  124
DSSP  EEEELLlllhhhhhhhhhhHHHHHHHHHHhLLLL-eEEEEELLLLLLLLHHHHHHHHHHH


DSSP  HHHHHlllllleEEEEEElLLLL---------llHHHHHHHHHHHHHHLLLLEEE----e
Query LERWRrlerpglRLGLSPhTPFT---------vsHRLMRLLSDYAAGEGLPLQIH----v  203
ident                     |              |              |  ||     
Sbjct VKEYG-------FVAINL-NPDPsgghwtsppltDRIWYPIYEKXVELEIPAXIHvstga  176
DSSP  HHLLL-------LLEEEE-LLLLlllllllllllLHHHHHHHHHHHHHLLLEEELlllll


DSSP  LLLHhhhhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHHHLLH----HH
Query AEHPtelemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDELGVL----AA  259
ident                                           |                 
Sbjct HYLN-----------------------------------adtTAFXQCVAGDLFkdfpEL  201
DSSP  HHHH-----------------------------------hhhHHHHHHHHLLHHhhllLL


DSSP  LLEEEE-LLLL---LHHH------------hHHHHhHLLLEEELHHhhhhllllllLHHH
Query RPTLVH-MVNV---TPDD------------iARVArAGCAVVTCPRsnhhlecgtfDWPA  303
ident      |    |                      |        ||                
Sbjct KFVIPHgGGAVpyhWGRFrglaqexkkplleDHVL-NNIFFDTCVY---hqpgidlLNTV  257
DSSP  LEEELHhHLLLhhhHHHHhhhhhhlllllhhHHLL-LLEEEELLLL---lhhhhhhHHHH


DSSP  HHhllLLEEELLLLHHHHL------llllhHHHHHHHHhLLLLLHHHHHHHHHHHHHHHh
Query FAaagVEVALGTDSVASGE------tlnvrEEVTFARQlYPGLDPRVLVRAAVKGGQRVv  357
ident        |                                  | |            || 
Sbjct IP--vDNVLFASEXIGAVRgidprtgfyydDTKRYIEA-STILTPEEKQQIYEGNARRV-  313
DSSP  LL--hHHEELLLLLLLLLLleelllleellLLHHHHHH-LLLLLHHHHHHHHLHHHHHH-


DSSP  llllllllllllhhhlhhhllll
Query gtpflrrgetwqegfrwelsrdl  380
ident                        
Sbjct -------yprldaalkakgkleh  329
DSSP  -------lhhhhhhhhhhhhhll


No 50: Query=2imrA Sbjct=3iacA Z-score=10.9

back to top
DSSP  -----------lleeeeeeLEEElleelleeeeeelleeeeeelhhhhhhhlllleeeel
Query -----------htprlltcDVLYtgaqspggvvvvgetvaaaghpdelrrqyphaaeera   49
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  lleELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllhhhhHHHH----------
Query gavIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrgvaaAQAG----------   99
ident       |    | ||                                |            
Sbjct ---APXPIYDFHCHLS------------------------------PQEIaddrrfdnlg   50
DSSP  ---LLLLEEELLLLLL------------------------------HHHHhhllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   99
ident                                                             
Sbjct qiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrr  110
DSSP  hhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhl


DSSP  --------------------------------hHHHHHLLLLLEEEEEL-LHHHhHHHHL
Query --------------------------------aDTLTRLGAGGVGDIVW-APEVmDALLA  126
ident                                            ||               
Sbjct pfgitgtlfgpdtaesiwtqcneklatpafsarGIXQQXNVRXVGTTDDpIDSL-EYHRQ  169
DSSP  llllllllllhhhhhhhhhhhhhhhllhhhlhhHHHHHLLEEEEELLLLlLLLL-HHHHH


DSSP  L-----LLLLEEEEEEEL--LLLH-------------------hhhHHHHHHHHHHHHHH
Query R-----EDLSGTLYFEVL--NPFP-------------------dkaDEVFAAARTHLERW  160
ident        |                                      |    |    |   
Sbjct IaaddsIDIEVAPSWRPDkvFKIEldgfvdylrkleaaadvsitrfDDLRQALTRRLDHF  229
DSSP  HhhlllLLLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllllllhHHHHHHHHHHHHHH


DSSP  HLLLllleEEEEEeLLLL--------------------------------llLHHHHHHH
Query RRLErpglRLGLSpHTPF--------------------------------tvSHRLMRLL  188
ident               |                                            |
Sbjct AACG----CRASD-HGIEtlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWL  284
DSSP  HHLL----LLEEE-EEELlllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHH


DSSP  HHHHHHHLLLLEEEEL-------------------llHHHHhhhhhlllllhhhllhhhl
Query SDYAAGEGLPLQIHVA-------------------ehPTELemfrtgggplwdnrmpaly  229
ident     |  |   | |                                              
Sbjct GRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsIGDN-------------------  325
DSSP  HHHHHHHLLEEEEEELeellllhhhhhhhllllllleELLL-------------------


DSSP  lllhhhhhllllllllLHHHHHHHHL------lhHHLLEEeELLL--LLHHHHHHHHHHL
Query phtlaevigrepgpdlTPVRYLDELG------vlAARPTLvHMVN--VTPDDIARVARAG  281
ident                      |  |              |    |               
Sbjct ----------------NISWALSRLLdsxdvtneLPKTIL-YCLNprDNEVLATXIGNFQ  368
DSSP  ----------------LLHHHHHHHHhhhhllllLLEEEE-EELLhhHHHHHHHHHHHLL


DSSP  -------LLEEElhhHHHHllLLLL--LHHHHHHLLL---LEEELLLLHHhhLLLL-LHH
Query -------CAVVTcprSNHHleCGTF--DWPAFAAAGV---EVALGTDSVAsgETLN-VRE  328
ident                                    |     |   |||            
Sbjct gpgiagkVQFGS-gwWFND-qKDGXlrQLEQLSQXGLlsqFVGXLTDSRS-fLSYTrHEY  425
DSSP  lllllllEEELL-llHHHL-lHHHHhhHHHHHHHHLLhhhLLLLLLLLLL-lLLLHhHHH


DSSP  HHHHHHHHLLL------------llHHHHHHHHHHHHHHHHLlllllllllllhhhlhhh
Query EVTFARQLYPG------------ldPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwel  376
ident        |                  |          ||                     
Sbjct FRRILCNLLGQwaqdgeipddeaxlSRXVQDICFNNAQRYFT------------------  467
DSSP  HHHHHHHHHHHhhhlllllllhhhhHHHHHHHHLHHHHHHLL------------------


DSSP  llll
Query srdl  380
ident     
Sbjct --ik  469
DSSP  --ll


No 51: Query=2imrA Sbjct=3dcpA Z-score=10.5

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
ident                                                             
Sbjct -------------------------------------------------------XKRDG    5
DSSP  -------------------------------------------------------LLEEE


DSSP  EEELLLLHHhhhhlhhhhllhhhhhhHLLLlhhhHHHHHHHHHHHLLLLLEEEEE-----
Query HTHLDMSAYefqalpyfqwipevvirGRHLrgvaAAQAGADTLTRLGAGGVGDIV-----  115
ident |||                       | |                |              
Sbjct HTHTEFCPH-----------------GTHD----DVEEXVLKAIELDFDEYSIVEhapls   44
DSSP  EELLLLLLL-----------------LLLL----LHHHHHHHHHHLLLLEEEEEEellll


DSSP  -------------------------lLHHHHHHHHLL--LLLLEEEeeeellllhhhhhh
Query -------------------------wAPEVMDALLAR--EDLSGTLyfevlnpfpdkade  148
ident                                         ||                  
Sbjct sefxkntagdkeavttasxaxsdlpyYFKKXNHIKKKyaSDLLIHI--------------   90
DSSP  hhhhhllllllhhhhlllllhhhhhhHHHHHHHHHHHllLLLEEEE--------------


DSSP  hhhhhhhhhhhhhlllllleeeEEEElLLLLlLHHHHHHHHHHHhHHLL-LLEEEElllh
Query vfaaarthlerwrrlerpglrlGLSPhTPFTvSHRLMRLLSDYAaGEGL-PLQIHVaehp  207
ident                       |              |       |              
Sbjct ----------------------GFEV-DYLIgYEDFTRDFLNEY-GPQTdDGVLSL----  122
DSSP  ----------------------EEEE-ELLLlLHHHHHHHHHHH-HHHLlEEEEEL----


DSSP  hHHHH------hhhllLLLHHHllhhhllllhhhhhllllLLLL--LHHHHHHHHLL-hh
Query tELEM------frtggGPLWDNrmpalyphtlaevigrepGPDL--TPVRYLDELGV-la  258
ident   ||                                            |    |      
Sbjct hFLEGqggfrsidfsaEDYNEG--------ivqfyggfeqAQLAylEGVKQSIEADLglf  174
DSSP  lEEEElleeeellllhHHHHHH--------lhhhhllhhhHHHHhhHHHHHHHHLLLlll


DSSP  HLLEEEELLL---------------------lLHHHHHHHHHHLLLEEELHhHHHHL--L
Query ARPTLVHMVN---------------------vTPDDIARVARAGCAVVTCPrSNHHL--E  295
ident       |                              | |                    
Sbjct KPRRXGHISLcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNT-AGLFKplC  233
DSSP  LLLEELLLLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEEL-HHHHLllL


DSSP  LLLL----LHHHHHHLLLLEEELLLLHHhhLLLLLhhHHHHHHHHLLlllhhhhhhhhhh
Query CGTF----DWPAFAAAGVEVALGTDSVAsgETLNVreEVTFARQLYPgldprvlvraavk  351
ident   |                   | ||                 |                
Sbjct GETYppkkIVTLASELQIPFVYGSDSHG-vQDIGR--GYSTYCQKLE-------------  277
DSSP  LLLLllhhHHHHHHHLLLLEEEELLLLL-hHHLLL--LHHHHHHHLL-------------


DSSP  hhhhhhllllllllllllhhhlhhhllll
Query ggqrvvgtpflrrgetwqegfrwelsrdl  380
ident                              
Sbjct -----------------------------  277
DSSP  -----------------------------


No 52: Query=2imrA Sbjct=3qy6A Z-score=10.1

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelllLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviappPVNA   60
ident                                                             
Sbjct --------------------------------------------------------MIDI    4
DSSP  --------------------------------------------------------LEEL


DSSP  EEEL--LLLHhhhhhlhhhhllhhhhhhhllLLHHHHHHHHHHHHHHLLLLLEEEEE---
Query HTHL--DMSAyefqalpyfqwipevvirgrhLRGVAAAQAGADTLTRLGAGGVGDIV---  115
ident | |    |                           |     |    | |           
Sbjct HCHIlpAMDD--------------------gAGDSADSIEMARAAVRQGIRTIIATPhhn   44
DSSP  LLLLllLLLL--------------------lLLLHHHHHHHHHHHHHLLLLEEELLLeel


DSSP  ---------llHHHHHHHHLLL-----LLLEEEEEeellllhhhhhhhhhhhhhhhhhhh
Query ---------waPEVMDALLARE-----DLSGTLYFevlnpfpdkadevfaaarthlerwr  161
ident             |  | |  |       |                               
Sbjct ngvyknepaavREAADQLNKRLikediPLHVLPGQ-------------------------   79
DSSP  lllllllhhhhHHHHHHHHHHHhhlllLLEEELLL-------------------------


DSSP  lllllleeeeeEELLlllllhhhHHHHHHHHHHH-------lLLLEEEElllhhhhhhhh
Query rlerpglrlglSPHTpftvshrlMRLLSDYAAGE-------gLPLQIHVaehptelemfr  214
ident                                |              |             
Sbjct -----------EIRI--------YGEVEQDLAKRqllslndtKYILIEF-----------  109
DSSP  -----------EEEL--------LLLHHHHHHLLllllhhhlLEEEEEL-----------


DSSP  hlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhLLHH------HLLEEEELLL
Query tgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelGVLA------ARPTLVHMVN  268
ident                                   ||                |   |   
Sbjct ----------------------------pfdHVPRYAE--QLFYdlqlkgYIPVIAHPER  139
DSSP  ----------------------------lllLLLLLHH--HHHHhhhhllLEEEEELHHH


DSSP  L-----LHHHHHHHHHHLLLEEELHHHH-HHLL---LLLL--LHHHHhhllLLEEELLLL
Query V-----TPDDIARVARAGCAVVTCPRSN-HHLE---CGTF--DWPAFaaagVEVALGTDS  317
ident        |         | |      |                  |            | 
Sbjct NreireNPSLLYHLVEKGAASQITSGSLaGIFGkqlKAFSlrLVEAN----LIHFVASDA  195
DSSP  LhhhhhLLHHHHHHHHLLLEEEEEHHHHlLLLLhhhHHHHhhHHHLL----LLLEEELLL


DSSP  HH-hhLLLLLHHHHHHHHHHlllLLHHHHHHHHhHHHHHHHLlllllllllllhhhlhhh
Query VA-sgETLNVREEVTFARQLypgLDPRVLVRAAvKGGQRVVGtpflrrgetwqegfrwel  376
ident            |                                                
Sbjct HNvktRNFHTQEALYVLEKE---FGSELPYMLT-ENAELLLR--------nqtifrqppq  243
DSSP  LLlllLLLLHHHHHHHHHHH---HLLHHHHHHH-HHHHHHHL--------llllllllll


DSSP  llll
Query srdl  380
ident     
Sbjct pvkr  247
DSSP  llll


No 53: Query=2imrA Sbjct=3au2A Z-score=9.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -llEEEEEELEeelleelleeeeeelleeeeeeLHHHHhhhlllleeeellleelLLLLe
Query -htPRLLTCDVlytgaqspggvvvvgetvaaagHPDELrrqyphaaeeragaviaPPPVn   59
ident      |                              |                   | | 
Sbjct yaaLGLPWIPP------------plredqgeveAALEG----------rlpklleLPQV-  337
DSSP  hhhLLLLLLLH------------hhlllllhhhHHHLL----------lllllllHHHL-


DSSP  eeeellllhhhhhhlhhhhllhhhhhhhllllhhhhhhhhhhhhhhllllLEEE-EELLH
Query ahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadtltrlgagGVGD-IVWAP  118
ident                                                             
Sbjct --------------------------------------------------KGDLqVHSTY  347
DSSP  --------------------------------------------------LEEEeELLLL


DSSP  ----HHHHHHHL--LLLL-LEEEEEEELLL-lHHHHhhHHHHHHHHHHHHHLLL---LLL
Query ----EVMDALLA--REDL-SGTLYFEVLNP-fPDKAdeVFAAARTHLERWRRLE---RPG  167
ident          |                                |       ||      | 
Sbjct sdgqNTLEELWEaaKTMGyRYLAVTDHSPAvrVAGG-pSPEEALKRVGEIRRFNethGPP  406
DSSP  llllLLHHHHHHhhHHHLlLEEEEEEELHHhhLLLL-lLHHHHHHHHHHHHHHHhhhLLL


DSSP  EEEEEEELLLL-lllhhHHHHHHHHHhhhlLLLEEEElllhHHHHHhhhlllllhhhllh
Query LRLGLSPHTPF-tvshrLMRLLSDYAagegLPLQIHVaehpTELEMfrtgggplwdnrmp  226
ident   |                                 |                       
Sbjct YLLAGAEVDIHpdgtldYPDWVLREL----DLVLVSV---hSRFNL--------------  445
DSSP  EEEEEEEEELLllllllLLHHHHLLL----LEEEEEL---lLLLLL--------------


DSSP  hhllllhhhhhllllLLLL--LHHHHHHHhllHHHLLEEEELL-----------LLLHHH
Query alyphtlaevigrepGPDL--TPVRYLDElgvLAARPTLVHMV-----------NVTPDD  273
ident                             |         | |                   
Sbjct ---------------PKADqtKRLLKALE---NPFVHVLAHPTarllgrrapieADWEAV  487
DSSP  ---------------LHHHhhHHHHHHHL---LLLLLEELLLLlllllllllllLLHHHH


DSSP  HHHHHHHLLLEEELH-HHHHhllllllLHHHHHHLLLLEEELLLLhhhhllLLLHHHHHH
Query IARVARAGCAVVTCP-RSNHhlecgtfDWPAFAAAGVEVALGTDSvasgetLNVREEVTF  332
ident        | ||                        |    | ||             |  
Sbjct FQKAKEKGVAVEIDGyYDRM--dlpddLARMAYGMGLWISLSTDAhqtdhlRFMELAVGT  545
DSSP  HHHHHHHLLEEEEELlLLLL--lllhhHHHHHHHLLLLEEEELLLllhhhhHHHHHHHHH


DSSP  HHHhlllllhHHHHHHhhHHHHHhhLLLLllllllllhhhlhhhllll
Query ARQlypgldpRVLVRAavKGGQRvvGTPFlrrgetwqegfrwelsrdl  380
ident |                                               
Sbjct AQR------aWIGPER--VLNTL-dYEDL---------lswlkarrgv  575
DSSP  HHH------lLLLLLL--LHHHL-lHHHH---------hhhhhlllll


No 54: Query=2imrA Sbjct=3f2bA Z-score=8.9

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlLLLE---------------
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyPHAA---------------   45
ident                                                             
Sbjct -----------------------------vrrletiveeerRVVVqgyvfdaevselksg   31
DSSP  -----------------------------lllhhhlllleeEEEEeeeeeeeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   45
ident                                                             
Sbjct rtlltmkitdytnsilvkmfsrdkedaelmsgvkkgmwvkvrgsvqndtfvrdlviiand   91
DSSP  leeeeeeeelllleeeeeeelllhhhhhhhhlllllleeeeeeeeeeelllleeeeeeee


DSSP  -------eeellleeLLLLLEEEEEL-LLLHhhhhhlhhhhllhhhhhhhLLLLhhhHHH
Query -------eeragaviAPPPVNAHTHL-DMSAyefqalpyfqwipevvirgRHLRgvaAAQ   97
ident                    |  | |                                   
Sbjct lneiaanerqdtapeGEKRVELHLHTpMSQM-------------------DAVT---SVT  129
DSSP  eeeelllllllllllLLLLLLLLLLLlLLLL-------------------LLLL---LHH


DSSP  HHHHHHHHLLLLLEEEEEL-LHHHHHHHHLL---LLLLEEEEEEellllhhhhhhhhhhh
Query AGADTLTRLGAGGVGDIVW-APEVMDALLAR---EDLSGTLYFEvlnpfpdkadevfaaa  153
ident          |                                 |                
Sbjct KLIEQAKKWGHPAIAVTDHaVVQSFPEAYSAakkHGMKVIYGLE----------------  173
DSSP  HHHHHHHHLLLLLEEELLLlLLLLHHHHHHHhhhHLLLEEEEEE----------------


DSSP  hhhhhhhhlllllleeeeeeeLLLL-----------------------------------
Query rthlerwrrlerpglrlglspHTPF-----------------------------------  178
ident                                                             
Sbjct ---------------------ANIVddpfhvtllaqnetglknlfklvslshiqyfhrvp  212
DSSP  ---------------------EEEEllleeeeeeellhhhhhhhhhhhhhhhllllllll


DSSP  LLLHHHHHHHHHhhhhhlLLLEeeelllhhhhhhhhhlllllhhhllhhhllllhhhhhl
Query TVSHRLMRLLSDyaagegLPLQihvaehptelemfrtgggplwdnrmpalyphtlaevig  238
ident            |        |                                       
Sbjct RIPRSVLVKHRD------GLLV--------------------------------------  228
DSSP  LEEHHHHHHLLL------LEEE--------------------------------------


DSSP  llllllllhhhhhhhhllhhhllEEEE----LLLLlhhHHHHHHhHLLLEEELHhhHHHL
Query repgpdltpvryldelgvlaarpTLVH----MVNVtpdDIARVArAGCAVVTCPrsNHHL  294
ident                                                      |      
Sbjct -----------------------GSGCdkgeLFDN---VEDIAR-FYDFLEVHP--PDVY  259
DSSP  -----------------------ELLLllllLLLL---LLLLHH-HLLLEEELL--HHHH


DSSP  LL--------lllLHHHHHHLL----LLEEELLLLHH-----------------------
Query EC--------gtfDWPAFAAAG----VEVALGTDSVA-----------------------  319
ident                    | |      |                               
Sbjct KPlyvkdeemiknIIRSIVALGekldIPVVATGNVHYlnpedkiyrkilihsqgganpln  319
DSSP  LLlllllhhhhhhHHHHHHHHHhhllLLEEELLLLLLllhhhhhhhhhhhhllhhhllll


DSSP  -----HHLLLLLHHHHHHHHHhlllLLHHHHHHHHHHHHHHHHL----------------
Query -----SGETLNVREEVTFARQlypgLDPRVLVRAAVKGGQRVVG----------------  358
ident              |           | |       |   |                    
Sbjct rhelpDVYFRTTNEMLDCFSF----LGPEKAKEIVVDNTQKIASligdvkpikdelytpr  375
DSSP  lllllLLLLLLHHHHHHHHHH----HHHHHHHHHHLHHHHHHHHllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct iegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkksld  435
DSSP  lllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct dgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncp  495
DSSP  llllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct rcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragti  555
DSSP  lllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct gtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiyd  615
DSSP  eellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct ftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptd  675
DSSP  llleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct dpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisgls  735
DSSP  lhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct hgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltp  795
DSSP  lllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct efeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvr  855
DSSP  hhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  358
ident                                                             
Sbjct aedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidly  915
DSSP  lllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllll


DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------tpf  361
ident                                                             
Sbjct rsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlley  975
DSSP  llllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhh


DSSP  llllllllhhhlhhhllll
Query lrrgetwqegfrwelsrdl  380
ident                    
Sbjct lesrgcldslpdhnqlslf  994
DSSP  hhhllllllllllllllll


No 55: Query=2imrA Sbjct=1m65A Z-score=8.1

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelllLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviappPVNA   60
ident                                                         ||  
Sbjct -------------------------------------------------------yPVDL    5
DSSP  -------------------------------------------------------lLEEL


DSSP  EEElLLLHhhhhhlhhhhllhhhhhhHLLLlhhhHHHHHHHHHHHLLLLLEEEEE-----
Query HTHlDMSAyefqalpyfqwipevvirGRHLrgvaAAQAGADTLTRLGAGGVGDIV-----  115
ident | |                                           |             
Sbjct HMH-TVAS------------------THAY---sTLSDYIAQAKQKGIKLFAITDhgpdm   43
DSSP  LLL-LLLL------------------LLLL---lLHHHHHHHHHHHLLLEEEEEEellll


DSSP  -------LLHHhHHHHhLLLL--LLEEEEEeellllhhhhhhhhhhHHHHHHhhhlllll
Query -------WAPEvMDALlARED--LSGTLYFevlnpfpdkadevfaaARTHLErwrrlerp  166
ident             |     |                                         
Sbjct edaphhwHFIN-MRIW-PRVVdgVGILRGI---eaniknvdgeidcSGKMFD--------   90
DSSP  llllllhHHHH-HHHL-LLEEllEEEEEEE---eeellllllllllLHHHHH--------


DSSP  leeEEEEelllllllhhhhhhhhhhhhhhllllEEEElllhhhhHHHHhlllllhhhllh
Query glrLGLSphtpftvshrlmrllsdyaageglplQIHVaehptelEMFRtgggplwdnrmp  226
ident    | |                                                      
Sbjct --sLDLI--------------------------IAGF--hepvfAPHD------------  108
DSSP  --hLLEE--------------------------EEEL--lllllLLLL------------


DSSP  hhllllhhhhhllllllLLLHhHHHHHhlLHHHLL-EEEELLL-----LLHHHHHHHHHH
Query alyphtlaevigrepgpDLTPvRYLDElgVLAARP-TLVHMVN-----VTPDDIARVARA  280
ident                                        |  |              |  
Sbjct ----------------kATNT-QAMIA-tIASGNVhIISHPGNpkyeiDVKAVAEAAAKH  150
DSSP  ----------------hHHHH-HHHHH-hHHLLLLlEELLLLLlllllLHHHHHHHHHHH


DSSP  LLLEEElHHHHhhlllLLLL-HHHHHHLLLLEEELLLLHHhhLLLLLhhHHHHHHhHLLL
Query GCAVVTcPRSNhhlecGTFD-WPAFAAAGVEVALGTDSVAsgETLNVreEVTFARqLYPG  339
ident   |      |             |   ||  |||| ||     |                
Sbjct QVALEI-NNSS-----NCREvAAAVRDAGGWVALGSDSHT-aFTMGE--FEECLK-ILDA  200
DSSP  LLEEEE-ELLL-----LHHHhHHHHHHHLLLEEEELLLLL-hHHLLL--LHHHHH-HHHH


DSSP  LLHHHhhHHHHHhhHHHHLlllllllllllhhhlhhhllll
Query LDPRVlvRAAVKggQRVVGtpflrrgetwqegfrwelsrdl  380
ident  |        |    |                         
Sbjct VDFPPerILNVS-pRRLLN------flesrgmapiaefadl  234
DSSP  LLLLHhhLHHHL-hHHHHH------hhhhllllllhhhlll


No 56: Query=2imrA Sbjct=1bksA Z-score=7.7

back to top
DSSP  lleeeeeeleeELLEelleeeeeelleeeeeelhhhhhhhlllleeeellleelllllEE
Query htprlltcdvlYTGAqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapppvNA   60
ident                                                             
Sbjct meryenlfaqlNDRR----------------------------------------egaFV   20
DSSP  lhhhhhhhhhhHHLL----------------------------------------lleEE


DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllLLHHHHHHHHHHHHHHLLlLLEEEEEL----
Query HTHLDmsayefqalpyfqwipevvirgrhLRGVAAAQAGADTLTRLGaGGVGDIVW----  116
ident                                |        |||   |             
Sbjct PFVTL-----------------------gDPGIEQSLKIIDTLIDAG-ADALELGVpfsd   56
DSSP  EEEEL-----------------------lLLLHHHHHHHHHHHHHLL-LLLEEEELllll


DSSP  ---------------------LHHHHHHHHL-LLLL--LEEEEEEELLllhhhhhhHHHH
Query ---------------------APEVMDALLA-REDL--SGTLYFEVLNpfpdkadeVFAA  152
ident                             |   ||             |            
Sbjct pladgptiqnanlrafaagvtPAQCFEMLALiREKHptIPIGLLMYAN------lvFNNG  110
DSSP  lllllhhhhhhhhhhhhhlllHHHHHHHHHHhHHHLllLLEEEEELHH------hhHLLL


DSSP  HHHHHHHHHLLLllleEEEEEELlllLLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhh
Query ARTHLERWRRLErpglRLGLSPHtpfTVSHRLMRLLSDYAAGEGLPLQIHVAehptelem  212
ident       |                    |           |                    
Sbjct IDAFYARCEQVG----VDSVLVA---DVPVEESAPFRQAALRHNIAPIFICP--------  155
DSSP  HHHHHHHHHHHL----LLEEEEL---LLLHHHLHHHHHHHHHLLLEEEEEEL--------


DSSP  hhhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHhLLHHHLL-EEEELllLLH
Query frtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDElGVLAARP-TLVHMvnVTP  271
ident                                       |    |                
Sbjct --------------------------------pnADDDLLR-QVASYGRgYTYLLalPLH  182
DSSP  --------------------------------llLLHHHHH-HHHHHLLlLEEELllLHH


DSSP  HHHHHHHHHL-LLEEELhHHHHhlllllLLHHHHhhllllEEELLLL-HHHH--------
Query DDIARVARAG-CAVVTCpRSNHhlecgtFDWPAFaaagveVALGTDS-VASG--------  321
ident   |                             |             |             
Sbjct HLIEKLKEYHaAPALQGfGISS-peqvsAAVRAG-----aAGAISGSaIVKIieknlasp  236
DSSP  HHHHHHHHHLlLLEEELlLLLL-hhhhhHHHHHL-----lLEEEELLhHHHHhhhllllh


DSSP  ------lllLLHHHHHHHHhhlllllhhhhhhhhhhhhhhhhllllllllllllhhhlhh
Query ------etlNVREEVTFARqlypgldprvlvraavkggqrvvgtpflrrgetwqegfrwe  375
ident           |       |                                         
Sbjct kqmlaelrsFVSAMKAASR-----------------------------------------  255
DSSP  hhhhhhhhhHHHHHHHLLL-----------------------------------------


DSSP  hllll
Query lsrdl  380
ident      
Sbjct -----  255
DSSP  -----


No 57: Query=2imrA Sbjct=2yb1A Z-score=5.8

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEe
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNa   60
ident                                                             
Sbjct -------------------------------------------------------ANID-    4
DSSP  -------------------------------------------------------LLEE-


DSSP  EEELLLlhhhhhhlhhhhllhhhhhhhlLLLHhhHHHHHHHHHHHLLLLLEEEEEL-lHH
Query HTHLDMsayefqalpyfqwipevvirgrHLRGvaAAQAGADTLTRLGAGGVGDIVW-aPE  119
ident                                         |                   
Sbjct LHFHSR--------------------tsDGAL--TPTEVIDRAAARAPALLALTDHdcTG   42
DSSP  LLLLLL--------------------llLLLL--LHHHHHHHHHLLLLLEEEELLLllLL


DSSP  HHHHHHLL---LLLLEEEEEEELLL-----------lhhhhhHHHHHHHH----------
Query VMDALLAR---EDLSGTLYFEVLNP-----------fpdkadEVFAAART----------  155
ident       |             ||                       ||             
Sbjct GLAEAAAAaarRGIPFLNGVEVSVSwgrhtvhivglgidpaePALAAGLKsiregrlera  102
DSSP  LHHHHHHHhhhLLLLEEEEEEEEEEelleeeeeeeellllllHHHHHHHHhhhllhhhhh


DSSP  ----------------------------------------hhhhhhlllllleeeeeeel
Query ----------------------------------------hlerwrrlerpglrlglsph  175
ident                                                             
Sbjct rqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkp  162
DSSP  hhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllll


DSSP  llllllhhHHHHHHHHHHHHLLLLEEEELLLHHHHhhhhhlllllhhhllhhhllllhhh
Query tpftvshrLMRLLSDYAAGEGLPLQIHVAEHPTELemfrtgggplwdnrmpalyphtlae  235
ident                   | |    |                                  
Sbjct gyvshqwaSLEDAVGWIVGAGGMAVIAHPGRYDMG-------------------------  197
DSSP  llllllllLHHHHHHHHHHLLLEEEELLHHHLLLL-------------------------


DSSP  hhlllllllLLHHHHHHhhLLHH-HLLEEEE-----lllllhhhHHHHHHHLLLEEelhh
Query vigrepgpdLTPVRYLDelGVLA-ARPTLVH-----mvnvtpddIARVARAGCAVVtcpr  289
ident              |        |                          | |        
Sbjct --------rTLIERLIL--DFQAaGGQGIEVasgshslddmhkfALHADRHGLYAS----  243
DSSP  --------hHHHHHHHH--HHHHlLLLEEEEeellllhhhhhhhHHHHHHHLLEEE----


DSSP  hhhhlllllllhhhhhhlllleeELLLLHHhhLLLLLhhhhhhhhhhlllllhhhhhhhH
Query snhhlecgtfdwpafaaagvevaLGTDSVAsgETLNVreevtfarqlypgldprvlvraA  349
ident                         | |  |  |                           
Sbjct -----------------------SGSDFHApgEDVGH----------------------T  258
DSSP  -----------------------EELLLLLllLLLLL----------------------L


DSSP  HHH---hhHHHLlllllllllllhhhlhhhllll
Query VKG---gqRVVGtpflrrgetwqegfrwelsrdl  380
ident                                   
Sbjct EDLppicrPIWR--------elearilrpadaen  284
DSSP  LLLlllllLHHH--------hlhhhlllllhhhl


No 58: Query=2imrA Sbjct=3e38A Z-score=5.3

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellLEEL-----L
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragAVIA-----P   55
ident                                                    |        
Sbjct -------------------------------------------aqrrneiQVPDldgytT   17
DSSP  -------------------------------------------lllllllLLLLlllleE


DSSP  LLLEEEEELLLLhhhhhhlhhhhllhhhhhhhllLLHHhhHHHHHHHHHHLLLLLEEEEE
Query PPVNAHTHLDMSayefqalpyfqwipevvirgrhLRGVaaAQAGADTLTRLGAGGVGDIV  115
ident      | |   |                                 |   | |        
Sbjct LKCDFHXHSVFS---------------------dGLVW--PTVRVDEAYRDGLDAISLTE   54
DSSP  EEEELLLLLLLL---------------------lLLLL--HHHHHHHHHHLLLLEELLEE


DSSP  -------------lLHHHHHHHHLL---LLLLEEEEEeellllhhhhhhhhhhhhhhhhh
Query -------------wAPEVMDALLAR---EDLSGTLYFevlnpfpdkadevfaaarthler  159
ident                    |                                        
Sbjct hieyrphkqdvvsdHNRSFDLCREQaekLGILLIKGS-----------------------   91
DSSP  elllllllllllllLLHHHHHHHHHhhhHLLEELLEE-----------------------


DSSP  hhlllllleeeeeEELLLL--------------lllHHHHHHHHHHHHHHLLLleeeell
Query wrrlerpglrlglSPHTPF--------------tvsHRLMRLLSDYAAGEGLPlqihvae  205
ident                                               |   |         
Sbjct -------------EITRAXapghfnaiflsdsnpleQKDYKDAFREAKKQGAF-------  131
DSSP  -------------EEELLLllleeeeelllllhhhlLLLHHHHHHHHHHLLLE-------


DSSP  lhhhhhhhhhlllllhhhllhhhllllhhhhhlllllllllhhhhhhhhllhhhlLEEEE
Query hptelemfrtgggplwdnrmpalyphtlaevigrepgpdltpvryldelgvlaarPTLVH  265
ident                                                            |
Sbjct -------------------------------------------------------XFWNH  136
DSSP  -------------------------------------------------------EEELL


DSSP  LL--------LLLHHHHHHHHHHL--LLEE-ELHHHHhhllllLLLHHHHHHLLLLEEEL
Query MV--------NVTPDDIARVARAG--CAVV-TCPRSNhhlecgTFDWPAFAAAGVEVALG  314
ident                        |                                    
Sbjct PGwdsqqpdtTKWWPEHTALYQEGcxHGIEvANGHLY-----xPEAIQWCLDKNLTXIGT  191
DSSP  LLllllllllLLLLHHHHHHHHLLllLEEEeEELLEE-----lLHHHHHHHHHLLEEEEE


DSSP  LLLHH---------hhlLLLLhhhhhhhhhhlllllhhhhhhhHHHHhhhhhlLLLL---
Query TDSVA---------sgeTLNVreevtfarqlypgldprvlvraAVKGgqrvvgTPFL---  362
ident  |                                                          
Sbjct SDIHQpiqtdydfekgeHRTX----------------------TFVF------AKERslq  223
DSSP  LLLLLlhhhhllhhhllLLLE----------------------EEEE------ELLLlhh


DSSP  -------------------------------------------lllllllhhhLHHH---
Query -------------------------------------------rrgetwqegfRWEL---  376
ident                                                             
Sbjct girealdnrrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvTDLVlkl  283
DSSP  hhhhhhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeelLLLLeee


DSSP  -------------------------------------------------------llll
Query -------------------------------------------------------srdl  380
ident                                                            
Sbjct kktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=2imrA Sbjct=2anuA Z-score=5.3

back to top
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleELLLLLEE
Query htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragavIAPPPVNA   60
ident                                                             
Sbjct ----------------------------------------------------TEWLLCDF    8
DSSP  ----------------------------------------------------LEEEEEEE


DSSP  EEELLLLhhhhhhlhhhhllhhhhhhhllllhhhHHHHHHHHHHHLLLLLEEEEE-----
Query HTHLDMSayefqalpyfqwipevvirgrhlrgvaAAQAGADTLTRLGAGGVGDIV-----  115
ident | |   |                                 |     |   |         
Sbjct HVHTNXS-----------------------dghlPLGEVVDLFGKHGVDVVSITDhivdr   45
DSSP  EELLLLL-----------------------llllLHHHHHHHHHHLLLLEEEEEEeeelh


DSSP  ----------------------lLHHHHHHHHLLLL----LLEEEEEeellllhhhhhhh
Query ----------------------wAPEVMDALLARED----LSGTLYFevlnpfpdkadev  149
ident                                  |                          
Sbjct rtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGV-------------   92
DSSP  hhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEE-------------


DSSP  hhhhhhhhhhhhlllllleeeeeEELLLL-------------lllHHHHHHHHHHHHHHL
Query faaarthlerwrrlerpglrlglSPHTPF-------------tvsHRLMRLLSDYAAGEG  196
ident                                                             
Sbjct -----------------------EITNNTdlyhivavdvkeyvdpSLPVEEIVEKLKEQN  129
DSSP  -----------------------EEEELLlleeeeeellllllllLLLHHHHHHHHHHLL


DSSP  LLleeeelllhhhhhhhhhlllllhhhllhhhllllhhhhhlllllllllhhhhhhhhll
Query LPlqihvaehptelemfrtgggplwdnrmpalyphtlaevigrepgpdltpvryldelgv  256
ident                                                             
Sbjct AL----------------------------------------------------------  131
DSSP  LE----------------------------------------------------------


DSSP  hhhlLEEEEL-----llllhHHHHHHHHHlLLEE-ELHHhhhhllllLLLHhHHHHLLLL
Query laarPTLVHM-----vnvtpDDIARVARAgCAVV-TCPRsnhhlecgTFDWpAFAAAGVE  310
ident         |               |      |                            
Sbjct ----VIAAHPdrkklswylwANXERFKDTfDAWEiANRD--------DLFN-SVGVKKYR  178
DSSP  ----EEELLLlllllllhhhHLLLLLLLLlLEEEeEELL--------EELH-HHHHLLLL


DSSP  EEELLLLHHhhLLLLL----hhhhhhhhhhlllllhhhhHHHHhhhhhhhhlllllllll
Query VALGTDSVAsgETLNV----reevtfarqlypgldprvlVRAAvkggqrvvgtpflrrge  366
ident      |                                 |                    
Sbjct YVANSDFHE-lWHVYSwktlvkseknieaikeairkntdVAIY-----------------  220
DSSP  EEEELLLLL-hHHHLLeeeeeeelllhhhhhhhhhhlllEEEE-----------------


DSSP  lllhhhlhhhllll
Query twqegfrwelsrdl  380
ident               
Sbjct ----------lxrk  224
DSSP  ----------elll