Results: dupa

Query: 2gwgA

MOLECULE: 4-OXALOMESACONATE HYDRATASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2gwg-A 58.7  0.0  329   329  100 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   2:  4ofc-A 30.1  3.0  281   335   21 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   3:  4hk5-D 27.7  3.2  289   380   17 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   4:  2dvt-A 27.7  2.5  261   325   21 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   5:  4qrn-A 27.6  3.0  274   352   22 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   6:  4dzi-C 21.5  3.5  269   388   17 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
   7:  3cjp-A 19.9  2.6  222   262   18 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   8:  2ffi-A 19.0  3.0  237   273   17 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
   9:  4dlf-A 18.3  3.0  231   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  10:  3irs-A 18.3  2.9  223   281   21 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  11:  4mup-B 17.2  3.5  231   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  12:  2y1h-B 16.8  3.4  225   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  13:  1itq-A 15.8  3.2  246   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  14:  2ob3-A 14.9  3.3  227   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  15:  4b3z-D 14.8  3.3  227   477   10 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  16:  2qpx-A 14.7  3.3  215   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  17:  1gkp-A 14.6  3.6  232   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  18:  4cqb-A 14.4  4.3  245   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  19:  2vun-A 14.3  3.7  221   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  20:  1bf6-A 14.3  3.9  226   291    9 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  21:  3giq-A 14.2  3.4  235   475   11 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  22:  1yrr-B 14.2  3.5  220   334    9 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  23:  2vc5-A 14.2  3.8  229   314   13 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  24:  3nqb-A 14.1  3.6  220   587   13 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  25:  2paj-A 14.1  3.7  217   421    9 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  26:  1k6w-A 13.9  4.1  243   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  27:  3gg7-A 13.8  3.9  215   243   13 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  28:  3k2g-B 13.7  3.4  222   358   10 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  3ls9-A 13.6  4.3  234   453    9 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  30:  1j6p-A 13.6  4.0  224   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  31:  4c5y-A 13.5  4.2  216   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  32:  3pnu-A 13.4  3.6  217   338   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  33:  1onx-A 13.3  3.9  223   390   12 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  34:  2oof-A 13.1  4.1  222   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  35:  1a4m-A 12.9  4.1  229   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  36:  3mtw-A 12.9  4.0  218   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  37:  3mkv-A 12.9  4.2  218   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  38:  3gri-A 12.7  3.7  221   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  39:  2ogj-A 12.5  3.8  228   379   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  40:  3icj-A 12.0  4.2  225   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  41:  1a5k-C 11.9  3.6  203   566   13 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  42:  3e74-A 11.9  3.7  208   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  43:  1j5s-A 11.7  3.1  214   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  44:  3iac-A 11.6  3.4  221   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  45:  4rdv-B 11.5  3.9  222   451    9 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  46:  2uz9-A 11.0  4.1  215   444   10 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  47:  2imr-A 10.9  3.7  203   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  48:  3qy6-A 10.1  3.4  186   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  3ooq-A  9.7  4.1  191   384   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  2a3l-A  8.7  4.4  237   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  1v77-A  8.1  3.8  160   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  52:  1m65-A  7.5  3.5  172   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  53:  3au2-A  7.0  3.7  172   575    9 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3dcp-A  6.2  4.5  159   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  6.0  4.2  163   994   10 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  5.4  3.8  159   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  4.6  3.9  146   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  4.0  4.0  148   342    6 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  2.6  4.1  121   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2gwgA Sbjct=2gwgA Z-score=58.7

back to top
DSSP  LLEEEEEELLLLLHHHHHHHHHHHHHHHLHHHLLLHHHLLLLHHHHHHHHHLLHHHHHHH
Query XIIDIHGHYTTAPKALEDWRNRQIAGIKDPSVXPKVSELKISDDELQASIIENQLKKXQE   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct XIIDIHGHYTTAPKALEDWRNRQIAGIKDPSVXPKVSELKISDDELQASIIENQLKKXQE   60
DSSP  LLEEEEEELLLLLHHHHHHHHHHHHHHHLHHHLLLHHHLLLLHHHHHHHHHLLHHHHHHH


DSSP  HLLLEEEEELLLLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEEELLLLLLLLHHHHHHH
Query RGSDLTVFSPRAGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAXLPQSPGVDPKTCIPE  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RGSDLTVFSPRAGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAXLPQSPGVDPKTCIPE  120
DSSP  HLLLEEEEELLLLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEEELLLLLLLLHHHHHHH


DSSP  HHHHHHLLLLLEEEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEELLLLLLHHHH
Query LEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRIWYPIYEKXVELEIPAXIHVSTGAHYLN  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRIWYPIYEKXVELEIPAXIHVSTGAHYLN  180
DSSP  HHHHHHLLLLLEEEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEELLLLLLHHHH


DSSP  HHHHHHHHHHHLLHHHHLLLLLEEELHHHLLLHHHHHHHHHHHHHLLLLLHHHHLLLLEE
Query ADTTAFXQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEXKKPLLEDHVLNNIF  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ADTTAFXQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEXKKPLLEDHVLNNIF  240
DSSP  HHHHHHHHHHHLLHHHHLLLLLEEELHHHLLLHHHHHHHHHHHHHLLLLLHHHHLLLLEE


DSSP  EELLLLLHHHHHHHHHHLLHHHEELLLLLLLLLLLEELLLLEELLLLHHHHHHLLLLLHH
Query FDTCVYHQPGIDLLNTVIPVDNVLFASEXIGAVRGIDPRTGFYYDDTKRYIEASTILTPE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct FDTCVYHQPGIDLLNTVIPVDNVLFASEXIGAVRGIDPRTGFYYDDTKRYIEASTILTPE  300
DSSP  EELLLLLHHHHHHHHHHLLHHHEELLLLLLLLLLLEELLLLEELLLLHHHHHHLLLLLHH


DSSP  HHHHHHLHHHHHHLHHHHHHHHHHHHHLL
Query EKQQIYEGNARRVYPRLDAALKAKGKLEH  329
ident |||||||||||||||||||||||||||||
Sbjct EKQQIYEGNARRVYPRLDAALKAKGKLEH  329
DSSP  HHHHHHLHHHHHHLHHHHHHHHHHHHHLL


No 2: Query=2gwgA Sbjct=4ofcA Z-score=30.1

back to top
DSSP  LLEEEEEELlLLLHhhHHHHHHHHHHHhlhhhlllhhhLLLL-----------------h
Query XIIDIHGHYtTAPKalEDWRNRQIAGIkdpsvxpkvseLKIS-----------------d   43
ident   |||| |                                                    
Sbjct MKIDIHSHI-LPKE--WPDLKKRFGYG--------gwvQLQHhskgeakllkdgkvfrvv   49
DSSP  LLEEEEEEL-LLLL--LLLHHHHHLLL--------lleEEEEeelleeeeeelleeeeee


DSSP  hhhhhHHHLlHHHHHHHHLLLEEEEELLL------LLHHHHHHHHHHHHHHHHHHHHHLL
Query delqaSIIEnQLKKXQERGSDLTVFSPRA------GDFNVSSTWAAICNELCYRVSQLFP   97
ident                   |      |                      |          |
Sbjct rencwDPEV-RIREMDQKGVTVQALSTVPvmfsywAKPEDTLNLCQLLNNDLASTVVSYP  108
DSSP  ehhhlLHHH-HHHHHHHHLLLEEEEELLHhhhlllLLHHHHHHHHHHHHHHHHHHHHHLL


DSSP  LLEEEEEELLLLlllLHHHHHHHHHHHHHLLLLLEEEELLLLLlllllLLLLLLHHHHHH
Query DNFIGAAXLPQSpgvDPKTCIPELEKCVKEYGFVAINLNPDPSgghwtSPPLTDRIWYPI  157
ident   | |   ||      |     | | |||| ||                  |      | 
Sbjct RRFVGLGTLPMQ---APELAVKEMERCVKELGFPGVQIGTHVN-----EWDLNAQELFPV  160
DSSP  LLEEEEELLLLL---LHHHHHHHHHHHHHLLLLLEEEEELEEL-----LEELLLHHHHHH


DSSP  HHHHHHHLLLEEELLL-------------LLLH-HHHHHHHHHHHHHHLLHHHHLLLLLE
Query YEKXVELEIPAXIHVS-------------TGAH-YLNADTTAFXQCVAGDLFKDFPELKF  203
ident |     |      |                         | |      |  |  || || 
Sbjct YAAAERLKCSLFVHPWdmqmdgrmakywlPWLVgMPAETTIAICSMIMGGVFEKFPKLKV  220
DSSP  HHHHHHHLLEEEEELLlllllhhhhlllhHHHLhHHHHHHHHHHHHHLLLHHHHLLLLLE


DSSP  EELHHHLLLHHHHHHHHHHHHHLL-------LLLHHHhLLLLEEEELLLLLHHHHHHHHH
Query VIPHGGGAVPYHWGRFRGLAQEXK-------KPLLEDhVLNNIFFDTCVYHQPGIDLLNT  256
ident    ||||| |   ||                        |     |  |       ||  
Sbjct CFAHGGGAFPFTVGRISHGFSMRPdlcaqdnPMNPKK-YLGSFYTDALVHDPLSLKLLTD  279
DSSP  EELHHHLLHHHHHHHHHHHHHHLHhhhllllLLLHHH-HLLLLEEELLLLLHHHHHHHHH


DSSP  HLLHHHEELLLLLLLLLlleelllleeLLLLHHHHHHLLLLLHHHHHHHHLHHHHHHLHh
Query VIPVDNVLFASEXIGAVrgidprtgfyYDDTKRYIEASTILTPEEKQQIYEGNARRVYPr  316
ident ||  | |                           ||       | |     |||      
Sbjct VIGKDKVILGTDYPFPL---------gELEPGKLIESMEEFDEETKNKLKAGNALAFLG-  329
DSSP  HHLLLLEELLLLLLLLL---------lLLLLLHHHHHLLLLLHHHHHHHHLHHHHHHHL-


DSSP  HHHHHHhhhhhll
Query LDAALKakgkleh  329
ident |            
Sbjct LERKQF-------  335
DSSP  LLHHHL-------


No 3: Query=2gwgA Sbjct=4hk5D Z-score=27.7

back to top
DSSP  --LLEEEEEElLLLLhHHHHHHHHhHHHH------------------------hlhhhll
Query --XIIDIHGHyTTAPkALEDWRNRqIAGI------------------------kdpsvxp   34
ident      ||| |    |             |                               
Sbjct tpVVVDIHTH-MYPP-SYIAMLEK-RQTIplvrtfpqadeprlillsselaaldaaladp   57
DSSP  llLLEEEEEE-ELLH-HHHHHHHL-LLLLleeeeelleeeeeeellhhhhhhhhhhhhll


DSSP  lhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEELLL-----LLHHHHHHHHHHHHHHH
Query kvselkisddelqaSIIEnQLKKXQERGSDLTVFSPRA-----GDFNVSSTWAAICNELC   89
ident               |            |    | |                 |   |   
Sbjct aaklpgrplsthfaSLAQ-KMHFMDTNGIRVSVISLANpwfdfLAPDEAPGIADAVNAEF  116
DSSP  lllllleellhhhlLHHH-HHHHHHHLLLLEEEEEELLlllllLLLLLHHHHHHHHHHHH


DSSP  HHHHHHLLLLEEEEEELLLLllLLHHHHHHHHHHHHHLLLLLEEEELLLLllllllLLLL
Query YRVSQLFPDNFIGAAXLPQSpgVDPKTCIPELEKCVKEYGFVAINLNPDPsgghwtSPPL  149
ident               | || |            |          | |             |
Sbjct SDMCAQHVGRLFFFAALPLS--APVDAVKASIERVKNLKYCRGIILGTSG-----lGKGL  169
DSSP  HHHHHLLLLLEEEEEELLLL--LLHHHHHHHHHHHHLLLLEEEEEELLLL-----lLLLL


DSSP  LLHHHHHHHHHHHHHLLLEEELLL-------------------LLLH-HHHHHHHHHHHH
Query TDRIWYPIYEKXVELEIPAXIHVS-------------------TGAH-YLNADTTAFXQC  189
ident  |    |  |           |                       |       | |    
Sbjct DDPHLLPVFEAVADAKLLVFLHPHyglpnevygprseeyghvlPLALgFPMETTIAVARM  229
DSSP  LLHHHHHHHHHHHHLLLEEEELLLllllhhhhlllhhhlllhhHHHLhHHHHHHHHHHHH


DSSP  HHLLHHHHLLLLLEEELHHHLLLHHHHHHHHHHHHHL-----------LLLLHHHHLLLL
Query VAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEX-----------KKPLLEDHVLNN  238
ident      |     |     | ||  |   ||                               
Sbjct YMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDghlvktgkvpkDRRTIWTVLKEQ  289
DSSP  HHLLHHHHLLLLLEEEHHHHLLHHHHHHHHHHHHHLLhhhhhllllllLLLLHHHHHHHL


DSSP  EEEELLLLLHHHHHHHHHHLLHHHEELLLLLLLlLLLEEL-llleELLL--LHHHHHHLL
Query IFFDTCVYHQPGIDLLNTVIPVDNVLFASEXIGaVRGIDP-rtgfYYDD--TKRYIEAST  295
ident |  |   |   |          |   |          |                      
Sbjct IYLDAVIYSEVGLQAAIASSGADRLMFGTDHPF-FPPIEEdvqgpWDSSrlNAQAVIKAV  348
DSSP  EEEELLLLLHHHHHHHHHHHLHHHEELLLLLLL-LLLLLLlllllLHHHhhHHHHHHHHH


DSSP  LLLHHHHHHHHLHHHHHHLHhHHHHHHHHHHHLl
Query ILTPEEKQQIYEGNARRVYPrLDAALKAKGKLEh  329
ident              || ||   | | |        
Sbjct GEGSSDAAAVMGLNAVRVLS-LKAELEHHHHHH-  380
DSSP  LLLLHHHHHHHLHHHHHHLL-LHHHHHHHHHHL-


No 4: Query=2gwgA Sbjct=2dvtA Z-score=27.7

back to top
DSSP  --LLEEEEEELLlllHHHHHhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLLHHHHH
Query --XIIDIHGHYTtapKALEDwrnrqiagikdpsvxpkvselkisddelqaSIIENQLKKX   58
ident          |                                         |    ||  
Sbjct mqGKVALEEHFA--iPETLQ-----------dsagfvpgdywkelqhrllDIQDTRLKLM   47
DSSP  llLEEEEEEEEL--lHHHHH-----------hhlllllllhhhhhhhhhhLLLLHHHHHH


DSSP  HHHLLLEEEEELLL------LLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEEELLLLlll
Query QERGSDLTVFSPRA------GDFNVSSTWAAICNELCYRVSQLFPDNFIGAAXLPQSpgv  112
ident    |      |  |       |       |   |          || |   | ||     
Sbjct DAHGIETMILSLNApavqaiPDRRKAIEIARRANDVLAEECAKRPDRFLAFAALPLQ---  104
DSSP  HHLLEEEEEEEELLlhhhhlLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLL---


DSSP  LHHHHHHHHHHHHHLLLLLEEEELLLLL-llllLLLLLLLHHHHHHHHHHHHHLLLEEEL
Query DPKTCIPELEKCVKEYGFVAINLNPDPS-gghwTSPPLTDRIWYPIYEKXVELEIPAXIH  171
ident ||     ||  ||   |||    |         |          |       |  |   |
Sbjct DPDAATEELQRCVNDLGFVGALVNGFSQegdgqTPLYYDLPQYRPFWGEVEKLDVPFYLH  164
DSSP  LHHHHHHHHHHHHHLLLLLEEEEELLLLlllllLLLLLLLHHHHHHHHHHHHHLLLEEEE


DSSP  LLL------------------LLHHHHHHHHHHHHHHHLLHHHHLLLLLEEELHHHLLLH
Query VST------------------GAHYLNADTTAFXQCVAGDLFKDFPELKFVIPHGGGAVP  213
ident                                      |  ||   | |     | |   |
Sbjct PRNplpqdsriydghpwllgpTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLP  224
DSSP  LLLllhhhlhhhlllhhhlhhHLHHHHHHHHHHHHHHHLLHHHHLLLLLEEELHHHLLHH


DSSP  HHHHHHHH----hhhHLLL---LLHHHHLLLLEEEELL-LLLHHHHHHHHHHLLHHHEEL
Query YHWGRFRG----laqEXKK---PLLEDHVLNNIFFDTC-VYHQPGIDLLNTVIPVDNVLF  265
ident |   |                     |    |    |               |  |  ||
Sbjct YMMWRIDHrnawvklPPRYpakRRFMDYFNENFHITTSgNFRTQTLIDAILEIGADRILF  284
DSSP  HHHHHHHHlllllllLLLLlllLLHHHHHHHHEEEELLlLLLHHHHHHHHLLLLHHHEEL


DSSP  LLLLLLLLlleelllleellLLHHHHHHLLlLLHHHHHHHHLHHHHHHlhhHHHHhhhhh
Query ASEXIGAVrgidprtgfyydDTKRYIEASTiLTPEEKQQIYEGNARRVyprLDAAlkakg  325
ident                            |           |   ||||             
Sbjct STDWPFEN----------idHASDWFNATS-IAEADRVKIGRTNARRL---FKLD-----  325
DSSP  LLLLLLLL----------hhHHHHHHHHLL-LLHHHHHHHHLHHHHHH---LLLL-----


DSSP  hhll
Query kleh  329
ident     
Sbjct ----  325
DSSP  ----


No 5: Query=2gwgA Sbjct=4qrnA Z-score=27.6

back to top
DSSP  --------------LLEEEEEELLlllHHHHHHHHHHHHHHH--------lhhhlllhhh
Query --------------XIIDIHGHYTtapKALEDWRNRQIAGIK--------dpsvxpkvse   38
ident                 |              |   | |                      
Sbjct smtqdlktggeqgyLRIATEEAFA--tREIIDVYLRMIRDGTadkgmvslwgfyaqspse   58
DSSP  llllllllllllllLLEEEEEEEL--lHHHHHHHHHHHHHLLllhhhhhhhhhhhhlllh


DSSP  llllhhhhhhHHHLLHHHHHHHHLLLEEEEELLL------LLHHHHHHHHHHHHHHHHHH
Query lkisddelqaSIIENQLKKXQERGSDLTVFSPRA------GDFNVSSTWAAICNELCYRV   92
ident              |         | |               |     | |   |      
Sbjct ratqilerllDLGERRIADMDATGIDKAILALTSpgvqplHDLDEARTLATRANDTLADA  118
DSSP  hhhhhhhhhhLLLHHHHHHHHHLLLLEEEEEELLllllllLLHHHHHHHHHHHHHHHHHH


DSSP  HHHLLLLEEEEEELLLLlllLHHHHHHHHHHHHHLLLLLEEEELLLLLlllllLLLLLLH
Query SQLFPDNFIGAAXLPQSpgvDPKTCIPELEKCVKEYGFVAINLNPDPSgghwtSPPLTDR  152
ident  |  || |||          ||     |      | ||  |  |            |   
Sbjct CQKYPDRFIGMGTVAPQ---DPEWSAREIHRGARELGFKGIQINSHTQ-----GRYLDEE  170
DSSP  HHHLLLLEEELLLLLLL---LHHHHHHHHHHHHHLLLLLLEEELLLLL-----LLLLLLH


DSSP  HHHHHHHHHHHHLLLEEELLL-----------------LLLHHHHHHHHHHHHHHHLLHH
Query IWYPIYEKXVELEIPAXIHVS-----------------TGAHYLNADTTAFXQCVAGDLF  195
ident    ||    ||   |  ||                                        |
Sbjct FFDPIFRALVEVDQPLYIHPAtspdsmidpmleagldgAIFGFGVETGMHLLRLITIGIF  230
DSSP  HHHHHHHHHHHHLLLEEELLLlllllllhhhhhhllllLLLHHHHHHHHHHHHHHHHLHH


DSSP  HHLLLLLEEELHHHLLLHHHHHHHHHHHHHLL-----------LLLHHHHLLLLEEEELL
Query KDFPELKFVIPHGGGAVPYHWGRFRGLAQEXK-----------KPLLEDHVLNNIFFDTC  244
ident    | |     | | | ||   |     |              |   |     |      
Sbjct DKYPSLQIMVGHMGEALPYWLYRLDYMHQAGVrsqryermkplKKTIEGYLKSNVLVTNS  290
DSSP  HHLLLLLEEELHHHHLHHHHHHHHHHHHHHHHhllllllllllLLLHHHHHHHLEEEELL


DSSP  -LLLHHHHHHHHHHLLHHHEELLLLLLLLLlleelllleELLLlHHHHHHLLlLLHHHHH
Query -VYHQPGIDLLNTVIPVDNVLFASEXIGAVrgidprtgfYYDDtKRYIEASTiLTPEEKQ  303
ident  |   | |     |   | |  |                  |   |   |        | 
Sbjct gVAWEPAIKFCQQVMGEDRVMYAMDYPYQY---------VADE-VRAMDAMD-MSAQTKK  339
DSSP  lLLLHHHHHHHHHHHLHHHEELLLLLLLLL---------LHHH-HHHHHLLL-LLHHHHH


DSSP  HHHLHHHHHHLHHhhhhhhhhhhhll
Query QIYEGNARRVYPRldaalkakgkleh  329
ident      ||                   
Sbjct KFFQTNAEKWFKL-------------  352
DSSP  HHHLHHHHHHLLL-------------


No 6: Query=2gwgA Sbjct=4dziC Z-score=21.5

back to top
DSSP  ----LLEEEEEELLlLLHHH----------hhHHHH----------HHHHH---------
Query ----XIIDIHGHYTtAPKAL----------edWRNR----------QIAGI---------   27
ident       ||   ||   |                                           
Sbjct alnyRVIDVDNHYY-EPLDSftrhldkkfkrrGVQMlsdgkrtwavIGDRVnhfipnptf   59
DSSP  llllLEEEEEEELL-LLLLLllllllhhhlllLEEEeelllleeeeELLEElllllllll


DSSP  ------------------hlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEE
Query ------------------kdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVFS   69
ident                                                   |         
Sbjct dpiivpgcldllfrgeipdgvdpaslmkverladhpeyqNRDA-RIAVMDEQDIETAFML  118
DSSP  lleelllllhhhhhllllllllhhhllleelhhhlhhhlLHHH-HHHHHHHHLEEEEEEE


DSSP  LLL---------LLHHHHHHHHHHHHHHHHHHHH--HLLLLEEEEEELLLLlllLHHHHH
Query PRA---------GDFNVSSTWAAICNELCYRVSQ--LFPDNFIGAAXLPQSpgvDPKTCI  118
ident |            |           |                | |         ||    
Sbjct PTFgcgveealkHDIEATMASVHAFNLWLDEDWGfdRPDHRIIAAPIVSLA---DPTRAV  175
DSSP  LLHhhhhhhhllLLHHHHHHHHHHHHHHHHHHLLllLLLLLEEELLLLLLL---LHHHHH


DSSP  HHHHHHHHLlLLLEEEEL-LLLLllllLLLLLLLHHHHHHHHHHHHHLLLEEELLL----
Query PELEKCVKEyGFVAINLN-PDPSgghwTSPPLTDRIWYPIYEKXVELEIPAXIHVS----  173
ident  |        |                    | ||   |      |   |   | |    
Sbjct EEVDFVLAR-GAKLVLVRpAPVP-glvKPRSLGDRSHDPVWARLAEAGVPVGFHLSdsgy  233
DSSP  HHHHHHHHL-LLLLEELLlLLLL-lllLLLLLLLHHHHHHHHHHHHHLLLEEEELLllll


DSSP  ----------------LLLHhHHHHHHHHHHHHHLLHHHHLLLLLEEEL-HHHLLLHHHH
Query ----------------TGAHyLNADTTAFXQCVAGDLFKDFPELKFVIP-HGGGAVPYHW  216
ident                        |             |   | || |    |   |    
Sbjct lhiaaawggakdpldqVLLD-DRAIHDTMASMIVHGVFTRHPKLKAVSIeNGSYFVHRLI  292
DSSP  hhhhhhllllllhhhhHHHL-LHHHHHHHHHHHHLLHHHHLLLLLEEEElLLLLHHHHHH


DSSP  HHHHHHHHHLL---lLLHHHHLLLLEEEElLLLLhHHHHHHHHHLLHHHEELLLLLLLLL
Query GRFRGLAQEXK---kPLLEDHVLNNIFFDtCVYHqPGIDLLNTVIPVDNVLFASEXIGAV  273
ident  |    |                ||       |       |  || ||  || |      
Sbjct KRLKKAANTQPqyfpEDPVEQLRNNVWIA-PYYE-DDLPELARVIGVDKILFGSDWPHGE  350
DSSP  HHHHHHHHHLHhhllLLHHHHHHHHEEEL-LLLL-LLHHHHHHHHLHHHLLLLLLLLLLL


DSSP  lleelllleeLLLLHHHHHHLLLLLHHHHHHHHLHHHHHHLHHhhhhhhhhhhhll
Query rgidprtgfyYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRldaalkakgkleh  329
ident                                |   ||                   
Sbjct ---------gLASPVSFTAELKGFSESDIRKIMRDNALDLLGV---------qvgs  388
DSSP  ---------lLLLHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL---------llll


No 7: Query=2gwgA Sbjct=3cjpA Z-score=19.9

back to top
DSSP  LLEEEEEELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHH
Query XIIDIHGHYTTapkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQE   60
ident  ||| | |                                               |   |
Sbjct LIIDGHTHVIL-------------------------------------PVEK-HIKIMDE   22
DSSP  LLEEEEEELLL-------------------------------------LHHH-HHHHHHH


DSSP  HLLLEEEEELLL------------------------llhhHHHHHHHHHHHHHHHHHHHL
Query RGSDLTVFSPRA------------------------gdfnVSSTWAAICNELCYRVSQLF   96
ident  | | |                                                 | |  
Sbjct AGVDKTILFSTSihpetavnlrdvkkemkklndvvngktnSMIDVRRNSIKELTNVIQAY   82
DSSP  HLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhlllllLLHHHHHHHHHHHHHHHHHL


DSSP  LLLEEEEEELLLlllLLHH-HHHHHHHHHHHLLLLLEEE-ELLLlllllllLLLLLlhHH
Query PDNFIGAAXLPQspgVDPK-TCIPELEKCVKEYGFVAIN-LNPDpsgghwtSPPLTdrIW  154
ident |    |    |               |        | |  | |        |        
Sbjct PSRYVGFGNVPV---GLSEnDTNSYIEENIVNNKLVGIGeLTPA-------SGQIK--SL  130
DSSP  LLLEEEEELLLL---LLLHhHHHHHHHHHLLLLLLLEEEeELLL-------LLLHH--HH


DSSP  HHHHHHHHH-HLLLEEELlllllhHHHHhHHHHHHHHhlLHHHHLLLLLEEELHHHLLLH
Query YPIYEKXVE-LEIPAXIHvstgahYLNAdTTAFXQCVagDLFKDFPELKFVIPHGGGAVP  213
ident  ||          |  ||                      | | ||       | ||   
Sbjct KPIFKYSMDsGSLPIWIH-----aFNPLvLQDIKEIA--ELCKAFPKVPVILGHMGGSNW  183
DSSP  HHHHHHHHHlLLLLEEEL-----lLLLLlHHHHHHHH--HHHHHLLLLLEEEHHHHHHHH


DSSP  HHhhhhhhhhhhlllllHHHHLlLLEEEELL-LLLHHHHHHHHHHlLHHHEELLLLLLLL
Query YHwgrfrglaqexkkplLEDHVlNNIFFDTC-VYHQPGIDLLNTViPVDNVLFASEXIGA  272
ident                  |      |   ||                      |       
Sbjct MT------------aveLAKEI-QNLYLDTSaYFSTFVLKIVINE-LPLKCIFGTDMPFG  229
DSSP  HH------------hhhHHHHL-LLEEEELLlLLLHHHHHHHHHH-LLLLEELLLLLLLL


DSSP  LlleelllleellLLHHHHHHLlLLLHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll
Query VrgidprtgfyydDTKRYIEAStILTPEEKQQIYEGNARRVYPrldaalkakgkleh  329
ident                   |                 |  |                 
Sbjct D----------lqLSIEAIKKM-SNDSYVANAVLGDNISRLLN-------------i  262
DSSP  L----------hhHHHHHHHHH-LLLHHHHHHHHLHHHHHHHL-------------l


No 8: Query=2gwgA Sbjct=2ffiA Z-score=19.0

back to top
DSSP  ---LLEEEEEELlLLLHHHH-HHHHhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHH
Query ---XIIDIHGHYtTAPKALE-DWRNrqiagikdpsvxpkvselkisddelqaSIIEnQLK   56
ident      || | |            |                                  | 
Sbjct lhlTAIDSHAHV-FSRGLNLaSQRR--------------------yapnydaPLGD-YLG   38
DSSP  lllLLEELLLLL-LLHHHHHhLLLL--------------------lllllllLHHH-HHH


DSSP  HHHHHLLLEEEEELLLllhhhhhhHHHHhHHHHHHHHHHLLLLEEEEEELLllllllHHH
Query KXQERGSDLTVFSPRAgdfnvsstWAAIcNELCYRVSQLFPDNFIGAAXLPqspgvdPKT  116
ident      |    |                  |       |  |    |  ||          
Sbjct QLRAHGFSHGVLVQPS-------fLGTD-NRYLLSALQTVPGQLRGVVXLE------RDV   84
DSSP  HHHHLLLLEELLLLLH-------hHLLL-LHHHHHHHHHLLLLLLLLLLLL------LLL


DSSP  HHHHHHHHHHlLLLLEEEELLLllLLLLllLLLLLHHHHHHHHHHHHHLLLEEELlllll
Query CIPELEKCVKeYGFVAINLNPDpsGGHWtsPPLTDRIWYPIYEKXVELEIPAXIHvstga  176
ident     |       |     ||    |     | ||   | |  |   |       |     
Sbjct EQATLAEXAR-LGVRGVRLNLX--GQDX--PDLTGAQWRPLLERIGEQGWHVELH-----  134
DSSP  LHHHHHHHHL-LLLLEEELLLL--LLLL--LLLLLLLLHHHHHHHHHHLLEEEEL-----


DSSP  hhhhHHHHHHHHHhhLLHHhHLLLlLEEELHHHLL-lhHHHHHHhhhhhhlllllHHHHL
Query hylnADTTAFXQCvaGDLFkDFPElKFVIPHGGGA-vpYHWGRFrglaqexkkplLEDHV  235
ident                  |         || | |        |             |    
Sbjct ----RQVADIPVL-vRALQ-PYGL-DIVIDHFGRPdarRGLGQP------gfaelLTLSG  181
DSSP  ----LLLLLHHHH-hHHHL-LLLL-LEEELHHHLLlllLLLLLL------lhhhhLLLLL


DSSP  LLLEEEELLLL---------LHHHHHHHHHHLL----HHHEELLLLLLLL-LLLEellll
Query LNNIFFDTCVY---------HQPGIDLLNTVIP----VDNVLFASEXIGA-VRGIdprtg  281
ident                                             |               
Sbjct RGKVWVKVSGIyrlqgspeeNLAFARQALCALEahygAERLXWGSDWPHTqHESE-----  236
DSSP  LLLEEEEEELHhhllllhhhHHHHHHHHHHHHHhhllHHHEEEELLLLLLlLLLL-----


DSSP  eELLL-LHHHHHHLLlLLHHHHHHHHLHHHHHHLhhHHHHHhhhhhhll
Query fYYDD-TKRYIEASTiLTPEEKQQIYEGNARRVYprLDAALkakgkleh  329
ident            ||         |      ||                  
Sbjct -VSFGsAVEQFEALG-CSAQLRQALLLDTARALF--GFELE--------  273
DSSP  -LLHHhHHHHHHHHL-LLHHHHHHHHLHHHHHHL--LLLLL--------


No 9: Query=2gwgA Sbjct=4dlfA Z-score=18.3

back to top
DSSP  -LLEEEEEElLLLLhhhHHHHhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHH
Query -XIIDIHGHyTTAPkalEDWRnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQ   59
ident    || | |                                                   
Sbjct aLRIDSHQH-FWRY---RAAD-------------ypwigagmgvlardyLPDA-LHPLMH   42
DSSP  lLLEEEEEL-LLLL---LHHH-------------llllllllhhhllllLHHH-HHHHHH


DSSP  HHLLLEEEEELLLllhhhhhhhHHHHHHHHHHHHHHlLLLE-EEEEELLLllllLHHHHH
Query ERGSDLTVFSPRAgdfnvsstwAAICNELCYRVSQLfPDNF-IGAAXLPQspgvDPKTCI  118
ident                                                             
Sbjct AQALGASIAVQAR--------aGRDETAFLLELACD-EARIaAVVGWEDL----RAPQLA   89
DSSP  HLLLLEEEEELLL--------lLHHHHHHHHHHHLL-LLLEeEEEELLLL----LLLLHH


DSSP  HHHHHHhHLLLLLEEEELLLllLLLLllLLLLLHHHHHHHHHHHHHLLLEEELlllllhh
Query PELEKCvKEYGFVAINLNPDpsGGHWtsPPLTDRIWYPIYEKXVELEIPAXIHvstgahy  178
ident                                 |                           
Sbjct ERVAEW-RGTKLRGFRHQLQ--DEADvrAFVDDADFARGVAWLQANDYVYDVL-------  139
DSSP  HHHHLL-LLLLEEEEEELHH--HLLLhhHHHHLHHHHHHHHHHHHLLLEEEEL-------


DSSP  hhHHHHHHHHHHhlLHHHHLLLLLEEELHHHLL-------------lHHHHhhhhhhhhh
Query lnADTTAFXQCVagDLFKDFPELKFVIPHGGGA-------------vPYHWgrfrglaqe  225
ident                          |  | |                             
Sbjct --VFERQLPDVQ--AFCARHDAHWLVLDHAGKPalaefdrddtalarWRAA---------  186
DSSP  --LLHHHHHHHH--HHHHHLLLLLEEEHHHHLLlhhhllllllhhhhHHHH---------


DSSP  llllLHHHhlLLLEEEELLLL-----------------LHHHHHHHHHHLLHHHEELLLL
Query xkkpLLEDhvLNNIFFDTCVY-----------------HQPGIDLLNTVIPVDNVLFASE  268
ident      |    |                                |            | | 
Sbjct --lrELAA--LPHVVCKLSGLvteadwrrglrasdlrhIEQCLDAALDAFGPQRLMFGSD  242
DSSP  --hhHHHL--LLLEEEEELLLlllllllllllhhhhhhHHHHHHHHHHHHLHHHEEELLL


DSSP  LLLLLLLeelllleELLL-LHHHHHHL--LLLLHHHHHHHHLHHHHHHLHHHhhhhhhhh
Query XIGAVRGidprtgfYYDD-TKRYIEAS--TILTPEEKQQIYEGNARRVYPRLdaalkakg  325
ident                  |      |      |   |      | | | |           
Sbjct WPVCLLA-------ASYDeVASLVERWaeSRLSAAERSALWGGTAARCYALP--------  287
DSSP  LLHHHHL-------LLHHhHHHHHHHHhhHHLLHHHHHHHLLHHHHHHLLLL--------


DSSP  hhll
Query kleh  329
ident     
Sbjct ----  287
DSSP  ----


No 10: Query=2gwgA Sbjct=3irsA Z-score=18.3

back to top
DSSP  -LLEEEEEELLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHLLhHHHHH
Query -XIIDIHGHYTTApkaledwrnrqiagikdpsvxpkvselkisddelqASIIENqLKKXQ   59
ident   |||                                            |          
Sbjct lKIIDFRLRPPAM----gflnariytrpdirnrftrqlgfepapsaeeKSLELM-FEEMA   55
DSSP  lLLEELLLLLLLH----hhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHH-HHHHH


DSSP  HHLLLEEEEELLlllhhhhhhhhhHHHHHHHHHHHHLLLLEEEEEELLLlllLLHHHHHH
Query ERGSDLTVFSPRagdfnvsstwaaICNELCYRVSQLFPDNFIGAAXLPQspgVDPKTCIP  119
ident   |    |   |              |     |    || |              |    
Sbjct AAGIEQGVCVGR-----nssvlgsVSNADVAAVAKAYPDKFHPVGSIEA---ATRKEAMA  107
DSSP  HLLLLEEEEELL-----eellleeLLHHHHHHHHHHLLLLEEEEEELLL---LLHHHHHH


DSSP  HHHHHHhLLLLLEEEEL-LLLLllllLLLLLLLHHHHHHHHHHHHHLLLEEELlllllhH
Query ELEKCVkEYGFVAINLN-PDPSgghwTSPPLTDRIWYPIYEKXVELEIPAXIHvstgahY  178
ident          |    ||          |     ||  || |       ||           
Sbjct QMQEIL-DLGIRIVNLEpGVWA----TPMHVDDRRLYPLYAFCEDNGIPVIMM-----tG  157
DSSP  HHHHHH-HLLLLLEEELhHHLL----LLLLLLLHHHHHHHHHHHHLLLLEEEE-----lL


DSSP  HHH----hhHHHHHHHhlLHHHHLLLLLEEELHHHLLLHHHhhhhhhhhhhllllLHHHH
Query LNA----dtTAFXQCVagDLFKDFPELKFVIPHGGGAVPYHwgrfrglaqexkkpLLEDH  234
ident  ||      |            ||| |  |  ||                          
Sbjct GNAgpdityTNPEHID--RVLGDFPDLTVVSSHGNWPWVQE------------iiHVAFR  203
DSSP  LLLlllhhhHLHHHHH--HHHHHLLLLLEEEEHHHLLLHHH------------hhHHHHH


DSSP  LlLLEEEELL--LLLHHHHHHHHHHL---LHHHEELLLLLlLLLLleelllleellLLHH
Query VlNNIFFDTC--VYHQPGIDLLNTVI---PVDNVLFASEXiGAVRgidprtgfyydDTKR  289
ident    |         |  ||             |  ||                        
Sbjct R-PNLYLSPDmyLYNLPGHADFIQAAnsfLADRMLFGTAY-PMCP---------lkEYTE  252
DSSP  L-LLEEEELHhhHLLLLLHHHHHHHHllhHHHLLLLLLLL-LLLL---------hhHHHH


DSSP  HHHHLlLLLHHHHHHHHLHHHHHHLHHHhhhhhhhhhhll
Query YIEAStILTPEEKQQIYEGNARRVYPRLdaalkakgkleh  329
ident          |     |  ||| |                 
Sbjct WFLTL-PIKPDAMEKILHGNAERLLAQA----------gr  281
DSSP  HHHLL-LLLHHHHHHHHLHHHHHHHHHL----------ll


No 11: Query=2gwgA Sbjct=4mupB Z-score=17.2

back to top
DSSP  ----------------LLEEEEEELlLLLHhHHHHHhhhhhhhhlhhhlllhhhllllhh
Query ----------------XIIDIHGHYtTAPKaLEDWRnrqiagikdpsvxpkvselkisdd   44
ident                    |   |    |                               
Sbjct lvrklsgtapnpafprGAVDTQMHM-YLPGyPALPG------------------gpglpp   41
DSSP  llllllllllllllllLLEELLLLL-LLLLlLLLLL------------------llllll


DSSP  hhhhHHHLlHHHHHHHHLLLEEEEELLLllhhhhhhHHHHhHHHHHHHHHHLLLLEEEEE
Query elqaSIIEnQLKKXQERGSDLTVFSPRAgdfnvsstWAAIcNELCYRVSQLFPDNFIGAA  104
ident               |  | |                     |                  
Sbjct galpGPED-YRRLMQWLGIDRVIITQGN-------aHQRD-NGNTLACVAEMGEAAHAVV   92
DSSP  llllLHHH-HHHHHHHHLLLEEEEELLH-------hHLLL-LHHHHHHHHHHHHHEEEEE


DSSP  ELlllllllHHHHH-HHHHHHHHlLLLLEEEELLLLllllllllllllHHHHHHHHHHHH
Query XLpqspgvdPKTCI-PELEKCVKeYGFVAINLNPDPsgghwtsppltdRIWYPIYEKXVE  163
ident            |      ||     | |       |                   |    
Sbjct II-------DATTTeKDMEKLTA-AGTVGARIMDLP------ggavnlSELDAVDERAHA  138
DSSP  LL-------LLLLLhHHHHHHHH-LLEEEEEEELLL------lllllhHHHHHHHHHHHH


DSSP  HLLLEEELlllllhhhhHHHHHHHHHHhLLHHhhLLLLLEEELHHHLL-lhHHHHHHHhh
Query LEIPAXIHvstgahylnADTTAFXQCVaGDLFkdFPELKFVIPHGGGA-vpYHWGRFRgl  222
ident                   |           |         |  | |              
Sbjct ADWMVAVQ---------FDGNGLLDHL-PRLQ--KIRSRWVFDHHGKFfkgIRTDGPE--  184
DSSP  LLLEEEEE---------LLHHHHHHHH-HHHH--LLLLEEEELHHHHLlllLLLLLHH--


DSSP  hhhlllllHHHHLL--LLEEEELLLLL--------HHHHHHHHHHL---LHHHEELLLLL
Query aqexkkplLEDHVL--NNIFFDTCVYH--------QPGIDLLNTVI---PVDNVLFASEX  269
ident                  |  |                       ||              
Sbjct ------maALLKLIdrGNLWFKFAGVYessrkswpYADVAAFSRVIaahAPERIVWGTNW  238
DSSP  ------hhHHHHHHhhLLEEEEELLHHhlllllllLHHHHHHHHHHhhhLHHHEEELLLL


DSSP  LLLLLLEELllLEELLL-LHHHHHHLllLLHHHHHHHHLHHHHHHLHhhHHHHhhhhhhl
Query IGAVRGIDPrtGFYYDD-TKRYIEAStiLTPEEKQQIYEGNARRVYPrlDAALkakgkle  328
ident                |                        |                   
Sbjct PHNSVRETA--AYPDDArLAELTLGW-lPDEAARHRALVENPEALFK--LSPV-------  286
DSSP  LLLLLLLHH--HLLLHHhHHHHHHLL-lLLHHHHHHHHLHHHHHHHL--LLLL-------


DSSP  l
Query h  329
ident  
Sbjct -  286
DSSP  -


No 12: Query=2gwgA Sbjct=2y1hB Z-score=16.8

back to top
DSSP  --LLEEEEEE-LLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHLLhHHH
Query --XIIDIHGH-YTTApkaledwrnrqiagikdpsvxpkvselkisddelqASIIENqLKK   57
ident      | | |                                               | |
Sbjct gvGLVDCHCHlSAPD---------------------------------fdRDLDDV-LEK   26
DSSP  llLEEEEEELlLLHH---------------------------------hlLLHHHH-HHH


DSSP  HHHHLLLEEEEELLlllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEEEL--------llL
Query XQERGSDLTVFSPRagdfnvsstwAAICNELCYRVSQLFPDNFIGAAXL--------pqS  109
ident          |                   |     |                        
Sbjct AKKANVVALVAVAE----------HSGEFEKIMQLSERYNGFVLPCLGVhpvqgldqrsV   76
DSSP  HHHLLEEEEEELLL----------LHHHHHHHHHHHHHLLLLEEEEELLlleelllleeL


DSSP  LLLLHHHHHHHHHHHHHllLLLEE-EELLL---lLLLL-LLLLlllLHHHHHHHHHHHHH
Query PGVDPKTCIPELEKCVKeyGFVAI-NLNPD---pSGGH-WTSPpltDRIWYPIYEKXVEL  164
ident    |     |  |         ||     |      |                      |
Sbjct TLKDLDVALPIIENYKD--RLLAIgEVGLDfsprFAGTgEQKE-eqRQVLIRQIQLAKRL  133
DSSP  LHHHHHHHHHHHHHHLL--LLLEEeEEEEEllllLLLLhHHHH-hhHHHHHHHHHHHHHH


DSSP  LLLEEELlllllhhhhhHHHHHHHHHHllHHHHLlLLLEEELHhHLLLHHhhhhhhhhhh
Query EIPAXIHvstgahylnaDTTAFXQCVAgdLFKDFpELKFVIPHgGGAVPYhwgrfrglaq  224
ident   |   |             |        |       |          |           
Sbjct NLPVNVH----------SRSAGRPTIN-lLQEQG-AEKVLLHA-FDGRPS----------  170
DSSP  LLLEEEE----------EELLHHHHHH-hHHHLL-LLLEEEEL-LLLLHH----------


DSSP  hlllllhhHHLL-LLEEEELLLLLH--HHHHHHHHHLLHHHEELLLLLLLLLLLEellll
Query exkkplleDHVL-NNIFFDTCVYHQ--PGIDLLNTVIPVDNVLFASEXIGAVRGIdprtg  281
ident                 ||              |    |                      
Sbjct ------vaMEGVrAGYFFSIPPSIIrsGQKQKLVKQLPLTSICLETDSPALGPEK--qvr  222
DSSP  ------hhHHHHhLLLEEEELHHHHllHHHHHHHHHLLHHHEEELLLLLLLLLLL--lll


DSSP  eellLLHHHHHH-LLLL---LHHHHHHHhLHHHHHHLHHHHHHHhhhhhhll
Query fyydDTKRYIEA-STIL---TPEEKQQIyEGNARRVYPRLDAALkakgkleh  329
ident           |           |        ||    | |   |        
Sbjct nepwNISISAEYiAQVKgisVEEVIEVT-TQNALKLFPKLRHLL--------  265
DSSP  llhhHHHHHHHHhHHHHlllHHHHHHHH-HHHHHHHLLLHHHHL--------


No 13: Query=2gwgA Sbjct=1itqA Z-score=15.8

back to top
DSSP  --------------LLEEEEEE-LLLL--LHHHhhhhhhhhhhhhlhhhlllhhhllLLH
Query --------------XIIDIHGH-YTTA--PKALedwrnrqiagikdpsvxpkvselkISD   43
ident                 || |                                        
Sbjct dffrdeaerimrdsPVIDGHNDlPWQLldMFNN------------------------RLQ   36
DSSP  lhhhhhhhhhhlllLEEEEEELhHHHHhhHHLL------------------------LLL


DSSP  HHhhHHHHL-----LHHHHHHHHLLLEEEEELLL---lLHHHHHHHHHHHHHHHHHHHH-
Query DElqASIIE-----NQLKKXQERGSDLTVFSPRA---gDFNVSSTWAAICNELCYRVSQ-   94
ident ||  |             |           |                        |    
Sbjct DE-rANLTTlagthTNIPKLRAGFVGGQFWSVYTpcdtQNKDAVRRTLEQMDVVHRMCRm   95
DSSP  LH-hHLLLLlllllLLHHHHHHLLEEEEEEEELLlhhhLLLLHHHHHHHHHHHHHHHHHh


DSSP  ----HLLL---------------LEEEEEE--LLLLllllhhHHHHHHHHHHHlLLLLEE
Query ----LFPD---------------NFIGAAX--LPQSpgvdpkTCIPELEKCVKeYGFVAI  133
ident                                                |       |    
Sbjct ypetFLYVtssagirqafregkvASLIGVEggHSID------SSLGVLRALYQ-LGMRYL  148
DSSP  llllEEELllhhhhhhhhhllleEEEEEEElhHHLL------LLHHHHHHHHH-LLEEEE


DSSP  EELLLLL-----------lLLLLLLLLLLHHHHHHHHHHHHHLLLEEELLllllhhhhhh
Query NLNPDPS-----------gGHWTSPPLTDRIWYPIYEKXVELEIPAXIHVstgahylnad  182
ident  |                                       |                  
Sbjct TLTHSCNtpwadnwlvdtgDSEPQSQGLSPFGQRVVKELNRLGVLIDLAH----------  198
DSSP  ELLLLLLllllllhhhlllLLLLLLLLLLHHHHHHHHHHHHHLLEEELLL----------


DSSP  hhHHHHHhhLLHHHHLlLLLEEE-LHHHlLLHHHhhhhhhhhhhllllLHHHHLL-LLEE
Query ttAFXQCvaGDLFKDFpELKFVI-PHGGgAVPYHwgrfrglaqexkkpLLEDHVL-NNIF  240
ident                                                      |      
Sbjct --VSVAT-mKATLQLS-RAPVIFsHSSA-YSVCA-------srrnvpdDVLRLVKqTDSL  246
DSSP  --LLHHH-hHHHHHHL-LLLLEElLLLL-LLLLL-------llllllhHHHHHHHhHLLE


DSSP  EELLLL----------LHHHHHHHHHHLL----HHHEELLLLLLLLLLLEEllllEELL-
Query FDTCVY----------HQPGIDLLNTVIP----VDNVLFASEXIGAVRGIDprtgFYYD-  285
ident      |                     |        | |     |  |          | 
Sbjct VMVNFYnnyisctnkaNLSQVADHLDHIKevagARAVGFGGDFDGVPRVPE----GLEDv  302
DSSP  EEELLLhhhhllllllLHHHHHHHHHHHHhhllHHHEEELLLLLLLLLLLL----LLLLl


DSSP  -LLHHHHHHL--LLLLHHHHHHHHLHHHHHHLH--------------------hhhhhhh
Query -DTKRYIEAS--TILTPEEKQQIYEGNARRVYP--------------------rldaalk  322
ident       |        |  |       |  ||                             
Sbjct sKYPDLIAELlrRNWTEAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscr  362
DSSP  lLHHHHHHHHhhLLLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhllllll


DSSP  hhhhhll
Query akgkleh  329
ident        
Sbjct thygyss  369
DSSP  lllllll


No 14: Query=2gwgA Sbjct=2ob3A Z-score=14.9

back to top
DSSP  ---------------LLEEEEEELL----llLHHHhhhhhhhhhhhhlhhhlllhhhlll
Query ---------------XIIDIHGHYT----taPKALedwrnrqiagikdpsvxpkvselki   41
ident                     | |          |                          
Sbjct drintvrgpitiseaGFTLTHEHICgssagfLRAW-----------------------pe   37
DSSP  lleeelleeelhhhhLLEEEEELLEellllhHHHL-----------------------hh


DSSP  lhHHHHHHHHLLhHHHHHHHL---LLEEEEELllllhhhhhhhHHHHHhhHHHHHHHLL-
Query sdDELQASIIENqLKKXQERG---SDLTVFSPragdfnvsstwAAICNelCYRVSQLFP-   97
ident       |                     |                |              
Sbjct ffGSRKALAEKA-VRGLRRARaagVRTIVDVS----------tFDIGR--DVSLLAEVSr   84
DSSP  hhLLHHHHHHHH-HHHHHHHHhllLLEEEELL----------lHHHLL--LHHHHHHHHh


DSSP  ---LLEEEEEEL-----llLLLLLHHHHHHHHHHHHHL------LLLLEEEELLLlllll
Query ---DNFIGAAXL-----pqSPGVDPKTCIPELEKCVKE------YGFVAINLNPDpsggh  143
ident         |  |                                     |          
Sbjct aadVHIVAATGLwfdpplsMRLRSVEELTQFFLREIQYgiedtgIRAGIIXVATT----g  140
DSSP  hhlLEEELEEELlllllhhHHLLLHHHHHHHHHHHHHLllllllLLLLEEEEELL----l


DSSP  LLLLlllLHHH-HHHHHHHHHHLLLEEELlllllhhhhHHHH-HHHHHhhLLHHHHLLLL
Query WTSPpltDRIW-YPIYEKXVELEIPAXIHvstgahylnADTT-AFXQCvaGDLFKDFPEL  201
ident    |                    |   |         |       |             
Sbjct KATP--fQELVlKAAARASLATGVPVTTH--------tAASQrDGEQQ-aAIFESEGLSP  189
DSSP  LLLH--hHHHHhHHHHHHHHHHLLLEEEE--------lLHHHlHHHHH-hHHHHHLLLLH


DSSP  -LEEELHHHLLlhHHHHhhhhhhhhlllllhhhHLLL-LEEEE-LLLL------------
Query -KFVIPHGGGAvpYHWGrfrglaqexkkplledHVLN-NIFFD-TCVY------------  246
ident     | |                                                     
Sbjct sRVCIGHSDDT--DDLS-------------yltALAArGYLIGlDHIPysaiglednasa  234
DSSP  hHEEELLHHHL--LLHH-------------hhhHHHHlLLEEEeLLLLlllllllllhhh


DSSP  --------LHHHHHHHHHHL---LHHHEELLLLLL-----------llLLLEellllEEL
Query --------HQPGIDLLNTVI---PVDNVLFASEXI-----------gaVRGIdprtgFYY  284
ident          |    |    |        |                               
Sbjct sallgirsWQTRALLIKALIdqgYMKQILVSNDWTfgfssyvtnimdvMDRV-----NPD  289
DSSP  hhhhllllHHHHHHHHHHHHhllLHHHEEELLLLLleellllllhhhhHHHH-----LLL


DSSP  L--LLHH-HHHHL--LLLLHHHHHHHHLHHHHHHLHHhhhhhhhhhhhll
Query D--DTKR-YIEAS--TILTPEEKQQIYEGNARRVYPRldaalkakgkleh  329
ident          |          |    |   |  |                 
Sbjct GmaFIPLrVIPFLreKGVPQETLAGITVTNPARFLSP----------tlr  329
DSSP  HhhHHHHlHHHHHhhLLLLHHHHHHHHLHHHHHHHLL----------lll


No 15: Query=2gwgA Sbjct=4b3zD Z-score=14.8

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------XIIDIHG    7
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEEEEEE


DSSP  ELLLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHlLHHHHHHHHLLLEEE
Query HYTTAPkaledwrnrqiagikdpsvxpkvselkisddelqASIIeNQLKKXQERGSDLTV   67
ident                                                       |     
Sbjct YLQKTA---------------------------------aDDFF-QGTRAALVGGTTMII   86
DSSP  LLLLLL---------------------------------lLLHH-HHHHHHHHLLEEEEE


DSSP  EELLlllhhHHHHHHHHHHHHHHHHHHHLL-LLEEEEEELLLLllllhhHHHHHHHHHHH
Query FSPRagdfnVSSTWAAICNELCYRVSQLFP-DNFIGAAXLPQSpgvdpkTCIPELEKCVK  126
ident                    |                                 |||  | 
Sbjct DHVV----pEPGSSLLTSFEKWHEAADTKScCDYSLHVDITSW----ydGVREELEVLVQ  138
DSSP  EEEL----lLLLLLHHHHHHHHHHHHHLLLlLEEEEEEELLLL----llLHHHHHHHHHH


DSSP  LLLLLEEEELLLLLLLllllllllLHHHHHHHHHHHHHLLLEEEL---------------
Query EYGFVAINLNPDPSGGhwtsppltDRIWYPIYEKXVELEIPAXIH---------------  171
ident   |                     |   |        |      |               
Sbjct DKGVNSFQVYMAYKDV----yqmsDSQLYEAFTFLKGLGAVILVHaengdliaqeqkril  194
DSSP  LLLLLEEEEELLLLLL----llllHHHHHHHHHHHHHHLLEEEEElllhhhhhhhhhhhh


DSSP  --------lllllhhhhhHHHHHHHHhhlLHHHHLLlLLEEELHHHL-LLHHhhhhhhhh
Query --------vstgahylnaDTTAFXQCvagDLFKDFPeLKFVIPHGGG-AVPYhwgrfrgl  222
ident                      |                   |                  
Sbjct emgitgpeghalsrpeelEAEAVFRA--iTIAGRIN-CPVYITKVMSkSAAD--------  243
DSSP  hllllllhhhhhhllhhhHHHHHHHH--hHHHHHHL-LLEEEEEELLhHHHH--------


DSSP  hhhlllllHHHHLllLEEEELL--LLLH--------------------------HHHHHH
Query aqexkkplLEDHVlnNIFFDTC--VYHQ--------------------------PGIDLL  254
ident                  |                                       | |
Sbjct ---iialaRKKGP--LVFGEPIaaSLGTdgthywsknwakaaafvtspplspdpTTPDYL  298
DSSP  ---hhhhhHHHLL--LEEEEELhhHHHLllhhhhlllhhhhhhlllllllllllLHHHHH


DSSP  HHHL-LHHHEELLLLLLL-----------------LLLLeelllleellLLHHHHHHL--
Query NTVI-PVDNVLFASEXIG-----------------AVRGidprtgfyydDTKRYIEAS--  294
ident        |     |                                              
Sbjct TSLLaCGDLQVTGSGHCPystaqkavgkdnftlipEGVN-------gieERMTVVWDKav  351
DSSP  HHHHhHLLLLLLLLLLLLllhhhhhhhlllhhhllLLLL-------lllLHHHHHHHHhl


DSSP  --LLLLHHHHHHHHLHHHHHHLHhhHHHH-----hHHHH---------------------
Query --TILTPEEKQQIYEGNARRVYPrlDAAL-----kAKGK---------------------  326
ident                 ||                                          
Sbjct atGKMDENQFVAVTSTNAAKIFN--LYPRkgriavGSDAdvviwdpdklktitakshksa  409
DSSP  llLLLLHHHHHHHHLHHHHHHHL--LLLLllllllLLLLleeeeeeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct veynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkv  469
DSSP  llllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhh


DSSP  -----hll
Query -----leh  329
ident         
Sbjct fglqgvsr  477
DSSP  llllllll


No 16: Query=2gwgA Sbjct=2qpxA Z-score=14.7

back to top
DSSP  ------------LLEEEEEELLLLLH---------------------hhhhhhhhhhhhh
Query ------------XIIDIHGHYTTAPK---------------------aledwrnrqiagi   27
ident                | | |     |                                  
Sbjct gxddlsefvdqvPLLDHHCHFLIDGKvpnrddrlaqvsteadkdypladtknrlayhgfl   60
DSSP  lllllhhhhhhlLEEEEEELLLLLLLlllhhhhhhhhlllllllllhhhhlllhhhhhhh


DSSP  hlhhhlllhhhllllhhhhhhHHHLLhHHHHHHHLLLEEEEELLLllhhhhhhhhhhhhh
Query kdpsvxpkvselkisddelqaSIIENqLKKXQERGSDLTVFSPRAgdfnvsstwaaicne   87
ident                          |                                  
Sbjct alakefaldannplaaxndpgYATYN-HRIFGHFHFKELLIDTGF------------vpd  107
DSSP  hhhhhhllllllllllllhhhHHHHH-HHHHHHLLEEEEEEELLL------------lll


DSSP  hhhHHHHHLL----LLEEEEEE--LLLL--------llllhhHHHHHHHHHHHLlLLLEE
Query lcyRVSQLFP----DNFIGAAX--LPQS--------pgvdpkTCIPELEKCVKEyGFVAI  133
ident                                                        |||  
Sbjct dpiLDLDQTAelvgIPVKAIYRleTHAEdfxlehdnfaawwqAFSNDVKQAKAH-GFVGF  166
DSSP  lllLLHHHHHhhhlLLEEEEEEhhHHHHhhhlllllhhhhhhHHHHHHHLLLLL-LLLLE


DSSP  EELL-LLLL------------------------llLLLLlllLHHHHHHHHHHHHHLLLE
Query NLNP-DPSG------------------------ghWTSPpltDRIWYPIYEKXVELEIPA  168
ident         |                             |   |   |           | 
Sbjct XSIAaYRVGlhlepvnvieaaagfdtwkhsgekrlTSKP-liDYXLYHVAPFIIAQDXPL  225
DSSP  EELHhHHLLlllllllhhhhhhhhhhhhhhlllllLLHH-hhHHHHHHHHHHHHHHLLLE


DSSP  EEL--llLLLHhhHHHHhhHHHHHhlLHHHHL--LLLLEEELHhHLLLHHHhhhhhhhhh
Query XIH--vsTGAHylNADTtaFXQCVagDLFKDF--PELKFVIPHgGGAVPYHwgrfrglaq  224
ident   |                       |  | |    || |  |                 
Sbjct QFHvgygDADTdxYLGN--PLLXR--DYLKAFtkKGLKVVLLH-CYPYHRE---------  271
DSSP  EEEelllLLLLlhHHLL--HHHHH--HHHHHHhhHLLLEEEEE-LLLLHHH---------


DSSP  hlllllhHHHLllLEEEELLLL-------LHHHHHHHHHHLLHHHEELLLLLLLllllee
Query exkkpllEDHVlnNIFFDTCVY-------HQPGIDLLNTVIPVDNVLFASEXIGavrgid  277
ident              |  ||                       |    ||||          
Sbjct --agylaSVFP--NLYFDISLLdnlgpsgASRVFNEAVELAPYTRILFASDAST------  321
DSSP  --hhhhhHHLL--LEEEELLLHhhhlhhhHHHHHHHHLLLLLHHHEELLLLLLL------


DSSP  lllleellLLHHHHHH--LLLL----------LHHHHHHHHLHHHHHHLHhHHHHHHhhh
Query prtgfyydDTKRYIEA--STIL----------TPEEKQQIYEGNARRVYPrLDAALKakg  325
ident            |                           |        |      |    
Sbjct --ypexygLAARQFKQalVAHFnqlpfvdlaqKKAWINAICWQTSAKLYH-QERELR---  375
DSSP  --lhhhhhHHHHHHHHhhHHHHhllllllhhhHHHHHHHHHLHHHHHHLL-LHHHHL---


DSSP  hhll
Query kleh  329
ident     
Sbjct ---v  376
DSSP  ---l


No 17: Query=2gwgA Sbjct=1gkpA Z-score=14.6

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------XIIDIHGH    8
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLLLlhhHHHHhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEE
Query YTTApkaLEDWrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVF   68
ident                                                |     |      
Sbjct IYLP---FMAT-------------------------fakdTHET-GSKAALMGGTTTYIE   91
DSSP  LLLE---ELLE-------------------------elllLHHH-HHHHHHHLLEEEEEE


DSSP  ELLlllhhhHHHHHHHHHHHHHHHHHHL-lLLEEEEEELLLlllllHHHHHHHHHHHHHL
Query SPRagdfnvSSTWAAICNELCYRVSQLF-pDNFIGAAXLPQspgvdPKTCIPELEKCVKE  127
ident              |     |                                 |   |  
Sbjct MCC----psRNDDALEGYQLWKSKAEGNsyCDYTFHMAVSK----fDEKTEGQLREIVAD  143
DSSP  EEL----llLLLLHHHHHHHHHHHHLLLllLEEEEEEELLL----lLLLHHHHHHHHHHL


DSSP  lLLLEEEELLLLLLlllllllllLHHHHHHHHHHHHHLLLEEEL----------------
Query yGFVAINLNPDPSGghwtsppltDRIWYPIYEKXVELEIPAXIH----------------  171
ident  |                     |   |       ||      |                
Sbjct -GISSFXIFLSYKN----ffgvdDGEMYQTLRLAKELGVIVTAHcenaelvgrlqqklls  198
DSSP  -LLLEEEEEELLLL----lllllHHHHHHHHHHHHHHLLEEEEEellhhhhhhhhhhhhh


DSSP  -------llLLLHhHHHHHHHHHHHhhlLHHHHLLlLLEEELHHHL-LLHHhhhhhhhhh
Query -------vsTGAHyLNADTTAFXQCvagDLFKDFPeLKFVIPHGGG-AVPYhwgrfrgla  223
ident                                           |                 
Sbjct egktgpewhEPSRpEAVEAEGTARF--aTFLETTG-ATGYVVHLSCkPALD---------  246
DSSP  lllllhhhlLLLLlHHHHHHHHHHH--hHHHHHHL-LEEEELLLLLhHHHH---------


DSSP  hhlllllHHHHLllLEEEELL-LLLH-------------------------hHHHHHHHH
Query qexkkplLEDHVlnNIFFDTC-VYHQ-------------------------pGIDLLNTV  257
ident            |   |                                        |   
Sbjct --aamaaKARGV--PIYIESViPHFLldktyaerggveamkyimspplrdkrNQKVLWDA  302
DSSP  --hhhhhHHLLL--LEEEEEEhHHHHllhhhhhllhhhhhlllllllllllhHHHHHHHH


DSSP  L-LHHHEELLLLLL------------------LLLLleelllleellLLHHHHHHL----
Query I-PVDNVLFASEXI------------------GAVRgidprtgfyydDTKRYIEAS----  294
ident                                                |            
Sbjct LaQGFIDTVGTDHCpfdteqkllgkeaftaipNGIP--------aieDRVNLLYTYgvsr  354
DSSP  HhLLLLLEEELLLLlllhhhhhhhlllhhhllLLLL--------lllLHHHHHHHHhlll


DSSP  LLLLHHHHHHHHLHHHHHHLHhHHHHHhhhHHHL--------------------------
Query TILTPEEKQQIYEGNARRVYPrLDAALkakGKLE--------------------------  328
ident   |            |      |                                     
Sbjct GRLDIHRFVDAASTKAAKLFG-LFPRKgtiAVGSdadlvvydpqyrgtisvktqhvnndy  413
DSSP  LLLLHHHHHHHHLHHHHHHLL-LLLLLlllLLLLllleeeeelllleellhhhlllllll


DSSP  --------------------------------------------l
Query --------------------------------------------h  329
ident                                              
Sbjct ngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lllllleelleeeeeeelleeeeelleelllllllllllllllll


No 18: Query=2gwgA Sbjct=4cqbA Z-score=14.4

back to top
DSSP  -----------------------------------------------------LLEEEEE
Query -----------------------------------------------------XIIDIHG    7
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeLEEEEEE


DSSP  EL-LLLL-----------------------hhHHHHhhhhhhhhhlhhhlllhhhLLLLh
Query HY-TTAP-----------------------kaLEDWrnrqiagikdpsvxpkvseLKISd   43
ident |                                                           
Sbjct HMdKSFTstgerlpkfwsrpytrdaaiedglkYYKN-------------------ATHE-  100
DSSP  LHhHLLLlllllllllllllllhhhhhhhhhhHHHH-------------------LLHH-


DSSP  hHHHHHHHlLHHHHHHHHLLLEEEEELllllhhhHHHHHHHHHHHHHHHHHHLL--LLEE
Query dELQASIIeNQLKKXQERGSDLTVFSPragdfnvSSTWAAICNELCYRVSQLFP--DNFI  101
ident  |     |          |   |            |       |                
Sbjct -EIKRHVI-EHAHMQVLHGTLYTRTHV-----dvDSVAKTKAVEAVLEAKEELKdlIDIQ  153
DSSP  -HHHHHHH-HHHHHHHHLLEEEEEEEE-----elLLLLLLHHHHHHHHHHHHLLllLEEE


DSSP  EEEEL--LLLLlllhhHHHHHHHHHHHLlLLLEEEEL-LLLLlllllLLLLllHHHHHHH
Query GAAXL--PQSPgvdpkTCIPELEKCVKEyGFVAINLN-PDPSgghwtSPPLtdRIWYPIY  158
ident   |                    |     |        |                     
Sbjct VVAFAqsGFFV---dlESESLIRKSLDM-GCDLVGGVdPATR----eNNVE--GSLDLCF  203
DSSP  EEEELllLLLL---llLHHHHHHHHHHH-LLLEEELLlLLLL----lLLHH--HHHHHHH


DSSP  HHHHHHLLLEEELlllllhHHHH---HHHHHHHHhhlLHHHHLLLL-LEEELHhHLLLHH
Query EKXVELEIPAXIHvstgahYLNA---DTTAFXQCvagDLFKDFPEL-KFVIPHgGGAVPY  214
ident     |       |                                       |       
Sbjct KLAKEYDVDIDYH------IHDIgtvGVYSINRL--aQKTIENGYKgRVTTSH-AWCFAD  254
DSSP  HHHHHLLLEEEEE------ELLLhhhHHHHHHHH--hHHHHHLLLLlLEEEEE-LLHHHH


DSSP  HHHHHHhhhhhllllLHHHHLL-LLEEEELL--LLLHHHhhhHHHHLL--HHHEELLLLL
Query HWGRFRglaqexkkpLLEDHVL-NNIFFDTC--VYHQPGidlLNTVIP--VDNVLFASEX  269
ident                            | ||                     |   ||  
Sbjct APSEWL--------dEAIPLYKdSGMKFVTCfsSTPPTM---PVIKLLeaGINLGCASDN  303
DSSP  LLHHHH--------hHHHHHHHhHLLEEEEEllLLLLLL---LHHHHHhlLLEEEEELLL


DSSP  L---LLLLleelllleellLLHHHHH-HLLL---lLHHHHHHHHLHHHHHHLHhhhhHHH
Query I---GAVRgidprtgfyydDTKRYIE-ASTI---lTPEEKQQIYEGNARRVYPrldaALK  322
ident |                                                ||        |
Sbjct IrdfWVPF-----gngdmvQGALIETqRLELktnrDLGLIWKMITSEGARVLG----IEK  354
DSSP  LlllLLLL-----llllhhHHHHHHHhHHLLllhhHHHHHHHHHLHHHHHHHL----LHH


DSSP  H---hhHHLL--------------------------------------
Query A---kgKLEH--------------------------------------  329
ident                                                 
Sbjct NygievGKKAdlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  HlllllLLLLleeeellllhhhhhhhllleeeeeelleeeeelleell


No 19: Query=2gwgA Sbjct=2vunA Z-score=14.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHH------LLH
Query XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkisddelqASII------ENQ   54
ident    | | |                                                    
Sbjct GLLDTHVHVS-------------------------------------GGDYaprqktMDF   83
DSSP  LEEEEEELLL-------------------------------------LLLEehhhleELH


DSSP  HHHHHHHLLLEEEE-ELLL-llhhhHHHHHHHHHHHHHHHHHHLL---LLEEE-EEELLL
Query LKKXQERGSDLTVF-SPRA-gdfnvSSTWAAICNELCYRVSQLFP---DNFIG-AAXLPQ  108
ident        |                                            | |  |  
Sbjct ISSALHGGVTTMISaGSPHfpgrpkDAAGTKALAITLSKSYYNARpagVKVHGgAVILEK  143
DSSP  HHHHHLLLEEEEEElLLLLllllllLHHHHHHHHHHHHHHHHHLLhhhLEEELlEELLLL


DSSP  LllllhhHHHHHHHHHHHLLlLLEEEE-LLLLllllllllLLLLhHHHHHHHHHHHHLLL
Query SpgvdpkTCIPELEKCVKEYgFVAINL-NPDPsgghwtspPLTDrIWYPIYEKXVELEIP  167
ident                  ||                             |  |        
Sbjct G------LTEEDFIEMKKEG-VWIVGEvGLGT-------iKNPE-DAAPMVEWAHKHGFK  188
DSSP  L------LLHHHHHHHHHLL-LLEEEEeLLLL-------lLLHH-HHHHHHHHHHHLLLE


DSSP  EEELlllllhHHHH---hhHHHHHHhhllhhhhlllLLEEELHHHL---LLHHHHhhhhh
Query AXIHvstgahYLNA---dtTAFXQCvagdlfkdfpeLKFVIPHGGG---AVPYHWgrfrg  221
ident    |               |                   |  |  |   |          
Sbjct VQMH-----tGGTSipgssTVTADD-------viktKPDVVSHINGgptAISVQE-----  231
DSSP  EEEE-----lLLLLlllllLLLHHH-------hhhhLLLEEELLLLlllLLLHHH-----


DSSP  hhhhlllllhHHHLLllEEEELLL-LLHHHHHHHHHHL----LHHHEELLLLLLLLLLle
Query laqexkkpllEDHVLnnIFFDTCV-YHQPGIDLLNTVI----PVDNVLFASEXIGAVRgi  276
ident            |                   |              | |           
Sbjct ------vdriMDETD--FAMEIVQcGNPKIADYVARRAaekgQLGRVIFGNDAPSGTG--  281
DSSP  ------hhhhHHHLL--LEEEEELlLLHHHHHHHHHHHhhhlLHHHEEEELLLLLLLL--


DSSP  elllleellLLHHHHHHL---LLLLHHHHHHHHLHHHHHHLhhHHHH-----hHHHH---
Query dprtgfyydDTKRYIEAS---TILTPEEKQQIYEGNARRVYprLDAA-----lKAKG---  325
ident             |            ||       ||   ||            |      
Sbjct -----liplGILRNMCQIasmSDIDPEVAVCMATGNSTAVY--GLNTgviapgKEADlii  334
DSSP  -----llllHHHHHHHHHhhhLLLLHHHHHHHHLHHHHHHH--LLLLllllllLLLLeee


DSSP  -----------------------------HHLL------------------
Query -----------------------------KLEH------------------  329
ident                                |                   
Sbjct mdtplgsvaedamgaiaagdipgisvvliDGEAvvtksrntppakraakil  385
DSSP  eelllllllllhhhhhhhlllleeeeeeeLLEEeellllllllllllleel


No 20: Query=2gwgA Sbjct=1bf6A Z-score=14.3

back to top
DSSP  -----LLEEEEEELLlllhhHHHHHHhhhhhhhlhhhlllhhhllllhhhHHHHHHLLhH
Query -----XIIDIHGHYTtapkaLEDWRNrqiagikdpsvxpkvselkisddeLQASIIENqL   55
ident           | |       |    |                          | |     
Sbjct sfdptGYTLAHEHLH---idLSGFKN-----------------nvdcrldQYAFICQE-M   39
DSSP  lllllLEEEEEELLL---eeLHHHHL-----------------lhhheelLHHHHHHH-H


DSSP  HHHHHHLLLEEEEELllllhhhhhhhHHHHHhhHHHHHHHLL----LLEEEEEEL-----
Query KKXQERGSDLTVFSPragdfnvsstwAAICNelCYRVSQLFP----DNFIGAAXL-----  106
ident      ||                                        |            
Sbjct NDLMTRGVRNVIEMT----------nRYMGR--NAQFMLDVMretgINVVACTGYyqdaf   87
DSSP  HHHHHLLEEEEEELL----------lHHHLL--LHHHHHHHHhhhlLEEEEEELLllhhh


DSSP  --llLLLLLHHHHHHHHHHHHHLL------LLLEEE-ELLLllLLLLLLLLLllhhHHHH
Query --pqSPGVDPKTCIPELEKCVKEY------GFVAIN-LNPDpsGGHWTSPPLtdriWYPI  157
ident                |                  |         |  |            
Sbjct fpehVATRSVQELAQEMVDEIEQGidgtelKAGIIAeIGTS--EGKITPLEE--kvFIAA  143
DSSP  lllhHHHLLHHHHHHHHHHHHHLLllllllLEEEEEeEELL--LLLLLHHHH--hhHHHH


DSSP  HHHHHHHLLLEEELLllllHHHHHHHHHHHHhhhllhHHHLLLL-LEEELHHHLLlHHHH
Query YEKXVELEIPAXIHVstgaHYLNADTTAFXQcvagdlFKDFPEL-KFVIPHGGGAvPYHW  216
ident          |   |                             |      |         
Sbjct ALAHNQTGRPISTHT----SFSTMGLEQLAL-----lQAHGVDLsRVTVGHCDLKdNLDN  194
DSSP  HHHHHHHLLLEEEEL----HHHLLHHHHHHH-----hHHLLLLHhHEEELLLLLLlLHHH


DSSP  hhhhhhhhhlllllhhhHLLL-LEEEELLLL------LHHHHHHHHHHL----LHHHEEL
Query grfrglaqexkkplledHVLN-NIFFDTCVY------HQPGIDLLNTVI----PVDNVLF  265
ident                                                          |  
Sbjct ---------------ilKMIDlGAYVQFDTIgknsyyPDEKRIAMLHALrdrgLLNRVML  239
DSSP  ---------------hhHHHHlLLEEEELLLllllllLHHHHHHHHHHHhhllLHHHEEE


DSSP  LLLLLL-lLLLEelllleellLLHH--HHHHL--LLLLHHHHHHHHLHHHHHHLHhhhhh
Query ASEXIG-aVRGIdprtgfyydDTKR--YIEAS--TILTPEEKQQIYEGNARRVYPrldaa  320
ident                      |      |                   |           
Sbjct SMDITRrsHLKA---nggygyDYLLttFIPQLrqSGFSQADVDVMLRENPSQFFQ-----  291
DSSP  LLLLLLhhHLHH---hlllllLHHHhlHHHHHhhLLLLHHHHHHHHLHHHHHHLL-----


DSSP  hhhhhhhll
Query lkakgkleh  329
ident          
Sbjct ---------  291
DSSP  ---------


No 21: Query=2gwgA Sbjct=3giqA Z-score=14.2

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------XIID    4
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeeLEEE


DSSP  EEE-ELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhHHHHLlhHHHHHHHLL
Query IHG-HYTTapkaledwrnrqiagikdpsvxpkvselkisddelqASIIEnqLKKXQERGS   63
ident  ||                                                |      | 
Sbjct VHGhDDLM-----------------------------------fVEKPD--LRWKTSQGI   83
DSSP  LLLlLLLH-----------------------------------hHHLLL--LHHHHLLLE


DSSP  LEEEEE-----lllllHHHH---------hhhhHHHHHHHHHHHH--HLLLLEEEEEE--
Query DLTVFS-----pragdFNVS---------stwaAICNELCYRVSQ--LFPDNFIGAAX--  105
ident    |                                               |        
Sbjct TTVVVGncgvsaapapLPGNtaaalallgetplFADVPAYFAALDaqRPMINVAALVGha  143
DSSP  EEEEELllllllllllLLLLllhhhhhhlllllLLLHHHHHHHHHhlLLLLEEEEEEEhh


DSSP  LLLL------LLLL----HHHHHHHHHHHHHLlLLLEEEELL-LLLLllLLLLlllLHHH
Query LPQS------PGVD----PKTCIPELEKCVKEyGFVAINLNP-DPSGghWTSPpltDRIW  154
ident                          |       | |          |             
Sbjct NLRLaamrdpQAAPtaaeQQAMQDMLQAALEA-GAVGFSTGLaYQPG--AVAQ---AAEL  197
DSSP  HHHHhhllllLLLLlhhhHHHHHHHHHHHHHH-LLLEEEEELlLLLH--HHLL---HHHH


DSSP  HHHHHHHHHHLLLEEELlllllhhhhHHHH-----HHHHHhhlLHHHHLlLLLEEELhHH
Query YPIYEKXVELEIPAXIHvstgahylnADTT-----AFXQCvagDLFKDFpELKFVIPhGG  209
ident         |       |                  |                  |     
Sbjct EGLARVAAERRRLHTSH--------iRNEAdgveaAVEEV--lAIGRGT-GCATVVS-HH  245
DSSP  HHHHHHHHHLLLEEEEE--------lLLLLllhhhHHHHH--hHHHHHH-LLEEEEL-LL


DSSP  LL----lhHHHHHHhhhhhhllllLHHHHLL---LLEEEELLLLL---------------
Query GA----vpYHWGRFrglaqexkkpLLEDHVL---NNIFFDTCVYH---------------  247
ident                            |           |   |                
Sbjct KCmmpqnwGRSRAT---------lANIDRAReqgVEVALDIYPYPgsstiliperaetid  296
DSSP  LLllhhhlLLHHHH---------hHHHHHHHhllLLEEEEELLLLeeeeellhhhlllll


DSSP  -----------------------------------------------HHHHHHHHHhllH
Query -----------------------------------------------QPGIDLLNTvipV  260
ident                                                             
Sbjct diritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdEDEVKRIFQ---H  353
DSSP  lleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeelllHHHHHHHHH---L


DSSP  HHEELLLLLLLLLLLeellllEELL--LLHHHHHHL-----LLLLHHHHHHHHLHHHHHH
Query DNVLFASEXIGAVRGidprtgFYYD--DTKRYIEAS-----TILTPEEKQQIYEGNARRV  313
ident       |                                     | |           ||
Sbjct PCCMVGSDGLPNDAR------PHPRlwGSFTRVLGRyvreaRLMTLEQAVARMTALPARV  407
DSSP  LLEEELLLLLLLLLL------LLLHhhHHHHHHHHHhhhhlLLLLHHHHHHHHLHHHHHH


DSSP  LHhhHHHH-----HHHH-------------------------------------------
Query YPrlDAAL-----KAKG-------------------------------------------  325
ident      |        |                                             
Sbjct FG--FAERgvlqpGAWAdvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppad  465
DSSP  HL--LLLLlllllLLLLleeeelllllllllllllllllllleeeeeelleeeellllll


DSSP  ------hhll
Query ------kleh  329
ident           
Sbjct grpgqvlrax  475
DSSP  llllllllll


No 22: Query=2gwgA Sbjct=1yrrB Z-score=14.2

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------XIIDIHGH    8
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL


DSSP  -----LLLLLHHHhhhhhhhhhhhhlhhhlllhhhllllhhhHHHHHHlLHHHHHHHHLL
Query -----YTTAPKALedwrnrqiagikdpsvxpkvselkisddeLQASIIeNQLKKXQERGS   63
ident                                                     |     | 
Sbjct gcggvQFNDTAEA----------------------------vSVETLE-IMQKANEKSGC   91
DSSP  eelleELLLLLLL----------------------------lLHHHHH-HHHHHHHLLLE


DSSP  LEEEEELLlllhhhHHHHHHHHHHHHHHHHHHLLLLEEE-EEELlllllllhHHHHHHHH
Query DLTVFSPRagdfnvSSTWAAICNELCYRVSQLFPDNFIG-AAXLpqspgvdpKTCIPELE  122
ident               |                  |    |                   | 
Sbjct TNYLPTLI----ttSDELMKQGVRVMREYLAKHPNQALGlHLEG----pwlnAALVDFLC  143
DSSP  EEEEEEEL----llLHHHHHHHHHHHHHHHHHLLLLLLLeEEEL----llllLHHHHHHH


DSSP  HHHhlLLLLEEEElllllllllllllLLLHhHHHHHHHHHHHLLLEEELLllllhhhhhh
Query KCVkeYGFVAINLnpdpsgghwtsppLTDRiWYPIYEKXVELEIPAXIHVstgahylnad  182
ident             |                        |     |                
Sbjct ENA--DVITKVTL------------aPEMV-PAEVISKLANAGIVVSAGH----------  178
DSSP  HLH--HHEEEEEE------------lHHHL-LHHHHHHHHHHLLEEEELL----------


DSSP  hhhhHHHHhLLHHHhLLLLLEEELHHHLLLhhhhhhHHHHHhhlllllhhhHLLLlEEEE
Query ttafXQCVaGDLFKdFPELKFVIPHGGGAVpyhwgrFRGLAqexkkplledHVLNnIFFD  242
ident                |        |   |         |                 |   
Sbjct ---sNATL-KEAKAgFRAGITFATHLYNAM----pyITGRE--pglagailDEAD-IYCG  227
DSSP  ---lLLLH-HHHHHhHHHLEEEELLLLLLL----llLLLLL--lhhhhhhhHLLL-LEEE


DSSP  LLLLLHhHHHHHHHHLL---HHHEELLLLLlLLLLleelllleeLLLLHHHHHHL---LL
Query TCVYHQpGIDLLNTVIP---VDNVLFASEXiGAVRgidprtgfyYDDTKRYIEAS---TI  296
ident                      |                                      
Sbjct IIADGLhVDYANIRNAKrlkGDKLCLVTDA-TSGS---------SLTMIEGVRNLvehCG  277
DSSP  EELLLLlLLHHHHHHHHhhhHHHEEEELLL-LLLL---------LLLHHHHHHHHhhhHL


DSSP  LLHHHHHHHHLHHHHHHLHhHHHHH-----HHHH--------------------hhll
Query LTPEEKQQIYEGNARRVYPrLDAAL-----KAKG--------------------kleh  329
ident     |          |        |                                 
Sbjct IALDEVLRMATLYPARAIG-VEKRLgtlaaGKVAnltaftpdfkitktivngnevvtq  334
DSSP  LLHHHHHHHHLHHHHHHLL-LLLLLlllllLLLLleeeellllleeeeeelleeeeel


No 23: Query=2gwgA Sbjct=2vc5A Z-score=14.2

back to top
DSSP  ----------------LLEEEEEELLlllhhHHHHHhhhhhhhhlhhhlllHHHL-LLLH
Query ----------------XIIDIHGHYTtapkaLEDWRnrqiagikdpsvxpkVSEL-KISD   43
ident                     || |        |  |                        
Sbjct mriplvgkdsieskdiGFTLIHEHLR---vfSEAVR---------------QQWPhLYNE   42
DSSP  llllllllllllhhhlLLEELLLLLL---llLHHHH---------------HHLHhHLLH


DSSP  HHHHHHHHLLhHHHHHHHLLLEEEEELllllhhhhhhhHHHHHHhhHHHHHHLL----LL
Query DELQASIIENqLKKXQERGSDLTVFSPragdfnvsstwAAICNElcYRVSQLFP----DN   99
ident ||          |     |    |                       |           |
Sbjct DEEFRNAVNE-VKRAMQFGVKTIVDPT----------vMGLGRD--IRFMEKVVkatgIN   89
DSSP  HHHHHHHHHH-HHHHHHLLLLEEEELL----------lLLLLLL--HHHHHHHHhlllLE


DSSP  EEEEEEL-------llLLLLLHHHHHHHHHHHHHL------LLLLEEEELLlllLLLLlL
Query FIGAAXL-------pqSPGVDPKTCIPELEKCVKE------YGFVAINLNPdpsGGHWtS  146
ident                                  ||                         
Sbjct LVAGTGIyiyidlpfyFLNRSIDEIADLFIHDIKEgiqgtlNKAGFVXIAA---DEPGiT  146
DSSP  EEELEELlllllllhhHLLLLHHHHHHHHHHHHHLllllllLLLLLEEEEL---LLLLlL


DSSP  LLLllhhHHHHHHHHHHHLLLEEELlllllHHHH--HHHHHHHhhhhllhHHHLLLL-LE
Query PPLtdriWYPIYEKXVELEIPAXIHvstgaHYLN--ADTTAFXqcvagdlFKDFPEL-KF  203
ident                 |   |   |                                 | 
Sbjct KDV-ekvIRAAAIANKETKVPIITH-----SNAHnnTGLEQQR-----ilTEEGVDPgKI  195
DSSP  HHH-hhhHHHHHHHHHHHLLLEEEE-----LLLLllHHHHHHH-----hhHHLLLLHhHE


DSSP  EELHHHLLlhHHHHhhhhhhhhlllllhhhhLLLLEEEELLLL----------LHHHHHH
Query VIPHGGGAvpYHWGrfrglaqexkkplledhVLNNIFFDTCVY----------HQPGIDL  253
ident  | | |                              |     |                 
Sbjct LIGHLGDT--DNID------------yikkiADKGSFIGLDRYgldlflpvdkRNETTLR  241
DSSP  EELLHHHL--LLHH------------hhhhhHHLLLEEEELLLlllllllhhhHHHHHHH


DSSP  HHHHLLHHHEELLLLLL-------------llLLLEelllleellLLHH-HHHHL--LLL
Query LNTVIPVDNVLFASEXI-------------gaVRGIdprtgfyydDTKR-YIEAS--TIL  297
ident |      |                                           |        
Sbjct LIKDGYSDKIMISHDYCctidwgtakpeykpkLAPR-----wsitLIFEdTIPFLkrNGV  296
DSSP  HHHLLLLLLEEELLLLLlllllllllhhhhhhHLLL-----llllHHHHlHHHHHhlLLL


DSSP  LHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll
Query TPEEKQQIYEGNARRVYPrldaalkakgkleh  329
ident   |    |   |                    
Sbjct NEEVIATIFKENPKKFFS--------------  314
DSSP  LHHHHHHHHLHHHHHHLL--------------


No 24: Query=2gwgA Sbjct=3nqbA Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllll
Query ------------------XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkis   42
ident                     || | |                                  
Sbjct srrdaaqvidaggayvspGLIDTHXHIE--------------------------------   88
DSSP  lllleeeeeelllleeeeLEEEEEELHH--------------------------------


DSSP  hhhhhHHHHlLHHHHHHHHLLLEEEEELLLllhhhhHHHHHHHHHHHHHHHHHLlLLEEE
Query ddelqASIIeNQLKKXQERGSDLTVFSPRAgdfnvsSTWAAICNELCYRVSQLFpDNFIG  102
ident                   ||    |  |                              | 
Sbjct --ssxITPA-AYAAAVVARGVTTIVWDPHE----fgNVHGVDGVRWAAKAIENLpLRAIL  141
DSSP  --hhlLLHH-HHHHHHHLLLEEEEEELLHH----hhHHHLHHHHHHHHHHHLLLlLEEEE


DSSP  EEEL-LLLLLL----lhhHHHHHHHHHHHLLLLLEEE-ELLLllllllllLLLLLHH--H
Query AAXL-PQSPGV----dpkTCIPELEKCVKEYGFVAIN-LNPDpsgghwtsPPLTDRI--W  154
ident  |     |               |           |                   |    
Sbjct LAPScVPSAPGlerggadFDAAILADLLSWPEIGGIAeIXNX--------RGVIERDprX  193
DSSP  EELLlLLLLLLlllllllLLHHHHHHHHLLLLEEEEEeELLH--------HHHHLLLhhH


DSSP  HHHHHHHHHHLLLEEELlllllhhhhhHHHHhhhHHHL--LHHHhlllLLEEELhhHLLL
Query YPIYEKXVELEIPAXIHvstgahylnaDTTAfxqCVAG--DLFKdfpeLKFVIPhgGGAV  212
ident   |       |     |                   |                       
Sbjct SGIVQAGLAAEKLVCGH----------ARGL---KNADlnAFXA---aGVSSDH--ELVS  235
DSSP  HHHHHHHHHHLLEEEEL----------LLLL---LHHHhhHHHH---lLLLEEL--LLLL


DSSP  HHHhhhhhhhhhhlllllhhhhlLLLEEEELLLLLHHHHHHHHHHL-----LHHHEELLL
Query PYHwgrfrglaqexkkplledhvLNNIFFDTCVYHQPGIDLLNTVI-----PVDNVLFAS  267
ident                                   |                    |    
Sbjct GED---------------lxaklRAGLTIELRGSHDHLLPEFVAALntlghLPQTVTLCT  280
DSSP  HHH---------------hhhhhHLLLEEEEELLLHHHHHHHHHHHhhhllLLLLEEEEL


DSSP  LLLllLLLEellllEELL--LLHHHHHHLlLLLHHHHHHHHLHHHHHHLHhhHHHH----
Query EXIgaVRGIdprtgFYYD--DTKRYIEAStILTPEEKQQIYEGNARRVYPrlDAAL----  321
ident                     |  |       | ||        ||          |    
Sbjct DDV--FPDD---llQGGGldDVVRRLVRY-GLKPEWALRAATLNAAQRLG--RSDLglia  332
DSSP  LLL--LHHH---hhHLLLhhHHHHHHHHL-LLLHHHHHHHHLHHHHHHHL--LLLLllll


DSSP  -HHHH-------------------------------------------------------
Query -KAKG-------------------------------------------------------  325
ident                                                             
Sbjct aGRRAdivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandf  392
DSSP  lLLLLleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct lvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgf  452
DSSP  llllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct ltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailpl  512
DSSP  eellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct plsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgia  572
DSSP  llllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellllee


DSSP  -----------hhll
Query -----------kleh  329
ident                
Sbjct dvltgkvxespviev  587
DSSP  elllleeellleeel


No 25: Query=2gwgA Sbjct=2pajA Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  -LLEEEEEE-LLLL---lhHHHHhhhhhhhhhhlhhhlllhhhlllLHHHHHHHHHlLHH
Query -XIIDIHGH-YTTA---pkALEDwrnrqiagikdpsvxpkvselkiSDDELQASIIeNQL   55
ident       | |                                                  |
Sbjct pAWVNTHHHlFQSLlkgepFRAL----------------------fDERRFRLAAR-IGL   97
DSSP  eLEELLLLLhHHHHlllllLHHH----------------------lLHHHHHHHHH-HHH


DSSP  HHHHHHLLLEEEEELLlllhhhHHHHhhhhhHHHHHHHHHLL---LLEEEEEELLLLLL-
Query KKXQERGSDLTVFSPRagdfnvSSTWaaicnELCYRVSQLFP---DNFIGAAXLPQSPG-  111
ident       |                                        |            
Sbjct IELARSGCATVADHNY----vyYPGM---pfDSSAILFEEAEklgLRFVLLRGGATQTRq  150
DSSP  HHHHLLLEEEEEELLL----llLLLL---llLHHHHHHHHHHhllLEEEEEELLLLLLLl


DSSP  -----------lLHHHHHHHHHHHHHLLL--------LLEEEE--LLLLlllllllllll
Query -----------vDPKTCIPELEKCVKEYG--------FVAINL--NPDPsgghwtspplt  150
ident                      |     |          |                     
Sbjct leadlptalrpeTLDAYVADIERLAARYHdaspramrRVVMAPttVLYS---------is  201
DSSP  llllllhhhlllLHHHHHHHHHHHHHHLLllllllleEEEELLllLLLL---------ll


DSSP  LHHHHHHHHHHHHHLLLEEELlllllhhhhhhhHHHHHHhhLLHHhhllllLEEELHhHL
Query DRIWYPIYEKXVELEIPAXIHvstgahylnadtTAFXQCvaGDLFkdfpelKFVIPHgGG  210
ident  |           |      |                 |  |              |   
Sbjct PREMRETAAVARRLGLRMHSH--------lsgkSPVAFC--GEHD--wlgsDVWYAH-LV  248
DSSP  HHHHHHHHHHHHHLLLEEEEE--------llllLHHHHH--HHLL--llllLEEEEL-LL


DSSP  LLhhhhhhhhhhhhhllllLHHHHLL-LLEEEELLLLlhhhhhhHHHHLL--hHHEELLL
Query AVpyhwgrfrglaqexkkpLLEDHVL-NNIFFDTCVYhqpgidlLNTVIP--vDNVLFAS  267
ident  |                                |                    |    
Sbjct KV---------------daDEIALLAqTGTGVAHCPQ--sngrlPVREMAdagVPVSIGV  291
DSSP  LL---------------lhHHHHHHHhHLLEEEELHH--hhhllLLLLHHhhlLLEEELL


DSSP  LLLLLLLleelllleellLLHHHHHHLLL---LLHHHHHHHHLHHHHHHLHhhHHHH---
Query EXIGAVRgidprtgfyydDTKRYIEASTI---LTPEEKQQIYEGNARRVYPrlDAAL---  321
ident                                     |          ||           
Sbjct DGAASNE------aadmiSEVHMTWLAQRarlASIAEVIHWGTAGGARVMG--LDEVgkv  343
DSSP  LHHHHLL------lllhhHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHL--LLLLlll


DSSP  ---------------------------------------hhhHHHL--------------
Query ---------------------------------------kakGKLE--------------  328
ident                                                             
Sbjct avgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsAGKRvvvddliegvdike  403
DSSP  llllllleeeeelllhhhlllllhhhhhhhllllleeeeeeeLLEEeeellllllllhhh


DSSP  -----------------l
Query -----------------h  329
ident                   
Sbjct lggearrvvrellrevvv  421
DSSP  hhhhhhhhhhhhhhhhhl


No 26: Query=2gwgA Sbjct=1k6wA Z-score=13.9

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------XIIDIHGH    8
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL


DSSP  L-LLLL----------------hhHHHHHHhhhhhhhlhhhlllhhhlLLLHHHHHHHHH
Query Y-TTAP----------------kaLEDWRNrqiagikdpsvxpkvselKISDDELQASII   51
ident   ||                                                |       
Sbjct LdTTQTagqpnwnqsgtlfegierWAERKA------------------LLTHDDVKQRAW  102
DSSP  LlLLLLlllllllllllhhhhhhhHHLLHH------------------HLLHHHHHHHHH


DSSP  lLHHHHHHHHLLLEEEEELLlllhhhHHHHhHHHHHHHHHHHHHLL--LLEEEEEEL--l
Query eNQLKKXQERGSDLTVFSPRagdfnvSSTWaAICNELCYRVSQLFP--DNFIGAAXL--p  107
ident    ||     |               |             | |           |     
Sbjct -QTLKWQIANGIQHVRTHVD-----vSDAT-LTALKAMLEVKQEVApwIDLQIVAFPqeg  155
DSSP  -HHHHHHHHLLEEEEEEEEE-----lLLLL-LHHHHHHHHHHHHHLllLEEEEEEELlll


DSSP  LLLLLLHHH-HHHHHHHHhhlllLLEEEEL-LLLLllllLLLLLLLhhHHHHHHHHHHHL
Query QSPGVDPKT-CIPELEKCvkeygFVAINLN-PDPSgghwTSPPLTDriWYPIYEKXVELE  165
ident               |                        |                    
Sbjct ILSYPNGEAlLEEALRLG-----ADVVGAIpHFEF----TREYGVE-sLHKTFALAQKYD  205
DSSP  LLLLLLHHHhHHHHHHLL-----LLEEEELhHHLL----LHHHHHH-hHHHHHHHHHHHL


DSSP  LLEEELlllllhHHHH-hHHHHHHhhhlLHHHHLLLL-LEEELHhHLLLHHH-HHHHHhh
Query IPAXIHvstgahYLNA-dTTAFXQcvagDLFKDFPEL-KFVIPHgGGAVPYH-WGRFRgl  222
ident      |                       |             |   |            
Sbjct RLIDVH----cdEIDDeqSRFVET--vaALAHHEGMGaRVTASH-TTAMHSYnGAYTS--  256
DSSP  LEEEEE----elLLLLllLLHHHH--hhHHHHHHLLHhHEEEEE-LHHHHHLlHHHHH--


DSSP  hhhllllLHHHHLL-LLEEEELLLL------------lhhhhhhHHHHLL--HHHEELLL
Query aqexkkpLLEDHVL-NNIFFDTCVY------------hqpgidlLNTVIP--VDNVLFAS  267
ident         |        | |                                  || |  
Sbjct -------RLFRLLKmSGINFVANPLvnihlqgrfdtypkrrgitRVKEMLesGINVCFGH  309
DSSP  -------HHHHHHHhHLLEEEELHHhhhhhllllllllllllllLHHHHHhlLLLEEELL


DSSP  LLLL--LLLLeelllleellLLHHHHHH-----lLLLLHHhHHHHHLHHHHHHLHhhHHH
Query EXIG--AVRGidprtgfyydDTKRYIEA-----sTILTPEeKQQIYEGNARRVYPrlDAA  320
ident                                                    |        
Sbjct DDVFdpWYPL----gtanmlQVLHMGLHvcqlmgYGQIND-GLNLITHHSARTLN--LQD  362
DSSP  LLLLllLLLL----llllhhHHHHHHHHhlllllHHHHHH-HHHHHLHHHHHHLL--LLL


DSSP  H---hHHHH-------------------------------------------------hl
Query L---kAKGK-------------------------------------------------le  328
ident                                                             
Sbjct YgiaaGNSAnliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidyk  422
DSSP  LllllLLLLleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeelll


DSSP  l
Query h  329
ident  
Sbjct r  423
DSSP  l


No 27: Query=2gwgA Sbjct=3gg7A Z-score=13.8

back to top
DSSP  LLEEEEEE-LLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHH
Query XIIDIHGH-YTTApkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQ   59
ident   || | |                                                    
Sbjct SLIDFHVHlDLYP------------------------------------DPVA-VARACE   23
DSSP  LLEEEEELhHHLL------------------------------------LHHH-HHHHHH


DSSP  HHLlLEEEEELLlllhhhhhhhhhHHHHHHHHHHHHLlLLEEEEEEL--lLLLLLLhhHH
Query ERGsDLTVFSPRagdfnvsstwaaICNELCYRVSQLFpDNFIGAAXL--pQSPGVDpkTC  117
ident ||                                         |                
Sbjct ERQ-LTVLSVTT----------tpAAWRGTLALAAGR-PHVWTALGFhpeVVSERA--AD   69
DSSP  HLL-LEEEELLL----------lhHHHHHHHHHHLLL-LLEEELLLLlhhHLLLLH--HH


DSSP  HHHHHHHHHllLLLEEE-ELLLllLLLL-LLLLllLHHHHHHHHHHHHH-LLLEEELlll
Query IPELEKCVKeyGFVAIN-LNPDpsGGHW-TSPPltDRIWYPIYEKXVEL-EIPAXIHvst  174
ident  |                   |                   |             ||   
Sbjct LPWFDRYLP--ETRFVGeVGLD-gSPSLrGTWTqqFAVFQHILRRCEDHgGRILSIH---  123
DSSP  LHHHHHHHH--HLLEEEeEELL-lLHHHhHHHHhhHHHHHHHHHHHHHLlLEEEEEE---


DSSP  llhhhhhHHHHHHHHHhlLHHHHLLL-LLEEELhHHLLlHHHHhhhhhhhhhlllllhhH
Query gahylnaDTTAFXQCVagDLFKDFPE-LKFVIPhGGGAvPYHWgrfrglaqexkkplleD  233
ident           |             |                                   
Sbjct -------SRRAESEVL--NCLEANPRsGTPILH-WYSG-SVTE---------------lR  157
DSSP  -------LLLLHHHHH--HHHHHLHHhEEEEEE-LLLL-LHHH---------------hH


DSSP  HLL-LLEEEELLLL--LHHHHHHHHHHLLHHHEELLLLLLLLLLLEelllleellLLHHH
Query HVL-NNIFFDTCVY--HQPGIDLLNTVIPVDNVLFASEXIGAVRGIdprtgfyydDTKRY  290
ident         |              |    | | ||                     | |  
Sbjct RAIsLGCWFSVGPTmvRTQKGAALIRSMPRDRVLTETDGPFLELDG---qaalpwDVKSV  214
DSSP  HHHhLLLEEEELHHhhLLHHHHHHHHHLLHHHEEELLLLLLLEELL---eellhhHHHHH


DSSP  HHH-LLLLL---HHHHHHHhLHHHHHHLHhhhhhhhhhhhhll
Query IEA-STILT---PEEKQQIyEGNARRVYPrldaalkakgkleh  329
ident  |  | |      |        |  |                 
Sbjct VEGlSKIWQipaSEVERIV-KENVSRLLG-------------t  243
DSSP  HHHhHHHHLllhHHHHHHH-HHHHHHHHH-------------l


No 28: Query=2gwgA Sbjct=3k2gB Z-score=13.7

back to top
DSSP  ---------------------------LLEEEEEELLLL-------lhhhhhhhhhhhhh
Query ---------------------------XIIDIHGHYTTA-------pkaledwrnrqiag   26
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNDcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEElhhhllllllhhhhhhhhlll


DSSP  hhlhhhlllhhhllllhhhhhHHHHLLhHHHHHHHL---LLEEEEELllllhhhhhhhhH
Query ikdpsvxpkvselkisddelqASIIENqLKKXQERG---SDLTVFSPragdfnvsstwaA   83
ident                                            |                
Sbjct sieilselrqdpfvnkhnialDDLDLA-IAEVKQFAavgGRSIVDPT----------crG  109
DSSP  lhhhhhhhhllhhhllllleeLLHHHH-HHHHHHHHhllLLEEEELL----------llL


DSSP  HHHhhHHHHHHHLL----LLEEEEEEL-------llLLLLLHHHHHHHHHHHHHL-----
Query ICNelCYRVSQLFP----DNFIGAAXL-------pqSPGVDPKTCIPELEKCVKE-----  127
ident |                       |                      |      |     
Sbjct IGR--DPVKLRRISaetgVQVVXGAGYylassxpetAARLSADDIADEIVAEALEgtdgt  167
DSSP  LLL--LHHHHHHHHhhhlLEEEELLLLllhhhllhhHHLLLHHHHHHHHHHHHHLlllll


DSSP  -LLLLEEE-ELLLlllllLLLLlllLHHH-HHHHHHHHHHLLLEEELlllllhHHHHhhH
Query -YGFVAIN-LNPDpsgghWTSPpltDRIW-YPIYEKXVELEIPAXIHvstgahYLNAdtT  184
ident       |                              |    | | |             
Sbjct dARIGLIGeIGVS----sDFTA--eEEKSlRGAARAQVRTGLPLXVH-----lPGWF--R  214
DSSP  lLLLLLEEeELLL----lLLLH--hHHHHhHHHHHHHHHHLLLEEEL-----lLLLL--L


DSSP  HHHHHhhLLHHHHLLLL-LEEELHhHLLLHHHHHhhhhhhhhlllllhhhHLLL-LEEEE
Query AFXQCvaGDLFKDFPEL-KFVIPHgGGAVPYHWGrfrglaqexkkplledHVLN-NIFFD  242
ident                 |   |  |                                 |  
Sbjct LAHRV-lDLVEEEGADLrHTVLCH-XNPSHXDPV-------------yqaTLAQrGAFLE  259
DSSP  LHHHH-hHHHHHLLLLHhHEEELL-LHHHLLLHH-------------hhhHHHHhLLEEE


DSSP  -LLLL-------------LHHHHHHHHHHL----LHHHEELLLLLLL-LLLLeellllEE
Query -TCVY-------------HQPGIDLLNTVI----PVDNVLFASEXIG-AVRGidprtgFY  283
ident                                     |  |                    
Sbjct fDXIGxdffyadqgvqcpSDDEVARAILGLadhgYLDRILLSHDVFVkXXLT----ryGG  315
DSSP  eLLLLllleelllleellLHHHHHHHHHHHhhllLHHHEEELLLLLLhHHLH----hhLL


DSSP  LL--LLHH-HHHHL--LLLLHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll
Query YD--DTKR-YIEAS--TILTPEEKQQIYEGNARRVYPrldaalkakgkleh  329
ident                   |           | |||                
Sbjct NGyaFVTKhFLPRLrrHGLDDAALETLXVTNPRRVFD--------asiegh  358
DSSP  LLllHHHHlHHHHHhhLLLLHHHHHHHHLHHHHHHHL--------llllll


No 29: Query=2gwgA Sbjct=3ls9A Z-score=13.6

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------XII    3
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeeLEE


DSSP  EEEEE-LLLL-------------------lHHHHHHHHhhhhhhhlhhhlllhhHLLLLH
Query DIHGH-YTTA-------------------pKALEDWRNrqiagikdpsvxpkvsELKISD   43
ident   | | |  |                         |                    |   
Sbjct NSHQHlYEGAmraipqlervtmaswlegvlTRSAGWWR----------------DGKFGP  104
DSSP  EEEELhHHHHhlllhhhllllhhhhhhhhhHHHHHHHH----------------LLLLLH


DSSP  HHHHHHHHlLHHHHHHHHLLLEEEEELLlllhhHHHHhhhhhhHHHHHHHHHLL---LLE
Query DELQASIIeNQLKKXQERGSDLTVFSPRagdfnVSSTwaaicnELCYRVSQLFP---DNF  100
ident |          |      |                                        |
Sbjct DVIREVAR-AVLLESLLGGITTVADQHL-ffpgATAD------SYIDATIEAATdlgIRF  156
DSSP  HHHHHHHH-HHHHHHHHLLEEEEEEEEL-llllLLLL------LHHHHHHHHHHhhlLEE


DSSP  EEEEELLLLLL-----------lLHHHHHHHHHHHHHLLL--------LLEEEE-LLLLl
Query IGAAXLPQSPG-----------vDPKTCIPELEKCVKEYG--------FVAINL-NPDPs  140
ident   |                                   |           |         
Sbjct HAARSSMTLGKseggfcddlfvePVDRVVQHCLGLIDQYHepepfgmvRIALGPcGVPY-  215
DSSP  EEEELLLLLLHhhlllllhhhllLHHHHHHHHHHHHHHHLllllllleEEEELLlLLLL-


DSSP  llllllllllLHHH-HHHHHHHHHHLLLEEELlllllhHHHH--------hhhHHHHHhh
Query gghwtsppltDRIW-YPIYEKXVELEIPAXIHvstgahYLNA--------dttAFXQCva  191
ident                                |                            
Sbjct ---------dKPELfEAFAQMAADYDVRLHTH----fyEPLDagmsdhlygmtPWRFL--  260
DSSP  ---------lLHHHhHHHHHHHHHHLLEEEEE----elLLLHhhhhhhhhlllHHHHH--


DSSP  LLHHhhllLLLEEELhHHLLlhHHHHhhhhhhhhlllllHHHHLL-LLEEEELLLL----
Query GDLFkdfpELKFVIPhGGGAvpYHWGrfrglaqexkkplLEDHVL-NNIFFDTCVY----  246
ident                                                             
Sbjct EKHG--waSDRVWLA-HAVV--PPRE-------------EIPEFAdAGVAIAHLIApdlr  302
DSSP  HHLL--llLLLEEEE-ELLL--LLHH-------------HHHHHHhHLLEEEELHHhhhh


DSSP  -lHHHHhhHHHHLL--hHHEELLLLLLLLLLleelllleellLLHHHHHH----------
Query -hQPGIdlLNTVIP--vDNVLFASEXIGAVRgidprtgfyydDTKRYIEA----------  293
ident                    | |                       |              
Sbjct mgWGLA--PIREYLdagITVGFGTTGSASND------ggnllGDLRLAALahrpadpnep  354
DSSP  llLLLL--LHHHHHhllLEEEELLLLLLLLL------lllhhHHHHHHHHhlhhhllllh


DSSP  lLLLLHHHHHHHHLHHHHHHLhhhHHHH-----HHHH-----------------------
Query sTILTPEEKQQIYEGNARRVYprlDAAL-----KAKG-----------------------  325
ident    |   |                   |                                
Sbjct eKWLSARELLRMATRGSAECL--gRPDLgvleeGRAAdiacwrldgvdrvgvhdpaigli  412
DSSP  hHLLLHHHHHHHLLHHHHHHL--lLLLLlllllLLLLleeeeelllhhhlllllhhhhhh


DSSP  -------------------------------------hhll
Query -------------------------------------kleh  329
ident                                          
Sbjct mtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  hlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 30: Query=2gwgA Sbjct=1j6pA Z-score=13.6

back to top
DSSP  ---------------------------------------------------LLEEEEEE-
Query ---------------------------------------------------XIIDIHGH-    8
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHa   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELh


DSSP  LLLL------------------lHHHHhhhhhhhhhhhlhhhlllhhhlLLLHHHHHHHH
Query YTTA------------------pKALEdwrnrqiagikdpsvxpkvselKISDDELQASI   50
ident   |                                                         
Sbjct PXTLlrgvaedlsfeewlfskvlPIED----------------------RLTEKXAYYGT   98
DSSP  HHHHhllllllllhhhhhhllhhHHHL----------------------LLLHHHHHHHH


DSSP  HlLHHHHHHHHLLLEEEEELllllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEEELlLLL
Query IeNQLKKXQERGSDLTVFSPragdfnvsstwaaiCNELCYRVSQLFPDNFIGAAXLpQSP  110
ident |      |   |    |                   |        |         |    
Sbjct I-LAQXEXARHGIAGFVDXY-------------fHEEWIAKAVRDFGXRALLTRGL-VDS  143
DSSP  H-HHHHHHHLLLEEEEEEEE-------------lLHHHHHHHHHHHLLEEEEEEEE-LLL


DSSP  LLLHHHHHHHHHHHHHLLL------LLEEEE-LLLLlllllllllllLHHHHHHHHHHHH
Query GVDPKTCIPELEKCVKEYG------FVAINL-NPDPsgghwtsppltDRIWYPIYEKXVE  163
ident   |      |  |   |        ||      |                          
Sbjct NGDDGGRLEENLKLYNEWNgfegriFVGFGPhSPYL---------csEEYLKRVFDTAKS  194
DSSP  LLLLLLHHHHHHHHHHHHLlhhhleEEEEEElLLLL---------llHHHHHHHHHHHHH


DSSP  HLLLEEELlllllhHHHHhhhhhHHHHhLLHHHHL-LLLLEEELHhHLLLhhhhhhhhhh
Query LEIPAXIHvstgahYLNAdttafXQCVaGDLFKDF-PELKFVIPHgGGAVpyhwgrfrgl  222
ident |  |  ||      |              |       | |    |               
Sbjct LNAPVTIH-----lYETS---keEYDL-EDILNIGlKEVKTIAAH-CVHL----------  234
DSSP  HLLLEEEE-----eLLLL---llLLLL-HHHHLLLlLLLLEEEEE-LLLL----------


DSSP  hhhllllLHHHHLL-LLEEEELLLL---lhhhhhhHHHHLL--hHHEELLLLLLLLLLle
Query aqexkkpLLEDHVL-NNIFFDTCVY---hqpgidlLNTVIP--vDNVLFASEXIGAVRgi  276
ident                   |                           |             
Sbjct -----peRYFGVLKdIPFFVSHNPAsnlklgngiaPVQRXIehgXKVTLGTDGAASNN--  287
DSSP  -----lhHHHHHHLlLLEEEEELHHhhhhllllllLHHHHHhllLEEEELLLLLLLLL--


DSSP  elllleellLLHHHHHHL------LLLLHHHHHHHHLHHHHHHLhhHHHHH-----HHHH
Query dprtgfyydDTKRYIEAS------TILTPEEKQQIYEGNARRVYprLDAAL-----KAKG  325
ident             |             |                                 
Sbjct ----slnlfFEXRLASLLqkaqnpRNLDVNTCLKXVTYDGAQAX--GFKSGkieegWNAD  341
DSSP  ----lllhhHHHHHHHHHhhllllLLLLHHHHHHHHLHHHHHHH--LLLLLlllllLLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct lvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelari  401
DSSP  eeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhh


DSSP  --hhll
Query --kleh  329
ident       
Sbjct ekelys  407
DSSP  hhhhhl


No 31: Query=2gwgA Sbjct=4c5yA Z-score=13.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -LLEEEEEELLLLLHHhHHHHHhhhhhhhlhhhlllhhhllLLHHHHHHHHHLlHHHHHH
Query -XIIDIHGHYTTAPKAlEDWRNrqiagikdpsvxpkvselkISDDELQASIIEnQLKKXQ   59
ident     | | |                                       |           
Sbjct pGLWDCHMHFGGDDDY-YNDYT---------------sglaTHPASSGARLAR-GCWEAL  103
DSSP  eLEEEEEELLLLLLLL-LLLLH---------------hhhhLLHHHHHHHHHH-HHHHHH


DSSP  HHLLLEEEEELLlllhhhhhhhhhhhhhHHHHHHHHLL------LLEEEE-EELLLLL--
Query ERGSDLTVFSPRagdfnvsstwaaicneLCYRVSQLFP------DNFIGA-AXLPQSP--  110
ident   |                             |            |     | | |    
Sbjct QNGYTSYRDLAG----------------YGCEVAKAINdgtivgPNVYSSgAALSQTAgh  147
DSSP  HLLEEEEEELLL----------------LHHHHHHHHHllllllLEEEELlLEEELLLll


DSSP  --------------------------------lLLHHHHHHHHHHHHHlLLLLEEEELLL
Query --------------------------------gVDPKTCIPELEKCVKeYGFVAINLNPD  138
ident                                                   |   |     
Sbjct gdifalpagevlgsygvmnprpgywgagplciaDGVEEVRRAVRLQIR-RGAKVIXVMAS  206
DSSP  lllllllhhhhhhhhlllllllllllllleeelLLHHHHHHHHHHHHH-HLLLLEEEELL


DSSP  ----llLLLLllllllLHHH-HHHHHHHHHHLLLEEELlllllhhhhHHHHHHHHhhhll
Query ----psGGHWtsppltDRIW-YPIYEKXVELEIPAXIHvstgahylnADTTAFXQcvagd  193
ident                        | |           |                      
Sbjct ggvmsrDDNP-nfaqfSPEElKVIVEEAARQNRIVSAH--------vHGKAGIMA-----  252
DSSP  llllllLLLL-lllllLHHHhHHHHHHHHHLLLLEEEE--------eLLHHHHHH-----


DSSP  hhhhlllLLEEELHhHLLLHHHhhhhhhhhhhlllllhhHHLL-LLEEEELLLL------
Query lfkdfpeLKFVIPHgGGAVPYHwgrfrglaqexkkplleDHVL-NNIFFDTCVY------  246
ident              |                                |             
Sbjct ---aikaGCKSLEH-VSYADEE---------------vwELMKeKGILYVATRSvieifl  293
DSSP  ---hhhhLLLEEEE-LLLLLHH---------------hhHHHHhHLLEEELLHHhhhhhh


DSSP  ---------------------lhhhHHHHHHHLLhhHEELLLLLLllllleelllleelL
Query ---------------------hqpgIDLLNTVIPvdNVLFASEXIgavrgidprtgfyyD  285
ident                                                             
Sbjct asngeglvkeswaklqaladshlkaYQGAIKAGV--TIALGTDTA---------pggptA  342
DSSP  hhllllllllhhhlllhhhhhhhhhHHHHHHLLL--LEELLLLLL---------lllllH


DSSP  LLHHHHHHLlLLLHHHHHHHHLHHHHHH-LHHHH--------------------------
Query DTKRYIEAStILTPEEKQQIYEGNARRV-YPRLD--------------------------  318
ident             || |       ||     |                             
Sbjct LELQFAVERgGMTPLEAIKAATANAPLSvGPQAPltgqlregyeadvialeenpledikv  402
DSSP  HHHHHHHHLlLLLHHHHHHHHLLLHHHHhHHHLLlllllllllllleeeelllllllhhh


DSSP  ------hhhhhHHHHL-----------------l
Query ------aalkaKGKLE-----------------h  329
ident            ||                     
Sbjct fqepkavthvwKGGKLfkgpgigpwgedarnpfl  436
DSSP  hhlhhheeeeeELLEEeellllllllllllllll


No 32: Query=2gwgA Sbjct=3pnuA Z-score=13.4

back to top
DSSP  -------------LLEEEEEELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhH
Query -------------XIIDIHGHYTTapkaledwrnrqiagikdpsvxpkvselkisddelQ   47
ident                 | | |                                       
Sbjct enlyfqsnamklkNPLDMHLHLRD-----------------------------------N   25
DSSP  llllllllleeeeLLEEEEELLLL-----------------------------------H


DSSP  HHHHLLHhHHHHHhLLLEEEEELLlllhhhhhhhHHHHHHHHHHHHHHLL-------lLE
Query ASIIENQlKKXQErGSDLTVFSPRagdfnvsstwAAICNELCYRVSQLFP-------dNF  100
ident                    |  |                |                    
Sbjct QMLELIA-PLSAR-DFCAAVIMPN-------lipPLCNLEDLKAYKMRILkackdenfTP   76
DSSP  HHHHHHH-HHHHL-LLLEEEELLL-------lllLLLLHHHHHHHHHHHHhhhlllllEE


DSSP  EEEEELLllllllhHHHHHHHHHHHHllLLLEEEELlLLLL----llllLLLLlLHHHHH
Query IGAAXLPqspgvdpKTCIPELEKCVKeyGFVAINLNpDPSG----ghwtSPPLtDRIWYP  156
ident                     |           | |              |         |
Sbjct LMTLFFK-------NYDEKFLYSAKD--EIFGIXLY-PAGIttnsnggvSSFD-IEYLKP  125
DSSP  EEEEELL-------LLLHHHHHHHLL--LLLEEEEL-LLLLllllllllLLLL-HHHHHH


DSSP  HHHHHHHHLLLEEEL----llLLLHhhhhHHHHHHHHHhlLHHHHLLLLLEEELHHHL-L
Query IYEKXVELEIPAXIH----vsTGAHylnaDTTAFXQCVagDLFKDFPELKFVIPHGGG-A  211
ident   |    | ||   |                          | | || || |  |     
Sbjct TLEAMSDLNIPLLVHgetndfVMDR----ESNFAKIYE--KLAKHFPRLKIVMEHITTkT  179
DSSP  HHHHHHHLLLLEEELllllllHHHL----LHHHHHHHH--HHHHHLLLLLEEELLLLLhH


DSSP  LHHhhhhhhhhhhhlllllHHHHLlLLEEEELL-LLLHH---------------------
Query VPYhwgrfrglaqexkkplLEDHVlNNIFFDTC-VYHQP---------------------  249
ident                    |      |                                 
Sbjct LCE----------------LLKDY-ENLYATITlHHLIItlddviggkmnphlfckpiak  222
DSSP  HHH----------------HHHHL-LLEEEEELlHHHLLlhhhhhlllllhhhlllllll


DSSP  ---hhHHHHHH--llHHHEELLLLLLL-------LLLLeelllleellLLHHHHHHL--L
Query ---giDLLNTV--ipVDNVLFASEXIG-------AVRGidprtgfyydDTKRYIEAS--T  295
ident        |          | | |            |                        
Sbjct ryedkEALCELafsgYEKVMFGSDSAPhpkgcaaGVFS--------apVILPVLAELfkQ  274
DSSP  lhhhhHHHHHHhhllLLLEEELLLLLLlllllllLLLL--------hhHHHHHHHHHhhH


DSSP  LLLHHHHHHHHLHHHHHHLHhhhhhHHHH-------------------------------
Query ILTPEEKQQIYEGNARRVYPrldaaLKAK-------------------------------  324
ident     |  |     |    |                                         
Sbjct NSSEENLQKFLSDNTCKIYD----lKFKEdkiltleekewqvpnvyedkynqvvpymage  330
DSSP  HLLHHHHHHHHLHHHHHHHL----lLLLLlleeeeellleelllleelllleelllllll


DSSP  ---hhhll
Query ---gkleh  329
ident         
Sbjct ilkfqlkh  338
DSSP  eelleell


No 33: Query=2gwgA Sbjct=1onxA Z-score=13.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --LLEEEEEELLLllhhhhHHHHhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHHHH
Query --XIIDIHGHYTTapkaleDWRNrqiagikdpsvxpkvselkisddelqasiieNQLKKX   58
ident     || | |                                              |   
Sbjct cpGFIDQHVHLIG--gggeAGPT--------------------------trtpeVALSRL   92
DSSP  eeLEEEEEELLLL--llllLLHH--------------------------hllllLLHHHH


DSSP  HHHLLLEEEEELLLllhhhHHHHhhHHHHHHHHHHHHLL---LLEEEEEELlllllllHH
Query QERGSDLTVFSPRAgdfnvSSTWaaICNELCYRVSQLFP---DNFIGAAXLpqspgvdPK  115
ident  | |    |           |       |                               
Sbjct TEAGVTSVVGLLGT-----DSIS--RHPESLLAKTRALNeegISAWMLTGA-----yhVP  140
DSSP  HHLLEEEEEELLLL-----LLLL--LLHHHHHHHHHHHHhhlLEEEEEEEL-----llLL


DSSP  HH--hHHHHHHH-HLLLLLEEEELL----LLLLlllllllllLHHHHHHHHHHHHH----
Query TC--iPELEKCV-KEYGFVAINLNP----DPSGghwtsppltDRIWYPIYEKXVEL----  164
ident         || |                                                
Sbjct SRtitGSVEKDVaIIDRVIGVXCAIsdhrSAAP--------dVYHLANMAAESRVGgllg  192
DSSP  LLlllLLHHHHHhHLLLEEEEEEEEllllLLLL--------lHHHHHHHHHHHHHHhhhh


DSSP  --LLLEEELlllllhHHHHhhHHHHHHHhlLHHH--HLLLLLEEELHHHLL--LHHHhhh
Query --EIPAXIHvstgahYLNAdtTAFXQCVagDLFK--DFPELKFVIPHGGGA--VPYHwgr  218
ident         |             |       ||    | |  |    |             
Sbjct gkPGVTVFH------MGDS-kKALQPIY--DLLEncDVPISKLLPTHVNRNvpLFEQ---  240
DSSP  llLLEEEEE------ELLL-lLLLHHHH--HHHHllLLLHHHEEEELHHHLhhHHHH---


DSSP  hhhhhhhlllllhhHHLL-LLEEEELLLLLH--hHHHHHHHHL-----LHHHEELLLLLL
Query frglaqexkkplleDHVL-NNIFFDTCVYHQ--pGIDLLNTVI-----PVDNVLFASEXI  270
ident                         |                       |   |   |   
Sbjct -------------aLEFArKGGTIDITSSIDepvAPAEGIARAvqagiPLARVTLSSDGN  287
DSSP  -------------hHHHHhLLLLEEEELLLLlllLHHHHHHHHhhlllLHHHEEEELLLL


DSSP  LLL-----lleelllleelLLLH-HHHHHL---LLLLHHHHHHHHLHHHHHHLHhhHHHH
Query GAV-----rgidprtgfyyDDTK-RYIEAS---TILTPEEKQQIYEGNARRVYPrlDAAL  321
ident |                    |                                      
Sbjct GSQpffddegnlthigvagFETLlETVQVLvkdYDFSISDALRPLTSSVAGFLN--LTGK  345
DSSP  LEEeeellllleeeeeellLHHHhHHHHHHhhhHLLLHHHHHHHHLHHHHHHLL--LLLL


DSSP  ----hHHHH---------------------------------hll
Query ----kAKGK---------------------------------leh  329
ident                                              
Sbjct geilpGNDAdllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  lllllLLLLleeeellllleeeeeelleeeeelleelllllllll


No 34: Query=2gwgA Sbjct=2oofA Z-score=13.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --LLEEEEEELLLLL-----------------------------HHHHhhhhhhhhhhhl
Query --XIIDIHGHYTTAP-----------------------------KALEdwrnrqiagikd   29
ident     || | |   |                               |              
Sbjct tpGLIDCHTHLIFAGsraeefelrqkgvpyaeiarkgggiistvRATR------------  108
DSSP  eeLEEEEEELLLLLLllhhhhhhhhhlllhhhhhhllllhhhhhHHHH------------


DSSP  hhhlllhhhlLLLHHHHHHHHHlLHHHHHHHHLLLEEEEELLLllhhhhhhHHHHHHHHH
Query psvxpkvselKISDDELQASIIeNQLKKXQERGSDLTVFSPRAgdfnvsstWAAICNELC   89
ident             | | |         |     |                           
Sbjct ----------AASEDQLFELAL-PRVKSLIREGVTTVEIKSGY------glTLEDELKXL  151
DSSP  ----------HLLHHHHHHHHH-HHHHHHHHHLEEEEEEELLL------llLHHHHHHHH


DSSP  HHHHHHLL---LLEEEEEEL-------lllLLLL-HHHHH-HHHHHHHHLLLLLEEEELL
Query YRVSQLFP---DNFIGAAXL-------pqsPGVD-PKTCI-PELEKCVKEYGFVAINLNP  137
ident      |                               |                |     
Sbjct RVARRLGEalpIRVKTTLLAahavppeyrdDPDSwVETICqEIIPAAAEAGLADAVDVFC  211
DSSP  HHHHHHHHhllLEEEEEEEEellllhhhllLHHHhHHHHHhLHHHHHHHLLLLLEEEEEE


DSSP  LlllllllllLLLLhHHHHHHHHHHHHLLLEEELlllllhhhhHHHHhHHHHhhllhhhh
Query DpsgghwtspPLTDrIWYPIYEKXVELEIPAXIHvstgahylnADTTaFXQCvagdlfkd  197
ident                     |            |                          
Sbjct E------higFSLA-QTEQVYLAADQYGLAVKGH--------xDQLS-NLGG----stla  251
DSSP  L------lllLLHH-HHHHHHHHHHHLLLEEEEE--------eLLLL-LLLH----hhhh


DSSP  lLLLLEEELHhHLLLhhhhhhhhhhhhhllllLHHHHLL-LLEEEELLLL----lhhhhh
Query fPELKFVIPHgGGAVpyhwgrfrglaqexkkpLLEDHVL-NNIFFDTCVY----hqpgid  252
ident          |                                                  
Sbjct aNFGALSVDH-LEYL---------------dpEGIQALAhRGVVATLLPTafyflketkl  295
DSSP  hHLLLLEEEE-LLLL---------------lhHHHHHHHhHLLEEEELHHhhhhllllll


DSSP  hHHHHLL--hHHEELLLLLL-LLLLleelllleellLLHHHHHHLlLLLHHHHHHHHLHH
Query lLNTVIP--vDNVLFASEXI-GAVRgidprtgfyydDTKRYIEAStILTPEEKQQIYEGN  309
ident                 |    |                         ||| |        
Sbjct pPVVALRkagVPXAVSSDINpGTAP------ivslrXAXNXACTLfGLTPVEAXAGVTRH  349
DSSP  lLHHHHHhllLLEEELLLLLlLLLL------lllhhHHHHHHHHHhLLLHHHHHHHLLHH


DSSP  HHHHLHhhHHHH----------------------------------hhhHHHL--l
Query ARRVYPrlDAAL----------------------------------kakGKLE--h  329
ident | |                                                 |   
Sbjct AARALG--EQEQlgqlrvgxladflvwncghpaelsyligvdqlvsrvvNGEEtlh  403
DSSP  HHHHLL--LLLLllllllllllleeeellllllhhhhlllllleeeeeeLLEElll


No 35: Query=2gwgA Sbjct=1a4mA Z-score=12.9

back to top
DSSP  ------LLEEEEEELL--------------------------------------------
Query ------XIIDIHGHYT--------------------------------------------   10
ident            | |                                              
Sbjct tpafnkPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
DSSP  llllllLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl


DSSP  ---llLHHHHhhhhhhhhhhhlhhhlllhhhLLLLhhhhhHHHHlLHHHHHHHHLLLEEE
Query ---taPKALEdwrnrqiagikdpsvxpkvseLKISddelqASIIeNQLKKXQERGSDLTV   67
ident                                                       |     
Sbjct kfdyyMPVIA---------------------GCRE--aikRIAY-EFVEMKAKEGVVYVE   96
DSSP  lhhhhHHHHL---------------------LLHH--hhhHHHH-HHHHHHHHLLEEEEE


DSSP  EELL-----llLHHH-------hhhHHHHHHHHHHHHHHHLL----LLEEEEEELlllll
Query FSPR-----agDFNV-------sstWAAICNELCYRVSQLFP----DNFIGAAXLpqspg  111
ident                                 |     |                     
Sbjct VRYSphllansKVDPmpwnqtegdvTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrhqp  156
DSSP  EEELlhhhlllLLLLlhhhllllllLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEelllh


DSSP  LLHHHHHHHHHHHHHlLLLLEEEELLLllLLLLllLLLLLHHHHHHHHHHH-HHLLlEEE
Query VDPKTCIPELEKCVKeYGFVAINLNPDpsGGHWtsPPLTDRIWYPIYEKXV-ELEIpAXI  170
ident            |       ||  |  |                   ||  |         
Sbjct SWSLEVLELCKKYNQ-KTVVAMDLAGD--ETIE--GSSLFPGHVEAYEGAVkNGIH-RTV  210
DSSP  HHHHHHHHHHHHLLL-LLEEEEEEELL--LLLL--LHHHLHHHHHHHHHHHhHLLE-EEE


DSSP  LlllllhHHHHhHHHHHHhhhllhhhhlllLLEEELHhHLLLhHHHHHHhhhhhhlllll
Query HvstgahYLNAdTTAFXQcvagdlfkdfpeLKFVIPHgGGAVpYHWGRFrglaqexkkpl  230
ident |                                   | |                     
Sbjct H-----aGEVGsPEVVRE-------avdilKTERVGH-GYHT-IEDEAL-----------  245
DSSP  E-----eLLLLlHHHHHH-------hhhllLLLEEEE-LHHH-HHLHHH-----------


DSSP  hhHHLL-LLEEEELLLL-----------lhHHHHHHHHHLLhhHEELLLLLLLLLlleel
Query leDHVL-NNIFFDTCVY-----------hqPGIDLLNTVIPvdNVLFASEXIGAVrgidp  278
ident      |  |  |  |                            |                
Sbjct -yNRLLkENMHFEVCPWssyltgawdpkttHAVVRFKNDKA--NYSLNTDDPLIF-----  297
DSSP  -hHHHHhLLLEEEELHHhhhhlllllllllLHHHHHHHLLL--LEEELLLLLLLL-----


DSSP  llleELLL--LHHHHHHLLLLLHHHHHHHhLHHHHHHLhHHHH-HHHH----hhhhll
Query rtgfYYDD--TKRYIEASTILTPEEKQQIyEGNARRVYpRLDA-ALKA----kgkleh  329
ident                      | ||       ||      |     |           
Sbjct ----KSTLdtDYQMTKKDMGFTEEEFKRL-NINAAKSS-FLPEeEKKEllerlyreyq  349
DSSP  ----LLLHhhHHHHHHHLLLLLHHHHHHH-HHHHHHLL-LLLHhHHHHhhhhhhhhll


No 36: Query=2gwgA Sbjct=3mtwA Z-score=12.9

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------XI    2
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeeLE


DSSP  EEEEEELLL----llhHHHHHhhhhhhhhhlhhhlllhhhllllhHHHHHHHHlLHHHHH
Query IDIHGHYTT----apkALEDWrnrqiagikdpsvxpkvselkisdDELQASIIeNQLKKX   58
ident || | |                                                   || 
Sbjct IDMHVHLDSlaevggyNSLEY----------------------sdRFWSVVQT-ANAKKT   97
DSSP  EEEEELLLLlllllhhHHHHL----------------------lhHHHHHHHH-HHHHHH


DSSP  HHHLLLEEEEELLlllhhhhhhhhhhHHHHHHHHHHHLL------LLEEEE-EELLLLL-
Query QERGSDLTVFSPRagdfnvsstwaaiCNELCYRVSQLFP------DNFIGA-AXLPQSP-  110
ident  | |                                              |         
Sbjct LEAGFTTVRNVGA-------------ADYDDVGLREAIDagyvpgPRIVTAaISFGATGg  144
DSSP  HHLLEEEEEELLL-------------LLLHHHHHHHHHHllllllLEEEELlLLEELLLl


DSSP  ------------------lLLHHHHHHHHHHHHHLLlLLEEEELLL---llLLLL-llll
Query ------------------gVDPKTCIPELEKCVKEYgFVAINLNPD---psGGHW-tspp  148
ident                      |           |      |           |       
Sbjct hcdstffppsmdqknpfnsDSPDEARKAVRTLKKYG-AQVIXICATggvfsRGNEpgqqq  203
DSSP  llllllllhhhllllllllLLHHHHHHHHHHHHHLL-LLEEEEELLlllllLLLLlllll


DSSP  LLLHHHHHHHHHHHHHLLLEEELlllllhhhhHHHHHHHHhhhllhhhhlllLLEEELHh
Query LTDRIWYPIYEKXVELEIPAXIHvstgahylnADTTAFXQcvagdlfkdfpeLKFVIPHg  208
ident ||               |    |                                 | | 
Sbjct LTYEEMKAVVDEAHMAGIKVAAH--------aHGASGIRE--------avraGVDTIEH-  246
DSSP  LLHHHHHHHHHHHHHLLLEEEEE--------eLLHHHHHH--------hhhlLLLEEEE-


DSSP  HLLLhhhhhhhhhhhhhlllllhhHHLL-LLEEEELLLLL--------------------
Query GGAVpyhwgrfrglaqexkkplleDHVL-NNIFFDTCVYH--------------------  247
ident    |                             |    |                     
Sbjct ASLV---------------ddegiKLAVqKGAYFSMDIYNtdytqaegkkngvlednlrk  291
DSSP  LLLL---------------lhhhhHHHHhHLLEEELLLLLhhhhhhhhhhhlllhhhhhh


DSSP  ----hHHHHHHHHHLL--hhHEELLLLLLLLLlleelllleellLLHHHHHH--LLLLLH
Query ----qPGIDLLNTVIP--vdNVLFASEXIGAVrgidprtgfyydDTKRYIEA--STILTP  299
ident                                             |             ||
Sbjct drdigELQRENFRKALkagvKMVYGTDAGIYP----------hgDNAKQFAVmvRYGATP  341
DSSP  hhhhhHHHHHHHHHHHhhllEEELLLLLLLLL----------llLHHHHHHHhhHLLLLH


DSSP  HHHHHHHLHHHHHHLHhHHHHH-----HHHH-----------------------------
Query EEKQQIYEGNARRVYPrLDAAL-----KAKG-----------------------------  325
ident     |     |                   |                             
Sbjct LQAIQSATLTAAEALG-RSKDVgqvavGRYGdmiavagdpladvttlekpvfvmkggavv  400
DSSP  HHHHHHLLHHHHHHHL-LLLLLlllllLLLLleeeelllllllhhhhhllleeeelleee


DSSP  hhll
Query kleh  329
ident     
Sbjct kapx  404
DSSP  elll


No 37: Query=2gwgA Sbjct=3mkvA Z-score=12.9

back to top
DSSP  ---------------------------------------------------------LLE
Query ---------------------------------------------------------XII    3
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeeLEE


DSSP  EEEEELLLL---lhHHHHhhhhhhhhhhlhhhlllhhhllLLHHHHHHHHHLLHhHHHHH
Query DIHGHYTTA---pkALEDwrnrqiagikdpsvxpkvselkISDDELQASIIENQlKKXQE   60
ident | | |                                                       
Sbjct DLHVHVVAIefnlpRVAT----------------------LPNVLVTLRAVPIM-RAMLR   97
DSSP  EEEELLLLLlllhhHHLL----------------------LLHHHHHHHHHHHH-HHHHH


DSSP  HLLLEEEEELLlllhhhhhhhhhhhhhhHHHHHHHLL------lLEEEEE-ELLLLL---
Query RGSDLTVFSPRagdfnvsstwaaicnelCYRVSQLFP------dNFIGAA-XLPQSP---  110
ident ||                           |   |                  | |     
Sbjct RGFTTVRDAGG----------------aGYPFKQAVEsglvegpRLFVSGrALSQTGgha  141
DSSP  LLEEEEEELLL----------------lLHHHHHHHHlllllllEEEELLlEEELLLlll


DSSP  ---------------------------lLLHHHHHHHHHHHHHLLlLLEEEELLL-----
Query ---------------------------gVDPKTCIPELEKCVKEYgFVAINLNPD-----  138
ident                                                  |          
Sbjct dprarsdymppdspcgccvrvgalgrvaDGVDEVRRAVREELQMG-ADQIXIMASggvas  200
DSSP  lllllllllllllllllllllllleeelLLHHHHHHHHHHHHHHL-LLLEEEELLlllll


DSSP  -lLLLLLllllllLHHH-HHHHHHHHHHLLLEEELlllllhhhhHHHH-HHHHhhhllhh
Query -pSGGHWtsppltDRIW-YPIYEKXVELEIPAXIHvstgahylnADTT-AFXQcvagdlf  195
ident                     |             |         | |  |          
Sbjct ptDPVGV---fgySEDEiRAIVAEAQGRGTYVLAH---------AYTPaAIAR-------  241
DSSP  llLLLLL---lllLHHHhHHHHHHHHLLLLLEEEE---------ELLHhHHHH-------


DSSP  hhlllLLEEELHhHLLLHHHhhhhhhhhhhlllllhhHHLL-LLEEEELLLL--------
Query kdfpeLKFVIPHgGGAVPYHwgrfrglaqexkkplleDHVL-NNIFFDTCVY--------  246
ident          | | |                         |                    
Sbjct -avrcGVRTIEH-GNLIDDE---------------taRLVAeHGAYVVPTLVtydalase  284
DSSP  -hhhlLLLEEEE-LLLLLHH---------------hhHHHHhHLLEEELLHHhhhhhhhh


DSSP  ----------------lhHHHHHHHHHLL--hHHEELLLLLlLLLLleelllleELLL-L
Query ----------------hqPGIDLLNTVIP--vDNVLFASEXiGAVRgidprtgfYYDD-T  287
ident                                     |                       
Sbjct gekyglppesiakiadvhGAGLHSIEIMKragVKMGFGTDL-LGEA-------qRLQSdE  336
DSSP  lllllllhhhhllhhhhhLLHHHHHHHHHhhlLLLLLLLLL-LHHH-------hHHLLhH


DSSP  HHHHHHLllLLHHHHHHHHLHHHHHHLHhhhhHHHH---hHHHL----------------
Query KRYIEAStiLTPEEKQQIYEGNARRVYPrldaALKA---kGKLE----------------  328
ident  |       | | |           |                                  
Sbjct FRILAEV--LSPAEVIASATIVSAEVLG----MQDKlgriVPGAhadvlvvdgnplksvd  390
DSSP  HHHHHLL--LLHHHHHHHLLHHHHHHLL----LLLLllllLLLLllleeeelllllllll


DSSP  -----------------------l
Query -----------------------h  329
ident                         
Sbjct cllgqgehiplvmkdgrlfvnele  414
DSSP  lllllllllleeeelleeeeelll


No 38: Query=2gwgA Sbjct=3griA Z-score=12.7

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------XIIDIHGH    8
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeLEEEEEEL


DSSP  LLLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEE
Query YTTAPkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVF   68
ident                                          |     |     |      
Sbjct LREPG------------------------------geykeTIET-GTKAAARGGFTTVCP   89
DSSP  LLLLL------------------------------lllllLHHH-HHHHHHHLLEEEEEE


DSSP  ELLLllhhhhhhhHHHHHHHHHHHHHHLL-LLEEEEEEL--LLLLlllhHHHHhHHHHHH
Query SPRAgdfnvsstwAAICNELCYRVSQLFP-DNFIGAAXL--PQSPgvdpKTCIpELEKCV  125
ident  |                |                 |     |      |         |
Sbjct XPNT----rpvpdSVEHFEALQKLIDDNAqVRVLPYASIttRQLG----KELV-DFPALV  140
DSSP  LLLL----lllllLHHHHHHHHHHHHHHLlLEELLLEELlhHHLL----LLLL-LHHHHH


DSSP  HlLLLLEEEELLLLlllllllllllLHHH-HHHHHHHHHHLLLEEEL-------llLLLH
Query KeYGFVAINLNPDPsgghwtsppltDRIW-YPIYEKXVELEIPAXIH-------vsTGAH  177
ident |  |  |                       |               |            |
Sbjct K-EGAFAFTDDGVG---------vqTASXxYEGXIEAAKVNKAIVAHcednsliygGAXH  190
DSSP  L-LLLLLEEELLLL---------llLHHHhHHHHHHHHHHLLLEEELlllhhhlllLLEE


DSSP  -------------hhHHHHHHHHHHhhlLHHHHLLlLLEEELhHHLL--LHHHhhhhhhh
Query -------------ylNADTTAFXQCvagDLFKDFPeLKFVIPhGGGA--VPYHwgrfrgl  222
ident                              |                              
Sbjct egkrskelgipgipnICESVQIARD--vLLAEAAG-CHYHVC-HVSTkeSVRV-------  239
DSSP  llhhhhhhllleellHHHHHHHHHH--hHHHHHHL-LLEEEL-LLLLhhHHHH-------


DSSP  hhhlllllHHHHLllLEEEELL-LLLHH----------------------hhHHHHHHLL
Query aqexkkplLEDHVlnNIFFDTC-VYHQP----------------------giDLLNTVIP  259
ident                                                       |     
Sbjct ----irdaKRAGI--HVTAEVTpHHLLLteddipgnnaiykxnpplrstedrEALLEGLL  293
DSSP  ----hhhhHHLLL--LEEEEELhHHHHLlhhhlllllhhhllllllllhhhhHHHHHHHH


DSSP  HH-HEELLLLLL---------------LLLLleelllleellLLHHHHHHL----LLLLH
Query VD-NVLFASEXI---------------GAVRgidprtgfyydDTKRYIEAS----TILTP  299
ident        |                                                  | 
Sbjct DGtIDCIATDHAphardekaqpxekapFGIV--------gseTAFPLLYTHfvknGDWTL  345
DSSP  LLlLLEELLLLLlllhhhhllllllllLLLL--------lllLHHHHHHHHhlllLLLLH


DSSP  HHHHHHHLHHHHHHLhhhHHHHhhhHHHL-------------------------------
Query EEKQQIYEGNARRVYprlDAALkakGKLE-------------------------------  328
ident                                                             
Sbjct QQLVDYLTIKPCETF---NLEYgtlKENGyadltiidldseqeikgedflskadntpfig  402
DSSP  HHHHHHHLHHHHHHL---LLLLlllLLLLllleeeeelllleellhhhllllllllllll


DSSP  -------------------l
Query -------------------h  329
ident                     
Sbjct ykvygnpiltxvegevkfeg  422
DSSP  leelleeeeeeelleeeeel


No 39: Query=2gwgA Sbjct=2ogjA Z-score=12.5

back to top
DSSP  --------------------------------------------------------LLEE
Query --------------------------------------------------------XIID    4
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeLEEE


DSSP  EEEELLLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHHHHHHHLLL
Query IHGHYTTAPkaledwrnrqiagikdpsvxpkvselkisddelqasiieNQLKKXQERGSD   64
ident  | |                                                   |||  
Sbjct LHVHIWHGG----------------------------------tdisiRPSECGAERGVT   86
DSSP  EEELLLLLL----------------------------------lllllLHHHLLHHHLEE


DSSP  EEEEELLlllhhhhhhhHHHHHHHHHH-HHHHLLLLEEEEEELL-----------LLLLL
Query LTVFSPRagdfnvsstwAAICNELCYR-VSQLFPDNFIGAAXLP-----------QSPGV  112
ident   |                                       |                 
Sbjct TLVDAGS---------aGEANFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpELRDI  137
DSSP  EEEEELL---------lLLLLHHHHHHhLLLLLLLEEEEEEELLlllllllllllLLLLH


DSSP  LHhHHHHHHHHHHHLLL--LLEEEELLL--LLLLlllLLLLllhhhHHHHHHHHHHLLLE
Query DPkTCIPELEKCVKEYG--FVAINLNPD--PSGGhwtSPPLtdriwYPIYEKXVELEIPA  168
ident            |  |     |           |                      |  | 
Sbjct KD-IDLDRILECYAENSehIVGLXVRAShvITGS---WGVT---pvKLGKKIAKILKVPX  190
DSSP  HH-LLHHHHHHHHHLLLllEEEEEEEELhhHHLL---LLLH---hhHHHHHHHHHHLLLE


DSSP  EELlllllhhHHHHhHHHHHHHhllhhhhllLLLEEELHHHL----LLHHHHHHHhhhhh
Query XIHvstgahyLNADtTAFXQCVagdlfkdfpELKFVIPHGGG----AVPYHWGRFrglaq  224
ident | |                                |  |                     
Sbjct XVH------vGEPPaLYDEVLE-------ilGPGDVVTHCFNgksgSSIXEDEDL-----  232
DSSP  EEE------eLLLLlLHHHHHH-------hlLLLLEEELLLLllllLLLLLLHHH-----


DSSP  hllllLHHHHLlLLEEEELLL----LLHHHHHHHH-HHLLhhHEELLLLLLLLLLLeell
Query exkkpLLEDHVlNNIFFDTCV----YHQPGIDLLN-TVIPvdNVLFASEXIGAVRGidpr  279
ident       |       |  |                                 |        
Sbjct ----fNLAERC-EGIRLDIGHggasFSFKVAEAAIaRGLL--PFSISTDLHGHSXN----  281
DSSP  ----hHHHHHL-LLLEEELLLllllLLHHHHHHHHhLLLL--LLLLLLLLLLLLLL----


DSSP  lleELLL-LHHHHHH--LLLLLHHHHHHHHLHHHHHHLhhHHHHhhhhHHHLL-------
Query tgfYYDD-TKRYIEA--STILTPEEKQQIYEGNARRVYprLDAAlkakGKLEH-------  329
ident                  |     |        |   |                       
Sbjct ---FPVWdLATTXSKllSVDXPFENVVEAVTRNPASVI--RLDX-enrLDVGQradftvf  335
DSSP  ---LLLLlHHHHHHHhhHLLLLHHHHHHLLLHHHHHHL--LLLL-lllLLLLLlleeeee


DSSP  --------------------------------------------
Query --------------------------------------------  329
ident                                             
Sbjct dlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 40: Query=2gwgA Sbjct=3icjA Z-score=12.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  LLEEEEEE--LLLL----------------------------------------------
Query XIIDIHGH--YTTA----------------------------------------------   12
ident    | | |                                                    
Sbjct AFFDSHLHldELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELhhHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  -----------------------------------------------lhhhHHHHhhhhh
Query -----------------------------------------------pkalEDWRnrqia   25
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKII-----  175
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHH-----


DSSP  hhhlhhhlllhhhLLLLHHHHHHHHHlLHHHHHHHHLLLEEEEELllllhhhhhhhhhhh
Query gikdpsvxpkvseLKISDDELQASIIeNQLKKXQERGSDLTVFSPragdfnvsstwaaic   85
ident                         |           |     |                 
Sbjct -----------neKILTVKDYKHYIE-SAQEHLLSLGVHSVGFMS--------------v  209
DSSP  -----------hhLLLLHHHHHHHHH-HHHHHHHHLLEEEEEEEE--------------e


DSSP  HHHHHHHHHHLL------LLEEEEEELLllllllhhhHHHH--hhHHHHL---lLLLEEE
Query NELCYRVSQLFP------DNFIGAAXLPqspgvdpktCIPE--leKCVKE---yGFVAIN  134
ident  |                 |                             |          
Sbjct GEKALKALFELEregrlkMNVFAYLSPE--------lLDKLeelnLGKFEgrrlRIWGVX  261
DSSP  LHHHHHHHHHHHhlllllLEEEEEELHH--------hHHHHhhhlLLLEEllleEEEEEE


DSSP  ELLL-----------------llLLLLlLLLLLLhHHHHHHHHHHHHLLLEEELlllllh
Query LNPD-----------------psGGHWtSPPLTDrIWYPIYEKXVELEIPAXIHvstgah  177
ident |  |                             |       |    |      |      
Sbjct LFVDgslgartallsepytdnptTSGE-LVMNKD-EIVEVIERAKPLGLDVAVH------  313
DSSP  EELLlllllllllllllllllllLLLL-LLLLHH-HHHHHHHHHLLLLLEEEEE------


DSSP  hhhHHHHHHHHHhhlLHHHHLLlLLEEELHhHLLLhhhHHHHhhhhhhlllllhHHHLL-
Query ylnADTTAFXQCvagDLFKDFPeLKFVIPHgGGAVpyhWGRFrglaqexkkpllEDHVL-  236
ident        |       | |         | |    |                         
Sbjct --aIGDKAVDVA--lDAFEEAE-FSGRIEH-ASLV---RDDQ------------LERIKe  352
DSSP  --eLLHHHHHHH--hHHHHHHL-LLLEEEE-LLLL---LHHH------------HHHHHh


DSSP  LLEEEELLL-LLHH-------------hhhHHHHHLLH-HHEELLLLLLLlllleellll
Query NNIFFDTCV-YHQP-------------gidLLNTVIPV-DNVLFASEXIGavrgidprtg  281
ident                                            |                
Sbjct LKVRISAQPhFIVSdwwivnrvgeerakwaYRLKTLSSiTKLGFSTDSPI----------  402
DSSP  HLLEEEELLlHHHHlllhhhhhhhhhhhhlLLHHHHHHhLLEEELLLLLL----------


DSSP  eeLLLLH-HHHHHLL---------LLLHHHHHHHHLHHHHHHLHhhHHHH-----HHHH-
Query fyYDDTK-RYIEAST---------ILTPEEKQQIYEGNARRVYPrlDAAL-----KAKG-  325
ident           | |               ||    |      |       |          
Sbjct --EPADPwVSIDAAVnryvvdpgeRVSREEALHLYTHGSAQVTL--AEDLgklerGFRAe  458
DSSP  --LLLLHhHHHHHHHhlllllhhhLLLHHHHHHHLLHHHHHHLL--LLLLlllllLLLLl


DSSP  ------hhll
Query ------kleh  329
ident           
Sbjct yiildrdplk  468
DSSP  eeeellllll


No 41: Query=2gwgA Sbjct=1a5kC Z-score=11.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------LLEEEEEELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlL
Query -------XIIDIHGHYTTapkaledwrnrqiagikdpsvxpkvselkisddelqasiieN   53
ident          || | |                                             
Sbjct egkivtaGGIDTHIHWIC----------------------------------------pQ  140
DSSP  llleeeeLEEEEEEELLL----------------------------------------lL


DSSP  HHHHHHHHLLLEEEEELL---lllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEEELllll
Query QLKKXQERGSDLTVFSPR---agdfnvsstwAAICNELCYRVSQLFPDNFIGAAXLpqsp  110
ident |       |    |                                | |           
Sbjct QAEEALVSGVTTMVGGGTgpaagthattctpGPWYISRMLQAADSLPVNIGLLGKG----  196
DSSP  HHHHHHHHLEEEEEEELLlllhhhhhlllllHHHHHHHHHHHHLLLLLEEEEEEEL----


DSSP  lllHHHHHHhHHHHHHLLlLLEEEELLLLlllllllllllLHHH-HHHHHHHHHHLLLEE
Query gvdPKTCIPeLEKCVKEYgFVAINLNPDPsgghwtsppltDRIW-YPIYEKXVELEIPAX  169
ident           |   |            |                         |  |   
Sbjct --nVSQPDA-LREQVAAG-VIGLEIHEDW---------gaTPAAiDCALTVADEMDIQVA  243
DSSP  --lLLLHHH-HHHHHHHL-LLEEEEEHHH---------llLHHHhHHHHHHHHHHLLEEE


DSSP  ELlllllhhhhhhhhHHHH--hHHLLHHHHLLLLLEEELHHHL-------LLHHhhhhhh
Query IHvstgahylnadttAFXQ--cVAGDLFKDFPELKFVIPHGGG-------AVPYhwgrfr  220
ident  |                       |             |  |                 
Sbjct LH------------sDTLNesgFVEDTLAAIGGRTIHTFHTEGaggghapDIIT------  285
DSSP  EE------------lLLLLlllLHHHHHHHHLLLLEEELLLLLlllllllLHHH------


DSSP  hhhhhlllllhhhhlLLLEEEELL-LLLHH------------------------------
Query glaqexkkplledhvLNNIFFDTC-VYHQP------------------------------  249
ident                  ||                                         
Sbjct ------------acaHPNILPSSTnPTLPYtlntidehldmlmvchhldpdiaedvafae  333
DSSP  ------------hhhLLLEEEEEEhHHLLLlllhhhhhhhhhhhhhllllllhhhhhlll


DSSP  ---------HHHHHHHHLLHhhEELLLLLLLLllleelllleellLLHHHHHH-LLLL--
Query ---------GIDLLNTVIPVdnVLFASEXIGAvrgidprtgfyydDTKRYIEA-STIL--  297
ident            | |         |  |                                 
Sbjct srirretiaAEDVLHDLGAF--SLTSSDSQAM---------grvgEVILRTWQvAHRMkv  382
DSSP  llllhhhhhHHHHHHHLLLL--LEEELLLLLL---------llllLHHHHHHHhHHHHhh


DSSP  ---------------LHHHHHHHHLHHHHHHLHhHHHHH----hHHHH------------
Query ---------------TPEEKQQIYEGNARRVYPrLDAAL----kAKGK------------  326
ident                        |  |                  |              
Sbjct qrgalaeetgdndnfRVKRYIAKYTINPALTHG-IAHEVgsievGKLAdlvvwspaffgv  441
DSSP  hhlllllllllllhhHHHHHHHLLLHHHHHHLL-LLLLLlllllLLLLleeeelhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct kpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangva  501
DSSP  llleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  326
ident                                                             
Sbjct erlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaq  561
DSSP  hhllllleeeellllllllhhhllllllllleeelllllleeelleelllllllllllll


DSSP  --hll
Query --leh  329
ident      
Sbjct ryflf  566
DSSP  lllll


No 42: Query=2gwgA Sbjct=3e74A Z-score=11.9

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------XIIDIHGH    8
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeLEEEEEEL


DSSP  LllllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEE
Query YttapkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVF   68
ident                                                      |      
Sbjct I---------------------------------------GYET-GTRAAAKGGITTXIE   80
DSSP  L---------------------------------------LHHH-HHHHHHHLLEEEEEE


DSSP  ELLLllhhhhhhhhhHHHH---HHHHHHHHL----llLEEEEEELLLlllllhhHHHHHH
Query SPRAgdfnvsstwaaICNE---LCYRVSQLF----pdNFIGAAXLPQspgvdpkTCIPEL  121
ident  |                                          |           |  |
Sbjct XPLN---------qlPATVdraSIELKFDAAkgkltiDAAQLGGLVS-------YNIDRL  124
DSSP  LLLL---------llLLLLlhhHHHHHHHHHllllllEEEELEELLL-------LLLLLH


DSSP  HHHHHlLLLLEEEELLLLlllllllllllLHHH-HHHHHHHHHHLLLEEEL---------
Query EKCVKeYGFVAINLNPDPsgghwtsppltDRIW-YPIYEKXVELEIPAXIH---------  171
ident        | |                             |  ||  |   |         
Sbjct HELDE-VGVVGFXCFVRD----------vNDWQfFKGAQKLGELGQPVLVHcenalicde  173
DSSP  HHHHH-HLLLLEEEELLL----------lLHHHhHHHHHHHHHHLLLEEEElllhhhhhh


DSSP  --------------lllllhhhHHHHHHHHHHhhlLHHHHLlLLLEEELHHHL-LLHHhh
Query --------------vstgahylNADTTAFXQCvagDLFKDFpELKFVIPHGGG-AVPYhw  216
ident                            |        | |          |          
Sbjct lgeeakregrvtahdyvasrpvFTEVEAIRRV--lYLAKVA-GCRLHVCHVSSpEGVE--  228
DSSP  hhhhhhhhllllhhhhhhlllhHHHHHHHHHH--hHHHHHH-LLLEEELLLLLhHHHH--


DSSP  hhhhhhhhhlllllHHHHLllLEEEELL-LLLH-------------------------HH
Query grfrglaqexkkplLEDHVlnNIFFDTC-VYHQ-------------------------PG  250
ident                       |    |  |                            |
Sbjct ---------evtraRQEGQ--DITCESCpHYFVldtdqfeeigtlakcsppirdlenqKG  277
DSSP  ---------hhhhhHHLLL--LEEEEELlHHHHllhhhhhhhlhhhllllllllhhhhHH


DSSP  HHHHHHHLLhhHEELLLLLL---------------LLLLleelllleellLLHHHHHHL-
Query IDLLNTVIPvdNVLFASEXI---------------GAVRgidprtgfyydDTKRYIEAS-  294
ident                 |                  |                        
Sbjct XWEKLFNGE--IDCLVSDHSpcppexkagnixkawGGIA--------glqSCXDVXFDEa  327
DSSP  HHHHHHLLL--LLEELLLLLlllllllllllllllLLLL--------lhhHHHHHHHHHh


DSSP  ---LLLLHHHHHHHHLHHHHHHLHhhHHHHhhhHHHL-----------------------
Query ---TILTPEEKQQIYEGNARRVYPrlDAALkakGKLE-----------------------  328
ident                  ||                                         
Sbjct vqkRGXSLPXFGKLXATNAADIFG--LQQKgriAPGKdadfvfiqpnssyvltnddleyr  385
DSSP  lllLLLLHHHHHHHHLHHHHHHLL--LLLLlllLLLLllleeeeelllleellhhhllll


DSSP  -------------------------------------------l
Query -------------------------------------------h  329
ident                                             
Sbjct hkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  llllllllleelleeeeeeelleeeeelllllllllllleelll


No 43: Query=2gwgA Sbjct=1j5sA Z-score=11.7

back to top
DSSP  -------------------------LLEEEEEELLLLlhhhhhhhhhhhhhhhlhhhlll
Query -------------------------XIIDIHGHYTTApkaledwrnrqiagikdpsvxpk   35
ident                           | | | |                           
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLDAK-----------------------   37
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLLHH-----------------------


DSSP  hhhllllhhhHHHH----------------------------------------------
Query vselkisddeLQAS----------------------------------------------   49
ident                                                             
Sbjct --------diVENKpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakv   89
DSSP  --------hhHHLLllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhh


DSSP  -------------------------------------------hhLLHHHHHHHHLLLEE
Query -------------------------------------------iiENQLKKXQERGSDLT   66
ident                                                  |          
Sbjct fprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpeMTPQKLLRDMKVEIL  149
DSSP  hhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllLLHHHHHHHLLEEEE


DSSP  EEELllllhhhhhhhHHHHhHHHHHHHHHL-lLLEEEEEEL-LLLLL-------------
Query VFSPragdfnvsstwAAICnELCYRVSQLF-pDNFIGAAXL-PQSPG-------------  111
ident                     |                                       
Sbjct CTTD---------dpVSTL-EHHRKAKEAVegVTILPTWRPdRAMNVdkegwreyvekmg  199
DSSP  ELLL---------llLLLL-HHHHHHHHHLllLEEELLLLLhHHHLLllllhhhhhhhhh


DSSP  -----------lLHHHHHHHHHHHHhLLLLLEEEELLLlllllllllLLLL---------
Query -----------vDPKTCIPELEKCVkEYGFVAINLNPDpsgghwtspPLTD---------  151
ident                      |    | | ||               |            
Sbjct erygedtstldgFLNALWKSHEHFK-EHGCVASDHALL--------ePSVYyvdenrara  250
DSSP  hhhllllllhhhHHHHHHHHHHHHH-LLLLLEEEEEEL--------lLLLLlllhhhhhh


DSSP  ---------------------HHHHHHHHHHHHHLLLEEEL-----------------ll
Query ---------------------RIWYPIYEKXVELEIPAXIH-----------------vs  173
ident                                 |       |                   
Sbjct vhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHigalrdyrdslfktlgpds  310
DSSP  hhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEeleellllhhhhhhlllll


DSSP  LLLHhhhhhhhhHHHHhhLLHHHHLL-LLLEEELhhHLLLhHHHHhhhhhhhhllllLHH
Query TGAHylnadttaFXQCvaGDLFKDFP-ELKFVIPhgGGAVpYHWGrfrglaqexkkpLLE  232
ident  |                      |   || |          |                 
Sbjct GGDI--stnflrIAEG-lRYFLNEFDgKLKIVLY--VLDP-THLP---------tisTIA  355
DSSP  LLLE--elllllHHHH-hHHHHHHLLlLLLEEEE--ELLH-HHHH---------hhhHHH


DSSP  HHLlLLEE-EELL--LLLHHHHHHHHHHL-----LHHHEELLLLLLLlllleelllleel
Query DHVlNNIF-FDTC--VYHQPGIDLLNTVI-----PVDNVLFASEXIGavrgidprtgfyy  284
ident      |              |                                       
Sbjct RAF-PNVYvGAPWwfNDSPFGMEMHLKYLasvdlLYNLAGMVTDSRK---------llsf  405
DSSP  HHL-LLEEeLLLLllLLLHHHHHHHHHHHhllllHHHLLLLLLLLLL---------llhh


DSSP  lLLHHHHHH--LLLL-------------LHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll
Query dDTKRYIEA--STIL-------------TPEEKQQIYEGNARRVYPrldaalkakgkleh  329
ident            |                  |                             
Sbjct gSRTEMFRRvlSNVVgemvekgqipikeARELVKHVSYDGPKALFF--------------  451
DSSP  hHHHHHHHHhhHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL--------------


No 44: Query=2gwgA Sbjct=3iacA Z-score=11.6

back to top
DSSP  --------------------------LLEEEEEELLLLlhhhhhhhhhhhhhhhlhhhll
Query --------------------------XIIDIHGHYTTApkaledwrnrqiagikdpsvxp   34
ident                            | | | |                          
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLSPQ----------------------   38
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLLHH----------------------


DSSP  lhhhllllhhhHHHH---------------------------------------------
Query kvselkisddeLQAS---------------------------------------------   49
ident                                                             
Sbjct ---------eiADDRrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawa   89
DSSP  ---------hhHHLLllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhh


DSSP  -------------------------------------------------hHLLHhHHHHH
Query -------------------------------------------------iIENQlKKXQE   60
ident                                                          || 
Sbjct ntvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpaFSAR-GIXQQ  148
DSSP  hhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhHLHH-HHHHH


DSSP  HLLLEEEEELllllhhhhhhhHHHHHHHHHHHHHH--LLLLEEEEEELLL--LLLL----
Query RGSDLTVFSPragdfnvsstwAAICNELCYRVSQL--FPDNFIGAAXLPQ--SPGV----  112
ident                           |                                 
Sbjct XNVRXVGTTD----------dPIDSLEYHRQIAADdsIDIEVAPSWRPDKvfKIELdgfv  198
DSSP  LLEEEEELLL----------lLLLLLHHHHHHHHLllLLLEEELLLLLHHhhLLLLllhh


DSSP  ------------------LHHH-HHHHHHHHHhLLLLLEEEELLLllllllLLLL-----
Query ------------------DPKT-CIPELEKCVkEYGFVAINLNPDpsgghwTSPP-----  148
ident                   |        |       |  |            |        
Sbjct dylrkleaaadvsitrfdDLRQaLTRRLDHFA-ACGCRASDHGIE------TLRFapvpd  251
DSSP  hhhhhhhhhhllllllhhHHHHhHHHHHHHHH-HLLLLEEEEEEL------LLLLlllll


DSSP  ------------------------llLHHHHHHHHHHHHHLLLEEEL-------------
Query ------------------------ltDRIWYPIYEKXVELEIPAXIH-------------  171
ident                                               |             
Sbjct daqldailgkrlagetlseleiaqftTAVLVWLGRQYAARGWVXQLHigairnnntrxfr  311
DSSP  hhhhhhhhhhhhllllllhhhhhhhhHHHHHHHHHHHHHHLLEEEEEeleellllhhhhh


DSSP  -----llLLLHhhhhhhhhhHHHHH--LLHHHHLLLLLEEELhhHLLL-HHHHhhhhhhh
Query -----vsTGAHylnadttafXQCVA--GDLFKDFPELKFVIPhgGGAV-PYHWgrfrgla  223
ident                                      |                      
Sbjct llgpdtgFDSI---gdnnisWALSRllDSXDVTNELPKTILY--CLNPrDNEV-------  359
DSSP  hhlllllLLEE---lllllhHHHHHhhHHHHLLLLLLEEEEE--ELLHhHHHH-------


DSSP  hhlllllHHHHLL-----LLEEEELLL---LLHHHHHHHHHHL-----LHHHEELLLLLL
Query qexkkplLEDHVL-----NNIFFDTCV---YHQPGIDLLNTVI-----PVDNVLFASEXI  270
ident                       |           |                 |       
Sbjct ----latXIGNFQgpgiaGKVQFGSGWwfnDQKDGXLRQLEQLsqxglLSQFVGXLTDSR  415
DSSP  ----hhhHHHHLLlllllLLEEELLLLhhhLLHHHHHHHHHHHhhhllHHHLLLLLLLLL


DSSP  LlllleelllleelLLLH-HHHHH-LLLL---------------LHHHHHHHHLHHHHHH
Query GavrgidprtgfyyDDTK-RYIEA-STIL---------------TPEEKQQIYEGNARRV  313
ident                             |                    | |   || | 
Sbjct S----------flsYTRHeYFRRIlCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRY  465
DSSP  L----------lllLHHHhHHHHHhHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHH


DSSP  LHHhhhhhhhhhhhll
Query YPRldaalkakgkleh  329
ident                 
Sbjct FTI------------k  469
DSSP  LLL------------l


No 45: Query=2gwgA Sbjct=4rdvB Z-score=11.5

back to top
DSSP  -------------------------------------------------LLEEEEEELLL
Query -------------------------------------------------XIIDIHGHYTT   11
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpGMPNLHSHAFQ   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeLEEEEEELHHH


DSSP  -----------------------llHHHHHhhhhhhhhhhlhhhlllhhhllLLHHHHHH
Query -----------------------apKALEDwrnrqiagikdpsvxpkvselkISDDELQA   48
ident                                                      |      
Sbjct ramaglaevagnpndsfwtwrelmyRMVAR----------------------LSPEQIEV   98
DSSP  hhhlllllllllllllhhhhhhhhhHHHLL----------------------LLHHHHHH


DSSP  HHHlLHHHHHHHHLLLEEEEELL--lllhHHHHhhhHHHHHHHHHHHHHLLLLEEEEEEL
Query SIIeNQLKKXQERGSDLTVFSPR--agdfNVSStwaAICNELCYRVSQLFPDNFIGAAXL  106
ident              |                 |    |       |              |
Sbjct IAC-QLYIEMLKAGYTAVAEFHYvhhdldGRSYadpAELSLRISRAASAAGIGLTLLPVL  157
DSSP  HHH-HHHHHHHHHLEEEEEEEELllllllLLLLlllLHHHHHHHHHHHHHLLEEEEEELL


DSSP  LLL--------------lllLHHHHHHHHHHHHHLL----LLLEEEE-LLLLllllllll
Query PQS--------------pgvDPKTCIPELEKCVKEY----GFVAINL-NPDPsgghwtsp  147
ident                             |                               
Sbjct YSHagfggqpasegqrrfinGSEAYLELLQRLRAPLeaagHSLGLCFhSLRA--------  209
DSSP  LLEeellleellhhhlllllLHHHHHHHHHHHHHHHhhhlLEELEEElLLLL--------


DSSP  lllLHHHHHHH-HHHHhhLLLEEELlllllhHHHH----------hhHHHHHHHHLlHHH
Query pltDRIWYPIY-EKXVelEIPAXIHvstgahYLNA----------dtTAFXQCVAGdLFK  196
ident                     |  ||                                   
Sbjct -vtPQQIATVLaAGHD--DLPVHIH-----iAEQQkevddcqawsgrRPLQWLYEN-VAV  260
DSSP  -llHHHHHHHHlLLLL--LLLEEEE-----eLLLHhhhhhhhhhhllLHHHHHHHH-LLL


DSSP  HllllLEEELHhHLLLhhhHHHHhhhhhhlllllhhHHLL-LLEEEELLLL---lhhhhh
Query DfpelKFVIPHgGGAVpyhWGRFrglaqexkkplleDHVL-NNIFFDTCVY---hqpgid  252
ident |         |                                     |           
Sbjct D---qRWCLVH-ATHA---DPAE------------vAAMArSGAVAGLCLSteanlgdgi  301
DSSP  L---lLEEEEE-LLLL---LHHH------------hHHHHhHLLEEEELHHhhhhlllll


DSSP  hHHHHLL--hHHEELLLLLLLlllleelllleellLLHHHHHHL--------LLLL----
Query lLNTVIP--vDNVLFASEXIGavrgidprtgfyydDTKRYIEAS--------TILT----  298
ident    |            |                     |  |            |     
Sbjct fPATDFLaqgGRLGIGSDSHV---------slsvvEELRWLEYGqrlrdrkrNRLYrddq  352
DSSP  lLHHHHHhllLEEEELLLLLL---------lllhhHHHHHHHHHhhhhhlllLLLLllll


DSSP  ---HHHHHHHHLHHHHHHLhHHHH----hhHHHH--------------------------
Query ---PEEKQQIYEGNARRVYpRLDA----alKAKG--------------------------  325
ident                                                             
Sbjct pmiGRTLYDAALAGGAQAL-GQPIgslavgRRADllvldgndpylasaegdallnrwlfa  411
DSSP  llhHHHHHHHHHHHHHHHH-LLLLllllllLLLLeeeellllhhhhllllhhhhhhhhhh


DSSP  ------------------------------------hhll
Query ------------------------------------kleh  329
ident                                         
Sbjct ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 46: Query=2gwgA Sbjct=2uz9A Z-score=11.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------LLEEEEEE-LLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhHHHHHHH
Query ---------XIIDIHGH-YTTApkaledwrnrqiagikdpsvxpkvselkisdDELQASI   50
ident             | | |                                    |      
Sbjct lshheffmpGLVDTHIHaSQYS---fagssidlpllewltkytfpaehrfqniDFAEEVY  117
DSSP  llllleeeeLEEEEEEEhHHHH---hllllllllhhhhhhhlhhhhhhhhhlhHHHHHHH


DSSP  HlLHHHHHHHHLLLEEEEELLlllhhhhhhhHHHHHHHHHHHHHHLLlLEEEEEELlLLL
Query IeNQLKKXQERGSDLTVFSPRagdfnvsstwAAICNELCYRVSQLFPdNFIGAAXLpQSP  110
ident            |                         |       |              
Sbjct T-RVVRRTLKNGTTTACYFAT---------iHTDSSLLLADITDKFG-QRAFVGKVcMDL  166
DSSP  H-HHHHHHHHLLEEEEEEELL---------lLHHHHHHHHHHHHHHL-LEEEEELEeLLL


DSSP  L----------LLHHH-HHHHHHHHhHLLL----LLEEEE-LLLLlllllllllllLHHH
Query G----------VDPKT-CIPELEKCvKEYG----FVAINL-NPDPsgghwtsppltDRIW  154
ident                                                             
Sbjct NdtfpeykettEESIKeTERFVSEM-LQKNysrvKPIVTPrFSLS----------cSETL  215
DSSP  LlllllllllhHHHHHhHHHHHHHH-HHHLllleEEEEEElLHHH----------lLHHH


DSSP  -HHHHHHHHHHLLLEEELlllllhHHHH---------hhhhhHHHHhllHHHHL-lLLLE
Query -YPIYEKXVELEIPAXIHvstgahYLNA---------dttafXQCVagdLFKDF-pELKF  203
ident                  |        |                        |      | 
Sbjct mGELGNIAKTRDLHIQSH-----iSENRdeveavknlypsykNYTS--vYDKNNllTNKT  268
DSSP  hHHHHHHHHHHLLEEEEE-----eLLLHhhhhhhhhhlllllLHHH--hHHHLLllLLLE


DSSP  EELHhHLLLhhhhhhhhhhhhhllllLHHHHLL-LLEEEELLLL---lhhhhhhHHHHLL
Query VIPHgGGAVpyhwgrfrglaqexkkpLLEDHVL-NNIFFDTCVY---hqpgidlLNTVIP  259
ident |  | |                                   |                  
Sbjct VMAH-GCYL---------------saEELNVFHeRGASIAHCPNsnlslssgflNVLEVL  312
DSSP  EEEE-LLLL---------------lhHHHHHHHhHLLEEEELHHhhhhllllllLHHHHH


DSSP  --hHHEELLLLLlLLLLleelllleellLLHHHHHHL-----------LLLLHHHHHHHH
Query --vDNVLFASEXiGAVRgidprtgfyydDTKRYIEAS-----------TILTPEEKQQIY  306
ident                             |  |                  ||  |     
Sbjct kheVKIGLGTDV-AGGY------sysmlDAIRRAVMVsnillinkvneKSLTLKEVFRLA  365
DSSP  hllLEEEELLLL-LLLL------lllhhHHHHHHHHHhhhhhhlllllLLLLHHHHHHHH


DSSP  LHHHHHHLHhHHHHH-----HHHH------------------------------------
Query EGNARRVYPrLDAAL-----KAKG------------------------------------  325
ident           ||                                                
Sbjct TLGGSQALG-LDGEIgnfevGKEFdailinpkasdspidlfygdffgdiseaviqkflyl  424
DSSP  LHHHHHHLL-LLLLLlllllLLLLleeeelllllllllllllhhhhlllllhhhhhhhhh


DSSP  ----------------hhll
Query ----------------kleh  329
ident                     
Sbjct gddrnieevyvggkqvvpfs  444
DSSP  llhhheeeeeelleeeelll


No 47: Query=2gwgA Sbjct=2imrA Z-score=10.9

back to top
DSSP  -------------------------------------------------------LLEEE
Query -------------------------------------------------------XIIDI    5
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleellLLLEE


DSSP  EEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhHHHHHHlLHHHHHHHHLLLE
Query HGHYTtapkaledwrnrqiagikdpsvxpkvselkisddeLQASIIeNQLKKXQERGSDL   65
ident | |                                       |             |   
Sbjct HTHLD---------msayefqalpyfqwipevvirgrhlrGVAAAQ-AGADTLTRLGAGG  110
DSSP  EEELL---------llhhhhhhlhhhhllhhhhhhhllllHHHHHH-HHHHHHHHLLLLL


DSSP  EEEELLlllhhhhhhhhhhHHHHHHHHHHhLLLL-eEEEEELLLLLLLLHHHHHHHHHHH
Query TVFSPRagdfnvsstwaaiCNELCYRVSQlFPDN-fIGAAXLPQSPGVDPKTCIPELEKC  124
ident                      |          |                           
Sbjct VGDIVW-------------APEVMDALLA-REDLsgTLYFEVLNPFPDKADEVFAAARTH  156
DSSP  EEEEEL-------------LHHHHHHHHL-LLLLleEEEEEELLLLHHHHHHHHHHHHHH


DSSP  HHLLL-------LLEEEE-LLLLlllllllllllLHHHHHHHHHHHHHLLLEEELlllll
Query VKEYG-------FVAINL-NPDPsgghwtsppltDRIWYPIYEKXVELEIPAXIHvstga  176
ident                     |              |              |  ||     
Sbjct LERWRrlerpglRLGLSPhTPFT---------vsHRLMRLLSDYAAGEGLPLQIH----v  203
DSSP  HHHHHlllllleEEEEEElLLLL---------llHHHHHHHHHHHHHHLLLLEEE----e


DSSP  HHHH-----------------------------------hhhHHHHHHHHLLHHhhllLL
Query HYLN-----------------------------------adtTAFXQCVAGDLFkdfpEL  201
ident                                           |                 
Sbjct AEHPtelemfrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDELGVL----AA  259
DSSP  LLLHhhhhhhhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHHHLLH----HH


DSSP  LEEELHhHLLLhhhHHHHhhhhhhlllllhhHHLL-LLEEEELLLL---lhhhhhhHHHH
Query KFVIPHgGGAVpyhWGRFrglaqexkkplleDHVL-NNIFFDTCVY---hqpgidlLNTV  257
ident      |    |                      |        ||                
Sbjct RPTLVH-MVNV---TPDD------------iARVArAGCAVVTCPRsnhhlecgtfDWPA  303
DSSP  LLEEEE-LLLL---LHHH------------hHHHHhHLLLEEELHHhhhhllllllLHHH


DSSP  LL--hHHEELLLLLLLLLLleelllleellLLHHHHHH-LLLLLHHHHHHHHLHHHHHH-
Query IP--vDNVLFASEXIGAVRgidprtgfyydDTKRYIEA-STILTPEEKQQIYEGNARRV-  313
ident        |                                  | |            || 
Sbjct FAaagVEVALGTDSVASGE------tlnvrEEVTFARQlYPGLDPRVLVRAAVKGGQRVv  357
DSSP  HHhllLLEEELLLLHHHHL------llllhHHHHHHHHhLLLLLHHHHHHHHHHHHHHHh


DSSP  -------lhhhhhhhhhhhhhll
Query -------yprldaalkakgkleh  329
ident                        
Sbjct gtpflrrgetwqegfrwelsrdl  380
DSSP  llllllllllllhhhlhhhllll


No 48: Query=2gwgA Sbjct=3qy6A Z-score=10.1

back to top
DSSP  lLEEEEEEL------LLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhHHHHHlLH
Query xIIDIHGHY------TTAPkaledwrnrqiagikdpsvxpkvselkisddelQASIIeNQ   54
ident   |||| |                                             |  |   
Sbjct -MIDIHCHIlpamddGAGD---------------------------------SADSI-EM   25
DSSP  -LEELLLLLllllllLLLL---------------------------------HHHHH-HH


DSSP  HHHHHHHLLLEEEEELLLllhhhhhhHHHHHHHHHHHHHHHLL-----LLEEEEeellll
Query LKKXQERGSDLTVFSPRAgdfnvsstWAAICNELCYRVSQLFP-----DNFIGAaxlpqs  109
ident        |       |            |   |                           
Sbjct ARAAVRQGIRTIIATPHH-nngvyknEPAAVREAADQLNKRLIkedipLHVLPG------   78
DSSP  HHHHHHLLLLEEELLLEE-lllllllLHHHHHHHHHHHHHHHHhllllLEEELL------


DSSP  llllhhhhhhhhhhhhhllllleEEELLLlllllllllllllhhHHHHHHH---hhhhLL
Query pgvdpktcipelekcvkeygfvaINLNPDpsgghwtsppltdriWYPIYEK---xvelEI  166
ident                                                             
Sbjct -----------------------QEIRIY------------gevEQDLAKRqllslndTK  103
DSSP  -----------------------LEEELL------------llhHHHHHLLllllhhhLL


DSSP  LEEELlllllhHHHHhhhHHHHHHH-lLHHHHLlLLLEEELHHHLL--LHHHHHhhhhhh
Query PAXIHvstgahYLNAdttAFXQCVA-gDLFKDFpELKFVIPHGGGA--VPYHWGrfrgla  223
ident    |                                  || |                  
Sbjct YILIE-----fPFDH---VPRYAEQlfYDLQLK-GYIPVIAHPERNreIRENPS------  148
DSSP  EEEEE-----lLLLL---LLLLHHHhhHHHHHL-LLEEEEELHHHLhhHHHLLH------


DSSP  hhllllLHHHHLlllEEEELL-LLLH--------HHHHHHHHHLLhhHEELLLLLLLLLL
Query qexkkpLLEDHVlnnIFFDTC-VYHQ--------PGIDLLNTVIPvdNVLFASEXIGAVR  274
ident        |                               |           ||       
Sbjct ---llyHLVEKG---AASQITsGSLAgifgkqlkAFSLRLVEANL--IHFVASDAHNVKT  200
DSSP  ---hhhHHHHLL---LEEEEEhHHHLllllhhhhHHHHHHHHLLL--LLEEELLLLLLLL


DSSP  leelllleelLLLHHHHHHL-LLLLHHHHHHHHlHHHHHHLHHhhhhhhhhhhhll
Query gidprtgfyyDDTKRYIEAS-TILTPEEKQQIYeGNARRVYPRldaalkakgkleh  329
ident             |             |        ||                   
Sbjct --------rnFHTQEALYVLeKEFGSELPYMLT-ENAELLLRNqtifrqppqpvkr  247
DSSP  --------llLLHHHHHHHHhHHHLLHHHHHHH-HHHHHHHLLlllllllllllll


No 49: Query=2gwgA Sbjct=3ooqA Z-score=9.7

back to top
DSSP  ----------------------------------------------------LLEEEEEE
Query ----------------------------------------------------XIIDIHGH    8
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeeLEEEEEEL


DSSP  --LLLL--LHHHhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLLHHHHHHHHLLL
Query --YTTA--PKALedwrnrqiagikdpsvxpkvselkisddelqaSIIENQLKKXQERGSD   64
ident                                                          |  
Sbjct igLFEEgvGYYY------------sdgneatdpvtphvkaldgfNPQDPAIERALAGGVT  108
DSSP  llLLLLllLHHH------------lllllllllllllllhhhhlLLLLHHHHHHHLLLEE


DSSP  EEEEELLLllhhhhhhhhhhhhhhhhhhHHHLLLleeeeeellllllllhhhhhhhhhhh
Query LTVFSPRAgdfnvsstwaaicnelcyrvSQLFPDnfigaaxlpqspgvdpktcipelekc  124
ident      |                                                      
Sbjct SVXIVPGS---anpvggqgsvikfrsiiVEECIV--------------------------  139
DSSP  EEEELLLL---llleeeeeeeeelllllHHHHEE--------------------------


DSSP  hhllLLLEEEELLL--LLLL---------LLLLLLllLHHHHH-----------------
Query vkeyGFVAINLNPD--PSGG---------HWTSPPltDRIWYP-----------------  156
ident                 |                     |                     
Sbjct ---kDPAGLKXAFGenPKRVygerkqtpsTRXGTAgvIRDYFTkvknyxkkkelaqkegk  196
DSSP  ---eEEEEEEEELLhhHHHHhhhllllllLHHHHHhhHHHHHHhhhhhhhhhhhhhhlll


DSSP  ----------HHHHHHHHLLLEEELlllllhhhhHHHHHHHHHhhLLHHHHLllLLEEEL
Query ----------IYEKXVELEIPAXIHvstgahylnADTTAFXQCvaGDLFKDFpeLKFVIP  206
ident             |      |||  |                                || 
Sbjct eftetdlkxeVGEXVLRKKIPARXH--------aHRADDILTA-iRIAEEFG--FNLVIE  245
DSSP  llllllhhhhHHHHHHLLLLLEEEE--------eLLHHHHHHH-hHHHHHHL--LLEEEE


DSSP  HhHLLLHHHHHhhhhhhhhlllllhhHHLLllEEEE-LLLLL--------hHHHHhHHHH
Query HgGGAVPYHWGrfrglaqexkkplleDHVLnnIFFD-TCVYH--------qPGIDlLNTV  257
ident | |                             |                           
Sbjct H-GTEAYKISK-------------vlAEKK--IPVVvGPLLTfrtklelkdLTXE-TIAK  288
DSSP  E-LLLHHHHHH-------------hhHHHL--LLEEeLLLLLllllhhhllLLLL-HHHH


DSSP  LL--hhHEELLLLLLLlllleelllleellLLHHHHHHLL--LLLHHHHHHHHLHHHHHH
Query IP--vdNVLFASEXIGavrgidprtgfyydDTKRYIEAST--ILTPEEKQQIYEGNARRV  313
ident                                               |    |   |    
Sbjct LLkdgvLIALXCDHPV----------ipleFATVQAATAXryGAKEEDLLKILTVNPAKI  338
DSSP  HHhlllLEEELLLLLL----------llhhHHHHHHHHHHhhLLLHHHHHHLLLHHHHHH


DSSP  LHhHHHHH-----HHHH--------------------------hhll
Query YPrLDAAL-----KAKG--------------------------kleh  329
ident    |                                           
Sbjct LG-LEDRIgsiepGKDAdlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  LL-LLLLLlllllLLLLleeeelllllllllleeeeeelleeeeell


No 50: Query=2gwgA Sbjct=2a3lA Z-score=8.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------LLEEEEEELL--------
Query ------------------------------------------XIIDIHGHYT--------   10
ident                                              | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   10
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  ----------llLHHHhhhhhhhhhhhhlhhhlllhhhLLLLHhHHHHHHHLLhHHHHHH
Query ----------taPKALedwrnrqiagikdpsvxpkvseLKISDdELQASIIENqLKKXQE   60
ident                                       |      |              
Sbjct nlkynpcgqsrlREIF-----------------lkqdnLIQGR-FLGEITKQV-FSDLEA  281
DSSP  hhhhllllllhhHHHH-----------------lllllLLLLL-LHHHHHHHH-HHHHLL


DSSP  HLLLEEEEELLlllhhHHHHHHHHHHHHhhhhhHHLLLLEEEEEELlLLLL---------
Query RGSDLTVFSPRagdfnVSSTWAAICNELcyrvsQLFPDNFIGAAXLpQSPG---------  111
ident                                   |   |      |              
Sbjct SKYQMAEYRIS--iygRKMSEWDQLASW-ivnnDLYSENVVWLIQLpRLYNiykdmgivt  338
DSSP  LLLEEEEEEEE--lllLLLLHHHHHHHH-hhllLLLLLLEEEEEEEeLLHHhhlllllll


DSSP  --LLHHH-HHHHHH---------hhhHLLL--LLEEEELLLlllLLLL------------
Query --VDPKT-CIPELE---------kcvKEYG--FVAINLNPDpsgGHWT------------  145
ident             |                    |   |  |                   
Sbjct sfQNILDnIFIPLFeatvdpdshpqlHVFLkqVVGFDLVDD-esKPERrptkhmptpaqw  397
DSSP  llHHHHHhHLLHHHhhhhlhhhllllHHHHllEEEEEEELL-llLLLLllllllllllll


DSSP  -----LLLLL-LHHH-HHHHHHHHH------HLLLEEELlllllhHHHHhHHHHHHHHHl
Query -----SPPLT-DRIW-YPIYEKXVE------LEIPAXIHvstgahYLNAdTTAFXQCVAg  192
ident                    |             |    |                     
Sbjct tnafnPAFSYyVYYCyANLYVLNKLreskgmTTITLRPH-----sGEAGdIDHLAATFL-  451
DSSP  lllllLLHHHhHHHHhHHHHHHHHHhlllllLLLEELLL-----lLLLLlLHHHHHHHH-


DSSP  lhhhhllllLEEELHhHLLLhHHHHHHhhhhhhlllllhhHHLLllEEEELLLL------
Query dlfkdfpelKFVIPHgGGAVpYHWGRFrglaqexkkplleDHVLnnIFFDTCVY------  246
ident             | | |                             |             
Sbjct --------tCHSIAH-GINL-RKSPVL---------qylyYLAQ--IGLAMSPLsnnslf  490
DSSP  --------hLLLLLL-LHHH-HHLHHH---------hhhhHHHL--LLEEELHHhhllll


DSSP  --LHHH-HHHHHHHLLhhHEELLLLLLLLLLLEelllleELLL--LHHHHHHLLLLLHHH
Query --HQPG-IDLLNTVIPvdNVLFASEXIGAVRGIdprtgfYYDD--TKRYIEASTILTPEE  301
ident                   ||                                   |    
Sbjct ldYHRNpFPVFFLRGL--NVSLSTDDPLQIHLT------KEPLveEYSIAASVWKLSACD  542
DSSP  llLLLLlHHHHHHLLL--LEEELLLLHHHHLLL------LLHHhhHHHHHHHHHLLLHHH


DSSP  HHHHHLHHHHHHLhhHHHHHHHH-------------------------------------
Query KQQIYEGNARRVYprLDAALKAK-------------------------------------  324
ident    |              |||                                       
Sbjct LCEIARNSVYQSG--FSHALKSHwigkdyykrgpdgndihktnvphirvefrdtiwkeem  600
DSSP  HHHHHHHHHHHLL--LLHHHHHHhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhh


DSSP  -----------hhhll
Query -----------gkleh  329
ident                 
Sbjct qqvylgkavisdevvp  616
DSSP  hhhlllllllllllll


No 51: Query=2gwgA Sbjct=1v77A Z-score=8.1

back to top
DSSP  -LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHHHHH
Query -XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkisddelqasiieNQLKKXQ   59
ident    |                                                        
Sbjct vKFIEMDIRDK------------------------------------------EAYELAK   18
DSSP  lLLEEEEELLH------------------------------------------HHHHHHH


DSSP  HhLLLEEEEelllllhhhhhhhHHHHHHHHHHHHhhllllEEEEeellllllllhhhhhh
Query ErGSDLTVFspragdfnvsstwAAICNELCYRVSqlfpdnFIGAaxlpqspgvdpktcip  119
ident |   |  |                                   |                
Sbjct E-WFDEVVV-----sikfneevDKEKLREARKEY------GKVA----------------   50
DSSP  H-HLLEEEE-----eeeellllLHHHHHHHHHHH------LLEE----------------


DSSP  hhhhhhhllllleEEELLLlllllllllLLLLhhhHHHHHHHHhhLLLEEELlllllhhh
Query elekcvkeygfvaINLNPDpsgghwtspPLTDriwYPIYEKXVelEIPAXIHvstgahyl  179
ident              | |                        |                   
Sbjct -------------ILLSNP---------KPSL--vRDTVQKFK--SYLIYVE--------   76
DSSP  -------------EEEELL---------LHHH--hHHHHHHLL--LLEEEEE--------


DSSP  hHHHH-HHHHhhhllhhhhlllLLEEELhHHLL-----LHHHhhhhhhhhhhllllLHHH
Query nADTT-AFXQcvagdlfkdfpeLKFVIPhGGGA-----VPYHwgrfrglaqexkkpLLED  233
ident                           |              |               |  
Sbjct -SNDLrVIRY--------siekGVDAII-SPWVnrkdpGIDH--------------VLAK  112
DSSP  -LLLHhHHHH--------hhhlLLLEEE-LLLLlllllLLLH--------------HHHH


DSSP  HLL-LLEEEELLLL------------LHHHHHHHHHHLL--hHHEELLLLLlLLLLleel
Query HVL-NNIFFDTCVY------------HQPGIDLLNTVIP--vDNVLFASEXiGAVRgidp  278
ident      |                                          |           
Sbjct LMVkKNVALGFSLRpllysnpyeranLLRFMMKAWKLVEkykVRRFLTSSA-QEKW----  167
DSSP  HHHhHLLEEEEELHhhhhllhhhhhhHHHHHHHHHHHHHhhlLLEEEELLL-LLHH----


DSSP  llleellLLHHHHHHLlLLLHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll
Query rtgfyydDTKRYIEAStILTPEEKQQIYEGNARRVYPrldaalkakgkleh  329
ident        |                                           
Sbjct -dvryprDLISLGVVI-GMEIPQAKASISMYPEIILK--------------  202
DSSP  -hlllhhHHHHHHHHL-LLLHHHHHHLLLHHHHHHHL--------------


No 52: Query=2gwgA Sbjct=1m65A Z-score=7.5

back to top
DSSP  lLEEEEEeLLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHH
Query xIIDIHGhYTTApkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQE   60
ident    | |   | |                                                
Sbjct yPVDLHM-HTVA------------------------------sthaysTLSD-YIAQAKQ   28
DSSP  lLEELLL-LLLL------------------------------llllllLHHH-HHHHHHH


DSSP  HLLLEEEEELLlllhhhhhhHHHHHHHHHHhhhHHLLL----LEEEEEELLLLlllLHHH
Query RGSDLTVFSPRagdfnvsstWAAICNELCYrvsQLFPD----NFIGAAXLPQSpgvDPKT  116
ident  |  |                                                   |   
Sbjct KGIKLFAITDH--gpdmedaPHHWHFINMR---IWPRVvdgvGILRGIEANIK-nvDGEI   82
DSSP  HLLLEEEEEEE--lllllllLLLHHHHHHH---HLLLEelleEEEEEEEEELL-llLLLL


DSSP  HhhHHHHHHHllLLLEEEELlLLLL-lLLLL--LLLLLhhHHHHHHHHhhhlllEEELll
Query CipELEKCVKeyGFVAINLNpDPSG-gHWTS--PPLTDriWYPIYEKXveleipAXIHvs  173
ident       |         |                          |            |   
Sbjct D--CSGKMFD--SLDLIIAG-FHEPvfAPHDkaTNTQA-mIATIASGN-----vHIIS--  129
DSSP  L--LLHHHHH--HLLEEEEE-LLLLllLLLLhhHHHHH-hHHHHHLLL-----lLEEL--


DSSP  lllhhhhHHHH-hhhHHHHllhhhhllLLLEEELH-hhLLLHhhhhhhhhhhhhlllllh
Query tgahylnADTT-afxQCVAgdlfkdfpELKFVIPH-ggGAVPyhwgrfrglaqexkkpll  231
ident                   |                                         
Sbjct ------hPGNPkyeiDVKA--vaeaaaKHQVALEInnsSNCR-------------evaaa  168
DSSP  ------lLLLLllllLHHH--hhhhhhHHLLEEEEellLLHH-------------hhhhh


DSSP  hHHLLllEEEEL-----------LLLLhhHHHHHHH-HLLHHHEELlllllllllleell
Query eDHVLnnIFFDT-----------CVYHqpGIDLLNT-VIPVDNVLFasexigavrgidpr  279
ident                                  |     |    |               
Sbjct vRDAG--GWVALgsdshtaftmgEFEE--CLKILDAvDFPPERILN--------------  210
DSSP  hHHHL--LLEEEelllllhhhllLLHH--HHHHHHHlLLLHHHLHH--------------


DSSP  lleellllhhhhhhlllllhhhhhhHHLHHHHHHLH--HHHHHhHHHHhhll
Query tgfyyddtkryieastiltpeekqqIYEGNARRVYP--RLDAAlKAKGkleh  329
ident                                                     
Sbjct -------------------------VSPRRLLNFLEsrGMAPI-AEFA--dl  234
DSSP  -------------------------HLHHHHHHHHHhlLLLLL-HHHL--ll


No 53: Query=2gwgA Sbjct=3au2A Z-score=7.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------lLEEEEEELLlllhhhhhhhhhhh
Query ------------------------------------xIIDIHGHYTtapkaledwrnrqi   24
ident                                        |   | |              
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHST--------------  346
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLL--------------


DSSP  hhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEELL--lllHHHHhhHH
Query agikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVFSPR--agdFNVSstWA   82
ident                            |         |                      
Sbjct ------------------ysdgqnTLEE-LWEAAKTMGYRYLAVTDHspavrVAGG--PS  385
DSSP  ------------------llllllLHHH-HHHHHHHHLLLEEEEEEElhhhhLLLL--LL


DSSP  HHHHHHHHHHHHHLL-----lLEEEEEELlllllLLHHhhHHHHHHHHHllLLLEEEELL
Query AICNELCYRVSQLFP-----dNFIGAAXLpqspgVDPKtcIPELEKCVKeyGFVAINLNP  137
ident              |            |        |                        
Sbjct PEEALKRVGEIRRFNethgppYLLAGAEV--dihPDGT--LDYPDWVLR--ELDLVLVSV  439
DSSP  HHHHHHHHHHHHHHHhhhlllEEEEEEEE--ellLLLL--LLLLHHHHL--LLLEEEEEL


DSSP  LLLlllLLLLL-llLHHHHHHHHHHhhhLLLEEEL---llLLLHhhhhhhhhhHHHHhLL
Query DPSgghWTSPP-ltDRIWYPIYEKXvelEIPAXIH---vsTGAHylnadttafXQCVaGD  193
ident          |            |           |      |                  
Sbjct HSR---FNLPKadqTKRLLKALENP---FVHVLAHptarlLGRR-----apieADWE-AV  487
DSSP  LLL---LLLLHhhhHHHHHHHHLLL---LLLEELLlllllLLLL-----llllLLHH-HH


DSSP  HHhhLLLLLEEELH-----hHLLLHhhhhhhhhhhhhlllllhHHHLllLEEEE------
Query LFkdFPELKFVIPH-----gGGAVPyhwgrfrglaqexkkpllEDHVlnNIFFD------  242
ident           |                                                 
Sbjct FQkaKEKGVAVEIDgyydrmDLPDD-------------larmaYGMG--LWISLstdahq  532
DSSP  HHhhHHHLLEEEEEllllllLLLHH-------------hhhhhHHLL--LLEEEelllll


DSSP  ----lLLLLhhhhHHHHH-HLLHHHEELlllllllllleelllleellllhhhhhhllll
Query ----tCVYHqpgiDLLNT-VIPVDNVLFasexigavrgidprtgfyyddtkryieastil  297
ident                     |    ||                                 
Sbjct tdhlrFMEL--avGTAQRaWIGPERVLN--------------------------------  558
DSSP  hhhhhHHHH--hhHHHHHlLLLLLLLHH--------------------------------


DSSP  lhhhhhhHHLH-hhHHHLHHhhhhhhhhhhhll
Query tpeekqqIYEG-naRRVYPRldaalkakgkleh  329
ident                                  
Sbjct -------TLDYedlLSWLKA---------rrgv  575
DSSP  -------HLLHhhhHHHHHL---------llll


No 54: Query=2gwgA Sbjct=3dcpA Z-score=6.2

back to top
DSSP  LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHH
Query XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQE   60
ident |  | | |                                           |    |  |
Sbjct XKRDGHTHTE------------------------------fcphgthdDVEE-XVLKAIE   29
DSSP  LLEEEEELLL------------------------------llllllllLHHH-HHHHHHH


DSSP  HLLLEEEEELL-----------------lllhhhHHHHHHHHHHHHHHHHHHLL--LLEE
Query RGSDLTVFSPR-----------------agdfnvSSTWAAICNELCYRVSQLFP--DNFI  101
ident    |                                                        
Sbjct LDFDEYSIVEHaplssefxkntagdkeavttasxAXSDLPYYFKKXNHIKKKYAsdLLIH   89
DSSP  LLLLEEEEEEEllllhhhhhllllllhhhhllllLHHHHHHHHHHHHHHHHHLLllLEEE


DSSP  EEeellllllllhhhhhhhhhhhhhllllleEEELLLlllllllllllllHHHHHHHHHH
Query GAaxlpqspgvdpktcipelekcvkeygfvaINLNPDpsgghwtsppltdRIWYPIYEKX  161
ident                                                             
Sbjct IG-----------------------------FEVDYL------------iGYEDFTRDFL  108
DSSP  EE-----------------------------EEEELL------------lLLHHHHHHHH


DSSP  HHHLL---lEEELLL---------LLLH----------------------hHHHHHHHHH
Query VELEI---pAXIHVS---------TGAH----------------------yLNADTTAFX  187
ident  |                                                 |        
Sbjct NEYGPqtddGVLSLHflegqggfrSIDFsaedynegivqfyggfeqaqlayLEGVKQSIE  168
DSSP  HHHHHhlleEEEELLeeeelleeeELLLlhhhhhhhlhhhhllhhhhhhhhHHHHHHHHH


DSSP  HhhhllhhhhlLLLL-EEELHH------------------------hlLLHHhhhhhhhh
Query QcvagdlfkdfPELK-FVIPHG------------------------ggAVPYhwgrfrgl  222
ident               |     |                                       
Sbjct A--------dlGLFKpRRXGHIslcqkfqqffgedtsdfseevxekfrVILA--------  212
DSSP  L--------llLLLLlLEELLLlhhhllhhhhlllhhhllhhhhhhhhHHHH--------


DSSP  hhhlllllhhHHLLllEEEELL------------LLLHHHHHHHHHHLLhhHEELLLLLL
Query aqexkkplleDHVLnnIFFDTC------------VYHQPGIDLLNTVIPvdNVLFASEXI  270
ident                    |                      |             |   
Sbjct --------lvKKRD--YELDFNtaglfkplcgetYPPKKIVTLASELQI--PFVYGSDSH  260
DSSP  --------hhHHHL--LEEEEElhhhhlllllllLLLHHHHHHHHHLLL--LEEEELLLL


DSSP  LlllleelllleellLLHHHHHHLLLllhhhhhhhhlhhhhhhlhhhhhhhhhhhhhll
Query GavrgidprtgfyydDTKRYIEASTIltpeekqqiyegnarrvyprldaalkakgkleh  329
ident |                                                          
Sbjct G---------vqdigRGYSTYCQKLE---------------------------------  277
DSSP  L---------hhhllLLHHHHHHHLL---------------------------------


No 55: Query=2gwgA Sbjct=3f2bA Z-score=6.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEEEEEELLLl
Query ------------------------------------------------XIIDIHGHYTTa   12
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPM-  119
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLL-


DSSP  lhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEEELLL
Query pkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVFSPRA   72
ident                                     |            |         |
Sbjct -----------------------------sqmdavtSVTK-LIEQAKKWGHPAIAVTDHA  149
DSSP  -----------------------------lllllllLHHH-HHHHHHHLLLLLEEELLLL


DSSP  llhhhhhhhhhhHHHHHHHHHHHLL---LLEEEEEellllllllhhhhhhhhhhhhhlll
Query gdfnvsstwaaiCNELCYRVSQLFP---DNFIGAAxlpqspgvdpktcipelekcvkeyg  129
ident                                |                            
Sbjct ------------VVQSFPEAYSAAKkhgMKVIYGL-------------------------  172
DSSP  ------------LLLLHHHHHHHHHhhlLLEEEEE-------------------------


DSSP  lleeEELLL------------------------------LLLLlllllllllhhHHHHHH
Query fvaiNLNPD------------------------------PSGGhwtsppltdriWYPIYE  159
ident       |                                                     
Sbjct ----EANIVddpfhvtllaqnetglknlfklvslshiqyFHRV-------pripRSVLVK  221
DSSP  ----EEEEEllleeeeeeellhhhhhhhhhhhhhhhlllLLLL-------lleeHHHHHH


DSSP  HHhhHLLLeeellllllhhhhhhhhhhhhhhhllhhhhlllllEEELH---hHLLLhhhh
Query KXveLEIPaxihvstgahylnadttafxqcvagdlfkdfpelkFVIPH---gGGAVpyhw  216
ident                                                             
Sbjct HR--DGLL-----------------------------------VGSGCdkgeLFDN----  240
DSSP  LL--LLEE-----------------------------------EELLLllllLLLL----


DSSP  hhhhhhhhhlllllhHHHLLLLE-EEELLLLL-------------HHHHHHHHHHLL--h
Query grfrglaqexkkpllEDHVLNNI-FFDTCVYH-------------QPGIDLLNTVIP--v  260
ident                         |                       |           
Sbjct ---------------VEDIARFYdFLEVHPPDvykplyvkdeemiKNIIRSIVALGEkld  285
DSSP  ---------------LLLLHHHLlLEEELLHHhhlllllllhhhhHHHHHHHHHHHHhll


DSSP  HHEELLLLLLLllLLEE-----------------lllleELLL---lhHHHHHLLLLLHH
Query DNVLFASEXIGavRGID-----------------prtgfYYDD---tkRYIEASTILTPE  300
ident   |             |                                       | ||
Sbjct IPVVATGNVHY-lNPEDkiyrkilihsqgganplnrhelPDVYfrttnEMLDCFSFLGPE  344
DSSP  LLEEELLLLLL-lLHHHhhhhhhhhhllhhhllllllllLLLLlllhhHHHHHHHHHHHH


DSSP  HHHHHHLHHHHHHLHHHHHH----------------------------------------
Query EKQQIYEGNARRVYPRLDAA----------------------------------------  320
ident     |   |                                                   
Sbjct KAKEIVVDNTQKIASLIGDVkpikdelytpriegadeeiremsyrrakeiygdplpklve  404
DSSP  HHHHHHLHHHHHHHHLLLLLllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct erlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplp  464
DSSP  hhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct phyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdi  524
DSSP  leeelllllleeellllllllhhhllllllllllllleeellllllhhhhllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct dlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeid  584
DSSP  eeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct rlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnl  644
DSSP  hhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct lkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtig  704
DSSP  leeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct ipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrd  764
DSSP  llllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct dimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpka  824
DSSP  hhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct haaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiq  884
DSSP  hhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  320
ident                                                             
Sbjct atakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnva  944
DSSP  llhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhh


DSSP  -----------------------------------------hhhhhhhll
Query -----------------------------------------lkakgkleh  329
ident                                                   
Sbjct qaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=2gwgA Sbjct=1bksA Z-score=5.4

back to top
DSSP  --------------lleeeEEELLLLLHHHhhhhhhhhhhhhlhhhlllhhhllllhHHH
Query --------------xiidiHGHYTTAPKALedwrnrqiagikdpsvxpkvselkisdDEL   46
ident                        |                                    
Sbjct meryenlfaqlndrregafVPFVTLGDPGI---------------------------EQS   33
DSSP  lhhhhhhhhhhhhlllleeEEEEELLLLLH---------------------------HHH


DSSP  HHHHHlLHHHHHhhhlllEEEEELL---------------lllhhhhhhHHHHHHHHHHH
Query QASIIeNQLKKXqergsdLTVFSPR---------------agdfnvsstWAAICNELCYR   91
ident    |                                               | | |    
Sbjct LKIID-TLIDAG-----aDALELGVpfsdpladgptiqnanlrafaagvTPAQCFEMLAL   87
DSSP  HHHHH-HHHHLL-----lLLEEEELlllllllllhhhhhhhhhhhhhllLHHHHHHHHHH


DSSP  HHHHLLLlEEEEEELLLLllllhhHHHHHHHHHHhLLLLLEEEELLllllllllllLLLL
Query VSQLFPDnFIGAAXLPQSpgvdpkTCIPELEKCVkEYGFVAINLNPdpsgghwtspPLTD  151
ident      |                          |    |                  |   
Sbjct IREKHPT-IPIGLLMYAN-lvfnnGIDAFYARCE-QVGVDSVLVAD---------vPVEE  135
DSSP  HHHHLLL-LLEEEEELHH-hhhllLHHHHHHHHH-HHLLLEEEELL---------lLHHH


DSSP  hhHHHHHHHHHHHLLLEEELlllllhHHHHhhhHHHHhhhllhhhhllLLLE-EELHhhl
Query riWYPIYEKXVELEIPAXIHvstgahYLNAdttAFXQcvagdlfkdfpELKF-VIPHggg  210
ident     |         |             ||      |                       
Sbjct --SAPFRQAALRHNIAPIFI-----cPPNAdddLLRQ---------vaSYGRgYTYL-la  178
DSSP  --LHHHHHHHHHLLLEEEEE-----eLLLLlhhHHHH---------hhHHLLlLEEE-ll


DSSP  LLHHHHhhhhhhhhhlllllhhhHLLLlEEEELLLL------lHHHHHHHhhhllhhhEE
Query AVPYHWgrfrglaqexkkplledHVLNnIFFDTCVY------hQPGIDLLntvipvdnVL  264
ident     |                                                       
Sbjct LPLHHL------------ieklkEYHA-APALQGFGisspeqvSAAVRAG-------aAG  218
DSSP  LLHHHH------------hhhhhHHLL-LLEEELLLlllhhhhHHHHHHL-------lLE


DSSP  LLLLLLL----------lllleelllleellLLHHHHhhlllllhhhhhhhhlhhhhhhl
Query FASEXIG----------avrgidprtgfyydDTKRYIeastiltpeekqqiyegnarrvy  314
ident   |                                                         
Sbjct AISGSAIvkiieknlaspkqmlaelrsfvsaMKAASR-----------------------  255
DSSP  EEELLHHhhhhhhllllhhhhhhhhhhhhhhHHHLLL-----------------------


DSSP  hhhhhhhhhhhhhll
Query prldaalkakgkleh  329
ident                
Sbjct ---------------  255
DSSP  ---------------


No 57: Query=2gwgA Sbjct=2anuA Z-score=4.6

back to top
DSSP  ---LLEEEEEEL----LLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhHHHHHlL
Query ---XIIDIHGHY----TTAPkaledwrnrqiagikdpsvxpkvselkisddelQASIIeN   53
ident       | | |        |                                        
Sbjct tewLLCDFHVHTnxsdGHLP--------------------------------lGEVVD-L   27
DSSP  leeEEEEEEELLllllLLLL--------------------------------hHHHHH-H


DSSP  HHHHHhhhlLLEEEEELlLLLH---------------hhHHHHHHHHHHHHHHHHHHLL-
Query QLKKXqergSDLTVFSPrAGDF---------------nvSSTWAAICNELCYRVSQLFP-   97
ident   |       |                                         |       
Sbjct FGKHG----VDVVSITD-HIVDrrtleqrkrngeplgaiTEDKFQDYLKRLWREQKRAWe   82
DSSP  HHHLL----LLEEEEEE-EEELhhhhhhhhhllllllllLLLLHHHHHHHHHHHHHHHHh


DSSP  ---LLEEEEEellllllllhhhhhhhhhhhhhllllleeEELLLL-----llllllllll
Query ---DNFIGAAxlpqspgvdpktcipelekcvkeygfvaiNLNPDP-----sgghwtsppl  149
ident       |                                                     
Sbjct eygXILIPGV-----------------------------EITNNTdlyhivavdvkeyvd  113
DSSP  hhlLEEEEEE-----------------------------EEEELLlleeeeeelllllll


DSSP  llhHHHHHHHHHHHHLLLEE-elllLLLHhhhhhHHHHHHHHhllhhhhllllleeelhh
Query tdrIWYPIYEKXVELEIPAX-ihvsTGAHylnadTTAFXQCVagdlfkdfpelkfviphg  208
ident        | ||  |                                              
Sbjct pslPVEEIVEKLKEQNALVIaahpdRKKL----sWYLWANXE------------------  151
DSSP  lllLHHHHHHHHHHLLLEEEellllLLLL----lLHHHHLLL------------------


DSSP  hlllhhhhhhhhhhhhhlllllhhhHLLLLE-EEEL-LLLLhhHHHHHHHHLLhhHEELL
Query ggavpyhwgrfrglaqexkkplledHVLNNI-FFDT-CVYHqpGIDLLNTVIPvdNVLFA  266
ident                                                             
Sbjct -------------------------RFKDTFdAWEIaNRDD--LFNSVGVKKY--RYVAN  182
DSSP  -------------------------LLLLLLlEEEEeELLE--ELHHHHHLLL--LEEEE


DSSP  LLLlLLLLleelllleelLLLHhhhhhlllllhhhhhhHHLHhhhhhlhhHHHH------
Query SEXiGAVRgidprtgfyyDDTKryieastiltpeekqqIYEGnarrvyprLDAA------  320
ident |                    |                              |       
Sbjct SDF-HELW--------hvYSWK----------------TLVK----seknIEAIkeairk  213
DSSP  LLL-LLHH--------hhLLEE----------------EEEE----elllHHHHhhhhhh


DSSP  --hhhhhhhll
Query --lkakgkleh  329
ident            
Sbjct ntdvaiylxrk  224
DSSP  llleeeeelll


No 58: Query=2gwgA Sbjct=3e38A Z-score=4.0

back to top
DSSP  -----------------LLEEEEEE-----LLLLlhhhhhhhhhhhhhhhlhhhlllhhh
Query -----------------XIIDIHGH-----YTTApkaledwrnrqiagikdpsvxpkvse   38
ident                     | | |                                   
Sbjct aqrrneiqvpdldgyttLKCDFHXHsvfsdGLVW--------------------------   34
DSSP  llllllllllllllleeEEEELLLLlllllLLLL--------------------------


DSSP  llllhhhhhhhhhlLHHHHHhhhlLLEEEEE---lllllHHHHHHHHHHHHHHHHHHHHH
Query lkisddelqasiieNQLKKXqergSDLTVFS---pragdFNVSSTWAAICNELCYRVSQL   95
ident                          |                          ||      
Sbjct --------ptvrvdEAYRDG----LDAISLTehieyrphKQDVVSDHNRSFDLCREQAEK   82
DSSP  --------hhhhhhHHHHLL----LLEELLEeellllllLLLLLLLLLHHHHHHHHHHHH


DSSP  LLlLEEEEeellllllllhhhhhhhhhhhhhlllllEEEELLL------lllllllllll
Query FPdNFIGAaxlpqspgvdpktcipelekcvkeygfvAINLNPD------psgghwtsppl  149
ident                                                             
Sbjct LG-ILLIK----------------------------GSEITRAxapghfnaiflsdsnpl  113
DSSP  HL-LEELL----------------------------EEEEELLlllleeeeelllllhhh


DSSP  llHHHHHHHHHHHHHLLLeeellllllhhhhhhhhhhhhhhhllhhhhlllllEEELhHH
Query tdRIWYPIYEKXVELEIPaxihvstgahylnadttafxqcvagdlfkdfpelkFVIPhGG  209
ident                                                             
Sbjct eqKDYKDAFREAKKQGAF-----------------------------------XFWN-HP  137
DSSP  llLLHHHHHHHHHHLLLE-----------------------------------EEEL-LL


DSSP  LL-----lhHHHHhhhhhhhhlllllhhHHLLL---LEEEE-LLLLLhhHHHHHHhHLLH
Query GA-----vpYHWGrfrglaqexkkplleDHVLN---NIFFD-TCVYHqpGIDLLNtVIPV  260
ident |          |                                                
Sbjct GWdsqqpdtTKWW------------pehTALYQegcXHGIEvANGHL--YXPEAI-QWCL  182
DSSP  LLlllllllLLLL------------hhhHHHHHlllLLEEEeEELLE--ELLHHH-HHHH


DSSP  ---HHEELLLLLLL---LLLLEElllLEELLL------------------------lHHH
Query ---DNVLFASEXIG---AVRGIDprtGFYYDD------------------------tKRY  290
ident          |                                                  
Sbjct dknLTXIGTSDIHQpiqTDYDFE---KGEHRTxtfvfakerslqgirealdnrrtaaYFH  239
DSSP  hhlLEEEEELLLLLlhhHHLLHH---HLLLLLeeeeeellllhhhhhhhhhllleeeEEL


DSSP  HHHLllLLHHH-------------------------------------------------
Query IEAStiLTPEE-------------------------------------------------  301
ident                                                             
Sbjct ELLI-gREDLLrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdx  298
DSSP  LEEE-lLHHHHhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleelllee


DSSP  ----------------hhhhhlhhhhhhlhhhhhhhhhhhhhll
Query ----------------kqqiyegnarrvyprldaalkakgkleh  329
ident                                             
Sbjct tlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=2gwgA Sbjct=2yb1A Z-score=2.6

back to top
DSSP  LLEEEEEEL----LLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHH
Query XIIDIHGHY----TTAPkaledwrnrqiagikdpsvxpkvselkisddelqasiieNQLK   56
ident   || | |                                                    
Sbjct ANIDLHFHSrtsdGALT---------------------------------ptevidRAAA   27
DSSP  LLEELLLLLllllLLLL---------------------------------hhhhhhHHHL


DSSP  HHhhhlLLEEEEELLlllhhhhhhhhhHHHHHHHHHHHHLLLLEEEEEellllllllhhh
Query KXqergSDLTVFSPRagdfnvsstwaaICNELCYRVSQLFPDNFIGAAxlpqspgvdpkt  116
ident         |                                  |                
Sbjct RA----PALLALTDH---------dctGGLAEAAAAAARRGIPFLNGV------------   62
DSSP  LL----LLEEEELLL---------lllLLHHHHHHHHHHLLLLEEEEE------------


DSSP  hhhhhhhhhhllllleeEELLLlllllLLLL-----------------------------
Query cipelekcvkeygfvaiNLNPDpsgghWTSP-----------------------------  147
ident                            |                                
Sbjct -----------------EVSVS-----WGRHtvhivglgidpaepalaaglksiregrle  100
DSSP  -----------------EEEEE-----ELLEeeeeeeellllllhhhhhhhhhhhllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  147
ident                                                             
Sbjct rarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpg  160
DSSP  hhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllll


DSSP  -----llllhhhhhhhhhhHHHLLLEEELlllllhHHHH---hhhHHHHHHHllhhhhll
Query -----pltdriwypiyekxVELEIPAXIHvstgahYLNA---dttAFXQCVAgdlfkdfp  199
ident                    |     | |                                
Sbjct kpgyvshqwasledavgwiVGAGGMAVIA-----hPGRYdmgrtlIERLILD-----fqa  210
DSSP  lllllllllllhhhhhhhhHHLLLEEEEL-----lHHHLlllhhhHHHHHHH-----hhh


DSSP  lLLEEELHH-----hlLLHHhhhhhhhhhhhlllllhhHHLLllEEEElllllhhhhhhh
Query eLKFVIPHG-----ggAVPYhwgrfrglaqexkkplleDHVLnnIFFDtcvyhqpgidll  254
ident      |                                |                     
Sbjct aGGQGIEVAsgshsldDMHK-------------falhaDRHG--LYAS------------  243
DSSP  lLLLEEEEEellllhhHHHH-------------hhhhhHHHL--LEEE------------


DSSP  hhhllhhheeLLLLLlLLLLLeelllleellllhhhhhhlllllhhhhhhhhlhHHHHhL
Query ntvipvdnvlFASEXiGAVRGidprtgfyyddtkryieastiltpeekqqiyegNARRvY  314
ident             |    |                                      |   
Sbjct ----------SGSDF-HAPGE-------------------dvghtedlppicrpIWRE-L  272
DSSP  ----------EELLL-LLLLL-------------------llllllllllllllHHHH-L


DSSP  HHHhhhhhhHHHHll
Query PRLdaalkaKGKLeh  329
ident                
Sbjct EAR--ilrpADAE-n  284
DSSP  HHH--llllLHHH-l