Results: dupa

Query: 2ffiA

MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2ffi-A 52.2  0.0  273   273  100 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
   2:  4dlf-A 29.0  2.4  258   287   22 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   3:  4mup-B 27.4  2.5  255   286   20 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   4:  4hk5-D 20.6  2.8  237   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   5:  2dvt-A 20.0  2.7  223   325   20 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   6:  3cjp-A 19.7  2.3  213   262   15 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   7:  4qrn-A 19.6  3.1  235   352   20 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   8:  4ofc-A 19.4  2.9  235   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   9:  3irs-A 19.2  2.8  223   281   16 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  10:  2gwg-A 19.0  3.0  237   329   17 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  11:  1bf6-A 17.6  3.2  233   291   10 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  12:  1gkp-A 16.8  3.0  234   458   14 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  1onx-A 16.6  2.9  230   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  14:  2ob3-A 16.6  3.4  234   329   12 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  15:  4b3z-D 16.5  3.0  232   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  16:  2y1h-B 16.5  3.1  217   265   12 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  17:  3pnu-A 16.3  3.2  226   338   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  18:  2vun-A 16.2  3.0  216   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  19:  4cqb-A 16.1  3.7  229   402   13 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  20:  2oof-A 15.8  3.4  224   403   13 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  21:  3k2g-B 15.8  3.3  235   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  22:  2paj-A 15.6  3.0  211   421   10 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  23:  1k6w-A 15.6  3.8  231   423   11 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  24:  3gri-A 15.6  3.2  228   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  2ogj-A 15.5  2.9  218   379   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  26:  1itq-A 15.5  3.4  234   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  27:  1yrr-B 15.4  3.1  212   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  28:  2vc5-A 15.4  3.4  232   314   10 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  29:  3icj-A 15.3  3.6  219   468   15 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  30:  3nqb-A 15.2  3.2  217   587   12 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  31:  4dzi-C 15.1  3.5  225   388   20 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  32:  3mtw-A 14.9  3.5  213   404   14 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  33:  3mkv-A 14.7  3.3  211   414   16 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  34:  3ls9-A 14.7  3.4  220   453    8 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  35:  3gg7-A 14.6  3.2  208   243   14 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  36:  3giq-A 14.6  3.3  232   475   15 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  37:  2qpx-A 14.5  3.5  216   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  38:  3e74-A 14.5  3.2  220   429   15 PDB  MOLECULE: ALLANTOINASE;                                              
  39:  1j6p-A 14.4  3.3  217   407    9 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  40:  1a4m-A 14.3  3.6  230   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  41:  4c5y-A 14.3  3.7  216   436   10 PDB  MOLECULE: OCHRATOXINASE;                                             
  42:  2imr-A 13.6  3.5  219   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  43:  3ooq-A 13.4  3.1  196   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  44:  1j5s-A 13.1  3.1  213   451   17 PDB  MOLECULE: URONATE ISOMERASE;                                         
  45:  3iac-A 12.7  2.9  211   469   15 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  46:  4rdv-B 12.6  3.4  213   451   15 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  47:  3qy6-A 12.6  3.2  191   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  2uz9-A 12.2  3.5  216   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  49:  1a5k-C 12.2  3.2  207   566   14 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  50:  1v77-A 11.4  3.3  178   202   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  3au2-A 10.1  3.2  171   575    9 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  52:  3dcp-A  9.8  3.1  178   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  2a3l-A  9.7  3.7  217   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  54:  1m65-A  9.0  3.4  169   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  8.5  3.7  169   994   10 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  7.1  3.7  169   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.9  3.8  148   284   19 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  6.3  3.5  149   342   11 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  6.0  3.5  139   224   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2ffiA Sbjct=2ffiA Z-score=52.2

back to top
DSSP  LLLLLEELLLLLLLHHHHHHLLLLLLLLLLLLHHHHHHHHHHLLLLEELLLLLHHHLLLL
Query LHLTAIDSHAHVFSRGLNLASQRRYAPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGTDN   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LHLTAIDSHAHVFSRGLNLASQRRYAPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGTDN   60
DSSP  LLLLLEELLLLLLLHHHHHHLLLLLLLLLLLLHHHHHHHHHHLLLLEELLLLLHHHLLLL


DSSP  HHHHHHHHHLLLLLLLLLLLLLLLLHHHHHHHHLLLLLEEELLLLLLLLLLLLLLLLHHH
Query RYLLSALQTVPGQLRGVVXLERDVEQATLAEXARLGVRGVRLNLXGQDXPDLTGAQWRPL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RYLLSALQTVPGQLRGVVXLERDVEQATLAEXARLGVRGVRLNLXGQDXPDLTGAQWRPL  120
DSSP  HHHHHHHHHLLLLLLLLLLLLLLLLHHHHHHHHLLLLLEEELLLLLLLLLLLLLLLLHHH


DSSP  HHHHHHHLLEEEELLLLLLHHHHHHHHLLLLLLEEELHHHLLLLLLLLLLLLHHHHLLLL
Query LERIGEQGWHVELHRQVADIPVLVRALQPYGLDIVIDHFGRPDARRGLGQPGFAELLTLS  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LERIGEQGWHVELHRQVADIPVLVRALQPYGLDIVIDHFGRPDARRGLGQPGFAELLTLS  180
DSSP  HHHHHHHLLEEEELLLLLLHHHHHHHHLLLLLLEEELHHHLLLLLLLLLLLLHHHHLLLL


DSSP  LLLLEEEEEELHHHLLLLHHHHHHHHHHHHHHHHHHLLHHHEEEELLLLLLLLLLLLLHH
Query GRGKVWVKVSGIYRLQGSPEENLAFARQALCALEAHYGAERLXWGSDWPHTQHESEVSFG  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GRGKVWVKVSGIYRLQGSPEENLAFARQALCALEAHYGAERLXWGSDWPHTQHESEVSFG  240
DSSP  LLLLEEEEEELHHHLLLLHHHHHHHHHHHHHHHHHHLLHHHEEEELLLLLLLLLLLLLHH


DSSP  HHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLL
Query SAVEQFEALGCSAQLRQALLLDTARALFGFELE  273
ident |||||||||||||||||||||||||||||||||
Sbjct SAVEQFEALGCSAQLRQALLLDTARALFGFELE  273
DSSP  HHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLL


No 2: Query=2ffiA Sbjct=4dlfA Z-score=29.0

back to top
DSSP  llLLLEELLLLLLLHHhhhhllLLLLL---------LLLLLHHHHHHHHHHLLLLEELLL
Query lhLTAIDSHAHVFSRGlnlasqRRYAP---------NYDAPLGDYLGQLRAHGFSHGVLV   51
ident      |||| |               |           |           |        |
Sbjct --ALRIDSHQHFWRYR------AADYPwigagmgvlARDYLPDALHPLMHAQALGASIAV   52
DSSP  --LLLEEEEELLLLLL------HHHLLllllllhhhLLLLLHHHHHHHHHHLLLLEEEEE


DSSP  LLHhHLLL-LHHHHHHHHHlLLLL-LLLLLLL-LLLL-HHHHHHHHLLLLLEEELLLLLL
Query QPSfLGTD-NRYLLSALQTvPGQL-RGVVXLE-RDVE-QATLAEXARLGVRGVRLNLXGQ  107
ident |    | |    ||             |     |        ||      || |  |   
Sbjct QAR-AGRDeTAFLLELACD-EARIaAVVGWEDlRAPQlAERVAEWRGTKLRGFRHQLQDE  110
DSSP  LLL-LLHHhHHHHHHHHLL-LLLEeEEEELLLlLLLLhHHHHHLLLLLLEEEEEELHHHL


DSSP  LLL--LLLLLLLHHHHHHHHHHLLEEEELLLLLLHHHHHHHHLLLL-LLEEELHHHLLLL
Query DXP--DLTGAQWRPLLERIGEQGWHVELHRQVADIPVLVRALQPYG-LDIVIDHFGRPDA  164
ident          |                         |              | || | |  
Sbjct ADVraFVDDADFARGVAWLQANDYVYDVLVFERQLPDVQAFCARHDaHWLVLDHAGKPAL  170
DSSP  LLHhhHHHLHHHHHHHHHHHHLLLEEEELLLHHHHHHHHHHHHHLLlLLEEEHHHHLLLH


DSSP  LL------LLLLlLHHHHLLLLLLLLEEEEEELHHHLLL----LHHHHHHHHHHHHHHHH
Query RR------GLGQpGFAELLTLSGRGKVWVKVSGIYRLQG----SPEENLAFARQALCALE  214
ident          |     | |  |     |  | ||               |    | | |  
Sbjct AEfdrddtALAR-WRAALRELAALPHVVCKLSGLVTEADwrrgLRASDLRHIEQCLDAAL  229
DSSP  HHllllllHHHH-HHHHHHHHHLLLLEEEEELLLLLLLLllllLLHHHHHHHHHHHHHHH


DSSP  HHLLHHHEEEELLLLLllLLLLLLHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHLLLL
Query AHYGAERLXWGSDWPHtqHESEVSFGSAVEQFEALG---CSAQLRQALLLDTARALFGFE  271
ident    |  ||  |||||        |        |       ||  | ||   ||       
Sbjct DAFGPQRLMFGSDWPV--CLLAASYDEVASLVERWAesrLSAAERSALWGGTAARCYALP  287
DSSP  HHHLHHHEEELLLLLH--HHHLLLHHHHHHHHHHHHhhhLLHHHHHHHLLHHHHHHLLLL


DSSP  ll
Query le  273
ident   
Sbjct --  287
DSSP  --


No 3: Query=2ffiA Sbjct=4mupB Z-score=27.4

back to top
DSSP  -------------llLLLEELLLLLLLHHHHhhllllLLLLL-LLLHHHHHHHHHHLLLL
Query -------------lhLTAIDSHAHVFSRGLNlasqrrYAPNY-DAPLGDYLGQLRAHGFS   46
ident                  | |   |    |          |        ||       |  
Sbjct lvrklsgtapnpafpRGAVDTQMHMYLPGYPalpggpGLPPGaLPGPEDYRRLMQWLGID   60
DSSP  lllllllllllllllLLLEELLLLLLLLLLLllllllLLLLLlLLLHHHHHHHHHHHLLL


DSSP  EELLLLLHHHLLLLHHHHHHHHHLLLLLLLLLLLLLLLLHHHHHHHHLLLLLEEELLLLL
Query HGVLVQPSFLGTDNRYLLSALQTVPGQLRGVVXLERDVEQATLAEXARLGVRGVRLNLXG  106
ident      |      ||   |            ||                 |  | |     
Sbjct RVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLP  120
DSSP  EEEEELLHHHLLLLHHHHHHHHHHHHHEEEEELLLLLLLHHHHHHHHHLLEEEEEEELLL


DSSP  L--lLLLLllllLHHHHHHHHHHLLEEEELLLLLLH---HHHHHHHlllLLLEEELHHHL
Query Q--dXPDLtgaqWRPLLERIGEQGWHVELHRQVADI---PVLVRALqpyGLDIVIDHFGR  161
ident                  ||     | |                          | || | 
Sbjct GgavNLSE----LDAVDERAHAADWMVAVQFDGNGLldhLPRLQKI---RSRWVFDHHGK  173
DSSP  LlllLHHH----HHHHHHHHHHLLLEEEEELLHHHHhhhHHHHHLL---LLEEEELHHHH


DSSP  LLLLLLLLLLLHHHHLLLLLLLLEEEEEELHHHLLLLHHHhHHHHHHHHHHHHHHlLHHH
Query PDARRGLGQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEEnLAFARQALCALEAHyGAER  221
ident          |  | || |  ||  | |  | |          |          ||   ||
Sbjct FFKGIRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWP-YADVAAFSRVIAAH-APER  231
DSSP  LLLLLLLLLHHHHHHHHHHHHLLEEEEELLHHHLLLLLLL-LHHHHHHHHHHHHH-LHHH


DSSP  EEEELLLLLLLLL---LLLLHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLL
Query LXWGSDWPHTQHE---SEVSFGSAVEQFEALGCSAQLRQALLLDTARALFGFELE  273
ident   ||  |||                |           |   |     |||     
Sbjct IVWGTNWPHNSVRetaAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV  286
DSSP  EEELLLLLLLLLLlhhHLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHLLLLL


No 4: Query=2ffiA Sbjct=4hk5D Z-score=20.6

back to top
DSSP  lLLLLEELLLLLLLHHHHHHLL---lLLLL------------------------------
Query lHLTAIDSHAHVFSRGLNLASQ---rRYAP------------------------------   27
ident       | | |                                                 
Sbjct -TPVVVDIHTHMYPPSYIAMLEkrqtIPLVrtfpqadeprlillsselaaldaaladpaa   59
DSSP  -LLLLEEEEEEELLHHHHHHHHllllLLEEeeelleeeeeeellhhhhhhhhhhhhllll


DSSP  ------LLLL--LHHHHHHHHHHLLLLEELLLLLHHHL-------------lLLHHHHHH
Query ------NYDA--PLGDYLGQLRAHGFSHGVLVQPSFLG-------------tDNRYLLSA   66
ident              |          |    |                       |      
Sbjct klpgrpLSTHfaSLAQKMHFMDTNGIRVSVISLANPWFdflapdeapgiadaVNAEFSDM  119
DSSP  lllleeLLHHhlLHHHHHHHHHHLLLLEEEEEELLLLLlllllllhhhhhhhHHHHHHHH


DSSP  HHHLLLLLLLLLLLLL------LLLH-HHHHHHhlLLLLEEELLLllLLLLlLLLLLLHH
Query LQTVPGQLRGVVXLER------DVEQ-ATLAEXarLGVRGVRLNLxgQDXPdLTGAQWRP  119
ident      | |     |                        ||  |         |      |
Sbjct CAQHVGRLFFFAALPLsapvdaVKASiERVKNL--KYCRGIILGTsgLGKG-LDDPHLLP  176
DSSP  HHLLLLLEEEEEELLLlllhhhHHHHhHHHHLL--LLEEEEEELLllLLLL-LLLHHHHH


DSSP  HHHHHHHHLLEEEELL-----------------------------LLLLHHHHHH-HHLL
Query LLERIGEQGWHVELHR-----------------------------QVADIPVLVR-ALQP  149
ident   |        | ||                                             
Sbjct VFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfpmeTTIAVARMYMaGVFD  236
DSSP  HHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhhHHHHHHHHHHlLHHH


DSSP  --LLLLEEELHHHLLlllllllllLHHHH------------------------lLLLL-L
Query --YGLDIVIDHFGRPdarrglgqpGFAEL------------------------lTLSG-R  182
ident     |     | |                                               
Sbjct hvRNLQMLLAHSGGT---------LPFLAgriescivhdghlvktgkvpkdrrtIWTVlK  287
DSSP  hlLLLLEEEHHHHLL---------HHHHHhhhhhhhhllhhhhhllllllllllHHHHhH


DSSP  LLEEEEEELHhhllllhhhhhhhHHHHHHHHHHHLLHHHEEEELLLLLllLLLL----ll
Query GKVWVKVSGIyrlqgspeenlafARQALCALEAHYGAERLXWGSDWPHtqHESE----vs  238
ident                            | |  |  || ||  | | |             
Sbjct EQIYLDAVIY-------------SEVGLQAAIASSGADRLMFGTDHPF--FPPIeedvqg  332
DSSP  HLEEEELLLL-------------LHHHHHHHHHHHLHHHEELLLLLLL--LLLLllllll


DSSP  HHHHHHHHHHH---LLLH--HHHHHHHLHHHHHHLLLLL--------l
Query FGSAVEQFEAL---GCSA--QLRQALLLDTARALFGFEL--------e  273
ident                         |     |                 
Sbjct PWDSSRLNAQAvikAVGEgsSDAAAVMGLNAVRVLSLKAelehhhhhh  380
DSSP  LLHHHHHHHHHhhhHHLLllHHHHHHHLHHHHHHLLLHHhhhhhhhhl


No 5: Query=2ffiA Sbjct=2dvtA Z-score=20.0

back to top
DSSP  lllLLEELLLLLLLHhhhhhllLLLLL----------LLLL--LHHH-HHHHHHHLLLLE
Query lhlTAIDSHAHVFSRglnlasqRRYAP----------NYDA--PLGD-YLGQLRAHGFSH   47
ident           |                                   |  |    |||   
Sbjct -mqGKVALEEHFAIP-----etLQDSAgfvpgdywkeLQHRllDIQDtRLKLMDAHGIET   54
DSSP  -llLEEEEEEEELLH-----hhHHHHLllllllhhhhHHHHhhLLLLhHHHHHHHLLEEE


DSSP  ELLLLLHHHL--------------lLLHHHHHHHHHLLLLLLLLLLLL-----LLLL--H
Query GVLVQPSFLG--------------tDNRYLLSALQTVPGQLRGVVXLE-----RDVE--Q   86
ident   |                       |  |       |        |         |  |
Sbjct MILSLNAPAVqaipdrrkaieiarrANDVLAEECAKRPDRFLAFAALPlqdpdAATEelQ  114
DSSP  EEEEELLLHHhhlllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEELLLlllhhHHHHhhH


DSSP  HHHHHHHlllLLEEELLL-----lllLLLLLLLLLLHHHHHHHHHHLLEEEELL------
Query ATLAEXArlgVRGVRLNL-----xgqDXPDLTGAQWRPLLERIGEQGWHVELHR------  135
ident             |   |                 | ||             ||       
Sbjct RCVNDLG---FVGALVNGfsqegdgqTPLYYDLPQYRPFWGEVEKLDVPFYLHPrnplpq  171
DSSP  HHHHLLL---LLEEEEELllllllllLLLLLLLHHHHHHHHHHHHHLLLEEEELllllhh


DSSP  -----------------LLLLHHHHHHHHLL-------LLLLEEELHHHLLlllllllll
Query -----------------QVADIPVLVRALQP-------YGLDIVIDHFGRPdarrglgqp  171
ident                        |    |           | |   | |           
Sbjct dsriydghpwllgptwaFAQETAVHALRLMAsglfdehPRLNIILGHMGEG---------  222
DSSP  hlhhhlllhhhlhhhlhHHHHHHHHHHHHHHllhhhhlLLLLEEELHHHLL---------


DSSP  lhhHHLLL------------------------LLLLLEEEEEELHhhllllhhhhhhhHH
Query gfaELLTL------------------------SGRGKVWVKVSGIyrlqgspeenlafAR  207
ident                                           ||                
Sbjct ---LPYMMwridhrnawvklpprypakrrfmdYFNENFHITTSGN------------fRT  267
DSSP  ---HHHHHhhhhhllllllllllllllllhhhHHHHHEEEELLLL------------lLH


DSSP  HHHHHHHHHLLHHHEEEELLLLLllllllLLHHHHHHHHHHHLLLHHHHHHHHLHHHHHH
Query QALCALEAHYGAERLXWGSDWPHtqheseVSFGSAVEQFEALGCSAQLRQALLLDTARAL  267
ident | |       || |     |||            |   | |       |       || |
Sbjct QTLIDAILEIGADRILFSTDWPF------ENIDHASDWFNATSIAEADRVKIGRTNARRL  321
DSSP  HHHHHHHLLLLHHHEELLLLLLL------LLHHHHHHHHHHLLLLHHHHHHHHLHHHHHH


DSSP  LLLLll
Query FGFEle  273
ident |     
Sbjct FKLD--  325
DSSP  LLLL--


No 6: Query=2ffiA Sbjct=3cjpA Z-score=19.7

back to top
DSSP  lllLLEELLLLLLlhhhhhhllllllllllLLHHHHHHHHHHLLLLEELLLLLHH-----
Query lhlTAIDSHAHVFsrglnlasqrryapnydAPLGDYLGQLRAHGFSHGVLVQPSF-----   55
ident      || | ||                   |           |     |   |      
Sbjct ---LIIDGHTHVI-----------------LPVEKHIKIMDEAGVDKTILFSTSIhpeta   40
DSSP  ---LLEEEEEELL-----------------LLHHHHHHHHHHHLLLEEEEELLLLlhhhl


DSSP  --------------------------HLLL-LHHHHHHHHHLLLLLLLLLLLL------L
Query --------------------------LGTD-NRYLLSALQTVPGQLRGVVXLE------R   82
ident                                   |    |  |    |            
Sbjct vnlrdvkkemkklndvvngktnsmidVRRNsIKELTNVIQAYPSRYVGFGNVPvglsenD  100
DSSP  llhhhhhhhhhhhhhhhlllllllhhHHHHhHHHHHHHHHHLLLLEEEEELLLllllhhH


DSSP  LLL--HHHHHHHHlllLLEE-ELLLllLLLLLLlllLLHHHHHHHH-HHLLEEEELL---
Query DVE--QATLAEXArlgVRGV-RLNLxgQDXPDLtgaQWRPLLERIG-EQGWHVELHR---  135
ident                   |   |                |               |    
Sbjct TNSyiEENIVNNK---LVGIgELTP--ASGQIK---SLKPIFKYSMdSGSLPIWIHAfnp  152
DSSP  HHHhhHHHLLLLL---LLEEeEELL--LLLLHH---HHHHHHHHHHhLLLLLEEELLlll


DSSP  -LLLLHHHHHHHHLLLL-LLEEELHHHLLlllllllllLHHHHLL--LLLLlLEEEEEEL
Query -QVADIPVLVRALQPYG-LDIVIDHFGRPdarrglgqpGFAELLT--LSGRgKVWVKVSG  191
ident     ||                  | |                               | 
Sbjct lVLQDIKEIAELCKAFPkVPVILGHMGGS---------NWMTAVElaKEIQ-NLYLDTSA  202
DSSP  lLHHHHHHHHHHHHHLLlLLEEEHHHHHH---------HHHHHHHhhHHLL-LEEEELLL


DSSP  HHhllllhhhHHHHHHHHHHHHhhhllHHHEEEELLLLLllllllLLHHHHHHHHHHHLL
Query IYrlqgspeeNLAFARQALCALeahygAERLXWGSDWPHtqheseVSFGSAVEQFEALGC  251
ident                      |           | | |              |       
Sbjct YF--------STFVLKIVINEL-----PLKCIFGTDMPF------GDLQLSIEAIKKMSN  243
DSSP  LL--------LHHHHHHHHHHL-----LLLEELLLLLLL------LLHHHHHHHHHHHLL


DSSP  LHHHHHHHHLHHHHHHLLLlll
Query SAQLRQALLLDTARALFGFele  273
ident       | | |    |      
Sbjct DSYVANAVLGDNISRLLNI---  262
DSSP  LHHHHHHHHLHHHHHHHLL---


No 7: Query=2ffiA Sbjct=4qrnA Z-score=19.6

back to top
DSSP  -----------lllLLEELLLLLLLHHHHHHLL---------------LLLL--------
Query -----------lhlTAIDSHAHVFSRGLNLASQ---------------RRYA--------   26
ident                 |        |                                  
Sbjct smtqdlktggeqgyLRIATEEAFATREIIDVYLrmirdgtadkgmvslWGFYaqspsera   60
DSSP  llllllllllllllLLEEEEEEELLHHHHHHHHhhhhhllllhhhhhhHHHHhhlllhhh


DSSP  --LLLL-LLHH-HHHHHHHHLLLLEELLLLLHHHL--------------lLLHHHHHHHH
Query --PNYD-APLG-DYLGQLRAHGFSHGVLVQPSFLG--------------tDNRYLLSALQ   68
ident          ||        | |     |   |                   |  |  | |
Sbjct tqILERlLDLGeRRIADMDATGIDKAILALTSPGVqplhdldeartlatrANDTLADACQ  120
DSSP  hhHHHHhHLLLhHHHHHHHHLLLLEEEEEELLLLLlllllhhhhhhhhhhHHHHHHHHHH


DSSP  HLLLLLLLLLLLL---LLLLHHHHHHHHL-LLLLEEELLLLLLLLLlLLLLLLHHHHHHH
Query TVPGQLRGVVXLE---RDVEQATLAEXAR-LGVRGVRLNLXGQDXPdLTGAQWRPLLERI  124
ident   |    |                   || ||  |   |   |    |      |     
Sbjct KYPDRFIGMGTVApqdPEWSAREIHRGAReLGFKGIQINSHTQGRY-LDEEFFDPIFRAL  179
DSSP  HLLLLEEELLLLLlllHHHHHHHHHHHHHlLLLLLEEELLLLLLLL-LLLHHHHHHHHHH


DSSP  HHHLLEEEEL--------------------------LLLLLHHHHHH-HHLL--LLLLEE
Query GEQGWHVELH--------------------------RQVADIPVLVR-ALQP--YGLDIV  155
ident  |       |                                  |           | | 
Sbjct VEVDQPLYIHpatspdsmidpmleagldgaifgfgvETGMHLLRLITiGIFDkyPSLQIM  239
DSSP  HHHLLLEEELlllllllllhhhhhhlllllllhhhhHHHHHHHHHHHhLHHHhlLLLLEE


DSSP  ELHHHLLlllllllllLHHH-----------------------hlLLLL-LLLEEEEEEL
Query IDHFGRPdarrglgqpGFAE-----------------------llTLSG-RGKVWVKVSG  191
ident   | |                                                | |  ||
Sbjct VGHMGEA--------lPYWLyrldymhqagvrsqryermkplkktIEGYlKSNVLVTNSG  291
DSSP  ELHHHHL--------hHHHHhhhhhhhhhhhhlllllllllllllHHHHhHHLEEEELLL


DSSP  HhhllllhhhhhhhHHHHHHHHHHHLLHHHEEEELLLLLllllllLLHHHHHHHHHHHLL
Query IyrlqgspeenlafARQALCALEAHYGAERLXWGSDWPHtqheseVSFGSAVEQFEALGC  251
ident                  |        |  |     | |             |    |   
Sbjct V------------aWEPAIKFCQQVMGEDRVMYAMDYPY------QYVADEVRAMDAMDM  333
DSSP  L------------lLHHHHHHHHHHHLHHHEELLLLLLL------LLLHHHHHHHHLLLL


DSSP  LHHHHHHHHLHHHHHHLLLlll
Query SAQLRQALLLDTARALFGFele  273
ident |||         |   |     
Sbjct SAQTKKKFFQTNAEKWFKL---  352
DSSP  LHHHHHHHHLHHHHHHLLL---


No 8: Query=2ffiA Sbjct=4ofcA Z-score=19.4

back to top
DSSP  llllLEELLLLLLLHhHHHH----------LLLL---------------LLLLLL--LLH
Query lhltAIDSHAHVFSRgLNLA----------SQRR---------------YAPNYD--APL   33
ident      || | |                    |                            
Sbjct ---mKIDIHSHILPK-EWPDlkkrfgyggwVQLQhhskgeakllkdgkvFRVVREncWDP   56
DSSP  ---lLEEEEEELLLL-LLLLhhhhhlllllEEEEeeelleeeeeelleeEEEEEHhhLLH


DSSP  HHHHHHHHHLLLLEELLLLLHHHL--------------lLLHHHHHHHHHLLLLLLLLLL
Query GDYLGQLRAHGFSHGVLVQPSFLG--------------tDNRYLLSALQTVPGQLRGVVX   79
ident           |     |                       |  | |     |    |   
Sbjct EVRIREMDQKGVTVQALSTVPVMFsywakpedtlnlcqlLNNDLASTVVSYPRRFVGLGT  116
DSSP  HHHHHHHHHHLLLEEEEELLHHHHlllllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEEL


DSSP  LL--LLLL-HHHHHHHHL-LLLLEEELLLllLLLLLLLLLLLHHHHHHHHHHLLEEEELL
Query LE--RDVE-QATLAEXAR-LGVRGVRLNLxgQDXPDLTGAQWRPLLERIGEQGWHVELHR  135
ident |                  ||  ||          ||      |              | 
Sbjct LPmqAPELaVKEMERCVKeLGFPGVQIGT-hVNEWDLNAQELFPVYAAAERLKCSLFVHP  175
DSSP  LLllLHHHhHHHHHHHHHlLLLLEEEEEL-eELLEELLLHHHHHHHHHHHHHLLEEEEEL


DSSP  ----------------------LLLL-HHHHHHH-HLLLL--LLEEELHHHLLlllllll
Query ----------------------QVAD-IPVLVRA-LQPYG--LDIVIDHFGRPdarrglg  169
ident                            |              |     | |         
Sbjct wdmqmdgrmakywlpwlvgmpaETTIaICSMIMGgVFEKFpkLKVCFAHGGGA-------  228
DSSP  llllllhhhhlllhhhhlhhhhHHHHhHHHHHLLlHHHHLllLLEEELHHHLL-------


DSSP  llLHHHH--------------------llLLLLLLEEEEEELHhhllllhhhhhhhHHHH
Query qpGFAEL--------------------ltLSGRGKVWVKVSGIyrlqgspeenlafARQA  209
ident                                  |                          
Sbjct --FPFTVgrishgfsmrpdlcaqdnpmnpKKYLGSFYTDALVH-------------DPLS  273
DSSP  --HHHHHhhhhhhhhhlhhhhlllllllhHHHLLLLEEELLLL-------------LHHH


DSSP  HHHHHHHLLHHHEEEELLLLLLLllllllHHHHHHHHHHHL-LLHHHHHHHHLHHHHHHL
Query LCALEAHYGAERLXWGSDWPHTQhesevsFGSAVEQFEALG-CSAQLRQALLLDTARALF  268
ident |  |    |      | | |                 |            |    | |  
Sbjct LKLLTDVIGKDKVILGTDYPFPL-----gELEPGKLIESMEeFDEETKNKLKAGNALAFL  328
DSSP  HHHHHHHHLLLLEELLLLLLLLL-----lLLLLLHHHHHLLlLLHHHHHHHHLHHHHHHH


DSSP  -LLLLL-
Query -GFELE-  273
ident        
Sbjct gLERKQf  335
DSSP  lLLHHHl


No 9: Query=2ffiA Sbjct=3irsA Z-score=19.2

back to top
DSSP  lllLLEELLLLLLLhhhhhhlllllLLLL-------------------LLLHHHHHHHHH
Query lhlTAIDSHAHVFSrglnlasqrryAPNY-------------------DAPLGDYLGQLR   41
ident      ||                                            |        
Sbjct --lKIIDFRLRPPA---mgflnariYTRPdirnrftrqlgfepapsaeEKSLELMFEEMA   55
DSSP  --lLLEELLLLLLL---hhhhhlhhHHLHhhhhhhhhhhlllllhhhhHLLHHHHHHHHH


DSSP  HLLLLEELLLLL----HHHLlLLHHHHHHHHHLLLLLLLLLLLL-----LLLL-hHHHHH
Query AHGFSHGVLVQP----SFLGtDNRYLLSALQTVPGQLRGVVXLE-----RDVE-qATLAE   91
ident | |   || |            |          |     |   |                
Sbjct AAGIEQGVCVGRnssvLGSV-SNADVAAVAKAYPDKFHPVGSIEaatrkEAMAqmQEILD  114
DSSP  HLLLLEEEEELLeellLEEL-LHHHHHHHHHHLLLLEEEEEELLlllhhHHHHhhHHHHH


DSSP  HHlllLLEEELLLLLL--LLLLLLLlLLHHHHHHHHHHLLEEEELLL-------lLLHHH
Query XArlgVRGVRLNLXGQ--DXPDLTGaQWRPLLERIGEQGWHVELHRQ-------vADIPV  142
ident       | | |                  ||       |  |                | 
Sbjct LG---IRIVNLEPGVWatPMHVDDR-RLYPLYAFCEDNGIPVIMMTGgnagpditYTNPE  170
DSSP  LL---LLLEEELHHHLllLLLLLLH-HHHHHHHHHHHLLLLEEEELLllllllhhHHLHH


DSSP  HHHHH-LLLL-LLEEELHHHLLlllllllllLHHHHLL--LLLLlLEEEEEELHhhllll
Query LVRAL-QPYG-LDIVIDHFGRPdarrglgqpGFAELLT--LSGRgKVWVKVSGIyrlqgs  198
ident            |  |  |   |            |                         
Sbjct HIDRVlGDFPdLTVVSSHGNWP---------WVQEIIHvaFRRP-NLYLSPDMY------  214
DSSP  HHHHHhHHLLlLLEEEEHHHLL---------LHHHHHHhhHHLL-LEEEELHHH------


DSSP  hhhHHHHHHHHHHHHHHHLLHHHEEEELLLLLllllllLLHHHHHHHHHHHLLLHHHHHH
Query peeNLAFARQALCALEAHYGAERLXWGSDWPHtqheseVSFGSAVEQFEALGCSAQLRQA  258
ident                     | |   |   |              | |  |         
Sbjct --lYNLPGHADFIQAANSFLADRMLFGTAYPM------CPLKEYTEWFLTLPIKPDAMEK  266
DSSP  --hLLLLLHHHHHHHHLLHHHHLLLLLLLLLL------LLHHHHHHHHHLLLLLHHHHHH


DSSP  HHLHHHHHHLLllll
Query LLLDTARALFGfele  273
ident  |   |  |      
Sbjct ILHGNAERLLAqagr  281
DSSP  HHLHHHHHHHHhlll


No 10: Query=2ffiA Sbjct=2gwgA Z-score=19.0

back to top
DSSP  lllLLEELLLLL-LLHHHHHhLLLL--------------------lllllllLHHH-HHH
Query lhlTAIDSHAHV-FSRGLNLaSQRR--------------------yapnydaPLGD-YLG   38
ident      || | |            |                                  | 
Sbjct ---XIIDIHGHYtTAPKALE-DWRNrqiagikdpsvxpkvselkisddelqaSIIEnQLK   56
DSSP  ---LLEEEEEELlLLLHHHH-HHHHhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHH


DSSP  HHHHLLLLEELLLLLH-------hHLLL-LHHHHHHHHHLLLLLLLLLLLL------LLL
Query QLRAHGFSHGVLVQPS-------fLGTD-NRYLLSALQTVPGQLRGVVXLE------RDV   84
ident      |    |                  |       |  |    |  ||          
Sbjct KXQERGSDLTVFSPRAgdfnvsstWAAIcNELCYRVSQLFPDNFIGAAXLPqspgvdPKT  116
DSSP  HHHHHLLLEEEEELLLllhhhhhhHHHHhHHHHHHHHHHLLLLEEEEEELLllllllHHH


DSSP  LHHHHHHHHL-LLLLEEELLLL--LLLL--LLLLLLLLHHHHHHHHHHLLEEEEL-----
Query EQATLAEXAR-LGVRGVRLNLX--GQDX--PDLTGAQWRPLLERIGEQGWHVELH-----  134
ident     |       |     ||    |     | ||   | |  |   |       |     
Sbjct CIPELEKCVKeYGFVAINLNPDpsGGHWtsPPLTDRIWYPIYEKXVELEIPAXIHvstga  176
DSSP  HHHHHHHHHHlLLLLEEEELLLllLLLLllLLLLLHHHHHHHHHHHHHLLLEEELlllll


DSSP  ----LLLLLHHHH-hHHHL-LLLL-LEEELHHHLLlllLLLLLL------lhhhhLLLLL
Query ----RQVADIPVL-vRALQ-PYGL-DIVIDHFGRPdarRGLGQP------gfaelLTLSG  181
ident                  |         || | |        |             |    
Sbjct hylnADTTAFXQCvaGDLFkDFPElKFVIPHGGGA-vpYHWGRFrglaqexkkplLEDHV  235
DSSP  hhhhHHHHHHHHHhhLLHHhHLLLlLEEELHHHLL-lhHHHHHHhhhhhhlllllHHHHL


DSSP  LLLEEEEEELHhhllllhhhHHHHHHHHHHHHHhhllHHHEEEELLLLLLlLLLL-----
Query RGKVWVKVSGIyrlqgspeeNLAFARQALCALEahygAERLXWGSDWPHTqHESE-----  236
ident                                             |               
Sbjct LNNIFFDTCVY---------HQPGIDLLNTVIP----VDNVLFASEXIGA-VRGIdprtg  281
DSSP  LLLEEEELLLL---------LHHHHHHHHHHLL----HHHEELLLLLLLL-LLLEellll


DSSP  -LLHHhHHHHHHHHL-LLHHHHHHHHLHHHHHHL--LLLLL--------
Query -VSFGsAVEQFEALG-CSAQLRQALLLDTARALF--GFELE--------  273
ident            ||         |      ||                  
Sbjct fYYDD-TKRYIEASTiLTPEEKQQIYEGNARRVYprLDAALkakgkleh  329
DSSP  eELLL-LHHHHHHLLlLLHHHHHHHHLHHHHHHLhhHHHHHhhhhhhll


No 11: Query=2ffiA Sbjct=1bf6A Z-score=17.6

back to top
DSSP  --llLLLEELLLLLLlhhhhhhlLLLLLLL-LLLL---HHHHHHHHHHLLLLEELLLLlh
Query --lhLTAIDSHAHVFsrglnlasQRRYAPN-YDAP---LGDYLGQLRAHGFSHGVLVQps   54
ident           | |                                |   |          
Sbjct sfdpTGYTLAHEHLH----idlsGFKNNVDcRLDQyafICQEMNDLMTRGVRNVIEMT--   54
DSSP  llllLLEEEEEELLL----eelhHHHLLHHhEELLhhhHHHHHHHHHHLLEEEEEELL--


DSSP  hHLLLLHhhHHHHHHLL----lLLLLLLLL----------------lLLLL-HHHHHHH-
Query fLGTDNRylLSALQTVP----gQLRGVVXL----------------eRDVE-QATLAEX-   92
ident                |                                  |         
Sbjct nRYMGRN--AQFMLDVMretgiNVVACTGYyqdaffpehvatrsvqeLAQEmVDEIEQGi  112
DSSP  lHHHLLL--HHHHHHHHhhhllEEEEEELLllhhhlllhhhhllhhhHHHHhHHHHHLLl


DSSP  --hLLLLLEEE-LLLLLLLLL-LLLLllLHHHHHHHHHHLLEEEELL-LLLLHHHHHHHH
Query --aRLGVRGVR-LNLXGQDXP-DLTGaqWRPLLERIGEQGWHVELHR-QVADIPVLVRAL  147
ident     |                                  |     |             |
Sbjct dgtELKAGIIAeIGTSEGKITpLEEK-vFIAAALAHNQTGRPISTHTsFSTMGLEQLALL  171
DSSP  lllLLLEEEEEeEELLLLLLLhHHHH-hHHHHHHHHHHHLLLEEEELhHHLLHHHHHHHH


DSSP  L-LLLL--LEEELHhHLLLLllllllllHHHHLL-LLLLllEEEEEELHHHLLLlhhhHH
Query Q-PYGL--DIVIDHfGRPDArrglgqpgFAELLT-LSGRgkVWVKVSGIYRLQGspeeNL  203
ident |            |                  |          |    |           
Sbjct QaHGVDlsRVTVGH-CDLKD-------nLDNILKmIDLG--AYVQFDTIGKNSY---yPD  218
DSSP  HhLLLLhhHEEELL-LLLLL-------lHHHHHHhHHLL--LEEEELLLLLLLL---lLH


DSSP  HHHHHHHHHHHHHLLHHHEEEELLLLlLLLL----LLLLHHHHH-HHHHHHL---LLHHH
Query AFARQALCALEAHYGAERLXWGSDWPhTQHE----SEVSFGSAV-EQFEALG---CSAQL  255
ident       | ||       |     |                          |     |   
Sbjct EKRIAMLHALRDRGLLNRVMLSMDIT-RRSHlkanGGYGYDYLLtTFIPQLRqsgFSQAD  277
DSSP  HHHHHHHHHHHHLLLHHHEEELLLLL-LHHHlhhhLLLLLLHHHhLHHHHHHhllLLHHH


DSSP  HHHHHLHHHHHHLLllll
Query RQALLLDTARALFGfele  273
ident     |       |     
Sbjct VDVMLRENPSQFFQ----  291
DSSP  HHHHHLHHHHHHLL----


No 12: Query=2ffiA Sbjct=1gkpA Z-score=16.8

back to top
DSSP  -------------------------------------------------llLLLEELLLL
Query -------------------------------------------------lhLTAIDSHAH   11
ident                                                       || | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  LLlhhhhhhllLLLLLlLLLLHHHHHHHHHHLLLLEELLLLLHH----hllLLHHHHHHH
Query VFsrglnlasqRRYAPnYDAPLGDYLGQLRAHGFSHGVLVQPSF----lgtDNRYLLSAL   67
ident                                 |                        |  
Sbjct IY-------lpFMATF-AKDTHETGSKAALMGGTTTYIEMCCPSrnddaleGYQLWKSKA  112
DSSP  LL-------leELLEE-LLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhHHHHHHHHH


DSSP  HHL-llLLLLLLLL-LLLL-LHHHHHHHHLLLLLEEELLLLLLL--LLLLllLLLHHHHH
Query QTV-pgQLRGVVXL-ERDV-EQATLAEXARLGVRGVRLNLXGQD--XPDLtgAQWRPLLE  122
ident                  |      | |    |       |        |         | 
Sbjct EGNsycDYTFHMAVsKFDEkTEGQLREIVADGISSFXIFLSYKNffGVDD--GEMYQTLR  170
DSSP  LLLlllEEEEEEELlLLLLlHHHHHHHHHHLLLLEEEEEELLLLllLLLH--HHHHHHHH


DSSP  HHHHHLLEEEELLL-------------------------------LLLH-HHHHHHHLLL
Query RIGEQGWHVELHRQ-------------------------------VADI-PVLVRALQPY  150
ident    | |  |  |                                  |         |   
Sbjct LAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGtARFATFLETT  230
DSSP  HHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHhHHHHHHHHHH


DSSP  LLLEEELHhHLLLlllllllLLHHHHlLLLL--LLLEEEEEELHH---------------
Query GLDIVIDHfGRPDarrglgqPGFAELlTLSG--RGKVWVKVSGIY---------------  193
ident |      |            |                                       
Sbjct GATGYVVH-LSCK-------PALDAA-MAAKarGVPIYIESVIPHflldktyaerggvea  281
DSSP  LLEEEELL-LLLH-------HHHHHH-HHHHhlLLLEEEEEEHHHhhllhhhhhllhhhh


DSSP  -------HLLLLhhhhhHHHHHHHHHHHHHLlhhhEEEELLLLL----------------
Query -------RLQGSpeenlAFARQALCALEAHYgaerLXWGSDWPH----------------  230
ident         |                ||           | |                   
Sbjct mkyimspPLRDK-----RNQKVLWDALAQGF---iDTVGTDHCPfdteqkllgkeaftai  333
DSSP  hllllllLLLLL-----HHHHHHHHHHHLLL---lLEEELLLLLllhhhhhhhlllhhhl


DSSP  LLLLllLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHLLLLLL------------
Query TQHEseVSFGSAVEQFEALG-----CSAQLRQALLLDTARALFGFELE------------  273
ident             |      |                  |  |||                
Sbjct PNGI--PAIEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGLFPRkgtiavgsdadl  391
DSSP  LLLL--LLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLLLllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct vvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkll  451
DSSP  eeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleellllllllll


DSSP  -------
Query -------  273
ident        
Sbjct rrepmyf  458
DSSP  lllllll


No 13: Query=2ffiA Sbjct=1onxA Z-score=16.6

back to top
DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------l    1
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  lLLLEELLLLLLlhhhhhhlllLLLLLLLLLHHhhHHHHHHLLLLEELLLLLHHHL-lLL
Query hLTAIDSHAHVFsrglnlasqrRYAPNYDAPLGdyLGQLRAHGFSHGVLVQPSFLG-tDN   60
ident     || | |                         |  |   |    |            
Sbjct cPGFIDQHVHLI-----ggggeAGPTTRTPEVA--LSRLTEAGVTSVVGLLGTDSIsrHP  113
DSSP  eELEEEEEELLL-----lllllLLHHHLLLLLL--HHHHHHLLEEEEEELLLLLLLllLH


DSSP  HHHHHHHHHLL---lLLLLLLL--LLLL-----llHHHHHHHhlLLLLEEELL-LLLL-L
Query RYLLSALQTVP---gQLRGVVX--LERD-----veQATLAEXarLGVRGVRLN-LXGQ-D  108
ident   ||                                   |      | ||          
Sbjct ESLLAKTRALNeegiSAWMLTGayHVPSrtitgsvEKDVAII--DRVIGVXCAiSDHRsA  171
DSSP  HHHHHHHHHHHhhllEEEEEEEllLLLLllllllhHHHHHHL--LLEEEEEEEeLLLLlL


DSSP  LLLLllLLLHHHHHHHHHHL------LEEEELLL-lLLHHHHHHHHL---LLLL-LEEEL
Query XPDLtgAQWRPLLERIGEQG------WHVELHRQ-vADIPVLVRALQ---PYGL-DIVID  157
ident  ||                |           |             |              
Sbjct APDV--YHLANMAAESRVGGllggkpGVTVFHMGdsKKALQPIYDLLencDVPIsKLLPT  229
DSSP  LLLH--HHHHHHHHHHHHHHhhhlllLEEEEEELllLLLLHHHHHHHhllLLLHhHEEEE


DSSP  HHHLLLlllllllLLHHHHLLLlLLLLeEEEEE-LHHHLlllhhhhhhHHHHHHHHHHHH
Query HFGRPDarrglgqPGFAELLTLsGRGKvWVKVS-GIYRLqgspeenlaFARQALCALEAH  216
ident |  |         | |   |     |         |                        
Sbjct HVNRNV-------PLFEQALEFaRKGG-TIDITsSIDEP--------vAPAEGIARAVQA  273
DSSP  LHHHLH-------HHHHHHHHHhHLLL-LEEEElLLLLL--------lLHHHHHHHHHHL


DSSP  -LLHHHEEEELLLLLLLL----------LLLLLHHhHHHHH-HHHL----LLHHHHHHHH
Query -YGAERLXWGSDWPHTQH----------ESEVSFGsAVEQF-EALG----CSAQLRQALL  260
ident      |    ||    |                |          |      |       |
Sbjct gIPLARVTLSSDGNGSQPffddegnlthIGVAGFE-TLLETvQVLVkdydFSISDALRPL  332
DSSP  lLLHHHEEEELLLLLEEEeellllleeeEEELLLH-HHHHHhHHHHhhhlLLHHHHHHHH


DSSP  LHHHHHHLLLLL---------------------------------------------l
Query LDTARALFGFEL---------------------------------------------e  273
ident                                                           
Sbjct TSSVAGFLNLTGkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  LHHHHHHLLLLLllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 14: Query=2ffiA Sbjct=2ob3A Z-score=16.6

back to top
DSSP  ------------lLLLLEELLLLLL--lhhHHHHLLLL-llllLLLL-HHHHHHHHHHLL
Query ------------lHLTAIDSHAHVF--srgLNLASQRR-yapnYDAP-LGDYLGQLRAHG   44
ident                     | |          |           |      |   || |
Sbjct drintvrgpitisEAGFTLTHEHICgssagFLRAWPEFfgsrkALAEkAVRGLRRARAAG   60
DSSP  lleeelleeelhhHHLLEEEEELLEellllHHHHLHHHhllhhHHHHhHHHHHHHHHHLL


DSSP  LLEELLLLlhhHLLLLhHHHHHHHHLL---lLLLLLLLL--------------lLLLL-H
Query FSHGVLVQpsfLGTDNrYLLSALQTVP---gQLRGVVXL--------------eRDVE-Q   86
ident     | |                               |                     
Sbjct VRTIVDVS--tFDIGR-DVSLLAEVSRaadvHIVAATGLwfdpplsmrlrsveeLTQFfL  117
DSSP  LLEEEELL--lHHHLL-LHHHHHHHHHhhllEEELEEELlllllhhhhlllhhhHHHHhH


DSSP  HHHHHH---hLLLLLEEELLLLlLLLL-LLLLlllHHHHHHHHHHLLEEEELLLL--LLH
Query ATLAEX---aRLGVRGVRLNLXgQDXP-DLTGaqwRPLLERIGEQGWHVELHRQV--ADI  140
ident                                              |  |  |      | 
Sbjct REIQYGiedtGIRAGIIXVATT-GKATpFQEL-vlKAAARASLATGVPVTTHTAAsqRDG  175
DSSP  HHHHLLllllLLLLLEEEEELL-LLLLhHHHH-hhHHHHHHHHHHLLLEEEELLHhhLHH


DSSP  HHHHHHHL-LLLL--LEEELHHHLLLllllllllLHHHHLLLlllLLEEEEEELHH----
Query PVLVRALQ-PYGL--DIVIDHFGRPDarrglgqpGFAELLTLsgrGKVWVKVSGIY----  193
ident                   | |    |            |  |            |     
Sbjct EQQAAIFEsEGLSpsRVCIGHSDDTD--------DLSYLTAL-aaRGYLIGLDHIPysai  226
DSSP  HHHHHHHHhLLLLhhHEEELLHHHLL--------LHHHHHHH-hhLLLEEEELLLLllll


DSSP  ----------HLLLlhhHHHHHHHHHHHHHHHHLLHHHEEEELLLL----------llLL
Query ----------RLQGspeENLAFARQALCALEAHYGAERLXWGSDWP----------htQH  233
ident            |                ||             ||               
Sbjct glednasasaLLGI---RSWQTRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdVM  283
DSSP  lllllhhhhhHHLL---LLHHHHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhHH


DSSP  LLLL--LHHHHH-HHHHHHL---LLHHHHHHHHLHHHHHHLLllll
Query ESEV--SFGSAV-EQFEALG---CSAQLRQALLLDTARALFGfele  273
ident                   |                           
Sbjct DRVNpdGMAFIPlRVIPFLRekgVPQETLAGITVTNPARFLSptlr  329
DSSP  HHHLllHHHHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHHLllll


No 15: Query=2ffiA Sbjct=4b3zD Z-score=16.5

back to top
DSSP  --------------------------------------------------llLLLEELLL
Query --------------------------------------------------lhLTAIDSHA   10
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  LLLLHhhhhhllllllllLLLLHHHHHHHHHHLLLLEELLLLlhHHLL------LLHHHH
Query HVFSRglnlasqrryapnYDAPLGDYLGQLRAHGFSHGVLVQpsFLGT------DNRYLL   64
ident                                  |                          
Sbjct YLQKT-------------AADDFFQGTRAALVGGTTMIIDHV--VPEPgsslltSFEKWH  105
DSSP  LLLLL-------------LLLLHHHHHHHHHHLLEEEEEEEE--LLLLlllhhhHHHHHH


DSSP  HHHHHL-llLLLLLLL-LLLL-LLHHHHHHHHL-LLLLEEELLLLLLL--LLLLllLLLH
Query SALQTV-pgQLRGVVX-LERD-VEQATLAEXAR-LGVRGVRLNLXGQD--XPDLtgAQWR  118
ident  |  |         |            |       ||          |         |  
Sbjct EAADTKsccDYSLHVDiTSWYdGVREELEVLVQdKGVNSFQVYMAYKDvyQMSD--SQLY  163
DSSP  HHHHLLlllEEEEEEElLLLLlLHHHHHHHHHHlLLLLEEEEELLLLLllLLLH--HHHH


DSSP  HHHHHHHHHLLEEEELL--------------------------------LLLLHHHHHHH
Query PLLERIGEQGWHVELHR--------------------------------QVADIPVLVRA  146
ident          |     |                                            
Sbjct EAFTFLKGLGAVILVHAengdliaqeqkrilemgitgpeghalsrpeelEAEAVFRAITI  223
DSSP  HHHHHHHHHLLEEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhHHHHHHHHHHH


DSSP  HLLLLLLEEELHhHLLLlllllllLLHHHHLLL-LLLLLEEEEEELHH------------
Query LQPYGLDIVIDHfGRPDarrglgqPGFAELLTL-SGRGKVWVKVSGIY------------  193
ident          |                             |                    
Sbjct AGRINCPVYITK-VMSK-------SAADIIALArKKGPLVFGEPIAASlgtdgthywskn  275
DSSP  HHHHLLLEEEEE-ELLH-------HHHHHHHHHhHHLLLEEEEELHHHhhlllhhhhlll


DSSP  -----------HLLLLhhhhhHHHHHHHHHHHHHLlhhhEEEELLLL-------------
Query -----------RLQGSpeenlAFARQALCALEAHYgaerLXWGSDWP-------------  229
ident             |                 |           ||                
Sbjct wakaaafvtspPLSPD----pTTPDYLTSLLACGD---lQVTGSGHCpystaqkavgkdn  328
DSSP  hhhhhhlllllLLLLL----lLHHHHHHHHHHHLL---lLLLLLLLLlllhhhhhhhlll


DSSP  ---lLLLLllLLHHHHHHHHHHHLL-----LHHHHHHHHLHHHHHHLLLLLL--------
Query ---hTQHEseVSFGSAVEQFEALGC-----SAQLRQALLLDTARALFGFELE--------  273
ident                                     |     |   |             
Sbjct ftliPEGV--NGIEERMTVVWDKAVatgkmDENQFVAVTSTNAAKIFNLYPRkgriavgs  386
DSSP  hhhlLLLL--LLLLLHHHHHHHHHLlllllLHHHHHHHHLHHHHHHHLLLLLllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct dadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgm  446
DSSP  llleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllll


DSSP  -------------------------------
Query -------------------------------  273
ident                                
Sbjct grfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  llllllllllhhhhhhhhhhhhhllllllll


No 16: Query=2ffiA Sbjct=2y1hB Z-score=16.5

back to top
DSSP  lllLLEELLLLLLlhhhhhhllllllllLLLL--HHHHHHHHHHLLLLEELLLLLhhhLL
Query lhlTAIDSHAHVFsrglnlasqrryapnYDAP--LGDYLGQLRAHGFSHGVLVQPsflGT   58
ident       | | |                  |    | | |           | |       
Sbjct -gvGLVDCHCHLS--------------aPDFDrdLDDVLEKAKKANVVALVAVAE---HS   42
DSSP  -llLEEEEEELLL--------------lHHHLllHHHHHHHHHHLLEEEEEELLL---LH


DSSP  LL-HHHHHHHHHLLLLLLLLLLL--------------LLLLlHHHHHHHHLLlLLEE-EL
Query DN-RYLLSALQTVPGQLRGVVXL--------------ERDVeQATLAEXARLgVRGV-RL  102
ident               |                        ||                   
Sbjct GEfEKIMQLSERYNGFVLPCLGVhpvqgldqrsvtlkDLDVaLPIIENYKDR-LLAIgEV  101
DSSP  HHhHHHHHHHHHLLLLEEEEELLlleelllleellhhHHHHhHHHHHHHLLL-LLEEeEE


DSSP  LLLLL--------LLLLLLLllLHHHHHHHHHHLLEEEELLLlLLHHHHHHHHLLLLL-L
Query NLXGQ--------DXPDLTGaqWRPLLERIGEQGWHVELHRQvADIPVLVRALQPYGL-D  153
ident  |                                  |  |            ||  |   
Sbjct GLDFSprfagtgeQKEEQRQ-vLIRQIQLAKRLNLPVNVHSR-SAGRPTINLLQEQGAeK  159
DSSP  EEELLllllllhhHHHHHHH-hHHHHHHHHHHHLLLEEEEEE-LLHHHHHHHHHHLLLlL


DSSP  EEELhHHLLllllllllllHHHHLLLlLLLLEEEEEELHHhllllhhhHHHHHHHHHHHH
Query IVIDhFGRPdarrglgqpgFAELLTLsGRGKVWVKVSGIYrlqgspeeNLAFARQALCAL  213
ident                             |                              |
Sbjct VLLH-AFDG----------RPSVAMEgVRAGYFFSIPPSI-------iRSGQKQKLVKQL  201
DSSP  EEEE-LLLL----------LHHHHHHhHHLLLEEEELHHH-------hLLHHHHHHHHHL


DSSP  HhhllHHHEEEELLLLL-llLLLLLLHhhHHHHHHHHLL------LHHHHHHHhLHHHHH
Query EahygAERLXWGSDWPH-tqHESEVSFgsAVEQFEALGC------SAQLRQALlLDTARA  266
ident              | |                                         |  
Sbjct P----LTSICLETDSPAlgpEKQVRNEpwNISISAEYIAqvkgisVEEVIEVT-TQNALK  256
DSSP  L----HHHEEELLLLLLlllLLLLLLLhhHHHHHHHHHHhhhlllHHHHHHHH-HHHHHH


DSSP  HL-LLLL-l
Query LF-GFEL-e  273
ident ||       
Sbjct LFpKLRHll  265
DSSP  HLlLHHHhl


No 17: Query=2ffiA Sbjct=3pnuA Z-score=16.3

back to top
DSSP  ----------lllLLEELLLLLLLHhhhhhlllllllllllLHHHHHHHHHHLlLLEELL
Query ----------lhlTAIDSHAHVFSRglnlasqrryapnydaPLGDYLGQLRAHgFSHGVL   50
ident                 | | |                     |           |   | 
Sbjct enlyfqsnamklkNPLDMHLHLRDN---------------qMLELIAPLSARD-FCAAVI   44
DSSP  llllllllleeeeLLEEEEELLLLH---------------hHHHHHHHHHHLL-LLEEEE


DSSP  LLLHHHL-LLLHHHHHHHHHLL-------lLLLLLLLLLLlLLHHHHHHHHLLlLLEEEL
Query VQPSFLG-TDNRYLLSALQTVP-------gQLRGVVXLERdVEQATLAEXARLgVRGVRL  102
ident              |                                |         |  |
Sbjct MPNLIPPlCNLEDLKAYKMRILkackdenfTPLMTLFFKN-YDEKFLYSAKDE-IFGIXL  102
DSSP  LLLLLLLlLLHHHHHHHHHHHHhhhlllllEEEEEEELLL-LLHHHHHHHLLL-LLEEEE


DSSP  LLLLL--------LLLLllLLLLHHHHHHHHHHLLEEEELLL--------LLLHHHHHHH
Query NLXGQ--------DXPDltGAQWRPLLERIGEQGWHVELHRQ--------VADIPVLVRA  146
ident    |            |       | ||           |                    
Sbjct YPAGIttnsnggvSSFD--IEYLKPTLEAMSDLNIPLLVHGEtndfvmdrESNFAKIYEK  160
DSSP  LLLLLllllllllLLLL--HHHHHHHHHHHHHLLLLEEELLLllllhhhlLHHHHHHHHH


DSSP  H-LLLL-LLEEELHHHllllllllllllhHHHLLL-LLLLLEEEEEELHH-hLLLLHH--
Query L-QPYG-LDIVIDHFGrpdarrglgqpgfAELLTL-SGRGKVWVKVSGIY-rLQGSPE--  200
ident |      | ||  |                 |  |                         
Sbjct LaKHFPrLKIVMEHIT------------tKTLCELlKDYENLYATITLHHliITLDDVig  208
DSSP  HhHHLLlLLEEELLLL------------lHHHHHHhHHLLLEEEEELLHHhlLLHHHHhl


DSSP  ------------hhhHHHHHHHHHHHhhlLHHHEEEELLLLL-----LLLLllLLHHHHH
Query ------------enlAFARQALCALEahyGAERLXWGSDWPH-----TQHEseVSFGSAV  243
ident                     ||| |    | |    |||               |     
Sbjct gkmnphlfckpiakrYEDKEALCELA-fsGYEKVMFGSDSAPhpkgcAAGV--FSAPVIL  265
DSSP  llllhhhllllllllHHHHHHHHHHH-hlLLLLEEELLLLLLlllllLLLL--LLHHHHH


DSSP  HHHHHHL---LLHHHHHHHHLHHHHHHLLLLLL---------------------------
Query EQFEALG---CSAQLRQALLLDTARALFGFELE---------------------------  273
ident      |     |    |  | |                                      
Sbjct PVLAELFkqnSSEENLQKFLSDNTCKIYDLKFKedkiltleekewqvpnvyedkynqvvp  325
DSSP  HHHHHHHhhhLLHHHHHHHHLHHHHHHHLLLLLllleeeeellleelllleelllleell


DSSP  -------------
Query -------------  273
ident              
Sbjct ymageilkfqlkh  338
DSSP  llllleelleell


No 18: Query=2ffiA Sbjct=2vunA Z-score=16.2

back to top
DSSP  ---------------------------------------------------------llL
Query ---------------------------------------------------------lhL    3
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE


DSSP  LLEELLLLLLlhhhhhhllllllllllLLHH-------HHHHHHHHLLLLEELLLLLHHH
Query TAIDSHAHVFsrglnlasqrryapnydAPLG-------DYLGQLRAHGFSHGVLVQPSFL   56
ident    | | ||                             |        |            
Sbjct GLLDTHVHVS-----------------GGDYaprqktmDFISSALHGGVTTMISAGSPHF  103
DSSP  LEEEEEELLL-----------------LLLEehhhleeLHHHHHHLLLEEEEEELLLLLL


DSSP  ---------LLLL--HHHHHHHHHL--llLLLL-LLLLLLLLLHHHHHHHHLLlLLEEEL
Query ---------GTDN--RYLLSALQTV--pgQLRG-VVXLERDVEQATLAEXARLgVRGVRL  102
ident                    |            |  | ||         |     |  |  
Sbjct pgrpkdaagTKALaiTLSKSYYNARpagvKVHGgAVILEKGLTEEDFIEMKKEgVWIVGE  163
DSSP  llllllhhhHHHHhhHHHHHHHHLLhhhlEEELlEELLLLLLLHHHHHHHHHLlLLEEEE


DSSP  LLlllllLLLLllLLHHHHHHHHHHLLEEEELLL-------lLLHHHHHHHHLllllLEE
Query NLxgqdxPDLTgaQWRPLLERIGEQGWHVELHRQ-------vADIPVLVRALQpyglDIV  155
ident                 |  |     |  |  |                |          |
Sbjct VG-lgtiKNPE--DAAPMVEWAHKHGFKVQMHTGgtsipgssTVTADDVIKTK----PDV  216
DSSP  EL-llllLLHH--HHHHHHHHHHHLLLEEEEELLllllllllLLLHHHHHHHL----LLE


DSSP  ELHH----HLLLllllllLLLHHHHLLLLLlllEEEEEELHHhllllhhhHHHHHHHHHH
Query IDHF----GRPDarrglgQPGFAELLTLSGrgkVWVKVSGIYrlqgspeeNLAFARQALC  211
ident   |                                               |   |     
Sbjct VSHInggpTAIS------VQEVDRIMDETD---FAMEIVQCG--------NPKIADYVAR  259
DSSP  EELLllllLLLL------HHHHHHHHHHLL---LEEEEELLL--------LHHHHHHHHH


DSSP  HHH-HHLLhHHEEEELLLLlLLLLllLLHHhHHHHH-HHHL----LLHHHHHHHHLHHHH
Query ALE-AHYGaERLXWGSDWPhTQHEseVSFGsAVEQF-EALG----CSAQLRQALLLDTAR  265
ident           |   | | |                                         
Sbjct RAAeKGQL-GRVIFGNDAP-SGTG--LIPL-GILRNmCQIAsmsdIDPEVAVCMATGNST  314
DSSP  HHHhHLLH-HHEEEELLLL-LLLL--LLLL-HHHHHhHHHHhhllLLHHHHHHHHLHHHH


DSSP  HHLLLLL-----------------------------------------------------
Query ALFGFEL-----------------------------------------------------  272
ident |  |                                                        
Sbjct AVYGLNTgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrn  374
DSSP  HHHLLLLlllllllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelllll


DSSP  ----------l
Query ----------e  273
ident            
Sbjct tppakraakil  385
DSSP  lllllllleel


No 19: Query=2ffiA Sbjct=4cqbA Z-score=16.1

back to top
DSSP  --------------------------------------------------llLLLEELLL
Query --------------------------------------------------lhLTAIDSHA   10
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE


DSSP  LLL--------------lhhhhhhlllLLLLLL---------llLHHHHHHHHHHLLLLE
Query HVF--------------srglnlasqrRYAPNY---------daPLGDYLGQLRAHGFSH   47
ident |                               |                      ||   
Sbjct HMDksftstgerlpkfwsrpytrdaaiEDGLKYyknatheeikrHVIEHAHMQVLHGTLY  120
DSSP  LHHhllllllllllllllllllhhhhhHHHHHHhhhllhhhhhhHHHHHHHHHHHLLEEE


DSSP  ELLLLL--hhHLLL-LHHHHHHHHHLL--LLLLLLLLL---------LLLLlHHHHHHHh
Query GVLVQP--sfLGTD-NRYLLSALQTVP--GQLRGVVXL---------ERDVeQATLAEXa   93
ident             |      | |            |                    |    
Sbjct TRTHVDvdsvAKTKaVEAVLEAKEELKdlIDIQVVAFAqsgffvdleSESLiRKSLDMG-  179
DSSP  EEEEEEllllLLLHhHHHHHHHHHHLLllLEEEEEEELlllllllllHHHHhHHHHHHL-


DSSP  lllLLEEELLL-LLLL-LLLLlllllHHHHHHHHHHLLEEEELL------LLLLHHHHHH
Query rlgVRGVRLNL-XGQD-XPDLtgaqwRPLLERIGEQGWHVELHR------QVADIPVLVR  145
ident       |                           |       |        |  |  |  
Sbjct ---CDLVGGVDpATREnNVEG---slDLCFKLAKEYDVDIDYHIhdigtvGVYSINRLAQ  233
DSSP  ---LLEEELLLlLLLLlLHHH---hhHHHHHHHHHLLLEEEEEElllhhhHHHHHHHHHH


DSSP  HHLLLLL--LEEELHHhLLLLLLLLLLllHHHHLLLLLLLLEEEEEELHHhllllhhhhH
Query ALQPYGL--DIVIDHFgRPDARRGLGQpgFAELLTLSGRGKVWVKVSGIYrlqgspeenL  203
ident      |        |     |          |   |                        
Sbjct KTIENGYkgRVTTSHA-WCFADAPSEW--LDEAIPLYKDSGMKFVTCFSS--------tP  282
DSSP  HHHHLLLllLEEEEEL-LHHHHLLHHH--HHHHHHHHHHHLLEEEEELLL--------lL


DSSP  HHHhhHHHHHHHHLLhhHEEEELLLLLLLLLlLLLH---hHHHHHHH-HHLL----LHHH
Query AFArqALCALEAHYGaeRLXWGSDWPHTQHEsEVSF---gSAVEQFE-ALGC----SAQL  255
ident          |        |   ||                         |         |
Sbjct PTM--PVIKLLEAGI--NLGCASDNIRDFWV-PFGNgdmvQGALIETqRLELktnrDLGL  337
DSSP  LLL--LHHHHHHLLL--EEEEELLLLLLLLL-LLLLllhhHHHHHHHhHHLLllhhHHHH


DSSP  HHHHHLHHHHH-HLLLLLL-----------------------------------------
Query RQALLLDTARA-LFGFELE-----------------------------------------  273
ident             |                                               
Sbjct IWKMITSEGARvLGIEKNYgievgkkadlvvlnslspqwaiidqakrlcvikngriivkd  397
DSSP  HHHHHLHHHHHhHLLHHHLllllllllleeeellllhhhhhhhllleeeeeelleeeeel


DSSP  -----
Query -----  273
ident      
Sbjct eviva  402
DSSP  leell


No 20: Query=2ffiA Sbjct=2oofA Z-score=15.8

back to top
DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------l    1
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  lLLLEELLLL-LLLHH-----------------hhhhlllLLLLLL---------llLHH
Query hLTAIDSHAH-VFSRG-----------------lnlasqrRYAPNY---------daPLG   34
ident     || | |  |                                               
Sbjct tPGLIDCHTHlIFAGSraeefelrqkgvpyaeiarkgggiISTVRAtraasedqlfeLAL  120
DSSP  eELEEEEEELlLLLLLlhhhhhhhhhlllhhhhhhllllhHHHHHHhhhllhhhhhhHHH


DSSP  HHHHHHHHLLLLEELLLLLhHHLL---LLHHHHHHHHHLL---LLLLLLLLL--------
Query DYLGQLRAHGFSHGVLVQPsFLGT---DNRYLLSALQTVP---GQLRGVVXL--------   80
ident      |   |             |       |  |                         
Sbjct PRVKSLIREGVTTVEIKSG-YGLTledELKXLRVARRLGEalpIRVKTTLLAahavppey  179
DSSP  HHHHHHHHHLEEEEEEELL-LLLLhhhHHHHHHHHHHHHHhllLEEEEEEEEellllhhh


DSSP  ----------LLLL-lHHHHHHHHlllLLEEELLLL-LLLLLLLlllllHHHHHHHHHHL
Query ----------ERDV-eQATLAEXArlgVRGVRLNLX-GQDXPDLtgaqwRPLLERIGEQG  128
ident                  |            |                            |
Sbjct rddpdswvetICQEiiPAAAEAGL---ADAVDVFCEhIGFSLAQ----tEQVYLAADQYG  232
DSSP  lllhhhhhhhHHHLhhHHHHHLLL---LLEEEEEELlLLLLHHH----hHHHHHHHHHLL


DSSP  LEEEELL--LLLLhhHHHHHHLLLlLLEEELhHHLLllllllllllHHHHLLLlLLLLEE
Query WHVELHR--QVADipVLVRALQPYgLDIVIDhFGRPdarrglgqpgFAELLTLsGRGKVW  186
ident   |  |                        |                 |         | 
Sbjct LAVKGHXdqLSNL--GGSTLAANF-GALSVD-HLEY---------lDPEGIQAlAHRGVV  279
DSSP  LEEEEEEllLLLL--LHHHHHHHL-LLLEEE-ELLL---------lLHHHHHHhHHHLLE


DSSP  EEEE--LHHHLLllhhhHHHHHhhHHHHHHHHLLhhHEEEELLLlLLLLlllLLHH--HH
Query VKVS--GIYRLQgspeeNLAFArqALCALEAHYGaeRLXWGSDWpHTQHeseVSFG--SA  242
ident         | |                ||            ||                |
Sbjct ATLLptAFYFLK-----ETKLP--PVVALRKAGV--PXAVSSDI-NPGT--aPIVSlrXA  327
DSSP  EEELhhHHHHLL-----LLLLL--LHHHHHHLLL--LEEELLLL-LLLL--lLLLLhhHH


DSSP  HHHHHH-HLLLHHHHHHHHLHHHHHHL-LLLLL---------------------------
Query VEQFEA-LGCSAQLRQALLLDTARALF-GFELE---------------------------  273
ident         |       |     |       |                             
Sbjct XNXACTlFGLTPVEAXAGVTRHAARALgEQEQLgqlrvgxladflvwncghpaelsylig  387
DSSP  HHHHHHhHLLLHHHHHHHLLHHHHHHLlLLLLLlllllllllleeeellllllhhhhlll


DSSP  ----------------
Query ----------------  273
ident                 
Sbjct vdqlvsrvvngeetlh  403
DSSP  llleeeeeelleelll


No 21: Query=2ffiA Sbjct=3k2gB Z-score=15.8

back to top
DSSP  ------------------------lLLLLEELLLLLLlhhhhhhllLLLL----------
Query ------------------------lHLTAIDSHAHVFsrglnlasqRRYA----------   26
ident                           |     | |           |             
Sbjct slselspchvrsgrixtvdgpipssALGHTLXHEHLQ------ndcRCWWnppqeperqy   54
DSSP  llllllllllllleeeelleeeehhHLLLEELLLLLL------eelHHHLlllllhhhhh


DSSP  ----------------------LLLLLL----HHHHHHHHHHLLLLEELLLLlhhhLLLL
Query ----------------------PNYDAP----LGDYLGQLRAHGFSHGVLVQpsflGTDN   60
ident                        |              |  | |    |           
Sbjct laeapisieilselrqdpfvnkHNIALDdldlAIAEVKQFAAVGGRSIVDPT---cRGIG  111
DSSP  hhhllllhhhhhhhhllhhhllLLLEELlhhhHHHHHHHHHHLLLLEEEELL---lLLLL


DSSP  HHhHHHHHHLL----lLLLLLLLL----------------lLLLL-HHHHHHH---hLLL
Query RYlLSALQTVP----gQLRGVVXL----------------eRDVE-QATLAEX---aRLG   96
ident |     |         |                           |  |   |        
Sbjct RD-PVKLRRISaetgvQVVXGAGYylassxpetaarlsaddIADEiVAEALEGtdgtDAR  170
DSSP  LL-HHHHHHHHhhhllEEEELLLLllhhhllhhhhlllhhhHHHHhHHHHHLLllllLLL


DSSP  LLEEE-LLLLlLLLLLllLLLLHHHHHHHHHHLLEEEELLLL--LLHHHHHHHHL-LLLL
Query VRGVR-LNLXgQDXPDltGAQWRPLLERIGEQGWHVELHRQV--ADIPVLVRALQ-PYGL  152
ident             |         |         |     |                     
Sbjct IGLIGeIGVS-SDFTAeeEKSLRGAARAQVRTGLPLXVHLPGwfRLAHRVLDLVEeEGAD  229
DSSP  LLLEEeELLL-LLLLHhhHHHHHHHHHHHHHHLLLEEELLLLllLLHHHHHHHHHhLLLL


DSSP  --LEEELHhHLLLlllLLLLllhHHHLLLLLLLlEEEEEELHHHLL-----llhhHHHHH
Query --DIVIDHfGRPDarrGLGQpgfAELLTLSGRGkVWVKVSGIYRLQ-----gspeENLAF  205
ident     |  |   |               ||  ||        |                  
Sbjct lrHTVLCH-XNPS---HXDP---VYQATLAQRG-AFLEFDXIGXDFfyadqgvqcPSDDE  281
DSSP  hhHEEELL-LHHH---LLLH---HHHHHHHHHL-LEEEELLLLLLLeelllleelLLHHH


DSSP  HHHHHHHHHHHLLHHHEEEELLLLlLLLL----LLLLHHHHH-HHHHHHL---LLHHHHH
Query ARQALCALEAHYGAERLXWGSDWPhTQHE----SEVSFGSAV-EQFEALG---CSAQLRQ  257
ident    |   |  |    |     |                          |           
Sbjct VARAILGLADHGYLDRILLSHDVF-VKXXltryGGNGYAFVTkHFLPRLRrhgLDDAALE  340
DSSP  HHHHHHHHHHLLLHHHEEELLLLL-LHHHlhhhLLLLLLHHHhLHHHHHHhllLLHHHHH


DSSP  HHHLHHHHHHLL--llll
Query ALLLDTARALFG--fele  273
ident  |     |  |       
Sbjct TLXVTNPRRVFDasiegh  358
DSSP  HHHLHHHHHHHLllllll


No 22: Query=2ffiA Sbjct=2pajA Z-score=15.6

back to top
DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------lh    2
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  LLLEELLLLLLlhhhhhhllllLLLLL-----lLLHHHHHHHHHHLLLLEELLLLlHHHL
Query LTAIDSHAHVFsrglnlasqrrYAPNY-----dAPLGDYLGQLRAHGFSHGVLVQpSFLG   57
ident       | | |                            |  |   |             
Sbjct PAWVNTHHHLF---qsllkgepFRALFderrfrLAARIGLIELARSGCATVADHN-YVYY  116
DSSP  ELEELLLLLHH---hhhlllllLHHHLlhhhhhHHHHHHHHHHHLLLEEEEEELL-LLLL


DSSP  --lllHHHHHHHHHLL---LLLLLLLL----------------------lLLLLlHHHHH
Query --tdnRYLLSALQTVP---GQLRGVVX----------------------lERDVeQATLA   90
ident                                                            |
Sbjct pgmpfDSSAILFEEAEklgLRFVLLRGgatqtrqleadlptalrpetldaYVADiERLAA  176
DSSP  lllllLHHHHHHHHHHhllLEEEEEELlllllllllllllhhhllllhhhHHHHhHHHHH


DSSP  HHHL-----lLLLEEELL-LLLLllLLLLLllLHHHHHHHHHHLLEEEELLL-lLLHHHH
Query EXAR-----lGVRGVRLN-LXGQdxPDLTGaqWRPLLERIGEQGWHVELHRQ-vADIPVL  143
ident                                  |         |     |          
Sbjct RYHDaspramRRVVMAPTtVLYS--ISPRE--MRETAAVARRLGLRMHSHLSgkSPVAFC  232
DSSP  HLLLllllllEEEEELLLlLLLL--LLHHH--HHHHHHHHHHLLLEEEEELLllLHHHHH


DSSP  HHHHLllllLEEELhHHLLlllllllllLHHHHLLLlLLLLEEEEEE--LHHHLlllhhh
Query VRALQpyglDIVIDhFGRPdarrglgqpGFAELLTLsGRGKVWVKVS--GIYRLqgspee  201
ident          |                    |    |       |        ||      
Sbjct GEHDW-lgsDVWYA-HLVK---------VDADEIALlAQTGTGVAHCpqSNGRL------  275
DSSP  HHLLL-lllLEEEE-LLLL---------LLHHHHHHhHHHLLEEEELhhHHHLL------


DSSP  hhhhhhhHHHHHHHHLLhhHEEEELLLLLLlllllLLHH--HHHHHHHHHL----LLHHH
Query nlafarqALCALEAHYGaeRLXWGSDWPHTqheseVSFG--SAVEQFEALG----CSAQL  255
ident                        | |               | |            |   
Sbjct -------PVREMADAGV--PVSIGVDGAAS----nEAADmiSEVHMTWLAQrarlASIAE  322
DSSP  -------LLLLHHHHLL--LEEELLLHHHH----lLLLLhhHHHHHHHHHHhhllLLHHH


DSSP  HHHHHLHHHHH-HLLLLL------------------------------------------
Query RQALLLDTARA-LFGFEL------------------------------------------  272
ident                 |                                           
Sbjct VIHWGTAGGARvMGLDEVgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvma  382
DSSP  HHHHHLHHHHHhHLLLLLlllllllllleeeeelllhhhlllllhhhhhhhllllleeee


DSSP  --------------------------------------l
Query --------------------------------------e  273
ident                                        
Sbjct lfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 23: Query=2ffiA Sbjct=1k6wA Z-score=15.6

back to top
DSSP  -------------------------------------------------llLLLEELLLL
Query -------------------------------------------------lhLTAIDSHAH   11
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LL----------------------lhHHHHHLLlllllllllLHHHHHHHHHHLLLLEEL
Query VF----------------------srGLNLASQrryapnydaPLGDYLGQLRAHGFSHGV   49
ident                                                |    | |  |  
Sbjct LDttqtagqpnwnqsgtlfegierwaERKALLT---hddvkqRAWQTLKWQIANGIQHVR  117
DSSP  LLlllllllllllllllhhhhhhhhhLLHHHLL---hhhhhhHHHHHHHHHHHLLEEEEE


DSSP  LLLlhhHLLL-----LHHHHHHHHHLL--LLLLLLLLL---------LLLLlhHHHHHHh
Query LVQpsfLGTD-----NRYLLSALQTVP--GQLRGVVXL---------ERDVeqATLAEXa   93
ident          |         |   | |     |  |                    |    
Sbjct THV---DVSDatltaLKAMLEVKQEVApwIDLQIVAFPqegilsypnGEALleEALRLG-  173
DSSP  EEE---ELLLlllhhHHHHHHHHHHHLllLEEEEEEELlllllllllHHHHhhHHHHLL-


DSSP  lllLLEEELLLLLL----LLLLllllllHHHHHHHHHHLLEEEELLL------lLLHHHH
Query rlgVRGVRLNLXGQ----DXPDltgaqwRPLLERIGEQGWHVELHRQ------vADIPVL  143
ident       |                                     |               
Sbjct ---ADVVGAIPHFEftreYGVE----slHKTFALAQKYDRLIDVHCDeiddeqsRFVETV  226
DSSP  ---LLEEEELHHHLllhhHHHH----hhHHHHHHHHHHLLEEEEEELlllllllLHHHHH


DSSP  HHHHLLLLL--LEEELHHhLLLLllLLLLLLHHHHLLLLLLLLEEEEEE--LHHHLLLL-
Query VRALQPYGL--DIVIDHFgRPDArrGLGQPGFAELLTLSGRGKVWVKVS--GIYRLQGS-  198
ident        |        |                 |  |                 |||  
Sbjct AALAHHEGMgaRVTASHT-TAMH--SYNGAYTSRLFRLLKMSGINFVANplVNIHLQGRf  283
DSSP  HHHHHHHLLhhHEEEEEL-HHHH--HLLHHHHHHHHHHHHHHLLEEEELhhHHHHHLLLl


DSSP  ---hHHHHhhhhhHHHHHHHHLLhhHEEEELLLLLL-LLLLlLLHH--HHHHHHH-HHLL
Query ---pEENLafarqALCALEAHYGaeRLXWGSDWPHT-QHESeVSFG--SAVEQFE-ALGC  251
ident                              | |                            
Sbjct dtypKRRG---itRVKEMLESGI--NVCFGHDDVFDpWYPL-GTANmlQVLHMGLhVCQL  337
DSSP  llllLLLL---llLHHHHHHLLL--LEEELLLLLLLlLLLL-LLLLhhHHHHHHHhHLLL


DSSP  -----LHHHhHHHHLHHHHHHLLLLLL---------------------------------
Query -----SAQLrQALLLDTARALFGFELE---------------------------------  273
ident             |                                               
Sbjct mgygqINDG-LNLITHHSARTLNLQDYgiaagnsanliilpaengfdalrrqvpvrysvr  396
DSSP  llhhhHHHH-HHHHLHHHHHHLLLLLLllllllllleeeellllhhhhhhhllllleeee


DSSP  ---------------------------
Query ---------------------------  273
ident                            
Sbjct ggkviastqpaqttvyleqpeaidykr  423
DSSP  lleeeeellllleeeellleeeellll


No 24: Query=2ffiA Sbjct=3griA Z-score=15.6

back to top
DSSP  -------------------------------------------------llLLLEELLLL
Query -------------------------------------------------lhLTAIDSHAH   11
ident                                                        | | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL


DSSP  LLLhhhhhhllllllLLLLLLHHHHHHHHHHLLLLEELLLLLHHHLL----LLHHHHHHH
Query VFSrglnlasqrryaPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGT----DNRYLLSAL   67
ident                  |              ||                     |    
Sbjct LRE----------pgGEYKETIETGTKAAARGGFTTVCPXPNTRPVPdsveHFEALQKLI  110
DSSP  LLL----------llLLLLLLHHHHHHHHHHLLEEEEEELLLLLLLLllhhHHHHHHHHH


DSSP  HHL-llLLLLLLLLL-----LLLLhhHHHHHHLLLLLEEELLLLllllLLLLllLLHHHH
Query QTV-pgQLRGVVXLE-----RDVEqaTLAEXARLGVRGVRLNLXgqdxPDLTgaQWRPLL  121
ident                                   |                         
Sbjct DDNaqvRVLPYASITtrqlgKELV--DFPALVKEGAFAFTDDGV--gvQTAS--XXYEGX  164
DSSP  HHHlllEELLLEELLhhhllLLLL--LHHHHHLLLLLLEEELLL--llLLHH--HHHHHH


DSSP  HHHHHHLLEEEELL-----------------------------LLLLHHHHHHHHLLLLL
Query ERIGEQGWHVELHR-----------------------------QVADIPVLVRALQPYGL  152
ident             |                                  |   |      | 
Sbjct IEAAKVNKAIVAHCednsliyggaxhegkrskelgipgipnicESVQIARDVLLAEAAGC  224
DSSP  HHHHHHLLLEEELLllhhhllllleellhhhhhhllleellhhHHHHHHHHHHHHHHHLL


DSSP  LEEELHhHLLLlllllllLLHHHHLLL-LLLLLEEEEEELHH------------------
Query DIVIDHfGRPDarrglgqPGFAELLTL-SGRGKVWVKVSGIY------------------  193
ident      |                           |   |                      
Sbjct HYHVCH-VSTK-------ESVRVIRDAkRAGIHVTAEVTPHHlllteddipgnnaiykxn  276
DSSP  LEEELL-LLLH-------HHHHHHHHHhHLLLLEEEEELHHHhhllhhhlllllhhhlll


DSSP  HLLLlhhhhhHHHHHHHHHHHHHLlhhhEEEELLLLL-------------LLLLllLLHH
Query RLQGspeenlAFARQALCALEAHYgaerLXWGSDWPH-------------TQHEseVSFG  240
ident                 |  |             |                      |   
Sbjct PPLR----stEDREALLEGLLDGT---iDCIATDHAPhardekaqpxekaPFGI--VGSE  327
DSSP  LLLL----lhHHHHHHHHHHHLLL---lLEELLLLLLllhhhhlllllllLLLL--LLLL


DSSP  HHHHHHHHHL-----LLHHHHHHHHLHHHHHHLLLLL-----------------------
Query SAVEQFEALG-----CSAQLRQALLLDTARALFGFEL-----------------------  272
ident  |                |     |       |  |                        
Sbjct TAFPLLYTHFvkngdWTLQQLVDYLTIKPCETFNLEYgtlkengyadltiidldseqeik  387
DSSP  LHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLLlllllllllleeeeelllleell


DSSP  ----------------------------------l
Query ----------------------------------e  273
ident                                    
Sbjct gedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  hhhllllllllllllleelleeeeeeelleeeeel


No 25: Query=2ffiA Sbjct=2ogjA Z-score=15.5

back to top
DSSP  -----------------------------------------------------llLLLEE
Query -----------------------------------------------------lhLTAID    7
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE


DSSP  LLL-LLLLhhhhhhllllllllLLLLhhHHHHHHHHLLLLEELLLLLhhHLLL-LHHHHH
Query SHA-HVFSrglnlasqrryapnYDAPlgDYLGQLRAHGFSHGVLVQPsfLGTD-NRYLLS   65
ident  |                                   |    |       |         
Sbjct LHVhIWHG------------gtDISI--RPSECGAERGVTTLVDAGS--AGEAnFHGFRE  104
DSSP  EEElLLLL------------llLLLL--LHHHLLHHHLEEEEEEELL--LLLLlHHHHHH


DSSP  -HHHHLllLLLLLLLLL------------------LLLL--HHHHHHHHlLLLLEEELLL
Query -ALQTVpgQLRGVVXLE------------------RDVE--QATLAEXArLGVRGVRLNL  104
ident                |                    |        ||       |     
Sbjct yIIEPSreRIKAFLNLGsiglvacnrvpelrdikdIDLDriLECYAENS-EHIVGLXVRA  163
DSSP  hLLLLLllEEEEEEELLlllllllllllllllhhhLLHHhhHHHHHLLL-LLEEEEEEEE


DSSP  LLL----LLLLLlllllHHHHHHHHHHLLEEEELLL--llLHHHHHHHHLlllLLEEELH
Query XGQ----DXPDLtgaqwRPLLERIGEQGWHVELHRQ--vaDIPVLVRALQpygLDIVIDH  158
ident                                  |              |       |  |
Sbjct SHVitgsWGVTP----vKLGKKIAKILKVPXXVHVGeppaLYDEVLEILG---PGDVVTH  216
DSSP  LHHhhllLLLHH----hHHHHHHHHHHLLLEEEEELllllLHHHHHHHLL---LLLEEEL


DSSP  HHLLL--lllLLLLLLHHHHLllLLLLlEEEEEELHHHLlllhhhHHHHHHHHH-HHHHh
Query FGRPD--arrGLGQPGFAELLtlSGRGkVWVKVSGIYRLqgspeeNLAFARQAL-CALEa  215
ident                 |         |                      |  |    |  
Sbjct CFNGKsgssiXEDEDLFNLAE--RCEG-IRLDIGHGGAS-----fSFKVAEAAIaRGLL-  267
DSSP  LLLLLlllllLLLHHHHHHHH--HLLL-LEEELLLLLLL-----lLHHHHHHHHhLLLL-


DSSP  hllhhhEEEELLLlLLLL-LLLLLHhhHHHHHHHHL---LLHHHHHHHHLHHHHHHLLLL
Query hygaerLXWGSDWpHTQH-ESEVSFgsAVEQFEALG---CSAQLRQALLLDTARALFGFE  271
ident            |  |       |           |                         
Sbjct -----pFSISTDL-HGHSxNFPVWD--LATTXSKLLsvdXPFENVVEAVTRNPASVIRLD  319
DSSP  -----lLLLLLLL-LLLLlLLLLLL--HHHHHHHHHhllLLHHHHHHLLLHHHHHHLLLL


DSSP  LL----------------------------------------------------------
Query LE----------------------------------------------------------  273
ident  |                                                          
Sbjct XEnrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  LLllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 26: Query=2ffiA Sbjct=1itqA Z-score=15.5

back to top
DSSP  -----------lLLLLEELLLLLL---LHHHH-hhllllllllllllhhHHHHHHHHLLL
Query -----------lHLTAIDSHAHVF---SRGLN-lasqrryapnydaplgDYLGQLRAHGF   45
ident                 || |           |                      |||   
Sbjct dffrdeaerimrDSPVIDGHNDLPwqlLDMFNnrlqderanlttlagthTNIPKLRAGFV   60
DSSP  lhhhhhhhhhhlLLLEEEEEELHHhhhHHHHLlllllhhhlllllllllLLHHHHHHLLE


DSSP  LEELLLLLHH----------HLLL-LHHHHHHHH-----HLLL---------------LL
Query SHGVLVQPSF----------LGTD-NRYLLSALQ-----TVPG---------------QL   74
ident                                                             
Sbjct GGQFWSVYTPcdtqnkdavrRTLEqMDVVHRMCRmypetFLYVtssagirqafregkvAS  120
DSSP  EEEEEEELLLhhhllllhhhHHHHhHHHHHHHHHhllllEEELllhhhhhhhhhllleEE


DSSP  LLLLL---LLLLLLhHHHHHHHLLLLLEEELLLLlLLLLLL----------------LLL
Query RGVVX---LERDVEqATLAEXARLGVRGVRLNLXgQDXPDL----------------TGA  115
ident    |             |     || |   |       |                     
Sbjct LIGVEgghSIDSSL-GVLRALYQLGMRYLTLTHS-CNTPWAdnwlvdtgdsepqsqgLSP  178
DSSP  EEEEElhhHLLLLH-HHHHHHHHLLEEEEELLLL-LLLLLLllhhhlllllllllllLLH


DSSP  LLHHHHHHHHHHLLEEEELLllllHHHHHHHHL-LLLLLEEE-LHHHlLLLLlllllllH
Query QWRPLLERIGEQGWHVELHRqvadIPVLVRALQ-PYGLDIVI-DHFGrPDARrglgqpgF  173
ident             |    |            |                             
Sbjct FGQRVVKELNRLGVLIDLAH---vSVATMKATLqLSRAPVIFsHSSAySVCA--srrnvP  233
DSSP  HHHHHHHHHHHHLLEEELLL---lLHHHHHHHHhHLLLLLEElLLLLlLLLL--lllllL


DSSP  HHHLLLlLLLLEEEEEELHH-HLLLLHHHHHHHHHHHHHHHHHHLLHHHEEEELLLLLLL
Query AELLTLsGRGKVWVKVSGIY-RLQGSPEENLAFARQALCALEAHYGAERLXWGSDWPHTQ  232
ident    | |       | |             ||      |       ||     | |     
Sbjct DDVLRLvKQTDSLVMVNFYNnYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVP  293
DSSP  HHHHHHhHHHLLEEEELLLHhHHLLLLLLLHHHHHHHHHHHHHHLLHHHEEELLLLLLLL


DSSP  L--lllLLHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHLL------------------
Query H--eseVSFGSAVEQFEALG---CSAQLRQALLLDTARALFG------------------  269
ident                   |             | |     |                   
Sbjct RvpeglEDVSKYPDLIAELLrrnWTEAEVKGALADNLLRVFEaveqasnltqapeeepip  353
DSSP  LlllllLLLLLHHHHHHHHHhllLLHHHHHHHHLHHHHHHHHhhhhllllllllllllll


DSSP  ------------llll
Query ------------fele  273
ident                 
Sbjct ldqlggscrthygyss  369
DSSP  hhhlllllllllllll


No 27: Query=2ffiA Sbjct=1yrrB Z-score=15.4

back to top
DSSP  -------------------------------------------------llLLLEELLLL
Query -------------------------------------------------lhLTAIDSHAH   11
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL


DSSP  ------LLLHHHHhhlllllllllllLHHHHHHHHHHLLLLEELLLLLhhHLLL--LHHH
Query ------VFSRGLNlasqrryapnydaPLGDYLGQLRAHGFSHGVLVQPsfLGTD--NRYL   63
ident                            |          |              |      
Sbjct gcggvqFNDTAEA---------vsveTLEIMQKANEKSGCTNYLPTLI--TTSDelMKQG  109
DSSP  eelleeLLLLLLL---------llhhHHHHHHHHHHLLLEEEEEEEEL--LLLHhhHHHH


DSSP  HHHHHHLL-----lLLLLLLLLL--lLLLHHHHHHHHLlLLLEEELlllllllLLLLlll
Query LSALQTVP-----gQLRGVVXLE--rDVEQATLAEXARlGVRGVRLnlxgqdxPDLTgaq  116
ident                |                | | |      | |              
Sbjct VRVMREYLakhpnqALGLHLEGPwlnAALVDFLCENAD-VITKVTL-----apEMVP---  160
DSSP  HHHHHHHHhhllllLLLEEEELLlllLHHHHHHHHLHH-HEEEEEE-----lhHHLL---


DSSP  lHHHHHHHHHHLLEEEELLLllLHHH-HHHHHLLLlLLEEELHHHLLlllllllllLHHH
Query wRPLLERIGEQGWHVELHRQvaDIPV-LVRALQPYgLDIVIDHFGRPdarrglgqpGFAE  175
ident            |  |               |           |                 
Sbjct -AEVISKLANAGIVVSAGHS--NATLkEAKAGFRA-GITFATHLYNA--------mPYIT  208
DSSP  -HHHHHHHHHHLLEEEELLL--LLLHhHHHHHHHH-LEEEELLLLLL--------lLLLL


DSSP  -----HLLL--LLLLlEEEEEElHHHLlllhhhhhhHHHHHHHHHHHHLLhHHEEEELLl
Query -----LLTL--SGRGkVWVKVSgIYRLqgspeenlaFARQALCALEAHYGaERLXWGSDw  228
ident      |                                           |   |    | 
Sbjct grepgLAGAilDEAD-IYCGIIaDGLH---------VDYANIRNAKRLKG-DKLCLVTD-  256
DSSP  llllhHHHHhhHLLL-LEEEEElLLLL---------LLHHHHHHHHHHHH-HHEEEELL-


DSSP  lLLLLlllLLHHhHHHHHHHHL----LLHHHHHHHHLHHHHHHLLLLLL-----------
Query pHTQHeseVSFGsAVEQFEALG----CSAQLRQALLLDTARALFGFELE-----------  273
ident   |      |     |    |                       | |             
Sbjct -ATSG---SSLT-MIEGVRNLVehcgIALDEVLRMATLYPARAIGVEKRlgtlaagkvan  311
DSSP  -LLLL---LLLL-HHHHHHHHHhhhlLLHHHHHHHHLHHHHHHLLLLLLlllllllllll


DSSP  -----------------------
Query -----------------------  273
ident                        
Sbjct ltaftpdfkitktivngnevvtq  334
DSSP  eeeellllleeeeeelleeeeel


No 28: Query=2ffiA Sbjct=2vc5A Z-score=15.4

back to top
DSSP  -------------lLLLLEELLLLLLlhhhhHHLLLL--lllLLLL-LHHHHHHHHHHLL
Query -------------lHLTAIDSHAHVFsrglnLASQRR--yapNYDA-PLGDYLGQLRAHG   44
ident                      | |          |                        |
Sbjct mriplvgkdsieskDIGFTLIHEHLRvfseaVRQQWPhlyneDEEFrNAVNEVKRAMQFG   60
DSSP  llllllllllllhhHLLLEELLLLLLlllhhHHHHLHhhllhHHHHhHHHHHHHHHHHLL


DSSP  LLEELLLLlhhHLLLLhHHHHHHHHLL---lLLLLLLLL----------------lLLLL
Query FSHGVLVQpsfLGTDNrYLLSALQTVP---gQLRGVVXL----------------eRDVE   85
ident     |       |            |      |                           
Sbjct VKTIVDPT--vMGLGR-DIRFMEKVVKatgiNLVAGTGIyiyidlpfyflnrsideIADL  117
DSSP  LLEEEELL--lLLLLL-LHHHHHHHHHllllEEEELEELlllllllhhhllllhhhHHHH


DSSP  -HHHHHHH---hLLLLLEEELLLLLLLL--LLLLllllHHHHHHHHHHLLEEEELLLL--
Query -QATLAEX---aRLGVRGVRLNLXGQDX--PDLTgaqwRPLLERIGEQGWHVELHRQV--  137
ident       |           |                   |       |       |     
Sbjct fIHDIKEGiqgtLNKAGFVXIAADEPGItkDVEK--viRAAAIANKETKVPIITHSNAhn  175
DSSP  hHHHHHLLllllLLLLLLEEEELLLLLLlhHHHH--hhHHHHHHHHHHLLLEEEELLLll


DSSP  LLHHHHHHHHL-LLLL--LEEELHhHLLLllLLLLllLHHHHLLLllllLEEEEEELHHH
Query ADIPVLVRALQ-PYGL--DIVIDHfGRPDarRGLGqpGFAELLTLsgrgKVWVKVSGIYR  194
ident        | |         | | |                                    
Sbjct NTGLEQQRILTeEGVDpgKILIGH-LGDT--DNID--YIKKIADK----GSFIGLDRYGL  226
DSSP  LHHHHHHHHHHhLLLLhhHEEELL-HHHL--LLHH--HHHHHHHL----LLEEEELLLLL


DSSP  -lLLLHHHHHHHHHHHHHHHHhhllHHHEEEELLLL------------lllLLLLLLHHH
Query -lQGSPEENLAFARQALCALEahygAERLXWGSDWP------------htqHESEVSFGS  241
ident                                  |                      |   
Sbjct dlFLPVDKRNETTLRLIKDGY----SDKIMISHDYCctidwgtakpeykpkLAPRWSITL  282
DSSP  llLLLHHHHHHHHHHHHHLLL----LLLEEELLLLLlllllllllhhhhhhHLLLLLLLH


DSSP  HHH-HHHHHL---LLHHHHHHHHLHHHHHHLLllll
Query AVE-QFEALG---CSAQLRQALLLDTARALFGfele  273
ident   |     |                     |     
Sbjct IFEdTIPFLKrngVNEEVIATIFKENPKKFFS----  314
DSSP  HHHlHHHHHHlllLLHHHHHHHHLHHHHHHLL----


No 29: Query=2ffiA Sbjct=3icjA Z-score=15.3

back to top
DSSP  ---------------------------------------------------------llL
Query ---------------------------------------------------------lhL    3
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE


DSSP  LLEELLLLLL-------------------------lhhhhHHLL----------------
Query TAIDSHAHVF-------------------------srglnLASQ----------------   22
ident    ||| |                                                    
Sbjct AFFDSHLHLDelgmslemvdlrgvksmeelvervkkgrgrIIFGfgwdqdelgrwptred  120
DSSP  LEEEEEELHHhhhhhhhleellllllhhhhhhhhhlllllLEEEeeelhhhhlllllhhh


DSSP  -------------------------------------------------LLLLLL-----
Query -------------------------------------------------RRYAPN-----   28
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleESRKIInekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhHHHHHHhhlll


DSSP  ----lllLHHHHHHHHHHLLLLEELLLLlhhhlllLHHHHHHHHHLL------lLLLLLL
Query ----ydaPLGDYLGQLRAHGFSHGVLVQpsflgtdNRYLLSALQTVP------gQLRGVV   78
ident                |   |                   | ||                 
Sbjct tvkdykhYIESAQEHLLSLGVHSVGFMS------vGEKALKALFELEregrlkmNVFAYL  234
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEE------eLHHHHHHHHHHHhllllllEEEEEE


DSSP  LLLllLLHHHhHHHHLL----LLLEEELLLLL---------------------LLLLLLL
Query XLErdVEQATlAEXARL----GVRGVRLNLXG---------------------QDXPDLT  113
ident   |                     || |   |                            
Sbjct SPEllDKLEElNLGKFEgrrlRIWGVXLFVDGslgartallsepytdnpttsgELVMNKD  294
DSSP  LHHhhHHHHHhLLLLEEllleEEEEEEEELLLlllllllllllllllllllllLLLLLHH


DSSP  LlllHHHHHHHHHHLLEEEELL-LLLLHHHHHHHHLLLLLLEEELhHHLLlllllllllL
Query GaqwRPLLERIGEQGWHVELHR-QVADIPVLVRALQPYGLDIVIDhFGRPdarrglgqpG  172
ident         ||    |  |  |        |   |         |                
Sbjct E--iVEVIERAKPLGLDVAVHAiGDKAVDVALDAFEEAEFSGRIE-HASL---------V  342
DSSP  H--hHHHHHHHLLLLLEEEEEElLHHHHHHHHHHHHHHLLLLEEE-ELLL---------L


DSSP  HHHHlLLLL-LLLEEEEEE-LHHHLLLLHH----hhhhhhhhHHHHHHHHLlhhHEEEEL
Query FAELlTLSG-RGKVWVKVS-GIYRLQGSPE----enlafarqALCALEAHYgaeRLXWGS  226
ident             ||                             |  |        |    
Sbjct RDDQ-LERIkELKVRISAQpHFIVSDWWIVnrvgeerakwayRLKTLSSIT---KLGFST  398
DSSP  LHHH-HHHHhHHLLEEEELlLHHHHLLLHHhhhhhhhhhhllLHHHHHHHL---LEEELL


DSSP  LLLLllllllLLHHhHHHHHHHHL----------LLHHHHHHHHLHHHHH-HLLLLL---
Query DWPHtqheseVSFGsAVEQFEALG----------CSAQLRQALLLDTARA-LFGFEL---  272
ident | |                  |             |      |             |   
Sbjct DSPI------EPAD-PWVSIDAAVnryvvdpgerVSREEALHLYTHGSAQvTLAEDLgkl  451
DSSP  LLLL------LLLL-HHHHHHHHHhlllllhhhlLLHHHHHHHLLHHHHHhLLLLLLlll


DSSP  ----------------l
Query ----------------e  273
ident                  
Sbjct ergfraeyiildrdplk  468
DSSP  llllllleeeellllll


No 30: Query=2ffiA Sbjct=3nqbA Z-score=15.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ---------------llLLLEELLLLLLlhhhhhhlllllllllLLLHHHHHHHHHHLLL
Query ---------------lhLTAIDSHAHVFsrglnlasqrryapnyDAPLGDYLGQLRAHGF   45
ident                     || | |                        |     | | 
Sbjct srrdaaqvidaggayvsPGLIDTHXHIE--------------ssXITPAAYAAAVVARGV  106
DSSP  lllleeeeeelllleeeELEEEEEELHH--------------hhLLLHHHHHHHHHLLLE


DSSP  LEELLLLLHHHL----lLLHHHHHHHHHLLLLLLLLLLL--------------LLLLL-H
Query SHGVLVQPSFLG----tDNRYLLSALQTVPGQLRGVVXL--------------ERDVE-Q   86
ident    |     |         |    |    |                              
Sbjct TTIVWDPHEFGNvhgvdGVRWAAKAIENLPLRAILLAPScvpsapglerggadFDAAIlA  166
DSSP  EEEEELLHHHHHhhlhhHHHHHHHHHLLLLLEEEEEELLllllllllllllllLLHHHhH


DSSP  HHHHHHhllLLLEEELLLlllllLLLL-LLLL-HHHHHHHHHHLLEEEELLLllLHHH-H
Query ATLAEXarlGVRGVRLNLxgqdxPDLT-GAQW-RPLLERIGEQGWHVELHRQvaDIPV-L  143
ident   |         |                                 |  |          
Sbjct DLLSWP---EIGGIAEIX---nxRGVIeRDPRxSGIVQAGLAAEKLVCGHAR--GLKNaD  218
DSSP  HHHLLL---LEEEEEEEL---lhHHHHlLLHHhHHHHHHHHHHLLEEEELLL--LLLHhH


DSSP  HHHHLLLlLLEEELhhHLLLllllllllLHHHHLLLllllLEEEEEELHHHllllhhHHH
Query VRALQPYgLDIVIDhfGRPDarrglgqpGFAELLTLsgrgKVWVKVSGIYRlqgspeENL  203
ident   |                              |             |           |
Sbjct LNAFXAA-GVSSDH--ELVS------geDLXAKLRA----GLTIELRGSHD------HLL  259
DSSP  HHHHHHL-LLLEEL--LLLL------hhHHHHHHHL----LLEEEEELLLH------HHH


DSSP  HHHHHHHHHhhhhlLHHHEEEELLLlLLLLL-LLLLH-HHHHHHHHHHLLLHHHHHHHHL
Query AFARQALCAleahyGAERLXWGSDWpHTQHE-SEVSF-GSAVEQFEALGCSAQLRQALLL  261
ident      ||                |                 |      |           
Sbjct PEFVAALNT--lghLPQTVTLCTDD-VFPDDlLQGGGlDDVVRRLVRYGLKPEWALRAAT  316
DSSP  HHHHHHHHH--hllLLLLEEEELLL-LLHHHhHHLLLhHHHHHHHHHLLLLHHHHHHHHL


DSSP  HHHHHHLLLLLL------------------------------------------------
Query DTARALFGFELE------------------------------------------------  273
ident   |    |                                                    
Sbjct LNAAQRLGRSDLgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdtt  376
DSSP  HHHHHHHLLLLLlllllllllleeeellllllleeeeeelleeeeelleelllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct vlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxis  436
DSSP  hhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct vthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgg  496
DSSP  eellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct gxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfga  556
DSSP  eeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhll


DSSP  -------------------------------
Query -------------------------------  273
ident                                
Sbjct tlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllllleelllleeelllleeellleeel


No 31: Query=2ffiA Sbjct=4dziC Z-score=15.1

back to top
DSSP  -llLLLEELLLLLLLHHH----------------------hHHLL-----LLLL--LLLL
Query -lhLTAIDSHAHVFSRGL----------------------nLASQ-----RRYA--PNYD   30
ident       ||   |                                            |  |
Sbjct alnYRVIDVDNHYYEPLDsftrhldkkfkrrgvqmlsdgkrTWAVigdrvNHFIpnPTFD   60
DSSP  lllLLEEEEEEELLLLLLlllllllhhhlllleeeeellllEEEEelleeLLLLllLLLL


DSSP  ------------------------------------LLHH-HHHHHHHHLLLLEELLLlL
Query ------------------------------------APLG-DYLGQLRAHGFSHGVLVqP   53
ident                                                            |
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdARIAVMDEQDIETAFML-P  119
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHhHHHHHHHHHLEEEEEEE-L


DSSP  HHHL------------------lLLHHHHHHHH--HLLLLLLLLLLLLL-----LLLH-H
Query SFLG------------------tDNRYLLSALQ--TVPGQLRGVVXLER-----DVEQ-A   87
ident  |                      |  |                           ||   
Sbjct TFGCgveealkhdieatmasvhaFNLWLDEDWGfdRPDHRIIAAPIVSLadptrAVEEvD  179
DSSP  LHHHhhhhhllllhhhhhhhhhhHHHHHHHHLLllLLLLLEEELLLLLLllhhhHHHHhH


DSSP  HHHHHHlllLLEEELLLllLLLL------LLLLLLLHHHHHHHHHHLLEEEELL------
Query TLAEXArlgVRGVRLNLxgQDXP------DLTGAQWRPLLERIGEQGWHVELHR------  135
ident             |         |       |      |   |  | |  |  |       
Sbjct FVLARG---AKLVLVRP--APVPglvkprSLGDRSHDPVWARLAEAGVPVGFHLsdsgyl  234
DSSP  HHHHLL---LLLEELLL--LLLLllllllLLLLHHHHHHHHHHHHHLLLEEEELlllllh


DSSP  ------------------LLLLHHHHHHHH--LLLL-----LLEEELH-HHLLlllllll
Query ------------------QVADIPVLVRAL--QPYG-----LDIVIDH-FGRPdarrglg  169
ident                       |                  |  |               
Sbjct hiaaawggakdpldqvllDDRAIHDTMASMivHGVFtrhpkLKAVSIEnGSYF-------  287
DSSP  hhhhhllllllhhhhhhhLLHHHHHHHHHHhhLLHHhhlllLLEEEELlLLLH-------


DSSP  lllhhhHLLLL---------------------LLLLEEEEEElhhhllllhhhhhhhHHH
Query qpgfaeLLTLS---------------------GRGKVWVKVSgiyrlqgspeenlafARQ  208
ident          |                       |  ||                      
Sbjct ------VHRLIkrlkkaantqpqyfpedpveqLRNNVWIAPY---------------YED  326
DSSP  ------HHHHHhhhhhhhhhlhhhllllhhhhHHHHEEELLL---------------LLL


DSSP  HHHHHHHHLLHHHEEEELLLLLLlllllLLHHHHHhHHHHHL--LLHHHHHHHHLHHHHH
Query ALCALEAHYGAERLXWGSDWPHTqheseVSFGSAVeQFEALG--CSAQLRQALLLDTARA  266
ident  |  |    |      ||||||          | |  | |     |         | |  
Sbjct DLPELARVIGVDKILFGSDWPHG-----EGLASPV-SFTAELkgFSESDIRKIMRDNALD  380
DSSP  LHHHHHHHHLHHHLLLLLLLLLL-----LLLLLHH-HHHHHHllLLHHHHHHHHLHHHHH


DSSP  HLL-llll
Query LFG-fele  273
ident | |     
Sbjct LLGvqvgs  388
DSSP  HHLlllll


No 32: Query=2ffiA Sbjct=3mtwA Z-score=14.9

back to top
DSSP  -------------------------------------------------------llLLL
Query -------------------------------------------------------lhLTA    5
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE


DSSP  EELLLLLL-----lhhhHHHLLLllllllllLHHHHHHHHHHLLLLEELLLLLhhhllLL
Query IDSHAHVF-----srglNLASQRryapnydaPLGDYLGQLRAHGFSHGVLVQPsflgtDN   60
ident || | |            |                        ||     |         
Sbjct IDMHVHLDslaevggynSLEYSD---rfwsvVQTANAKKTLEAGFTTVRNVGA-----AD  112
DSSP  EEEEELLLllllllhhhHHHLLH---hhhhhHHHHHHHHHHHLLEEEEEELLL-----LL


DSSP  HHHHHHHHHLL------lLLLLL-LLLL----------------------------LLLL
Query RYLLSALQTVP------gQLRGV-VXLE----------------------------RDVE   85
ident                                                             
Sbjct YDDVGLREAIDagyvpgpRIVTAaISFGatgghcdstffppsmdqknpfnsdspdeARKA  172
DSSP  LHHHHHHHHHHlllllllEEEELlLLEEllllllllllllhhhllllllllllhhhHHHH


DSSP  hHHHHHHHlllLLEEELLLLL----------llLLLLLllllHHHHHHHHHHLLEEEELL
Query qATLAEXArlgVRGVRLNLXG----------qdXPDLTgaqwRPLLERIGEQGWHVELHR  135
ident   ||                |                               |  |  | 
Sbjct vRTLKKYG---AQVIXICATGgvfsrgnepgqqQLTYE--emKAVVDEAHMAGIKVAAHA  227
DSSP  hHHHHHLL---LLEEEEELLLllllllllllllLLLHH--hhHHHHHHHHHLLLEEEEEE


DSSP  -LLLLHHHHHHHHllllllEEELhHHLLllllllllllHHHHLLLlLLLLEEEEEELHHH
Query -QVADIPVLVRALqpygldIVIDhFGRPdarrglgqpgFAELLTLsGRGKVWVKVSGIYR  194
ident      |   |||         |                  |   |               
Sbjct hGASGIREAVRAG-----vDTIE-HASL---------vDDEGIKLaVQKGAYFSMDIYNT  272
DSSP  lLHHHHHHHHHLL-----lLEEE-ELLL---------lLHHHHHHhHHHLLEEELLLLLH


DSSP  -----------------lLLLHhhHHHHHHHHHHHHHHHLLhhHEEEELLLLLllllllL
Query -----------------lQGSPeeNLAFARQALCALEAHYGaeRLXWGSDWPHtqheseV  237
ident                              |                 | |          
Sbjct dytqaegkkngvlednlrKDRD--IGELQRENFRKALKAGV--KMVYGTDAGI------Y  322
DSSP  hhhhhhhhhhlllhhhhhHHHH--HHHHHHHHHHHHHHHLL--EEELLLLLLL------L


DSSP  LHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHL-LLLL---------------------
Query SFGSAVEQFEALG---CSAQLRQALLLDTARALF-GFEL---------------------  272
ident   |    ||                   ||                              
Sbjct PHGDNAKQFAVMVrygATPLQAIQSATLTAAEALgRSKDvgqvavgrygdmiavagdpla  382
DSSP  LLLLHHHHHHHHHhllLLHHHHHHHLLHHHHHHHlLLLLllllllllllleeeellllll


DSSP  ---------------------l
Query ---------------------e  273
ident                       
Sbjct dvttlekpvfvmkggavvkapx  404
DSSP  lhhhhhllleeeelleeeelll


No 33: Query=2ffiA Sbjct=3mkvA Z-score=14.7

back to top
DSSP  ------------------------------------------------------llLLLE
Query ------------------------------------------------------lhLTAI    6
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE


DSSP  ELLLLLLlhhhhhhllllLLLLL--------llLHHHHHHHHHHLLLLEELLLLLhhhll
Query DSHAHVFsrglnlasqrrYAPNY--------daPLGDYLGQLRAHGFSHGVLVQPsflgt   58
ident | | ||              |                        ||             
Sbjct DLHVHVV-------aiefNLPRVatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG-----  108
DSSP  EEEELLL-------llllLHHHHllllhhhhhhHHHHHHHHHHHLLEEEEEELLL-----


DSSP  llhhHHHHHHHLL------lLLLLL-LLLL------------------------------
Query dnryLLSALQTVP------gQLRGV-VXLE------------------------------   81
ident          | |         |      |                               
Sbjct ---aGYPFKQAVEsglvegpRLFVSgRALSqtgghadprarsdymppdspcgccvrvgal  165
DSSP  ---lLHHHHHHHHlllllllEEEELlLEEEllllllllllllllllllllllllllllll


DSSP  ---------LLLLhHHHHHHHlllLLEEELLLLL----------LLLLLLLlllLHHHHH
Query ---------RDVEqATLAEXArlgVRGVRLNLXG----------QDXPDLTgaqWRPLLE  122
ident                                  |                     |    
Sbjct grvadgvdeVRRAvREELQMG---ADQIXIMASGgvasptdpvgVFGYSED--eIRAIVA  220
DSSP  eeelllhhhHHHHhHHHHHHL---LLLEEEELLLllllllllllLLLLLHH--hHHHHHH


DSSP  HHHHHLLEEEELLLL-LLHHHHHHHHllllllEEELhHHLLllllllllllHHHHLLLlL
Query RIGEQGWHVELHRQV-ADIPVLVRALqpygldIVIDhFGRPdarrglgqpgFAELLTLsG  181
ident      |  |  |    | |   ||          |   |              |   |  
Sbjct EAQGRGTYVLAHAYTpAAIARAVRCG-----vRTIE-HGNL---------iDDETARLvA  265
DSSP  HHHLLLLLEEEEELLhHHHHHHHHLL-----lLEEE-ELLL---------lLHHHHHHhH


DSSP  LLLEEEEEELHHH-----------------lLLLHhhHHHHHHHHHHHHHHHLLhhHEEE
Query RGKVWVKVSGIYR-----------------lQGSPeeNLAFARQALCALEAHYGaeRLXW  224
ident      |                                                      
Sbjct EHGAYVVPTLVTYdalasegekyglppesiaKIAD--VHGAGLHSIEIMKRAGV--KMGF  321
DSSP  HHLLEEELLHHHHhhhhhhlllllllhhhhlLHHH--HHLLHHHHHHHHHHHLL--LLLL


DSSP  ELLLLLllllllLLHHhHHHHHHHHL--LLHHHHHHHHLHHHHHHLLLLLL---------
Query GSDWPHtqheseVSFGsAVEQFEALG--CSAQLRQALLLDTARALFGFELE---------  273
ident | |                  |  |    |     |          |             
Sbjct GTDLLG-----eAQRL-QSDEFRILAevLSPAEVIASATIVSAEVLGMQDKlgrivpgah  375
DSSP  LLLLLH-----hHHHH-LLHHHHHHHllLLHHHHHHHLLHHHHHHLLLLLLlllllllll


DSSP  ---------------------------------------
Query ---------------------------------------  273
ident                                        
Sbjct advlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  lleeeellllllllllllllllllleeeelleeeeelll


No 34: Query=2ffiA Sbjct=3ls9A Z-score=14.7

back to top
DSSP  ------------------------------------------------------llLLLE
Query ------------------------------------------------------lhLTAI    6
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE


DSSP  ELLLLLL----------------------lhHHHHHLLLL--lllllllLHHHHHHHHHH
Query DSHAHVF----------------------srGLNLASQRR--yapnydaPLGDYLGQLRA   42
ident  || |                                                 |     
Sbjct NSHQHLYegamraipqlervtmaswlegvltRSAGWWRDGkfgpdvireVARAVLLESLL  120
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhHHHHHHHLLlllhhhhhhHHHHHHHHHHH


DSSP  LLLLEELLLLLhHHLL--llHHHHHHHHHLL---LLLLLLLL------------------
Query HGFSHGVLVQPsFLGT--dnRYLLSALQTVP---GQLRGVVX------------------   79
ident  |          |        |                                      
Sbjct GGITTVADQHL-FFPGatadSYIDATIEAATdlgIRFHAARSsmtlgkseggfcddlfve  179
DSSP  LLEEEEEEEEL-LLLLllllLHHHHHHHHHHhhlLEEEEEELlllllhhhlllllhhhll


DSSP  ---lLLLLlHHHHHHHHL-----lLLLEEELLLLLLlLLLLlllllHHHHHHHHHHLLEE
Query ---lERDVeQATLAEXAR-----lGVRGVRLNLXGQdXPDLtgaqwRPLLERIGEQGWHV  131
ident                                                             
Sbjct pvdrVVQHcLGLIDQYHEpepfgmVRIALGPCGVPY-DKPE---lfEAFAQMAADYDVRL  235
DSSP  lhhhHHHHhHHHHHHHLLllllllEEEEELLLLLLL-LLHH---hhHHHHHHHHHHLLEE


DSSP  EELLLL------------lLHHHHHHHHLllLLLEEELhHHLLlllllllllLHHHHLLL
Query ELHRQV------------aDIPVLVRALQpyGLDIVIDhFGRPdarrglgqpGFAELLTL  179
ident   |                                                    |    
Sbjct HTHFYEpldagmsdhlygmTPWRFLEKHGwaSDRVWLA-HAVV---------PPREEIPE  285
DSSP  EEEELLllhhhhhhhhhllLHHHHHHHLLllLLLEEEE-ELLL---------LLHHHHHH


DSSP  LLLLLEEEEEE--LHHHLLllhhhhHHHHhhHHHHHHHHLLhhHEEEELLLLLLlllllL
Query SGRGKVWVKVS--GIYRLQgspeenLAFArqALCALEAHYGaeRLXWGSDWPHTqheseV  237
ident      |          |           |                  |            
Sbjct FADAGVAIAHLiaPDLRMG------WGLA--PIREYLDAGI--TVGFGTTGSAS----nD  331
DSSP  HHHHLLEEEELhhHHHHLL------LLLL--LHHHHHHLLL--EEEELLLLLLL----lL


DSSP  LHHhHHHHHHHHL--------------LLHHHHHHHHLHHHHH-HLLLLL----------
Query SFGsAVEQFEALG--------------CSAQLRQALLLDTARA-LFGFEL----------  272
ident                             ||              |    |          
Sbjct GGN-LLGDLRLAAlahrpadpnepekwLSARELLRMATRGSAEcLGRPDLgvleegraad  390
DSSP  LLL-HHHHHHHHHhhlhhhllllhhhlLLHHHHHHHLLHHHHHhLLLLLLllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct iacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivantta  450
DSSP  eeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhh


DSSP  --l
Query --e  273
ident    
Sbjct lip  453
DSSP  hll


No 35: Query=2ffiA Sbjct=3gg7A Z-score=14.6

back to top
DSSP  lllLLEELLLL-LLLHhhhhhlllllllllllLHHHHHHHHHHLLLlEELLLLLhhhLLL
Query lhlTAIDSHAH-VFSRglnlasqrryapnydaPLGDYLGQLRAHGFsHGVLVQPsflGTD   59
ident      || | |                                        |        
Sbjct ---SLIDFHVHlDLYP----------------DPVAVARACEERQL-TVLSVTT---TPA   37
DSSP  ---LLEEEEELhHHLL----------------LHHHHHHHHHHLLL-EEEELLL---LHH


DSSP  L-HHHHHHHHHLlLLLLLLLLL----------LLLLLHHHHHHhhlllLLEEE-LLLLLL
Query N-RYLLSALQTVpGQLRGVVXL----------ERDVEQATLAExarlgVRGVR-LNLXGQ  107
ident   |  |                                  | |      | |    | | 
Sbjct AwRGTLALAAGR-PHVWTALGFhpevvseraaDLPWFDRYLPE-----TRFVGeVGLDGS   91
DSSP  HhHHHHHHHLLL-LLEEELLLLlhhhllllhhHLHHHHHHHHH-----LLEEEeEELLLL


DSSP  --------LLLLllllllHHHHHHHHHH-LLEEEELLLlLLHHHHHHHHLLLL--LLEEE
Query --------DXPDltgaqwRPLLERIGEQ-GWHVELHRQvADIPVLVRALQPYG--LDIVI  156
ident                      | |     |     |            |           
Sbjct pslrgtwtQQFA----vfQHILRRCEDHgGRILSIHSR-RAESEVLNCLEANPrsGTPIL  146
DSSP  hhhhhhhhHHHH----hhHHHHHHHHHLlLEEEEEELL-LLHHHHHHHHHHLHhhEEEEE


DSSP  LhHHLLlllllllllLHHHHLlLLLLLLEEEEEELHhhllllhhhHHHHHHHHHHHHhhh
Query DhFGRPdarrglgqpGFAELLtLSGRGKVWVKVSGIyrlqgspeeNLAFARQALCALeah  216
ident                   ||         |  |                           
Sbjct H-WYSG---------SVTELR-RAISLGCWFSVGPT-------mvRTQKGAALIRSM---  185
DSSP  E-LLLL---------LHHHHH-HHHHLLLEEEELHH-------hhLLHHHHHHHHHL---


DSSP  lLHHHEEEELLLLLLLLLLLLLH-HHHHHHHHHH--LLLH---HHHHHHhLHHHHHHLLl
Query yGAERLXWGSDWPHTQHESEVSF-GSAVEQFEAL--GCSA---QLRQALlLDTARALFGf  270
ident     |     | |                  | |                      | | 
Sbjct -PRDRVLTETDGPFLELDGQAALpWDVKSVVEGLskIWQIpasEVERIV-KENVSRLLG-  242
DSSP  -LHHHEEELLLLLLLEELLEELLhHHHHHHHHHHhhHHLLlhhHHHHHH-HHHHHHHHH-


DSSP  lll
Query ele  273
ident    
Sbjct --t  243
DSSP  --l


No 36: Query=2ffiA Sbjct=3giqA Z-score=14.6

back to top
DSSP  -----------------------------------------------------llLLLEE
Query -----------------------------------------------------lhLTAID    7
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE


DSSP  LLL-LLLLhhhhhhlllllllllLLLHHhhHHHHHHLLLLEELLLL-lHHHLLL------
Query SHA-HVFSrglnlasqrryapnyDAPLGdyLGQLRAHGFSHGVLVQ-pSFLGTD------   59
ident  |                            |      |    |                 
Sbjct VHGhDDLM--------------fVEKPD--LRWKTSQGITTVVVGNcgVSAAPAplpgnt  104
DSSP  LLLlLLLH--------------hHHLLL--LHHHHLLLEEEEEELLllLLLLLLllllll


DSSP  ---------------LHHHHHHHH--hlllLLLLLLLL------------------lLLL
Query ---------------NRYLLSALQ--tvpgQLRGVVXL------------------eRDV   84
ident                      ||            |                        
Sbjct aaalallgetplfadVPAYFAALDaqrpmiNVAALVGHanlrlaamrdpqaaptaaeQQA  164
DSSP  lhhhhhhllllllllHHHHHHHHHhlllllEEEEEEEHhhhhhhhlllllllllhhhHHH


DSSP  LHHHHHHHHLLLLLEEELLLLLL--LLLLLllLLLHHHHHHHHHHLLEEEE-LLLL----
Query EQATLAEXARLGVRGVRLNLXGQ--DXPDLtgAQWRPLLERIGEQGWHVEL-HRQV----  137
ident  |  |      |  |    |  |         |    |     |         |      
Sbjct MQDMLQAALEAGAVGFSTGLAYQpgAVAQA--AELEGLARVAAERRRLHTShIRNEadgv  222
DSSP  HHHHHHHHHHHLLLEEEEELLLLlhHHLLH--HHHHHHHHHHHHLLLEEEEeLLLLlllh


DSSP  LLHHHHHHHH-LLLLLLEEELHHhLLLLL-LLLLlllHHHHLLL--LLLL---LEEEEEE
Query ADIPVLVRAL-QPYGLDIVIDHFgRPDAR-RGLGqpgFAELLTL--SGRG---KVWVKVS  190
ident       | |     |   |  |                   |      |     |     
Sbjct EAAVEEVLAIgRGTGCATVVSHH-KCMMPqNWGR---SRATLANidRAREqgvEVALDIY  278
DSSP  HHHHHHHHHHhHHHLLEEEELLL-LLLLHhHLLL---HHHHHHHhhHHHHlllLEEEEEL


DSSP  LHHHL-------------------------------------------------------
Query GIYRL-------------------------------------------------------  195
ident                                                             
Sbjct PYPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagai  338
DSSP  LLLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeee


DSSP  LLLHhhHHHHHHHHHHHhhhhllhHHEEEELLLLLLlLLLLLL-HHHHHHHH-HHHL---
Query QGSPeeNLAFARQALCAleahygaERLXWGSDWPHTqHESEVS-FGSAVEQF-EALG---  250
ident                              |||                            
Sbjct YFAM--DEDEVKRIFQH-------PCCMVGSDGLPN-DARPHPrLWGSFTRVlGRYVrea  388
DSSP  EELL--LHHHHHHHHHL-------LLEEELLLLLLL-LLLLLLhHHHHHHHHhHHHHhhl


DSSP  --LLHHHHHHHHLHHHHHHLLLLLL-----------------------------------
Query --CSAQLRQALLLDTARALFGFELE-----------------------------------  273
ident          |         |||                                      
Sbjct rlMTLEQAVARMTALPARVFGFAERgvlqpgawadvvvfdpdtvadratwdeptlasvgi  448
DSSP  llLLHHHHHHHHLHHHHHHHLLLLLlllllllllleeeelllllllllllllllllllle


DSSP  ---------------------------
Query ---------------------------  273
ident                            
Sbjct agvlvngaevfpqppadgrpgqvlrax  475
DSSP  eeeeelleeeellllllllllllllll


No 37: Query=2ffiA Sbjct=2qpxA Z-score=14.5

back to top
DSSP  ---------lllLLEELLLLLLLHhhhhhllllllLLLL---------------------
Query ---------lhlTAIDSHAHVFSRglnlasqrryaPNYD---------------------   30
ident                | | |                                        
Sbjct gxddlsefvdqvPLLDHHCHFLID-----gkvpnrDDRLaqvsteadkdypladtknrla   55
DSSP  lllllhhhhhhlLEEEEEELLLLL-----lllllhHHHHhhhlllllllllhhhhlllhh


DSSP  -------------------------llhhHHHHHHHHLLLLEELLLLLHHhllllhhhhH
Query -------------------------aplgDYLGQLRAHGFSHGVLVQPSFlgtdnryllS   65
ident                                        |                    
Sbjct yhgflalakefaldannplaaxndpgyatYNHRIFGHFHFKELLIDTGFV----pddpiL  111
DSSP  hhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLLEEEEEEELLLL----lllllL


DSSP  HHHHLL----lLLLLLLLLL----------------lllLHHHHHHHHLLLLLEEELLLL
Query ALQTVP----gQLRGVVXLE----------------rdvEQATLAEXARLGVRGVRLNLX  105
ident  |                ||                              |  |      
Sbjct DLDQTAelvgiPVKAIYRLEthaedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIAA  171
DSSP  LHHHHHhhhllLEEEEEEHHhhhhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELHH


DSSP  LLLLLLLLL----------------------------LLLHHHHHHHHHHLLEEEELLL-
Query GQDXPDLTG----------------------------AQWRPLLERIGEQGWHVELHRQ-  136
ident       |                                       |  |      |   
Sbjct YRVGLHLEPvnvieaaagfdtwkhsgekrltskplidYXLYHVAPFIIAQDXPLQFHVGy  231
DSSP  HHLLLLLLLllhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHHLLLEEEEELl


DSSP  --------lLLHHHHHHHHLLLL---LLEEELhHHLLlllllllllLHHHHLL--LLLLl
Query --------vADIPVLVRALQPYG---LDIVIDhFGRPdarrglgqpGFAELLT--LSGRg  183
ident                   |       |  |      |            |          
Sbjct gdadtdxylGNPLLXRDYLKAFTkkgLKVVLL-HCYP---------YHREAGYlaSVFP-  280
DSSP  llllllhhhLLHHHHHHHHHHHHhhlLLEEEE-ELLL---------LHHHHHHhhHHLL-


DSSP  LEEEEEEL-HHHLlllhhhhHHHHHHHHHHHHHHLLHHHEEEELLLLlllllllLLHHHH
Query KVWVKVSG-IYRLqgspeenLAFARQALCALEAHYGAERLXWGSDWPhtqheseVSFGSA  242
ident       |                |              |    ||            | |
Sbjct NLYFDISLlDNLG-------PSGASRVFNEAVELAPYTRILFASDAS----typEXYGLA  329
DSSP  LEEEELLLhHHHL-------HHHHHHHHHHHLLLLLHHHEELLLLLL----llhHHHHHH


DSSP  HHHHHHHLL-------------LHHHHHHHHLHHHHHHLLLLLL---
Query VEQFEALGC-------------SAQLRQALLLDTARALFGFELE---  273
ident   ||                        |    |   |   | |   
Sbjct ARQFKQALVahfnqlpfvdlaqKKAWINAICWQTSAKLYHQERElrv  376
DSSP  HHHHHHHHHhhhhllllllhhhHHHHHHHHHLHHHHHHLLLHHHhll


No 38: Query=2ffiA Sbjct=3e74A Z-score=14.5

back to top
DSSP  -------------------------------------------------llLLLEELLLL
Query -------------------------------------------------lhLTAIDSHAH   11
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL


DSSP  LllhhhhhhlllllllllllLHHHHHHHHHHLLLLEELLLLLHhHLLLL---HHHHHHHH
Query VfsrglnlasqrryapnydaPLGDYLGQLRAHGFSHGVLVQPSfLGTDN---RYLLSALQ   68
ident                                 |                           
Sbjct I-------------------GYETGTRAAAKGGITTXIEXPLN-QLPATvdrASIELKFD  100
DSSP  L-------------------LHHHHHHHHHHLLEEEEEELLLL-LLLLLllhHHHHHHHH


DSSP  HL----llLLLLLLLLLLLLLHhHHHHHHLLLLLEEELLLlllllLLLLlllLHHHHHHH
Query TV----pgQLRGVVXLERDVEQaTLAEXARLGVRGVRLNLxgqdxPDLTgaqWRPLLERI  124
ident                |        | |    || |                         
Sbjct AAkgkltiDAAQLGGLVSYNID-RLHELDEVGVVGFXCFV---rdVNDW--qFFKGAQKL  154
DSSP  HHllllllEEEELEELLLLLLL-LHHHHHHHLLLLEEEEL---llLLHH--hHHHHHHHH


DSSP  HHHLLEEEELL--------------------------------LLLLHHHHHHHHLLLLL
Query GEQGWHVELHR--------------------------------QVADIPVLVRALQPYGL  152
ident || |  |  |                                  |  |          | 
Sbjct GELGQPVLVHCenalicdelgeeakregrvtahdyvasrpvftEVEAIRRVLYLAKVAGC  214
DSSP  HHHLLLEEEELllhhhhhhhhhhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHHHHLL


DSSP  LEEELHhHLLLlllllllLLHHHHLLL-LLLLLEEEEEELHH------------------
Query DIVIDHfGRPDarrglgqPGFAELLTL-SGRGKVWVKVSGIY------------------  193
ident      |             |  |                  |                  
Sbjct RLHVCH-VSSP-------EGVEEVTRArQEGQDITCESCPHYfvldtdqfeeigtlakcs  266
DSSP  LEEELL-LLLH-------HHHHHHHHHhHLLLLEEEEELLHHhhllhhhhhhhlhhhlll


DSSP  HLLLLhHHHHHHHHHHHHHHHhhllhhhEEEELLLLL--------------LLLLlllLH
Query RLQGSpEENLAFARQALCALEahygaerLXWGSDWPH--------------TQHEsevSF  239
ident        ||       |   |           ||                          
Sbjct PPIRD-LENQKGXWEKLFNGE------iDCLVSDHSPcppexkagnixkawGGIA---GL  316
DSSP  LLLLL-HHHHHHHHHHHHLLL------lLEELLLLLLllllllllllllllLLLL---LH


DSSP  HHHHHHH-HHHL----LLHHHHHHHHLHHHHHHLLLLL----------------------
Query GSAVEQF-EALG----CSAQLRQALLLDTARALFGFEL----------------------  272
ident  |               |      |    |   ||                         
Sbjct QSCXDVXfDEAVqkrgXSLPXFGKLXATNAADIFGLQQkgriapgkdadfvfiqpnssyv  376
DSSP  HHHHHHHhHHHLllllLLHHHHHHHHLHHHHHHLLLLLllllllllllleeeeellllee


DSSP  ----------------------------------------------------l
Query ----------------------------------------------------e  273
ident                                                      
Sbjct ltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  llhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 39: Query=2ffiA Sbjct=1j6pA Z-score=14.4

back to top
DSSP  ------------------------------------------------lLLLLEELLLLL
Query ------------------------------------------------lHLTAIDSHAHV   12
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  L--------lhhhhhhllLLLLLLL---------llLHHHHHHHHHHLLLLEELLLLlhh
Query F--------srglnlasqRRYAPNY---------daPLGDYLGQLRAHGFSHGVLVQpsf   55
ident                                                ||    |      
Sbjct PxtllrgvaedlsfeewlFSKVLPIedrltekxayyGTILAQXEXARHGIAGFVDXY---  117
DSSP  HhhhhllllllllhhhhhHLLHHHHhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE---


DSSP  hlLLLHHHHHHHHHLLlLLLLLLL----------lLLLLlHHHHHHHHLL---LLLEEEL
Query lgTDNRYLLSALQTVPgQLRGVVX----------lERDVeQATLAEXARL---GVRGVRL  102
ident           |                                  |          |   
Sbjct --FHEEWIAKAVRDFG-XRALLTRglvdsngddggRLEEnLKLYNEWNGFegrIFVGFGP  174
DSSP  --LLHHHHHHHHHHHL-LEEEEEEeelllllllllHHHHhHHHHHHHLLHhhlEEEEEEE


DSSP  LLLLLLLLLLlllllHHHHHHHHHHLLEEEELLL-----lLLHHHHHHHHLLlLLLEEEL
Query NLXGQDXPDLtgaqwRPLLERIGEQGWHVELHRQ-----vADIPVLVRALQPyGLDIVID  157
ident                             |  |         |                  
Sbjct HSPYLCSEEY----lKRVFDTAKSLNAPVTIHLYetskeeYDLEDILNIGLK-EVKTIAA  229
DSSP  LLLLLLLHHH----hHHHHHHHHHHLLLEEEEELllllllLLLHHHHLLLLL-LLLEEEE


DSSP  hHHLLllllllllllHHHHLLLLLLLLEEEEEE--LHHHLLllhhhHHHHhhhHHHHHHH
Query hFGRPdarrglgqpgFAELLTLSGRGKVWVKVS--GIYRLQgspeeNLAFarqALCALEA  215
ident                              |         |      |             
Sbjct -HCVH---------lPERYFGVLKDIPFFVSHNpaSNLKLG-----NGIA---PVQRXIE  271
DSSP  -ELLL---------lLHHHHHHHLLLLEEEEELhhHHHHLL-----LLLL---LHHHHHH


DSSP  HLLhhHEEEELLLLLLlllllLLHHhhHHHHHHHL----------LLHHHHHHHHLHHHH
Query HYGaeRLXWGSDWPHTqheseVSFGsaVEQFEALG----------CSAQLRQALLLDTAR  265
ident |        | |          |                                     
Sbjct HGX--KVTLGTDGAAS----nNSLN-lFFEXRLASllqkaqnprnLDVNTCLKXVTYDGA  324
DSSP  LLL--EEEELLLLLLL----lLLLL-hHHHHHHHHhhhhllllllLLHHHHHHHHLHHHH


DSSP  HHLLLLL-----------------------------------------------------
Query ALFGFEL-----------------------------------------------------  272
ident    ||                                                       
Sbjct QAXGFKSgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdg  384
DSSP  HHHLLLLlllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeell


DSSP  ----------------------l
Query ----------------------e  273
ident                        
Sbjct eyptidseevkrelariekelys  407
DSSP  llllllhhhhhhhhhhhhhhhhl


No 40: Query=2ffiA Sbjct=1a4mA Z-score=14.3

back to top
DSSP  ---lllLLEELLLLLL------LHHHHHHLL-----------------------------
Query ---lhlTAIDSHAHVF------SRGLNLASQ-----------------------------   22
ident            | |                                              
Sbjct tpafnkPKVELHVHLDgaikpeTILYFGKKRgialpadtveelrniigmdkplslpgfla   60
DSSP  llllllLEEEEEEEHHhlllhhHHHHHHHHHllllllllhhhhhhhhlllllllhhhhhl


DSSP  llLLLL---------lllLHHHHHHHHHHLLLLEELLLLlhhhLLLLH------------
Query rrYAPN---------ydaPLGDYLGQLRAHGFSHGVLVQpsflGTDNR------------   61
ident                               |                             
Sbjct kfDYYMpviagcreaikrIAYEFVEMKAKEGVVYVEVRY----SPHLLanskvdpmpwnq  116
DSSP  lhHHHHhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEE----LLHHHllllllllhhhl


DSSP  ---------HHHHHHHHLL-------lLLLLLLLL------LLLLlhHHHHHHHLLLLLE
Query ---------YLLSALQTVP-------gQLRGVVXL------ERDVeqATLAEXARLGVRG   99
ident                |             |                           |  
Sbjct tegdvtpddVVDLVNQGLQegeqafgiKVRSILCCmrhqpsWSLEvlELCKKYNQKTVVA  176
DSSP  llllllhhhHHHHHHHHHHhhhhhhllEEEEEEEEelllhhHHHHhhHHHHHLLLLLEEE


DSSP  EELL-LLLLLLLLLlLLLLHHHHHHHHHHLLEEEELL---LLLL-HHHHHHHHllllLLE
Query VRLN-LXGQDXPDLtGAQWRPLLERIGEQGWHVELHR---QVAD-IPVLVRALqpygLDI  154
ident   |          |         |     | |   |             |  |       
Sbjct MDLAgDETIEGSSL-FPGHVEAYEGAVKNGIHRTVHAgevGSPEvVREAVDIL----KTE  231
DSSP  EEEElLLLLLLHHH-LHHHHHHHHHHHHHLLEEEEEElllLLHHhHHHHHHLL----LLL


DSSP  EELhHHLLlllllllllLHHH--HLLLLlLLLEEEEEE--LHHH--LLLLhHHHHhHHHH
Query VIDhFGRPdarrglgqpGFAE--LLTLSgRGKVWVKVS--GIYR--LQGSpEENLaFARQ  208
ident      |                 |            |     |                 
Sbjct RVG-HGYH---------TIEDeaLYNRLlKENMHFEVCpwSSYLtgAWDP-KTTH-AVVR  279
DSSP  EEE-ELHH---------HHHLhhHHHHHhHLLLEEEELhhHHHHllLLLL-LLLL-HHHH


DSSP  HHHHHHhhllhhHEEEELLLlLLLLLllLLHHHHHHHHH-HHLLLHHHHHHHHlHHHH-H
Query ALCALEahygaeRLXWGSDWpHTQHEseVSFGSAVEQFE-ALGCSAQLRQALLlDTAR-A  266
ident                   |                       |        |    |   
Sbjct FKNDKA------NYSLNTDD-PLIFK--STLDTDYQMTKkDMGFTEEEFKRLN-INAAkS  329
DSSP  HHHLLL------LEEELLLL-LLLLL--LLHHHHHHHHHhLLLLLHHHHHHHH-HHHHhL


DSSP  HLL---LLLL----------
Query LFG---FELE----------  273
ident  |       |          
Sbjct SFLpeeEKKEllerlyreyq  349
DSSP  LLLlhhHHHHhhhhhhhhll


No 41: Query=2ffiA Sbjct=4c5yA Z-score=14.3

back to top
DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------lh    2
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLLEELLLLLLLHHHhhhlLLLLLLLL--------llLHHHHHHHHHHLLLLEELLLLlh
Query LTAIDSHAHVFSRGLnlasQRRYAPNY--------daPLGDYLGQLRAHGFSHGVLVQps   54
ident     | | |                             |          |          
Sbjct PGLWDCHMHFGGDDD----YYNDYTSGlathpassgaRLARGCWEALQNGYTSYRDLA--  114
DSSP  ELEEEEEELLLLLLL----LLLLLHHHhhllhhhhhhHHHHHHHHHHHLLEEEEEELL--


DSSP  hhllllhHHHHHHHHLL------lLLLLL-LLLL--------------------------
Query flgtdnrYLLSALQTVP------gQLRGV-VXLE--------------------------   81
ident        |                        |                           
Sbjct ------gYGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifalpagevlgsygvmnpr  168
DSSP  ------lLHHHHHHHHHlllllllEEEELlLEEEllllllllllllhhhhhhhhllllll


DSSP  ----------------LLLL-hHHHHHHHlllLLEEELLLLL----------llLLLLLl
Query ----------------RDVE-qATLAEXArlgVRGVRLNLXG----------qdXPDLTg  114
ident                                          |                  
Sbjct pgywgagplciadgveEVRRavRLQIRRG---AKVIXVMASGgvmsrddnpnfaQFSPE-  224
DSSP  lllllllleeelllhhHHHHhhHHHHHHL---LLLEEEELLLllllllllllllLLLHH-


DSSP  llLHHHHHHHHHHLLEEEELLLLLL-HHHHHHHHllllllEEELhHHLLllllllllllH
Query aqWRPLLERIGEQGWHVELHRQVAD-IPVLVRALqpygldIVIDhFGRPdarrglgqpgF  173
ident        |    |   |  |      |     |                           
Sbjct -eLKVIVEEAARQNRIVSAHVHGKAgIMAAIKAG-----cKSLE-HVSY---------aD  268
DSSP  -hHHHHHHHHHHLLLLEEEEELLHHhHHHHHHHL-----lLEEE-ELLL---------lL


DSSP  HHHLLLlLLLLEEEEEELHHH---------------lLLLHhHHHHHHHHHHHHHHHHLL
Query AELLTLsGRGKVWVKVSGIYR---------------lQGSPeENLAFARQALCALEAHYG  218
ident  |   |                                            |         
Sbjct EEVWELmKEKGILYVATRSVIeiflasngeglvkeswAKLQ-ALADSHLKAYQGAIKAGV  327
DSSP  HHHHHHhHHHLLEEELLHHHHhhhhhhllllllllhhHLLL-HHHHHHHHHHHHHHHLLL


DSSP  hhHEEEELLLLllllllllLHHHHHHHHHHH-LLLHHHHHHHHLHHHHHHL--LLLLL--
Query aeRLXWGSDWPhtqhesevSFGSAVEQFEAL-GCSAQLRQALLLDTARALF--GFELE--  273
ident       | |                       |             |         |   
Sbjct --TIALGTDTA-----pggPTALELQFAVERgGMTPLEAIKAATANAPLSVgpQAPLTgq  380
DSSP  --LEELLLLLL-----lllLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHHhhHLLLLll


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  273
ident                                                         
Sbjct lregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 42: Query=2ffiA Sbjct=2imrA Z-score=13.6

back to top
DSSP  ----------------------------------------------------llLLLEEL
Query ----------------------------------------------------lhLTAIDS    8
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE


DSSP  LLLLL--------lhhhhhhllllLLLLLLL---LHHHHHHHHHHLLLLEELLLLLhhhl
Query HAHVF--------srglnlasqrrYAPNYDA---PLGDYLGQLRAHGFSHGVLVQPsflg   57
ident | |                                       |   |             
Sbjct HTHLDmsayefqalpyfqwipevvIRGRHLRgvaAAQAGADTLTRLGAGGVGDIVW----  116
DSSP  EEELLllhhhhhhlhhhhllhhhhHHHLLLLhhhHHHHHHHHHHHLLLLLEEEEEL----


DSSP  lLLHHHHHHHHHLLLLLLLLLLL----------LLLLLHHHHHHHHLL----LLLEEELL
Query tDNRYLLSALQTVPGQLRGVVXL----------ERDVEQATLAEXARL----GVRGVRLN  103
ident          |                               |    ||       |    
Sbjct -APEVMDALLAREDLSGTLYFEVlnpfpdkadeVFAAARTHLERWRRLerpgLRLGLSPH  175
DSSP  -LHHHHHHHHLLLLLLEEEEEEEllllhhhhhhHHHHHHHHHHHHHLLllllEEEEEEEL


DSSP  LllllLLLLLLlLLHHHHHHHHHHLLEEEELLL---------------------------
Query LxgqdXPDLTGaQWRPLLERIGEQGWHVELHRQ---------------------------  136
ident               | |       |     |                             
Sbjct T---pFTVSHR-LMRLLSDYAAGEGLPLQIHVAehptelemfrtgggplwdnrmpalyph  231
DSSP  L---lLLLLHH-HHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllllhhhllhhhlll


DSSP  -------------lLLHHHHH-HHHLllLLLEEELhHHLLlllllllllLHHHHLLLlLL
Query -------------vADIPVLV-RALQpyGLDIVIDhFGRPdarrglgqpGFAELLTLsGR  182
ident                    |                                       |
Sbjct tlaevigrepgpdlTPVRYLDeLGVL--AARPTLV-HMVN---------VTPDDIARvAR  279
DSSP  lhhhhhllllllllLHHHHHHhHLLH--HHLLEEE-ELLL---------LLHHHHHHhHH


DSSP  LLEEEEEE--LHHHLLllhhhhhhHHHHhHHHHHHHLLhhHEEEELLLLLLlllllLLHH
Query GKVWVKVS--GIYRLQgspeenlaFARQaLCALEAHYGaeRLXWGSDWPHTqheseVSFG  240
ident     |         |                |  |         | |             
Sbjct AGCAVVTCprSNHHLE-------cGTFD-WPAFAAAGV--EVALGTDSVAS----gETLN  325
DSSP  HLLLEEELhhHHHHLL-------lLLLL-HHHHHHLLL--LEEELLLLHHH----hLLLL


DSSP  --HHHHHHHHHL--LLHHHHHHHHLHHHHHHLlLLLL-------------------
Query --SAVEQFEALG--CSAQLRQALLLDTARALFgFELE-------------------  273
ident     |     |                                             
Sbjct vrEEVTFARQLYpgLDPRVLVRAAVKGGQRVV-GTPFlrrgetwqegfrwelsrdl  380
DSSP  lhHHHHHHHHHLllLLHHHHHHHHHHHHHHHH-LLLLllllllllhhhlhhhllll


No 43: Query=2ffiA Sbjct=3ooqA Z-score=13.4

back to top
DSSP  -------------------------------------------------llLLLEELLLL
Query -------------------------------------------------lhLTAIDSHAH   11
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  --LLLHhhhhhllllllLLLL------------------lLHHH-HHHHHHHLLLLEELL
Query --VFSRglnlasqrryaPNYD------------------aPLGD-YLGQLRAHGFSHGVL   50
ident    |               |                       |       | |      
Sbjct igLFEE--------gvgYYYSdgneatdpvtphvkaldgfNPQDpAIERALAGGVTSVXI  112
DSSP  llLLLL--------lllHHHLllllllllllllllhhhhlLLLLhHHHHHHLLLEEEEEE


DSSP  LLLHH-----hllllhhhhhhHHHLLLlllllllllllllhhhhhhhhlLLLLEEELLLL
Query VQPSF-----lgtdnryllsaLQTVPGqlrgvvxlerdveqatlaexarLGVRGVRLNLX  105
ident |  |                                                 |      
Sbjct VPGSAnpvggqgsvikfrsiiVEECIV----------------------KDPAGLKXAFG  150
DSSP  LLLLLlleeeeeeeeelllllHHHHEE----------------------EEEEEEEEELL


DSSP  LLL----------------LLLLLLlLLHH---------------------------HHH
Query GQD----------------XPDLTGaQWRP---------------------------LLE  122
ident                                                            |
Sbjct ENPkrvygerkqtpstrxgTAGVIR-DYFTkvknyxkkkelaqkegkeftetdlkxeVGE  209
DSSP  HHHhhhhhhlllllllhhhHHHHHH-HHHHhhhhhhhhhhhhhhlllllllllhhhhHHH


DSSP  HHHHHLLEEEELL-LLLLHHHHHHHHLLLLLLEEELhHHLLllllllllllhhHHLLLlL
Query RIGEQGWHVELHR-QVADIPVLVRALQPYGLDIVIDhFGRPdarrglgqpgfaELLTLsG  181
ident            |     ||    |     |   ||   |                     
Sbjct XVLRKKIPARXHAhRADDILTAIRIAEEFGFNLVIE-HGTE----------ayKISKVlA  258
DSSP  HHHLLLLLEEEEElLHHHHHHHHHHHHHHLLLEEEE-ELLL----------hhHHHHHhH


DSSP  LLLEEEEEELH-HHLLLLhhhhhhHHHHHHHHHHHHLLhhHEEEELLLLLllllllLLHH
Query RGKVWVKVSGI-YRLQGSpeenlaFARQALCALEAHYGaeRLXWGSDWPHtqheseVSFG  240
ident   |  | |                        |             | |           
Sbjct EKKIPVVVGPLlTFRTKL--elkdLTXETIAKLLKDGV--LIALXCDHPV------IPLE  308
DSSP  HHLLLEEELLLlLLLLLH--hhllLLLLHHHHHHHLLL--LEEELLLLLL------LLHH


DSSP  HHHHHHHHHL---LLHHHHHHHHLHHHHHHL-LLLL------------------------
Query SAVEQFEALG---CSAQLRQALLLDTARALF-GFEL------------------------  272
ident  |  |                 |                                     
Sbjct FATVQAATAXrygAKEEDLLKILTVNPAKILgLEDRigsiepgkdadlvvwsghpfdxks  368
DSSP  HHHHHHHHHHhhlLLHHHHHHLLLHHHHHHLlLLLLllllllllllleeeelllllllll


DSSP  ---------------l
Query ---------------e  273
ident                 
Sbjct vvervyidgvevfrre  384
DSSP  leeeeeelleeeeell


No 44: Query=2ffiA Sbjct=1j5sA Z-score=13.1

back to top
DSSP  ----------------------lllLLEELLLLLLlhhhhhhllllllllllLLHH----
Query ----------------------lhlTAIDSHAHVFsrglnlasqrryapnydAPLG----   34
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHLD----------------aKDIVenkp   44
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL----------------hHHHHhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   34
ident                                                             
Sbjct wndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihl  104
DSSP  lllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhh


DSSP  -------------------------------hHHHHHHHLLLLEELLLLlhhhLLLLHhh
Query -------------------------------dYLGQLRAHGFSHGVLVQpsflGTDNRyl   63
ident                                     ||                      
Sbjct dlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEILCTTD----DPVST--  158
DSSP  hhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL----LLLLL--


DSSP  HHHHHHLL-----lLLLLLLLL--LLLL-----------------------------LHH
Query LSALQTVP-----gQLRGVVXL--ERDV-----------------------------EQA   87
ident |                          |                                
Sbjct LEHHRKAKeavegvTILPTWRPdrAMNVdkegwreyvekmgerygedtstldgflnaLWK  218
DSSP  LHHHHHHHhhllllEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhhhhhHHH


DSSP  HHHHHHLLLLLEEELLLLlllLLLLLLL-----------------------------LLH
Query TLAEXARLGVRGVRLNLXgqdXPDLTGA-----------------------------QWR  118
ident         |       |     |                                     
Sbjct SHEHFKEHGCVASDHALL---EPSVYYVdenraravhekafsgekltqdeindykafMMV  275
DSSP  HHHHHHLLLLLEEEEEEL---LLLLLLLlhhhhhhhhhhhlllllllhhhhhhhhhhHHH


DSSP  HHHHHHHHHLLEEEELLL------------------------lLLHHHHHH-HHLLL--L
Query PLLERIGEQGWHVELHRQ------------------------vADIPVLVR-ALQPY--G  151
ident        |  |   ||                             |    |  |      
Sbjct QFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnfLRIAEGLRyFLNEFdgK  335
DSSP  HHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllLLHHHHHHhHHHHLllL


DSSP  LLEEELhhHLLLlllllllLLHHHHLLL-LLLLLEEEEEelHHHLlllhhhHHHHHHHHH
Query LDIVIDhfGRPDarrglgqPGFAELLTL-SGRGKVWVKVsgIYRLqgspeeNLAFARQAL  210
ident | ||                      |       | |                      |
Sbjct LKIVLY--VLDP-------THLPTISTIaRAFPNVYVGA-pWWFN-----dSPFGMEMHL  380
DSSP  LLEEEE--ELLH-------HHHHHHHHHhHHLLLEEELL-lLLLL-----lLHHHHHHHH


DSSP  HHHHHHLL-HHHEEEELLLLLlllllllLHHHHHHHHHHHLL----------------LH
Query CALEAHYG-AERLXWGSDWPHtqhesevSFGSAVEQFEALGC----------------SA  253
ident   |              |          ||||  | |                       
Sbjct KYLASVDLlYNLAGMVTDSRK-----llSFGSRTEMFRRVLSnvvgemvekgqipikeAR  435
DSSP  HHHHLLLLhHHLLLLLLLLLL-----llHHHHHHHHHHHHHHhhhhhhhhlllllhhhHH


DSSP  HHHHHHHLHHHHHHLLllll
Query QLRQALLLDTARALFGfele  273
ident  |      |   |||     
Sbjct ELVKHVSYDGPKALFF----  451
DSSP  HHHHHHHLHHHHHHHL----


No 45: Query=2ffiA Sbjct=3iacA Z-score=12.7

back to top
DSSP  -----------------------lllLLEELLLLLLlhhhhhhllllllllllLLHHH--
Query -----------------------lhlTAIDSHAHVFsrglnlasqrryapnydAPLGD--   35
ident                              | | |                       |  
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHLS---------------pqEIADDrr   45
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLLL---------------hhHHHHLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   35
ident                                                             
Sbjct fdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwth  105
DSSP  lllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhh


DSSP  ------------------------------------HHHHHHHLLLLEELLLLlhhhLLL
Query ------------------------------------YLGQLRAHGFSHGVLVQpsflGTD   59
ident                                       |                     
Sbjct lelrrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTD----DPI  161
DSSP  hhhhlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLL----LLL


DSSP  LHhhHHHHHHLL------lLLLLLLLLLLL------------------------------
Query NRylLSALQTVP------gQLRGVVXLERD------------------------------   83
ident     |                                                       
Sbjct DS--LEYHRQIAaddsidiEVAPSWRPDKVfkieldgfvdylrkleaaadvsitrfddlr  219
DSSP  LL--LHHHHHHHhllllllEEELLLLLHHHhllllllhhhhhhhhhhhhllllllhhhhh


DSSP  -lLHHHHHHHHLLLLLEEELLLLllLLLL--------------------------llLLL
Query -vEQATLAEXARLGVRGVRLNLXgqDXPD--------------------------ltGAQ  116
ident       |   |  | |                                            
Sbjct qaLTRRLDHFAACGCRASDHGIE--TLRFapvpddaqldailgkrlagetlseleiaQFT  277
DSSP  hhHHHHHHHHHHLLLLEEEEEEL--LLLLlllllhhhhhhhhhhhhllllllhhhhhHHH


DSSP  L---HHHHHHHHHHLLEEEELLL-----------------------llLHHHHHH-HHLL
Query W---RPLLERIGEQGWHVELHRQ-----------------------vaDIPVLVR-ALQP  149
ident       |       ||   ||                            |       |  
Sbjct TavlVWLGRQYAARGWVXQLHIGairnnntrxfrllgpdtgfdsigdnNISWALSrLLDS  337
DSSP  HhhhHHHHHHHHHHLLEEEEEELeellllhhhhhhhllllllleelllLLHHHHHhHHHH


DSSP  L-----LLLEEELhhHLLLlllllllLLHHHHLL--LLLL-----LLEEEEEelHHHLll
Query Y-----GLDIVIDhfGRPDarrglgqPGFAELLT--LSGR-----GKVWVKVsgIYRLqg  197
ident                                | |           |||            
Sbjct XdvtneLPKTILY--CLNP-------RDNEVLATxiGNFQgpgiaGKVQFGS-gWWFN--  385
DSSP  HhllllLLEEEEE--ELLH-------HHHHHHHHhhHHLLlllllLLEEELL-lLHHH--


DSSP  lhhhHHHHHHHHHHHHHH-HLLHHHEEEELLLLLlllllllLHHHHHHHHHHHLL-----
Query speeNLAFARQALCALEA-HYGAERLXWGSDWPHtqhesevSFGSAVEQFEALGC-----  251
ident             |  |              |                | |    |     
Sbjct ---dQKDGXLRQLEQLSQxGLLSQFVGXLTDSRS------fLSYTRHEYFRRILCnllgq  436
DSSP  ---lLHHHHHHHHHHHHHhLLHHHLLLLLLLLLL------lLLLHHHHHHHHHHHhhhhh


DSSP  -------------LHHHHHHHHLHHHHHHLLllll
Query -------------SAQLRQALLLDTARALFGfele  273
ident                   |      |   |     
Sbjct waqdgeipddeaxLSRXVQDICFNNAQRYFT--ik  469
DSSP  hhhlllllllhhhHHHHHHHHHLHHHHHHLL--ll


No 46: Query=2ffiA Sbjct=4rdvB Z-score=12.6

back to top
DSSP  ----------------------------------------------llLLLEELLLLLL-
Query ----------------------------------------------lhLTAIDSHAHVF-   13
ident                                                       | | | 
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh


DSSP  ------------lhhhhhhllLLLL--LLLL------lLHHHHHHHHHHLLLLEELLLLL
Query ------------srglnlasqRRYA--PNYD------aPLGDYLGQLRAHGFSHGVLVQP   53
ident                                                   |         
Sbjct ramaglaevagnpndsfwtwrELMYrmVARLspeqievIACQLYIEMLKAGYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhhhHHHHhhHLLLlhhhhhhHHHHHHHHHHHHLEEEEEEEEL


DSSP  hhHLLL---------LHHHHHHHHHLL---lLLLLLLLL-------------------LL
Query sfLGTD---------NRYLLSALQTVP---gQLRGVVXL-------------------ER   82
ident      |             |            |     |                     
Sbjct --VHHDldgrsyadpAELSLRISRAASaagiGLTLLPVLyshagfggqpasegqrrfiNG  178
DSSP  --LLLLlllllllllLHHHHHHHHHHHhhllEEEEEELLlleeellleellhhhllllLL


DSSP  LLL-HHHHHHHHLL-----LLLEEELLLLLLllLLLLlllLHHHHHHhHHHLLEEEELLL
Query DVE-QATLAEXARL-----GVRGVRLNLXGQdxPDLTgaqWRPLLERiGEQGWHVELHRQ  136
ident        |              |                     |   |     |  |  
Sbjct SEAyLELLQRLRAPleaagHSLGLCFHSLRA--VTPQ--qIATVLAA-GHDDLPVHIHIA  233
DSSP  HHHhHHHHHHHHHHhhhhlLEELEEELLLLL--LLHH--hHHHHHLL-LLLLLLEEEEEL


DSSP  --------------llLHHHHHHHHLllllLEEELhHHLLlllllllllLHHHHLLLllL
Query --------------vaDIPVLVRALQpyglDIVIDhFGRPdarrglgqpGFAELLTLsgR  182
ident                     |                                      |
Sbjct eqqkevddcqawsgrrPLQWLYENVA-vdqRWCLV-HATH---------ADPAEVAAmaR  282
DSSP  llhhhhhhhhhhhlllHHHHHHHHLL-lllLEEEE-ELLL---------LLHHHHHHhhH


DSSP  LLEEEEEE--LHHHLLllhhhhHHHHhhHHHHHHHHLLhhHEEEELLLLlllllllLLHH
Query GKVWVKVS--GIYRLQgspeenLAFArqALCALEAHYGaeRLXWGSDWPhtqheseVSFG  240
ident               |                   |  |  ||  |||         ||  
Sbjct SGAVAGLClsTEANLG------DGIF--PATDFLAQGG--RLGIGSDSH-------VSLS  325
DSSP  HLLEEEELhhHHHHLL------LLLL--LHHHHHHLLL--EEEELLLLL-------LLLL


DSSP  hhHHHHHHHL--------------------LLHHHHHHHhLHHHHHHLLLLL--------
Query saVEQFEALG--------------------CSAQLRQALlLDTARALFGFEL--------  272
ident   ||    |                         |  |  |       |           
Sbjct -vVEELRWLEygqrlrdrkrnrlyrddqpmIGRTLYDAA-LAGGAQALGQPIgslavgrr  383
DSSP  -hHHHHHHHHhhhhhhhlllllllllllllHHHHHHHHH-HHHHHHHHLLLLllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct adllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersaraf  443
DSSP  lleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhh


DSSP  -------l
Query -------e  273
ident         
Sbjct vqvlgell  451
DSSP  hhhhhhhl


No 47: Query=2ffiA Sbjct=3qy6A Z-score=12.6

back to top
DSSP  llllLEELLL-LLLLhhhhhhllllllllLLLL-HHHHHHHHHHLLLLEELLLLLH----
Query lhltAIDSHA-HVFSrglnlasqrryapnYDAP-LGDYLGQLRAHGFSHGVLVQPS----   54
ident      || |                     |              |              
Sbjct ----MIDIHChILPA---------mddgaGDSAdSIEMARAAVRQGIRTIIATPHHnngv   47
DSSP  ----LEELLLlLLLL---------lllllLLHHhHHHHHHHHHHLLLLEEELLLEEllll


DSSP  -HHLLL--LHHHHHHHHHLL-----lLLLLLLlllllllhhhhhhhhllllleeELLLll
Query -FLGTD--NRYLLSALQTVP-----gQLRGVVxlerdveqatlaexarlgvrgvRLNLxg  106
ident                                                             
Sbjct yKNEPAavREAADQLNKRLIkediplHVLPGQ----------------------EIRI--   83
DSSP  lLLLHHhhHHHHHHHHHHHHhlllllEEELLL----------------------EEEL--


DSSP  llLLLLlllllhHHHHHH----hhhLLEEEELLL----lLLHHHHHHHHLLLLLLEEELH
Query qdXPDLtgaqwrPLLERI----geqGWHVELHRQ----vADIPVLVRALQPYGLDIVIDH  158
ident               |                             |   ||  |   || |
Sbjct --YGEV-----eQDLAKRqllslndTKYILIEFPfdhvpRYAEQLFYDLQLKGYIPVIAH  136
DSSP  --LLLH-----hHHHHLLllllhhhLLEEEEELLlllllLLHHHHHHHHHHLLLEEEEEL


DSSP  hHLLLllLLLLLllHHHHLL-LLLLllEEEEEELHHhlllLHHHHHHHHHHHHHHHHhhl
Query fGRPDarRGLGQpgFAELLT-LSGRgkVWVKVSGIYrlqgSPEENLAFARQALCALEahy  217
ident                  |                            ||      |     
Sbjct -PERN-rEIREN--PSLLYHlVEKG--AASQITSGSlagiFGKQLKAFSLRLVEANL---  187
DSSP  -HHHL-hHHHHL--LHHHHHhHHLL--LEEEEEHHHhlllLLHHHHHHHHHHHHLLL---


DSSP  lhhhEEEELLLLLlllLLLLLHHhHHHHHHHH--LLLHHHHHHHHlHHHHHHLL------
Query gaerLXWGSDWPHtqhESEVSFGsAVEQFEAL--GCSAQLRQALLlDTARALFG------  269
ident         ||           |    |    |       |   |    |  |        
Sbjct ---iHFVASDAHN---VKTRNFH-TQEALYVLekEFGSELPYMLT-ENAELLLRnqtifr  239
DSSP  ---lLEEELLLLL---LLLLLLL-HHHHHHHHhhHHLLHHHHHHH-HHHHHHHLllllll


DSSP  ----llll
Query ----fele  273
ident         
Sbjct qppqpvkr  247
DSSP  llllllll


No 48: Query=2ffiA Sbjct=2uz9A Z-score=12.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ------llLLLEELLLLLL--------lhhhhhhllLLLLLLL----------llLHHHH
Query ------lhLTAIDSHAHVF--------srglnlasqRRYAPNY----------daPLGDY   36
ident             | | |                     |                     
Sbjct lshheffmPGLVDTHIHASqysfagssidlpllewlTKYTFPAehrfqnidfaeeVYTRV  120
DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhHHLHHHHhhhhhlhhhhhhHHHHH


DSSP  HHHHHHLLLLEELLLLLhhhlLLLHHHHHHHHHLL---LLLLLLLLL-------------
Query LGQLRAHGFSHGVLVQPsflgTDNRYLLSALQTVP---GQLRGVVXL-------------   80
ident        |                   |                                
Sbjct VRRTLKNGTTTACYFAT----IHTDSSLLLADITDkfgQRAFVGKVCmdlndtfpeyket  176
DSSP  HHHHHHLLEEEEEEELL----LLHHHHHHHHHHHHhhlLEEEEELEElllllllllllll


DSSP  ---LLLLlHHHHHHHHL----lLLLEEELLLLLLllllllLLLL-HHHHHHHHHHLLEEE
Query ---ERDVeQATLAEXAR----lGVRGVRLNLXGQdxpdltGAQW-RPLLERIGEQGWHVE  132
ident              |            |                    |         |  
Sbjct teeSIKEtERFVSEMLQknysrVKPIVTPRFSLS-----cSETLmGELGNIAKTRDLHIQ  231
DSSP  hhhHHHHhHHHHHHHHHhllllEEEEEEELLHHH-----lLHHHhHHHHHHHHHHLLEEE


DSSP  ELLL---------------llLHHHHHHHHLlllLLEEELhHHLLlllllllllLHHHHL
Query LHRQ---------------vaDIPVLVRALQpygLDIVIDhFGRPdarrglgqpGFAELL  177
ident  |                                   |    |             || |
Sbjct SHISenrdeveavknlypsykNYTSVYDKNNlltNKTVMA-HGCY---------LSAEEL  281
DSSP  EEELllhhhhhhhhhhlllllLHHHHHHHLLlllLLEEEE-ELLL---------LLHHHH


DSSP  LLlLLLLEEEEEE--LHHHLLLlhhhhhhHHHHhHHHHHHHLLhhHEEEELLLLLlllll
Query TLsGRGKVWVKVS--GIYRLQGspeenlaFARQaLCALEAHYGaeRLXWGSDWPHtqhes  235
ident                    |                    |        | |        
Sbjct NVfHERGASIAHCpnSNLSLSS-------GFLN-VLEVLKHEV--KIGLGTDVAG-----  326
DSSP  HHhHHHLLEEEELhhHHHHLLL-------LLLL-HHHHHHLLL--EEEELLLLLL-----


DSSP  lLLHH--HHHHHHHHHL------------LLHHHHHHHHLHHHHH-HLLLLLL-------
Query eVSFG--SAVEQFEALG------------CSAQLRQALLLDTARA-LFGFELE-------  273
ident   |     |                            |        |             
Sbjct gYSYSmlDAIRRAVMVSnillinkvneksLTLKEVFRLATLGGSQaLGLDGEIgnfevgk  386
DSSP  lLLLLhhHHHHHHHHHHhhhhhlllllllLLHHHHHHHHLHHHHHhLLLLLLLlllllll


DSSP  ----------------------------------------------------------
Query ----------------------------------------------------------  273
ident                                                           
Sbjct efdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  llleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 49: Query=2ffiA Sbjct=1a5kC Z-score=12.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ----llLLLEELLLLLllhhhhhhllllllllllLLHHhHHHHHHHLLLLEELLLL----
Query ----lhLTAIDSHAHVfsrglnlasqrryapnydAPLGdYLGQLRAHGFSHGVLVQ----   52
ident          || | |                                |    |       
Sbjct egkivtAGGIDTHIHW------------------ICPQ-QAEEALVSGVTTMVGGGtgpa  161
DSSP  llleeeELEEEEEEEL------------------LLLL-HHHHHHHHLEEEEEEELllll


DSSP  --LHHH--lLLLHHHHHHHHHLL---lLLLLLLLL-LLLLL--HHHHHHHhlllLLEEEL
Query --PSFL--gTDNRYLLSALQTVP---gQLRGVVXL-ERDVE--QATLAEXarlgVRGVRL  102
ident              |    ||                           |      | |   
Sbjct agTHATtctPGPWYISRMLQAADslpvNIGLLGKGnVSQPDalREQVAAG----VIGLEI  217
DSSP  hhHHHLlllLHHHHHHHHHHHHLllllEEEEEEELlLLLHHhhHHHHHHL----LLEEEE


DSSP  LLLLLllLLLLllllHHHHHHHHHHLLEEEELL----lllLHHHHHHHHLllLLLEEELH
Query NLXGQdxPDLTgaqwRPLLERIGEQGWHVELHR----qvaDIPVLVRALQpyGLDIVIDH  158
ident                   |    |    | ||               |    |  |   |
Sbjct HEDWG--ATPA--aiDCALTVADEMDIQVALHSdtlnesgFVEDTLAAIG--GRTIHTFH  271
DSSP  EHHHL--LLHH--hhHHHHHHHHHHLLEEEEELlllllllLHHHHHHHHL--LLLEEELL


DSSP  HHLLlllllllLLLHhHHLLLlllLLEEEEEELHH-------------------------
Query FGRPdarrglgQPGFaELLTLsgrGKVWVKVSGIY-------------------------  193
ident             |                                               
Sbjct TEGA---ggghAPDIiTACAH---PNILPSSTNPTlpytlntidehldmlmvchhldpdi  325
DSSP  LLLL---llllLLLHhHHHHL---LLEEEEEEHHHllllllhhhhhhhhhhhhhllllll


DSSP  --------hLLLLhhHHHHHHHHHHHHHHhhllhhhEEEELLLLLLllllllLHHHHHHH
Query --------rLQGSpeENLAFARQALCALEahygaerLXWGSDWPHTqhesevSFGSAVEQ  245
ident                |  |                     ||            |     
Sbjct aedvafaesRIRR--ETIAAEDVLHDLGA------fSLTSSDSQAM-----gRVGEVILR  372
DSSP  hhhhhllllLLLH--HHHHHHHHHHHLLL------lLEEELLLLLL-----lLLLLHHHH


DSSP  HHHHL-------------------lLHHHHHHHHLHHHHHHL-LLLLL------------
Query FEALG-------------------cSAQLRQALLLDTARALF-GFELE------------  273
ident                                |                            
Sbjct TWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHgIAHEVgsievgkladlv  432
DSSP  HHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLlLLLLLllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct vwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltfls  492
DSSP  eelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  273
ident                                                             
Sbjct qaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitse  552
DSSP  hhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellll


DSSP  --------------
Query --------------  273
ident               
Sbjct padvlpmaqryflf  566
DSSP  llllllllllllll


No 50: Query=2ffiA Sbjct=1v77A Z-score=11.4

back to top
DSSP  llLLLEELLLLLllhhhhhhllllllllllllhhHHHHHHHHLlLLEELLLLLH--hhLL
Query lhLTAIDSHAHVfsrglnlasqrryapnydaplgDYLGQLRAHgFSHGVLVQPS--flGT   58
ident      |                                      |   |           
Sbjct --VKFIEMDIRD---------------------kEAYELAKEW-FDEVVVSIKFneevDK   36
DSSP  --LLLEEEEELL---------------------hHHHHHHHHH-LLEEEEEEEEllllLH


DSSP  LL-HHHHHHHhhllllLLLLllllllllhhhhhhhhllllleEELLLllllLLLLlllll
Query DN-RYLLSALqtvpgqLRGVvxlerdveqatlaexarlgvrgVRLNLxgqdXPDLtgaqw  117
ident    |                                        |       | |     
Sbjct EKlREARKEY------GKVA----------------------ILLSN---pKPSL----v   61
DSSP  HHhHHHHHHH------LLEE----------------------EEEEL---lLHHH----h


DSSP  HHHHHHHhhHLLEEEELLLlllHHHHHHHHLLLlLLEEELhHHLLLllllllLLLHhhHL
Query RPLLERIgeQGWHVELHRQvadIPVLVRALQPYgLDIVIDhFGRPDarrglgQPGFaeLL  177
ident |                          |          |                     
Sbjct RDTVQKF--KSYLIYVESN---DLRVIRYSIEK-GVDAII-SPWVN------RKDP-gID  107
DSSP  HHHHHHL--LLLEEEEELL---LHHHHHHHHHL-LLLEEE-LLLLL------LLLL-lLL


DSSP  LL--LLLL--LEEEEEE-LHHHlLLLHHHHhHHHHHHHHHHHHHLL--hHHEEEELLLLL
Query TL--SGRG--KVWVKVS-GIYRlQGSPEENlAFARQALCALEAHYG--aERLXWGSDWPH  230
ident            |    |         | |  |                  |    |    
Sbjct HVlaKLMVkkNVALGFSlRPLL-YSNPYER-ANLLRFMMKAWKLVEkykVRRFLTSSAQE  165
DSSP  HHhhHHHHhhLLEEEEElHHHH-HLLHHHH-HHHHHHHHHHHHHHHhhlLLEEEELLLLL


DSSP  llllllLLHHhhhHHHH---HHLLLHHHHHHHHLHHHHHHLLllll
Query tqheseVSFGsavEQFE---ALGCSAQLRQALLLDTARALFGfele  273
ident                       |       |               
Sbjct -----kWDVRyprDLISlgvVIGMEIPQAKASISMYPEIILK----  202
DSSP  -----hHHLLlhhHHHHhhhHLLLLHHHHHHLLLHHHHHHHL----


No 51: Query=2ffiA Sbjct=3au2A Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------------------llllLEELLLLLLLhhhhhhlllllll
Query ---------------------------------lhltAIDSHAHVFSrglnlasqrryap   27
ident                                        |   |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTY------------s  348
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLL------------l


DSSP  llLLLHHHHHHHHHHLLLLEELLLLLH-------HHLL--LLHHHHHHHHHLL----lLL
Query nyDAPLGDYLGQLRAHGFSHGVLVQPS-------FLGT--DNRYLLSALQTVP----gQL   74
ident      |          |         |                                |
Sbjct dgQNTLEELWEAAKTMGYRYLAVTDHSpavrvagGPSPeeALKRVGEIRRFNEthgppYL  408
DSSP  llLLLHHHHHHHHHHHLLLEEEEEEELhhhhlllLLLHhhHHHHHHHHHHHHHhhlllEE


DSSP  LLLllllllllhhhhhhhhllllleEELLLllllLLLLlllllhhhHHHHhhhlleEEEL
Query RGVvxlerdveqatlaexarlgvrgVRLNLxgqdXPDLtgaqwrplLERIgeqgwhVELH  134
ident                                                         |   
Sbjct LAG----------------------AEVDI---hPDGT-----ldyPDWVlreldlVLVS  438
DSSP  EEE----------------------EEEEL---lLLLL-----lllLHHHhlllleEEEE


DSSP  LL----------llLHHHHHHHHllllLLEEELHhHLLLLL--llllLLLHHHHLLLlLL
Query RQ----------vaDIPVLVRALqpygLDIVIDHfGRPDAR--rglgQPGFAELLTLsGR  182
ident                               |  |                          
Sbjct VHsrfnlpkadqtkRLLKALENP----FVHVLAH-PTARLLgrrapiEADWEAVFQKaKE  493
DSSP  LLllllllhhhhhhHHHHHHLLL----LLLEELL-LLLLLLllllllLLLHHHHHHHhHH


DSSP  LLEEEEEE-LHHHllllhhhhhhhHHHHHHHHHHHLLhhHEEEELLLLlllllllLLHHh
Query GKVWVKVS-GIYRlqgspeenlafARQALCALEAHYGaeRLXWGSDWPhtqheseVSFGs  241
ident   | |       |                                |              
Sbjct KGVAVEIDgYYDR--------mdlPDDLARMAYGMGL--WISLSTDAH-----qtDHLR-  537
DSSP  HLLEEEEElLLLL--------lllLHHHHHHHHHLLL--LEEEELLLL-----lhHHHH-


DSSP  HHHHHHHHLL---LHHHhhHHHLHhhhHHLL----llll
Query AVEQFEALGC---SAQLrqALLLDtarALFG----fele  273
ident   |                 |       |          
Sbjct FMELAVGTAQrawIGPE-rVLNTLdyeDLLSwlkarrgv  575
DSSP  HHHHHHHHHHhllLLLL-lLHHHLlhhHHHHhhhlllll


No 52: Query=2ffiA Sbjct=3dcpA Z-score=9.8

back to top
DSSP  lllLLEELLLLLLlhhhhhhllllllllLLLLHHHHHHHHHHLLLLEELLLLL-------
Query lhlTAIDSHAHVFsrglnlasqrryapnYDAPLGDYLGQLRAHGFSHGVLVQP-------   53
ident       | | |                                 |     |         
Sbjct ---XKRDGHTHTE----------fcphgTHDDVEEXVLKAIELDFDEYSIVEHaplssef   47
DSSP  ---LLEEEEELLL----------lllllLLLLHHHHHHHHHHLLLLEEEEEEEllllhhh


DSSP  -------------HHHLL-LLHHHHHHHHHLLL------LLLLLLlllllllhhhhhhhh
Query -------------SFLGT-DNRYLLSALQTVPG------QLRGVVxlerdveqatlaexa   93
ident                    |  |                                     
Sbjct xkntagdkeavttASXAXsDLPYYFKKXNHIKKkyasdlLIHIGF---------------   92
DSSP  hhllllllhhhhlLLLLHhHHHHHHHHHHHHHHhlllllEEEEEE---------------


DSSP  llllleeELLLllllLLLLllLLLHHHHHHHHHhlleeEELL------------------
Query rlgvrgvRLNLxgqdXPDLtgAQWRPLLERIGEqgwhvELHR------------------  135
ident                         |  |   |       |                    
Sbjct -------EVDY---lIGYE--DFTRDFLNEYGPqtddgVLSLhflegqggfrsidfsaed  140
DSSP  -------EEEL---lLLLH--HHHHHHHHHHHHhlleeEEELleeeelleeeellllhhh


DSSP  ------------------LLLLHHHHHHHHllLLLL-EEELHhHLLL----------LLL
Query ------------------QVADIPVLVRALqpYGLD-IVIDHfGRPD----------ARR  166
ident                             |            |                  
Sbjct ynegivqfyggfeqaqlaYLEGVKQSIEAD-lGLFKpRRXGH-ISLCqkfqqffgedTSD  198
DSSP  hhhhlhhhhllhhhhhhhHHHHHHHHHHLL-lLLLLlLEELL-LLHHhllhhhhlllHHH


DSSP  L--lLLLLHHHHLLLlLLLLEEEEEELHHH-llLLHHhhhhhHHHHHHHHHHHLLhhHEE
Query G--lGQPGFAELLTLsGRGKVWVKVSGIYR-lqGSPEenlafARQALCALEAHYGaeRLX  223
ident         |   | |                     |                       
Sbjct FseeVXEKFRVILALvKKRDYELDFNTAGLfkpLCGE--typPKKIVTLASELQI--PFV  254
DSSP  LlhhHHHHHHHHHHHhHHHLLEEEEELHHHhllLLLL--lllLHHHHHHHHHLLL--LEE


DSSP  EELLLLllllllllLHHHHHHHHHHHLLlhhhhhhhhlhhhhhhllllll
Query WGSDWPhtqhesevSFGSAVEQFEALGCsaqlrqallldtaralfgfele  273
ident  |||            |                                 
Sbjct YGSDSH-----gvqDIGRGYSTYCQKLE----------------------  277
DSSP  EELLLL-----lhhHLLLLHHHHHHHLL----------------------


No 53: Query=2ffiA Sbjct=2a3lA Z-score=9.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------------------lllLLEELLLLLL--------
Query ---------------------------------------lhlTAIDSHAHVF--------   13
ident                                              | | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   13
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -----------lHHHH----HHLLLllllllllLHHHHHHHHHHLLLLEELLLLlhhHLL
Query -----------sRGLN----LASQRryapnydaPLGDYLGQLRAHGFSHGVLVQpsfLGT   58
ident             |          |                 | |                
Sbjct nlkynpcgqsrlREIFlkqdNLIQG---rflgeITKQVFSDLEASKYQMAEYRI---SIY  294
DSSP  hhhhllllllhhHHHHllllLLLLL---llhhhHHHHHHHHHLLLLLEEEEEEE---ELL


DSSP  L--------lhhhhhhhhHLLLLLLLLLLL------------------LLLL-LHHH---
Query D--------nryllsalqTVPGQLRGVVXL------------------ERDV-EQAT---   88
ident                              |                    |         
Sbjct GrkmsewdqlaswivnndLYSENVVWLIQLprlyniykdmgivtsfqnILDNiFIPLfea  354
DSSP  LllllhhhhhhhhhhlllLLLLLEEEEEEEellhhhhlllllllllhhHHHHhLLHHhhh


DSSP  ---------hHHHHlLLLLEEELLLL-LLLL-------------------LLLLlllLHH
Query ---------lAEXArLGVRGVRLNLX-GQDX-------------------PDLTgaqWRP  119
ident                  | |  |                                     
Sbjct tvdpdshpqlHVFL-KQVVGFDLVDDeSKPErrptkhmptpaqwtnafnpAFSY--yVYY  411
DSSP  hhlhhhllllHHHH-LLEEEEEEELLlLLLLlllllllllllllllllllLHHH--hHHH


DSSP  HHHHHHH-----------HLLEEEELLLLLLhHHHHHHHLLLllLEEELhHHLLllllll
Query LLERIGE-----------QGWHVELHRQVADiPVLVRALQPYglDIVIDhFGRPdarrgl  168
ident                               |      |         |   |        
Sbjct CYANLYVlnklreskgmtTITLRPHSGEAGD-IDHLAATFLT--CHSIA-HGIN------  461
DSSP  HHHHHHHhhhhhllllllLLEELLLLLLLLL-LHHHHHHHHH--LLLLL-LLHH------


DSSP  llllHHHH-lLLLL-LLLEEEEEELHHHLLLlhhhHHHHHhhHHHHHHHHLLhhHEEEEL
Query gqpgFAEL-lTLSG-RGKVWVKVSGIYRLQGspeeNLAFArqALCALEAHYGaeRLXWGS  226
ident                        |                                    
Sbjct ---lRKSPvlQYLYyLAQIGLAMSPLSNNSL--flDYHRN--PFPVFFLRGL--NVSLST  512
DSSP  ---hHHLHhhHHHHhHHLLLEEELHHHHLLL--llLLLLL--LHHHHHHLLL--LEEELL


DSSP  LLlLLLLLlLLLHhHHHHHHHHHL----LLHHHHHHHHlHHHHHHLLLLLL---------
Query DWpHTQHEsEVSFgSAVEQFEALG----CSAQLRQALLlDTARALFGFELE---------  273
ident |    |          ||           ||               ||            
Sbjct DD-PLQIH-LTKE-PLVEEYSIAAsvwkLSACDLCEIA-RNSVYQSGFSHAlkshwigkd  568
DSSP  LL-HHHHL-LLLL-HHHHHHHHHHhhhlLLHHHHHHHH-HHHHHHLLLLHHhhhhhllll


DSSP  ------------------------------------------------
Query ------------------------------------------------  273
ident                                                 
Sbjct yykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 54: Query=2ffiA Sbjct=1m65A Z-score=9.0

back to top
DSSP  llllLEELLLLLLlhhhhhhllllllLLLLLLHHHHHHHHHHLLLLEELLLLLH-----H
Query lhltAIDSHAHVFsrglnlasqrryaPNYDAPLGDYLGQLRAHGFSHGVLVQPS-----F   55
ident       | | |                     | ||  |    |                
Sbjct ---yPVDLHMHTV-----------asTHAYSTLSDYIAQAKQKGIKLFAITDHGpdmedA   46
DSSP  ---lLEELLLLLL-----------llLLLLLLHHHHHHHHHHHLLLEEEEEEELlllllL


DSSP  HLLLL-HHHHHhhHHLL---lLLLLLL---lllllllhhhHHHHHLLlLLEEelllllll
Query LGTDN-RYLLSalQTVP---gQLRGVV---xlerdveqatLAEXARLgVRGVrlnlxgqd  108
ident                                                             
Sbjct PHHWHfINMRI--WPRVvdgvGILRGIeaniknvdgeidcSGKMFDS-LDLI--------   95
DSSP  LLLHHhHHHHH--LLLEelleEEEEEEeeellllllllllLHHHHHH-LLEE--------


DSSP  lllllllllhhhhhhhhhhlleeEELL--------lllLHHHHHHHHllLLLLE-EELHh
Query xpdltgaqwrpllerigeqgwhvELHR--------qvaDIPVLVRALqpYGLDI-VIDHf  159
ident                                              |          | | 
Sbjct -----------------------IAGFhepvfaphdkaTNTQAMIAT-iASGNVhIISH-  130
DSSP  -----------------------EEELlllllllllhhHHHHHHHHH-hHLLLLlEELL-


DSSP  HLLLllllllllLHHHHLLL---llLLLEEEEEELHHhllllhhhhhhHHHHHHHHHHHH
Query GRPDarrglgqpGFAELLTL---sgRGKVWVKVSGIYrlqgspeenlaFARQALCALEAH  216
ident                             |                     |    |    
Sbjct PGNP-------kYEIDVKAVaeaaaKHQVALEINNSS-----------NCREVAAAVRDA  172
DSSP  LLLL-------lLLLLHHHHhhhhhHHLLEEEEELLL-----------LHHHHHHHHHHH


DSSP  LLhhHEEEELLLLLllllllllhhhHHHHHHHHLL----LHHHhhHHHLH--HHHHHLL-
Query YGaeRLXWGSDWPHtqhesevsfgsAVEQFEALGC----SAQLrqALLLD--TARALFG-  269
ident  |      |||                |                  |             
Sbjct GG--WVALGSDSHT------aftmgEFEECLKILDavdfPPER--ILNVSprRLLNFLEs  222
DSSP  LL--LEEEELLLLL------hhhllLLHHHHHHHHhlllLHHH--LHHHLhhHHHHHHHh


DSSP  --------LLLL
Query --------FELE  273
ident         |   
Sbjct rgmapiaeFADL  234
DSSP  llllllhhHLLL


No 55: Query=2ffiA Sbjct=3f2bA Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ---------------------------------------------lLLLLEELLLLLLLH
Query ---------------------------------------------lHLTAIDSHAHVFSR   15
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLLL


DSSP  hhhhhlllllLLLLLLLHHHHHHHHHHLLLLEELLLLLHhhlllLHHHHHHHHHLL---l
Query glnlasqrryAPNYDAPLGDYLGQLRAHGFSHGVLVQPSflgtdNRYLLSALQTVP---g   72
ident                        |    |                     |         
Sbjct ----------QMDAVTSVTKLIEQAKKWGHPAIAVTDHA----vVQSFPEAYSAAKkhgm  166
DSSP  ----------LLLLLLLHHHHHHHHHHLLLLLEEELLLL----lLLLHHHHHHHHHhhll


DSSP  LLLLLLlllllllhhhhhhhhllllleeELLLllllLLLL--------------------
Query QLRGVVxlerdveqatlaexarlgvrgvRLNLxgqdXPDL--------------------  112
ident                               |       |                     
Sbjct KVIYGL----------------------EANI----VDDPfhvtllaqnetglknlfklv  200
DSSP  LEEEEE----------------------EEEE----ELLLeeeeeeellhhhhhhhhhhh


DSSP  -----------llllLHHHHHHHhhHLLEeeellllllhhhhhhhhllllllEEELH---
Query -----------tgaqWRPLLERIgeQGWHvelhrqvadipvlvralqpygldIVIDH---  158
ident                   |       |                                 
Sbjct slshiqyfhrvpripRSVLVKHR--DGLL-----------------------VGSGCdkg  235
DSSP  hhhhllllllllleeHHHHHHLL--LLEE-----------------------EELLLlll


DSSP  hHLLLlllllllllHHHHllllllllEEEEEELHH-HLLL---LHHHHHHHHHHHHHHHH
Query fGRPDarrglgqpgFAELltlsgrgkVWVKVSGIY-RLQG---SPEENLAFARQALCALE  214
ident                               |              |      |      |
Sbjct eLFDN---------VEDI----arfyDFLEVHPPDvYKPLyvkDEEMIKNIIRSIVALGE  282
DSSP  lLLLL---------LLLL----hhhlLLEEELLHHhHLLLlllLHHHHHHHHHHHHHHHH


DSSP  HHLLhhHEEEELLLL-----------------------llllLLLLLHH---hhhHHHHh
Query AHYGaeRLXWGSDWP-----------------------htqhESEVSFG---savEQFEa  248
ident                                              | |         |  
Sbjct KLDI--PVVATGNVHylnpedkiyrkilihsqgganplnrheLPDVYFRttnemlDCFS-  339
DSSP  HLLL--LEEELLLLLlllhhhhhhhhhhhhllhhhlllllllLLLLLLLlhhhhhHHHH-


DSSP  hLLLHHHHHHHHLHHHHHHLLL--------------------------------------
Query lGCSAQLRQALLLDTARALFGF--------------------------------------  270
ident              |                                              
Sbjct -FLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdp  398
DSSP  -HHHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct lpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteit  458
DSSP  llhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct evnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkg  518
DSSP  llllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct dkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlel  578
DSSP  llllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct rgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfh  638
DSSP  lhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct sihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimc  698
DSSP  hhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct nvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlse  758
DSSP  llllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct vigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkik  818
DSSP  llllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct ymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieei  878
DSSP  llllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  270
ident                                                             
Sbjct nakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipg  938
DSSP  hhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlll


DSSP  -----------------------------------------------------lll
Query -----------------------------------------------------ele  273
ident                                                         
Sbjct lgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  llhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=2ffiA Sbjct=1bksA Z-score=7.1

back to top
DSSP  ------------llllleeLLLLL-LLHHHHhhlllllllllllLHHHHHHHHHHLllle
Query ------------lhltaidSHAHV-FSRGLNlasqrryapnydaPLGDYLGQLRAHgfsh   47
ident                             |                |        |     
Sbjct meryenlfaqlndrregafVPFVTlGDPGIE------------qSLKIIDTLIDAG--ad   46
DSSP  lhhhhhhhhhhhhlllleeEEEEElLLLLHH------------hHHHHHHHHHHLL--ll


DSSP  ELLLLLHH-------------------hllLLHHHHHHHHHLL---LLLLLLL-LLLL--
Query GVLVQPSF-------------------lgtDNRYLLSALQTVP---GQLRGVV-XLER--   82
ident        |                              |                     
Sbjct ALELGVPFsdpladgptiqnanlrafaagvTPAQCFEMLALIRekhPTIPIGLlMYANlv  106
DSSP  LEEEELLLlllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHhhlLLLLEEEeELHHhh


DSSP  --lLLHHHHHHHHLLLLLEEELLLllllllLLLLllLHHHHHHHHHHLLEEEELLLLLL-
Query --dVEQATLAEXARLGVRGVRLNLxgqdxpDLTGaqWRPLLERIGEQGWHVELHRQVAD-  139
ident       |  |     ||  |                  |                     
Sbjct fnnGIDAFYARCEQVGVDSVLVAD-----vPVEE--SAPFRQAALRHNIAPIFICPPNAd  159
DSSP  hllLHHHHHHHHHHHLLLEEEELL-----lLHHH--LHHHHHHHHHLLLEEEEEELLLLl


DSSP  --hHHHHHHHlllllLEEELHHhlllllllllLLLHHHHLL--LLLLlLEEEEEELHHhl
Query --iPVLVRALqpyglDIVIDHFgrpdarrglgQPGFAELLT--LSGRgKVWVKVSGIYrl  195
ident       |                               |                     
Sbjct ddlLRQVASY----gRGYTYLL----------ALPLHHLIEklKEYH-AAPALQGFGI--  202
DSSP  hhhHHHHHHH----lLLLEEEL----------LLLHHHHHHhhHHHL-LLLEEELLLL--


DSSP  lllhhhhhhhhHHHHHHHhhhllhhhEEEELLLLLLLL-------------llllLHHHH
Query qgspeenlafaRQALCALeahygaerLXWGSDWPHTQH-------------esevSFGSA  242
ident              |  |             |                             
Sbjct -----sspeqvSAAVRAG-------aAGAISGSAIVKIieknlaspkqmlaelrsFVSAM  250
DSSP  -----llhhhhHHHHHHL-------lLEEEELLHHHHHhhhllllhhhhhhhhhhHHHHH


DSSP  HHHHHhhlllhhhhhhhhlhhhhhhllllll
Query VEQFEalgcsaqlrqallldtaralfgfele  273
ident                                
Sbjct KAASR--------------------------  255
DSSP  HHLLL--------------------------


No 57: Query=2ffiA Sbjct=2yb1A Z-score=6.9

back to top
DSSP  llllLEELLLLLLLhhhhhhlllllllllLLLHHHHHHHHHHLLLLEELLLLLHhhlllL
Query lhltAIDSHAHVFSrglnlasqrryapnyDAPLGDYLGQLRAHGFSHGVLVQPSflgtdN   60
ident      || | |                              |       |          
Sbjct ---aNIDLHFHSRT------------sdgALTPTEVIDRAAARAPALLALTDHD----cT   41
DSSP  ---lLEELLLLLLL------------lllLLLHHHHHHHHHLLLLLEEEELLLL----lL


DSSP  HHHHHHHHHLL---LLLLLLLlllllllhhhhhhhhllllleeELLL-llllllllllll
Query RYLLSALQTVP---GQLRGVVxlerdveqatlaexarlgvrgvRLNL-xgqdxpdltgaq  116
ident   |  |              |                                       
Sbjct GGLAEAAAAAArrgIPFLNGV----------------------EVSVswgrhtvhivglg   79
DSSP  LLHHHHHHHHHhllLLEEEEE----------------------EEEEeelleeeeeeeel


DSSP  lhhhHHHH----------------------------------------------------
Query wrplLERI----------------------------------------------------  124
ident                                                             
Sbjct idpaEPALaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarh  139
DSSP  llllLHHHhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhh


DSSP  -------------hhhlleeeellllllhhhHHHHH----lllllLEEELHHHLLLllll
Query -------------geqgwhvelhrqvadipvLVRAL----qpyglDIVIDHFGRPDarrg  167
ident                                                || | || |    
Sbjct lvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDAvgwivgaggMAVIAHPGRYD----  195
DSSP  hhhllllllhhhhhhhlllllllllllllllLHHHHhhhhhhlllEEEELLHHHLL----


DSSP  lLLLLHHHHLLLLLL-LLEEEEE-ELHHhllllhhhHHHHHHHHHHHHHHHLLhhHEEEE
Query lGQPGFAELLTLSGR-GKVWVKV-SGIYrlqgspeeNLAFARQALCALEAHYGaeRLXWG  225
ident  |      |       |     | ||           |            |        |
Sbjct mGRTLIERLILDFQAaGGQGIEVaSGSH--------SLDDMHKFALHADRHGL--YASSG  245
DSSP  lLHHHHHHHHHHHHHlLLLEEEEeELLL--------LHHHHHHHHHHHHHHLL--EEEEE


DSSP  LLLLllllllLLLHhhhhhhHHHHLLlhhhhhhhhlHHHHHHLLL------lll
Query SDWPhtqhesEVSFgsaveqFEALGCsaqlrqalllDTARALFGF------ele  273
ident ||                                     | |            
Sbjct SDFH----apGEDV---ghtEDLPPI--------crPIWRELEARilrpadaen  284
DSSP  LLLL----llLLLL---lllLLLLLL--------llLHHHHLHHHlllllhhhl


No 58: Query=2ffiA Sbjct=3e38A Z-score=6.3

back to top
DSSP  --------------lllLLEELLLLLLlhhhhhhlllllllllLLLHHHHHHHHHHLLLL
Query --------------lhlTAIDSHAHVFsrglnlasqrryapnyDAPLGDYLGQLRAHGFS   46
ident                     | | |                                |  
Sbjct aqrrneiqvpdldgyttLKCDFHXHSV------------fsdgLVWPTVRVDEAYRDGLD   48
DSSP  llllllllllllllleeEEEELLLLLL------------llllLLLHHHHHHHHHHLLLL


DSSP  EELLLLL-HHHL-------LLLHHHHHHHHHLL---LLLLLLLlllllllhhhhhhhhll
Query HGVLVQP-SFLG-------TDNRYLLSALQTVP---GQLRGVVxlerdveqatlaexarl   95
ident    |                 ||               |                     
Sbjct AISLTEHiEYRPhkqdvvsDHNRSFDLCREQAEklgILLIKGS-----------------   91
DSSP  EELLEEElLLLLlllllllLLLHHHHHHHHHHHhhlLEELLEE-----------------


DSSP  llleeELLLL---------------llllLLLLllllhhhHHHHHHHLLEeeellllllh
Query gvrgvRLNLX---------------gqdxPDLTgaqwrplLERIGEQGWHvelhrqvadi  140
ident                               |               ||            
Sbjct -----EITRAxapghfnaiflsdsnpleqKDYK-----daFREAKKQGAF----------  131
DSSP  -----EEELLlllleeeeelllllhhhllLLHH-----hhHHHHHHLLLE----------


DSSP  hhhhhhhllllllEEELHhHLLL--LLLLLlllLHHHhllllLLLL--EEEE-EELHHhl
Query pvlvralqpygldIVIDHfGRPD--ARRGLgqpGFAElltlsGRGK--VWVK-VSGIYrl  195
ident                  |    |                                |    
Sbjct -------------XFWNH-PGWDsqQPDTT---KWWPehtalYQEGcxHGIEvANGHL--  172
DSSP  -------------EEELL-LLLLllLLLLL---LLLHhhhhhHHLLllLEEEeEELLE--


DSSP  lllhhhhhhhHHHHHHHHHHHLLHhHEEEELLLLLllllLLLL----hHHHHhhhhhhll
Query qgspeenlafARQALCALEAHYGAeRLXWGSDWPHtqheSEVS----fGSAVeqfealgc  251
ident                               ||                            
Sbjct ----------YXPEAIQWCLDKNL-TXIGTSDIHQ--piQTDYdfekgEHRT--------  211
DSSP  ----------ELLHHHHHHHHHLL-EEEEELLLLL--lhHHHLlhhhlLLLL--------


DSSP  lhhhhhhHHLHhhhhhlLLLL---------------------------------------
Query saqlrqaLLLDtaralfGFEL---------------------------------------  272
ident                                                             
Sbjct ------xTFVF--akerSLQGirealdnrrtaayfhelligredllrpffekcvkieevs  263
DSSP  ------eEEEE--elllLHHHhhhhhhllleeeeelleeellhhhhhhhhhhheeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  272
ident                                                             
Sbjct rneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnf  323
DSSP  eelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleeee


DSSP  ------------------l
Query ------------------e  273
ident                    
Sbjct evtnfivapdkglkytisl  342
DSSP  eeeeeeeelleeeeeeeel


No 59: Query=2ffiA Sbjct=2anuA Z-score=6.0

back to top
DSSP  lllLLEELLLLLLLhhhhhhlllllllllLLLHHHHHHHHHHLLLLEELLLLLH------
Query lhlTAIDSHAHVFSrglnlasqrryapnyDAPLGDYLGQLRAHGFSHGVLVQPS------   54
ident       | | |                    |||        ||                
Sbjct tewLLCDFHVHTNX------------sdgHLPLGEVVDLFGKHGVDVVSITDHIvdrrtl   48
DSSP  leeEEEEEEELLLL------------lllLLLHHHHHHHHHHLLLLEEEEEEEEelhhhh


DSSP  -----------HHLL--LLHHHHHHHHHLL-------lLLLLLLlllllllhhhhhhhhl
Query -----------FLGT--DNRYLLSALQTVP-------gQLRGVVxlerdveqatlaexar   94
ident                     ||                 |   |                
Sbjct eqrkrngeplgAITEdkFQDYLKRLWREQKraweeygxILIPGV----------------   92
DSSP  hhhhhllllllLLLLllHHHHHHHHHHHHHhhhhhhllEEEEEE----------------


DSSP  lllleeELLLLLL---------llllllllllhHHHHHHHHHLLEEeellllllhhhhhh
Query lgvrgvRLNLXGQ---------dxpdltgaqwrPLLERIGEQGWHVelhrqvadipvlvr  145
ident                                     |   ||   |              
Sbjct ------EITNNTDlyhivavdvkeyvdpslpveEIVEKLKEQNALV--------------  132
DSSP  ------EEEELLLleeeeeelllllllllllhhHHHHHHHHLLLEE--------------


DSSP  hhlllllleEELHhHLLLLllllllllHHHHlLLLLLLLEEEE-EELHHhllllhhhhhh
Query alqpygldiVIDHfGRPDArrglgqpgFAELlTLSGRGKVWVK-VSGIYrlqgspeenla  204
ident             |               |                               
Sbjct ---------IAAH-PDRKK---lswylWANX-ERFKDTFDAWEiANRDD-----------  167
DSSP  ---------EELL-LLLLL---lllhhHHLL-LLLLLLLLEEEeEELLE-----------


DSSP  hhhhhHHHHHHHLLhhHEEEELLLLLllllllLLHHhhhhhhhhhlllhhhhhhhHLHHh
Query farqaLCALEAHYGaeRLXWGSDWPHtqheseVSFGsaveqfealgcsaqlrqalLLDTa  264
ident                 |    ||                                 |   
Sbjct ----lFNSVGVKKY--RYVANSDFHE-----lWHVY----------------swkTLVK-  199
DSSP  ----eLHHHHHLLL--LEEEELLLLL-----hHHHL----------------leeEEEE-


DSSP  hhhlLLLL-----------------l
Query ralfGFEL-----------------e  273
ident       |                   
Sbjct -sekNIEAikeairkntdvaiylxrk  224
DSSP  -ellLHHHhhhhhhhllleeeeelll