Results: dupa

Query: 2dvtA

MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2dvt-A 60.2  0.0  325   325  100 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   2:  4qrn-A 42.5  2.0  313   352   33 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   3:  4ofc-A 35.8  2.1  295   335   22 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
   4:  4hk5-D 34.4  2.8  304   380   24 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   5:  4dzi-C 27.8  2.9  294   388   21 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
   6:  2gwg-A 27.7  2.5  261   329   21 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   7:  3cjp-A 22.0  2.5  233   262   20 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   8:  3irs-A 21.9  2.8  246   281   17 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   9:  4dlf-A 21.8  2.7  241   287   17 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  10:  2ffi-A 20.0  2.7  223   273   20 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  11:  4b3z-D 17.6  3.2  250   477   11 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  12:  4mup-B 17.5  3.1  230   286   17 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  13:  1gkp-A 17.4  3.2  253   458   15 PDB  MOLECULE: HYDANTOINASE;                                              
  14:  2qpx-A 16.5  3.7  229   376   14 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  15:  1bf6-A 15.8  3.1  226   291   13 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  16:  1itq-A 15.8  3.1  227   369   13 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  17:  2y1h-B 15.7  3.4  216   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  18:  2vun-A 15.6  3.1  221   385   13 PDB  MOLECULE: ENAMIDASE;                                                 
  19:  4cqb-A 15.5  4.2  234   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  20:  1yrr-B 15.5  3.0  211   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  21:  3gri-A 15.4  3.2  232   422   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  1onx-A 15.3  2.9  224   390   11 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  23:  3k2g-B 15.3  3.2  229   358   14 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  24:  3pnu-A 15.1  3.2  221   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  2ob3-A 14.9  3.4  220   329   15 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  26:  2paj-A 14.7  3.4  217   421   13 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  27:  2vc5-A 14.4  3.2  217   314   16 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  28:  3e74-A 14.4  3.3  227   429   13 PDB  MOLECULE: ALLANTOINASE;                                              
  29:  3ls9-A 14.2  3.7  223   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  30:  3giq-A 14.2  3.3  226   475    9 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  31:  3nqb-A 14.2  3.3  211   587   10 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  32:  1j6p-A 14.0  3.4  216   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  33:  1k6w-A 13.9  4.2  232   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  34:  3gg7-A 13.8  3.7  209   243   12 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  35:  3mtw-A 13.5  3.5  209   404   10 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  36:  1a4m-A 13.5  3.8  225   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  37:  2ogj-A 13.4  3.5  222   379   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  38:  2imr-A 13.3  3.6  227   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  39:  2oof-A 13.3  4.0  219   403   11 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  40:  1j5s-A 12.9  4.0  233   451   13 PDB  MOLECULE: URONATE ISOMERASE;                                         
  41:  3mkv-A 12.9  3.6  208   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  42:  2uz9-A 12.8  3.7  217   444   14 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  43:  3icj-A 12.7  3.3  205   468   12 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  44:  1a5k-C 12.6  3.0  206   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  4c5y-A 12.5  3.5  204   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  46:  3iac-A 12.3  3.9  228   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  47:  4rdv-B 12.1  3.8  222   451   10 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  48:  3ooq-A 11.5  3.8  198   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  3qy6-A 11.0  3.5  190   247    9 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1v77-A  9.3  3.4  162   202    6 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A  9.1  3.8  221   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3dcp-A  9.1  4.6  187   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3au2-A  8.6  3.6  175   575   13 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  1m65-A  8.2  3.6  170   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  7.8  3.5  161   994    7 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2anu-A  6.0  3.3  146   224    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  57:  1bks-A  5.6  3.5  152   255    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  58:  2yb1-A  5.3  4.0  149   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  4.6  3.5  140   342   14 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2dvtA Sbjct=2dvtA Z-score=60.2

back to top
DSSP  LLLEEEEEEEELLHHHHHHHLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLLEEEEEEEEL
Query MQGKVALEEHFAIPETLQDSAGFVPGDYWKELQHRLLDIQDTRLKLMDAHGIETMILSLN   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MQGKVALEEHFAIPETLQDSAGFVPGDYWKELQHRLLDIQDTRLKLMDAHGIETMILSLN   60
DSSP  LLLEEEEEEEELLHHHHHHHLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLLEEEEEEEEL


DSSP  LLHHHHLLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLHHHHHHHHHHHHHLL
Query APAVQAIPDRRKAIEIARRANDVLAEECAKRPDRFLAFAALPLQDPDAATEELQRCVNDL  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct APAVQAIPDRRKAIEIARRANDVLAEECAKRPDRFLAFAALPLQDPDAATEELQRCVNDL  120
DSSP  LLHHHHLLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLLLHHHHHHHHHHHHHLL


DSSP  LLLEEEEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEELLLLLHHHLHHHLLLH
Query GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLPQDSRIYDGHP  180
DSSP  LLLEEEEELLLLLLLLLLLLLLLLHHHHHHHHHHHHHLLLEEEELLLLLHHHLHHHLLLH


DSSP  HHLHHHLHHHHHHHHHHHHHHHLLHHHHLLLLLEEELHHHLLHHHHHHHHHHLLLLLLLL
Query WLLGPTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLP  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct WLLGPTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLP  240
DSSP  HHLHHHLHHHHHHHHHHHHHHHLLHHHHLLLLLEEELHHHLLHHHHHHHHHHLLLLLLLL


DSSP  LLLLLLLLHHHHHHHHEEEELLLLLLHHHHHHHHLLLLHHHEELLLLLLLLLHHHHHHHH
Query PRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSTDWPFENIDHASDWF  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PRYPAKRRFMDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSTDWPFENIDHASDWF  300
DSSP  LLLLLLLLHHHHHHHHEEEELLLLLLHHHHHHHHLLLLHHHEELLLLLLLLLHHHHHHHH


DSSP  HHLLLLHHHHHHHHLHHHHHHLLLL
Query NATSIAEADRVKIGRTNARRLFKLD  325
ident |||||||||||||||||||||||||
Sbjct NATSIAEADRVKIGRTNARRLFKLD  325
DSSP  HHLLLLHHHHHHHHLHHHHHHLLLL


No 2: Query=2dvtA Sbjct=4qrnA Z-score=42.5

back to top
DSSP  ------------LLLEEEEEEEELLHHHHH----------------hHLLLL--LLLH-H
Query ------------MQGKVALEEHFAIPETLQ----------------dSAGFV--PGDY-W   29
ident                  | || ||  |                      ||         
Sbjct smtqdlktggeqGYLRIATEEAFATREIIDvylrmirdgtadkgmvsLWGFYaqSPSErA   60
DSSP  llllllllllllLLLLEEEEEEELLHHHHHhhhhhhhhllllhhhhhHHHHHhhLLLHhH


DSSP  HHHHHHHHLLLLHHHHHHHHLLEEEEEEEELLLHHHHLLLHHHHHHHHHHHHHHHHHHHH
Query KELQHRLLDIQDTRLKLMDAHGIETMILSLNAPAVQAIPDRRKAIEIARRANDVLAEECA   89
ident      ||||    |   ||| ||   || |  | ||   |   |   | |||| ||  | 
Sbjct TQILERLLDLGERRIADMDATGIDKAILALTSPGVQPLHDLDEARTLATRANDTLADACQ  120
DSSP  HHHHHHHHLLLHHHHHHHHHLLLLEEEEEELLLLLLLLLLHHHHHHHHHHHHHHHHHHHH


DSSP  HLLLLEEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEELLLLllllllLLLLLLHHHHH
Query KRPDRFLAFAALPLQDPDAATEELQRCVNDLGFVGALVNGFSQegdgqtPLYYDLPQYRP  149
ident | ||||        |||     |  |    ||| |   |   |        | |     |
Sbjct KYPDRFIGMGTVAPQDPEWSAREIHRGARELGFKGIQINSHTQ------GRYLDEEFFDP  174
DSSP  HLLLLEEELLLLLLLLHHHHHHHHHHHHHLLLLLLEEELLLLL------LLLLLLHHHHH


DSSP  HHHHHHHHLLLEEEELLLLLHHHLHHHLLLHhHLHHHLHHHHHHHHHHHHHHHLLHHHHL
Query FWGEVEKLDVPFYLHPRNPLPQDSRIYDGHPwLLGPTWAFAQETAVHALRLMASGLFDEH  209
ident         | | | ||                | |    |  ||  | |||   | ||  
Sbjct IFRALVEVDQPLYIHPATSPDSMIDPMLEAG-LDGAIFGFGVETGMHLLRLITIGIFDKY  233
DSSP  HHHHHHHHLLLEEELLLLLLLLLLHHHHHHL-LLLLLLHHHHHHHHHHHHHHHHLHHHHL


DSSP  LLLLEEELHHHLLHHHHHHHHHHL--lllLLLL-LLLL-LLLLHHHHHHHHEEEELLLLL
Query PRLNIILGHMGEGLPYMMWRIDHR--nawVKLP-PRYP-AKRRFMDYFNENFHITTSGNF  265
ident | | |  ||||| |||   | |             |    |     |   |   | ||  
Sbjct PSLQIMVGHMGEALPYWLYRLDYMhqagvRSQRyERMKpLKKTIEGYLKSNVLVTNSGVA  293
DSSP  LLLLEEELHHHHLHHHHHHHHHHHhhhhhHLLLlLLLLlLLLLHHHHHHHLEEEELLLLL


DSSP  LHHHHHHHHLLLLHHHEELLLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHLLLl
Query RTQTLIDAILEIGADRILFSTDWPFENIDHASDWFNATSIAEADRVKIGRTNARRLFKLd  325
ident             | ||     | |            |         |   |||   ||| 
Sbjct WEPAIKFCQQVMGEDRVMYAMDYPYQYVADEVRAMDAMDMSAQTKKKFFQTNAEKWFKL-  352
DSSP  LHHHHHHHHHHHLHHHEELLLLLLLLLLHHHHHHHHLLLLLHHHHHHHHLHHHHHHLLL-


No 3: Query=2dvtA Sbjct=4ofcA Z-score=35.8

back to top
DSSP  llLEEEEEEEELLH-------------HHHH-------------hhLLLLlllhhhhHHH
Query mqGKVALEEHFAIP-------------ETLQ-------------dsAGFVpgdywkeLQH   34
ident    |     |                                       |          
Sbjct --MKIDIHSHILPKewpdlkkrfgyggWVQLqhhskgeakllkdgkVFRV-------VRE   51
DSSP  --LLEEEEEELLLLllllhhhhhllllLEEEeeeelleeeeeelleEEEE-------EEH


DSSP  HHHLLlLHHHHHHHHLLEEEEEEEELLLHHHHLLLHHHHHHHHHHHHHHHHHHHHHLLLL
Query RLLDIqDTRLKLMDAHGIETMILSLNAPAVQAIPDRRKAIEIARRANDVLAEECAKRPDR   94
ident    |    |   ||  |     ||                      |  ||      | |
Sbjct NCWDP-EVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRR  110
DSSP  HHLLH-HHHHHHHHHHLLLEEEEELLHHHHLLLLLHHHHHHHHHHHHHHHHHHHHHLLLL


DSSP  EEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEELLLLllllllLLLLLLHHHHHHHHHH
Query FLAFAALPLQDPDAATEELQRCVNDLGFVGALVNGFSQegdgqtPLYYDLPQYRPFWGEV  154
ident |     || | |  |  |  |||  ||| |                        |     
Sbjct FVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVN------EWDLNAQELFPVYAAA  164
DSSP  EEEEELLLLLLHHHHHHHHHHHHHLLLLLEEEEELEEL------LEELLLHHHHHHHHHH


DSSP  HHHLLLEEEELLLLLHhhLHHHLlLHHHLHhHLHHHHHHHHHHHHHHHLLHHHHLLLLLE
Query EKLDVPFYLHPRNPLPqdSRIYDgHPWLLGpTWAFAQETAVHALRLMASGLFDEHPRLNI  214
ident | |      ||               ||         ||          | |   | |  
Sbjct ERLKCSLFVHPWDMQM--DGRMA-KYWLPW-LVGMPAETTIAICSMIMGGVFEKFPKLKV  220
DSSP  HHHLLEEEEELLLLLL--LHHHH-LLLHHH-HLHHHHHHHHHHHHHHLLLHHHHLLLLLE


DSSP  EELHHHLLHHHHHHHHHHLlllllLLLL---LLLLLLHHHHhHHHEEEELLlLLLHHHHH
Query ILGHMGEGLPYMMWRIDHRnawvkLPPR---YPAKRRFMDYfNENFHITTSgNFRTQTLI  271
ident    | |   |    || |        |             |    |            | 
Sbjct CFAHGGGAFPFTVGRISHG---fsMRPDlcaQDNPMNPKKY-LGSFYTDAL-VHDPLSLK  275
DSSP  EELHHHLLHHHHHHHHHHH---hhHLHHhhlLLLLLLHHHH-LLLLEEELL-LLLHHHHH


DSSP  HHHLLLLHHHEELLLLLLL--LLHHhHHHHHHHL-LLLHHHHHHHHLHHHHHHLLLL---
Query DAILEIGADRILFSTDWPF--ENIDhASDWFNAT-SIAEADRVKIGRTNARRLFKLD---  325
ident      || |     || ||                   |    |    ||     |    
Sbjct LLTDVIGKDKVILGTDYPFplGELE-PGKLIESMeEFDEETKNKLKAGNALAFLGLErkq  334
DSSP  HHHHHHLLLLEELLLLLLLllLLLL-LLHHHHHLlLLLHHHHHHHHLHHHHHHHLLLhhh


DSSP  -
Query -  325
ident  
Sbjct f  335
DSSP  l


No 4: Query=2dvtA Sbjct=4hk5D Z-score=34.4

back to top
DSSP  lLLEEEEEEEELLHHHHH--------HHLL--llLLLHH---------------------
Query mQGKVALEEHFAIPETLQ--------DSAG--fvPGDYW---------------------   29
ident     |    |   |                                              
Sbjct tPVVVDIHTHMYPPSYIAmlekrqtiPLVRtfpqADEPRlillsselaaldaaladpaak   60
DSSP  lLLLEEEEEEELLHHHHHhhhlllllLEEEeellEEEEEeellhhhhhhhhhhhhlllll


DSSP  ---hHHHHHHHLLlLHHHHHHHHLLEEEEEEEELLLHHHHLlLHHHHHHHHHHHHHHHHH
Query ---kELQHRLLDIqDTRLKLMDAHGIETMILSLNAPAVQAIpDRRKAIEIARRANDVLAE   86
ident      |              ||  ||     ||  |          |  ||   |     
Sbjct lpgrPLSTHFASL-AQKMHFMDTNGIRVSVISLANPWFDFL-APDEAPGIADAVNAEFSD  118
DSSP  llleELLHHHLLH-HHHHHHHHHLLLLEEEEEELLLLLLLL-LLLLHHHHHHHHHHHHHH


DSSP  HHHHLLLLEEEEELLLLLL-HHHHHHHHHHHHHLLLLLEEEEELLLlllllllLLLLLLH
Query ECAKRPDRFLAFAALPLQD-PDAATEELQRCVNDLGFVGALVNGFSqegdgqtPLYYDLP  145
ident  ||    |   ||||||    ||      |  |     |                  | |
Sbjct MCAQHVGRLFFFAALPLSApVDAVKASIERVKNLKYCRGIILGTSG------lGKGLDDP  172
DSSP  HHHLLLLLEEEEEELLLLLlHHHHHHHHHHHHLLLLEEEEEELLLL------lLLLLLLH


DSSP  HHHHHHHHHHHHLLLEEEELLLLLhhHLHHHLL-----LHHHLhHHLHHHHHHHHHHHHH
Query QYRPFWGEVEKLDVPFYLHPRNPLpqDSRIYDG-----HPWLLgPTWAFAQETAVHALRL  200
ident    |    |        |||   |      |          |      |  ||     | 
Sbjct HLLPVFEAVADAKLLVFLHPHYGL--PNEVYGPrseeyGHVLP-LALGFPMETTIAVARM  229
DSSP  HHHHHHHHHHHLLLEEEELLLLLL--LHHHHLLlhhhlLLHHH-HHLHHHHHHHHHHHHH


DSSP  HHLLHHHHLLLLLEEELHHHLLHHHHHHHHHHL--LLLLL---LLLLlllLLLHHHHHHH
Query MASGLFDEHPRLNIILGHMGEGLPYMMWRIDHR--NAWVK---LPPRypaKRRFMDYFNE  255
ident    | ||    |   | | |  ||    ||                     |       |
Sbjct YMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCivHDGHLvktGKVP-kdRRTIWTVLKE  288
DSSP  HHLLHHHHLLLLLEEEHHHHLLHHHHHHHHHHHhhLLHHHhhlLLLL-llLLLHHHHHHH


DSSP  HEEEELLlLLLHHHHHHHHLLLLHHHEELLLLLLLLL--------hHHHHHHHHH--LLL
Query NFHITTSgNFRTQTLIDAILEIGADRILFSTDWPFEN--------iDHASDWFNA--TSI  305
ident               |  ||   ||||  | || ||              |          
Sbjct QIYLDAV-IYSEVGLQAAIASSGADRLMFGTDHPFFPpieedvqgpWDSSRLNAQavIKA  347
DSSP  LEEEELL-LLLHHHHHHHHHHHLHHHEELLLLLLLLLlllllllllLHHHHHHHHhhHHH


DSSP  L---HHHHHHHHLHHHHHHLLLL----------
Query A---EADRVKIGRTNARRLFKLD----------  325
ident       |       || |   |           
Sbjct VgegSSDAAAVMGLNAVRVLSLKaelehhhhhh  380
DSSP  HlllLHHHHHHHLHHHHHHLLLHhhhhhhhhhl


No 5: Query=2dvtA Sbjct=4dziC Z-score=27.8

back to top
DSSP  --lLLEEEEEEEELLHH--------------------------------hhHHHLLllll
Query --mQGKVALEEHFAIPE--------------------------------tlQDSAGfvpg   26
ident            |   |                                            
Sbjct alnYRVIDVDNHYYEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnHFIPN---p   57
DSSP  lllLLEEEEEEELLLLLllllllllhhhlllleeeeelllleeeeelleelLLLLL---l


DSSP  lHHHHH------------------------------hHHHHLLLLhHHHHHHHLLEEEEE
Query dYWKEL------------------------------qHRLLDIQDtRLKLMDAHGIETMI   56
ident                                               |   ||   |||  
Sbjct tFDPIIvpgcldllfrgeipdgvdpaslmkverladhPEYQNRDA-RIAVMDEQDIETAF  116
DSSP  lLLLEElllllhhhhhllllllllhhhllleelhhhlHHHLLHHH-HHHHHHHHLEEEEE


DSSP  EEEL--LLHHHHLL-LHHHHHHHHHHHHHHHHHHHH--HLLLLEEEEELLLLLLHHHHHH
Query LSLN--APAVQAIP-DRRKAIEIARRANDVLAEECA--KRPDRFLAFAALPLQDPDAATE  111
ident            |   |           |  | |         |  |     | ||  | |
Sbjct MLPTfgCGVEEALKhDIEATMASVHAFNLWLDEDWGfdRPDHRIIAAPIVSLADPTRAVE  176
DSSP  EELLhhHHHHHHLLlLHHHHHHHHHHHHHHHHHHLLllLLLLLEEELLLLLLLLHHHHHH


DSSP  HHHHHHHlLLLLEEEEELL-LLLLLllLLLLLLLHHHHHHHHHHHHHLLLEEEELL-LLL
Query ELQRCVNdLGFVGALVNGF-SQEGDgqTPLYYDLPQYRPFWGEVEKLDVPFYLHPR-NPL  169
ident |        |    ||            |         | |       ||   |      
Sbjct EVDFVLA-RGAKLVLVRPApVPGLV--KPRSLGDRSHDPVWARLAEAGVPVGFHLSdSGY  233
DSSP  HHHHHHH-LLLLLEELLLLlLLLLL--LLLLLLLHHHHHHHHHHHHHLLLEEEELLlLLL


DSSP  HhHLHHHL----LLHHHLhhhlHHHHHHHHHHHHHHHLLHHHHLLLLLEEELH-HHLLHH
Query PqDSRIYD----GHPWLLgptwAFAQETAVHALRLMASGLFDEHPRLNIILGH-MGEGLP  224
ident                                       | |  || |             
Sbjct L-HIAAAWggakDPLDQV---lLDDRAIHDTMASMIVHGVFTRHPKLKAVSIEnGSYFVH  289
DSSP  H-HHHHHLllllLHHHHH---hHLLHHHHHHHHHHHHLLHHHHLLLLLEEEELlLLLHHH


DSSP  HHHHHHHHllllllLLLLLLlLLLHHHHHHHHEEEELllLLLHhHHHHHHLLLLHHHEEL
Query YMMWRIDHrnawvkLPPRYPaKRRFMDYFNENFHITTsgNFRTqTLIDAILEIGADRILF  284
ident     |           | |            |  |          |      || | |||
Sbjct RLIKRLKK---aanTQPQYF-PEDPVEQLRNNVWIAP--YYED-DLPELARVIGVDKILF  342
DSSP  HHHHHHHH---hhhHLHHHL-LLLHHHHHHHHEEELL--LLLL-LHHHHHHHHLHHHLLL


DSSP  LLLLLL-LLHHHHHHhHHHL--LLLHHHHHHHHLHHHHHHLL---ll
Query STDWPF-ENIDHASDwFNAT--SIAEADRVKIGRTNARRLFK---ld  325
ident   |||  |        | |      | |  || | ||  |       
Sbjct GSDWPHgEGLASPVS-FTAElkGFSESDIRKIMRDNALDLLGvqvgs  388
DSSP  LLLLLLlLLLLLHHH-HHHHhlLLLHHHHHHHHLHHHHHHHLlllll


No 6: Query=2dvtA Sbjct=2gwgA Z-score=27.7

back to top
DSSP  llLEEEEEEEEL--lHHHHH-----------hhlllllllhhhhhhhhhhLLLLHHHHHH
Query mqGKVALEEHFA--iPETLQ-----------dsagfvpgdywkelqhrllDIQDTRLKLM   47
ident          |                                         |    ||  
Sbjct --XIIDIHGHYTtapKALEDwrnrqiagikdpsvxpkvselkisddelqaSIIENQLKKX   58
DSSP  --LLEEEEEELLlllHHHHHhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLLHHHHH


DSSP  HHLLEEEEEEEELLlhhhhlLLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEELLLLL---
Query DAHGIETMILSLNApavqaiPDRRKAIEIARRANDVLAEECAKRPDRFLAFAALPLQ---  104
ident    |      |  |       |       |   |          || |   | ||     
Sbjct QERGSDLTVFSPRA------GDFNVSSTWAAICNELCYRVSQLFPDNFIGAAXLPQSpgv  112
DSSP  HHHLLLEEEEELLL------LLHHHHHHHHHHHHHHHHHHHHHLLLLEEEEEELLLLlll


DSSP  LHHHHHHHHHHHHHLLLLLEEEEELLLLlllllLLLLLLLHHHHHHHHHHHHHLLLEEEE
Query DPDAATEELQRCVNDLGFVGALVNGFSQegdgqTPLYYDLPQYRPFWGEVEKLDVPFYLH  164
ident ||     ||  ||   |||    |         |          |       |  |   |
Sbjct DPKTCIPELEKCVKEYGFVAINLNPDPS-gghwTSPPLTDRIWYPIYEKXVELEIPAXIH  171
DSSP  LHHHHHHHHHHHHHLLLLLEEEELLLLL-llllLLLLLLLHHHHHHHHHHHHHLLLEEEL


DSSP  LLLllhhhlhhhlllhhhlhhHLHHHHHHHHHHHHHHHLLHHHHLLLLLEEELHHHLLHH
Query PRNplpqdsriydghpwllgpTWAFAQETAVHALRLMASGLFDEHPRLNIILGHMGEGLP  224
ident                                      |  ||   | |     | |   |
Sbjct VST------------------GAHYLNADTTAFXQCVAGDLFKDFPELKFVIPHGGGAVP  213
DSSP  LLL------------------LLHHHHHHHHHHHHHHHLLHHHHLLLLLEEELHHHLLLH


DSSP  HHHHHHHHlllllllLLLLlllLLHHHHHHHHEEEELLlLLLHHHHHHHHLLLLHHHEEL
Query YMMWRIDHrnawvklPPRYpakRRFMDYFNENFHITTSgNFRTQTLIDAILEIGADRILF  284
ident |   |                     |    |    |               |  |  ||
Sbjct YHWGRFRG----laqEXKK---PLLEDHVLNNIFFDTC-VYHQPGIDLLNTVIPVDNVLF  265
DSSP  HHHHHHHH----hhhHLLL---LLHHHHLLLLEEEELL-LLLHHHHHHHHHHLLHHHEEL


DSSP  LLLLLLLL----------hhHHHHHHHHLL-LLHHHHHHHHLHHHHHH---LLLL-----
Query STDWPFEN----------idHASDWFNATS-IAEADRVKIGRTNARRL---FKLD-----  325
ident                            |           |   ||||             
Sbjct ASEXIGAVrgidprtgfyydDTKRYIEASTiLTPEEKQQIYEGNARRVyprLDAAlkakg  325
DSSP  LLLLLLLLlleelllleellLLHHHHHHLLlLLHHHHHHHHLHHHHHHlhhHHHHhhhhh


DSSP  ----
Query ----  325
ident     
Sbjct kleh  329
DSSP  hhll


No 7: Query=2dvtA Sbjct=3cjpA Z-score=22.0

back to top
DSSP  llLEEEEEEEEllhhhhhhhlllllllhhhhhhhhHHLLlLHHHHHHHHLLEEEEEEEEL
Query mqGKVALEEHFaipetlqdsagfvpgdywkelqhrLLDIqDTRLKLMDAHGIETMILSLN   60
ident          |                          |       | ||  |    ||   
Sbjct --LIIDGHTHV------------------------ILPV-EKHIKIMDEAGVDKTILFST   33
DSSP  --LLEEEEEEL------------------------LLLH-HHHHHHHHHHLLLEEEEELL


DSSP  -------------------LLHH--HHLLlhhHHHHHHHHHHHHHHHHHHHLLLLEEEEE
Query -------------------APAV--QAIPdrrKAIEIARRANDVLAEECAKRPDRFLAFA   99
ident                       |           |   |     |       | |   | 
Sbjct sihpetavnlrdvkkemkkLNDVvnGKTN---SMIDVRRNSIKELTNVIQAYPSRYVGFG   90
DSSP  lllhhhlllhhhhhhhhhhHHHHhlLLLL---LLHHHHHHHHHHHHHHHHHLLLLEEEEE


DSSP  LLLLLLHH-HHHHHHHHHHHLLLLLEEE-EELLllllllllLLLLLLhhHHHHHHHHHH-
Query ALPLQDPD-AATEELQRCVNDLGFVGAL-VNGFsqegdgqtPLYYDLpqYRPFWGEVEK-  156
ident   |                     ||                         |        
Sbjct NVPVGLSEnDTNSYIEENIVNNKLVGIGeLTPA--------SGQIKS--LKPIFKYSMDs  140
DSSP  LLLLLLLHhHHHHHHHHHLLLLLLLEEEeELLL--------LLLHHH--HHHHHHHHHHl


DSSP  HLLLEEEELllllhhhlhhhlllhhhlhhhlhhHHHHH-HHHHHHHhlLHHHHLLLLLEE
Query LDVPFYLHPrnplpqdsriydghpwllgptwafAQETA-VHALRLMasGLFDEHPRLNII  215
ident    |   |                                         |    |    |
Sbjct GSLPIWIHA------------------------FNPLVlQDIKEIA--ELCKAFPKVPVI  174
DSSP  LLLLEEELL------------------------LLLLLhHHHHHHH--HHHHHLLLLLEE


DSSP  ELHHHLLHHHHhhhhhhllllllllllllllllhhHHHH--HHEEEELLLLLLHHHHHHH
Query LGHMGEGLPYMmwridhrnawvklpprypakrrfmDYFN--ENFHITTSGNFRTQTLIDA  273
ident |||||                                     |    ||  | |  |   
Sbjct LGHMGGSNWMT----------------------avELAKeiQNLYLDTSAYFSTFVLKIV  212
DSSP  EHHHHHHHHHH----------------------hhHHHHhlLLEEEELLLLLLHHHHHHH


DSSP  HLLlLHHHEELLLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHLLLl
Query ILEiGADRILFSTDWPFENIDHASDWFNATSIAEADRVKIGRTNARRLFKLd  325
ident | |       | || ||             |            |  ||    
Sbjct INE-LPLKCIFGTDMPFGDLQLSIEAIKKMSNDSYVANAVLGDNISRLLNI-  262
DSSP  HHH-LLLLEELLLLLLLLLHHHHHHHHHHHLLLHHHHHHHHLHHHHHHHLL-


No 8: Query=2dvtA Sbjct=3irsA Z-score=21.9

back to top
DSSP  lLLEEEEEEEE---LLHHHH--HHHLLLLL------llhhhhHHHHhhllLLHHHHHHHH
Query mQGKVALEEHF---AIPETL--QDSAGFVP------gdywkeLQHRlldiQDTRLKLMDA   49
ident                                                          | |
Sbjct -LKIIDFRLRPpamGFLNARiyTRPDIRNRftrqlgfepapsAEEK---sLELMFEEMAA   56
DSSP  -LLLEELLLLLllhHHHHLHhhHLHHHHHHhhhhhlllllhhHHHL---lHHHHHHHHHH


DSSP  LLEEEEEEEELllhHHHLllhhhhhhhhhHHHHHHHHHHHHLLLLEEEEELLLLLLHHHH
Query HGIETMILSLNapaVQAIpdrrkaieiarRANDVLAEECAKRPDRFLAFAALPLQDPDAA  109
ident  |||                           |   |      || |             |
Sbjct AGIEQGVCVGR---NSSV--------lgsVSNADVAAVAKAYPDKFHPVGSIEAATRKEA  105
DSSP  LLLLEEEEELL---EELL--------leeLLHHHHHHHHHHLLLLEEEEEELLLLLHHHH


DSSP  HHHHHHHHhLLLLLEEEEEL-LLLLlllllLLLLLLHHHHHHHHHHHHHLLLEEEE---L
Query TEELQRCVnDLGFVGALVNG-FSQEgdgqtPLYYDLPQYRPFWGEVEKLDVPFYLH---P  165
ident     |    |||                  |   |     |     |    |        
Sbjct MAQMQEIL-DLGIRIVNLEPgVWAT-----PMHVDDRRLYPLYAFCEDNGIPVIMMtggN  159
DSSP  HHHHHHHH-HLLLLLEEELHhHLLL-----LLLLLLHHHHHHHHHHHHLLLLEEEElllL


DSSP  LLLLhhhlhhhlllhhhlhhhlhhhHHHHHhHHHHHhlLHHHHLLLLLEEELHHHLLHHH
Query RNPLpqdsriydghpwllgptwafaQETAVhALRLMasGLFDEHPRLNIILGHMGEGLPY  225
ident   |                                         | |     |       
Sbjct AGPD---------------------ITYTN-PEHID--RVLGDFPDLTVVSSHGNWPWVQ  195
DSSP  LLLL---------------------HHHHL-HHHHH--HHHHHLLLLLEEEEHHHLLLHH


DSSP  HhhhhhhllllllllllllllllhHHHHH--HHEEEELLLLLLHH-HHHHHHLL---LLH
Query MmwridhrnawvklpprypakrrfMDYFN--ENFHITTSGNFRTQ-TLIDAILE---IGA  279
ident                                 |                | |       |
Sbjct E----------------------iIHVAFrrPNLYLSPDMYLYNLpGHADFIQAansFLA  233
DSSP  H----------------------hHHHHHhlLLEEEELHHHHLLLlLHHHHHHHhllHHH


DSSP  HHEELLLLLLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHLLL--l
Query DRILFSTDWPFENIDHASDWFNATSIAEADRVKIGRTNARRLFKL--d  325
ident || || |  |         ||    |      ||   || ||      
Sbjct DRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQagr  281
DSSP  HLLLLLLLLLLLLHHHHHHHHHLLLLLHHHHHHHHLHHHHHHHHHlll


No 9: Query=2dvtA Sbjct=4dlfA Z-score=21.8

back to top
DSSP  llLEEEEEEEELLHH--HHHHHLLlllllHHHHHHHhhHLLLLHHHHHHHHLLEEEEEEE
Query mqGKVALEEHFAIPE--TLQDSAGfvpgdYWKELQHrlLDIQDTRLKLMDAHGIETMILS   58
ident          ||                      |        |    || |      |  
Sbjct -aLRIDSHQHFWRYRaaDYPWIGA-----GMGVLAR--DYLPDALHPLMHAQALGASIAV   52
DSSP  -lLLEEEEELLLLLLhhHLLLLLL-----LLHHHLL--LLLHHHHHHHHHHLLLLEEEEE


DSSP  ELLLhhhhlllhhhhhhhHHHHHHHHHHHHHHlLLLE-EEEELLLLlLHHHHHHHHHHHh
Query LNAPavqaipdrrkaieiARRANDVLAEECAKrPDRF-LAFAALPLqDPDAATEELQRCv  117
ident                    |     | |       |         |       |      
Sbjct QARA--------------GRDETAFLLELACD-EARIaAVVGWEDL-RAPQLAERVAEW-   95
DSSP  LLLL--------------LHHHHHHHHHHHLL-LLLEeEEEELLLL-LLLLHHHHHHLL-


DSSP  HLLLLLEEEEEL-LLLLllllllLLLLLHHHHHHHHHHHHHLLLEEEELllllhhhlhhh
Query NDLGFVGALVNG-FSQEgdgqtpLYYDLPQYRPFWGEVEKLDVPFYLHPrnplpqdsriy  176
ident       |                   |              |                  
Sbjct RGTKLRGFRHQLqDEAD----vrAFVDDADFARGVAWLQANDYVYDVLV-----------  140
DSSP  LLLLEEEEEELHhHLLL----hhHHHHLHHHHHHHHHHHHLLLEEEELL-----------


DSSP  lllhhhlhhhlhHHHHhHHHHHHHHHLlhhhhLLLLLEEELHHHLL-------------h
Query dghpwllgptwaFAQEtAVHALRLMASglfdeHPRLNIILGHMGEG-------------l  223
ident             |            |      |      | | |                
Sbjct ------------FERQ-LPDVQAFCAR-----HDAHWLVLDHAGKPalaefdrddtalar  182
DSSP  ------------LHHH-HHHHHHHHHH-----LLLLLEEEHHHHLLlhhhllllllhhhh


DSSP  HHHHhhhhhllllllllllllllllhHHHHH-HHEEEELLLLL----------------L
Query PYMMwridhrnawvklpprypakrrfMDYFN-ENFHITTSGNF----------------R  266
ident                                        ||                   
Sbjct WRAA---------------------lRELAAlPHVVCKLSGLVteadwrrglrasdlrhI  221
DSSP  HHHH---------------------hHHHHLlLLEEEEELLLLllllllllllhhhhhhH


DSSP  HHHHHHHHLLLLHHHEELLLLLLLL----LHHHHHHHHHHL---LLLHHHHHHHHLHHHH
Query TQTLIDAILEIGADRILFSTDWPFE----NIDHASDWFNAT---SIAEADRVKIGRTNAR  319
ident  | |  |    |  |  |  |||        |                | |       | 
Sbjct EQCLDAALDAFGPQRLMFGSDWPVCllaaSYDEVASLVERWaesRLSAAERSALWGGTAA  281
DSSP  HHHHHHHHHHHLHHHEEELLLLLHHhhllLHHHHHHHHHHHhhhHLLHHHHHHHLLHHHH


DSSP  HHLLLL
Query RLFKLD  325
ident |   | 
Sbjct RCYALP  287
DSSP  HHLLLL


No 10: Query=2dvtA Sbjct=2ffiA Z-score=20.0

back to top
DSSP  -llLEEEEEEEELLH-----hhHHHHLllllllhhhhHHHHhhLLLLhHHHHHHHLLEEE
Query -mqGKVALEEHFAIP-----etLQDSAgfvpgdywkeLQHRllDIQDtRLKLMDAHGIET   54
ident           |                                   |  |    |||   
Sbjct lhlTAIDSHAHVFSRglnlasqRRYAP----------NYDA--PLGD-YLGQLRAHGFSH   47
DSSP  lllLLEELLLLLLLHhhhhhllLLLLL----------LLLL--LHHH-HHHHHHHLLLLE


DSSP  EEEEELLLHHhhlllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEELLLlllhhHHHHhhH
Query MILSLNAPAVqaipdrrkaieiarrANDVLAEECAKRPDRFLAFAALPlqdpdAATEelQ  114
ident   |                       |  |       |        |         |  |
Sbjct GVLVQPSFLG--------------tDNRYLLSALQTVPGQLRGVVXLE-----RDVE--Q   86
DSSP  ELLLLLHHHL--------------lLLHHHHHHHHHLLLLLLLLLLLL-----LLLL--H


DSSP  HHHHLLL---LLEEEEELllllllllLLLLLLLHHHHHHHHHHHHHLLLEEEELllllhh
Query RCVNDLG---FVGALVNGfsqegdgqTPLYYDLPQYRPFWGEVEKLDVPFYLHPrnplpq  171
ident             |   |                 | ||             ||       
Sbjct ATLAEXArlgVRGVRLNL-----xgqDXPDLTGAQWRPLLERIGEQGWHVELHR------  135
DSSP  HHHHHHHlllLLEEELLL-----lllLLLLLLLLLLHHHHHHHHHHLLEEEELL------


DSSP  hlhhhlllhhhlhhhlhHHHHHHHHHHHHHHllhhhhlLLLLEEELHHHLL---------
Query dsriydghpwllgptwaFAQETAVHALRLMAsglfdehPRLNIILGHMGEG---------  222
ident                        |    |           | |   | |           
Sbjct -----------------QVADIPVLVRALQP-------YGLDIVIDHFGRPdarrglgqp  171
DSSP  -----------------LLLLHHHHHHHHLL-------LLLLEEELHHHLLlllllllll


DSSP  ---HHHHHhhhhhllllllllllllllllhhhHHHHHEEEELLLL------------lLH
Query ---LPYMMwridhrnawvklpprypakrrfmdYFNENFHITTSGN------------fRT  267
ident                                           ||                
Sbjct gfaELLTL------------------------SGRGKVWVKVSGIyrlqgspeenlafAR  207
DSSP  lhhHHLLL------------------------LLLLLEEEEEELHhhllllhhhhhhhHH


DSSP  HHHHHHHLLLLHHHEELLLLLLL------LLHHHHHHHHHHLLLLHHHHHHHHLHHHHHH
Query QTLIDAILEIGADRILFSTDWPF------ENIDHASDWFNATSIAEADRVKIGRTNARRL  321
ident | |       || |     |||            |   | |       |       || |
Sbjct QALCALEAHYGAERLXWGSDWPHtqheseVSFGSAVEQFEALGCSAQLRQALLLDTARAL  267
DSSP  HHHHHHHHHLLHHHEEEELLLLLllllllLLHHHHHHHHHHHLLLHHHHHHHHLHHHHHH


DSSP  LLLL--
Query FKLD--  325
ident |     
Sbjct FGFEle  273
DSSP  LLLLll


No 11: Query=2dvtA Sbjct=4b3zD Z-score=17.6

back to top
DSSP  ---------------------------------------------------LLLEEEEEE
Query ---------------------------------------------------MQGKVALEE    9
ident                                                      |      
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE


DSSP  EELLhhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEELllhhhhlll
Query HFAIpetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSLNapavqaipd   69
ident                             |            |    |             
Sbjct YLQK------------------TAAD--DFFQ-GTRAALVGGTTMIIDHVV---------   90
DSSP  LLLL------------------LLLL--LHHH-HHHHHHHLLEEEEEEEEL---------


DSSP  hhHHHHHHHHHHHHHHHHHHHLL-LLEEEEELLLLLLhHHHHHHHHHHHHLLLLLEEEEE
Query rrKAIEIARRANDVLAEECAKRP-DRFLAFAALPLQDpDAATEELQRCVNDLGFVGALVN  128
ident                 |                     |   |||   | | |     | 
Sbjct -pEPGSSLLTSFEKWHEAADTKScCDYSLHVDITSWY-DGVREELEVLVQDKGVNSFQVY  148
DSSP  -lLLLLLHHHHHHHHHHHHHLLLlLEEEEEEELLLLL-LLHHHHHHHHHHLLLLLEEEEE


DSSP  LLLLLllllllLLLLlHHHHHHHHHHHHHLLLEEEELL---LLLHhHLHHHL----LLHH
Query GFSQEgdgqtpLYYDlPQYRPFWGEVEKLDVPFYLHPR---NPLPqDSRIYD----GHPW  181
ident               |  |          |      |                      | 
Sbjct MAYKD----vyQMSD-SQLYEAFTFLKGLGAVILVHAEngdLIAQ-EQKRILemgiTGPE  202
DSSP  LLLLL----llLLLH-HHHHHHHHHHHHHLLEEEEELLlhhHHHH-HHHHHHhlllLLLH


DSSP  HLHhhlHHHHHHHHHHHHHHHllHHHHLLlLLEEELHHHLL-HHHHhhhhhhllllllll
Query LLGptwAFAQETAVHALRLMAsgLFDEHPrLNIILGHMGEG-LPYMmwridhrnawvklp  240
ident             |    |                                          
Sbjct GHA-lsRPEELEAEAVFRAIT--IAGRIN-CPVYITKVMSKsAADI--------------  244
DSSP  HHH-hhLLHHHHHHHHHHHHH--HHHHHL-LLEEEEEELLHhHHHH--------------


DSSP  llllllllHHHHhhhHEEEELL-LLLL------------------------------HHH
Query prypakrrFMDYfneNFHITTS-GNFR------------------------------TQT  269
ident                                                             
Sbjct ---ialarKKGP---LVFGEPIaASLGtdgthywsknwakaaafvtspplspdpttpDYL  298
DSSP  ---hhhhhHHLL---LEEEEELhHHHHlllhhhhlllhhhhhhllllllllllllhhHHH


DSSP  HHHHHLLLlhhHEELLLLLL-------------------LLLH-HHHHHHHHHL-----L
Query LIDAILEIgadRILFSTDWP-------------------FENI-DHASDWFNAT-----S  304
ident                                          |                  
Sbjct TSLLACGD---LQVTGSGHCpystaqkavgkdnftlipeGVNGiEERMTVVWDKavatgK  355
DSSP  HHHHHHLL---LLLLLLLLLlllhhhhhhhlllhhhlllLLLLlLLHHHHHHHHhllllL


DSSP  LLHHHHHHHHLHHHHHHLLLL---------------------------------------
Query IAEADRVKIGRTNARRLFKLD---------------------------------------  325
ident   |   |    |||   | |                                        
Sbjct MDENQFVAVTSTNAAKIFNLYprkgriavgsdadvviwdpdklktitakshksaveynif  415
DSSP  LLHHHHHHHHLHHHHHHHLLLllllllllllllleeeeeeeeeeelllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct egmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgv  475
DSSP  llleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhhhhhhllllll


DSSP  --
Query --  325
ident   
Sbjct sr  477
DSSP  ll


No 12: Query=2dvtA Sbjct=4mupB Z-score=17.5

back to top
DSSP  --------------LLLEEEEEEEEL---LHHH---HHHHlllllllhhhHHHHhhhLLL
Query --------------MQGKVALEEHFA---IPET---LQDSagfvpgdywkELQHrllDIQ   40
ident                 | |    |      |                             
Sbjct lvrklsgtapnpafPRGAVDTQMHMYlpgYPALpggPGLP----------PGAL---PGP   47
DSSP  llllllllllllllLLLLEELLLLLLlllLLLLlllLLLL----------LLLL---LLH


DSSP  LHHHHHHHHLLEEEEEEEELLLHHhhlllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEEL
Query DTRLKLMDAHGIETMILSLNAPAVqaipdrrkaieiarrANDVLAEECAKRPDRFLAFAA  100
ident      ||   ||   |                        |       |       |   
Sbjct EDYRRLMQWLGIDRVIITQGNAHQ--------------rDNGNTLACVAEMGEAAHAVVI   93
DSSP  HHHHHHHHHHLLLEEEEELLHHHL--------------lLLHHHHHHHHHHHHHEEEEEL


DSSP  LLlllhHHHHH-HHHHHHhLLLLLEEEEELLLlllllllllLLLLhhHHHHHHHHHHHLL
Query LPlqdpDAATE-ELQRCVnDLGFVGALVNGFSqegdgqtplYYDLpqYRPFWGEVEKLDV  159
ident          ||          | |||                                | 
Sbjct ID----ATTTEkDMEKLT-AAGTVGARIMDLP-----ggavNLSE--LDAVDERAHAADW  141
DSSP  LL----LLLLHhHHHHHH-HLLEEEEEEELLL-----llllLHHH--HHHHHHHHHHLLL


DSSP  LEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHHHHHlLHHHhlLLLLEEELHH
Query PFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALRLMAsGLFDehPRLNIILGHM  219
ident                                       |      |     |      | 
Sbjct MVAVQF---------------------------DGNGLLDHLP-RLQK--IRSRWVFDHH  171
DSSP  EEEEEL---------------------------LHHHHHHHHH-HHHL--LLLEEEELHH


DSSP  HLL-hhHHHHHHhhlllllllllllllllLHHHHHHH-HEEEELLLL-----------lL
Query GEG-lpYMMWRIdhrnawvklpprypakrRFMDYFNE-NFHITTSGN-----------fR  266
ident |                                     |      |              
Sbjct GKFfkgIRTDGP--------------emaALLKLIDRgNLWFKFAGVyessrkswpyadV  217
DSSP  HHLlllLLLLLH--------------hhhHHHHHHHHlLEEEEELLHhhllllllllhhH


DSSP  HHHHHHHHLLlLHHHEELLLLLLL---------LLHHHHHHHHHHLLLLHHHHHHHHLHH
Query TQTLIDAILEiGADRILFSTDWPF---------ENIDHASDWFNATSIAEADRVKIGRTN  317
ident               ||   | ||                          || |      |
Sbjct AAFSRVIAAH-APERIVWGTNWPHnsvretaayPDDARLAELTLGWLPDEAARHRALVEN  276
DSSP  HHHHHHHHHH-LHHHEEELLLLLLlllllhhhlLLHHHHHHHHHLLLLLHHHHHHHHLHH


DSSP  HHHHLLLL--
Query ARRLFKLD--  325
ident    ||||   
Sbjct PEALFKLSpv  286
DSSP  HHHHHLLLll


No 13: Query=2dvtA Sbjct=1gkpA Z-score=17.4

back to top
DSSP  --------------------------------------------------LLLEEEEEEE
Query --------------------------------------------------MQGKVALEEH   10
ident                                                     |      |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  -ELLHhhHHHHlllllllhhhhhhhhHHLLLLHHHHHHHHLLEEEEEEEELllHHHHlll
Query -FAIPetLQDSagfvpgdywkelqhrLLDIQDTRLKLMDAHGIETMILSLNapAVQAipd   69
ident                             |   |  |     |  | |             
Sbjct iYLPF--MATF---------------AKDTHETGSKAALMGGTTTYIEMCC--PSRN---   98
DSSP  lLLEE--LLEE---------------LLLLHHHHHHHHHHLLEEEEEEEEL--LLLL---


DSSP  hhhhhHHHHHHHHHHHHHHHHLL-LLEEEEELLLLlLHHHHHHHHHHHHHLlLLLEEEEE
Query rrkaiEIARRANDVLAEECAKRP-DRFLAFAALPLqDPDAATEELQRCVNDlGFVGALVN  128
ident        |                       |            |   | | |       
Sbjct -----DDALEGYQLWKSKAEGNSyCDYTFHMAVSK-FDEKTEGQLREIVAD-GISSFXIF  151
DSSP  -----LLHHHHHHHHHHHHLLLLlLEEEEEEELLL-LLLLHHHHHHHHHHL-LLLEEEEE


DSSP  LLLLLllllllLLLLlHHHHHHHHHHHHHLLLEEEEL---llLLHHHLHH----hLLLHH
Query GFSQEgdgqtpLYYDlPQYRPFWGEVEKLDVPFYLHP---rnPLPQDSRI----yDGHPW  181
ident               |             | |    |                    |  |
Sbjct LSYKN----ffGVDD-GEMYQTLRLAKELGVIVTAHCenaelVGRLQQKLlsegkTGPEW  206
DSSP  ELLLL----llLLLH-HHHHHHHHHHHHHLLEEEEEEllhhhHHHHHHHHhhlllLLHHH


DSSP  HLhhhlHHHHHHHHHHHHHHhlLHHHHLLlLLEEELHHHLL-HHHHhhhhhhllllllll
Query LLgptwAFAQETAVHALRLMasGLFDEHPrLNIILGHMGEG-LPYMmwridhrnawvklp  240
ident             |    |                  |                       
Sbjct HE--psRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCKpALDA--------------  247
DSSP  LL--llLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLHhHHHH--------------


DSSP  llllllllhHHHHH--HHEEEELL-LLLL---------------------------HHHH
Query prypakrrfMDYFN--ENFHITTS-GNFR---------------------------TQTL  270
ident          |          |      |                               |
Sbjct --------aMAAKArgVPIYIESViPHFLldktyaerggveamkyimspplrdkrnQKVL  299
DSSP  --------hHHHHHllLLEEEEEEhHHHHllhhhhhllhhhhhlllllllllllhhHHHH


DSSP  HHHHlllLHHHEELLLLLL--------------------LLLHHHHHHHHHHLL-----L
Query IDAIleiGADRILFSTDWP--------------------FENIDHASDWFNATS-----I  305
ident  ||            ||                         |                 
Sbjct WDAL--aQGFIDTVGTDHCpfdteqkllgkeaftaipngIPAIEDRVNLLYTYGvsrgrL  357
DSSP  HHHH--hLLLLLEEELLLLlllhhhhhhhlllhhhllllLLLLLLHHHHHHHHHlllllL


DSSP  LHHHHHHHHLHHHHHHLLLL----------------------------------------
Query AEADRVKIGRTNARRLFKLD----------------------------------------  325
ident      |    | |  || |                                         
Sbjct DIHRFVDAASTKAAKLFGLFprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfe  417
DSSP  LHHHHHHHHLHHHHHHLLLLllllllllllllleeeeelllleellhhhlllllllllll


DSSP  -----------------------------------------
Query -----------------------------------------  325
ident                                          
Sbjct gfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lleelleeeeeeelleeeeelleelllllllllllllllll


No 14: Query=2dvtA Sbjct=2qpxA Z-score=16.5

back to top
DSSP  ----------LLLEEEEEEEEllhhhhhhhllllLLLHHHHHHHH---------------
Query ----------MQGKVALEEHFaipetlqdsagfvPGDYWKELQHR---------------   35
ident                    ||                    |                  
Sbjct gxddlsefvdQVPLLDHHCHF--------lidgkVPNRDDRLAQVsteadkdypladtkn   52
DSSP  lllllhhhhhHLLEEEEEELL--------lllllLLLHHHHHHHHlllllllllhhhhll


DSSP  --------------------------hhllLLHHHHHHHHLLEEEEEEEELLlhhhhlll
Query --------------------------lldiQDTRLKLMDAHGIETMILSLNApavqaipd   69
ident                                                             
Sbjct rlayhgflalakefaldannplaaxndpgyATYNHRIFGHFHFKELLIDTGF--------  104
DSSP  lhhhhhhhhhhhhhllllllllllllhhhhHHHHHHHHHHLLEEEEEEELLL--------


DSSP  hhhhhhhhhhhhhhhhHHHHHLL----LLEEEEELL--LLLL-----------HHHHHHH
Query rrkaieiarrandvlaEECAKRP----DRFLAFAAL--PLQD-----------PDAATEE  112
ident                                |   |     |             |    
Sbjct ----------vpddpiLDLDQTAelvgIPVKAIYRLetHAEDfxlehdnfaawWQAFSND  154
DSSP  ----------llllllLLHHHHHhhhlLLEEEEEEHhhHHHHhhlllllhhhhHHHHHHH


DSSP  HHHHHHlLLLLEEEEEL----------------lllLLLLL---------lLLLLllHHH
Query LQRCVNdLGFVGALVNG----------------fsqEGDGQ---------tPLYYdlPQY  147
ident         ||||                                       ||       
Sbjct VKQAKA-HGFVGFXSIAayrvglhlepvnvieaaagFDTWKhsgekrltskPLID--YXL  211
DSSP  HHLLLL-LLLLLEEELHhhhlllllllllhhhhhhhHHHHHhhlllllllhHHHH--HHH


DSSP  HHHHHHHHHHLLLEEEELllllhhhlhhhlllhHHLHhhLHHHHhhHHHHHHHHHlLHHH
Query RPFWGEVEKLDVPFYLHPrnplpqdsriydghpWLLGptWAFAQetAVHALRLMAsGLFD  207
ident           | |   |                                           
Sbjct YHVAPFIIAQDXPLQFHV-----------gygdADTD--XYLGN--PLLXRDYLK-AFTK  255
DSSP  HHHHHHHHHHLLLEEEEE-----------llllLLLL--HHHLL--HHHHHHHHH-HHHH


DSSP  hlLLLLEEELHhHLLHHHHhhhhhhllllllllllllllllHHHHhhHHEEEELLLLL--
Query ehPRLNIILGHmGEGLPYMmwridhrnawvklpprypakrrFMDYfnENFHITTSGNF--  265
ident     |   | |                                     |     |     
Sbjct --KGLKVVLLH-CYPYHRE------------------agylASVF--PNLYFDISLLDnl  292
DSSP  --HLLLEEEEE-LLLLHHH------------------hhhhHHHL--LLEEEELLLHHhh


DSSP  ----LHHHHHHHHLLLLHHHEELLLLLLL--lLHHHHHHHHHH--LLLL-----------
Query ----RTQTLIDAILEIGADRILFSTDWPF--eNIDHASDWFNA--TSIA-----------  306
ident            |       ||||  |          |   |                   
Sbjct gpsgASRVFNEAVELAPYTRILFASDASTypeXYGLAARQFKQalVAHFnqlpfvdlaqk  352
DSSP  lhhhHHHHHHHHLLLLLHHHEELLLLLLLlhhHHHHHHHHHHHhhHHHHhllllllhhhh


DSSP  HHHHHHHHLHHHHHHLLLL-----
Query EADRVKIGRTNARRLFKLD-----  325
ident  |    |       |         
Sbjct KAWINAICWQTSAKLYHQErelrv  376
DSSP  HHHHHHHHLHHHHHHLLLHhhhll


No 15: Query=2dvtA Sbjct=1bf6A Z-score=15.8

back to top
DSSP  ---llLEEEEEE-EELLhhHHHHHLllllllhHHHHHhhHHLL--LLHHHHHHHHLLEEE
Query ---mqGKVALEE-HFAIpeTLQDSAgfvpgdyWKELQhrLLDI--QDTRLKLMDAHGIET   54
ident      |     |                           |                |   
Sbjct sfdptGYTLAHEhLHID--LSGFKN-------NVDCR--LDQYafICQEMNDLMTRGVRN   49
DSSP  lllllLEEEEEElLLEE--LHHHHL-------LHHHE--ELLHhhHHHHHHHHHHLLEEE


DSSP  EEEEElllhhhhlllhhhhhhhHHHHhhHHHHHHHHLL----LLEEEEELL---------
Query MILSLnapavqaipdrrkaieiARRAndVLAEECAKRP----DRFLAFAAL---------  101
ident  |                     |      |               |             
Sbjct VIEMT-----------------NRYM-gRNAQFMLDVMretgINVVACTGYyqdaffpeh   91
DSSP  EEELL-----------------LHHH-lLLHHHHHHHHhhhlLEEEEEELLllhhhlllh


DSSP  -llLLHHHHHHHHHHHHHLL------LLLEEE-EELLllllllllLLLLllhhhHHHHHH
Query -plQDPDAATEELQRCVNDL------GFVGAL-VNGFsqegdgqtPLYYdlpqyRPFWGE  153
ident            |                                 ||             
Sbjct vatRSVQELAQEMVDEIEQGidgtelKAGIIAeIGTS---egkitPLEE--kvfIAAALA  146
DSSP  hhhLLHHHHHHHHHHHHHLLllllllLEEEEEeEELL---lllllHHHH--hhhHHHHHH


DSSP  HHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhhHHHHHHhLLHHHHLLLL-
Query VEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtavHALRLMaSGLFDEHPRL-  212
ident       |   |                                 |      |      | 
Sbjct HNQTGRPISTHT-----------------------SFST---MGLEQL-ALLQAHGVDLs  179
DSSP  HHHHLLLEEEEL-----------------------HHHL---LHHHHH-HHHHHLLLLHh


DSSP  LEEELHHHLLHHHHHhhhhhllllllllllllllllhHHHHHHHEEEELLLLL-------
Query NIILGHMGEGLPYMMwridhrnawvklpprypakrrfMDYFNENFHITTSGNF-------  265
ident     ||                                                      
Sbjct RVTVGHCDLKDNLDN---------------------iLKMIDLGAYVQFDTIGknsyypd  218
DSSP  HEEELLLLLLLLHHH---------------------hHHHHHLLLEEEELLLLllllllh


DSSP  --LHHHHHHHHLLLLHHHEELLLLLLL---------lLHHHHH-HHHHHLL---LLHHHH
Query --RTQTLIDAILEIGADRILFSTDWPF---------eNIDHAS-DWFNATS---IAEADR  310
ident   |   |          |   | |               |                 || 
Sbjct ekRIAMLHALRDRGLLNRVMLSMDITRrshlkanggyGYDYLLtTFIPQLRqsgFSQADV  278
DSSP  hhHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhlllLLLHHHhLHHHHHHhllLLHHHH


DSSP  HHHHLHHHHHHLLll
Query VKIGRTNARRLFKld  325
ident     | |    |   
Sbjct DVMLRENPSQFFQ--  291
DSSP  HHHHLHHHHHHLL--


No 16: Query=2dvtA Sbjct=1itqA Z-score=15.8

back to top
DSSP  ------------LLLEEEEEEEE-LLHHhhhhhlllllllhhhhHHHHhhllllhHHHHH
Query ------------MQGKVALEEHF-AIPEtlqdsagfvpgdywkeLQHRlldiqdtRLKLM   47
ident                                             |               
Sbjct dffrdeaerimrDSPVIDGHNDLpWQLLdmfnnrlqderanlttLAGT-----htNIPKL   55
DSSP  lhhhhhhhhhhlLLLEEEEEELHhHHHHhhhllllllhhhllllLLLL-----llLHHHH


DSSP  HHLLEEEEEEEELllHHHHLLLHhHHHHHHHHHHHHHHHHHH-----HLLL---------
Query DAHGIETMILSLNapAVQAIPDRrKAIEIARRANDVLAEECA-----KRPD---------   93
ident  |        |              |        ||    |                   
Sbjct RAGFVGGQFWSVY--TPCDTQNK-DAVRRTLEQMDVVHRMCRmypetFLYVtssagirqa  112
DSSP  HHLLEEEEEEEEL--LLHHHLLL-LHHHHHHHHHHHHHHHHHhllllEEELllhhhhhhh


DSSP  ------LEEEEELL--LLLLHhhhHHHHHHHHHlLLLLEEEE-ELLLlllllllLLLL--
Query ------RFLAFAAL--PLQDPdaaTEELQRCVNdLGFVGALV-NGFSqegdgqtPLYY--  142
ident         |                  |      ||                        
Sbjct fregkvASLIGVEGghSIDSS---LGVLRALYQ-LGMRYLTLtHSCN-------TPWAdn  161
DSSP  hhllleEEEEEEELhhHLLLL---HHHHHHHHH-LLEEEEELlLLLL-------LLLLll


DSSP  --------------LLHHHHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlh
Query --------------DLPQYRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwa  188
ident                 |       |   | |   |                         
Sbjct wlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH-----------------------  198
DSSP  hhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL-----------------------


DSSP  hhhHHHHHHHHHHHllhhhhLLLLLEEE-LHHH--------LLHHhhhhhhhhlllllll
Query faqETAVHALRLMAsglfdeHPRLNIIL-GHMG--------EGLPymmwridhrnawvkl  239
ident                       |   |                                 
Sbjct ---VSVATMKATLQ------LSRAPVIFsHSSAysvcasrrNVPD---------------  234
DSSP  ---LLHHHHHHHHH------HLLLLLEElLLLLllllllllLLLH---------------


DSSP  lllllllllhhHHHHHH-EEEELLLL-------------lLHHHHHHHHLLLLHHHEELL
Query pprypakrrfmDYFNEN-FHITTSGN-------------fRTQTLIDAILEIGADRILFS  285
ident                                             |       ||    | 
Sbjct --------dvlRLVKQTdSLVMVNFYnnyisctnkanlsqVADHLDHIKEVAGARAVGFG  286
DSSP  --------hhhHHHHHHlLEEEELLLhhhhlllllllhhhHHHHHHHHHHHLLHHHEEEL


DSSP  LLLLLL--------LHHHHHHHHHHLL---LLHHHHHHHHLHHHHHHLL-----------
Query TDWPFE--------NIDHASDWFNATS---IAEADRVKIGRTNARRLFK-----------  323
ident  |                  |           ||        |  | |            
Sbjct GDFDGVprvpegleDVSKYPDLIAELLrrnWTEAEVKGALADNLLRVFEaveqasnltqa  346
DSSP  LLLLLLllllllllLLLLHHHHHHHHHhllLLHHHHHHHHLHHHHHHHHhhhhlllllll


DSSP  ---------------------ll
Query ---------------------ld  325
ident                        
Sbjct peeepipldqlggscrthygyss  369
DSSP  lllllllhhhlllllllllllll


No 17: Query=2dvtA Sbjct=2y1hB Z-score=15.7

back to top
DSSP  lLLEEEEEEEELLhhhhhhhlllllllhhhhhhHHHHllLLHHHHHHHHLLEEEEEEEEL
Query mQGKVALEEHFAIpetlqdsagfvpgdywkelqHRLLdiQDTRLKLMDAHGIETMILSLN   60
ident   | |    |                              |  |                
Sbjct gVGLVDCHCHLSA--------------------PDFDrdLDDVLEKAKKANVVALVAVAE   40
DSSP  lLLEEEEEELLLL--------------------HHHLllHHHHHHHHHHLLEEEEEELLL


DSSP  llhhhhlllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELL---------lLLLH--HHH
Query apavqaipdrrkaieiARRANDVLAEECAKRPDRFLAFAAL---------pLQDP--DAA  109
ident                                    |                     | |
Sbjct ----------------HSGEFEKIMQLSERYNGFVLPCLGVhpvqgldqrsVTLKdlDVA   84
DSSP  ----------------LHHHHHHHHHHHHHLLLLEEEEELLlleelllleeLLHHhhHHH


DSSP  HHHHHHHHHllLLLEE-EEELL--llllLLLL--LLLLLlhhhHHHHHHHHHHLLLEEEE
Query TEELQRCVNdlGFVGA-LVNGF--sqegDGQT--PLYYDlpqyRPFWGEVEKLDVPFYLH  164
ident                   |                                 |  |   |
Sbjct LPIIENYKD--RLLAIgEVGLDfsprfaGTGEqkEEQRQ--vlIRQIQLAKRLNLPVNVH  140
DSSP  HHHHHHHLL--LLLEEeEEEEEllllllLLHHhhHHHHH--hhHHHHHHHHHHLLLEEEE


DSSP  LllllhhhlhhhlllhhhlhhhlhhHHHHHHHHHHHHHllhhhhLLLLLEEELHhHLLHH
Query PrnplpqdsriydghpwllgptwafAQETAVHALRLMAsglfdeHPRLNIILGHmGEGLP  224
ident                                    |               |     | |
Sbjct S------------------------RSAGRPTINLLQE------QGAEKVLLHA-FDGRP  169
DSSP  E------------------------ELLHHHHHHHHHH------LLLLLEEEEL-LLLLH


DSSP  HHhhhhhhllllllllllllllllhHHHHHHHEEEELLLLLL-----HHHHHHHhlllLH
Query YMmwridhrnawvklpprypakrrfMDYFNENFHITTSGNFR-----TQTLIDAileiGA  279
ident                          |                                  
Sbjct SV----------------------aMEGVRAGYFFSIPPSIIrsgqkQKLVKQL----PL  203
DSSP  HH----------------------hHHHHHLLLEEEELHHHHllhhhHHHHHHL----LH


DSSP  HHEELLLLLLL--------LLHHHHHHHHHHL--LLLH---HHHHHHhLHHHHHH-LLLL
Query DRILFSTDWPF--------ENIDHASDWFNAT--SIAE---ADRVKIgRTNARRL-FKLD  325
ident   |   || |               |                        ||  |  || 
Sbjct TSICLETDSPAlgpekqvrNEPWNISISAEYIaqVKGIsveEVIEVT-TQNALKLfPKLR  262
DSSP  HHEEELLLLLLllllllllLLHHHHHHHHHHHhhHHLLlhhHHHHHH-HHHHHHHlLLHH


DSSP  ---
Query ---  325
ident    
Sbjct hll  265
DSSP  hhl


No 18: Query=2dvtA Sbjct=2vunA Z-score=15.6

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------MQ    2
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LEEEEEEEELlhhhhhhhlllllllhhhHHHHHhhlllLHHHHHHHHLLEEEEEE-EELL
Query GKVALEEHFAipetlqdsagfvpgdywkELQHRlldiqDTRLKLMDAHGIETMIL-SLNA   61
ident |      |                      |                 |  |||      
Sbjct GLLDTHVHVS-------------ggdyaPRQKT-----MDFISSALHGGVTTMISaGSPH  102
DSSP  LEEEEEELLL-------------llleeHHHLE-----ELHHHHHHLLLEEEEEElLLLL


DSSP  lhhhhlllhhhHHHHHHHHHHHHHHHHHHLL---LLEEE-EELLLlLLHHhhHHHHHHHH
Query pavqaipdrrkAIEIARRANDVLAEECAKRP---DRFLA-FAALPlQDPDaaTEELQRCV  117
ident                       |                    |         |      
Sbjct -----fpgrpkDAAGTKALAITLSKSYYNARpagVKVHGgAVILE-KGLT--EEDFIEMK  154
DSSP  -----llllllLHHHHHHHHHHHHHHHHHLLhhhLEEELlEELLL-LLLL--HHHHHHHH


DSSP  HLLlLLEEE-EELLLllllllllLLLLLhhHHHHHHHHHHHLLLEEEE--lLLLLHhhlh
Query NDLgFVGAL-VNGFSqegdgqtpLYYDLpqYRPFWGEVEKLDVPFYLH--pRNPLPqdsr  174
ident           |                     |      |       |            
Sbjct KEG-VWIVGeVGLGT-------iKNPED--AAPMVEWAHKHGFKVQMHtggTSIPG----  200
DSSP  HLL-LLEEEeELLLL-------lLLHHH--HHHHHHHHHHLLLEEEEElllLLLLL----


DSSP  hhlllhhhlhhhlhhhHHHHHHHHHHhhllhhhhlllLLEEELHHHL---LHHHHHHhhh
Query iydghpwllgptwafaQETAVHALRLmasglfdehprLNIILGHMGE---GLPYMMWrid  231
ident                   ||                       |                
Sbjct --------------ssTVTADDVIKT-----------KPDVVSHINGgptAISVQEV---  232
DSSP  --------------llLLLHHHHHHH-----------LLLEEELLLLlllLLLHHHH---


DSSP  hllllllllllllllllhHHHHhhHEEEELL-LLLLhHHHHHHHLLL----LHHHEELLL
Query hrnawvklpprypakrrfMDYFneNFHITTS-GNFRtQTLIDAILEI----GADRILFST  286
ident                   ||     |                            |  |  
Sbjct ---------------driMDET--DFAMEIVqCGNP-KIADYVARRAaekgQLGRVIFGN  274
DSSP  ---------------hhhHHHL--LLEEEEElLLLH-HHHHHHHHHHhhhlLHHHEEEEL


DSSP  LLLL--LLHHHHHHHHHHL-----LLLHHHHHHHHLHHHHHHLLLL--------------
Query DWPF--ENIDHASDWFNAT-----SIAEADRVKIGRTNARRLFKLD--------------  325
ident | |     |                |     |     |      |               
Sbjct DAPSgtGLIPLGILRNMCQiasmsDIDPEVAVCMATGNSTAVYGLNtgviapgkeadlii  334
DSSP  LLLLllLLLLLHHHHHHHHhhhhlLLLHHHHHHHHLHHHHHHHLLLllllllllllleee


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  325
ident                                                    
Sbjct mdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  eelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 19: Query=2dvtA Sbjct=4cqbA Z-score=15.5

back to top
DSSP  ---------------------------------------------------LLLEEEEEE
Query ---------------------------------------------------MQGKVALEE    9
ident                                                      | |    
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  EELLhhhhhhhllLLLL-LHHHH---------------------hhhhhHLLLlHHHHHH
Query HFAIpetlqdsagFVPG-DYWKE---------------------lqhrlLDIQdTRLKLM   47
ident |                                                           
Sbjct HMDK------sftSTGErLPKFWsrpytrdaaiedglkyyknatheeikRHVI-EHAHMQ  113
DSSP  LHHH------lllLLLLlLLLLLlllllhhhhhhhhhhhhhhllhhhhhHHHH-HHHHHH


DSSP  HHLLEEEEEEEElllhhhhlllhhhHHHHHHHHHHHHHHHHHHLL--LLEEEEELL--LL
Query DAHGIETMILSLnapavqaipdrrkAIEIARRANDVLAEECAKRP--DRFLAFAAL--PL  103
ident   ||                            |     |              |      
Sbjct VLHGTLYTRTHV-----------dvDSVAKTKAVEAVLEAKEELKdlIDIQVVAFAqsGF  162
DSSP  HHLLEEEEEEEE-----------elLLLLLLHHHHHHHHHHHHLLllLEEEEEEELllLL


DSSP  LLHHHHHHHHHHHHHlLLLLEEEEELLllllllllLLLLLlhhhHHHHHHHHHHLLLEEE
Query QDPDAATEELQRCVNdLGFVGALVNGFsqegdgqtPLYYDlpqyRPFWGEVEKLDVPFYL  163
ident                  |                                    ||    
Sbjct FVDLESESLIRKSLD-MGCDLVGGVDP----atreNNVEG--slDLCFKLAKEYDVDIDY  215
DSSP  LLLLLHHHHHHHHHH-HLLLEEELLLL----llllLLHHH--hhHHHHHHHHHLLLEEEE


DSSP  ELLlllhhhlhhhlllhhhlhhhlhHHHH-HHHHHHHHHHllHHHHLLLL-LEEELHhHL
Query HPRnplpqdsriydghpwllgptwaFAQE-TAVHALRLMAsgLFDEHPRL-NIILGHmGE  221
ident |                                   ||       |          |   
Sbjct HIH----------------------DIGTvGVYSINRLAQ--KTIENGYKgRVTTSH-AW  250
DSSP  EEL----------------------LLHHhHHHHHHHHHH--HHHHLLLLlLEEEEE-LL


DSSP  LH----hhHHHHhhhllllllllllllllllHHHHHH-HHEEEELL-LLLLHHH-HHHHH
Query GL----pyMMWRidhrnawvklpprypakrrFMDYFN-ENFHITTS-GNFRTQT-LIDAI  274
ident                                             |           |   
Sbjct CFadapseWLDE-------------------AIPLYKdSGMKFVTCfSSTPPTMpVIKLL  291
DSSP  HHhhllhhHHHH-------------------HHHHHHhHLLEEEEElLLLLLLLlHHHHH


DSSP  LLLLhhHEELLLLLL------LLLHHhHHHHHHHLL--------lLHHHHHHHHLHHHHH
Query LEIGadRILFSTDWP------FENIDhASDWFNATS--------iAEADRVKIGRTNARR  320
ident             |        | | |                         |       |
Sbjct EAGI--NLGCASDNIrdfwvpFGNGD-MVQGALIETqrlelktnrDLGLIWKMITSEGAR  348
DSSP  HLLL--EEEEELLLLllllllLLLLL-HHHHHHHHHhhhllllhhHHHHHHHHHLHHHHH


DSSP  HLLLL-------------------------------------------------
Query LFKLD-------------------------------------------------  325
ident                                                       
Sbjct VLGIEknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  HHLLHhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 20: Query=2dvtA Sbjct=1yrrB Z-score=15.5

back to top
DSSP  --------------------------------------------------LLLEEEEEEE
Query --------------------------------------------------MQGKVALEEH   10
ident                                                     |       
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  ------ELLHHHHhhhlllllllhhhhhhhhhHLLLLhHHHHHHHLLEEEEEEEEllLHH
Query ------FAIPETLqdsagfvpgdywkelqhrlLDIQDtRLKLMDAHGIETMILSLnaPAV   64
ident       |                                 |     |       |     
Sbjct gcggvqFNDTAEA----------------vsvETLEI-MQKANEKSGCTNYLPTL--ITT  101
DSSP  eelleeLLLLLLL----------------llhHHHHH-HHHHHHLLLEEEEEEEE--LLL


DSSP  HhlllhhhhHHHHHHHHHHHHHHHHHLLLLEE-EEELLLLllhHHHHHHHHHHHhlLLLL
Query QaipdrrkaIEIARRANDVLAEECAKRPDRFL-AFAALPLqdpDAATEELQRCVndLGFV  123
ident           |       |  |  || |   |      |     |    |          
Sbjct S--------DELMKQGVRVMREYLAKHPNQALgLHLEGPW-lnAALVDFLCENA--DVIT  150
DSSP  L--------HHHHHHHHHHHHHHHHHLLLLLLlEEEELLL-llLHHHHHHHHLH--HHEE


DSSP  EEEEellllllllllllLLLLhhhHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhl
Query GALVngfsqegdgqtplYYDLpqyRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwll  183
ident                                                             
Sbjct KVTL-----------apEMVP---AEVISKLANAGIVVSAGH------------------  178
DSSP  EEEE-----------lhHHLL---HHHHHHHHHHLLEEEELL------------------


DSSP  hhhlhhhhhHHHHhHHHHHllhhhhlLLLLEEELHHHLlhhhHHHHHHhlllllllllll
Query gptwafaqeTAVHaLRLMAsglfdehPRLNIILGHMGEglpyMMWRIDhrnawvklppry  243
ident                   |               |                         
Sbjct ---------SNATlKEAKA-----gfRAGITFATHLYN-ampYITGRE------------  211
DSSP  ---------LLLLhHHHHH-----hhHHLEEEELLLLL-lllLLLLLL------------


DSSP  lllllhhhHHHHhEEEELlLLLL----HHHHHHHHLLLLhHHEELLLLLL-LLLHHhHHH
Query pakrrfmdYFNEnFHITTsGNFR----TQTLIDAILEIGaDRILFSTDWP-FENIDhASD  298
ident                                  |    | |     ||            
Sbjct pglagailDEAD-IYCGI-IADGlhvdYANIRNAKRLKG-DKLCLVTDATsGSSLT-MIE  267
DSSP  lhhhhhhhHLLL-LEEEE-ELLLllllHHHHHHHHHHHH-HHEEEELLLLlLLLLL-HHH


DSSP  HHHHL----LLLHHHHHHHHLHHHHHHLLLL-----------------------------
Query WFNAT----SIAEADRVKIGRTNARRLFKLD-----------------------------  325
ident           ||             |                                  
Sbjct GVRNLvehcGIALDEVLRMATLYPARAIGVEkrlgtlaagkvanltaftpdfkitktivn  327
DSSP  HHHHHhhhhLLLHHHHHHHHLHHHHHHLLLLllllllllllllleeeellllleeeeeel


DSSP  -------
Query -------  325
ident        
Sbjct gnevvtq  334
DSSP  leeeeel


No 21: Query=2dvtA Sbjct=3griA Z-score=15.4

back to top
DSSP  --------------------------------------------------LLLEEEEEEE
Query --------------------------------------------------MQGKVALEEH   10
ident                                                     | |    |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  -ELLHhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEELllhhhhlll
Query -FAIPetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSLNapavqaipd   69
ident                              |     |     |  |     |         
Sbjct lREPG----------------gEYKE--TIET-GTKAAARGGFTTVCPXPN---------   92
DSSP  lLLLL----------------lLLLL--LHHH-HHHHHHHLLEEEEEELLL---------


DSSP  hhhhhhhHHHHHHHHHHHHHHLL-LLEEEEELLL----LLLHhhhhHHHHHHHHlLLLLE
Query rrkaieiARRANDVLAEECAKRP-DRFLAFAALP----LQDPdaatEELQRCVNdLGFVG  124
ident               |          | |  |                     |   |   
Sbjct -trpvpdSVEHFEALQKLIDDNAqVRVLPYASITtrqlGKEL----VDFPALVK-EGAFA  146
DSSP  -llllllLHHHHHHHHHHHHHHLlLEELLLEELLhhhlLLLL----LLHHHHHL-LLLLL


DSSP  EEEELLLlllllllllLLLLhHHHHHHHHHHHHLLLEEEELLLLLhhhlhhhlllHHHLH
Query ALVNGFSqegdgqtplYYDLpQYRPFWGEVEKLDVPFYLHPRNPLpqdsriydghPWLLG  184
ident     |                       |  |       |                    
Sbjct FTDDGVG--------vQTAS-XXYEGXIEAAKVNKAIVAHCEDNS--------liYGGAX  189
DSSP  EEELLLL--------lLLHH-HHHHHHHHHHHHLLLEEELLLLHH--------hlLLLLE


DSSP  H-----------HLHHhHHHHHHHHHHHhlLHHHHLLlLLEEELhHHLL--HHHHhhhhh
Query P-----------TWAFaQETAVHALRLMasGLFDEHPrLNIILGhMGEG--LPYMmwrid  231
ident                      |   |     |                            
Sbjct HegkrskelgipGIPN-ICESVQIARDV--LLAEAAG-CHYHVC-HVSTkeSVRV-----  239
DSSP  EllhhhhhhlllEELL-HHHHHHHHHHH--HHHHHHL-LLEEEL-LLLLhhHHHH-----


DSSP  hllllllllllllllllhHHHHH--HHEEEELL-LLLL----------------------
Query hrnawvklpprypakrrfMDYFN--ENFHITTS-GNFR----------------------  266
ident                    |                                        
Sbjct -----------------iRDAKRagIHVTAEVTpHHLLlteddipgnnaiykxnpplrst  282
DSSP  -----------------hHHHHHllLLEEEEELhHHHHllhhhlllllhhhllllllllh


DSSP  --hHHHHHH-HLLLlhhHEELLLLLL----------------LLLH-HHHHHHHHHLL--
Query --tQTLIDA-ILEIgadRILFSTDWP----------------FENI-DHASDWFNATS--  304
ident      |                ||                         |          
Sbjct edrEALLEGlLDGT---IDCIATDHAphardekaqpxekapfGIVGsETAFPLLYTHFvk  339
DSSP  hhhHHHHHHhHLLL---LLEELLLLLlllhhhhlllllllllLLLLlLLHHHHHHHHHll


DSSP  ---LLHHHHHHHHLHHHHHHLLLL------------------------------------
Query ---IAEADRVKIGRTNARRLFKLD------------------------------------  325
ident          |          | |                                     
Sbjct ngdWTLQQLVDYLTIKPCETFNLEygtlkengyadltiidldseqeikgedflskadntp  399
DSSP  lllLLHHHHHHHHLHHHHHHLLLLllllllllllleeeeelllleellhhhlllllllll


DSSP  -----------------------
Query -----------------------  325
ident                        
Sbjct figykvygnpiltxvegevkfeg  422
DSSP  lllleelleeeeeeelleeeeel


No 22: Query=2dvtA Sbjct=1onxA Z-score=15.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  LLLEEEEEEEELlhhhhhHHLLlllllhHHHHhhhHHLLllhHHHHHHHLLEEEEEEEEL
Query MQGKVALEEHFAipetlqDSAGfvpgdyWKELqhrLLDIqdtRLKLMDAHGIETMILSLN   60
ident   |      |          ||                     |      |       | 
Sbjct CPGFIDQHVHLI---gggGEAG------PTTR---TPEV---ALSRLTEAGVTSVVGLLG  105
DSSP  EELEEEEEELLL---lllLLLL------HHHL---LLLL---LHHHHHHLLEEEEEELLL


DSSP  LLHhhhlllhhhhhhhhhHHHHHHHHHHHHLL---LLEEEEEL-LLLLlhhhhhHHHHHH
Query APAvqaipdrrkaieiarRANDVLAEECAKRP---DRFLAFAA-LPLQdpdaatEELQRC  116
ident                   |    |                                    
Sbjct TDS-------------isRHPESLLAKTRALNeegISAWMLTGaYHVP-srtitGSVEKD  151
DSSP  LLL-------------llLLHHHHHHHHHHHHhhlLEEEEEEElLLLL-lllllLLHHHH


DSSP  HHLLL-LLEEEEELlllllllllLLLLLLhhHHHHHHHHHHHL------LLEEEELllll
Query VNDLG-FVGALVNGfsqegdgqtPLYYDLpqYRPFWGEVEKLD------VPFYLHPrnpl  169
ident |       |                            |                |     
Sbjct VAIIDrVIGVXCAI----sdhrsAAPDVY-hLANMAAESRVGGllggkpGVTVFHM----  202
DSSP  HHHLLlEEEEEEEE----lllllLLLLHH-hHHHHHHHHHHHHhhhlllLEEEEEE----


DSSP  hhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhlLHHH-HLLLL-LEEELHHHLL--HHH
Query pqdsriydghpwllgptwaFAQEtaVHALRLMasGLFD-EHPRL-NIILGHMGEG--LPY  225
ident                                    |              |      |  
Sbjct -------------------GDSK--KALQPIY--DLLEnCDVPIsKLLPTHVNRNvpLFE  239
DSSP  -------------------LLLL--LLLHHHH--HHHHlLLLLHhHEEEELHHHLhhHHH


DSSP  HhhhhhhllllllllllllllllhhHHHH-HHEEEELLLL----LLHHHHHHHHLL-LLH
Query MmwridhrnawvklpprypakrrfmDYFN-ENFHITTSGN----FRTQTLIDAILE-IGA  279
ident                                     ||              |    |  
Sbjct Q----------------------alEFARkGGTIDITSSIdepvAPAEGIARAVQAgIPL  277
DSSP  H----------------------hhHHHHlLLLEEEELLLllllLHHHHHHHHHHLlLLH


DSSP  HHEELLLLLLL----------------LLHHHHHHHHHHLL----LLHHHHHHHHLHHHH
Query DRILFSTDWPF----------------ENIDHASDWFNATS----IAEADRVKIGRTNAR  319
ident  |   | |                                         |          
Sbjct ARVTLSSDGNGsqpffddegnlthigvAGFETLLETVQVLVkdydFSISDALRPLTSSVA  337
DSSP  HHEEEELLLLLeeeeellllleeeeeeLLLHHHHHHHHHHHhhhlLLHHHHHHHHLHHHH


DSSP  HHLLLL-----------------------------------------------
Query RLFKLD-----------------------------------------------  325
ident     |                                                
Sbjct GFLNLTgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  HHLLLLlllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 23: Query=2dvtA Sbjct=3k2gB Z-score=15.3

back to top
DSSP  -------------------------llLEEEEEEE-ELLHhhhHHHLL------------
Query -------------------------mqGKVALEEH-FAIPetlQDSAG------------   22
ident                            |     ||                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDC---RCWWNppqeperqylae   57
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEEL---HHHLLllllhhhhhhhh


DSSP  --------------LLLLlhHHHHHhhHHLL--LLHHHHHHHHLLEEEEEEEElllhhhh
Query --------------FVPGdyWKELQhrLLDI--QDTRLKLMDAHGIETMILSLnapavqa   66
ident                            | |        |   | |               
Sbjct apisieilselrqdPFVN--KHNIA--LDDLdlAIAEVKQFAAVGGRSIVDPT-------  106
DSSP  llllhhhhhhhhllHHHL--LLLLE--ELLHhhHHHHHHHHHHLLLLEEEELL-------


DSSP  lllhhhhhhhhhhhhhHHHHHHHHLL----LLEEEEELL----------llLLHHHHHHH
Query ipdrrkaieiarrandVLAEECAKRP----DRFLAFAAL----------plQDPDAATEE  112
ident                                     |                 |    |
Sbjct -----------crgigRDPVKLRRISaetgVQVVXGAGYylassxpetaarLSADDIADE  155
DSSP  -----------lllllLLHHHHHHHHhhhlLEEEELLLLllhhhllhhhhlLLHHHHHHH


DSSP  HHHHHHL------LLLLEEE-EELLllllllllLLLLllhhhHHHHHHHHHHLLLEEEEL
Query LQRCVND------LGFVGAL-VNGFsqegdgqtPLYYdlpqyRPFWGEVEKLDVPFYLHP  165
ident                                           |           |   | 
Sbjct IVAEALEgtdgtdARIGLIGeIGVS----sdftAEEE--kslRGAARAQVRTGLPLXVHL  209
DSSP  HHHHHHLllllllLLLLLEEeELLL----llllHHHH--hhhHHHHHHHHHHLLLEEELL


DSSP  llllhhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLLHHhHLLLL--LEEELHhHLLH
Query rnplpqdsriydghpwllgptwaFAQEtaVHALRLMaSGLFdEHPRL--NIILGHmGEGL  223
ident                                | |        |         | |     
Sbjct -----------------------PGWF--RLAHRVL-DLVE-EEGADlrHTVLCH-XNPS  241
DSSP  -----------------------LLLL--LLHHHHH-HHHH-HLLLLhhHEEELL-LHHH


DSSP  HHHHHhhhhllllllllllllllllhHHHHHHHEEEELLLLL-----------------L
Query PYMMWridhrnawvklpprypakrrfMDYFNENFHITTSGNF-----------------R  266
ident                                                             
Sbjct HXDPV-------------------yqATLAQRGAFLEFDXIGxdffyadqgvqcpsddeV  282
DSSP  LLLHH-------------------hhHHHHHHLLEEEELLLLllleelllleelllhhhH


DSSP  HHHHHHHHLLLLHHHEELLLLLLL---------LLHHHHH-HHHHHLL---LLHHHHHHH
Query TQTLIDAILEIGADRILFSTDWPF---------ENIDHAS-DWFNATS---IAEADRVKI  313
ident              |||| | |                                 |     
Sbjct ARAILGLADHGYLDRILLSHDVFVkxxltryggNGYAFVTkHFLPRLRrhgLDDAALETL  342
DSSP  HHHHHHHHHLLLHHHEEELLLLLLhhhlhhhllLLLLHHHhLHHHHHHhllLLHHHHHHH


DSSP  HLHHHHHHLLLL----
Query GRTNARRLFKLD----  325
ident   || || |       
Sbjct XVTNPRRVFDASiegh  358
DSSP  HLHHHHHHHLLLllll


No 24: Query=2dvtA Sbjct=3pnuA Z-score=15.1

back to top
DSSP  -----------LLLEEEEEEEellhhhhhhhlllllllhhhhhhhHHHL-lLLHHHHHHH
Query -----------MQGKVALEEHfaipetlqdsagfvpgdywkelqhRLLD-iQDTRLKLMD   48
ident                     |                                    |  
Sbjct enlyfqsnamkLKNPLDMHLH------------------------LRDNqmLELIAPLSA   36
DSSP  llllllllleeEELLEEEEEL------------------------LLLHhhHHHHHHHHH


DSSP  HLlEEEEEEEELllhhhhlllhhhhhhHHHHHHHHHHHHHHHLL-------LLEEEEELL
Query AHgIETMILSLNapavqaipdrrkaieIARRANDVLAEECAKRP-------DRFLAFAAL  101
ident            |                       |                  |     
Sbjct RD-FCAAVIMPN-------------liPPLCNLEDLKAYKMRILkackdenFTPLMTLFF   82
DSSP  LL-LLEEEELLL-------------llLLLLLHHHHHHHHHHHHhhhllllLEEEEEEEL


DSSP  LLllhhHHHHHHHHHHHllLLLEEEEELLL-llllllllLLLLLHHHHHHHHHHHHHLLL
Query PLqdpdAATEELQRCVNdlGFVGALVNGFS-qegdgqtpLYYDLPQYRPFWGEVEKLDVP  160
ident            |          |                   |     |       |  |
Sbjct KN----YDEKFLYSAKD--EIFGIXLYPAGittnsnggvSSFDIEYLKPTLEAMSDLNIP  136
DSSP  LL----LLHHHHHHHLL--LLLEEEELLLLlllllllllLLLLHHHHHHHHHHHHHLLLL


DSSP  EEEELLLLLhhhlhhhlllhhhlhhHLHHHHHHHHHHHHHhhllhHHHLLLLLEEELHHH
Query FYLHPRNPLpqdsriydghpwllgpTWAFAQETAVHALRLmasglFDEHPRLNIILGHMG  220
ident    |                             |     |         ||| |   |  
Sbjct LLVHGETND---------------fVMDRESNFAKIYEKL-----AKHFPRLKIVMEHIT  176
DSSP  EEELLLLLL---------------lHHHLLHHHHHHHHHH-----HHHLLLLLEEELLLL


DSSP  L-LHHHhhhhhhhllllllllllllllllHHHHhhHHEEEELLLLLLH------------
Query E-GLPYmmwridhrnawvklpprypakrrFMDYfnENFHITTSGNFRT------------  267
ident    |                           ||  ||   |                   
Sbjct TkTLCE----------------------lLKDY--ENLYATITLHHLIitlddviggkmn  212
DSSP  LhHHHH----------------------hHHHL--LLEEEEELLHHHLllhhhhhlllll


DSSP  ---------------HHHHHHHlllLHHHEELLLLLL---------LLLHHHHHHHHHHL
Query ---------------QTLIDAIleiGADRILFSTDWP---------FENIDHASDWFNAT  303
ident                  |       |     |  |                         
Sbjct phlfckpiakryedkEALCELA-fsGYEKVMFGSDSAphpkgcaagVFSAPVILPVLAEL  271
DSSP  hhhllllllllhhhhHHHHHHH-hlLLLLEEELLLLLlllllllllLLLHHHHHHHHHHH


DSSP  ---LLLHHHHHHHHLHHHHHHLLLL-----------------------------------
Query ---SIAEADRVKIGRTNARRLFKLD-----------------------------------  325
ident       |    |    |      |                                    
Sbjct fkqNSSEENLQKFLSDNTCKIYDLKfkedkiltleekewqvpnvyedkynqvvpymagei  331
DSSP  hhhHLLHHHHHHHHLHHHHHHHLLLllllleeeeellleelllleelllleellllllle


DSSP  -------
Query -------  325
ident        
Sbjct lkfqlkh  338
DSSP  elleell


No 25: Query=2dvtA Sbjct=2ob3A Z-score=14.9

back to top
DSSP  -------------llLEEEEEEE-ELLHHHHHhhllllllLHHHhhhhhhhllLLHHHHH
Query -------------mqGKVALEEH-FAIPETLQdsagfvpgDYWKelqhrlldiQDTRLKL   46
ident                |     ||                                  |  
Sbjct drintvrgpitiseaGFTLTHEHiCGSSAGFL----rawpEFFG-srkalaekAVRGLRR   55
DSSP  lleeelleeelhhhhLLEEEEELlEELLLLHH----hhlhHHHL-lhhhhhhhHHHHHHH


DSSP  HHHLLEEEEEEEElllhhhhlllhhhhhhhHHHHhhHHHHHHHHLL----LLEEEEELL-
Query MDAHGIETMILSLnapavqaipdrrkaieiARRAndVLAEECAKRP----DRFLAFAAL-  101
ident   | |  |                                  |           |   | 
Sbjct ARAAGVRTIVDVS-----------------TFDI-gRDVSLLAEVSraadVHIVAATGLw   97
DSSP  HHHLLLLEEEELL-----------------LHHH-lLLHHHHHHHHhhhlLEEELEEELl


DSSP  -------llLLHHHHHHHHHHHHHLL------LLLEEEEELLllllllllLLLLllhhhH
Query -------plQDPDAATEELQRCVNDL------GFVGALVNGFsqegdgqtPLYYdlpqyR  148
ident                |    |                 |           |         
Sbjct fdpplsmrlRSVEELTQFFLREIQYGiedtgiRAGIIXVATT----gkatPFQE--lvlK  151
DSSP  llllhhhhlLLHHHHHHHHHHHHHLLllllllLLLEEEEELL----llllHHHH--hhhH


DSSP  HHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLLHHHH
Query PFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtaVHALRLMaSGLFDE  208
ident           ||   |                         |                 |
Sbjct AAARASLATGVPVTTHT-----------------------AASQ--RDGEQQA-AIFESE  185
DSSP  HHHHHHHHHLLLEEEEL-----------------------LHHH--LHHHHHH-HHHHHL


DSSP  LLLL-LEEELHHHLLHHHHHhhhhhllllllllllllllllhHHHHHHHEEEELLLLL--
Query HPRL-NIILGHMGEGLPYMMwridhrnawvklpprypakrrfMDYFNENFHITTSGNF--  265
ident          ||                                        |        
Sbjct GLSPsRVCIGHSDDTDDLSY---------------------lTALAARGYLIGLDHIPys  224
DSSP  LLLHhHEEELLHHHLLLHHH---------------------hHHHHHLLLEEEELLLLll


DSSP  ---------------------LHHHHHHHHLLLLHHHEELLLLLL---------------
Query ---------------------RTQTLIDAILEIGADRILFSTDWP---------------  289
ident                      |       |       || | ||                
Sbjct aiglednasasallgirswqtRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdvmd  284
DSSP  lllllllhhhhhhhllllhhhHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhhhh


DSSP  ---llLHHHHHHHHHHLL----LLHHHHHHHHLHHHHHHLL--ll
Query ---feNIDHASDWFNATS----IAEADRVKIGRTNARRLFK--ld  325
ident                               |  ||  |       
Sbjct rvnpdGMAFIPLRVIPFLrekgVPQETLAGITVTNPARFLSptlr  329
DSSP  hhlllHHHHHHHLHHHHHhhllLLHHHHHHHHLHHHHHHHLllll


No 26: Query=2dvtA Sbjct=2pajA Z-score=14.7

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------M    1
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLEEEEEEEEL---lhhhhHHHLllllllhhhhhhhhhHLLLlHHHHHHHHLLEEEEEEE
Query QGKVALEEHFA---ipetlQDSAgfvpgdywkelqhrlLDIQdTRLKLMDAHGIETMILS   58
ident    |    |                             |      |      |  |    
Sbjct PAWVNTHHHLFqsllkgepFRAL--------fderrfrLAAR-IGLIELARSGCATVADH  111
DSSP  ELEELLLLLHHhhhlllllLHHH--------llhhhhhHHHH-HHHHHHHLLLEEEEEEL


DSSP  EllLHHHhlllhHHHHhhhhHHHHHHHHHHHHLLLLEEEEELLLL---------------
Query LnaPAVQaipdrRKAIeiarRANDVLAEECAKRPDRFLAFAALPL---------------  103
ident                          | ||  |   ||                       
Sbjct N--YVYY-----PGMP---fDSSAILFEEAEKLGLRFVLLRGGATqtrqleadlptalrp  161
DSSP  L--LLLL-----LLLL---lLHHHHHHHHHHHLLLEEEEEELLLLllllllllllhhhll


DSSP  LLHHHHHHHHHHHHHLLL--------LLEEE-EELLLllllllllllLLLHHHHHHHHHH
Query QDPDAATEELQRCVNDLG--------FVGAL-VNGFSqegdgqtplyYDLPQYRPFWGEV  154
ident    ||      |               |                         |      
Sbjct ETLDAYVADIERLAARYHdaspramrRVVMApTTVLY---------sISPREMRETAAVA  212
DSSP  LLHHHHHHHHHHHHHHLLllllllleEEEELlLLLLL---------lLLHHHHHHHHHHH


DSSP  HHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhhhHHHHHHHHLlhhhhllllLE
Query EKLDVPFYLHPrnplpqdsriydghpwllgptwafaqetaVHALRLMASglfdehprlNI  214
ident   |      |                                                  
Sbjct RRLGLRMHSHL--------------------------sgkSPVAFCGEH----dwlgsDV  242
DSSP  HHLLLEEEEEL--------------------------lllLHHHHHHHL----lllllLE


DSSP  EELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEEEELL--LLLLhhHHH
Query ILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFHITTS--GNFRtqTLI  271
ident    |                                                | |     
Sbjct WYAH-LVKVDADE----------------------iALLAqTGTGVAHCpqSNGR-lPVR  278
DSSP  EEEL-LLLLLHHH----------------------hHHHHhHLLEEEELhhHHHL-lLLL


DSSP  HHHLLLLhhHEELLLLLL--LLLH--HHHHHHHHHLL----LLHHHHHHHHLHHHHHHLL
Query DAILEIGadRILFSTDWP--FENI--DHASDWFNATS----IAEADRVKIGRTNARRLFK  323
ident                |     |                      |     |     |   
Sbjct EMADAGV--PVSIGVDGAasNEAAdmISEVHMTWLAQrarlASIAEVIHWGTAGGARVMG  336
DSSP  LHHHHLL--LEEELLLHHhhLLLLlhHHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHL


DSSP  LL----------------------------------------------------------
Query LD----------------------------------------------------------  325
ident ||                                                          
Sbjct LDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddli  396
DSSP  LLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeellll


DSSP  -------------------------
Query -------------------------  325
ident                          
Sbjct egvdikelggearrvvrellrevvv  421
DSSP  llllhhhhhhhhhhhhhhhhhhhhl


No 27: Query=2dvtA Sbjct=2vc5A Z-score=14.4

back to top
DSSP  --------------llLEEEEEEE-ELLHHHHHhhlllllllhhhhhhhhhhLLLLhHHH
Query --------------mqGKVALEEH-FAIPETLQdsagfvpgdywkelqhrllDIQDtRLK   45
ident                 |     ||     |                             |
Sbjct mriplvgkdsieskdiGFTLIHEHlRVFSEAVR-----qqwphlynedeefrNAVN-EVK   54
DSSP  llllllllllllhhhlLLEELLLLlLLLLHHHH-----hhlhhhllhhhhhhHHHH-HHH


DSSP  HHHHLLEEEEEEEElllhhhhlllhhhhhhhHHHHHhhHHHHHHHLL----LLEEEEELL
Query LMDAHGIETMILSLnapavqaipdrrkaieiARRANdvLAEECAKRP----DRFLAFAAL  101
ident      |  |                                   |          |    
Sbjct RAMQFGVKTIVDPT----------------vMGLGR--DIRFMEKVVkatgINLVAGTGI   96
DSSP  HHHHLLLLEEEELL----------------lLLLLL--LHHHHHHHHhlllLEEEELEEL


DSSP  ----------llllHHHHHHHHHHHHHLL------LLLEEEEELLllllllllLLLLLlh
Query ----------plqdPDAATEELQRCVNDL------GFVGALVNGFsqegdgqtPLYYDlp  145
ident                |                                            
Sbjct yiyidlpfyflnrsIDEIADLFIHDIKEGiqgtlnKAGFVXIAAD----epgiTKDVE--  150
DSSP  lllllllhhhllllHHHHHHHHHHHHHLLllllllLLLLEEEELL----llllLHHHH--


DSSP  HHHHH-HHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLL
Query QYRPF-WGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtaVHALRLMaSG  204
ident               ||   |                         |       |      
Sbjct KVIRAaAIANKETKVPIITHS-----------------------NAHN--NTGLEQQ-RI  184
DSSP  HHHHHhHHHHHHHLLLEEEEL-----------------------LLLL--LHHHHHH-HH


DSSP  HHHHLLLL-LEEELHHHLLhHHHHhhhhhllllllllllllllllhHHHHHHHEEEELLL
Query LFDEHPRL-NIILGHMGEGlPYMMwridhrnawvklpprypakrrfMDYFNENFHITTSG  263
ident |  |      |  || |                                      |    
Sbjct LTEEGVDPgKILIGHLGDTdNIDY---------------------iKKIADKGSFIGLDR  223
DSSP  HHHLLLLHhHEEELLHHHLlLHHH---------------------hHHHHHLLLEEEELL


DSSP  L---------lLHHHHHHHHLLLLHHHEELLLLLL------------------lLLHHHH
Query N---------fRTQTLIDAILEIGADRILFSTDWP------------------fENIDHA  296
ident            |  |    |     | |  | |                       |   
Sbjct YgldlflpvdkRNETTLRLIKDGYSDKIMISHDYCctidwgtakpeykpklaprWSITLI  283
DSSP  LlllllllhhhHHHHHHHHHHLLLLLLEEELLLLLlllllllllhhhhhhhlllLLLLHH


DSSP  HHHHHHLL----LLHHHHHHHHLHHHHHHLLll
Query SDWFNATS----IAEADRVKIGRTNARRLFKld  325
ident               |     |   |    |   
Sbjct FEDTIPFLkrngVNEEVIATIFKENPKKFFS--  314
DSSP  HHLHHHHHhlllLLHHHHHHHHLHHHHHHLL--


No 28: Query=2dvtA Sbjct=3e74A Z-score=14.4

back to top
DSSP  --------------------------------------------------LLLEEEEEEE
Query --------------------------------------------------MQGKVALEEH   10
ident                                                     | |    |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL


DSSP  EllhhhhhhhlllllllhhhhhhhhhhlLLLHHHHHHHHLLEEEEEEEELLlhhhhlllh
Query FaipetlqdsagfvpgdywkelqhrlldIQDTRLKLMDAHGIETMILSLNApavqaipdr   70
ident                                |        || | |              
Sbjct I---------------------------GYETGTRAAAKGGITTXIEXPLN---------   84
DSSP  L---------------------------LHHHHHHHHHHLLEEEEEELLLL---------


DSSP  hhhhhhHHHHHHHHHHHHHHL-lLLEEEEELLLLllhhHHHHHHHHHHHlLLLLEEEEEL
Query rkaieiARRANDVLAEECAKR-pDRFLAFAALPLqdpdAATEELQRCVNdLGFVGALVNG  129
ident        |                       |           |       | ||     
Sbjct qlpatvDRASIELKFDAAKGKltIDAAQLGGLVS----YNIDRLHELDE-VGVVGFXCFV  139
DSSP  llllllLHHHHHHHHHHHLLLllLEEEELEELLL----LLLLLHHHHHH-HLLLLEEEEL


DSSP  LLllllllllllllLHHH-HHHHHHHHHHLLLEEEEL-lLLLHHHLHHHLL-------LH
Query FSqegdgqtplyydLPQY-RPFWGEVEKLDVPFYLHP-rNPLPQDSRIYDG-------HP  180
ident                             |  |   |                      | 
Sbjct RD-----------vNDWQfFKGAQKLGELGQPVLVHCenALICDELGEEAKregrvtaHD  188
DSSP  LL-----------lLHHHhHHHHHHHHHHLLLEEEELllHHHHHHHHHHHHhhllllhHH


DSSP  HHLhhhlhhHHHHHHHHHHHHhlLHHHHLLlLLEEELhHHLL--HHHHhhhhhhllllll
Query WLLgptwafAQETAVHALRLMasGLFDEHPrLNIILGhMGEG--LPYMmwridhrnawvk  238
ident                   |     |                                   
Sbjct YVA---srpVFTEVEAIRRVL--YLAKVAG-CRLHVC-HVSSpeGVEE------------  229
DSSP  HHH---lllHHHHHHHHHHHH--HHHHHHL-LLEEEL-LLLLhhHHHH------------


DSSP  llllllllllhHHHHH--HHEEEELL-LLLL-------------------------hHHH
Query lpprypakrrfMDYFN--ENFHITTS-GNFR-------------------------tQTL  270
ident                              |                              
Sbjct ----------vTRARQegQDITCESCpHYFVldtdqfeeigtlakcsppirdlenqkGXW  279
DSSP  ----------hHHHHHllLLEEEEELlHHHHllhhhhhhhlhhhllllllllhhhhhHHH


DSSP  HHHHLLLlhhHEELLLLLL-----------------LLLHHHHHHHHHHLL-----LLHH
Query IDAILEIgadRILFSTDWP-----------------FENIDHASDWFNATS-----IAEA  308
ident                 |                           |               
Sbjct EKLFNGE---IDCLVSDHSpcppexkagnixkawggIAGLQSCXDVXFDEAvqkrgXSLP  336
DSSP  HHHHLLL---LLEELLLLLlllllllllllllllllLLLHHHHHHHHHHHHlllllLLHH


DSSP  HHHHHHLHHHHHHLLLL-------------------------------------------
Query DRVKIGRTNARRLFKLD-------------------------------------------  325
ident    |   |||   | |                                            
Sbjct XFGKLXATNAADIFGLQqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrti  396
DSSP  HHHHHHLHHHHHHLLLLlllllllllllleeeeelllleellhhhlllllllllllllee


DSSP  ---------------------------------
Query ---------------------------------  325
ident                                  
Sbjct garitktilrgdviydieqgfpvapkgqfilkh  429
DSSP  lleeeeeeelleeeeelllllllllllleelll


No 29: Query=2dvtA Sbjct=3ls9A Z-score=14.2

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------MQGKV    5
ident                                                          |  
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  EEEEEELlhhhhhhhllLLLLLHHH----------------------hhhhhhHLLLlHH
Query ALEEHFAipetlqdsagFVPGDYWK----------------------elqhrlLDIQdTR   43
ident     |              |                                        
Sbjct NSHQHLY-----egamrAIPQLERVtmaswlegvltrsagwwrdgkfgpdvirEVAR-AV  114
DSSP  EEEELHH-----hhhhlLLHHHLLLlhhhhhhhhhhhhhhhhhlllllhhhhhHHHH-HH


DSSP  HHHHHHLLEEEEEEEEllLHHHhlllhHHHHHhhhHHHHHHHHHHHHLLLLEEEEELLLL
Query LKLMDAHGIETMILSLnaPAVQaipdrRKAIEiarRANDVLAEECAKRPDRFLAFAALPL  103
ident |      || |                           |   |       || |      
Sbjct LLESLLGGITTVADQH--LFFP-----GATAD---SYIDATIEAATDLGIRFHAARSSMT  164
DSSP  HHHHHHLLEEEEEEEE--LLLL-----LLLLL---LHHHHHHHHHHHHLLEEEEEELLLL


DSSP  --------------LLHHHHHHHHHHHHHLLL--------LLEEEEELLlllllllllLL
Query --------------QDPDAATEELQRCVNDLG--------FVGALVNGFsqegdgqtpLY  141
ident                  |                             |            
Sbjct lgkseggfcddlfvEPVDRVVQHCLGLIDQYHepepfgmvRIALGPCGV--------pYD  216
DSSP  llhhhlllllhhhlLLHHHHHHHHHHHHHHHLllllllleEEEELLLLL--------lLL


DSSP  LLLhhHHHHHHHHHHHLLLEEEElllllhhhlhhhlllhhhlhhhlhHHHH--------h
Query YDLpqYRPFWGEVEKLDVPFYLHprnplpqdsriydghpwllgptwaFAQE--------t  193
ident         |       ||    |                                     
Sbjct KPE-lFEAFAQMAADYDVRLHTH----------------------fyEPLDagmsdhlyg  253
DSSP  LHH-hHHHHHHHHHHHLLEEEEE----------------------elLLLHhhhhhhhhl


DSSP  hHHHHHHhhLLHHhhllLLLEEELhHHLLhhHHHHhhhhllllllllllllllllHHHHH
Query aVHALRLmaSGLFdehpRLNIILGhMGEGlpYMMWridhrnawvklpprypakrrFMDYF  253
ident       |               |                                    |
Sbjct mTPWRFL--EKHG--waSDRVWLA-HAVV--PPRE--------------------EIPEF  286
DSSP  lLHHHHH--HHLL--llLLLEEEE-ELLL--LLHH--------------------HHHHH


DSSP  H-HHEEEELLLL------llhhHHHHHHLLLLhhHEELLLLLLL--LLHHhHHHHHH---
Query N-ENFHITTSGN------frtqTLIDAILEIGadRILFSTDWPF--ENIDhASDWFN---  301
ident       |                              | |                    
Sbjct AdAGVAIAHLIApdlrmgwglaPIREYLDAGI--TVGFGTTGSAsnDGGN-LLGDLRlaa  343
DSSP  HhHLLEEEELHHhhhhllllllLHHHHHHLLL--EEEELLLLLLllLLLL-HHHHHHhhh


DSSP  -----------hlLLLHHHHHHHHLHHHHH-HLLLL------------------------
Query -----------atSIAEADRVKIGRTNARR-LFKLD------------------------  325
ident                                |   |                        
Sbjct lahrpadpnepekWLSARELLRMATRGSAEcLGRPDlgvleegraadiacwrldgvdrvg  403
DSSP  hhlhhhllllhhhLLLHHHHHHHLLHHHHHhLLLLLllllllllllleeeeelllhhhll


DSSP  --------------------------------------------------
Query --------------------------------------------------  325
ident                                                   
Sbjct vhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 30: Query=2dvtA Sbjct=3giqA Z-score=14.2

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------MQGKVA    6
ident                                                         |   
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  EEEEELlhhhhhhhlllllllhhhhhhhhHHLL-LLHHhHHHHHLLEEEEEEEelllhhh
Query LEEHFAipetlqdsagfvpgdywkelqhrLLDI-QDTRlKLMDAHGIETMILSlnapavq   65
ident    |                         |               || |           
Sbjct VHGHDD-----------------------LMFVeKPDL-RWKTSQGITTVVVG-------   89
DSSP  LLLLLL-----------------------LHHHhLLLL-HHHHLLLEEEEEEL-------


DSSP  hlllhhhhhhHHHH--------------------HHHHHHHHHH--HLLLLEEEEEL--L
Query aipdrrkaieIARR--------------------ANDVLAEECA--KRPDRFLAFAA--L  101
ident            |                                         |      
Sbjct -----ncgvsAAPAplpgntaaalallgetplfaDVPAYFAALDaqRPMINVAALVGhaN  144
DSSP  -----lllllLLLLlllllllhhhhhhlllllllLHHHHHHHHHhlLLLLEEEEEEEhhH


DSSP  LLL-------------LHHHHHHHHHHHHHlLLLLEEEEELLLLLlllllLLLLlLHHHH
Query PLQ-------------DPDAATEELQRCVNdLGFVGALVNGFSQEgdgqtPLYYdLPQYR  148
ident                    |    ||      | ||       |                
Sbjct LRLaamrdpqaaptaaEQQAMQDMLQAALE-AGAVGFSTGLAYQP----gAVAQ-AAELE  198
DSSP  HHHhhlllllllllhhHHHHHHHHHHHHHH-HLLLEEEEELLLLL----hHHLL-HHHHH


DSSP  HHHHHHHHHLLLEEEELLlllhhhlhhhlllhhhlhhhlhHHHH-HHHHHHHHHhlLHHH
Query PFWGEVEKLDVPFYLHPRnplpqdsriydghpwllgptwaFAQE-TAVHALRLMasGLFD  207
ident                | |                                          
Sbjct GLARVAAERRRLHTSHIR----------------------NEADgVEAAVEEVL--AIGR  234
DSSP  HHHHHHHHLLLEEEEELL----------------------LLLLlHHHHHHHHH--HHHH


DSSP  HLlLLLEEELhHHLL-------HHHHHhhhhhllllllllllllllllHHHHHH--HHEE
Query EHpRLNIILGhMGEG-------LPYMMwridhrnawvklpprypakrrFMDYFN--ENFH  258
ident                                                             
Sbjct GT-GCATVVS-HHKCmmpqnwgRSRAT------------------lanIDRAREqgVEVA  274
DSSP  HH-LLEEEEL-LLLLllhhhllLHHHH------------------hhhHHHHHHllLLEE


DSSP  EELlLLLL----------------------------------------------------
Query ITTsGNFR----------------------------------------------------  266
ident                                                             
Sbjct LDI-YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrla  333
DSSP  EEE-LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhl


DSSP  ----------HHHHHHHHlllLHHHEELLLLLL------LLLHHHHHHHHHHL------L
Query ----------TQTLIDAIleiGADRILFSTDWP------FENIDHASDWFNAT------S  304
ident                               |                             
Sbjct pagaiyfamdEDEVKRIF---QHPCCMVGSDGLpndarpHPRLWGSFTRVLGRyvrearL  390
DSSP  leeeeeelllHHHHHHHH---HLLLEEELLLLLllllllLLHHHHHHHHHHHHhhhhllL


DSSP  LLHHHHHHHHLHHHHHHLLLL---------------------------------------
Query IAEADRVKIGRTNARRLFKLD---------------------------------------  325
ident       |        | |                                          
Sbjct MTLEQAVARMTALPARVFGFAergvlqpgawadvvvfdpdtvadratwdeptlasvgiag  450
DSSP  LLHHHHHHHHLHHHHHHHLLLlllllllllllleeeelllllllllllllllllllleee


DSSP  -------------------------
Query -------------------------  325
ident                          
Sbjct vlvngaevfpqppadgrpgqvlrax  475
DSSP  eeelleeeellllllllllllllll


No 31: Query=2dvtA Sbjct=3nqbA Z-score=14.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ----------------LLLEEEEEEEELlhhhhhhhlllllllhhhhhhhHHHLLLLhHH
Query ----------------MQGKVALEEHFAipetlqdsagfvpgdywkelqhRLLDIQDtRL   44
ident                   |      |                                  
Sbjct srrdaaqvidaggayvSPGLIDTHXHIE---------------------sSXITPAA-YA   98
DSSP  lllleeeeeelllleeEELEEEEEELHH---------------------hHLLLHHH-HH


DSSP  HHHHHLLEEEEEEEELLlhhhhlllhhhhhHHHHHHHHHHHHHHHHLLLLEEEEELLLLL
Query KLMDAHGIETMILSLNApavqaipdrrkaiEIARRANDVLAEECAKRPDRFLAFAALPLQ  104
ident     | |  |                              |      | |    |     
Sbjct AAVVARGVTTIVWDPHE----------fgnVHGVDGVRWAAKAIENLPLRAILLAPSCVP  148
DSSP  HHHHLLLEEEEEELLHH----------hhhHHLHHHHHHHHHHHLLLLLEEEEEELLLLL


DSSP  --------lhhHHHHHHHHHHHLLLLLEEEEELLlllllllllLLLL-LHHH-HHHHHHH
Query --------dpdAATEELQRCVNDLGFVGALVNGFsqegdgqtpLYYD-LPQY-RPFWGEV  154
ident                 |          |                                
Sbjct sapglerggadFDAAILADLLSWPEIGGIAEIXN--------xRGVIeRDPRxSGIVQAG  200
DSSP  lllllllllllLLHHHHHHHHLLLLEEEEEEELL--------hHHHHlLLHHhHHHHHHH


DSSP  HHHLLLEEEElllllhhhlhhhlllhhhlhhhlhhhhhHHHH----HHHHHHllhhhhll
Query EKLDVPFYLHprnplpqdsriydghpwllgptwafaqeTAVH----ALRLMAsglfdehp  210
ident          |                                         |        
Sbjct LAAEKLVCGH----------------------------ARGLknadLNAFXA--------  224
DSSP  HHHLLEEEEL----------------------------LLLLlhhhHHHHHH--------


DSSP  lLLEEELhHHLL--HHHHhhhhhhllllllllllllllllhhhhHHHHEEEELLLLL---
Query rLNIILGhMGEG--LPYMmwridhrnawvklpprypakrrfmdyFNENFHITTSGNF---  265
ident                                                   |   |     
Sbjct aGVSSDH-ELVSgeDLXA-------------------------kLRAGLTIELRGSHdhl  258
DSSP  lLLLEEL-LLLLhhHHHH-------------------------hHHLLLEEEEELLLhhh


DSSP  LHHHHHHHHLL-lLHHHEELLLLLLL-------lLHHHHHHHHHHLLLLHHHHHHHHLHH
Query RTQTLIDAILE-iGADRILFSTDWPF-------eNIDHASDWFNATSIAEADRVKIGRTN  317
ident                      ||  |          |                      |
Sbjct LPEFVAALNTLghLPQTVTLCTDDVFpddllqggGLDDVVRRLVRYGLKPEWALRAATLN  318
DSSP  HHHHHHHHHHHllLLLLEEEELLLLLhhhhhhllLHHHHHHHHHHLLLLHHHHHHHHLHH


DSSP  HHHHLLLL----------------------------------------------------
Query ARRLFKLD----------------------------------------------------  325
ident |                                                           
Sbjct AAQRLGRSdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvl  378
DSSP  HHHHHLLLlllllllllllleeeellllllleeeeeelleeeeelleelllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct kgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvt  438
DSSP  llllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct hrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggx  498
DSSP  llllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct avasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatl  558
DSSP  eeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhllll


DSSP  -----------------------------
Query -----------------------------  325
ident                              
Sbjct acnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllleelllleeelllleeellleeel


No 32: Query=2dvtA Sbjct=1j6pA Z-score=14.0

back to top
DSSP  -------------------------------------------------lLLEEEEEEEE
Query -------------------------------------------------mQGKVALEEHF   11
ident                                                           | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH


DSSP  L---------lhhhhHHHLLL-llllhhhhhhhhhHLLLLhHHHHHHHLLEEEEEEEEll
Query A---------ipetlQDSAGF-vpgdywkelqhrlLDIQDtRLKLMDAHGIETMILSLna   61
ident                                                 |||         
Sbjct PxtllrgvaedlsfeEWLFSKvlpiedrltekxayYGTIL-AQXEXARHGIAGFVDXY--  117
DSSP  HhhhhllllllllhhHHHHLLhhhhhllllhhhhhHHHHH-HHHHHHLLLEEEEEEEE--


DSSP  lhhhhlllhhhhhhhhhhHHHHHHHHHHHLlLLEE-EEELLLLL--LHHHHHHHHHHHHH
Query pavqaipdrrkaieiarrANDVLAEECAKRpDRFL-AFAALPLQ--DPDAATEELQRCVN  118
ident                        |                |     |     ||     |
Sbjct -----------------fHEEWIAKAVRDF-GXRAlLTRGLVDSngDDGGRLEENLKLYN  159
DSSP  -----------------lLHHHHHHHHHHH-LLEEeEEEEELLLllLLLLHHHHHHHHHH


DSSP  LLL------LLEEE-EELLLlllllllllLLLLhHHHHHHHHHHHHLLLEEEELllllhh
Query DLG------FVGAL-VNGFSqegdgqtplYYDLpQYRPFWGEVEKLDVPFYLHPrnplpq  171
ident          |||                                 |  |   |       
Sbjct EWNgfegriFVGFGpHSPYL---------CSEE-YLKRVFDTAKSLNAPVTIHL------  203
DSSP  HHLlhhhleEEEEEeLLLLL---------LLHH-HHHHHHHHHHHHLLLEEEEE------


DSSP  hlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLLHHhhlLLLLEEELHhHLLHHHHHhhhh
Query dsriydghpwllgptwaFAQEtaVHALRLMaSGLFdehPRLNIILGHmGEGLPYMMwrid  231
ident                     |                      |  |    ||       
Sbjct ---------------yeTSKE-eYDLEDIL-NIGL---KEVKTIAAH-CVHLPERY----  238
DSSP  ---------------llLLLL-lLLLHHHH-LLLL---LLLLEEEEE-LLLLLHHH----


DSSP  hllllllllllllllllhHHHHHHHEEEELLLL------llhhHHHHHHLLLLhhHEELL
Query hrnawvklpprypakrrfMDYFNENFHITTSGN------frtqTLIDAILEIGadRILFS  285
ident                          |                      |           
Sbjct -----------------fGVLKDIPFFVSHNPAsnlklgngiaPVQRXIEHGX--KVTLG  279
DSSP  -----------------hHHHLLLLEEEEELHHhhhhllllllLHHHHHHLLL--EEEEL


DSSP  LLLL-LLLH---HHHHHHHHHL-------LLLHHHHHHHHLHHHHHHLLLL---------
Query TDWP-FENI---DHASDWFNAT-------SIAEADRVKIGRTNARRLFKLD---------  325
ident ||     |                             |                      
Sbjct TDGAaSNNSlnlFFEXRLASLLqkaqnprNLDVNTCLKXVTYDGAQAXGFKsgkieegwn  339
DSSP  LLLLlLLLLllhHHHHHHHHHHhhlllllLLLHHHHHHHHLHHHHHHHLLLlllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct adlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrela  399
DSSP  lleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhh


DSSP  --------
Query --------  325
ident         
Sbjct riekelys  407
DSSP  hhhhhhhl


No 33: Query=2dvtA Sbjct=1k6wA Z-score=13.9

back to top
DSSP  --------------------------------------------------LLLEEEEEEE
Query --------------------------------------------------MQGKVALEEH   10
ident                                                       |    |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  ELlhhhhhhHLLL--LLLLH--------------hhhhhhhhHLLLlHHHHHHHHLLEEE
Query FAipetlqdSAGF--VPGDY--------------wkelqhrlLDIQdTRLKLMDAHGIET   54
ident           ||                                     ||   | ||  
Sbjct LD----ttqTAGQpnWNQSGtlfegierwaerkallthddvkQRAW-QTLKWQIANGIQH  115
DSSP  LL----lllLLLLllLLLLLlhhhhhhhhhllhhhllhhhhhHHHH-HHHHHHHHLLEEE


DSSP  EEEEElllhhhhlllhhhHHHHhHHHHHHHHHHHHHLL--LLEEEEELL--LLLLHHHHH
Query MILSLnapavqaipdrrkAIEIaRRANDVLAEECAKRP--DRFLAFAAL--PLQDPDAAT  110
ident                          |     |              |             
Sbjct VRTHV-----------dvSDAT-LTALKAMLEVKQEVApwIDLQIVAFPqeGILSYPNGE  163
DSSP  EEEEE-----------elLLLL-LHHHHHHHHHHHHHLllLEEEEEEELllLLLLLLLHH


DSSP  HHHHHHHHlLLLLEEEEE-LLLLlllllLLLLLLLhhHHHHHHHHHHHLLLEEEElllll
Query EELQRCVNdLGFVGALVN-GFSQegdgqTPLYYDLpqYRPFWGEVEKLDVPFYLHprnpl  169
ident   |      ||         |       |  |              | |     |     
Sbjct ALLEEALR-LGADVVGAIpHFEF-----TREYGVE-sLHKTFALAQKYDRLIDVH-----  211
DSSP  HHHHHHHH-LLLLEEEELhHHLL-----LHHHHHH-hHHHHHHHHHHHLLEEEEE-----


DSSP  hhhlhhhlllhhhlhhhlhHHHH-hHHHHHHHHhlLHHHHLLLL-LEEELHhHLLHHHHH
Query pqdsriydghpwllgptwaFAQE-tAVHALRLMasGLFDEHPRL-NIILGHmGEGLPYMM  227
ident                                     |             |         
Sbjct -----------------cdEIDDeqSRFVETVA--ALAHHEGMGaRVTASH-TTAMHSYN  251
DSSP  -----------------elLLLLllLLHHHHHH--HHHHHHLLHhHEEEEE-LHHHHHLL


DSSP  HHHHhlllllllllllllllLHHHHHH-HHEEEELL-LLLL----------hhhhhhHHL
Query WRIDhrnawvklpprypakrRFMDYFN-ENFHITTS-GNFR----------tqtlidAIL  275
ident                     |                                       
Sbjct GAYT---------------sRLFRLLKmSGINFVANpLVNIhlqgrfdtypkrrgitRVK  296
DSSP  HHHH---------------hHHHHHHHhHLLEEEELhHHHHhhllllllllllllllLHH


DSSP  LLL--hHHEELLLLLLL------LLHHhhHHHHHHL----------lLLHHhHHHHHLHH
Query EIG--aDRILFSTDWPF------ENIDhaSDWFNAT----------sIAEAdRVKIGRTN  317
ident |         |  |  |                                           
Sbjct EMLesgINVCFGHDDVFdpwyplGTAN--MLQVLHMglhvcqlmgygQIND-GLNLITHH  353
DSSP  HHHhllLLEEELLLLLLllllllLLLL--HHHHHHHhhhhlllllhhHHHH-HHHHHLHH


DSSP  HHHHLLLL----------------------------------------------------
Query ARRLFKLD----------------------------------------------------  325
ident   |   |                                                     
Sbjct SARTLNLQdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl  413
DSSP  HHHHLLLLllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeel


DSSP  ----------
Query ----------  325
ident           
Sbjct eqpeaidykr  423
DSSP  lleeeellll


No 34: Query=2dvtA Sbjct=3gg7A Z-score=13.8

back to top
DSSP  llLEEEEEEEELlhhhhhhhlllllllhhhhhhhHHHLLLLhHHHHHHHLLEeEEEEEEl
Query mqGKVALEEHFAipetlqdsagfvpgdywkelqhRLLDIQDtRLKLMDAHGIeTMILSLn   60
ident          |                           |               |      
Sbjct --SLIDFHVHLD----------------------LYPDPVA-VARACEERQL-TVLSVT-   33
DSSP  --LLEEEEELHH----------------------HLLLHHH-HHHHHHHLLL-EEEELL-


DSSP  llhhhhlllhhhhhhhHHHHHHHHHHHHHHLlLLEEEEELL---LLLL-HHHHhHHHHHH
Query apavqaipdrrkaieiARRANDVLAEECAKRpDRFLAFAAL---PLQD-PDAAtEELQRC  116
ident                    |        | |                           | 
Sbjct ---------------tTPAAWRGTLALAAGR-PHVWTALGFhpeVVSErAADL-PWFDRY   76
DSSP  ---------------lLHHHHHHHHHHHLLL-LLEEELLLLlhhHLLLlHHHL-HHHHHH


DSSP  HHllLLLEEE-EELLllllLLLLL--LLLLlhhhHHHHHHHHHH-LLLEEEElllllhhh
Query VNdlGFVGAL-VNGFsqegDGQTP--LYYDlpqyRPFWGEVEKL-DVPFYLHprnplpqd  172
ident            |                             |         |        
Sbjct LP--ETRFVGeVGLD-gspSLRGTwtQQFA--vfQHILRRCEDHgGRILSIH--------  123
DSSP  HH--HLLEEEeEELL-llhHHHHHhhHHHH--hhHHHHHHHHHLlLEEEEEE--------


DSSP  lhhhlllhhhlhhhlhHHHHhHHHHHHHhhllhHHHLLL-LLEEELHhHLLHHHHhhhhh
Query sriydghpwllgptwaFAQEtAVHALRLmasglFDEHPR-LNIILGHmGEGLPYMmwrid  231
ident                          |           ||    ||     |         
Sbjct ----------------SRRA-ESEVLNC-----LEANPRsGTPILHW-YSGSVTE-----  155
DSSP  ----------------LLLL-HHHHHHH-----HHHLHHhEEEEEEL-LLLLHHH-----


DSSP  hllllllllllllllllhHHHHHHHEEEELLLLLL-----HHHHHHHhlllLHHHEELLL
Query hrnawvklpprypakrrfMDYFNENFHITTSGNFR-----TQTLIDAileiGADRILFST  286
ident                                                      || |  |
Sbjct -----------------lRRAISLGCWFSVGPTMVrtqkgAALIRSM----PRDRVLTET  194
DSSP  -----------------hHHHHHLLLEEEELHHHHllhhhHHHHHHL----LHHHEEELL


DSSP  LLLL-------LLHHHHHHHHHHL--LLLH---HHHHHHhLHHHHHHLLll
Query DWPF-------ENIDHASDWFNAT--SIAE---ADRVKIgRTNARRLFKld  325
ident | ||                                      |  ||    
Sbjct DGPFleldgqaALPWDVKSVVEGLskIWQIpasEVERIV-KENVSRLLG-t  243
DSSP  LLLLleelleeLLHHHHHHHHHHHhhHHLLlhhHHHHHH-HHHHHHHHH-l


No 35: Query=2dvtA Sbjct=3mtwA Z-score=13.5

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------MQGK    4
ident                                                           | 
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEEEELlhhhhhhhllLLLLlHHHH-hhhhhHLLLLhHHHHHHHLLEEEEEEEELllh
Query VALEEHFAipetlqdsagFVPGdYWKE-lqhrlLDIQDtRLKLMDAHGIETMILSLNapa   63
ident      |                                   |     |  |         
Sbjct IDMHVHLD-----slaevGGYN-SLEYsdrfwsVVQTA-NAKKTLEAGFTTVRNVGA---  110
DSSP  EEEEELLL-----lllllLHHH-HHHLlhhhhhHHHHH-HHHHHHHLLEEEEEELLL---


DSSP  hhhlllhhhhhhhhhhHHHHHHHHHHHLL------lLEEEE-ELLL--------------
Query vqaipdrrkaieiarrANDVLAEECAKRP------dRFLAF-AALP--------------  102
ident                 |                   |                       
Sbjct ----------------ADYDDVGLREAIDagyvpgpRIVTAaISFGatgghcdstffpps  154
DSSP  ----------------LLLHHHHHHHHHHlllllllEEEELlLLEEllllllllllllhh


DSSP  --------LLLHHHHHHHHHHHHHlLLLLEEEEELL----lllllllllLLLLLhhHHHH
Query --------LQDPDAATEELQRCVNdLGFVGALVNGF----sqegdgqtpLYYDLpqYRPF  150
ident            || |           |                                 
Sbjct mdqknpfnSDSPDEARKAVRTLKK-YGAQVIXICATggvfsrgnepgqqQLTYE-eMKAV  212
DSSP  hlllllllLLLHHHHHHHHHHHHH-LLLLEEEEELLlllllllllllllLLLHH-hHHHH


DSSP  HHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHHHhhllhhhhll
Query WGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALRLmasglfdehp  210
ident   |          |                             |                
Sbjct VDEAHMAGIKVAAHA--------------------------hGASGIREA--------vr  238
DSSP  HHHHHHLLLEEEEEE--------------------------lLHHHHHHH--------hh


DSSP  lLLEEELHhHLLHHHHhhhhhhllllllllllllllllhhHHHH-HHEEEELLLLL----
Query rLNIILGHmGEGLPYMmwridhrnawvklpprypakrrfmDYFN-ENFHITTSGNF----  265
ident        |                                                    
Sbjct aGVDTIEH-ASLVDDE----------------------giKLAVqKGAYFSMDIYNtdyt  275
DSSP  lLLLEEEE-LLLLLHH----------------------hhHHHHhHLLEEELLLLLhhhh


DSSP  -----------------------lHHHHHHHHLLLLhhHEELLLLLLLLLHHHHHHhHHH
Query -----------------------rTQTLIDAILEIGadRILFSTDWPFENIDHASDwFNA  302
ident                               |            ||              |
Sbjct qaegkkngvlednlrkdrdigelqRENFRKALKAGV--KMVYGTDAGIYPHGDNAK-QFA  332
DSSP  hhhhhhhlllhhhhhhhhhhhhhhHHHHHHHHHHLL--EEELLLLLLLLLLLLHHH-HHH


DSSP  L----LLLHHHHHHHHLHHHHHHLLLL---------------------------------
Query T----SIAEADRVKIGRTNARRLFKLD---------------------------------  325
ident                    |                                        
Sbjct VmvryGATPLQAIQSATLTAAEALGRSkdvgqvavgrygdmiavagdpladvttlekpvf  392
DSSP  HhhhlLLLHHHHHHHLLHHHHHHHLLLllllllllllllleeeelllllllhhhhhllle


DSSP  ------------
Query ------------  325
ident             
Sbjct vmkggavvkapx  404
DSSP  eeelleeeelll


No 36: Query=2dvtA Sbjct=1a4mA Z-score=13.5

back to top
DSSP  ----LLLEEEEEEEEL------------lhhhhhhhlllLLLLHHHHH------------
Query ----MQGKVALEEHFA------------ipetlqdsagfVPGDYWKEL------------   32
ident        || |  |                         |                    
Sbjct tpafNKPKVELHVHLDgaikpetilyfgkkrgialpadtVEELRNIIGmdkplslpgfla   60
DSSP  llllLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllHHHHHHHHLllllllhhhhhl


DSSP  -------------hhhhhLLLLhHHHHHHHLLEEEEEEEE-lllhhhhllLHHH-----h
Query -------------qhrllDIQDtRLKLMDAHGIETMILSL-napavqaipDRRK-----a   73
ident                                |                  |         
Sbjct kfdyympviagcreaikrIAYE-FVEMKAKEGVVYVEVRYsphllanskvDPMPwnqteg  119
DSSP  lhhhhhhhhlllhhhhhhHHHH-HHHHHHHLLEEEEEEEEllhhhlllllLLLHhhllll


DSSP  hhHHHHHHHHHHHHHHHLL----LLEEEEELLLLLLHHHHHHHHHHhHHLLL---LLEEE
Query ieIARRANDVLAEECAKRP----DRFLAFAALPLQDPDAATEELQRcVNDLG---FVGAL  126
ident         |                           |    | |            |   
Sbjct dvTPDDVVDLVNQGLQEGEqafgIKVRSILCCMRHQPSWSLEVLEL-CKKYNqktVVAMD  178
DSSP  llLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEELLLHHHHHHHHHH-HHHLLlllEEEEE


DSSP  EELLllllllllLLLLlLHHH-HHHHHHHHHHLLLEEEElllllhhhlhhhlllhhhlhh
Query VNGFsqegdgqtPLYYdLPQY-RPFWGEVEKLDVPFYLHprnplpqdsriydghpwllgp  185
ident   |              |            |       |                     
Sbjct LAGD-----etiEGSS-LFPGhVEAYEGAVKNGIHRTVH---------------------  211
DSSP  EELL-----lllLLHH-HLHHhHHHHHHHHHHLLEEEEE---------------------


DSSP  hlhHHHHhHHHHHHHHHLlhhhhlllLLEEELHhHLLHHhHHHHhhhlllllllllllll
Query twaFAQEtAVHALRLMASglfdehprLNIILGHmGEGLPyMMWRidhrnawvklpprypa  245
ident                                || |                         
Sbjct -agEVGS-PEVVREAVDI-------lKTERVGH-GYHTI-EDEA----------------  244
DSSP  -elLLLL-HHHHHHHHHL-------lLLLEEEE-LHHHH-HLHH----------------


DSSP  lllHHHHHH-HHEEEELLLL----------llhHHHHHHHLLLLhhHEELLLLLLL---L
Query krrFMDYFN-ENFHITTSGN----------frtQTLIDAILEIGadRILFSTDWPF---E  291
ident           || |                                     || |     
Sbjct ---LYNRLLkENMHFEVCPWssyltgawdpkttHAVVRFKNDKA--NYSLNTDDPLifkS  299
DSSP  ---HHHHHHhLLLEEEELHHhhhhlllllllllLHHHHHHHLLL--LEEELLLLLLlllL


DSSP  LHHHHHHHH-hHLLLLHHHHHHHhLHHHHHH-LLLL---------------
Query NIDHASDWF-nATSIAEADRVKIgRTNARRL-FKLD---------------  325
ident   |             |         ||    |                  
Sbjct TLDTDYQMTkkDMGFTEEEFKRL-NINAAKSsFLPEeekkellerlyreyq  349
DSSP  LHHHHHHHHhhLLLLLHHHHHHH-HHHHHHLlLLLHhhhhhhhhhhhhhll


No 37: Query=2dvtA Sbjct=2ogjA Z-score=13.4

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------MQGKVA    6
ident                                                         | | 
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE


DSSP  EEEEELlHHHHhhhlllllllhhhhhhhhHHLLllhHHHHHHHLLEEEEEEEELllhhhh
Query LEEHFAiPETLqdsagfvpgdywkelqhrLLDIqdtRLKLMDAHGIETMILSLNapavqa   66
ident |  |     |                                  |  |            
Sbjct LHVHIWhGGTD------------------ISIR---PSECGAERGVTTLVDAGS------   93
DSSP  EEELLLlLLLL------------------LLLL---HHHLLHHHLEEEEEEELL------


DSSP  lllhhhhhhhHHHHHHHHHH-HHHHLLLLEEEEELLL------------LLLHHHH-HHH
Query ipdrrkaieiARRANDVLAE-ECAKRPDRFLAFAALP------------LQDPDAA-TEE  112
ident                    |        |  ||  |             | |        
Sbjct ---------aGEANFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIKDIdLDR  144
DSSP  ---------lLLLLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHHHLlHHH


DSSP  HHHHHHLLL--LLEEEEEL---LLLLlllllLLLLllhhhHHHHHHHHHHLLLEEEELll
Query LQRCVNDLG--FVGALVNG---FSQEgdgqtPLYYdlpqyRPFWGEVEKLDVPFYLHPrn  167
ident    |        ||  |                                | ||   |   
Sbjct ILECYAENSehIVGLXVRAshvITGS-----WGVT---pvKLGKKIAKILKVPXXVHV--  194
DSSP  HHHHHHLLLllEEEEEEEElhhHHLL-----LLLH---hhHHHHHHHHHHLLLEEEEE--


DSSP  llhhhlhhhlllhhhlhhhlhHHHH-HHHHHHHHhhllhhhhllLLLEEELHHHL----L
Query plpqdsriydghpwllgptwaFAQE-TAVHALRLmasglfdehpRLNIILGHMGE----G  222
ident                                |                   |        
Sbjct ---------------------GEPPaLYDEVLEI---------lGPGDVVTHCFNgksgS  224
DSSP  ---------------------LLLLlLHHHHHHH---------lLLLLEEELLLLllllL


DSSP  HHHHHHHHhhllllllllllllllllHHHHhhHHEEEELLL---LLLHHHHHHHH-LLLL
Query LPYMMWRIdhrnawvklpprypakrrFMDYfnENFHITTSG---NFRTQTLIDAI-LEIG  278
ident                                 |            |       ||     
Sbjct SIXEDEDL---------------fnlAERC--EGIRLDIGHggaSFSFKVAEAAIaRGLL  267
DSSP  LLLLLHHH---------------hhhHHHL--LLLEEELLLlllLLLHHHHHHHHhLLLL


DSSP  hhHEELLLLL-LLLL---HHHHHHHHHHL---LLLHHHHHHHHLHHHHHHLLLL------
Query adRILFSTDW-PFEN---IDHASDWFNAT---SIAEADRVKIGRTNARRLFKLD------  325
ident       |||                              |     |      ||      
Sbjct --PFSISTDLhGHSXnfpVWDLATTXSKLlsvDXPFENVVEAVTRNPASVIRLDxenrld  325
DSSP  --LLLLLLLLlLLLLlllLLLHHHHHHHHhhlLLLHHHHHHLLLHHHHHHLLLLllllll


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  325
ident                                                       
Sbjct vgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 38: Query=2dvtA Sbjct=2imrA Z-score=13.3

back to top
DSSP  -----------------------------------------------------LLLEEEE
Query -----------------------------------------------------MQGKVAL    7
ident                                                          |  
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleeLLLLLEE


DSSP  EEEELLhhHHHHHL-----LLLLlLHHHHHHHHHH--LLLLhHHHHHHHLLEEEEEEEEl
Query EEHFAIpeTLQDSA-----GFVPgDYWKELQHRLL--DIQDtRLKLMDAHGIETMILSLn   60
ident   |                   |        |       |          |         
Sbjct HTHLDM--SAYEFQalpyfQWIP-EVVIRGRHLRGvaAAQA-GADTLTRLGAGGVGDIV-  115
DSSP  EEELLL--LHHHHHhlhhhHLLH-HHHHHHLLLLHhhHHHH-HHHHHHHLLLLLEEEEE-


DSSP  llhhhhlllhhhhhhhhhhHHHHHHHHHHhLLLLE-EEEELLLLL----LHHHHHHHHHH
Query apavqaipdrrkaieiarrANDVLAEECAkRPDRF-LAFAALPLQ----DPDAATEELQR  115
ident                    |  |     | | |                           
Sbjct ------------------wAPEVMDALLA-REDLSgTLYFEVLNPfpdkADEVFAAARTH  156
DSSP  ------------------lLHHHHHHHHL-LLLLLeEEEEEELLLlhhhHHHHHHHHHHH


DSSP  HhHLLL-------LLEEE-EELLLllllllllllllLHHH-HHHHHHHHHHLLLEEEELl
Query CvNDLG-------FVGAL-VNGFSqegdgqtplyydLPQY-RPFWGEVEKLDVPFYLHPr  166
ident                |      |                  |           |   |  
Sbjct L-ERWRrlerpglRLGLSpHTPFT-----------vSHRLmRLLSDYAAGEGLPLQIHV-  203
DSSP  H-HHHHlllllleEEEEEeLLLLL-----------lLHHHhHHHHHHHHHHLLLLEEEE-


DSSP  lllhhhlhhhlllhhhlhhHLHHHHH-------------------------------hhH
Query nplpqdsriydghpwllgpTWAFAQE-------------------------------taV  195
ident                                                             
Sbjct -----------------aeHPTELEMfrtgggplwdnrmpalyphtlaevigrepgpdlT  246
DSSP  -----------------llLHHHHHHhhhlllllhhhllhhhllllhhhhhllllllllL


DSSP  HHHHHHhLLHHhhllLLLEEELHhHLLHHHHHhhhhhllllllllllllllllhHHHHH-
Query HALRLMaSGLFdehpRLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfMDYFN-  254
ident     |               | |                                     
Sbjct PVRYLD-ELGV---lAARPTLVH-MVNVTPDD----------------------IARVAr  279
DSSP  HHHHHH-HHLL---hHHLLEEEE-LLLLLHHH----------------------HHHHHh


DSSP  HHEEEELLL------lllhhHHHHHHLLLLhhHEELLLLLL-LLLHhHHHHHHHHLL---
Query ENFHITTSG------nfrtqTLIDAILEIGadRILFSTDWP-FENIdHASDWFNATS---  304
ident       |                              ||                     
Sbjct AGCAVVTCPrsnhhlecgtfDWPAFAAAGV--EVALGTDSVaSGETlNVREEVTFARqly  337
DSSP  HLLLEEELHhhhhhllllllLHHHHHHLLL--LEEELLLLHhHHLLlLLHHHHHHHHhhl


DSSP  --LLHHHHHHHHLHHHHHHLL--------------------ll
Query --IAEADRVKIGRTNARRLFK--------------------ld  325
ident         |        |                         
Sbjct pgLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  llLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 39: Query=2dvtA Sbjct=2oofA Z-score=13.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  lLLEEEEEEEELLHhhhhhhLLLLLLLH--------------------------hhhhhh
Query mQGKVALEEHFAIPetlqdsAGFVPGDY--------------------------wkelqh   34
ident   |      |                                                  
Sbjct tPGLIDCHTHLIFA------GSRAEEFElrqkgvpyaeiarkgggiistvratraasedq  114
DSSP  eELEEEEEELLLLL------LLLHHHHHhhhhlllhhhhhhllllhhhhhhhhhhllhhh


DSSP  hhhLLLLhHHHHHHHLLEEEEEEEELllhhhhlllhhhHHHHHHHHHHHHHHHHHHLlLL
Query rllDIQDtRLKLMDAHGIETMILSLNapavqaipdrrkAIEIARRANDVLAEECAKRpDR   94
ident         | |     |  |                    |       |          |
Sbjct lfeLALP-RVKSLIREGVTTVEIKSG---------yglTLEDELKXLRVARRLGEALpIR  164
DSSP  hhhHHHH-HHHHHHHHLEEEEEEELL---------lllLHHHHHHHHHHHHHHHHHLlLE


DSSP  EEEEELL-----------llLLHHHHH-HHHHHHHHLLLLLEEEEELLllllllllLLLL
Query FLAFAAL-----------plQDPDAAT-EELQRCVNDLGFVGALVNGFsqegdgqtPLYY  142
ident                             |               |               
Sbjct VKTTLLAahavppeyrddpdSWVETICqEIIPAAAEAGLADAVDVFCE-------hIGFS  217
DSSP  EEEEEEEellllhhhlllhhHHHHHHHhLHHHHHHHLLLLLEEEEEEL-------lLLLL


DSSP  LLhHHHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhHHHHhhhh
Query DLpQYRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtaVHALrlma  202
ident    |                 |                                      
Sbjct LA-QTEQVYLAADQYGLAVKGHX----------------------dQLSN-lGGST----  249
DSSP  HH-HHHHHHHHHHHLLLEEEEEE----------------------lLLLL-lLHHH----


DSSP  llhhhhlLLLLEEELHhHLLHHHHhhhhhhllllllllllllllllhhHHHH-HHEEEEL
Query sglfdehPRLNIILGHmGEGLPYMmwridhrnawvklpprypakrrfmDYFN-ENFHITT  261
ident                |  | |                                     | 
Sbjct ----laaNFGALSVDH-LEYLDPE----------------------giQALAhRGVVATL  282
DSSP  ----hhhHLLLLEEEE-LLLLLHH----------------------hhHHHHhHLLEEEE


DSSP  L-LLLL------hhHHHHHHLLLLhhHEELLLLLL----LLLH-HHHHHHHHH-LLLLHH
Query S-GNFR------tqTLIDAILEIGadRILFSTDWP----FENI-DHASDWFNA-TSIAEA  308
ident     |                         | |             |             
Sbjct LpTAFYflketklpPVVALRKAGV--PXAVSSDINpgtaPIVSlRXAXNXACTlFGLTPV  340
DSSP  LhHHHHhlllllllLHHHHHHLLL--LEEELLLLLllllLLLLhHHHHHHHHHhHLLLHH


DSSP  HHHHHHLHHHHH-HLLLL------------------------------------------
Query DRVKIGRTNARR-LFKLD------------------------------------------  325
ident          | | |                                              
Sbjct EAXAGVTRHAARaLGEQEqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngee  400
DSSP  HHHHHLLHHHHHhLLLLLlllllllllllleeeellllllhhhhlllllleeeeeellee


DSSP  ---
Query ---  325
ident    
Sbjct tlh  403
DSSP  lll


No 40: Query=2dvtA Sbjct=1j5sA Z-score=12.9

back to top
DSSP  -----------------------LLLEEEEEEEELlhhhhhhhllllllLHHHH-HHHH-
Query -----------------------MQGKVALEEHFAipetlqdsagfvpgDYWKE-LQHR-   35
ident                            |    |                | |        
Sbjct hmflgedylltnraavrlfnevkDLPIVDPHNHLD---akdivenkpwnDIWEVeGATDh   57
DSSP  llllllllllllhhhhhhhhhhlLLLEEELLLLLL---hhhhhhlllllLHHHHhLLLLh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   35
ident                                                             
Sbjct yvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvis  117
DSSP  hhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllll


DSSP  ------------hhllllHHHHHHHHLLEEEEEEEElllhhhhlllhhhhhhhHHHHhhh
Query ------------lldiqdTRLKLMDAHGIETMILSLnapavqaipdrrkaieiARRAndv   83
ident                   |  ||      |                              
Sbjct eetaeeiweetkkklpemTPQKLLRDMKVEILCTTD-----------------DPVS---  157
DSSP  hhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLL-----------------LLLL---


DSSP  hHHHHHHLL-----LLEEEEELL--LLLL--------------------------HHHHH
Query lAEECAKRP-----DRFLAFAAL--PLQD--------------------------PDAAT  110
ident   |   |          |                                       |  
Sbjct tLEHHRKAKeavegVTILPTWRPdrAMNVdkegwreyvekmgerygedtstldgfLNALW  217
DSSP  lLHHHHHHHhhlllLEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhhHHHHH


DSSP  HHHHHHHhLLLLLEEEEELLlllllllllLLLL---------------------------
Query EELQRCVnDLGFVGALVNGFsqegdgqtpLYYD---------------------------  143
ident           | |                                               
Sbjct KSHEHFK-EHGCVASDHALL---------EPSVyyvdenraravhekafsgekltqdein  267
DSSP  HHHHHHH-LLLLLEEEEEEL---------LLLLllllhhhhhhhhhhhlllllllhhhhh


DSSP  ---LHHHHHHHHHHHHHLLLEEEEL-LLLLHhhLHHHLL----lHHHLhhhlHHHHhhhH
Query ---LPQYRPFWGEVEKLDVPFYLHP-RNPLPqdSRIYDG----hPWLLgptwAFAQetaV  195
ident          |            ||                                    
Sbjct dykAFMMVQFGKMNQETNWVTQLHIgALRDY--RDSLFKtlgpdSGGD----ISTN-flR  320
DSSP  hhhHHHHHHHHHHHHHHLLEEEEEElEELLL--LHHHHHhllllLLLL----EELL-llL


DSSP  HHHHHHhlLHHHHLL-LLLEEELhhhLLHHHHhhhhhhllllllllllllllllhhHHHH
Query HALRLMasGLFDEHP-RLNIILGhmgEGLPYMmwridhrnawvklpprypakrrfmDYFN  254
ident  |  |       |    | | |                                      
Sbjct IAEGLR--YFLNEFDgKLKIVLYvldPTHLPT----------------------isTIAR  356
DSSP  HHHHHH--HHHHHLLlLLLEEEEellHHHHHH----------------------hhHHHH


DSSP  --HHEE-EELL--LLLL---HHHHHHHHLLLLHHHE-ELLLLLLLL-LHHHHHHHHHHLL
Query --ENFH-ITTS--GNFR---TQTLIDAILEIGADRI-LFSTDWPFE-NIDHASDWFNATS  304
ident    |                   |                ||             |    
Sbjct afPNVYvGAPWwfNDSPfgmEMHLKYLASVDLLYNLaGMVTDSRKLlSFGSRTEMFRRVL  416
DSSP  hlLLEEeLLLLllLLLHhhhHHHHHHHHLLLLHHHLlLLLLLLLLLlHHHHHHHHHHHHH


DSSP  L----------------LHHHHHHHHLHHHHHHLLll
Query I----------------AEADRVKIGRTNARRLFKld  325
ident                  |              ||   
Sbjct SnvvgemvekgqipikeARELVKHVSYDGPKALFF--  451
DSSP  HhhhhhhhhlllllhhhHHHHHHHHHLHHHHHHHL--


No 41: Query=2dvtA Sbjct=3mkvA Z-score=12.9

back to top
DSSP  -------------------------------------------------------lLLEE
Query -------------------------------------------------------mQGKV    5
ident                                                          |  
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE


DSSP  EEEEEEL--lhHHHHHHLLlllllhhhhhhhhhhLLLLhHHHHHHHLLEEEEEEEELllh
Query ALEEHFA--ipETLQDSAGfvpgdywkelqhrllDIQDtRLKLMDAHGIETMILSLNapa   63
ident  |  |                                      |   |  |         
Sbjct DLHVHVVaiefNLPRVATL--------pnvlvtlRAVP-IMRAMLRRGFTTVRDAGG---  108
DSSP  EEEELLLllllLHHHHLLL--------lhhhhhhHHHH-HHHHHHHLLEEEEEELLL---


DSSP  hhhlllhhhhhhhhhhhhhhHHHHHHHLL------lLEEEE-ELLL--------------
Query vqaipdrrkaieiarrandvLAEECAKRP------dRFLAF-AALP--------------  102
ident                                     |      ||               
Sbjct -------------------aGYPFKQAVEsglvegpRLFVSgRALSqtgghadprarsdy  149
DSSP  -------------------lLHHHHHHHHlllllllEEEELlLEEEllllllllllllll


DSSP  -------------------LLLHHHHHHHHHHHHHlLLLLEEEEELL---llllllllLL
Query -------------------LQDPDAATEELQRCVNdLGFVGALVNGF---sqegdgqtPL  140
ident                        |             |                      
Sbjct mppdspcgccvrvgalgrvADGVDEVRRAVREELQ-MGADQIXIMASggvasptdpvgVF  208
DSSP  lllllllllllllllleeeLLLHHHHHHHHHHHHH-HLLLLEEEELLlllllllllllLL


DSSP  LLlLHHH-HHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHH
Query YYdLPQY-RPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALR  199
ident  |      |    |          |                            |     |
Sbjct GY-SEDEiRAIVAEAQGRGTYVLAHA--------------------------yTPAAIAR  241
DSSP  LL-LHHHhHHHHHHHHLLLLLEEEEE--------------------------lLHHHHHH


DSSP  HHHllhhhhlllLLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEE
Query LMAsglfdehprLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFH  258
ident                   | |                                       
Sbjct AVR--------cGVRTIEH-GNLIDDET----------------------aRLVAeHGAY  270
DSSP  HHH--------lLLLEEEE-LLLLLHHH----------------------hHHHHhHLLE


DSSP  EELLLL---------------------------lLHHHHHHHHLLLLhhHEELLLLLL--
Query ITTSGN---------------------------fRTQTLIDAILEIGadRILFSTDWP--  289
ident                                                     | ||    
Sbjct VVPTLVtydalasegekyglppesiakiadvhgaGLHSIEIMKRAGV--KMGFGTDLLge  328
DSSP  EELLHHhhhhhhhhlllllllhhhhllhhhhhllHHHHHHHHHHHLL--LLLLLLLLLhh


DSSP  -LLLHHHHHHHHhHLLLLHHHHHHHHLHHHHHHLLLL-----------------------
Query -FENIDHASDWFnATSIAEADRVKIGRTNARRLFKLD-----------------------  325
ident              |     |                                        
Sbjct aQRLQSDEFRIL-AEVLSPAEVIASATIVSAEVLGMQdklgrivpgahadvlvvdgnplk  387
DSSP  hHHHLLHHHHHH-HLLLLHHHHHHHLLHHHHHHLLLLllllllllllllleeeellllll


DSSP  ---------------------------
Query ---------------------------  325
ident                            
Sbjct svdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllleeeelleeeeelll


No 42: Query=2dvtA Sbjct=2uz9A Z-score=12.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  -------LLLEEEEEEEEL------------------------LHHHhhhhlllllllhh
Query -------MQGKVALEEHFA------------------------IPETlqdsagfvpgdyw   29
ident        | | |    |                                           
Sbjct lshheffMPGLVDTHIHASqysfagssidlpllewltkytfpaEHRF----------qni  110
DSSP  llllleeEELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhHHHH----------hlh


DSSP  hhhhHHHHLLLLHHHHHHhhllEEEEEEEElllhhhhlllhhhhhhhHHHHHHHHHHHHH
Query kelqHRLLDIQDTRLKLMdahgIETMILSLnapavqaipdrrkaieiARRANDVLAEECA   89
ident               ||        |                             ||    
Sbjct dfaeEVYTRVVRRTLKNG----TTTACYFA---------------tiHTDSSLLLADITD  151
DSSP  hhhhHHHHHHHHHHHHLL----EEEEEEEL---------------llLHHHHHHHHHHHH


DSSP  HLLLLEEEEELLLL---------LLHHHHHHHHHHHHHLLL-------LLEEE-EELLLl
Query KRPDRFLAFAALPL---------QDPDAATEELQRCVNDLG-------FVGAL-VNGFSq  132
ident |   |                          |  | |                     | 
Sbjct KFGQRAFVGKVCMDlndtfpeykETTEESIKETERFVSEMLqknysrvKPIVTpRFSLS-  210
DSSP  HHLLEEEEELEELLlllllllllLLHHHHHHHHHHHHHHHHhhlllleEEEEEeLLHHH-


DSSP  lllllllllllLHHH-HHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhHLHHHH
Query egdgqtplyydLPQY-RPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgpTWAFAQ  191
ident                           |     |                           
Sbjct ----------cSETLmGELGNIAKTRDLHIQSHI------------------seNRDEVE  242
DSSP  ----------lLHHHhHHHHHHHHHHLLEEEEEE------------------llLHHHHH


DSSP  H-------hhHHHHHHHHllhhhhllLLLEEELHhHLLHHHHHhhhhhllllllllllll
Query E-------taVHALRLMAsglfdehpRLNIILGHmGEGLPYMMwridhrnawvklppryp  244
ident                                  | |  |                     
Sbjct AvknlypsykNYTSVYDK----nnllTNKTVMAH-GCYLSAEE-----------------  280
DSSP  HhhhhlllllLHHHHHHH----llllLLLEEEEE-LLLLLHHH-----------------


DSSP  llllhhHHHHHH-EEEELL--LLLL----hhHHHHHHLLLLhhHEELLLLLLLLLH---H
Query akrrfmDYFNEN-FHITTS--GNFR----tqTLIDAILEIGadRILFSTDWPFENI---D  294
ident         | |    |      |                     |   ||          
Sbjct -----lNVFHERgASIAHCpnSNLSlssgflNVLEVLKHEV--KIGLGTDVAGGYSysmL  333
DSSP  -----hHHHHHHlLEEEELhhHHHHllllllLHHHHHHLLL--EEEELLLLLLLLLllhH


DSSP  HHHHHHHHL------------LLLHHHHHHHHLHHHHH-HLLLL----------------
Query HASDWFNAT------------SIAEADRVKIGRTNARR-LFKLD----------------  325
ident  |                   |                 |                    
Sbjct DAIRRAVMVsnillinkvnekSLTLKEVFRLATLGGSQaLGLDGeignfevgkefdaili  393
DSSP  HHHHHHHHHhhhhhhllllllLLLHHHHHHHHLHHHHHhLLLLLlllllllllllleeee


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  325
ident                                                    
Sbjct npkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  lllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 43: Query=2dvtA Sbjct=3icjA Z-score=12.7

back to top
DSSP  ----------------------------------------------------------LL
Query ----------------------------------------------------------MQ    2
ident                                                           | 
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LEEEEEEEELlhhhhhhhlllllllhhhHHHH----------------------------
Query GKVALEEHFAipetlqdsagfvpgdywkELQH----------------------------   34
ident        |                                                    
Sbjct AFFDSHLHLD---------------elgMSLEmvdlrgvksmeelvervkkgrgriifgf  105
DSSP  LEEEEEELHH---------------hhhHHHHleellllllhhhhhhhhhlllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   34
ident                                                             
Sbjct gwdqdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivre  165
DSSP  eelhhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeeh


DSSP  -------------------hhHLLLLhHHHHHHHLLEEEEEEEElllhhhhlllhhhhhh
Query -------------------rlLDIQDtRLKLMDAHGIETMILSLnapavqaipdrrkaie   75
ident                        |           |                        
Sbjct raleesrkiinekiltvkdykHYIES-AQEHLLSLGVHSVGFMS----------------  208
DSSP  hhhhhhhhhhhhllllhhhhhHHHHH-HHHHHHHLLEEEEEEEE----------------


DSSP  hHHHHHHHHHHHHH--HLLLLEEEEELLLlllhhhHHHH--hhHHHH---llLLLEEEEE
Query iARRANDVLAEECA--KRPDRFLAFAALPlqdpdaATEE--lqRCVN---dlGFVGALVN  128
ident     |   | |            |                               |    
Sbjct vGEKALKALFELERegRLKMNVFAYLSPE-----lLDKLeelnLGKFegrrlRIWGVXLF  263
DSSP  eLHHHHHHHHHHHHllLLLLEEEEEELHH-----hHHHHhhhlLLLEellleEEEEEEEE


DSSP  L----------------lllllllllLLLLLLhhhhHHHHHHHHHLLLEEEELllllhhh
Query G----------------fsqegdgqtPLYYDLpqyrPFWGEVEKLDVPFYLHPrnplpqd  172
ident                               |             |      |        
Sbjct VdgslgartallsepytdnpttsgelVMNKDE--ivEVIERAKPLGLDVAVHA-------  314
DSSP  LlllllllllllllllllllllllllLLLHHH--hhHHHHHHLLLLLEEEEEE-------


DSSP  lhhhlllhhhlhhhlhHHHHHHHHHHHHHhLLHHhhlllLLEEELHhHLLHHHHHhhhhh
Query sriydghpwllgptwaFAQETAVHALRLMaSGLFdehprLNIILGHmGEGLPYMMwridh  232
ident                         ||                   |              
Sbjct ----------------IGDKAVDVALDAF-EEAE-----FSGRIEH-ASLVRDDQ-----  346
DSSP  ----------------LLHHHHHHHHHHH-HHHL-----LLLEEEE-LLLLLHHH-----


DSSP  llllllllllllllllhHHHHH-HHEEEELLlLLLH------------------hHHHHH
Query rnawvklpprypakrrfMDYFN-ENFHITTSgNFRT------------------qTLIDA  273
ident                            |                            |   
Sbjct -----------------LERIKeLKVRISAQ-PHFIvsdwwivnrvgeerakwayRLKTL  388
DSSP  -----------------HHHHHhHLLEEEEL-LLHHhhlllhhhhhhhhhhhhllLHHHH


DSSP  HLLLlhhHEELLLLLLLLLHHhhHHHHHHL-----------LLLHHHHHHHHLHHHHH-H
Query ILEIgadRILFSTDWPFENIDhaSDWFNAT-----------SIAEADRVKIGRTNARR-L  321
ident           |||| | |  |                                       
Sbjct SSIT---KLGFSTDSPIEPAD--PWVSIDAavnryvvdpgeRVSREEALHLYTHGSAQvT  443
DSSP  HHHL---LEEELLLLLLLLLL--HHHHHHHhhhlllllhhhLLLHHHHHHHLLHHHHHhL


DSSP  LLLL---------------------
Query FKLD---------------------  325
ident    |                     
Sbjct LAEDlgklergfraeyiildrdplk  468
DSSP  LLLLllllllllllleeeellllll


No 44: Query=2dvtA Sbjct=1a5kC Z-score=12.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -----LLLEEEEEEEEllhhhhhhhlllllllhhhhhhhhHHLLllhHHHHHHHLLEEEE
Query -----MQGKVALEEHFaipetlqdsagfvpgdywkelqhrLLDIqdtRLKLMDAHGIETM   55
ident        |      |                                        |  ||
Sbjct egkivTAGGIDTHIHW------------------------ICPQ---QAEEALVSGVTTM  153
DSSP  llleeEELEEEEEEEL------------------------LLLL---HHHHHHHHLEEEE


DSSP  EEEE------LLLHhhhlllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELLlLLLHhhh
Query ILSL------NAPAvqaipdrrkaieiARRANDVLAEECAKRPDRFLAFAALpLQDPdaa  109
ident                                           |                 
Sbjct VGGGtgpaagTHAT---------tctpGPWYISRMLQAADSLPVNIGLLGKG-NVSQ---  200
DSSP  EEELllllhhHHHL---------llllHHHHHHHHHHHHLLLLLEEEEEEEL-LLLL---


DSSP  HHHHHHHHHlLLLLEEEEELLLllllllllLLLLLhhhHHHHHHHHHHLLLEEEELllll
Query TEELQRCVNdLGFVGALVNGFSqegdgqtpLYYDLpqyRPFWGEVEKLDVPFYLHPrnpl  169
ident    |   |   |  |                                 |    ||     
Sbjct PDALREQVA-AGVIGLEIHEDW--------GATPA-aiDCALTVADEMDIQVALHS----  246
DSSP  HHHHHHHHH-HLLLEEEEEHHH--------LLLHH-hhHHHHHHHHHHLLEEEEEL----


DSSP  hhhlhhhlllhhhlhhhlhhhhHHHH---hHHHHHHlLHHHhlllLLEEELHHHL-----
Query pqdsriydghpwllgptwafaqETAV---hALRLMAsGLFDehprLNIILGHMGE-----  221
ident                        |           |           |   |        
Sbjct ----------------------DTLNesgfVEDTLA-AIGG----RTIHTFHTEGagggh  279
DSSP  ----------------------LLLLllllHHHHHH-HHLL----LLEEELLLLLlllll


DSSP  --LHHHhhhhhhhllllllllllllllllhhhhHHHHEEEELLL-LLLH-----------
Query --GLPYmmwridhrnawvklpprypakrrfmdyFNENFHITTSG-NFRT-----------  267
ident                                     |                       
Sbjct apDIIT-------------------------acAHPNILPSSTNpTLPYtlntidehldm  314
DSSP  llLHHH-------------------------hhHLLLEEEEEEHhHLLLlllhhhhhhhh


DSSP  ----------------------------HHHHHHHLlllHHHEELLLLLLL-LLHHHHHH
Query ----------------------------QTLIDAILeigADRILFSTDWPF-ENIDHASD  298
ident                                    |       | | |            
Sbjct lmvchhldpdiaedvafaesrirretiaAEDVLHDL---GAFSLTSSDSQAmGRVGEVIL  371
DSSP  hhhhhllllllhhhhhlllllllhhhhhHHHHHHHL---LLLLEEELLLLLlLLLLLHHH


DSSP  HHHHLL-------------------lLHHHHHHHHLHHHHHHLLLL--------------
Query WFNATS-------------------iAEADRVKIGRTNARRLFKLD--------------  325
ident                                      |                      
Sbjct RTWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAhevgsievgkladl  431
DSSP  HHHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLllllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct vvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltfl  491
DSSP  eeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  325
ident                                                             
Sbjct sqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelits  551
DSSP  lhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelll


DSSP  ---------------
Query ---------------  325
ident                
Sbjct epadvlpmaqryflf  566
DSSP  lllllllllllllll


No 45: Query=2dvtA Sbjct=4c5yA Z-score=12.5

back to top
DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------m    1
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLEEEEEEEELLHH-hhHHHLllllllhhhhhhhhhhLLLLhHHHHHHHLLEEEEEEEEl
Query QGKVALEEHFAIPE-tlQDSAgfvpgdywkelqhrllDIQDtRLKLMDAHGIETMILSLn   60
ident  |      ||        |                               |         
Sbjct PGLWDCHMHFGGDDdyyNDYT----sglathpassgaRLAR-GCWEALQNGYTSYRDLA-  114
DSSP  ELEEEEEELLLLLLlllLLLH----hhhhllhhhhhhHHHH-HHHHHHHLLEEEEEELL-


DSSP  llhhhhlllhhhhhhhhhhhhhHHHHHHHHLL------lLEEEE-ELLL-----------
Query apavqaipdrrkaieiarrandVLAEECAKRP------dRFLAF-AALP-----------  102
ident                          |                   |||            
Sbjct ---------------------gYGCEVAKAINdgtivgpNVYSSgAALSqtaghgdifal  153
DSSP  ---------------------lLHHHHHHHHHlllllllEEEELlLEEElllllllllll


DSSP  --------------------------LLLHHHHHHHHHHHHHlLLLLEEEEELL----ll
Query --------------------------LQDPDAATEELQRCVNdLGFVGALVNGF----sq  132
ident                                             |     |         
Sbjct pagevlgsygvmnprpgywgagplciADGVEEVRRAVRLQIR-RGAKVIXVMASggvmsr  212
DSSP  lhhhhhhhhlllllllllllllleeeLLLHHHHHHHHHHHHH-HLLLLEEEELLllllll


DSSP  lllllllLLLLLhhhHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHH
Query egdgqtpLYYDLpqyRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQE  192
ident                     |          |                            
Sbjct ddnpnfaQFSPE-elKVIVEEAARQNRIVSAHV-----------------------HGKA  248
DSSP  lllllllLLLHH-hhHHHHHHHHHLLLLEEEEE-----------------------LLHH


DSSP  HHHHHHHHhhllhhhhlllLLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHH
Query TAVHALRLmasglfdehprLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDY  252
ident     |                  | |                                  
Sbjct GIMAAIKA-----------GCKSLEH-VSYADEEV----------------------wEL  274
DSSP  HHHHHHHH-----------LLLEEEE-LLLLLHHH----------------------hHH


DSSP  HH-HHEEEELLLL--------------------------llHHHHHHHHLLLLhhHEELL
Query FN-ENFHITTSGN--------------------------frTQTLIDAILEIGadRILFS  285
ident                                                ||       |   
Sbjct MKeKGILYVATRSvieiflasngeglvkeswaklqaladshLKAYQGAIKAGV--TIALG  332
DSSP  HHhHLLEEELLHHhhhhhhhhllllllllhhhlllhhhhhhHHHHHHHHHLLL--LEELL


DSSP  LLLL-llLHHHHHHHHHHL-LLLHHHHHHHHLHHHHHH---LLLL---------------
Query TDWP-feNIDHASDWFNAT-SIAEADRVKIGRTNARRL---FKLD---------------  325
ident ||                          |    ||                         
Sbjct TDTApggPTALELQFAVERgGMTPLEAIKAATANAPLSvgpQAPLtgqlregyeadvial  392
DSSP  LLLLlllLLHHHHHHHHHLlLLLHHHHHHHHLLLHHHHhhhHLLLllllllllllleeee


DSSP  --------------------------------------------
Query --------------------------------------------  325
ident                                             
Sbjct eenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 46: Query=2dvtA Sbjct=3iacA Z-score=12.3

back to top
DSSP  ------------------------LLLEEEEEEEELlhhhhhhhlllllllhhhhhhhhh
Query ------------------------MQGKVALEEHFAipetlqdsagfvpgdywkelqhrl   36
ident                                  |                          
Sbjct atfxtedfllkndiartlyhkyaaPXPIYDFHCHLS-----------------------p   37
DSSP  llllllllllllhhhhhhhhhlllLLLEEELLLLLL-----------------------h


DSSP  HLLL--------------------------------------------------------
Query LDIQ--------------------------------------------------------   40
ident   |                                                         
Sbjct QEIAddrrfdnlgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlg   97
DSSP  HHHHhllllllhhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhlll


DSSP  ------------------------------------------lHHHHHHHHLLEEEEEEE
Query ------------------------------------------dTRLKLMDAHGIETMILS   58
ident                                                             
Sbjct nplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTT  157
DSSP  lhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELL


DSSP  ElllhhhhlllhhhhhhhHHHHHHHHHHHHHH--LLLLEEEEELL--LLLL---------
Query LnapavqaipdrrkaieiARRANDVLAEECAK--RPDRFLAFAAL--PLQD---------  105
ident                               |                             
Sbjct D----------------dPIDSLEYHRQIAADdsIDIEVAPSWRPdkVFKIeldgfvdyl  201
DSSP  L----------------lLLLLLHHHHHHHHLllLLLEEELLLLLhhHHLLllllhhhhh


DSSP  -----------------HHHHHHHHHHHHhLLLLLEEEEEL--------------lllLL
Query -----------------PDAATEELQRCVnDLGFVGALVNG--------------fsqEG  134
ident                    | |  |       |                          |
Sbjct rkleaaadvsitrfddlRQALTRRLDHFA-ACGCRASDHGIetlrfapvpddaqldaiLG  260
DSSP  hhhhhhhllllllhhhhHHHHHHHHHHHH-HLLLLEEEEEEllllllllllhhhhhhhHH


DSSP  LL--------LLLLlllLHHHHHHHHHHHHHLLLEEEELLLLlhhhlhHHLLL-------
Query DG--------QTPLyydLPQYRPFWGEVEKLDVPFYLHPRNPlpqdsrIYDGH-------  179
ident                                     ||                      
Sbjct KRlagetlseLEIAqftTAVLVWLGRQYAARGWVXQLHIGAI----rnNNTRXfrllgpd  316
DSSP  HHhllllllhHHHHhhhHHHHHHHHHHHHHHLLEEEEEELEE----llLLHHHhhhhlll


DSSP  hHHLHHHLHhhhhhhhhHHHHHHLlHHHHLLLLLEEEL----hhhlLHHHhhhhhhhlll
Query pWLLGPTWAfaqetavhALRLMASgLFDEHPRLNIILG----hmgeGLPYmmwridhrna  235
ident                    ||  |           ||          |            
Sbjct tGFDSIGDN---niswaLSRLLDS-XDVTNELPKTILYclnprdneVLAT----------  362
DSSP  lLLLEELLL---llhhhHHHHHHH-HHLLLLLLEEEEEellhhhhhHHHH----------


DSSP  lllllllllllllhHHHH----hHHEEEELLL--LLLH----HHHHHHHLLLLH-HHEEL
Query wvklpprypakrrfMDYF----nENFHITTSG--NFRT----QTLIDAILEIGA-DRILF  284
ident                                   |         |               
Sbjct ------------xiGNFQgpgiaGKVQFGSGWwfNDQKdgxlRQLEQLSQXGLLsQFVGX  410
DSSP  ------------hhHHLLlllllLLEEELLLLhhHLLHhhhhHHHHHHHHHLLHhHLLLL


DSSP  LLLLLLlLHHHHHHHHHHLLL------------------LHHHHHHHHLHHHHHHLLll
Query STDWPFeNIDHASDWFNATSI------------------AEADRVKIGRTNARRLFKld  325
ident  ||            |                              |   || | |   
Sbjct LTDSRSfLSYTRHEYFRRILCnllgqwaqdgeipddeaxLSRXVQDICFNNAQRYFTik  469
DSSP  LLLLLLlLLLHHHHHHHHHHHhhhhhhhhlllllllhhhHHHHHHHHHLHHHHHHLLll


No 47: Query=2dvtA Sbjct=4rdvB Z-score=12.1

back to top
DSSP  -----------------------------------------------LLLEEEEEEEEL-
Query -----------------------------------------------MQGKVALEEHFA-   12
ident                                                  |   |  |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh


DSSP  ----------lhhhhhhhLLLLLllhHHHH-----hhhhHLLLLhHHHHHHHLLEEEEEE
Query ----------ipetlqdsAGFVPgdyWKEL-----qhrlLDIQDtRLKLMDAHGIETMIL   57
ident                                                  |   |      
Sbjct ramaglaevagnpndsfwTWREL--mYRMVarlspeqieVIACQ-LYIEMLKAGYTAVAE  117
DSSP  hhhlllllllllllllhhHHHHH--hHHHHllllhhhhhHHHHH-HHHHHHHHLEEEEEE


DSSP  EELllhhhhlllhHHHHhHHHHHHHHHHHHHHHLLLLEEEEELL----------------
Query SLNapavqaipdrRKAIeIARRANDVLAEECAKRPDRFLAFAAL----------------  101
ident                                            |                
Sbjct FHY----vhhdldGRSYaDPAELSLRISRAASAAGIGLTLLPVLyshagfggqpasegqr  173
DSSP  EEL----llllllLLLLlLLLHHHHHHHHHHHHHLLEEEEEELLlleeellleellhhhl


DSSP  -llLLHHHHHHHHHHHhHLLL-----LLEEEEELLLllllllllLLLLLhHHHHHH-HHH
Query -plQDPDAATEELQRCvNDLG-----FVGALVNGFSqegdgqtpLYYDLpQYRPFW-GEV  154
ident        |  | |||             |                     |         
Sbjct rfiNGSEAYLELLQRL-RAPLeaaghSLGLCFHSLR--------AVTPQ-QIATVLaAGH  223
DSSP  lllLLHHHHHHHHHHH-HHHHhhhllEELEEELLLL--------LLLHH-HHHHHHlLLL


DSSP  HhhLLLEEEELllllhhhlhhhlllhhhlhhHLHHHH-----hhhHHHHHHHhLLHHhhl
Query EklDVPFYLHPrnplpqdsriydghpwllgpTWAFAQ-----etaVHALRLMaSGLFdeh  209
ident    | |   |                                        |         
Sbjct D--DLPVHIHI------------------aeQQKEVDdcqawsgrRPLQWLY-ENVA---  259
DSSP  L--LLLEEEEE------------------llLHHHHHhhhhhhllLHHHHHH-HHLL---


DSSP  lllLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEEEELL--LLLL
Query prlNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFHITTS--GNFR  266
ident       | |                                                   
Sbjct vdqRWCLVH-ATHADPAE----------------------vAAMArSGAVAGLClsTEAN  296
DSSP  lllLEEEEE-LLLLLHHH----------------------hHHHHhHLLEEEELhhHHHH


DSSP  ----hhHHHHHHLLLLhhHEELLLLLLlLLHHhhHHHH-HHLL-----------------
Query ----tqTLIDAILEIGadRILFSTDWPfENIDhaSDWF-NATS-----------------  304
ident          |     |  |     |                                   
Sbjct lgdgifPATDFLAQGG--RLGIGSDSH-VSLS--VVEElRWLEygqrlrdrkrnrlyrdd  351
DSSP  llllllLHHHHHHLLL--EEEELLLLL-LLLL--HHHHhHHHHhhhhhhhllllllllll


DSSP  --lLHHHHHHHHLHHHHHH-LLLL------------------------------------
Query --iAEADRVKIGRTNARRL-FKLD------------------------------------  325
ident                                                             
Sbjct qpmIGRTLYDAALAGGAQAlGQPIgslavgrradllvldgndpylasaegdallnrwlfa  411
DSSP  lllHHHHHHHHHHHHHHHHhLLLLlllllllllleeeellllhhhhllllhhhhhhhhhh


DSSP  ----------------------------------------
Query ----------------------------------------  325
ident                                         
Sbjct ggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 48: Query=2dvtA Sbjct=3ooqA Z-score=11.5

back to top
DSSP  --------------------------------------------------LLLEEEEEEE
Query --------------------------------------------------MQGKVALEEH   10
ident                                                     | |    |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  ellhhhhhhhllllllLHHHHHH-------------hhhHLLL-LHHHHHHHHLLEEEEE
Query faipetlqdsagfvpgDYWKELQ-------------hrlLDIQ-DTRLKLMDAHGIETMI   56
ident                                             |       | |     
Sbjct ---------iglfeegVGYYYSDgneatdpvtphvkaldGFNPqDPAIERALAGGVTSVX  111
DSSP  ---------lllllllLLHHHLLlllllllllllllhhhHLLLlLHHHHHHHLLLEEEEE


DSSP  EEELLLHhhhlllhhhhhhhhhhhhhhhhhHHHHLLLLeeeeellllllhhhhhhhhhhh
Query LSLNAPAvqaipdrrkaieiarrandvlaeECAKRPDRflafaalplqdpdaateelqrc  116
ident                                                             
Sbjct IVPGSAN---------pvggqgsvikfrsiIVEECIVK----------------------  140
DSSP  ELLLLLL---------leeeeeeeeellllLHHHHEEE----------------------


DSSP  hhllLLLEEEEELL-----lLLLLLLL----LLLL-lLHHHHH-----------------
Query vndlGFVGALVNGF-----sQEGDGQT----PLYY-dLPQYRP-----------------  149
ident        |                 ||             |                   
Sbjct ----DPAGLKXAFGenpkrvYGERKQTpstrXGTAgvIRDYFTkvknyxkkkelaqkegk  196
DSSP  ----EEEEEEEELLhhhhhhHHHLLLLlllhHHHHhhHHHHHHhhhhhhhhhhhhhhlll


DSSP  ----------hHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhhhhhHHHHHHH
Query ----------fWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwafaqeTAVHALR  199
ident               |     |   |                             |   | 
Sbjct eftetdlkxevGEXVLRKKIPARXHA--------------------------hRADDILT  230
DSSP  llllllhhhhhHHHHHLLLLLEEEEE--------------------------lLHHHHHH


DSSP  HHHLlHHHHLllLLEEELHhHLLHHHHHhhhhhllllllllllllllllhhHHHH-HHEE
Query LMASgLFDEHprLNIILGHmGEGLPYMMwridhrnawvklpprypakrrfmDYFN-ENFH  258
ident              |    | |                                       
Sbjct AIRI-AEEFG--FNLVIEH-GTEAYKIS-----------------------KVLAeKKIP  263
DSSP  HHHH-HHHHL--LLEEEEE-LLLHHHHH-----------------------HHHHhHLLL


DSSP  EELLLLL-----------LHHHHHHHHLLLLhhHEELLLLLLLLLHHHHHHHHHHLL---
Query ITTSGNF-----------RTQTLIDAILEIGadRILFSTDWPFENIDHASDWFNATS---  304
ident                      |            |    | |      |           
Sbjct VVVGPLLtfrtklelkdlTXETIAKLLKDGV--LIALXCDHPVIPLEFATVQAATAXryg  321
DSSP  EEELLLLlllllhhhlllLLLHHHHHHHLLL--LEEELLLLLLLLHHHHHHHHHHHHhhl


DSSP  LLHHHHHHHHLHHHHHHLLLL---------------------------------------
Query IAEADRVKIGRTNARRLFKLD---------------------------------------  325
ident   | |  ||   |      |                                        
Sbjct AKEEDLLKILTVNPAKILGLEdrigsiepgkdadlvvwsghpfdxksvvervyidgvevf  381
DSSP  LLHHHHHHLLLHHHHHHLLLLllllllllllllleeeelllllllllleeeeeelleeee


DSSP  ---
Query ---  325
ident    
Sbjct rre  384
DSSP  ell


No 49: Query=2dvtA Sbjct=3qy6A Z-score=11.0

back to top
DSSP  lllEEEEEEE-ELLHhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEE
Query mqgKVALEEH-FAIPetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSL   59
ident          |                            |            || | |   
Sbjct ---MIDIHCHiLPAM--------------ddgAGDS-aDSIE-MARAAVRQGIRTIIATP   41
DSSP  ---LEELLLLlLLLL--------------lllLLLH-hHHHH-HHHHHHHLLLLEEELLL


DSSP  LllhhHHLLlhhhhhhHHHHHHHHHHHHHHHL-----lLLEEEEellllllhhhhhhhhh
Query NapavQAIPdrrkaieIARRANDVLAEECAKR-----pDRFLAFaalplqdpdaateelq  114
ident                                          |                  
Sbjct H---hNNGV----yknEPAAVREAADQLNKRLikedipLHVLPG----------------   78
DSSP  E---eLLLL----lllLHHHHHHHHHHHHHHHhhllllLEEELL----------------


DSSP  hhhhllllleEEEELLllllllllllllllhhhHHHHHH----hhhhlLLEEEELllllh
Query rcvndlgfvgALVNGFsqegdgqtplyydlpqyRPFWGE----vekldVPFYLHPrnplp  170
ident                                                             
Sbjct ----------QEIRIY--------------gevEQDLAKrqllslndtKYILIEF-----  109
DSSP  ----------LEEELL--------------llhHHHHHLlllllhhhlLEEEEEL-----


DSSP  hhlhhhlllhhhlhhhlhHHHHHHHHHHHHHhLLHHhhLLLLLEEELHHHLL--HHHHHH
Query qdsriydghpwllgptwaFAQETAVHALRLMaSGLFdeHPRLNIILGHMGEG--LPYMMW  228
ident                           |  |    |            |            
Sbjct ------------------PFDHVPRYAEQLF-YDLQ--LKGYIPVIAHPERNreIRENPS  148
DSSP  ------------------LLLLLLLLHHHHH-HHHH--HLLLEEEEELHHHLhhHHHLLH


DSSP  hhhhllllllllllllllllhHHHHHHHEEEELL-LLLL-------HHHHHHHHLLLLhh
Query ridhrnawvklpprypakrrfMDYFNENFHITTS-GNFR-------TQTLIDAILEIGad  280
ident                                    |                        
Sbjct -------------------llYHLVEKGAASQITsGSLAgifgkqlKAFSLRLVEANL--  187
DSSP  -------------------hhHHHHHLLLEEEEEhHHHLllllhhhHHHHHHHHHLLL--


DSSP  HEELLLLLL---LLLHhhHHHHHHHL---LLLHHHHHHHhLHHHHHHLLLL---------
Query RILFSTDWP---FENIdhASDWFNAT---SIAEADRVKIgRTNARRLFKLD---------  325
ident       |       |                           ||  |             
Sbjct IHFVASDAHnvkTRNF--HTQEALYVlekEFGSELPYML-TENAELLLRNQtifrqppqp  244
DSSP  LLEEELLLLlllLLLL--LHHHHHHHhhhHHLLHHHHHH-HHHHHHHHLLLlllllllll


DSSP  ---
Query ---  325
ident    
Sbjct vkr  247
DSSP  lll


No 50: Query=2dvtA Sbjct=1v77A Z-score=9.3

back to top
DSSP  lLLEEEEEEEEllhhhhhhhlllllllhhhhhhhhhhllllHHHHHHHHLlEEEEEEEEL
Query mQGKVALEEHFaipetlqdsagfvpgdywkelqhrlldiqdTRLKLMDAHgIETMILSLN   60
ident                                              |           |  
Sbjct -VKFIEMDIRD-----------------------------kEAYELAKEW-FDEVVVSIK   29
DSSP  -LLLEEEEELL-----------------------------hHHHHHHHHH-LLEEEEEEE


DSSP  LlhhhhlllhhhhhhhHHHHHHHHHHHHhhllllEEEEellllllhhhhhhhhhhhhhll
Query ApavqaipdrrkaieiARRANDVLAEECakrpdrFLAFaalplqdpdaateelqrcvndl  120
ident                           |                                 
Sbjct F-----------neevDKEKLREARKEY------GKVA----------------------   50
DSSP  E-----------llllLHHHHHHHHHHH------LLEE----------------------


DSSP  llleEEEELLllllllllllLLLLhhhhhhHHHHhhHLLLEEEELllllhhhlhhhlllh
Query gfvgALVNGFsqegdgqtplYYDLpqyrpfWGEVekLDVPFYLHPrnplpqdsriydghp  180
ident      |                 |                 |                  
Sbjct ----ILLSNP----------KPSL--vrdtVQKF--KSYLIYVES---------------   77
DSSP  ----EEEELL----------LHHH--hhhhHHHL--LLLEEEEEL---------------


DSSP  hhlhhhlhhhhHHHHHHHHHhhllhhhhlllLLEEELhHHLL-----HHHHHhhhhhlll
Query wllgptwafaqETAVHALRLmasglfdehprLNIILGhMGEG-----LPYMMwridhrna  235
ident                                                             
Sbjct -----------NDLRVIRYS--------iekGVDAII-SPWVnrkdpGIDHV--------  109
DSSP  -----------LLHHHHHHH--------hhlLLLEEE-LLLLlllllLLLHH--------


DSSP  lllllllllllllHHHHHHHH-EEEELLLL-----------lLHHHHHHHHLLLL--hhH
Query wvklpprypakrrFMDYFNEN-FHITTSGN-----------fRTQTLIDAILEIG--adR  281
ident                            |                     |         |
Sbjct -------------LAKLMVKKnVALGFSLRpllysnpyeranLLRFMMKAWKLVEkykvR  156
DSSP  -------------HHHHHHHHlLEEEEELHhhhhllhhhhhhHHHHHHHHHHHHHhhllL


DSSP  EELLLLLLL--LLHHhhHHHHHHL----LLLHHHHHHHHLHHHHHHLLll
Query ILFSTDWPF--ENIDhaSDWFNAT----SIAEADRVKIGRTNARRLFKld  325
ident                                                |  
Sbjct RFLTSSAQEkwDVRY--PRDLISLgvviGMEIPQAKASISMYPEIILK--  202
DSSP  EEEELLLLLhhHLLL--HHHHHHHhhhlLLLHHHHHHLLLHHHHHHHL--


No 51: Query=2dvtA Sbjct=2a3lA Z-score=9.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------------------LLLEEEEEEEEL--------
Query ----------------------------------------MQGKVALEEHFA--------   12
ident                                            ||    |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfyNVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllLLLEEEEEEELLllllhhhh


DSSP  --------------------------lhhhhhhhlllllLLHHH----------------
Query --------------------------ipetlqdsagfvpGDYWK----------------   30
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydLNVDLldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhllllllLLLLLllllllllllllllll


DSSP  -----------------------hhhhhhhLLLLHHHHHHHHLLEeEEEEEElllHHHHl
Query -----------------------elqhrllDIQDTRLKLMDAHGIeTMILSLnapAVQAi   67
ident                                       |                     
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQ-MAEYRI---SIYG-  295
DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLE-EEEEEE---ELLL-


DSSP  llhhHHHHHHHHHHHHHHhhhHHLLLLEEEEELL---------------lllLHHHHHHH
Query pdrrKAIEIARRANDVLAeecAKRPDRFLAFAAL---------------plqDPDAATEE  112
ident                                  |                    |     
Sbjct ----RKMSEWDQLASWIV-nnDLYSENVVWLIQLprlyniykdmgivtsfqnILDNIFIP  350
DSSP  ----LLLLHHHHHHHHHH-llLLLLLLEEEEEEEellhhhhlllllllllhhHHHHHLLH


DSSP  HH---------hhhHLLL--LLEEEEEL---------------llllLLLLLL---LLLL
Query LQ---------rcvNDLG--FVGALVNG---------------fsqeGDGQTP---LYYD  143
ident |                    ||                             |    |  
Sbjct LFeatvdpdshpqlHVFLkqVVGFDLVDdeskperrptkhmptpaqwTNAFNPafsYYVY  410
DSSP  HHhhhhlhhhllllHHHHllEEEEEEELlllllllllllllllllllLLLLLLlhhHHHH


DSSP  LhhHHHHHHHHHH------HLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhHHHH
Query LpqYRPFWGEVEK------LDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtAVHA  197
ident    |                      |                         |     | 
Sbjct Y-cYANLYVLNKLreskgmTTITLRPHS----------------------gEAGD-IDHL  446
DSSP  H-hHHHHHHHHHHhlllllLLLEELLLL----------------------lLLLL-LHHH


DSSP  HHHHHllhhhhllllLEEELHhHLLHhHHHHhhhhlllllllllllllllLHHHHHH-HH
Query LRLMAsglfdehprlNIILGHmGEGLpYMMWridhrnawvklpprypakrRFMDYFN-EN  256
ident                     | |  |                                  
Sbjct AATFL---------tCHSIAH-GINL-RKSP-------------------VLQYLYYlAQ  476
DSSP  HHHHH---------hLLLLLL-LHHH-HHLH-------------------HHHHHHHhHL


DSSP  EEEELLLL-------lLHHH-HHHHHLLLLhhHEELLLLLLLLL---hHHHHHHHHHL--
Query FHITTSGN-------fRTQT-LIDAILEIGadRILFSTDWPFEN---iDHASDWFNAT--  303
ident      |                    |         ||| |                   
Sbjct IGLAMSPLsnnslfldYHRNpFPVFFLRGL--NVSLSTDDPLQIhltkEPLVEEYSIAas  534
DSSP  LLEEELHHhhllllllLLLLlHHHHHHLLL--LEEELLLLHHHHllllLHHHHHHHHHhh


DSSP  --LLLHHHHHHHHlHHHHHH-LLLL-----------------------------------
Query --SIAEADRVKIGrTNARRL-FKLD-----------------------------------  325
ident        |   |   |                                            
Sbjct vwKLSACDLCEIA-RNSVYQsGFSHalkshwigkdyykrgpdgndihktnvphirvefrd  593
DSSP  hhLLLHHHHHHHH-HHHHHHlLLLHhhhhhhlllllllllhhhllhhhhlllhhhhhhhh


DSSP  -----------------------
Query -----------------------  325
ident                        
Sbjct tiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhlllllllllllll


No 52: Query=2dvtA Sbjct=3dcpA Z-score=9.1

back to top
DSSP  llLEEEEEEEELLhhhhhhhlllllllhhhhHHHHhhLLLLhHHHHHHHLLEEEEEEEEL
Query mqGKVALEEHFAIpetlqdsagfvpgdywkeLQHRllDIQDtRLKLMDAHGIETMILSLN   60
ident    |     |                       |   |                      
Sbjct --XKRDGHTHTEF---------------cphGTHD--DVEE-XVLKAIELDFDEYSIVEH   40
DSSP  --LLEEEEELLLL---------------lllLLLL--LHHH-HHHHHHHLLLLEEEEEEE


DSSP  -------------------LLHHhhlllhhhHHHHHHHHHHHHHHHHHHLL--LLEEEEe
Query -------------------APAVqaipdrrkAIEIARRANDVLAEECAKRP--DRFLAFa   99
ident                                |                |           
Sbjct aplssefxkntagdkeavtTASX--------AXSDLPYYFKKXNHIKKKYAsdLLIHIG-   91
DSSP  llllhhhhhllllllhhhhLLLL--------LHHHHHHHHHHHHHHHHHLLllLEEEEE-


DSSP  llllllhhhhhhhhhhhhhllllleEEEELLlllllllllLLLLlhhhHHHHHHHHHHLL
Query alplqdpdaateelqrcvndlgfvgALVNGFsqegdgqtpLYYDlpqyRPFWGEVEKLDV  159
ident                            |              |                 
Sbjct -------------------------FEVDYL---------IGYE----DFTRDFLNEYGP  113
DSSP  -------------------------EEEELL---------LLLH----HHHHHHHHHHHH


DSSP  ---leEEELLLLLH-----------HHLH--HHLL--LHHHLhhhlHHHHHHHHHHHHHh
Query ---pfYLHPRNPLP-----------QDSR--IYDG--HPWLLgptwAFAQETAVHALRLm  201
ident       |                   |    |              |             
Sbjct qtddgVLSLHFLEGqggfrsidfsaEDYNegIVQFygGFEQA--qlAYLEGVKQSIEAD-  170
DSSP  hlleeEEELLEEEElleeeellllhHHHHhhLHHHhlLHHHH--hhHHHHHHHHHHHLL-


DSSP  hllhhhhlLLLL-EEELHH------------------------hllHHHHhhhhhhllll
Query asglfdehPRLN-IILGHM------------------------gegLPYMmwridhrnaw  236
ident                 ||                                          
Sbjct -------lGLFKpRRXGHIslcqkfqqffgedtsdfseevxekfrvILAL----------  213
DSSP  -------lLLLLlLEELLLlhhhllhhhhlllhhhllhhhhhhhhhHHHH----------


DSSP  llllllllllllhHHHHhhhEEEELLL-----------LLLHHHHHHHHLLLLhhHEELL
Query vklpprypakrrfMDYFnenFHITTSG-----------NFRTQTLIDAILEIGadRILFS  285
ident                                                |            
Sbjct ------------vKKRD---YELDFNTaglfkplcgetYPPKKIVTLASELQI--PFVYG  256
DSSP  ------------hHHHL---LEEEEELhhhhlllllllLLLHHHHHHHHHLLL--LEEEE


DSSP  LLLL-llLHHHHHHHHHHLLLlhhhhhhhhlhhhhhhllll
Query TDWP-feNIDHASDWFNATSIaeadrvkigrtnarrlfkld  325
ident  |      |                                
Sbjct SDSHgvqDIGRGYSTYCQKLE--------------------  277
DSSP  LLLLlhhHLLLLHHHHHHHLL--------------------


No 53: Query=2dvtA Sbjct=3au2A Z-score=8.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ----------------------------------LLLEEEEEEEELLhhhhhhhllllll
Query ----------------------------------MQGKVALEEHFAIpetlqdsagfvpg   26
ident                                    | |  |  |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTY-------------  347
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLL-------------


DSSP  lhhhhhhhHHHLLLlHHHHHHHHLLEEEEEEEELLlHHHHLllhhhHHHHHHHHHHHHHH
Query dywkelqhRLLDIQdTRLKLMDAHGIETMILSLNApAVQAIpdrrkAIEIARRANDVLAE   86
ident                         |                            |     |
Sbjct ------sdGQNTLE-ELWEAAKTMGYRYLAVTDHS-PAVRV----aGGPSPEEALKRVGE  395
DSSP  ------llLLLLHH-HHHHHHHHHLLLEEEEEEEL-HHHHL----lLLLLHHHHHHHHHH


DSSP  HHHHLL----lLEEEEellllllhhhhhhhhhhhhhllllleEEEELLllllllllLLLL
Query ECAKRP----dRFLAFaalplqdpdaateelqrcvndlgfvgALVNGFsqegdgqtPLYY  142
ident              ||                           | |           |   
Sbjct IRRFNEthgppYLLAG--------------------------AEVDIH--------PDGT  421
DSSP  HHHHHHhhlllEEEEE--------------------------EEEELL--------LLLL


DSSP  llhhhhhhhhhhhhhllLEEEELLLLLHhhlhhhlllhhhlhhhlhhhhhhHHHHHHHhh
Query dlpqyrpfwgevekldvPFYLHPRNPLPqdsriydghpwllgptwafaqetAVHALRLma  202
ident                                                        |    
Sbjct -----ldypdwvlreldLVLVSVHSRFN-----------------lpkadqTKRLLKA--  457
DSSP  -----llllhhhhllllEEEEELLLLLL-----------------llhhhhHHHHHHH--


DSSP  llhhhhllLLLEEELH----------hhllHHHHhhhhhhllllllllllllllllhhHH
Query sglfdehpRLNIILGH----------mgegLPYMmwridhrnawvklpprypakrrfmDY  252
ident              | |                                            
Sbjct -----lenPFVHVLAHptarllgrrapieaDWEA----------------------vfQK  490
DSSP  -----hllLLLLEELLllllllllllllllLHHH----------------------hhHH


DSSP  HHHH-EEEELLL-----LLLHHHHHHHHLLLLhhHEELLLLLLL-lLHHHHhHHHHH--L
Query FNEN-FHITTSG-----NFRTQTLIDAILEIGadRILFSTDWPF-eNIDHAsDWFNA--T  303
ident   |        |              |        |  |||                   
Sbjct AKEKgVAVEIDGyydrmDLPDDLARMAYGMGL--WISLSTDAHQtdHLRFM-ELAVGtaQ  547
DSSP  HHHHlLEEEEELlllllLLLHHHHHHHHHLLL--LEEEELLLLLhhHHHHH-HHHHHhhH


DSSP  LLLhhHHHH-HHLH---hHHHHLL---ll
Query SIAeaDRVK-IGRT---nARRLFK---ld  325
ident                        |     
Sbjct RAW-iGPERvLNTLdyedLLSWLKarrgv  575
DSSP  HLL-lLLLLlHHHLlhhhHHHHHHlllll


No 54: Query=2dvtA Sbjct=1m65A Z-score=8.2

back to top
DSSP  llLEEEEEEEELlhhHHHHhlllllllhhhhhhhhHHLLLlHHHHHHHHLLEEEEEEEEL
Query mqGKVALEEHFAipeTLQDsagfvpgdywkelqhrLLDIQdTRLKLMDAHGIETMILSLN   60
ident     | |  |                                        ||        
Sbjct --YPVDLHMHTV---ASTH---------------aYSTLS-DYIAQAKQKGIKLFAITDH   39
DSSP  --LLEELLLLLL---LLLL---------------lLLLHH-HHHHHHHHHLLLEEEEEEE


DSSP  LlHHHHLllhhhhhhHHHHHHHHHHHhhHHLL---LLEEEEellllllhhhhhhhHHHHH
Query ApAVQAIpdrrkaieIARRANDVLAEecAKRP---DRFLAFaalplqdpdaateeLQRCV  117
ident                               |       |                     
Sbjct G-PDMED-------aPHHWHFINMRI--WPRVvdgVGILRGieaniknvdgeidcSGKMF   89
DSSP  L-LLLLL-------lLLLHHHHHHHH--LLLEellEEEEEEeeeellllllllllLHHHH


DSSP  HllLLLEEeeellllllllllllllllhhhhhhhhhhhhhllleEEELLLLlhhhlhhhl
Query NdlGFVGAlvngfsqegdgqtplyydlpqyrpfwgevekldvpfYLHPRNPlpqdsriyd  177
ident                                                   |         
Sbjct D--SLDLI------------------------------------IAGFHEP---------  102
DSSP  H--HLLEE------------------------------------EEELLLL---------


DSSP  llhhhlhhhlhhhhhhHHHHHHHhhllhhhhllLLLE-EELHHHL----LHHHHhhhhhh
Query ghpwllgptwafaqetAVHALRLmasglfdehpRLNI-ILGHMGE----GLPYMmwridh  232
ident                                    |  |  | |                
Sbjct ------vfaphdkatnTQAMIAT--------iaSGNVhIISHPGNpkyeIDVKA------  142
DSSP  ------llllllhhhhHHHHHHH--------hhLLLLlEELLLLLllllLLHHH------


DSSP  llllllllllllllllhhhHHHHH-EEEELLL-llLHHHHHHHHLLLLhhHEELLLLLLL
Query rnawvklpprypakrrfmdYFNEN-FHITTSG-nfRTQTLIDAILEIGadRILFSTDWPF  290
ident                                                |        |   
Sbjct ----------------vaeAAAKHqVALEINNssnCREVAAAVRDAGG--WVALGSDSHT  184
DSSP  ----------------hhhHHHHHlLEEEEELlllHHHHHHHHHHHLL--LEEEELLLLL


DSSP  -lLHHHHhHHHHH--LLLLhhHHHHHHLH---HHHHHLL-----------ll
Query -eNIDHAsDWFNA--TSIAeaDRVKIGRT---NARRLFK-----------ld  325
ident                          |                          
Sbjct afTMGEF-EECLKilDAVD-fPPERILNVsprRLLNFLEsrgmapiaefadl  234
DSSP  hhHLLLL-HHHHHhhHHLL-lLHHHLHHHlhhHHHHHHHhllllllhhhlll


No 55: Query=2dvtA Sbjct=3f2bA Z-score=7.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ----------------------------------------------lLLEEEEEEEE-LL
Query ----------------------------------------------mQGKVALEEHF-AI   13
ident                                                   | |  |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTpMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLlLL


DSSP  HHHhhhhlllllllhhhhhhhHHHLLLLhHHHHHHHLLEEEEEEEELLlhhhhlllhhhh
Query PETlqdsagfvpgdywkelqhRLLDIQDtRLKLMDAHGIETMILSLNApavqaipdrrka   73
ident                                      |         |            
Sbjct QMD------------------AVTSVTK-LIEQAKKWGHPAIAVTDHA------------  149
DSSP  LLL------------------LLLLHHH-HHHHHHHLLLLLEEELLLL------------


DSSP  hhhhhhHHHHHHHHHHHLL---LLEEEEEllllllhhhhhhhhhhhhhllllleeEEELL
Query ieiarrANDVLAEECAKRP---DRFLAFAalplqdpdaateelqrcvndlgfvgaLVNGF  130
ident             |                                            |  
Sbjct ------VVQSFPEAYSAAKkhgMKVIYGL--------------------------EANIV  177
DSSP  ------LLLLHHHHHHHHHhhlLLEEEEE--------------------------EEEEE


DSSP  -----------------------------LLLLllllllllllhhhHHHHHHHhhHLLLe
Query -----------------------------SQEGdgqtplyydlpqyRPFWGEVekLDVPf  161
ident                                                             
Sbjct ddpfhvtllaqnetglknlfklvslshiqYFHR-------vpriprSVLVKHR--DGLL-  227
DSSP  llleeeeeeellhhhhhhhhhhhhhhhllLLLL-------llleehHHHHHLL--LLEE-


DSSP  eeelllllhhhlhhhlllhhhlhhhlhhhhhhhhhhhhhhhllhhhhlllllEEELH---
Query ylhprnplpqdsriydghpwllgptwafaqetavhalrlmasglfdehprlnIILGH---  218
ident                                                        |    
Sbjct ----------------------------------------------------VGSGCdkg  235
DSSP  ----------------------------------------------------EELLLlll


DSSP  hHLLHhhhhhhhhhllllllllllllllllhHHHHHHHE-EEELlLLLL-----------
Query mGEGLpymmwridhrnawvklpprypakrrfMDYFNENF-HITTsGNFR-----------  266
ident                                                             
Sbjct eLFDN--------------------------VEDIARFYdFLEV-HPPDvykplyvkdee  268
DSSP  lLLLL--------------------------LLLLHHHLlLEEE-LLHHhhlllllllhh


DSSP  --HHHHHHHHLLLL--hHHEELLLLLL-----------------------------lLLH
Query --TQTLIDAILEIG--aDRILFSTDWP-----------------------------fENI  293
ident                                                             
Sbjct miKNIIRSIVALGEkldIPVVATGNVHylnpedkiyrkilihsqgganplnrhelpdVYF  328
DSSP  hhHHHHHHHHHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhhhllllllllllLLL


DSSP  HhHHHHHHHL--LLLHHHHHHHHLHHHHHHLLL---------------------------
Query DhASDWFNAT--SIAEADRVKIGRTNARRLFKL---------------------------  324
ident                      |   |      |                           
Sbjct R-TTNEMLDCfsFLGPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeirems  387
DSSP  L-LHHHHHHHhhHHHHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct yrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvg  447
DSSP  hhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct ssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghd  507
DSSP  hlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct ipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfv  567
DSSP  lllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct kayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddts  627
DSSP  hhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct sewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsste  687
DSSP  lllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct plgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqe  747
DSSP  hhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct liqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvp  807
DSSP  hhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct ewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikg  867
DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct saairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgn  927
DSSP  hhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  324
ident                                                             
Sbjct slippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpd  987
DSSP  eeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllll


DSSP  ------l
Query ------d  325
ident        
Sbjct hnqlslf  994
DSSP  lllllll


No 56: Query=2dvtA Sbjct=2anuA Z-score=6.0

back to top
DSSP  -llLEEEEEEEELLhhhhhhhlllllllhhhhhhhHHHLLLLhHHHHHHHLLEEEEEEEE
Query -mqGKVALEEHFAIpetlqdsagfvpgdywkelqhRLLDIQDtRLKLMDAHGIETMILSL   59
ident           |                          |        |   ||        
Sbjct tewLLCDFHVHTNX-------------------sdGHLPLGE-VVDLFGKHGVDVVSITD   40
DSSP  leeEEEEEEELLLL-------------------llLLLLHHH-HHHHHHHLLLLEEEEEE


DSSP  LLL--------hhhhlllhhhHHHHHHHHHHHHHHHHHHLL----LLEEEEellllllhh
Query NAP--------avqaipdrrkAIEIARRANDVLAEECAKRP----DRFLAFaalplqdpd  107
ident                                 |  |                        
Sbjct HIVdrrtleqrkrngeplgaiTEDKFQDYLKRLWREQKRAWeeygXILIPG---------   91
DSSP  EEElhhhhhhhhhllllllllLLLLHHHHHHHHHHHHHHHHhhhlLEEEEE---------


DSSP  hhhhhhhhhhhllllleEEEELLL-------lllllllllLLLLhhhhhhHHHHHHHLLL
Query aateelqrcvndlgfvgALVNGFS-------qegdgqtplYYDLpqyrpfWGEVEKLDVP  160
ident                                                             
Sbjct -----------------VEITNNTdlyhivavdvkeyvdpSLPV---eeiVEKLKEQNAL  131
DSSP  -----------------EEEEELLlleeeeeellllllllLLLH---hhhHHHHHHLLLE


DSSP  EEeelllllhhhlhhhlllhhhlhHHLHhhhhhHHHHhhhhhllhhhhllllleeelhhh
Query FYlhprnplpqdsriydghpwllgPTWAfaqetAVHAlrlmasglfdehprlniilghmg  220
ident                                                             
Sbjct VI-----------------aahpdRKKL-----SWYL-----------------------  146
DSSP  EE-----------------ellllLLLL-----LLHH-----------------------


DSSP  llhhhhhhhhhhllllllllllllllllHHHHHHHH-EEEE-LLLLLLhhhHHHHHLLLL
Query eglpymmwridhrnawvklpprypakrrFMDYFNEN-FHIT-TSGNFRtqtLIDAILEIG  278
ident                                 |                           
Sbjct --------------------------waNXERFKDTfDAWEiANRDDL---FNSVGVKKY  177
DSSP  --------------------------hhLLLLLLLLlLEEEeEELLEE---LHHHHHLLL


DSSP  hhHEELLLLLLL-lLHHHHhhhhhhllllhhhhhhhHLHH-----hhHHLLL--------
Query adRILFSTDWPF-eNIDHAsdwfnatsiaeadrvkiGRTN-----arRLFKL--------  324
ident   |     |                                                   
Sbjct --RYVANSDFHElwHVYSW-----------------KTLVkseknieAIKEAirkntdva  218
DSSP  --LEEEELLLLLhhHHLLE-----------------EEEEeelllhhHHHHHhhhlllee


DSSP  -----l
Query -----d  325
ident       
Sbjct iylxrk  224
DSSP  eeelll


No 57: Query=2dvtA Sbjct=1bksA Z-score=5.6

back to top
DSSP  -------------lLLEEeeeeeellhhhhhhhlllllllhhhhhhhhhhllllhhhhhh
Query -------------mQGKValeehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklm   47
ident                                                             
Sbjct meryenlfaqlndrREGA------------------------------------------   18
DSSP  lhhhhhhhhhhhhlLLLE------------------------------------------


DSSP  hhlleeeEEEEElllhhhhlllhhhhhhhHHHH-hHHHHHHHHH-LLLLE-EEEELLLLL
Query dahgietMILSLnapavqaipdrrkaieiARRA-nDVLAEECAK-RPDRF-LAFAALPLQ  104
ident                                                          |  
Sbjct -------FVPFV----------------tLGDPgiEQSLKIIDTlIDAGAdALELGVPFS   55
DSSP  -------EEEEE----------------eLLLLlhHHHHHHHHHhHHLLLlLEEEELLLL


DSSP  ------------------lhhHHHHHHHHhHHLLL------lLEEEEELLLlllllllll
Query ------------------dpdAATEELQRcVNDLG------fVGALVNGFSqegdgqtpl  140
ident                                            | |              
Sbjct dpladgptiqnanlrafaagvTPAQCFEM-LALIRekhptipIGLLMYANL---------  105
DSSP  llllllhhhhhhhhhhhhhllLHHHHHHH-HHHHHhhlllllEEEEELHHH---------


DSSP  lllLHHH-HHHHHHHHHHLL-LEEEELllllhhhlhhhlllhhhlhhhlhhhhHHHHHHH
Query yydLPQY-RPFWGEVEKLDV-PFYLHPrnplpqdsriydghpwllgptwafaqETAVHAL  198
ident           |    |   |                                        
Sbjct --vFNNGiDAFYARCEQVGVdSVLVAD--------------------------VPVEESA  137
DSSP  --hHLLLhHHHHHHHHHHLLlEEEELL--------------------------LLHHHLH


DSSP  HHHhlLHHHHLlLLLEEELHH---hllHHHHhhhhhhllllllllllllllllhhhhhHH
Query RLMasGLFDEHpRLNIILGHM---gegLPYMmwridhrnawvklpprypakrrfmdyfNE  255
ident           |     |          |                                
Sbjct PFR--QAALRH-NIAPIFICPpnadddLLRQ-------------------------vaSY  169
DSSP  HHH--HHHHHL-LLEEEEEELllllhhHHHH-------------------------hhHH


DSSP  HE-EEELLlllLHHHHHHHHLLLLhhHEELLLLLllLLHHHHHHHHHHL-----------
Query NF-HITTSgnfRTQTLIDAILEIGadRILFSTDWpfENIDHASDWFNAT-----------  303
ident                                                             
Sbjct GRgYTYLLalpLHHLIEKLKEYHA--APALQGFG--ISSPEQVSAAVRAgaagaisgsai  225
DSSP  LLlLEEELlllHHHHHHHHHHHLL--LLEEELLL--LLLHHHHHHHHHHllleeeellhh


DSSP  --------lllhhhhhhhhlhhhhhhllll
Query --------siaeadrvkigrtnarrlfkld  325
ident                               
Sbjct vkiieknlaspkqmlaelrsfvsamkaasr  255
DSSP  hhhhhhllllhhhhhhhhhhhhhhhhhlll


No 58: Query=2dvtA Sbjct=2yb1A Z-score=5.3

back to top
DSSP  lllEEEEEEEELLhhhhhhhlllllllhhhhhhhHHHLLLlHHHHHHHHLLEEEEEEEEL
Query mqgKVALEEHFAIpetlqdsagfvpgdywkelqhRLLDIQdTRLKLMDAHGIETMILSLN   60
ident       |  |                          |           |       |   
Sbjct --aNIDLHFHSRT-------------------sdGALTPT-EVIDRAAARAPALLALTDH   38
DSSP  --lLEELLLLLLL-------------------llLLLLHH-HHHHHHHLLLLLEEEELLL


DSSP  LlhhhhlllhhhhhhhhhhhHHHHHHHHHHLL---LLEEEEellllllhhhhhhhhhhhh
Query ApavqaipdrrkaieiarraNDVLAEECAKRP---DRFLAFaalplqdpdaateelqrcv  117
ident                        |||  |        ||                     
Sbjct D------------------cTGGLAEAAAAAArrgIPFLNG-------------------   61
DSSP  L------------------lLLLHHHHHHHHHhllLLEEEE-------------------


DSSP  hllllleEEEELL--------------------------------lLLLLL---------
Query ndlgfvgALVNGF--------------------------------sQEGDG---------  136
ident          |                                                  
Sbjct -------VEVSVSwgrhtvhivglgidpaepalaaglksiregrleRARQMgasleaagi  114
DSSP  -------EEEEEEelleeeeeeeellllllhhhhhhhhhhhllhhhHHHHHhhhhhhlll


DSSP  --------------------------------------------------LLLLLLllhh
Query --------------------------------------------------QTPLYYdlpq  146
ident                                                             
Sbjct agcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyVSHQWA---s  171
DSSP  llhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllLLLLLL---l


DSSP  hhhhhhHHHHHLLLEeeelllllhhhlhhhlllhhhlhhhlhhhhhhhhhhhhhhhllhh
Query yrpfwgEVEKLDVPFylhprnplpqdsriydghpwllgptwafaqetavhalrlmasglf  206
ident                                                             
Sbjct ledavgWIVGAGGMA---------------------------------------------  186
DSSP  hhhhhhHHHHLLLEE---------------------------------------------


DSSP  hhllllleEELHhHLLHhHHHHHhhhllllllllllllllllhHHHHHHH-----EEEE-
Query dehprlniILGHmGEGLpYMMWRidhrnawvklpprypakrrfMDYFNEN-----FHIT-  260
ident            |                                             |  
Sbjct --------VIAH-PGRYdMGRTL-------------------iERLILDFqaaggQGIEv  218
DSSP  --------EELL-HHHLlLLHHH-------------------hHHHHHHHhhlllLEEEe


DSSP  LLLLLLHHHHHHHHLLLL--hHHEELLLLLLL--lLHHHhhhhhhhllllhhHHHHhhlh
Query TSGNFRTQTLIDAILEIG--aDRILFSTDWPF--eNIDHasdwfnatsiaeaDRVKigrt  316
ident  ||           |             |         |                     
Sbjct ASGSHSLDDMHKFALHADrhgLYASSGSDFHApgeDVGH--------tedlpPICR----  266
DSSP  EELLLLHHHHHHHHHHHHhhlLEEEEELLLLLlllLLLL--------lllllLLLL----


DSSP  HHHHHLLL---------l
Query NARRLFKL---------d  325
ident    |              
Sbjct PIWRELEArilrpadaen  284
DSSP  LHHHHLHHhlllllhhhl


No 59: Query=2dvtA Sbjct=3e38A Z-score=4.6

back to top
DSSP  ---------------llLEEEEEEEELLhhhhhhhlllllllhhhhhhhhHHLLLlHHHH
Query ---------------mqGKVALEEHFAIpetlqdsagfvpgdywkelqhrLLDIQdTRLK   45
ident                   |     |                         |      |  
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVF-------------------sdgLVWPT-VRVD   40
DSSP  llllllllllllllleeEEEELLLLLLL-------------------lllLLLHH-HHHH


DSSP  HHHHLLEEEEEEEELLLHHhhlllhhhhhhhhHHHHhHHHHHHHHLLL----LEEEE---
Query LMDAHGIETMILSLNAPAVqaipdrrkaieiaRRANdVLAEECAKRPD----RFLAF---   98
ident      |     |                       |      |                 
Sbjct EAYRDGLDAISLTEHIEYR------phkqdvvSDHN-RSFDLCREQAEklgiLLIKGsei   93
DSSP  HHHHLLLLEELLEEELLLL------lllllllLLLL-HHHHHHHHHHHhhllEELLEeee


DSSP  ---------------ELLLlllhhhhhhhhhhhhhllllleeeeelllllllllllLLLL
Query ---------------AALPlqdpdaateelqrcvndlgfvgalvngfsqegdgqtpLYYD  143
ident                   |                                       | 
Sbjct traxapghfnaiflsDSNP----------------------------------leqKDYK  119
DSSP  elllllleeeeelllLLHH----------------------------------hllLLHH


DSSP  lhhhhhhhHHHHHHLLLeeeelllllhhhlhhhlllhhhlhhhlhhhhhhhhhhhhhhhl
Query lpqyrpfwGEVEKLDVPfylhprnplpqdsriydghpwllgptwafaqetavhalrlmas  203
ident          |  |                                               
Sbjct -----dafREAKKQGAF-------------------------------------------  131
DSSP  -----hhhHHHHHLLLE-------------------------------------------


DSSP  lhhhhlllllEEELhHHLL-----hhHHHHhhhhlllllllllllllllLHHHHHHH---
Query glfdehprlnIILGhMGEG-----lpYMMWridhrnawvklpprypakrRFMDYFNE---  255
ident                              |                              
Sbjct ----------XFWN-HPGWdsqqpdtTKWW-------------------PEHTALYQegc  161
DSSP  ----------EEEL-LLLLlllllllLLLL-------------------HHHHHHHHlll


DSSP  HEEEE-LLLLLLhhhHHHHHLLLL--hHHEELLLLLLL---------llhHHHH------
Query NFHIT-TSGNFRtqtLIDAILEIG--aDRILFSTDWPF---------eniDHAS------  297
ident    |    |         ||              |                         
Sbjct XHGIEvANGHLY---XPEAIQWCLdknLTXIGTSDIHQpiqtdydfekgeHRTXtfvfak  218
DSSP  LLEEEeEELLEE---LLHHHHHHHhhlLEEEEELLLLLlhhhhllhhhllLLLEeeeeel


DSSP  -----------------hHHHHL-------------------------------------
Query -----------------dWFNAT-------------------------------------  303
ident                    |                                        
Sbjct erslqgirealdnrrtaaYFHELligredllrpffekcvkieevsrneqgvtlsitnvtd  278
DSSP  lllhhhhhhhhhllleeeEELLEeellhhhhhhhhhhheeeeeeeeelleeeeeeeelll


DSSP  ------------------------------------------------LLLHhhhhhhhl
Query ------------------------------------------------SIAEadrvkigr  315
ident                                                             
Sbjct lvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtNFIV------ap  332
DSSP  lleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeEEEE------el


DSSP  hhhhhhllll
Query tnarrlfkld  325
ident           
Sbjct dkglkytisl  342
DSSP  leeeeeeeel