Results: dupa

Query: 2anuA

MOLECULE: HYPOTHETICAL PROTEIN TM0559;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2anu-A 45.6  0.0  224   224  100 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
   2:  3e38-A 21.4  2.8  197   342   24 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
   3:  2yb1-A 13.5  3.0  164   284   22 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   4:  3au2-A 12.4  3.1  169   575   17 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   5:  3f2b-A 11.7  2.8  157   994   19 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
   6:  3dcp-A 11.0  3.6  166   277   16 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
   7:  1m65-A  9.9  3.3  157   234   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   8:  3qy6-A  9.1  3.7  161   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   9:  2oof-A  7.9  3.2  154   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  10:  1yrr-B  7.4  3.3  152   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  11:  3nqb-A  7.1  3.6  153   587   10 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  12:  1k6w-A  7.1  3.3  147   423   10 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  13:  2paj-A  6.8  3.3  145   421    8 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  14:  4cqb-A  6.8  3.6  156   402    8 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  15:  1v77-A  6.8  3.3  131   202   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  16:  4hk5-D  6.7  3.3  145   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  17:  3gg7-A  6.5  3.2  137   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  18:  1a4m-A  6.5  3.5  156   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  19:  2y1h-B  6.3  3.5  140   265   10 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  20:  3ls9-A  6.2  3.4  148   453   10 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  21:  1onx-A  6.0  3.5  150   390   11 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  22:  2dvt-A  6.0  3.3  146   325    7 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  23:  3gri-A  6.0  3.7  152   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  24:  2ffi-A  6.0  3.5  139   273   17 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  25:  2vun-A  6.0  4.0  150   385   13 PDB  MOLECULE: ENAMIDASE;                                                 
  26:  4dlf-A  5.8  3.7  143   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  27:  2vc5-A  5.7  3.4  140   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  28:  4mup-B  5.7  3.5  143   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  29:  1gkp-A  5.6  3.4  142   458    9 PDB  MOLECULE: HYDANTOINASE;                                              
  30:  4qrn-A  5.6  3.6  140   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  31:  1itq-A  5.5  3.7  152   369   14 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  32:  1bf6-A  5.5  3.6  145   291    4 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  33:  4rdv-B  5.5  3.4  148   451   10 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  34:  4ofc-A  5.4  3.4  139   335   12 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  35:  2uz9-A  5.4  3.4  145   444   14 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  36:  2imr-A  5.3  3.4  132   380    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  37:  3mkv-A  5.2  3.6  145   414   13 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  38:  1j6p-A  5.2  3.4  134   407   12 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  39:  4b3z-D  5.1  3.3  140   477    7 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  40:  2ob3-A  5.1  3.7  137   329    9 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  41:  2ogj-A  5.1  3.8  142   379   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  42:  3k2g-B  5.0  3.4  140   358    6 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  43:  3pnu-A  5.0  4.1  147   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  44:  1a5k-C  4.9  3.7  145   566   14 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  1bks-A  4.8  3.9  127   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  46:  3mtw-A  4.7  3.9  149   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  47:  3irs-A  4.7  3.9  130   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  48:  2gwg-A  4.6  3.9  146   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  49:  3icj-A  4.4  3.8  135   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  50:  4c5y-A  4.4  3.6  134   436   13 PDB  MOLECULE: OCHRATOXINASE;                                             
  51:  3iac-A  4.3  3.6  139   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  1j5s-A  4.3  3.8  136   451   13 PDB  MOLECULE: URONATE ISOMERASE;                                         
  53:  3giq-A  4.1  4.2  149   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  54:  2a3l-A  3.8  3.5  133   616    8 PDB  MOLECULE: AMP DEAMINASE;                                             
  55:  4dzi-C  3.7  3.9  139   388    9 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  56:  3e74-A  3.7  4.1  134   429    9 PDB  MOLECULE: ALLANTOINASE;                                              
  57:  3cjp-A  3.5  3.3  112   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  58:  3ooq-A  3.3  3.8  122   384    8 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  2qpx-A  3.1  4.2  122   376   16 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2anuA Sbjct=2anuA Z-score=45.6

back to top
DSSP  LEEEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEEEEEELHHHHHHHHHLLLLLLL
Query TEWLLCDFHVHTNXSDGHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TEWLLCDFHVHTNXSDGHLPLGEVVDLFGKHGVDVVSITDHIVDRRTLEQRKRNGEPLGA   60
DSSP  LEEEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEEEEEELHHHHHHHHHLLLLLLL


DSSP  LLLLLHHHHHHHHHHHHHHHHHHHLLEEEEEEEEEELLLLEEEEEELLLLLLLLLLLHHH
Query ITEDKFQDYLKRLWREQKRAWEEYGXILIPGVEITNNTDLYHIVAVDVKEYVDPSLPVEE  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ITEDKFQDYLKRLWREQKRAWEEYGXILIPGVEITNNTDLYHIVAVDVKEYVDPSLPVEE  120
DSSP  LLLLLHHHHHHHHHHHHHHHHHHHLLEEEEEEEEEELLLLEEEEEELLLLLLLLLLLHHH


DSSP  HHHHHHHLLLEEEELLLLLLLLLLHHHHLLLLLLLLLLEEEEEELLEELHHHHHLLLLEE
Query IVEKLKEQNALVIAAHPDRKKLSWYLWANXERFKDTFDAWEIANRDDLFNSVGVKKYRYV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IVEKLKEQNALVIAAHPDRKKLSWYLWANXERFKDTFDAWEIANRDDLFNSVGVKKYRYV  180
DSSP  HHHHHHHLLLEEEELLLLLLLLLLHHHHLLLLLLLLLLEEEEEELLEELHHHHHLLLLEE


DSSP  EELLLLLHHHHLLEEEEEEELLLHHHHHHHHHHLLLEEEEELLL
Query ANSDFHELWHVYSWKTLVKSEKNIEAIKEAIRKNTDVAIYLXRK  224
ident ||||||||||||||||||||||||||||||||||||||||||||
Sbjct ANSDFHELWHVYSWKTLVKSEKNIEAIKEAIRKNTDVAIYLXRK  224
DSSP  EELLLLLHHHHLLEEEEEEELLLHHHHHHHHHHLLLEEEEELLL


No 2: Query=2anuA Sbjct=3e38A Z-score=21.4

back to top
DSSP  --------------LEEEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEEEEEElhh
Query --------------TEWLLCDFHVHTNXSDGHLPLGEVVDLFGKHGVDVVSITDHIVdrr   46
ident                  | |||| |   |||       ||     | |  | | ||    
Sbjct aqrrneiqvpdldgYTTLKCDFHXHSVFSDGLVWPTVRVDEAYRDGLDAISLTEHIE---   57
DSSP  llllllllllllllLEEEEEELLLLLLLLLLLLLHHHHHHHHHHLLLLEELLEEELL---


DSSP  hhhhhhhllllllLLLL--llhHHHHHHHHHHHHHHHHhHLLEEEEEEEEEELLLLEEEE
Query tleqrkrngeplgAITE--dkfQDYLKRLWREQKRAWEeYGXILIPGVEITNNTDLYHIV  104
ident                        |           |    |  || | |||      |  
Sbjct -------------YRPHkqdvvSDHNRSFDLCREQAEK-LGILLIKGSEITRAXAPGHFN  103
DSSP  -------------LLLLlllllLLLLHHHHHHHHHHHH-HLLEELLEEEEELLLLLLEEE


DSSP  EELLLL-LLLLLLLHHHHHHHHHHLLLEEEELLLLLLLLL--lhhHHLL-LLLL--LLLL
Query AVDVKE-YVDPSLPVEEIVEKLKEQNALVIAAHPDRKKLS--wylWANX-ERFK--DTFD  158
ident |                     | | |     ||           |              
Sbjct AIFLSDsNPLEQKDYKDAFREAKKQGAFXFWNHPGWDSQQpdttkWWPEhTALYqeGCXH  163
DSSP  EELLLLlHHHLLLLHHHHHHHHHHLLLEEEELLLLLLLLLlllllLLHHhHHHHhlLLLL


DSSP  EEEEEELLEELHHHHHLL----LLEEEELLLLLHH--------hhLLEEEEEEE-LLLHH
Query AWEIANRDDLFNSVGVKK----YRYVANSDFHELW--------hvYSWKTLVKS-EKNIE  205
ident   | ||                      || |                 | |   |    
Sbjct GIEVANGHLYXPEAIQWCldknLTXIGTSDIHQPIqtdydfekgeHRTXTFVFAkERSLQ  223
DSSP  EEEEEELLEELLHHHHHHhhhlLEEEEELLLLLLHhhhllhhhllLLLEEEEEElLLLHH


DSSP  HHHHHHHHLlLEEEEELL------------------------------------------
Query AIKEAIRKNtDVAIYLXR------------------------------------------  223
ident  | ||       | |                                             
Sbjct GIREALDNR-RTAAYFHElligredllrpffekcvkieevsrneqgvtlsitnvtdlvlk  282
DSSP  HHHHHHHLL-LEEEEELLeeellhhhhhhhhhhheeeeeeeeelleeeeeeeelllllee


DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------k  224
ident                                                             
Sbjct lkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 3: Query=2anuA Sbjct=2yb1A Z-score=13.5

back to top
DSSP  leeEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEEEEEelhhhhhhhhhlllllll
Query tewLLCDFHVHTNXSDGHLPLGEVVDLFGKHGVDVVSITDHIvdrrtleqrkrngeplga   60
ident       | | |   ||| |   || |            |||                   
Sbjct ---ANIDLHFHSRTSDGALTPTEVIDRAAARAPALLALTDHD------------------   39
DSSP  ---LLEELLLLLLLLLLLLLHHHHHHHHHLLLLLEEEELLLL------------------


DSSP  lllllhhhhHHHHHHHHHHHHHhHLLEEEEEEEEEEL--LLLEEEEEELLL------LLL
Query itedkfqdyLKRLWREQKRAWEeYGXILIPGVEITNN--TDLYHIVAVDVK------EYV  112
ident             |      |    |     |||          |||              
Sbjct --------cTGGLAEAAAAAAR-RGIPFLNGVEVSVSwgRHTVHIVGLGIDpaepalAAG   90
DSSP  --------lLLLHHHHHHHHHH-LLLLEEEEEEEEEEelLEEEEEEEELLLlllhhhHHH


DSSP  L-----------------------------------------------------------
Query D-----------------------------------------------------------  113
ident                                                             
Sbjct Lksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmr  150
DSSP  Hhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhh


DSSP  -----------------lLLLHHHHHHHHHHLLLEEEELLLLLlLLLL-hhHHLL-LLLL
Query -----------------pSLPVEEIVEKLKEQNALVIAAHPDRkKLSW-ylWANX-ERFK  154
ident                       |  |            ||| |               | 
Sbjct tvfrkyltpgkpgyvshqWASLEDAVGWIVGAGGMAVIAHPGR-YDMGrtlIERLiLDFQ  209
DSSP  hhhhhlllllllllllllLLLHHHHHHHHHHLLLEEEELLHHH-LLLLhhhHHHHhHHHH


DSSP  L-LLLEEEEEELLEE---LHHHHHLL----LLEEEELLLLLHHHHlleEEEE-eelllhh
Query D-TFDAWEIANRDDL---FNSVGVKK----YRYVANSDFHELWHVyswKTLV-kseknie  205
ident        | |                          ||||                    
Sbjct AaGGQGIEVASGSHSlddMHKFALHAdrhgLYASSGSDFHAPGEDvghTEDLppicrpiw  269
DSSP  HlLLLEEEEEELLLLhhhHHHHHHHHhhhlLEEEEELLLLLLLLLlllLLLLllllllhh


DSSP  HHHHhhhhllleeeeelll
Query AIKEairkntdvaiylxrk  224
ident    |               
Sbjct RELE----arilrpadaen  284
DSSP  HHLH----hhlllllhhhl


No 4: Query=2anuA Sbjct=3au2A Z-score=12.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------------------leEEEEEEEELLLLLLLLLLHHHHHHH
Query ---------------------------------teWLLCDFHVHTNXSDGHLPLGEVVDL   27
ident                                        |  ||   |||   | |    
Sbjct yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHSTYSDGQNTLEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLLLLLLLLLHHHHHHH


DSSP  HHHLLLLEEEEEEEEELhhhhhhhhhllLLLLlLLLLLHHHHHHHHHHHHHHHHhhhLLE
Query FGKHGVDVVSITDHIVDrrtleqrkrngEPLGaITEDKFQDYLKRLWREQKRAWeeyGXI   87
ident     |      |||                 |               |            
Sbjct AKTMGYRYLAVTDHSPA---------vrVAGG-PSPEEALKRVGEIRRFNETHG---PPY  407
DSSP  HHHHLLLEEEEEEELHH---------hhLLLL-LLHHHHHHHHHHHHHHHHHHL---LLE


DSSP  EEEEEEEEELLLleeeeeellLLLL-------------------llllLHHHH-HHHHhh
Query LIPGVEITNNTDlyhivavdvKEYV-------------------dpslPVEEI-VEKLke  127
ident |  | |     |                                                
Sbjct LLAGAEVDIHPD---gtldypDWVLreldlvlvsvhsrfnlpkadqtkRLLKAlENPF--  462
DSSP  EEEEEEEELLLL---llllllHHHHlllleeeeellllllllhhhhhhHHHHHhLLLL--


DSSP  lllEEEELL--LLLL--LLLLHhhHLLLLLLLLL----LEEEEEELL--EELH--HHHHL
Query qnaLVIAAH--PDRK--KLSWYlwANXERFKDTF----DAWEIANRD--DLFN--SVGVK  175
ident        ||               |  |           | ||                 
Sbjct ---VHVLAHptARLLgrRAPIE--ADWEAVFQKAkekgVAVEIDGYYdrMDLPddLARMA  517
DSSP  ---LLEELLllLLLLllLLLLL--LLHHHHHHHHhhhlLEEEEELLLllLLLLhhHHHHH


DSSP  L---LLEEEELLLLLHHHHLLE-----------------eEEEEelllHHHHHHHHhhll
Query K---YRYVANSDFHELWHVYSW-----------------kTLVKseknIEAIKEAIrknt  215
ident            | |   |                               |          
Sbjct YgmgLWISLSTDAHQTDHLRFMelavgtaqrawigpervlNTLD----YEDLLSWL----  569
DSSP  HhllLLEEEELLLLLHHHHHHHhhhhhhhhhllllllllhHHLL----HHHHHHHH----


DSSP  leeeeelll
Query dvaiylxrk  224
ident          
Sbjct ---karrgv  575
DSSP  ---hlllll


No 5: Query=2anuA Sbjct=3f2bA Z-score=11.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ---------------------------------------------lEEEEEEEEELLLLL
Query ---------------------------------------------tEWLLCDFHVHTNXS   15
ident                                                      | ||  |
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapeGEKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllLLLLLLLLLLLLLL


DSSP  --LLLLLHHHHHHHHHHLLLLEEEEEEEEelhhhhhhhhhllllllllllllhhHHHHHH
Query --DGHLPLGEVVDLFGKHGVDVVSITDHIvdrrtleqrkrngeplgaitedkfqDYLKRL   73
ident   |             | |      |||                                
Sbjct qmDAVTSVTKLIEQAKKWGHPAIAVTDHA-----------------------vvQSFPEA  157
DSSP  llLLLLLHHHHHHHHHHLLLLLEEELLLL-----------------------llLLHHHH


DSSP  HHHHHHHHhhhlLEEEEEEEEEELLlLEEEEEEL-------lLLLL------------LL
Query WREQKRAWeeygXILIPGVEITNNTdLYHIVAVD-------vKEYV------------DP  114
ident     |          | | |        |                               
Sbjct YSAAKKHG----MKVIYGLEANIVDdPFHVTLLAqnetglknLFKLvslshiqyfhrvPR  213
DSSP  HHHHHHHL----LLEEEEEEEEEELlLEEEEEEEllhhhhhhHHHHhhhhhlllllllLL


DSSP  LLLhHHHHHHHHhlLLEEEELLLlllllllHHHHLLLLLLLLLLEEEeEELLE-------
Query SLPvEEIVEKLKeqNALVIAAHPdrkklswYLWANXERFKDTFDAWEiANRDD-------  167
ident        |        ||             |  | |      |  |     |       
Sbjct IPR-SVLVKHRD--GLLVGSGCD-----kgELFDNVEDIARFYDFLE-VHPPDvykplyv  264
DSSP  EEH-HHHHHLLL--LEEEELLLL-----llLLLLLLLLLHHHLLLEE-ELLHHhhlllll


DSSP  --------eLHHHHHLL----LLEEEELLLLLHH--------------------------
Query --------lFNSVGVKK----YRYVANSDFHELW--------------------------  189
ident            |            ||    | |                           
Sbjct kdeemikniIRSIVALGekldIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelp  324
DSSP  llhhhhhhhHHHHHHHHhhllLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllll


DSSP  --HHLL-----------------eEEEE---eelLLHH----------------------
Query --HVYS-----------------wKTLV---kseKNIE----------------------  205
ident                                     |                       
Sbjct dvYFRTtnemldcfsflgpekakeIVVDntqkiaSLIGdvkpikdelytpriegadeeir  384
DSSP  llLLLLhhhhhhhhhhhhhhhhhhHHLHhhhhhhHLLLllllllllllllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct emsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrg  444
DSSP  hhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct svgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkd  504
DSSP  hhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct ghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktay  564
DSSP  llllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct gfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypad  624
DSSP  hhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct dtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifs  684
DSSP  llllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct steplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgn  744
DSSP  llhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct aqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkh  804
DSSP  hhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct dvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldam  864
DSSP  lllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  205
ident                                                             
Sbjct ikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvi  924
DSSP  hhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllllllllllee


DSSP  ---------------------------------------------------hhhhhhhhl
Query ---------------------------------------------------aikeairkn  214
ident                                                             
Sbjct dgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgclds  984
DSSP  elleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllll


DSSP  lleeeeelll
Query tdvaiylxrk  224
ident           
Sbjct lpdhnqlslf  994
DSSP  llllllllll


No 6: Query=2anuA Sbjct=3dcpA Z-score=11.0

back to top
DSSP  leeEEEEEEELLLLL-LLLL-LHHHHHHHHHHLLLLEEEEEEEEELHHHHHH-hhHLLL-
Query tewLLCDFHVHTNXS-DGHL-PLGEVVDLFGKHGVDVVSITDHIVDRRTLEQ-rkRNGE-   56
ident       | | ||     |      | |        |  ||  |               | 
Sbjct ---XKRDGHTHTEFCpHGTHdDVEEXVLKAIELDFDEYSIVEHAPLSSEFXKntaGDKEa   57
DSSP  ---LLEEEEELLLLLlLLLLlLHHHHHHHHHHLLLLEEEEEEELLLLHHHHHlllLLLHh


DSSP  -LLLLLLLLLHHHHHHHHHHHHHHHHHhhLLEEEEEEEEEELLL-leeeeeellLLLL--
Query -PLGAITEDKFQDYLKRLWREQKRAWEeyGXILIPGVEITNNTD-lyhivavdvKEYV--  112
ident              | |      |            | |                      
Sbjct vTTASXAXSDLPYYFKKXNHIKKKYAS--DLLIHIGFEVDYLIGyedftrdflnEYGPqt  115
DSSP  hHLLLLLHHHHHHHHHHHHHHHHHLLL--LLEEEEEEEEELLLLlhhhhhhhhhHHHHhl


DSSP  -----------------------------------------------lllllHHHHhHHH
Query -----------------------------------------------dpslpVEEIvEKL  125
ident                                                             
Sbjct ddgvlslhflegqggfrsidfsaedynegivqfyggfeqaqlaylegvkqsiEADL-GLF  174
DSSP  leeeeelleeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhhhhhhhhHLLL-LLL


DSSP  HhlllEEEELLL-LLLL---------------lllhhhHLLLLL-LLLLlEEEEEELL--
Query KeqnaLVIAAHP-DRKK---------------lswylwANXERF-KDTFdAWEIANRD--  166
ident |         |     |                            |              
Sbjct K----PRRXGHIsLCQKfqqffgedtsdfseevxekfrVILALVkKRDY-ELDFNTAGlf  229
DSSP  L----LLEELLLlHHHLlhhhhlllhhhllhhhhhhhhHHHHHHhHHLL-EEEEELHHhh


DSSP  ------EELH--HHHHLL---LLEEEELLLLLHHHHLLEEeeeeelllhhhhhhhhhhll
Query ------DLFN--SVGVKK---YRYVANSDFHELWHVYSWKtlvkseknieaikeairknt  215
ident              |          |  || |                             
Sbjct kplcgeTYPPkkIVTLASelqIPFVYGSDSHGVQDIGRGY--------------------  269
DSSP  llllllLLLLhhHHHHHHhllLLEEEELLLLLHHHLLLLH--------------------


DSSP  lEEEEelll
Query dVAIYlxrk  224
ident          
Sbjct -STYCqkle  277
DSSP  -HHHHhhll


No 7: Query=2anuA Sbjct=1m65A Z-score=9.9

back to top
DSSP  leeEEEEEEELLLLL-LLLLLHHHHHHHHHHLLLLEEEEEEEEELhhhhhhhhhllllLL
Query tewLLCDFHVHTNXS-DGHLPLGEVVDLFGKHGVDVVSITDHIVDrrtleqrkrngepLG   59
ident       | | ||  |      |          |     ||||  |               
Sbjct ---YPVDLHMHTVAStHAYSTLSDYIAQAKQKGIKLFAITDHGPD------------mED   45
DSSP  ---LLEELLLLLLLLlLLLLLHHHHHHHHHHHLLLEEEEEEELLL------------lLL


DSSP  LLLLLLHHhHHHHhhHHHHHhhhhHLLEEEEEEEEEELLlleeeeeellLLLL-------
Query AITEDKFQdYLKRlwREQKRaweeYGXILIPGVEITNNTdlyhivavdvKEYV-------  112
ident |     |                  |     | |                          
Sbjct APHHWHFI-NMRI--WPRVV----DGVGILRGIEANIKN--vdgeidcsGKMFdsldlii   96
DSSP  LLLLHHHH-HHHH--LLLEE----LLEEEEEEEEEELLL--llllllllHHHHhhlleee


DSSP  --------------llllLHHHHHHHHHhlllEEEELLlllllLLLHhhHLLLLLLLLL-
Query --------------dpslPVEEIVEKLKeqnaLVIAAHpdrkkLSWYlwANXERFKDTF-  157
ident                                   |  |                      
Sbjct agfhepvfaphdkatntqAMIATIASGN----VHIISH--pgnPKYE--IDVKAVAEAAa  148
DSSP  eellllllllllhhhhhhHHHHHHHLLL----LLEELL--lllLLLL--LLHHHHHHHHh


DSSP  ---LEEEeEELLEeLHHHHHLL----LLEEEELLLLLHHHHLLE----------------
Query ---DAWEiANRDDlFNSVGVKK----YRYVANSDFHELWHVYSW----------------  194
ident     | |  |       |              || |                        
Sbjct khqVALE-INNSSnCREVAAAVrdagGWVALGSDSHTAFTMGEFeeclkildavdfpper  207
DSSP  hhlLEEE-EELLLlHHHHHHHHhhhlLLEEEELLLLLHHHLLLLhhhhhhhhhllllhhh


DSSP  -eEEEEElllhhHHHHHHHH-llleeeeelll
Query -kTLVKSeknieAIKEAIRK-ntdvaiylxrk  224
ident                                 
Sbjct ilNVSPR-----RLLNFLESrgmapiaefadl  234
DSSP  lhHHLHH-----HHHHHHHHllllllhhhlll


No 8: Query=2anuA Sbjct=3qy6A Z-score=9.1

back to top
DSSP  leeeEEEEEEL--lLLLLLlLLHHHHHHHHHHLL----LLEEEEEEEEELHhhhhhhhhl
Query tewlLCDFHVH--tNXSDGhLPLGEVVDLFGKHG----VDVVSITDHIVDRrtleqrkrn   54
ident       | | |      ||                         | |             
Sbjct ----MIDIHCHilpAMDDG-AGDSADSIEMARAAvrqgIRTIIATPHHNNG---------   46
DSSP  ----LEELLLLlllLLLLL-LLLHHHHHHHHHHHhhllLLEEELLLEELLL---------


DSSP  lllLLLLlllLHHHHHHHHHHHHHHHHHH-HLLEEEEEEEEEELLL------leeeeEEL
Query gepLGAItedKFQDYLKRLWREQKRAWEE-YGXILIPGVEITNNTD------lyhivAVD  107
ident                        ||   |       || ||                   
Sbjct ---VYKN---EPAAVREAADQLNKRLIKEdIPLHVLPGQEIRIYGEveqdlakrqllSLN  100
DSSP  ---LLLL---LHHHHHHHHHHHHHHHHHLlLLLEEELLLEEELLLLhhhhhhlllllLHH


DSSP  L-----------llllllllLHHHHHHHHHhllleEEELLLllllLLLH-hHHLLLLLL-
Query V-----------keyvdpslPVEEIVEKLKeqnalVIAAHPdrkkLSWY-lWANXERFK-  154
ident                            |          |||                   
Sbjct DtkyiliefpfdhvpryaeqLFYDLQLKGY----iPVIAHP-ernREIRenPSLLYHLVe  155
DSSP  HlleeeeelllllllllhhhHHHHHHHLLL----eEEEELH-hhlHHHHhlLHHHHHHHh


DSSP  LLLLeEEEEELLE----------eLHHHHHLLLLEEEELLLLLH-HHHLLE---------
Query DTFDaWEIANRDD----------lFNSVGVKKYRYVANSDFHEL-WHVYSW---------  194
ident        |                              || |                  
Sbjct KGAA-SQITSGSLagifgkqlkafSLRLVEANLIHFVASDAHNVkTRNFHTqealyvlek  214
DSSP  LLLE-EEEEHHHHlllllhhhhhhHHHHHHLLLLLEEELLLLLLlLLLLLHhhhhhhhhh


DSSP  --------eeEEEElllhhHHHHHhHHLLleeeeelll
Query --------ktLVKSeknieAIKEAiRKNTdvaiylxrk  224
ident                                       
Sbjct efgselpymlTENA----eLLLRN-QTIFrqppqpvkr  247
DSSP  hhllhhhhhhHHHH----hHHHLL-LLLLlllllllll


No 9: Query=2anuA Sbjct=2oofA Z-score=7.9

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------T    1
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklV   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllleE


DSSP  EEEEEEEEELLLL---------------------------------------lllllLHH
Query EWLLCDFHVHTNX---------------------------------------sdghlPLG   22
ident    | | | |                                                  
Sbjct TPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfeLAL  120
DSSP  EELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHLLLLEEEEEEEeelhhhhhhhhhllllllLLLLL-LHHHHHHHHHHHHHHHH
Query EVVDLFGKHGVDVVSITDHivdrrtleqrkrngeplgAITED-KFQDYLKRLWREQKRAW   81
ident   |      ||  | |                                |    |      
Sbjct PRVKSLIREGVTTVEIKSG------------------YGLTLeDELKXLRVARRLGEALP  162
DSSP  HHHHHHHHHLEEEEEEELL------------------LLLLHhHHHHHHHHHHHHHHHLL


DSSP  hhhlLEEEEEEE--------------------------------------EEELLLLeee
Query eeygXILIPGVE--------------------------------------ITNNTDLyhi  103
ident                                                             
Sbjct ----IRVKTTLLaahavppeyrddpdswveticqeiipaaaeagladavdVFCEHIG---  215
DSSP  ----LEEEEEEEeellllhhhlllhhhhhhhhhhlhhhhhhhllllleeeEEELLLL---


DSSP  eeelllllllLLLL-HHHHHHHHH-HLLLEE---------------------EELLLlll
Query vavdvkeyvdPSLP-VEEIVEKLK-EQNALV---------------------IAAHPdrk  140
ident            ||   |           |                          |    
Sbjct ----------FSLAqTEQVYLAADqYGLAVKghxdqlsnlggstlaanfgalSVDHL---  262
DSSP  ----------LLHHhHHHHHHHHHhLLLEEEeeelllllllhhhhhhhllllEEEEL---


DSSP  llllhHHHL--LLLLLLLlLEEEeEELL----------eeLHHHHHLLLLEEEELLLL--
Query klswyLWAN--XERFKDTfDAWEiANRD----------dlFNSVGVKKYRYVANSDFH--  186
ident                                                       ||    
Sbjct ----eYLDPegIQALAHRgVVAT-LLPTafyflketklppVVALRKAGVPXAVSSDINpg  317
DSSP  ----lLLLHhhHHHHHHHlLEEE-ELHHhhhhllllllllHHHHHHLLLLEEELLLLLll


DSSP  --LHHH-HLLE----------------EEEEeelllhhhHHHH---------------hh
Query --ELWH-VYSW----------------KTLVkseknieaIKEA---------------ir  212
ident                                          |                  
Sbjct taPIVSlRXAXnxactlfgltpveaxaGVTR---haaraLGEQeqlgqlrvgxladflvw  374
DSSP  llLLLLhHHHHhhhhhhhlllhhhhhhHLLH---hhhhhLLLLllllllllllllleeee


DSSP  hllleeeeELLL-----------------
Query kntdvaiyLXRK-----------------  224
ident                              
Sbjct ncghpaelSYLIgvdqlvsrvvngeetlh  403
DSSP  llllllhhHHLLlllleeeeeelleelll


No 10: Query=2anuA Sbjct=1yrrB Z-score=7.4

back to top
DSSP  -------------------------------------------------lEEEEEEEEEL
Query -------------------------------------------------tEWLLCDFHVH   11
ident                                                        |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  L----LLLL-----lllLHHHHHHHHHHLLLLEEEEEEEEElhhhhhhhhhllllllllL
Query T----NXSD-----ghlPLGEVVDLFGKHGVDVVSITDHIVdrrtleqrkrngeplgaiT   62
ident         |         |        | |      |                       
Sbjct GcggvQFNDtaeavsveTLEIMQKANEKSGCTNYLPTLITT------------------S  102
DSSP  EelleELLLllllllhhHHHHHHHHHHLLLEEEEEEEELLL------------------L


DSSP  LLLHHHHHHHHHHHHHHHHhhhlLEEE-EEEEEEELL------lleeeeeELLLlllllL
Query EDKFQDYLKRLWREQKRAWeeygXILI-PGVEITNNT------dlyhivaVDVKeyvdpS  115
ident                                |                            
Sbjct DELMKQGVRVMREYLAKHP----NQALgLHLEGPWLNaalvdflcenadvITKVtlapeM  158
DSSP  HHHHHHHHHHHHHHHHHLL----LLLLlEEEELLLLLlhhhhhhhhlhhhEEEEeelhhH


DSSP  LLHhHHHHHHHHLLLEE---------------------EELLLlllLLLL------HHHH
Query LPVeEIVEKLKEQNALV---------------------IAAHPdrkKLSW------YLWA  148
ident  |  |   ||      |                      | |               |  
Sbjct VPA-EVISKLANAGIVVsaghsnatlkeakagfragitFATHL-ynAMPYitgrepGLAG  216
DSSP  LLH-HHHHHHHHHLLEEeellllllhhhhhhhhhhleeEELLL-llLLLLllllllHHHH


DSSP  LLLLLLLllLEEEeEELLE------eLHHHHHLLL-LEEEELLLL-lhHHHL--------
Query NXERFKDtfDAWEiANRDD------lFNSVGVKKY-RYVANSDFH-elWHVY--------  192
ident       |          |               |        |                 
Sbjct AILDEAD--IYCG-IIADGlhvdyanIRNAKRLKGdKLCLVTDATsgsSLTMiegvrnlv  273
DSSP  HHHHLLL--LEEE-EELLLllllhhhHHHHHHHHHhHEEEELLLLlllLLLHhhhhhhhh


DSSP  ----------leEEEE-------eELLL------------hhhhhhhhhhllleeeeell
Query ----------swKTLV-------kSEKN------------ieaikeairkntdvaiylxr  223
ident                                                             
Sbjct ehcgialdevlrMATLyparaigvEKRLgtlaagkvanltaftpdfkitktivngnevvt  333
DSSP  hhhlllhhhhhhHHLHhhhhhlllLLLLlllllllllleeeellllleeeeeelleeeee


DSSP  l
Query k  224
ident  
Sbjct q  334
DSSP  l


No 11: Query=2anuA Sbjct=3nqbA Z-score=7.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ---------------lEEEEEEEEELLLllLLLLLHHHHHHHHHHLLLLEEEEEEEEelh
Query ---------------tEWLLCDFHVHTNxsDGHLPLGEVVDLFGKHGVDVVSITDHIvdr   45
ident                    | | | |                    ||       |    
Sbjct srrdaaqvidaggayvSPGLIDTHXHIE--SSXITPAAYAAAVVARGVTTIVWDPHE---  115
DSSP  lllleeeeeelllleeEELEEEEEELHH--HHLLLHHHHHHHHHLLLEEEEEELLHH---


DSSP  hhhhhhhhllllllLLLLlLHHHHHHHHHHHHHHHhhhhLLEEEEEEEEE-ELLL-----
Query rtleqrkrngeplgAITEdKFQDYLKRLWREQKRAweeyGXILIPGVEIT-NNTD-----   99
ident                       |                    |                
Sbjct --------------FGNV-HGVDGVRWAAKAIENL----PLRAILLAPSCvPSAPglerg  156
DSSP  --------------HHHH-HLHHHHHHHHHHHLLL----LLEEEEEELLLlLLLLlllll


DSSP  -----------leeeeeELLL-------llllllLLHHHHHHHHHHLLLEEEELLlllll
Query -----------lyhivaVDVK-------eyvdpsLPVEEIVEKLKEQNALVIAAHpdrkk  141
ident                                        ||        ||         
Sbjct gadfdaailadllswpeIGGIaeixnxrgvierdPRXSGIVQAGLAAEKLVCGHA-----  211
DSSP  lllllhhhhhhhhllllEEEEeeellhhhhhlllHHHHHHHHHHHHHLLEEEELL-----


DSSP  lllHHHH-LLLLLLL-LLLEEEEEelleeLHHHHHLLLLEEE------------------
Query lswYLWA-NXERFKD-TFDAWEIAnrddlFNSVGVKKYRYVA------------------  181
ident     |       |                                               
Sbjct --rGLKNaDLNAFXAaGVSSDHELvsgedLXAKLRAGLTIELrgshdhllpefvaalntl  269
DSSP  --lLLLHhHHHHHHHlLLLEELLLllhhhHHHHHHLLLEEEEelllhhhhhhhhhhhhhh


DSSP  ---------ELLLLLH------HHHLLE---------------eeEEEElllhhHHHHH-
Query ---------NSDFHEL------WHVYSW---------------ktLVKSeknieAIKEA-  210
ident            |                                                
Sbjct ghlpqtvtlCTDDVFPddllqgGGLDDVvrrlvryglkpewalraATLN---aaQRLGRs  326
DSSP  lllllleeeELLLLLHhhhhhlLLHHHHhhhhhhllllhhhhhhhHLHH---hhHHHLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  210
ident                                                             
Sbjct dlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklpl  386
DSSP  lllllllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  210
ident                                                             
Sbjct rxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaep  446
DSSP  llhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  210
ident                                                             
Sbjct ttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkv  506
DSSP  leeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  210
ident                                                             
Sbjct tailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphq  566
DSSP  eeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhllllllllllee


DSSP  -------hhhllleeeeelll
Query -------irkntdvaiylxrk  224
ident                      
Sbjct tdxgiadvltgkvxespviev  587
DSSP  lllleeelllleeellleeel


No 12: Query=2anuA Sbjct=1k6wA Z-score=7.1

back to top
DSSP  -------------------------------------------------LEEEEEEEEEL
Query -------------------------------------------------TEWLLCDFHVH   11
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEEEL


DSSP  LllLLLL---------------------------------lLHHHHHHHHHHLLLLEEEE
Query TnxSDGH---------------------------------lPLGEVVDLFGKHGVDVVSI   38
ident                                                      |   |  
Sbjct L--DTTQtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRT  118
DSSP  L--LLLLllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEE


DSSP  EEEEelhhhhhhhhhlllllllllLLLHhHHHHHHHHHHHHHHHhhLLEEEEEEE-----
Query TDHIvdrrtleqrkrngeplgaitEDKFqDYLKRLWREQKRAWEeyGXILIPGVE-----   93
ident                                ||                |          
Sbjct HVDV-------------------sDATL-TALKAMLEVKQEVAP--WIDLQIVAFpqegi  156
DSSP  EEEL-------------------lLLLL-HHHHHHHHHHHHHLL--LLEEEEEEElllll


DSSP  ----------------------EEELLLleeeeeellllllllLLLHHHHHHHHH-HLLL
Query ----------------------ITNNTDlyhivavdvkeyvdpSLPVEEIVEKLK-EQNA  130
ident                                                             
Sbjct lsypngealleealrlgadvvgAIPHFE---------ftreygVESLHKTFALAQkYDRL  207
DSSP  lllllhhhhhhhhhhlllleeeELHHHL---------llhhhhHHHHHHHHHHHHhHLLE


DSSP  ------------------------------EEEELLLL--llllllhhhhLLLLLLLLLL
Query ------------------------------LVIAAHPD--rkklswylwaNXERFKDTFD  158
ident                                | | |                   |    
Sbjct idvhcdeiddeqsrfvetvaalahhegmgaRVTASHTTamhsyngaytsrLFRLLKMSGI  267
DSSP  eeeeelllllllllhhhhhhhhhhhhllhhHEEEEELHhhhhllhhhhhhHHHHHHHHLL


DSSP  EEEeEELL------------------eeLHHHHHLLLLEEEELLLLL-----HHHHLL--
Query AWEiANRD------------------dlFNSVGVKKYRYVANSDFHE-----LWHVYS--  193
ident     ||                                     |        |       
Sbjct NFV-ANPLvnihlqgrfdtypkrrgitrVKEMLESGINVCFGHDDVFdpwypLGTANMlq  326
DSSP  EEE-ELHHhhhhhlllllllllllllllHHHHHHLLLLEEELLLLLLlllllLLLLLHhh


DSSP  ---------------------eEEEEeelllhhhHHHH----------------------
Query ---------------------wKTLVkseknieaIKEA----------------------  210
ident                                                             
Sbjct vlhmglhvcqlmgygqindglnLITH---hsartLNLQdygiaagnsanliilpaengfd  383
DSSP  hhhhhhhhlllllhhhhhhhhhHHLH---hhhhhLLLLllllllllllleeeellllhhh


DSSP  --------------------------hhhllleeeeelll
Query --------------------------irkntdvaiylxrk  224
ident                                         
Sbjct alrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  hhhhllllleeeelleeeeellllleeeellleeeellll


No 13: Query=2anuA Sbjct=2pajA Z-score=6.8

back to top
DSSP  ----------------------------------------------------------lE
Query ----------------------------------------------------------tE    2
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  EEEEEEEELLlllLLLL-----------------LHHHHHHHHHHLLLLEEEEEEEeelh
Query WLLCDFHVHTnxsDGHL-----------------PLGEVVDLFGKHGVDVVSITDHivdr   45
ident       | |       |                             |   |         
Sbjct PAWVNTHHHL---FQSLlkgepfralfderrfrlAARIGLIELARSGCATVADHNY----  113
DSSP  ELEELLLLLH---HHHHllllllhhhllhhhhhhHHHHHHHHHHLLLEEEEEELLL----


DSSP  hhhhhhhhllllllLLLLLLhHHHHHHHHHHHHHHHhhhlLEEEEEEEEEEL--------
Query rtleqrkrngeplgAITEDKfQDYLKRLWREQKRAWeeygXILIPGVEITNN--------   97
ident                       |    |  |                             
Sbjct --------------VYYPGMpFDSSAILFEEAEKLG----LRFVLLRGGATQtrqleadl  155
DSSP  --------------LLLLLLlLLHHHHHHHHHHHLL----LEEEEEELLLLLllllllll


DSSP  ----------------------------------------lLLEEeeeelllllllllLL
Query ----------------------------------------tDLYHivavdvkeyvdpsLP  117
ident                                                             
Sbjct ptalrpetldayvadierlaaryhdaspramrrvvmapttvLYSI-----------spRE  204
DSSP  lhhhllllhhhhhhhhhhhhhhllllllllleeeeelllllLLLL-----------lhHH


DSSP  HHHHHHHHHHLLLEEEELLLlllllllhhhHLLLLL--LLLL---LEEEEeelleELHH-
Query VEEIVEKLKEQNALVIAAHPdrkklswylwANXERF--KDTF---DAWEIanrddLFNS-  171
ident   |                                    |               |    
Sbjct MRETAAVARRLGLRMHSHLS--------gkSPVAFCgeHDWLgsdVWYAH-----LVKVd  251
DSSP  HHHHHHHHHHLLLEEEEELL--------llLHHHHHhhLLLLlllEEEEL-----LLLLl


DSSP  -hhHLLL-----LEEE----------------------ELLLL--LHHH--HLLE-----
Query -vgVKKY-----RYVA----------------------NSDFH--ELWH--VYSW-----  194
ident                                         |                   
Sbjct adeIALLaqtgtGVAHcpqsngrlpvremadagvpvsiGVDGAasNEAAdmISEVhmtwl  311
DSSP  hhhHHHHhhhllEEEElhhhhhllllllhhhhllleeeLLLHHhhLLLLlhHHHHhhhhh


DSSP  --------------eEEEEelllhhHHHHH------------------------------
Query --------------kTLVKseknieAIKEA------------------------------  210
ident                                                             
Sbjct aqrarlasiaevihwGTAG----gaRVMGLdevgkvavgyaadiavyrlddpryfglhdp  367
DSSP  hhhhllllhhhhhhhHLHH----hhHHHLLllllllllllllleeeeelllhhhlllllh


DSSP  ----------------------------------------hhhllleeeeelll
Query ----------------------------------------irkntdvaiylxrk  224
ident                                                       
Sbjct aigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  hhhhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 14: Query=2anuA Sbjct=4cqbA Z-score=6.8

back to top
DSSP  --------------------------------------------------lEEEEEEEEE
Query --------------------------------------------------tEWLLCDFHV   10
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  LLlllLLLL-------------------------------------LHHHHHHHHHHLLL
Query HTnxsDGHL-------------------------------------PLGEVVDLFGKHGV   33
ident |                                                |       || 
Sbjct HM--dKSFTstgerlpkfwsrpytrdaaiedglkyyknatheeikrHVIEHAHMQVLHGT  118
DSSP  LH--hHLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhhhHHHHHHHHHHHLLE


DSSP  LEEEEEEEEelhhhhhhhhhllllllllLLLLHHHHHHHHHHHHHHHHHhhLLEEEEEEE
Query DVVSITDHIvdrrtleqrkrngeplgaiTEDKFQDYLKRLWREQKRAWEeyGXILIPGVE   93
ident                                                             
Sbjct LYTRTHVDV-------------------DSVAKTKAVEAVLEAKEELKD--LIDIQVVAF  157
DSSP  EEEEEEEEL-------------------LLLLLLHHHHHHHHHHHHLLL--LLEEEEEEE


DSSP  EE-ELLLleeeeeellLLLL-----------------lllLLHHHHHHHHHHLLLEEEEL
Query IT-NNTDlyhivavdvKEYV-----------------dpsLPVEEIVEKLKEQNALVIAA  135
ident                                                   ||        
Sbjct AQsGFFV-dlesesliRKSLdmgcdlvggvdpatrennveGSLDLCFKLAKEYDVDIDYH  216
DSSP  LLlLLLL-lllhhhhhHHHHhhllleeellllllllllhhHHHHHHHHHHHHLLLEEEEE


DSSP  LLllllLLLHhHHLLLL-LLLL-------lLEEE--------------------------
Query HPdrkkLSWYlWANXER-FKDT-------fDAWE--------------------------  161
ident                 |    |                                      
Sbjct IH--diGTVG-VYSINRlAQKTiengykgrVTTShawcfadapsewldeaiplykdsgmk  273
DSSP  EL--llHHHH-HHHHHHhHHHHhhllllllEEEEellhhhhllhhhhhhhhhhhhhhlle


DSSP  -EEELLEEL--HHHHHLL---LLEEEELLLLL----HHHH--------------------
Query -IANRDDLF--NSVGVKK---YRYVANSDFHE----LWHV--------------------  191
ident              |             ||                               
Sbjct fVTCFSSTPptMPVIKLLeagINLGCASDNIRdfwvPFGNgdmvqgalietqrlelktnr  333
DSSP  eEEELLLLLllLLHHHHHhllLEEEEELLLLLllllLLLLllhhhhhhhhhhhhllllhh


DSSP  ----lleEEEEeelllhhhHHHH-----------------------------------hh
Query ----yswKTLVkseknieaIKEA-----------------------------------ir  212
ident                                                             
Sbjct dlgliwkMITS---egarvLGIEknygievgkkadlvvlnslspqwaiidqakrlcvikn  390
DSSP  hhhhhhhHHLH---hhhhhHLLHhhlllllllllleeeellllhhhhhhhllleeeeeel


DSSP  hllleeeeelll
Query kntdvaiylxrk  224
ident             
Sbjct griivkdeviva  402
DSSP  leeeeelleell


No 15: Query=2anuA Sbjct=1v77A Z-score=6.8

back to top
DSSP  leEEEEEEEELLllllllllhHHHHHHHHhLLLLEEEEEEEEELHhhhhhhhhlllllll
Query teWLLCDFHVHTnxsdghlplGEVVDLFGkHGVDVVSITDHIVDRrtleqrkrngeplga   60
ident                       |   |      | |                        
Sbjct --VKFIEMDIRD---------KEAYELAK-EWFDEVVVSIKFNEE---------------   33
DSSP  --LLLEEEEELL---------HHHHHHHH-HHLLEEEEEEEELLL---------------


DSSP  lllllHHHHHHHHHHHHhhhhhhhlleEEEEEEEEELLlleeeeeellllllLLLL----
Query itedkFQDYLKRLWREQkraweeygxiLIPGVEITNNTdlyhivavdvkeyvDPSL----  116
ident          |     |                   |                        
Sbjct ----vDKEKLREARKEY----------GKVAILLSNPK------------psLVRDtvqk   67
DSSP  ----lLHHHHHHHHHHH----------LLEEEEEELLL------------hhHHHHhhhh


DSSP  --------------LHHHHHHHHhhllleEEELLLlllLLLLHHHhlLLLLLLLL----L
Query --------------PVEEIVEKLkeqnalVIAAHPdrkKLSWYLWanXERFKDTF----D  158
ident                     ||            |                         
Sbjct fksyliyvesndlrVIRYSIEKG-----vDAIISP-wvNRKDPGI--DHVLAKLMvkknV  119
DSSP  lllleeeeelllhhHHHHHHHLL-----lLEEELL-llLLLLLLL--LHHHHHHHhhhlL


DSSP  EEEeEELLE--------------eLHHHHHL----LLLEEEELLLLLHHHHL--------
Query AWEiANRDD--------------lFNSVGVK----KYRYVANSDFHELWHVY--------  192
ident |                                  | |    |   | | |         
Sbjct ALG-FSLRPllysnpyeranllrfMMKAWKLvekyKVRRFLTSSAQEKWDVRyprdlisl  178
DSSP  EEE-EELHHhhhllhhhhhhhhhhHHHHHHHhhhhLLLEEEELLLLLHHHLLlhhhhhhh


DSSP  -----------leeEEEEelllhhHHHHhhhhllleeeeelll
Query -----------swkTLVKseknieAIKEairkntdvaiylxrk  224
ident                          |                 
Sbjct gvvigmeipqakasISMY----peIILK---------------  202
DSSP  hhhllllhhhhhhlLLHH----hhHHHL---------------


No 16: Query=2anuA Sbjct=4hk5D Z-score=6.7

back to top
DSSP  lEEEEEEEEELLLL----------------------------------------------
Query tEWLLCDFHVHTNX----------------------------------------------   14
ident       | | |                                                 
Sbjct -TPVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaa   59
DSSP  -LLLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhllll


DSSP  -------lllLLLHHHHHHHHHHLLLLEEEEEEE--EELHhhhhhhhhllllllllLLLL
Query -------sdgHLPLGEVVDLFGKHGVDVVSITDH--IVDRrtleqrkrngeplgaiTEDK   65
ident              |          |  |  |       |                     
Sbjct klpgrplsthFASLAQKMHFMDTNGIRVSVISLAnpWFDF-----------lapdeAPGI  108
DSSP  lllleellhhHLLHHHHHHHHHHLLLLEEEEEELllLLLL-----------lllllHHHH


DSSP  HHHHHHHHHHHHHHHHhhhlLEEEEEE---------------------------EEEELL
Query FQDYLKRLWREQKRAWeeygXILIPGV---------------------------EITNNT   98
ident                       |                                     
Sbjct ADAVNAEFSDMCAQHV----GRLFFFAalplsapvdavkasiervknlkycrgiILGTSG  164
DSSP  HHHHHHHHHHHHHLLL----LLEEEEEellllllhhhhhhhhhhhhlllleeeeEELLLL


DSSP  LleeeeeelllllllllllhHHHHHHHHHLLLEE--------------------------
Query DlyhivavdvkeyvdpslpvEEIVEKLKEQNALV--------------------------  132
ident                         |       ||                          
Sbjct L----------gkglddphlLPVFEAVADAKLLVflhphyglpnevygprseeyghvlpl  214
DSSP  L----------llllllhhhHHHHHHHHHLLLEEeelllllllhhhhlllhhhlllhhhh


DSSP  -----------------------------EELL----------------------lllll
Query -----------------------------IAAH----------------------pdrkk  141
ident                                ||                           
Sbjct algfpmettiavarmymagvfdhvrnlqmLLAHsggtlpflagriescivhdghlvktgk  274
DSSP  hlhhhhhhhhhhhhhhhllhhhhllllleEEHHhhllhhhhhhhhhhhhhllhhhhhlll


DSSP  lllhhhhLLLLLLLLlLEEEeEELLEE--LHHHHHLLL--LEEEELLLLLHH--------
Query lswylwaNXERFKDTfDAWEiANRDDL--FNSVGVKKY--RYVANSDFHELW--------  189
ident             |        |                  |     |             
Sbjct vpkdrrtIWTVLKEQ-IYLD-AVIYSEvgLQAAIASSGadRLMFGTDHPFFPpieedvqg  332
DSSP  lllllllHHHHHHHL-EEEE-LLLLLHhhHHHHHHHHLhhHEELLLLLLLLLllllllll


DSSP  ---HHLLE------------------EEEEeelllhhHHHHhhhhllleeeeelll
Query ---HVYSW------------------KTLVkseknieAIKEairkntdvaiylxrk  224
ident                             |                           
Sbjct pwdSSRLNaqavikavgegssdaaavMGLN-----avRVLS---lkaelehhhhhh  380
DSSP  llhHHHHHhhhhhhhhllllhhhhhhHLHH-----hhHHLL---lhhhhhhhhhhl


No 17: Query=2anuA Sbjct=3gg7A Z-score=6.5

back to top
DSSP  leeEEEEEEELLLlllLLLLHHHHHHHHHHLLLlEEEEEEEeelhhhhhhhhhlllllll
Query tewLLCDFHVHTNxsdGHLPLGEVVDLFGKHGVdVVSITDHivdrrtleqrkrngeplga   60
ident     | |||||            |           |                        
Sbjct ---SLIDFHVHLD---LYPDPVAVARACEERQL-TVLSVTT-------------------   34
DSSP  ---LLEEEEELHH---HLLLHHHHHHHHHHLLL-EEEELLL-------------------


DSSP  lllllHHHHHHHHHHHHHHHhhhhlLEEEEE----------------------------e
Query itedkFQDYLKRLWREQKRAweeygXILIPG----------------------------v   92
ident                                                             
Sbjct -----TPAAWRGTLALAAGR-----PHVWTAlgfhpevvseraadlpwfdrylpetrfvg   84
DSSP  -----LHHHHHHHHHHHLLL-----LLEEELllllhhhllllhhhlhhhhhhhhhlleee


DSSP  EEEELLLleeeeeellllllLLLL--------------------------LHHHHhHHHH
Query EITNNTDlyhivavdvkeyvDPSL--------------------------PVEEIvEKLK  126
ident |                                                   |       
Sbjct EVGLDGS-pslrgtwtqqfaVFQHilrrcedhggrilsihsrraesevlnCLEAN-PRSG  142
DSSP  EEELLLL-hhhhhhhhhhhhHHHHhhhhhhhllleeeeeellllhhhhhhHHHHL-HHHE


DSSP  hlllEEEELLLlllllllhhhHLLLLL-LLLLlEEEEeELLEE----LHHHHHLLL--LE
Query eqnaLVIAAHPdrkklswylwANXERF-KDTFdAWEIaNRDDL----FNSVGVKKY--RY  179
ident       |                  |                                | 
Sbjct ----TPILHWY------sgsvTELRRAiSLGC-WFSV-GPTMVrtqkGAALIRSMPrdRV  190
DSSP  ----EEEEELL------lllhHHHHHHhHLLL-EEEE-LHHHHllhhHHHHHHHLLhhHE


DSSP  EEELLLL------LHHH-HLLE------------------eeEEEElllhhhhHHHHHHl
Query VANSDFH------ELWH-VYSW------------------ktLVKSeknieaiKEAIRKn  214
ident     |                                                       
Sbjct LTETDGPfleldgQAALpWDVKsvveglskiwqipaseveriVKEN-------VSRLLG-  242
DSSP  EELLLLLlleellEELLhHHHHhhhhhhhhhhlllhhhhhhhHHHH-------HHHHHH-


DSSP  lleeeeelll
Query tdvaiylxrk  224
ident           
Sbjct ---------t  243
DSSP  ---------l


No 18: Query=2anuA Sbjct=1a4mA Z-score=6.5

back to top
DSSP  ---leeEEEEEEELLllLLLLL--------------------------------------
Query ---tewLLCDFHVHTnxSDGHL--------------------------------------   19
ident            |||                                              
Sbjct tpafnkPKVELHVHL--DGAIKpetilyfgkkrgialpadtveelrniigmdkplslpgf   58
DSSP  llllllLEEEEEEEH--HHLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhh


DSSP  --------------------LHHHHHHHHHHLLLLEEEEEEEEE-----lHHHHHhHHHL
Query --------------------PLGEVVDLFGKHGVDVVSITDHIV-----dRRTLEqRKRN   54
ident                        | |    | ||  |                       
Sbjct lakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPHllanskVDPMP-WNQT  117
DSSP  hllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLHhhllllLLLLH-HHLL


DSSP  LllllllLLLLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEEELLLleeeeeellllllLL
Query GeplgaiTEDKFQDYLKRLWREQKRAWeeygXILIPGVEITNNTDlyhivavdvkeyvDP  114
ident          |        |                                         
Sbjct E--gdvtPDDVVDLVNQGLQEGEQAFG----IKVRSILCCMRHQP------------sWS  159
DSSP  L--llllHHHHHHHHHHHHHHHHHHHL----LEEEEEEEEELLLH------------hHH


DSSP  LL-------------------------------LHHHHHHHHHHLLLEEEELLlllllll
Query SL-------------------------------PVEEIVEKLKEQNALVIAAHpdrkkls  143
ident                                     |  |                    
Sbjct LEvlelckkynqktvvamdlagdetiegsslfpGHVEAYEGAVKNGIHRTVHA-----ge  214
DSSP  HHhhhhhhhllllleeeeeeelllllllhhhlhHHHHHHHHHHHHLLEEEEEE-----ll


DSSP  lhhHHLLLLLLL--LLLEEEEeelleELHH----hHHLL----LLEEE------------
Query wylWANXERFKD--TFDAWEIanrddLFNS----vGVKK----YRYVA------------  181
ident            |                                                
Sbjct vgsPEVVREAVDilKTERVGH----gYHTIedealYNRLlkenMHFEVcpwssyltgawd  270
DSSP  lllHHHHHHHHHllLLLEEEE----lHHHHhlhhhHHHHhhllLEEEElhhhhhhlllll


DSSP  -------------------ELLLLL--HHHHLLE---------------eeEEEElllhh
Query -------------------NSDFHE--LWHVYSW---------------ktLVKSeknie  205
ident                    | |                             |        
Sbjct pktthavvrfkndkanyslNTDDPLifKSTLDTDyqmtkkdmgfteeefkrLNIN---aa  327
DSSP  lllllhhhhhhhlllleeeLLLLLLllLLLHHHHhhhhhhlllllhhhhhhHHHH---hh


DSSP  HHHH---hhhhllleeeeelll
Query AIKE---airkntdvaiylxrk  224
ident                       
Sbjct KSSFlpeeekkellerlyreyq  349
DSSP  HLLLllhhhhhhhhhhhhhhll


No 19: Query=2anuA Sbjct=2y1hB Z-score=6.3

back to top
DSSP  lEEEEEEEEELLllllLLLLHhHHHHHHHHLL---LLEEEEEEEeelhhhhhhhhhllll
Query tEWLLCDFHVHTnxsdGHLPLgEVVDLFGKHG---VDVVSITDHivdrrtleqrkrngep   57
ident     | | | |              |   |     |                        
Sbjct -GVGLVDCHCHL---sAPDFDrDLDDVLEKAKkanVVALVAVAE----------------   40
DSSP  -LLLEEEEEELL---lLHHHLlLHHHHHHHHHhllEEEEEELLL----------------


DSSP  llllllllHHHHHHHHHHHHHHHHhhhlLEEEEE--------------------------
Query lgaitedkFQDYLKRLWREQKRAWeeygXILIPG--------------------------   91
ident                      |          |                           
Sbjct --------HSGEFEKIMQLSERYN----GFVLPClgvhpvqgldqrsvtlkdldvalpii   88
DSSP  --------LHHHHHHHHHHHHHLL----LLEEEEelllleelllleellhhhhhhhhhhh


DSSP  ----------EEEEELLLleeeeeelllllllLLLLHHHHHHHHHHLLLE----------
Query ----------VEITNNTDlyhivavdvkeyvdPSLPVEEIVEKLKEQNAL----------  131
ident            |                                |  |            
Sbjct enykdrllaiGEVGLDFS--prfagtgeqkeeQRQVLIRQIQLAKRLNLPvnvhsrsagr  146
DSSP  hhhllllleeEEEEEELL--llllllhhhhhhHHHHHHHHHHHHHHHLLLeeeeeellhh


DSSP  -------------EEELLLlllllllhhhHLLLLLLLLlLEEEeEELLEE----LHHHHH
Query -------------VIAAHPdrkklswylwANXERFKDTfDAWEiANRDDL----FNSVGV  174
ident              |                                              
Sbjct ptinllqeqgaekVLLHAF------dgrpSVAMEGVRAgYFFS-IPPSIIrsgqKQKLVK  199
DSSP  hhhhhhhhlllllEEEELL------lllhHHHHHHHHLlLEEE-ELHHHHllhhHHHHHH


DSSP  LLL--LEEEELLLLL-------HHHHLLEE-----------------------eeeeell
Query KKY--RYVANSDFHE-------LWHVYSWK-----------------------tlvksek  202
ident            |                                                
Sbjct QLPltSICLETDSPAlgpekqvRNEPWNISisaeyiaqvkgisveevievttqnalklfp  259
DSSP  HLLhhHEEELLLLLLlllllllLLLHHHHHhhhhhhhhhhlllhhhhhhhhhhhhhhhll


DSSP  LHHHHhhhhhhllleeeeelll
Query NIEAIkeairkntdvaiylxrk  224
ident                       
Sbjct KLRHL----------------l  265
DSSP  LHHHH----------------l


No 20: Query=2anuA Sbjct=3ls9A Z-score=6.2

back to top
DSSP  ------------------------------------------------------LEEEEE
Query ------------------------------------------------------TEWLLC    6
ident                                                           | 
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiALPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeEEELEE


DSSP  EEEELLLllLLLL--------------------------------------LHHHHHHHH
Query DFHVHTNxsDGHL--------------------------------------PLGEVVDLF   28
ident   | |     |                                            |    
Sbjct NSHQHLY--EGAMraipqlervtmaswlegvltrsagwwrdgkfgpdvireVARAVLLES  118
DSSP  EEEELHH--HHHHlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhHHHHHHHHH


DSSP  HHLLLLEEEEEEeeelhhhhhhhhhllllllLLLL--LLHHhHHHHHHHHHHHHHhhhlL
Query GKHGVDVVSITDhivdrrtleqrkrngeplgAITE--DKFQdYLKRLWREQKRAWeeygX   86
ident    |   |                                  |                 
Sbjct LLGGITTVADQH-------------------LFFPgaTADS-YIDATIEAATDLG----I  154
DSSP  HHLLEEEEEEEE-------------------LLLLllLLLL-HHHHHHHHHHHHL----L


DSSP  EEEEEE------------------------------------------------EEEELL
Query ILIPGV------------------------------------------------EITNNT   98
ident                                                             
Sbjct RFHAARssmtlgkseggfcddlfvepvdrvvqhclglidqyhepepfgmvrialGPCGVP  214
DSSP  EEEEEEllllllhhhlllllhhhlllhhhhhhhhhhhhhhhlllllllleeeeeLLLLLL


DSSP  LleeeeeelllllllLLLL-HHHHHHHHH-HLLLEE------------------------
Query DlyhivavdvkeyvdPSLP-VEEIVEKLK-EQNALV------------------------  132
ident                      |            |                         
Sbjct Y--------------DKPElFEAFAQMAAdYDVRLHthfyepldagmsdhlygmtpwrfl  260
DSSP  L--------------LLHHhHHHHHHHHHhHLLEEEeeellllhhhhhhhhhlllhhhhh


DSSP  ----------EELLLLllllllhhhHLLLLLLLLlLEEEeEELL---------eeLHHHH
Query ----------IAAHPDrkklswylwANXERFKDTfDAWEiANRD---------dlFNSVG  173
ident             ||                | |   |                       
Sbjct ekhgwasdrvWLAHAV-----vpprEEIPEFADAgVAIA-HLIApdlrmgwglapIREYL  314
DSSP  hhllllllleEEEELL-----lllhHHHHHHHHHlLEEE-ELHHhhhhlllllllHHHHH


DSSP  HLLLLEEEELLLLL-HHHHLL-----------------------------eEEEE-----
Query VKKYRYVANSDFHE-LWHVYS-----------------------------wKTLV-----  198
ident                                                             
Sbjct DAGITVGFGTTGSAsNDGGNLlgdlrlaalahrpadpnepekwlsarellrMATRgsaec  374
DSSP  HLLLEEEELLLLLLlLLLLLHhhhhhhhhhhlhhhllllhhhlllhhhhhhHLLHhhhhh


DSSP  -----------eELLL------------------------------------------hh
Query -----------kSEKN------------------------------------------ie  205
ident                                                             
Sbjct lgrpdlgvleegRAADiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvene  434
DSSP  llllllllllllLLLLeeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeell


DSSP  hhhhhhhhllleeeeelll
Query aikeairkntdvaiylxrk  224
ident                    
Sbjct rpvladlerivanttalip  453
DSSP  eellllhhhhhhhhhhhll


No 21: Query=2anuA Sbjct=1onxA Z-score=6.0

back to top
DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------t    1
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  EEEEEEEEEL-LLLLL------lLLLHhhHHHHHHHLLLLEEEEEEEEelhhhhhhhhhl
Query EWLLCDFHVH-TNXSD------gHLPLgeVVDLFGKHGVDVVSITDHIvdrrtleqrkrn   54
ident      | |||                           ||  |                  
Sbjct CPGFIDQHVHlIGGGGeagpttrTPEV--ALSRLTEAGVTSVVGLLGT------------  106
DSSP  EELEEEEEELlLLLLLlllhhhlLLLL--LHHHHHHLLEEEEEELLLL------------


DSSP  lllllLLLLllhhhHHHHHHHHHHHHHHHhLLEEEEEE-EEEE-----------------
Query geplgAITEdkfqdYLKRLWREQKRAWEEyGXILIPGV-EITN-----------------   96
ident                   |        || |                             
Sbjct -----DSIS----rHPESLLAKTRALNEE-GISAWMLTgAYHVpsrtitgsvekdvaiid  156
DSSP  -----LLLL----lLHHHHHHHHHHHHHH-LLEEEEEEeLLLLllllllllhhhhhhhll


DSSP  -------------LLLLeeeeeelllllllllLLHHHHHHHHHHLL------LEEEELLL
Query -------------NTDLyhivavdvkeyvdpsLPVEEIVEKLKEQN------ALVIAAHP  137
ident                                                             
Sbjct rvigvxcaisdhrSAAP-------------dvYHLANMAAESRVGGllggkpGVTVFHMG  203
DSSP  leeeeeeeellllLLLL-------------lhHHHHHHHHHHHHHHhhhlllLEEEEEEL


DSSP  llllLLLHhHHLLLLLL------LLLLEEEEE-elleeLHHHHHLL---LLEEE------
Query drkkLSWYlWANXERFK------DTFDAWEIA-nrddlFNSVGVKK---YRYVA------  181
ident                                       |                     
Sbjct ---dSKKA-LQPIYDLLencdvpISKLLPTHVnrnvplFEQALEFArkgGTIDItsside  259
DSSP  ---lLLLL-LHHHHHHHhlllllHHHEEEELHhhlhhhHHHHHHHHhllLLEEEelllll


DSSP  -----------------------ELLLL---------------lHHHHLLE---------
Query -----------------------NSDFH---------------eLWHVYSW---------  194
ident                         ||                                  
Sbjct pvapaegiaravqagiplarvtlSSDGNgsqpffddegnlthigVAGFETLletvqvlvk  319
DSSP  lllhhhhhhhhhhllllhhheeeELLLLleeeeellllleeeeeELLLHHHhhhhhhhhh


DSSP  ----------eeEEEElllhhHHHHH----------------------------------
Query ----------ktLVKSeknieAIKEA----------------------------------  210
ident             |  |                                            
Sbjct dydfsisdalrpLTSS---vaGFLNLtgkgeilpgndadllvmtpelrieqvyargklmv  376
DSSP  hhlllhhhhhhhHLHH---hhHHLLLllllllllllllleeeellllleeeeeelleeee


DSSP  hhhllleeeeelll
Query irkntdvaiylxrk  224
ident               
Sbjct kdgkacvkgtfetd  390
DSSP  elleelllllllll


No 22: Query=2anuA Sbjct=2dvtA Z-score=6.0

back to top
DSSP  leeEEEEEEELLLL-------------------llLLLLHHH-HHHHHHHLLLLEEEEEE
Query tewLLCDFHVHTNX-------------------sdGHLPLGE-VVDLFGKHGVDVVSITD   40
ident           |                          |        |   ||        
Sbjct -mqGKVALEEHFAIpetlqdsagfvpgdywkelqhRLLDIQDtRLKLMDAHGIETMILSL   59
DSSP  -llLEEEEEEEELLhhhhhhhlllllllhhhhhhhHHHLLLLhHHHHHHHLLEEEEEEEE


DSSP  EEElhhhhhhhhhllllllllLLLLHHHHHHHHHHHHHHHHhhhlLEEEEE---------
Query HIVdrrtleqrkrngeplgaiTEDKFQDYLKRLWREQKRAWeeygXILIPG---------   91
ident                                 |  |                        
Sbjct NAP--------avqaipdrrkAIEIARRANDVLAEECAKRP----DRFLAFaalplqdpd  107
DSSP  LLL--------hhhhlllhhhHHHHHHHHHHHHHHHHHHLL----LLEEEEellllllhh


DSSP  -----------------EEEEELLlleeeeeellllllllLLLH---hhhHHHHHHLLLE
Query -----------------VEITNNTdlyhivavdvkeyvdpSLPV---eeiVEKLKEQNAL  131
ident                                                             
Sbjct aateelqrcvndlgfvgALVNGFS-------qegdgqtplYYDLpqyrpfWGEVEKLDVP  160
DSSP  hhhhhhhhhhhllllleEEEELLL-------lllllllllLLLLhhhhhhHHHHHHHLLL


DSSP  EE-----------------ellllLLLL-----LLHH-----------------------
Query VI-----------------aahpdRKKL-----SWYL-----------------------  146
ident                                                             
Sbjct FYlhprnplpqdsriydghpwllgPTWAfaqetAVHAlrlmasglfdehprlniilghmg  220
DSSP  EEeelllllhhhlhhhlllhhhlhHHLHhhhhhHHHHhhhhhllhhhhllllleeelhhh


DSSP  --------------------------hhLLLLLLLLlLEEEeEELLEE---LHHHHHLLL
Query --------------------------waNXERFKDTfDAWEiANRDDL---FNSVGVKKY  177
ident                                 |                           
Sbjct eglpymmwridhrnawvklpprypakrrFMDYFNEN-FHIT-TSGNFRtqtLIDAILEIG  278
DSSP  llhhhhhhhhhhllllllllllllllllHHHHHHHH-EEEE-LLLLLLhhhHHHHHLLLL


DSSP  --LEEEELLLLLhhHHLLE-----------------EEEEeelllhhHHHHHhhhlllee
Query --RYVANSDFHElwHVYSW-----------------KTLVkseknieAIKEAirkntdva  218
ident   |     |                                                   
Sbjct adRILFSTDWPF-eNIDHAsdwfnatsiaeadrvkiGRTN-----arRLFKL--------  324
DSSP  hhHEELLLLLLL-lLHHHHhhhhhhllllhhhhhhhHLHH-----hhHHLLL--------


DSSP  eeelll
Query iylxrk  224
ident       
Sbjct -----d  325
DSSP  -----l


No 23: Query=2anuA Sbjct=3griA Z-score=6.0

back to top
DSSP  -------------------------------------------------LEEEEEEEEEL
Query -------------------------------------------------TEWLLCDFHVH   11
ident                                                        | |||
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfVSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleEEELEEEEEEL


DSSP  LLL--lllLLLHHHHHHHHHHLLLLEEEEEEEeelhhhhhhhhhlllllLLLLllLHHHH
Query TNX--sdgHLPLGEVVDLFGKHGVDVVSITDHivdrrtleqrkrngeplGAITedKFQDY   69
ident                       |   |                                 
Sbjct LREpggeyKETIETGTKAAARGGFTTVCPXPN-----------------TRPV-pDSVEH  102
DSSP  LLLlllllLLLHHHHHHHHHHLLEEEEEELLL-----------------LLLL-lLLHHH


DSSP  HHHHHH-HHHHHHhhhlLEEEEEE-------------------------EEEELllleee
Query LKRLWR-EQKRAWeeygXILIPGV-------------------------EITNNtdlyhi  103
ident    |       |         |                                      
Sbjct FEALQKlIDDNAQ----VRVLPYAsittrqlgkelvdfpalvkegafafTDDGV------  152
DSSP  HHHHHHhHHHHLL----LEELLLEellhhhlllllllhhhhhlllllleEELLL------


DSSP  eeellllllLLLL--LHHHHHHHHHHLLLEE-----------------------------
Query vavdvkeyvDPSL--PVEEIVEKLKEQNALV-----------------------------  132
ident                   |        |                                
Sbjct ---------GVQTasXXYEGXIEAAKVNKAIvahcednsliyggaxhegkrskelgipgi  203
DSSP  ---------LLLLhhHHHHHHHHHHHHLLLEeellllhhhllllleellhhhhhhlllee


DSSP  -----------------------EELLLLllllllhHHHL-LLLL--LLLLlEEEEeELL
Query -----------------------IAAHPDrkklswyLWAN-XERF--KDTFdAWEIaNRD  166
ident                           |                           |     
Sbjct pnicesvqiardvllaeaagchyHVCHVS----tkeSVRViRDAKraGIHV-TAEV-TPH  257
DSSP  llhhhhhhhhhhhhhhhhhllleEELLLL----lhhHHHHhHHHHhlLLLE-EEEE-LHH


DSSP  EE----------------------------LHHHHHLLLLEEEELLLLL-----------
Query DL----------------------------FNSVGVKKYRYVANSDFHE-----------  187
ident  |                                           |              
Sbjct HLllteddipgnnaiykxnpplrstedreaLLEGLLDGTIDCIATDHAPhardekaqpxe  317
DSSP  HHhllhhhlllllhhhllllllllhhhhhhHHHHHHLLLLLEELLLLLLllhhhhlllll


DSSP  -----HHHHLLE---------------------eEEEEelllhhhhhhHHHH--------
Query -----LWHVYSW---------------------kTLVKseknieaikeAIRK--------  213
ident                                      |                      
Sbjct kapfgIVGSETAfpllythfvkngdwtlqqlvdyLTIK--------pcETFNleygtlke  369
DSSP  lllllLLLLLLHhhhhhhhhlllllllhhhhhhhHLHH--------hhHHLLllllllll


DSSP  ------------------------------------------llleeeeelll
Query ------------------------------------------ntdvaiylxrk  224
ident                                                      
Sbjct ngyadltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  llllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel


No 24: Query=2anuA Sbjct=2ffiA Z-score=6.0

back to top
DSSP  leeEEEEEEELLLL------------lllLLLHHHHHHHHHHLLLLEEEEEEEEelhhhh
Query tewLLCDFHVHTNX------------sdgHLPLGEVVDLFGKHGVDVVSITDHIvdrrtl   48
ident       | | |                    |||        ||                
Sbjct lhlTAIDSHAHVFSrglnlasqrryapnyDAPLGDYLGQLRAHGFSHGVLVQPS------   54
DSSP  lllLLEELLLLLLLhhhhhhlllllllllLLLHHHHHHHHHHLLLLEELLLLLH------


DSSP  hhhhhllllllLLLLllHHHHHHHHHHHHHhhhhhhllEEEEEE----------------
Query eqrkrngeplgAITEdkFQDYLKRLWREQKraweeygxILIPGV----------------   92
ident                     ||                 |   |                
Sbjct -----------FLGT--DNRYLLSALQTVP-------gQLRGVVxlerdveqatlaexar   94
DSSP  -----------HHLL--LLHHHHHHHHHLL-------lLLLLLLlllllllhhhhhhhhl


DSSP  ------EEEELLLleeeeeelllllllllllhhHHHHHHHHLLLEE--------------
Query ------EITNNTDlyhivavdvkeyvdpslpveEIVEKLKEQNALV--------------  132
ident                                     |   ||   |              
Sbjct lgvrgvRLNLXGQ---------dxpdltgaqwrPLLERIGEQGWHVelhrqvadipvlvr  145
DSSP  lllleeELLLLLL---------llllllllllhHHHHHHHHHLLEEeellllllhhhhhh


DSSP  ---------EELL-LLLLL---lllhhHHLL-LLLLLLLLEEEeEELLE-----------
Query ---------IAAH-PDRKK---lswylWANX-ERFKDTFDAWEiANRDD-----------  167
ident             |               |                               
Sbjct alqpygldiVIDHfGRPDArrglgqpgFAELlTLSGRGKVWVK-VSGIYrlqgspeenla  204
DSSP  hhlllllleEELHhHLLLLllllllllHHHHlLLLLLLLEEEE-EELHHhllllhhhhhh


DSSP  ----eLHHHHHLLL--LEEEELLLLL-----hHHHL----------------leeEEEE-
Query ----lFNSVGVKKY--RYVANSDFHE-----lWHVY----------------swkTLVK-  199
ident                 |    ||                                 |   
Sbjct farqaLCALEAHYGaeRLXWGSDWPHtqheseVSFGsaveqfealgcsaqlrqalLLDTa  264
DSSP  hhhhhHHHHHHHLLhhHEEEELLLLLllllllLLHHhhhhhhhhhlllhhhhhhhHLHHh


DSSP  -ellLHHHhhhhhhhllleeeeelll
Query -sekNIEAikeairkntdvaiylxrk  224
ident       |                   
Sbjct ralfGFEL-----------------e  273
DSSP  hhhlLLLL-----------------l


No 25: Query=2anuA Sbjct=2vunA Z-score=6.0

back to top
DSSP  ---------------------------------------------------------LEE
Query ---------------------------------------------------------TEW    3
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstVTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleEEE


DSSP  EEEEEEELLLL---lLLLLLhhHHHHHHHHLLLLEEEEEEEEelhhhhhhhhhlllllll
Query LLCDFHVHTNX---sDGHLPlgEVVDLFGKHGVDVVSITDHIvdrrtleqrkrngeplga   60
ident  | | |||                       ||                           
Sbjct GLLDTHVHVSGgdyaPRQKT-mDFISSALHGGVTTMISAGSP--------hfpgrpkdaa  111
DSSP  LEEEEEELLLLlleeHHHLE-eLHHHHHHLLLEEEEEELLLL--------llllllllhh


DSSP  lLLLLHHHHHHHHHHhhHHHHhhhLLEEEEEE-----------------------EEEEl
Query iTEDKFQDYLKRLWReqKRAWeeyGXILIPGV-----------------------EITNn   97
ident  |        |       |     |     |                             
Sbjct gTKALAITLSKSYYN--ARPA---GVKVHGGAvilekglteedfiemkkegvwivGEVG-  165
DSSP  hHHHHHHHHHHHHHH--LLHH---HLEEELLEelllllllhhhhhhhhhlllleeEEEL-


DSSP  llleeeeeelllllllLLLLHH-HHHHHHHHL---LLEE---------------------
Query tdlyhivavdvkeyvdPSLPVE-EIVEKLKEQ---NALV---------------------  132
ident                                       |                     
Sbjct ---------------lGTIKNPeDAAPMVEWAhkhGFKVqmhtggtsipgsstvtaddvi  210
DSSP  ---------------lLLLLLHhHHHHHHHHHhhlLLEEeeelllllllllllllhhhhh


DSSP  -----EELL--LLLLLLLlhhHHLL-LLLLlllLEEEeEELLEE---LHHHHHLL-----
Query -----IAAH--PDRKKLSwylWANX-ERFKdtfDAWEiANRDDL---FNSVGVKK-----  176
ident         |        |                | |             |         
Sbjct ktkpdVVSHinGGPTAISvqeVDRImDETD---FAME-IVQCGNpkiADYVARRAaekgq  266
DSSP  hhlllEEELllLLLLLLLhhhHHHHhHHLL---LEEE-EELLLLhhhHHHHHHHHhhhll


DSSP  -lLEEEELLLLL--HHHHLLE--------------------EEEE-eelllHHHH-----
Query -yRYVANSDFHE--LWHVYSW--------------------KTLV-kseknIEAI-----  207
ident   |     |                                                   
Sbjct lgRVIFGNDAPSgtGLIPLGIlrnmcqiasmsdidpevavcMATGnstavyGLNTgviap  326
DSSP  hhHEEEELLLLLllLLLLLHHhhhhhhhhhhllllhhhhhhHHLHhhhhhhLLLLlllll


DSSP  ------------------------------------------hhhhhhllleeeeelll
Query ------------------------------------------keairkntdvaiylxrk  224
ident                                                            
Sbjct gkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  llllleeeeelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 26: Query=2anuA Sbjct=4dlfA Z-score=5.8

back to top
DSSP  leEEEEEEEELLLL---------------lllLLLHHHHHHHHHHLLLLEEEEEEEeelh
Query teWLLCDFHVHTNX---------------sdgHLPLGEVVDLFGKHGVDVVSITDHivdr   45
ident    |  | | |                              |                  
Sbjct --ALRIDSHQHFWRyraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQA----   54
DSSP  --LLLEEEEELLLLllhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELL----


DSSP  hhhhhhhhllllllLLLLllhhHHHHHHHHHHHHHHhhhlLEEEEEE-------------
Query rtleqrkrngeplgAITEdkfqDYLKRLWREQKRAWeeygXILIPGV-------------   92
ident                       |    |             |                  
Sbjct --------------RAGR----DETAFLLELACDEA----RIAAVVGwedlrapqlaerv   92
DSSP  --------------LLLH----HHHHHHHHHHLLLL----LEEEEEEllllllllhhhhh


DSSP  -----------EEEELLLleeeeeellllllllllLHHHHHHHHHHLLLEE---------
Query -----------EITNNTDlyhivavdvkeyvdpslPVEEIVEKLKEQNALV---------  132
ident                                         |  |                
Sbjct aewrgtklrgfRHQLQDE-------advrafvddaDFARGVAWLQANDYVYdvlvferql  145
DSSP  hlllllleeeeEELHHHL-------llhhhhhhlhHHHHHHHHHHHLLLEEeelllhhhh


DSSP  ---------------EELL-LLLLL-----------lllhhHHLLllLLLLlLEEEeEEL
Query ---------------IAAH-PDRKK-----------lswylWANXerFKDTfDAWEiANR  165
ident                   |                                         
Sbjct pdvqafcarhdahwlVLDHaGKPALaefdrddtalarwraaLREL-aALPH-VVCK-LSG  202
DSSP  hhhhhhhhhllllleEEHHhHLLLHhhllllllhhhhhhhhHHHH-hLLLL-EEEE-ELL


DSSP  LE-------------------eLHHHHHLLL--LEEEELLLLL----hHHHLLE------
Query DD-------------------lFNSVGVKKY--RYVANSDFHE----lWHVYSW------  194
ident                                  |    ||                    
Sbjct LVteadwrrglrasdlrhieqcLDAALDAFGpqRLMFGSDWPVcllaaSYDEVAslverw  262
DSSP  LLllllllllllhhhhhhhhhhHHHHHHHHLhhHEEELLLLLHhhhllLHHHHHhhhhhh


DSSP  ------------eEEEEelllhhHHHHhhhhllleeeeelll
Query ------------kTLVKseknieAIKEairkntdvaiylxrk  224
ident                                           
Sbjct aesrlsaaersalWGGT----aaRCYA-------------lp  287
DSSP  hhhhllhhhhhhhLLHH----hhHHLL-------------ll


No 27: Query=2anuA Sbjct=2vc5A Z-score=5.7

back to top
DSSP  -------------LEEEEEEEEELLLLL---------------llllLHHHHHHHHHHLL
Query -------------TEWLLCDFHVHTNXS---------------dghlPLGEVVDLFGKHG   32
ident                      | |                            |      |
Sbjct mriplvgkdsiesKDIGFTLIHEHLRVFseavrqqwphlynedeefrNAVNEVKRAMQFG   60
DSSP  llllllllllllhHHLLLEELLLLLLLLlhhhhhhlhhhllhhhhhhHHHHHHHHHHHLL


DSSP  LLEEEEEEEEElhhhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEE
Query VDVVSITDHIVdrrtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGV   92
ident |                                            |         |  | 
Sbjct VKTIVDPTVMG----------------------lgrDIRFMEKVVKATG----INLVAGT   94
DSSP  LLEEEELLLLL----------------------lllLHHHHHHHHHLLL----LEEEELE


DSSP  EEEELLL---------------------------------leeeeeelllllllllLLHH
Query EITNNTD---------------------------------lyhivavdvkeyvdpsLPVE  119
ident  |    |                                                     
Sbjct GIYIYIDlpfyflnrsideiadlfihdikegiqgtlnkagfvxiaadepgitkdveKVIR  154
DSSP  ELLLLLLllhhhllllhhhhhhhhhhhhhlllllllllllleeeelllllllhhhhHHHH


DSSP  HHHHHHHHLLLEEEELLLllllLLLHHHHLLLLLLLL-----lLEEE---eeelleeLHH
Query EIVEKLKEQNALVIAAHPdrkkLSWYLWANXERFKDT-----fDAWE---ianrddlFNS  171
ident       ||     |                                              
Sbjct AAAIANKETKVPIITHSN---aHNNTGLEQQRILTEEgvdpgkILIGhlgdtdnidyIKK  211
DSSP  HHHHHHHHHLLLEEEELL---lLLLHHHHHHHHHHHLlllhhhEEELlhhhlllhhhHHH


DSSP  HHHLLLLE--------------------------------EEELLLLL------------
Query VGVKKYRY--------------------------------VANSDFHE------------  187
ident    |                                        |               
Sbjct IADKGSFIgldrygldlflpvdkrnettlrlikdgysdkiMISHDYCCtidwgtakpeyk  271
DSSP  HHHLLLEEeellllllllllhhhhhhhhhhhhhlllllleEELLLLLLllllllllhhhh


DSSP  ------HHHHLL------------------eeEEEEelllhhHHHHhhhhllleeeeell
Query ------LWHVYS------------------wkTLVKseknieAIKEairkntdvaiylxr  223
ident                                                             
Sbjct pklaprWSITLIfedtipflkrngvneeviatIFKE---npkKFFS--------------  314
DSSP  hhhlllLLLLHHhhlhhhhhhlllllhhhhhhHHLH---hhhHHLL--------------


DSSP  l
Query k  224
ident  
Sbjct -  314
DSSP  -


No 28: Query=2anuA Sbjct=4mupB Z-score=5.7

back to top
DSSP  -------------lEEEEEEEEELLL------------lllllLLHHhhhHHHHHLL---
Query -------------tEWLLCDFHVHTN------------xsdghLPLGevvDLFGKHG---   32
ident                    |   |                   ||               
Sbjct lvrklsgtapnpafPRGAVDTQMHMYlpgypalpggpglppgaLPGP---EDYRRLMqwl   57
DSSP  llllllllllllllLLLLEELLLLLLlllllllllllllllllLLLH---HHHHHHHhhh


DSSP  -LLEEEEEEEEelhhhhhhhhhllllllLLLLllhhhHHHHHHHHHHHHHhhhlLEEEEE
Query -VDVVSITDHIvdrrtleqrkrngeplgAITEdkfqdYLKRLWREQKRAWeeygXILIPG   91
ident   | | ||                    |                               
Sbjct gIDRVIITQGN-----------------AHQR-----DNGNTLACVAEMG----EAAHAV   91
DSSP  lLLEEEEELLH-----------------HHLL-----LLHHHHHHHHHHH----HHEEEE


DSSP  ----------------------eEEEELLlleeeeeellllllLLLLLHHHHHHHHHHLL
Query ----------------------vEITNNTdlyhivavdvkeyvDPSLPVEEIVEKLKEQN  129
ident                         |                            |      
Sbjct viidatttekdmekltaagtvgaRIMDLP-----------ggaVNLSELDAVDERAHAAD  140
DSSP  elllllllhhhhhhhhhlleeeeEEELLL-----------lllLLHHHHHHHHHHHHHLL


DSSP  LE-----------------------EEEL-LLLLlLLLL----hhhHLLLLLL-LLLLEE
Query AL-----------------------VIAA-HPDRkKLSW----ylwANXERFK-DTFDAW  160
ident                               |               |             
Sbjct WMvavqfdgnglldhlprlqkirsrWVFDhHGKF-FKGIrtdgpemAALLKLIdRGNLWF  199
DSSP  LEeeeellhhhhhhhhhhhhlllleEEELhHHHL-LLLLllllhhhHHHHHHHhHLLEEE


DSSP  EeEELLE--------------eLHHHHHLLL-LEEEELLLLL--------hHHHL-----
Query EiANRDD--------------lFNSVGVKKY-RYVANSDFHE--------lWHVY-----  192
ident                                 | |                         
Sbjct K-FAGVYessrkswpyadvaafSRVIAAHAPeRIVWGTNWPHnsvretaayPDDArlael  258
DSSP  E-ELLHHhllllllllhhhhhhHHHHHHHLHhHEEELLLLLLlllllhhhlLLHHhhhhh


DSSP  ----------leeEEEE---elllHHHHhhhhhhllleeeeelll
Query ----------swkTLVK---seknIEAIkeairkntdvaiylxrk  224
ident               ||                             
Sbjct tlgwlpdeaarhrALVEnpealfkLSPV-----------------  286
DSSP  hhlllllhhhhhhHHLHhhhhhhlLLLL-----------------


No 29: Query=2anuA Sbjct=1gkpA Z-score=5.6

back to top
DSSP  -------------------------------------------------lEEEEEEEEEL
Query -------------------------------------------------tEWLLCDFHVH   11
ident                                                        | |||
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  LLLL----LLLLLHHHHHHHHHHLLLLEEEEEEEEELHhhhhhhhhllllllllLLLLHH
Query TNXS----DGHLPLGEVVDLFGKHGVDVVSITDHIVDRrtleqrkrngeplgaiTEDKFQ   67
ident                         |                                  |
Sbjct IYLPfmatFAKDTHETGSKAALMGGTTTYIEMCCPSRN--------------ddALEGYQ  106
DSSP  LLLEelleELLLLHHHHHHHHHHLLEEEEEEEELLLLL--------------llHHHHHH


DSSP  HHHHHHHHHHhhhhhhhlLEEEeEEEEeelllleeeeeellllllLLLL-----------
Query DYLKRLWREQkraweeygXILIpGVEItnntdlyhivavdvkeyvDPSL-----------  116
ident                                                             
Sbjct LWKSKAEGNS-------yCDYT-FHMA------------------VSKFdektegqlrei  140
DSSP  HHHHHHLLLL-------lLEEE-EEEE------------------LLLLlllhhhhhhhh


DSSP  -----------------------LHHHHHHHHHHLLLEEEELL-----------------
Query -----------------------PVEEIVEKLKEQNALVIAAH-----------------  136
ident                                 ||    | |                   
Sbjct vadgissfxiflsyknffgvddgEMYQTLRLAKELGVIVTAHCenaelvgrlqqkllseg  200
DSSP  hhlllleeeeeelllllllllhhHHHHHHHHHHHHLLEEEEEEllhhhhhhhhhhhhhll


DSSP  --------llllLLLL-HHHHL-LLLLL--LLLLEEE-----------------------
Query --------pdrkKLSW-YLWAN-XERFK--DTFDAWE-----------------------  161
ident                     |                                       
Sbjct ktgpewhepsrpEAVEaEGTARfATFLEttGATGYVVhlsckpaldaamaakargvpiyi  260
DSSP  lllhhhllllllHHHHhHHHHHhHHHHHhhLLEEEELllllhhhhhhhhhhhhlllleee


DSSP  EEELLEE-------------------------------lhhhhhllllEEEELLLLL---
Query IANRDDL-------------------------------fnsvgvkkyrYVANSDFHE---  187
ident                                                      |      
Sbjct ESVIPHFlldktyaerggveamkyimspplrdkrnqkvlwdalaqgfiDTVGTDHCPfdt  320
DSSP  EEEHHHHhllhhhhhllhhhhhlllllllllllhhhhhhhhhhhllllLEEELLLLLllh


DSSP  ---------------hHHHL----------------------leeEEEEelllhhHHHHH
Query ---------------lWHVY----------------------swkTLVKseknieAIKEA  210
ident                                                 |           
Sbjct eqkllgkeaftaipngIPAIedrvnllytygvsrgrldihrfvdaASTK----aaKLFGL  376
DSSP  hhhhhhlllhhhllllLLLLllhhhhhhhhhlllllllhhhhhhhHLHH----hhHHLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  210
ident                                                             
Sbjct fprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvav  436
DSSP  lllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeee


DSSP  --------hhhllleeeeelll
Query --------irkntdvaiylxrk  224
ident                       
Sbjct rdgqfvgekgwgkllrrepmyf  458
DSSP  elleelllllllllllllllll


No 30: Query=2anuA Sbjct=4qrnA Z-score=5.6

back to top
DSSP  -----------lEEEEEEEEELLLL-----------------------------------
Query -----------tEWLLCDFHVHTNX-----------------------------------   14
ident               |                                             
Sbjct smtqdlktggeqGYLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllLLLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  ---lllLLLHH-HHHHHHHHLLLLEEEEEEEeelhhhhhhhhhlllllLLLL--------
Query ---sdgHLPLG-EVVDLFGKHGVDVVSITDHivdrrtleqrkrngeplGAIT--------   62
ident        | ||          | |                                    
Sbjct tqilerLLDLGeRRIADMDATGIDKAILALT-----------------SPGVqplhdlde  103
DSSP  hhhhhhHHLLLhHHHHHHHHLLLLEEEEEEL-----------------LLLLlllllhhh


DSSP  -LLLHHHHHHHHHHHHHHHHhhhlLEEEEEEeeeelllleeeeeellllLLLLLL-----
Query -EDKFQDYLKRLWREQKRAWeeygXILIPGVeitnntdlyhivavdvkeYVDPSL-----  116
ident            |               |                                
Sbjct aRTLATRANDTLADACQKYP----DRFIGMG-----------------tVAPQDPewsar  142
DSSP  hHHHHHHHHHHHHHHHHHLL----LLEEELL-----------------lLLLLLHhhhhh


DSSP  ----------------------------lhHHHHHHHHHLLLEE----------------
Query ----------------------------pvEEIVEKLKEQNALV----------------  132
ident                                 |   | |                     
Sbjct eihrgarelgfkgiqinshtqgryldeeffDPIFRALVEVDQPLyihpatspdsmidpml  202
DSSP  hhhhhhhlllllleeelllllllllllhhhHHHHHHHHHHLLLEeellllllllllhhhh


DSSP  ------------------------------------EELLllllllllhHHHL-------
Query ------------------------------------IAAHpdrkklswyLWAN-------  149
ident                                        |         |          
Sbjct eagldgaifgfgvetgmhllrlitigifdkypslqiMVGH-----mgeaLPYWlyrldym  257
DSSP  hhlllllllhhhhhhhhhhhhhhhhlhhhhllllleEELH-----hhhlHHHHhhhhhhh


DSSP  -------------------lLLLLlllLEEEeEELLEE---LHHHHHLLL--LEEEELLL
Query -------------------xERFKdtfDAWEiANRDDL---FNSVGVKKY--RYVANSDF  185
ident                     |                               |     | 
Sbjct hqagvrsqryermkplkktiEGYLksnVLVT-NSGVAWepaIKFCQQVMGedRVMYAMDY  316
DSSP  hhhhhhlllllllllllllhHHHHhhlEEEE-LLLLLLhhhHHHHHHHHLhhHEELLLLL


DSSP  LlhHHHL-----------------leEEEEeelllhhHHHHHhhhllleeeeelll
Query HelWHVY-----------------swKTLVkseknieAIKEAirkntdvaiylxrk  224
ident                                                         
Sbjct P--YQYVadevramdamdmsaqtkkkFFQT----naeKWFKL--------------  352
DSSP  L--LLLLhhhhhhhhlllllhhhhhhHHLH----hhhHHLLL--------------


No 31: Query=2anuA Sbjct=1itqA Z-score=5.5

back to top
DSSP  -----------lEEEEEEEEELLLLL---------------lllllhhHHHH-HHHHLLL
Query -----------tEWLLCDFHVHTNXS---------------dghlplgEVVD-LFGKHGV   33
ident                  | |                                       |
Sbjct dffrdeaerimrDSPVIDGHNDLPWQlldmfnnrlqderanlttlagtHTNIpKLRAGFV   60
DSSP  lhhhhhhhhhhlLLLEEEEEELHHHHhhhhhllllllhhhllllllllLLLHhHHHHLLE


DSSP  LEEEEEEEEELHHHHHhhhhllllllllLLLLHHHHHHHHHHHHHHhHHHH---------
Query DVVSITDHIVDRRTLEqrkrngeplgaiTEDKFQDYLKRLWREQKRaWEEY---------   84
ident                                          |       |          
Sbjct GGQFWSVYTPCDTQNK-----------dAVRRTLEQMDVVHRMCRM-YPETflyvtssag  108
DSSP  EEEEEEELLLHHHLLL-----------lHHHHHHHHHHHHHHHHHH-LLLLeeelllhhh


DSSP  --------LLEEEEEEEEEE------------------------LLLL------eeeeee
Query --------GXILIPGVEITN------------------------NTDL------yhivav  106
ident               |||                                           
Sbjct irqafregKVASLIGVEGGHsidsslgvlralyqlgmryltlthSCNTpwadnwlvdtgd  168
DSSP  hhhhhhllLEEEEEEEELHHhllllhhhhhhhhhlleeeeelllLLLLlllllhhhllll


DSSP  llllllllllLHHHHHHHHHHLLLEEEELLllllllllhHHHLLLLLLLL--lLEEEeeE
Query dvkeyvdpslPVEEIVEKLKEQNALVIAAHpdrkklswyLWANXERFKDT--fDAWEiaN  164
ident                |  |     |   ||           |                  
Sbjct sepqsqglspFGQRVVKELNRLGVLIDLAH--------vSVATMKATLQLsraPVIF-sH  219
DSSP  lllllllllhHHHHHHHHHHHHLLEEELLL--------lLHHHHHHHHHHlllLLEE-lL


DSSP  LLEE---------LHHHHHLLL---LEEE-------------------------------
Query RDDL---------FNSVGVKKY---RYVA-------------------------------  181
ident                 |          |                                
Sbjct SSAYsvcasrrnvPDDVLRLVKqtdSLVMvnfynnyisctnkanlsqvadhldhikevag  279
DSSP  LLLLlllllllllLHHHHHHHHhhlLEEEelllhhhhlllllllhhhhhhhhhhhhhhll


DSSP  ------ELLLL-------lHHHH------------------lleeEEEEelllhhhhHHH
Query ------NSDFH-------eLWHV------------------yswkTLVKseknieaiKEA  210
ident         ||         |  |                       |             
Sbjct aravgfGGDFDgvprvpegLEDVskypdliaellrrnwteaevkgALAD-------nLLR  332
DSSP  hhheeeLLLLLllllllllLLLLllhhhhhhhhhhllllhhhhhhHHLH-------hHHH


DSSP  HHHL-----------------------lleeeeelll
Query IRKN-----------------------tdvaiylxrk  224
ident                                      
Sbjct VFEAveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHHHhhhllllllllllllllhhhlllllllllllll


No 32: Query=2anuA Sbjct=1bf6A Z-score=5.5

back to top
DSSP  --lEEEEEEEEELLLLLL---------lLLLHHHHHHHHHHLL---LLEEEEEEEEElhh
Query --tEWLLCDFHVHTNXSD---------gHLPLGEVVDLFGKHG---VDVVSITDHIVdrr   46
ident           | |                                 |  |          
Sbjct sfdPTGYTLAHEHLHIDLsgfknnvdcrLDQYAFICQEMNDLMtrgVRNVIEMTNRY---   57
DSSP  lllLLLEEEEEELLLEELhhhhllhhheELLHHHHHHHHHHHHhllEEEEEELLLHH---


DSSP  hhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEEEEEELL--------
Query tleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGVEITNNT--------   98
ident                                                             
Sbjct -------------------mgrNAQFMLDVMRETG----INVVACTGYYQDAffpehvat   94
DSSP  -------------------hllLHHHHHHHHHHHL----LEEEEEELLLLHHhlllhhhh


DSSP  lleeeeeellLLLL--------------------------lllLLHHHHHHHHHHLLLEE
Query dlyhivavdvKEYV--------------------------dpsLPVEEIVEKLKEQNALV  132
ident                                                             
Sbjct rsvqelaqemVDEIeqgidgtelkagiiaeigtsegkitpleeKVFIAAALAHNQTGRPI  154
DSSP  llhhhhhhhhHHHHhllllllllleeeeeeeelllllllhhhhHHHHHHHHHHHHHLLLE


DSSP  EELLLLllllllhHHHL-LLLLLL-----lLLEEEEE---elleeLHHHHHLLLLEE---
Query IAAHPDrkklswyLWAN-XERFKD-----tFDAWEIA---nrddlFNSVGVKKYRYV---  180
ident                                                             
Sbjct STHTSF-----stMGLEqLALLQAhgvdlsRVTVGHCdlkdnldnILKMIDLGAYVQfdt  209
DSSP  EEELHH-----hlLHHHhHHHHHHllllhhHEEELLLlllllhhhHHHHHHLLLEEEell


DSSP  -----------------------------EELLLLLH--------HHHLLE---------
Query -----------------------------ANSDFHEL--------WHVYSW---------  194
ident                                 |                           
Sbjct igknsyypdekriamlhalrdrgllnrvmLSMDITRRshlkanggYGYDYLlttfipqlr  269
DSSP  llllllllhhhhhhhhhhhhhlllhhheeELLLLLLHhhlhhhllLLLLHHhhlhhhhhh


DSSP  ----------eeEEEElllhhHHHHhhhhllleeeeelll
Query ----------ktLVKSeknieAIKEairkntdvaiylxrk  224
ident             |                           
Sbjct qsgfsqadvdvmLREN---psQFFQ---------------  291
DSSP  hllllhhhhhhhHLHH---hhHHLL---------------


No 33: Query=2anuA Sbjct=4rdvB Z-score=5.5

back to top
DSSP  ----------------------------------------------lEEEEEEEEELLll
Query ----------------------------------------------tEWLLCDFHVHTnx   14
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHA--   58
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELH--


DSSP  llLLLL-------------------------------------HHHHHHHHHHLLLLEEE
Query sdGHLP-------------------------------------LGEVVDLFGKHGVDVVS   37
ident                                                     | |   | 
Sbjct --FQRAmaglaevagnpndsfwtwrelmyrmvarlspeqieviACQLYIEMLKAGYTAVA  116
DSSP  --HHHHhlllllllllllllhhhhhhhhhhhhllllhhhhhhhHHHHHHHHHHHLEEEEE


DSSP  EEEEeelhhhhhhhhhllllllLLLL------LLHHHHHHHHHHHHHHHHhhhlLEEEEE
Query ITDHivdrrtleqrkrngeplgAITE------DKFQDYLKRLWREQKRAWeeygXILIPG   91
ident                                         |  |    |       |   
Sbjct EFHY------------------VHHDldgrsyADPAELSLRISRAASAAG----IGLTLL  154
DSSP  EEEL------------------LLLLllllllLLLLHHHHHHHHHHHHHL----LEEEEE


DSSP  EEEEELLLLeeeeeellllllLLLL----------------------------------L
Query VEITNNTDLyhivavdvkeyvDPSL----------------------------------P  117
ident                                                             
Sbjct PVLYSHAGFggqpasegqrrfINGSeaylellqrlrapleaaghslglcfhslravtpqQ  214
DSSP  ELLLLEEELlleellhhhlllLLLHhhhhhhhhhhhhhhhhhlleeleeelllllllhhH


DSSP  HHHHHHHhHHLLLEEEELLLLL--lLLLL------hhHHLL-LLLLLL-lLEEEEeelle
Query VEEIVEKlKEQNALVIAAHPDR--kKLSW------ylWANX-ERFKDT-fDAWEIanrdd  167
ident               |                           |                 
Sbjct IATVLAA-GHDDLPVHIHIAEQqkeVDDCqawsgrrpLQWLyENVAVDqrWCLVH----a  269
DSSP  HHHHHLL-LLLLLLEEEEELLLhhhHHHHhhhhlllhHHHHhHHLLLLllEEEEE----l


DSSP  ELHH--hHHLL----LLEEE---------------------------ELLLLlhHHHL--
Query LFNS--vGVKK----YRYVA---------------------------NSDFHelWHVY--  192
ident                                                 || |        
Sbjct THADpaeVAAMarsgAVAGLclsteanlgdgifpatdflaqggrlgiGSDSH--VSLSvv  327
DSSP  LLLLhhhHHHHhhhlLEEEElhhhhhhlllllllhhhhhhllleeeeLLLLL--LLLLhh


DSSP  --------------------------------leeEEEE---------------ELLL--
Query --------------------------------swkTLVK---------------SEKN--  203
ident                                     |                       
Sbjct eelrwleygqrlrdrkrnrlyrddqpmigrtlydaALAGgaqalgqpigslavgRRADll  387
DSSP  hhhhhhhhhhhhhhlllllllllllllhhhhhhhhHHHHhhhhhllllllllllLLLLee


DSSP  -------------------------------------------hhhhhhhhhhllleeee
Query -------------------------------------------ieaikeairkntdvaiy  220
ident                                                             
Sbjct vldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvl  447
DSSP  eellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhh


DSSP  elll
Query lxrk  224
ident     
Sbjct gell  451
DSSP  hhhl


No 34: Query=2anuA Sbjct=4ofcA Z-score=5.4

back to top
DSSP  leeeEEEEEELLL------------------------------------lllllLLHHhh
Query tewlLCDFHVHTN------------------------------------xsdghLPLGev   24
ident       | | |                                                 
Sbjct ---mKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvreNCWD--   55
DSSP  ---lLEEEEEELLllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehHHLL--


DSSP  HHHHHHLL----LLEEEEEEEEelhhhhhhhhhlllllLLLL--------LLLHHHHHHH
Query VDLFGKHG----VDVVSITDHIvdrrtleqrkrngeplGAIT--------EDKFQDYLKR   72
ident             | |                                       |     
Sbjct PEVRIREMdqkgVTVQALSTVP----------------VMFSywakpedtLNLCQLLNND   99
DSSP  HHHHHHHHhhhlLLEEEEELLH----------------HHHLllllhhhhHHHHHHHHHH


DSSP  HHHHHHHHHhhhlLEEEEE--------------------------EEEEELLLleeeeee
Query LWREQKRAWeeygXILIPG--------------------------VEITNNTDlyhivav  106
ident |                                            | |            
Sbjct LASTVVSYP----RRFVGLgtlpmqapelavkemercvkelgfpgVQIGTHVN-------  148
DSSP  HHHHHHHLL----LLEEEEellllllhhhhhhhhhhhhhllllleEEEELEEL-------


DSSP  llllllllLLLH---hHHHHHHHHLLLE--------------------------------
Query dvkeyvdpSLPV---eEIVEKLKEQNAL--------------------------------  131
ident          |                                                  
Sbjct ------ewDLNAqelfPVYAAAERLKCSlfvhpwdmqmdgrmakywlpwlvgmpaettia  202
DSSP  ------leELLLhhhhHHHHHHHHHLLEeeeelllllllhhhhlllhhhhlhhhhhhhhh


DSSP  -----------------EEELLllllllllhhHHLL------------------------
Query -----------------VIAAHpdrkklswylWANX------------------------  150
ident                  |  ||           |                          
Sbjct icsmimggvfekfpklkVCFAH--------ggGAFPftvgrishgfsmrpdlcaqdnpmn  254
DSSP  hhhhhlllhhhhlllllEEELH--------hhLLHHhhhhhhhhhhhhlhhhhlllllll


DSSP  -LLLLLLLlEEEEeeLLEE---LHHHHHLLL--LEEEELLLLLHHH-HLLE---------
Query -ERFKDTFdAWEIanRDDL---FNSVGVKKY--RYVANSDFHELWH-VYSW---------  194
ident        |                               |                    
Sbjct pKKYLGSF-YTDA--LVHDplsLKLLTDVIGkdKVILGTDYPFPLGeLEPGkliesmeef  311
DSSP  hHHHLLLL-EEEL--LLLLhhhHHHHHHHHLllLEELLLLLLLLLLlLLLLhhhhhllll


DSSP  ---------------eeeeEELLLhhhhhhhhhhllleeeeelll
Query ---------------ktlvKSEKNieaikeairkntdvaiylxrk  224
ident                                              
Sbjct deetknklkagnalaflglERKQF---------------------  335
DSSP  lhhhhhhhhlhhhhhhhllLHHHL---------------------


No 35: Query=2anuA Sbjct=2uz9A Z-score=5.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ------LEEEEEEEEELLLlllLLLL---------------------------------H
Query ------TEWLLCDFHVHTNxsdGHLP---------------------------------L   21
ident           | | | |                                           
Sbjct lshhefFMPGLVDTHIHAS---QYSFagssidlpllewltkytfpaehrfqnidfaeevY  117
DSSP  llllleEEELEEEEEEEHH---HHHHllllllllhhhhhhhlhhhhhhhhhlhhhhhhhH


DSSP  HHHHHHHHHLLLLEEEEEEeeelhhhhhhhhhlllllllllllLHHHHHHHHHHHHHHHH
Query GEVVDLFGKHGVDVVSITDhivdrrtleqrkrngeplgaitedKFQDYLKRLWREQKRAW   81
ident   ||    | |                                   |    |        
Sbjct TRVVRRTLKNGTTTACYFA-----------------------tIHTDSSLLLADITDKFG  154
DSSP  HHHHHHHHHLLEEEEEEEL-----------------------lLLHHHHHHHHHHHHHHL


DSSP  hhhlLEEEEE-------------------------------------------EEEEELl
Query eeygXILIPG-------------------------------------------VEITNNt   98
ident          |                                                  
Sbjct ----QRAFVGkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpivTPRFSL-  209
DSSP  ----LEEEEEleelllllllllllllhhhhhhhhhhhhhhhhhhlllleeeeeEELLHH-


DSSP  lleeeeeellllllLLLL-LHHHHHHHHH-HLLLE-------------------------
Query dlyhivavdvkeyvDPSL-PVEEIVEKLK-EQNAL-------------------------  131
ident                 |     |     |                               
Sbjct --------------SCSEtLMGELGNIAKtRDLHIqshisenrdeveavknlypsyknyt  255
DSSP  --------------HLLHhHHHHHHHHHHhHLLEEeeeelllhhhhhhhhhhllllllhh


DSSP  ------------EEELLLlllllllhhhHLLLLLLLLLLEEEeEELL--------EELH-
Query ------------VIAAHPdrkklswylwANXERFKDTFDAWEiANRD--------DLFN-  170
ident                ||                |                      |   
Sbjct svydknnlltnkTVMAHG-----cylsaEELNVFHERGASIA-HCPNsnlslssgFLNVl  309
DSSP  hhhhhlllllllEEEEEL-----llllhHHHHHHHHHLLEEE-ELHHhhhhllllLLLHh


DSSP  HHHHLLLLEEEELLLLLHHH---HLLE---------------------------EEEEee
Query SVGVKKYRYVANSDFHELWH---VYSW---------------------------KTLVks  200
ident  |           |                                              
Sbjct EVLKHEVKIGLGTDVAGGYSysmLDAIrravmvsnillinkvneksltlkevfrLATL--  367
DSSP  HHHHLLLEEEELLLLLLLLLllhHHHHhhhhhhhhhhhhlllllllllhhhhhhHHLH--


DSSP  lllhhhHHHH--------------------------------------------------
Query eknieaIKEA--------------------------------------------------  210
ident                                                             
Sbjct -ggsqaLGLDgeignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgd  426
DSSP  -hhhhhLLLLllllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhll


DSSP  ----hhhllleeeeelll
Query ----irkntdvaiylxrk  224
ident                   
Sbjct drnieevyvggkqvvpfs  444
DSSP  hhheeeeeelleeeelll


No 36: Query=2anuA Sbjct=2imrA Z-score=5.3

back to top
DSSP  ----------------------------------------------------LEEEEEEE
Query ----------------------------------------------------TEWLLCDF    8
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragavIAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleELLLLLEE


DSSP  EELLLLL-----------------------llllLHHHHHHHHHHLLLLEEEEEEeeelh
Query HVHTNXS-----------------------dghlPLGEVVDLFGKHGVDVVSITDhivdr   45
ident | |   |                                 |     |   |         
Sbjct HTHLDMSayefqalpyfqwipevvirgrhlrgvaAAQAGADTLTRLGAGGVGDIV-----  115
DSSP  EEELLLLhhhhhhlhhhhllhhhhhhhllllhhhHHHHHHHHHHHLLLLLEEEEE-----


DSSP  hhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEE-------------
Query rtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGV-------------   92
ident                                  |                          
Sbjct ----------------------wAPEVMDALLARED----LSGTLYFevlnpfpdkadev  149
DSSP  ----------------------lLHHHHHHHHLLLL----LLEEEEEeellllhhhhhhh


DSSP  -----------------------EEEELLlleeeeeellllllllLLLHHHHHHHHHHLL
Query -----------------------EITNNTdlyhivavdvkeyvdpSLPVEEIVEKLKEQN  129
ident                                                             
Sbjct faaarthlerwrrlerpglrlglSPHTPF-------------tvsHRLMRLLSDYAAGEG  196
DSSP  hhhhhhhhhhhhlllllleeeeeEELLLL-------------lllHHHHHHHHHHHHHHL


DSSP  LE----------------------------------------------------------
Query AL----------------------------------------------------------  131
ident                                                             
Sbjct LPlqihvaehptelemfrtgggplwdnrmpalyphtlaevigrepgpdltpvryldelgv  256
DSSP  LLleeeelllhhhhhhhhhlllllhhhllhhhllllhhhhhlllllllllhhhhhhhhll


DSSP  ----EEELLLlllllllhhhHLLLLLLLLlLEEEeEELL--------EELH-HHHHLLLL
Query ----VIAAHPdrkklswylwANXERFKDTfDAWEiANRD--------DLFN-SVGVKKYR  178
ident         |               |      |                            
Sbjct laarPTLVHM-----vnvtpDDIARVARAgCAVV-TCPRsnhhlecgTFDWpAFAAAGVE  310
DSSP  hhhlLEEEEL-----llllhHHHHHHHHHlLLEE-ELHHhhhhllllLLLHhHHHHLLLL


DSSP  EEEELLLLL-hHHHLLeeeeeeelllhhhhhhhhhhlllEEEE-----------------
Query YVANSDFHE-lWHVYSwktlvkseknieaikeairkntdVAIY-----------------  220
ident      |                                 |                    
Sbjct VALGTDSVAsgETLNV----reevtfarqlypgldprvlVRAAvkggqrvvgtpflrrge  366
DSSP  EEELLLLHHhhLLLLL----hhhhhhhhhhlllllhhhhHHHHhhhhhhhhlllllllll


DSSP  ----------elll
Query ----------lxrk  224
ident               
Sbjct twqegfrwelsrdl  380
DSSP  lllhhhlhhhllll


No 37: Query=2anuA Sbjct=3mkvA Z-score=5.2

back to top
DSSP  ------------------------------------------------------lEEEEE
Query ------------------------------------------------------tEWLLC    6
ident                                                           | 
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEELLllLLLL---------------lLHHHHHHHHHHLLLLEEEEEEEeelhhhhhhh
Query DFHVHTnxSDGH---------------lPLGEVVDLFGKHGVDVVSITDHivdrrtleqr   51
ident | |||                                   |   |               
Sbjct DLHVHV--VAIEfnlprvatlpnvlvtlRAVPIMRAMLRRGFTTVRDAGG----------  108
DSSP  EEEELL--LLLLllhhhhllllhhhhhhHHHHHHHHHHHLLEEEEEELLL----------


DSSP  hhllllllllllllhhhHHHHHHHHH--HHHHhhhlLEEEEEEEEEELLLLEEE------
Query krngeplgaitedkfqdYLKRLWREQ--KRAWeeygXILIPGVEITNNTDLYHI------  103
ident                                       |         |           
Sbjct ----------------aGYPFKQAVEsgLVEG----PRLFVSGRALSQTGGHADprarsd  148
DSSP  ----------------lLHHHHHHHHllLLLL----LEEEELLLEEELLLLLLLllllll


DSSP  ----------------------------eeellLLLL-----------------------
Query ----------------------------vavdvKEYV-----------------------  112
ident                                                             
Sbjct ymppdspcgccvrvgalgrvadgvdevrravreELQMgadqiximasggvasptdpvgvf  208
DSSP  llllllllllllllllleeelllhhhhhhhhhhHHHHlllleeeelllllllllllllll


DSSP  -llllLHHHHHHHHHHLLLEEEELLllllllllhhhHLLLLLLL-LLLEEEEeelleELH
Query -dpslPVEEIVEKLKEQNALVIAAHpdrkklswylwANXERFKD-TFDAWEIanrddLFN  170
ident          ||         | |             |   |         |         
Sbjct gysedEIRAIVAEAQGRGTYVLAHA--------ytpAAIARAVRcGVRTIEH----gNLI  256
DSSP  lllhhHHHHHHHHHHLLLLLEEEEE--------llhHHHHHHHHlLLLEEEE----lLLL


DSSP  H-hhHLLL-----LEEE-------------------------------------------
Query S-vgVKKY-----RYVA-------------------------------------------  181
ident                |                                            
Sbjct DdetARLVaehgaYVVPtlvtydalasegekyglppesiakiadvhgaglhsieimkrag  316
DSSP  LhhhHHHHhhhllEEELlhhhhhhhhhhlllllllhhhhllhhhhhllhhhhhhhhhhhl


DSSP  -----ELLLL--LHHHHLLE--------------eeEEEElllhhHHHHH----------
Query -----NSDFH--ELWHVYSW--------------ktLVKSeknieAIKEA----------  210
ident        |                                                    
Sbjct vkmgfGTDLLgeAQRLQSDEfrilaevlspaeviasATIV---saEVLGMqdklgrivpg  373
DSSP  lllllLLLLLhhHHHHLLHHhhhhhllllhhhhhhhLLHH---hhHHLLLllllllllll


DSSP  --------hhhllleeeeELLL-------------------
Query --------irkntdvaiyLXRK-------------------  224
ident                   |                      
Sbjct ahadvlvvdgnplksvdcLLGQgehiplvmkdgrlfvnele  414
DSSP  lllleeeellllllllllLLLLllllleeeelleeeeelll


No 38: Query=2anuA Sbjct=1j6pA Z-score=5.2

back to top
DSSP  ------------------------------------------------LEEEEEEEEELL
Query ------------------------------------------------TEWLLCDFHVHT   12
ident                                                     |   | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklVXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeEEELEEEEEELH


DSSP  lllLLLL--------------------------------LHHHHHHHHHHLLLLEEEEEE
Query nxsDGHL--------------------------------PLGEVVDLFGKHGVDVVSITD   40
ident       |                                           ||        
Sbjct ---PXTLlrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY  117
DSSP  ---HHHHhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE


DSSP  eeelhhhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEEE-------
Query hivdrrtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGVE-------   93
ident                                              |              
Sbjct ---------------------------fHEEWIAKAVRDFG----XRALLTRGlvdsngd  146
DSSP  ---------------------------lLHHHHHHHHHHHL----LEEEEEEEellllll


DSSP  ----------------------------EEELllleeeeeellllllLLLL-LHHHH-hh
Query ----------------------------ITNNtdlyhivavdvkeyvDPSL-PVEEI-ve  123
ident                                                  |          
Sbjct dggrleenlklynewngfegrifvgfgpHSPY---------------LCSEeYLKRVfdt  191
DSSP  lllhhhhhhhhhhhhllhhhleeeeeeeLLLL---------------LLLHhHHHHHhhh


DSSP  hhhHLLLE--------------------------EEELLLlllllllhHHHL--LLLLLL
Query klkEQNAL--------------------------VIAAHPdrkklswyLWAN--XERFKD  155
ident                                    ||||                   ||
Sbjct aksLNAPVtihlyetskeeydledilniglkevkTIAAHC-------vHLPEryFGVLKD  244
DSSP  hhhHLLLEeeeellllllllllhhhhllllllllEEEEEL-------lLLLHhhHHHHLL


DSSP  LLLEEEeEELL---------eeLHHHHHLLLLEEEELLLLL-hHHHLL------------
Query TFDAWEiANRD---------dlFNSVGVKKYRYVANSDFHE-lWHVYS------------  193
ident         |                            |                      
Sbjct IPFFVS-HNPAsnlklgngiapVQRXIEHGXKVTLGTDGAAsnNSLNLffexrlasllqk  303
DSSP  LLEEEE-ELHHhhhhlllllllHHHHHHLLLEEEELLLLLLllLLLLHhhhhhhhhhhhh


DSSP  -------------eeEEEE-elllHHHH--------------------------------
Query -------------wkTLVK-seknIEAI--------------------------------  207
ident                                                             
Sbjct aqnprnldvntclkxVTYDgaqaxGFKSgkieegwnadlvvidldlpexfpvqniknhlv  363
DSSP  llllllllhhhhhhhHLHHhhhhhLLLLlllllllllleeeeelllhhhllhhhhhhhhh


DSSP  ---------------------------hhhhhhllleeeeelll
Query ---------------------------keairkntdvaiylxrk  224
ident                                             
Sbjct hafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  hllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 39: Query=2anuA Sbjct=4b3zD Z-score=5.1

back to top
DSSP  --------------------------------------------------leEEEEEEEE
Query --------------------------------------------------teWLLCDFHV   10
ident                                                         |   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  LLLLlllLLLHHHHHHHHHHLLLLEEEEEEEEELHhhhhhhhhllllllllLLLLHHHHH
Query HTNXsdgHLPLGEVVDLFGKHGVDVVSITDHIVDRrtleqrkrngeplgaiTEDKFQDYL   70
ident                      |                                 |    
Sbjct YLQK-taADDFFQGTRAALVGGTTMIIDHVVPEPG--------------ssLLTSFEKWH  105
DSSP  LLLL-llLLLHHHHHHHHHHLLEEEEEEEELLLLL--------------llHHHHHHHHH


DSSP  HHHHHHHhhhhhhhlLEEEEEEEEEE------------------------------LLLL
Query KRLWREQkraweeygXILIPGVEITN------------------------------NTDL  100
ident                      | ||                                   
Sbjct EAADTKS-------cCDYSLHVDITSwydgvreelevlvqdkgvnsfqvymaykdvYQMS  158
DSSP  HHHHLLL-------lLEEEEEEELLLllllhhhhhhhhhhllllleeeeellllllLLLL


DSSP  eeeeeellllllllllLHHHHHHHHHhllLEEEELLL-----------------------
Query yhivavdvkeyvdpslPVEEIVEKLKeqnALVIAAHP-----------------------  137
ident                         |    |                              
Sbjct -----------dsqlyEAFTFLKGLG---AVILVHAEngdliaqeqkrilemgitgpegh  204
DSSP  -----------hhhhhHHHHHHHHHL---LEEEEELLlhhhhhhhhhhhhhllllllhhh


DSSP  ---lllllllhHHHL-LLLLL--LLLLEEEEEelleeLHHHHHLL-----LLEEEE----
Query ---drkklswyLWAN-XERFK--DTFDAWEIAnrddlFNSVGVKK-----YRYVAN----  182
ident                                                             
Sbjct alsrpeeleaeAVFRaITIAGriNCPVYITKVmsksaADIIALARkkgplVFGEPIaasl  264
DSSP  hhhllhhhhhhHHHHhHHHHHhhLLLEEEEEEllhhhHHHHHHHHhhlllEEEEELhhhh


DSSP  -----------------------------------------------LLLLL--------
Query -----------------------------------------------SDFHE--------  187
ident                                                |            
Sbjct gtdgthywsknwakaaafvtspplspdpttpdyltsllacgdlqvtgSGHCPystaqkav  324
DSSP  hlllhhhhlllhhhhhhllllllllllllhhhhhhhhhhhlllllllLLLLLllhhhhhh


DSSP  ----------HHHH---------------------lleeeEEEElllhHHHHHH------
Query ----------LWHV---------------------yswktLVKSekniEAIKEA------  210
ident                                                   |         
Sbjct gkdnftlipeGVNGieermtvvwdkavatgkmdenqfvavTSTN---aAKIFNLyprkgr  381
DSSP  hlllhhhlllLLLLlllhhhhhhhhhlllllllhhhhhhhHLHH---hHHHHLLllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  210
ident                                                             
Sbjct iavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgnin  441
DSSP  lllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleel


DSSP  ----------------------hhhllleeeeelll
Query ----------------------irkntdvaiylxrk  224
ident                                     
Sbjct vnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  lllllllllllllllhhhhhhhhhhhhhllllllll


No 40: Query=2anuA Sbjct=2ob3A Z-score=5.1

back to top
DSSP  -----------LEEE-EEEEEELLLLL----------------llllLHHHHHHHHHHLL
Query -----------TEWL-LCDFHVHTNXS----------------dghlPLGEVVDLFGKHG   32
ident                     | |   |                                |
Sbjct drintvrgpitISEAgFTLTHEHICGSsagflrawpeffgsrkalaeKAVRGLRRARAAG   60
DSSP  lleeelleeelHHHHlLEEEEELLEELlllhhhhlhhhhllhhhhhhHHHHHHHHHHHLL


DSSP  LLEEEEEEEEElhhhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEeEE
Query VDVVSITDHIVdrrtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIpGV   92
ident |                                       |      |            
Sbjct VRTIVDVSTFD----------------------igrDVSLLAEVSRAAD----VHIV-AA   93
DSSP  LLEEEELLLHH----------------------hllLHHHHHHHHHHHL----LEEE-LE


DSSP  EE-EELL------------------------------lleeeeeelllllllllLLHHHH
Query EI-TNNT------------------------------dlyhivavdvkeyvdpsLPVEEI  121
ident                                                       |     
Sbjct TGlWFDPplsmrlrsveeltqfflreiqygiedtgiragiixvattgkatpfqeLVLKAA  153
DSSP  EElLLLLlhhhhlllhhhhhhhhhhhhhllllllllllleeeeellllllhhhhHHHHHH


DSSP  HHHHHHLLLEEEELLLllllLLLHHHHLLLLLLL-----lLLEEE---eeelleeLHHHH
Query VEKLKEQNALVIAAHPdrkkLSWYLWANXERFKD-----tFDAWE---ianrddlFNSVG  173
ident           |                    |                            
Sbjct ARASLATGVPVTTHTA---aSQRDGEQQAAIFESeglspsRVCIGhsddtddlsyLTALA  210
DSSP  HHHHHHHLLLEEEELL---hHHLHHHHHHHHHHHllllhhHEEELlhhhlllhhhHHHHH


DSSP  HLLLLE----------------------------------------------EEELLLL-
Query VKKYRY----------------------------------------------VANSDFH-  186
ident    |                                                    |   
Sbjct ARGYLIgldhipysaiglednasasallgirswqtrallikalidqgymkqiLVSNDWTf  270
DSSP  HLLLEEeelllllllllllllhhhhhhhllllhhhhhhhhhhhhhlllhhheEELLLLLl


DSSP  -----------------lHHHHLL-------------------eeEEEEelllhhHHHHh
Query -----------------eLWHVYS-------------------wkTLVKseknieAIKEa  210
ident                                              |              
Sbjct gfssyvtnimdvmdrvnpDGMAFIplrvipflrekgvpqetlagiTVTN----paRFLS-  325
DSSP  eellllllhhhhhhhhllLHHHHHhhlhhhhhhhllllhhhhhhhHLHH----hhHHHL-


DSSP  hhhllleeeeelll
Query irkntdvaiylxrk  224
ident               
Sbjct ----------ptlr  329
DSSP  ----------llll


No 41: Query=2anuA Sbjct=2ogjA Z-score=5.1

back to top
DSSP  -----------------------------------------------------LEEEEEE
Query -----------------------------------------------------TEWLLCD    7
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafISPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleEEELEEE


DSSP  EEELL---lLLLLLllhhhHHHH-HHHLLLLEEEEEEeeelhhhhhhhhhllllllllll
Query FHVHT---nXSDGHlplgeVVDL-FGKHGVDVVSITDhivdrrtleqrkrngeplgaite   63
ident  |||                        ||                              
Sbjct LHVHIwhggTDISI-----RPSEcGAERGVTTLVDAG----------------------s   93
DSSP  EEELLllllLLLLL-----LHHHlLHHHLEEEEEEEL----------------------l


DSSP  llHHHHhHHHHH-HHHHHHhhhlLEEEEEE------------------------------
Query dkFQDYlKRLWR-EQKRAWeeygXILIPGV------------------------------   92
ident                                                             
Sbjct agEANF-HGFREyIIEPSR----ERIKAFLnlgsiglvacnrvpelrdikdidldrilec  148
DSSP  llLLLH-HHHHHhLLLLLL----LEEEEEEelllllllllllllllllhhhllhhhhhhh


DSSP  -----------EEEELLLLeeeeeelllllllllLLHHHHHHHHHHLLLEE---------
Query -----------EITNNTDLyhivavdvkeyvdpsLPVEEIVEKLKEQNALV---------  132
ident                                    ||       |               
Sbjct yaensehivglXVRASHVI---------tgswgvTPVKLGKKIAKILKVPXxvhvgeppa  199
DSSP  hhllllleeeeEEEELHHH---------hlllllHHHHHHHHHHHHHLLLEeeeelllll


DSSP  -------------EELLLlLLLLLL------hhhhLLLLlLLLLlEEEEEELL-----ee
Query -------------IAAHPdRKKLSW------ylwaNXERfKDTFdAWEIANRD-----dl  168
ident                 |    |               ||         |           
Sbjct lydevleilgpgdVVTHCfNGKSGSsixededlfnLAER-CEGI-RLDIGHGGasfsfkv  257
DSSP  lhhhhhhhlllllEEELLlLLLLLLlllllhhhhhHHHH-LLLL-EEELLLLLllllhhh


DSSP  LHHHHH-LLLLEEEELLLLLHH----HHLL------------------eEEEEeelllhh
Query FNSVGV-KKYRYVANSDFHELW----HVYS------------------wKTLVkseknie  205
ident                 | |                                         
Sbjct AEAAIArGLLPFSISTDLHGHSxnfpVWDLattxskllsvdxpfenvveAVTR----npa  313
DSSP  HHHHHHlLLLLLLLLLLLLLLLllllLLLHhhhhhhhhhllllhhhhhhLLLH----hhh


DSSP  HHHHH-----------------------------------------------hhhlllee
Query AIKEA-----------------------------------------------irkntdva  218
ident                                                             
Sbjct SVIRLdxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaas  373
DSSP  HHLLLlllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeell


DSSP  eeelll
Query iylxrk  224
ident       
Sbjct ryipra  379
DSSP  llllll


No 42: Query=2anuA Sbjct=3k2gB Z-score=5.0

back to top
DSSP  ------------------------leeEEEEEEELLLLLL--------------------
Query ------------------------tewLLCDFHVHTNXSD--------------------   16
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNDCrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEELhhhllllllhhhhhhhhlll


DSSP  -------------------lLLLHHHHHHHHHHLL---LLEEEEEEEEElhhhhhhhhhl
Query -------------------gHLPLGEVVDLFGKHG---VDVVSITDHIVdrrtleqrkrn   54
ident                        |                                    
Sbjct sieilselrqdpfvnkhniaLDDLDLAIAEVKQFAavgGRSIVDPTCRG-----------  109
DSSP  lhhhhhhhhllhhhllllleELLHHHHHHHHHHHHhllLLEEEELLLLL-----------


DSSP  lllllllllllhhhHHHHHHHHHHHHHhhhlLEEEeEEEE-EELL---------------
Query geplgaitedkfqdYLKRLWREQKRAWeeygXILIpGVEI-TNNT---------------   98
ident                   | |                                       
Sbjct -----------igrDPVKLRRISAETG----VQVV-XGAGyYLASsxpetaarlsaddia  153
DSSP  -----------lllLHHHHHHHHHHHL----LEEE-ELLLlLLHHhllhhhhlllhhhhh


DSSP  ------------------lleeeeeelllllllllLLHHHHHHHHHHLLLEEEELLLlll
Query ------------------dlyhivavdvkeyvdpsLPVEEIVEKLKEQNALVIAAHPdrk  140
ident                                                         |   
Sbjct deivaealegtdgtdarigligeigvssdftaeeeKSLRGAARAQVRTGLPLXVHLP---  210
DSSP  hhhhhhhhlllllllllllleeeelllllllhhhhHHHHHHHHHHHHHLLLEEELLL---


DSSP  lLLLHhHHLLlLLLL------llLEEEEEellEELH---hhHHLLL----LEEEE-----
Query kLSWYlWANXeRFKD------tfDAWEIAnrdDLFN---svGVKKY----RYVAN-----  182
ident                                                             
Sbjct gWFRL-AHRVlDLVEeegadlrhTVLCHX---NPSHxdpvyQATLAqrgaFLEFDxigxd  266
DSSP  lLLLL-HHHHhHHHHhllllhhhEEELLL---HHHLllhhhHHHHHhhllEEEELlllll


DSSP  -----------------------------------LLLLLH--------HHHLLE-----
Query -----------------------------------SDFHEL--------WHVYSW-----  194
ident                                     |                       
Sbjct ffyadqgvqcpsddevarailgladhgyldrillsHDVFVKxxltryggNGYAFVtkhfl  326
DSSP  leelllleelllhhhhhhhhhhhhhlllhhheeelLLLLLHhhlhhhllLLLLHHhhlhh


DSSP  --------------eeEEEElllhHHHHHHhhhllleeeeelll
Query --------------ktLVKSekniEAIKEAirkntdvaiylxrk  224
ident                  |           |              
Sbjct prlrrhglddaaletlXVTN---pRRVFDA---------siegh  358
DSSP  hhhhhllllhhhhhhhHLHH---hHHHHLL---------lllll


No 43: Query=2anuA Sbjct=3pnuA Z-score=5.0

back to top
DSSP  ----------LEEEEEEEEELLLllllllLHHHHHHHHHHlLLLEEEEEEEeelhhhhhh
Query ----------TEWLLCDFHVHTNxsdghlPLGEVVDLFGKhGVDVVSITDHivdrrtleq   50
ident                 | | |         |     |          |            
Sbjct enlyfqsnamKLKNPLDMHLHLR---dnqMLELIAPLSAR-DFCAAVIMPN---------   47
DSSP  llllllllleEEELLEEEEELLL---lhhHHHHHHHHHHL-LLLEEEELLL---------


DSSP  hhhllllLLLLLlllHHHHHHHHHHHHHHHHHHHLLEEEEEE------------------
Query rkrngepLGAITedkFQDYLKRLWREQKRAWEEYGXILIPGV------------------   92
ident                    ||        |                              
Sbjct ------lIPPLC---NLEDLKAYKMRILKACKDENFTPLMTLffknydekflysakdeif   98
DSSP  ------lLLLLL---LHHHHHHHHHHHHHHHLLLLLEEEEEEelllllhhhhhhhlllll


DSSP  --EEEELLlleeeeeellllllLLLL--------LHHHHHHHHHhllLEEEEL-----ll
Query --EITNNTdlyhivavdvkeyvDPSL--------PVEEIVEKLKeqnALVIAA-----hp  137
ident                                   |  |    |                 
Sbjct giXLYPAG--------ittnsnGGVSsfdieylkPTLEAMSDLN---IPLLVHgetndfv  147
DSSP  eeEELLLL--------llllllLLLLlllhhhhhHHHHHHHHLL---LLEEELllllllh


DSSP  llllLLLH-HHHL-LLLLLLLLLE-------------------EEEEELLEE--------
Query drkkLSWY-LWAN-XERFKDTFDA-------------------WEIANRDDL--------  168
ident                  |                                 |        
Sbjct mdreSNFAkIYEKlAKHFPRLKIVmehittktlcellkdyenlYATITLHHLiitlddvi  207
DSSP  hhllHHHHhHHHHhHHHLLLLLEEelllllhhhhhhhhhllleEEEELLHHHlllhhhhh


DSSP  ----------------------LHHH-hhlllLEEEELLLLLH--------HHHL-----
Query ----------------------FNSV-gvkkyRYVANSDFHEL--------WHVY-----  192
ident                                      ||                     
Sbjct ggkmnphlfckpiakryedkeaLCELafsgyeKVMFGSDSAPHpkgcaagvFSAPvilpv  267
DSSP  lllllhhhllllllllhhhhhhHHHHhhllllLEEELLLLLLLllllllllLLHHhhhhh


DSSP  --------------leeEEEEelllhhhhhHHHHH-------------------------
Query --------------swkTLVKseknieaikEAIRK-------------------------  213
ident                                 |                           
Sbjct laelfkqnsseenlqkfLSDN--------tCKIYDlkfkedkiltleekewqvpnvyedk  319
DSSP  hhhhhhhhllhhhhhhhHLHH--------hHHHHLllllllleeeeellleelllleell


DSSP  --------llleeeeelll
Query --------ntdvaiylxrk  224
ident                    
Sbjct ynqvvpymageilkfqlkh  338
DSSP  lleellllllleelleell


No 44: Query=2anuA Sbjct=1a5kC Z-score=4.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ----lEEEEEEEEELLLlllllllHHHHHHHHHHLLLLEEEEEEeeelhhhhhhhhhlll
Query ----tEWLLCDFHVHTNxsdghlpLGEVVDLFGKHGVDVVSITDhivdrrtleqrkrnge   56
ident           | | |                    ||                       
Sbjct egkivTAGGIDTHIHWI-------CPQQAEEALVSGVTTMVGGG----------------  157
DSSP  llleeEELEEEEEEELL-------LLLHHHHHHHHLEEEEEEEL----------------


DSSP  llLLLL-----lllHHHHHHHHHHHHHHHhhhhLLEEEEEE-------------------
Query plGAIT-----edkFQDYLKRLWREQKRAweeyGXILIPGV-------------------   92
ident    |             |  |                                       
Sbjct tgPAAGthattctpGPWYISRMLQAADSL----PVNIGLLGkgnvsqpdalreqvaagvi  213
DSSP  llLLHHhhhlllllHHHHHHHHHHHHLLL----LLEEEEEEelllllhhhhhhhhhhlll


DSSP  --EEEELLLLeeeeeelllllllllLLHHHHHHHHHHLLLEEEELllllllLLLH-hHHL
Query --EITNNTDLyhivavdvkeyvdpsLPVEEIVEKLKEQNALVIAAhpdrkkLSWY-lWAN  149
ident   ||                                |    |         |        
Sbjct glEIHEDWGA-------------tpAAIDCALTVADEMDIQVALH---sdtLNESgfVED  257
DSSP  eeEEEHHHLL-------------lhHHHHHHHHHHHHHLLEEEEE---lllLLLLllHHH


DSSP  LLL-LLLLLLEEE------------------------EEELLEE----------------
Query XER-FKDTFDAWE------------------------IANRDDL----------------  168
ident                                            |                
Sbjct TLAaIGGRTIHTFhtegaggghapdiitacahpnilpSSTNPTLpytlntidehldmlmv  317
DSSP  HHHhHLLLLEEELllllllllllllhhhhhhllleeeEEEHHHLlllllhhhhhhhhhhh


DSSP  --------------------------lhhhHHLLllEEEELLLLLhhHHLLE--------
Query --------------------------fnsvGVKKyrYVANSDFHElwHVYSW--------  194
ident                                         ||      |           
Sbjct chhldpdiaedvafaesrirretiaaedvlHDLGafSLTSSDSQAmgRVGEVilrtwqva  377
DSSP  hhllllllhhhhhlllllllhhhhhhhhhhHHLLllLEEELLLLLllLLLLHhhhhhhhh


DSSP  ---------------------------EEEE--eelllHHHH------------------
Query ---------------------------KTLV--kseknIEAI------------------  207
ident                            |          |                     
Sbjct hrmkvqrgalaeetgdndnfrvkryiaKYTInpalthgIAHEvgsievgkladlvvwspa  437
DSSP  hhhhhhhlllllllllllhhhhhhhhhLLLHhhhhhllLLLLllllllllllleeeelhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  207
ident                                                             
Sbjct ffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaa  497
DSSP  hlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhh


DSSP  -----------------hhhhHHLLLE---------------------------------
Query -----------------keaiRKNTDV---------------------------------  217
ident                          |                                  
Sbjct ngvaerlnlrsaiavvkgcrtVQKADMvhnslqpnitvdaqtyevrvdgelitsepadvl  557
DSSP  hlhhhhllllleeeellllllLLHHHLlllllllleeelllllleeelleelllllllll


DSSP  --eeeelll
Query --aiylxrk  224
ident          
Sbjct pmaqryflf  566
DSSP  lllllllll


No 45: Query=2anuA Sbjct=1bksA Z-score=4.8

back to top
DSSP  -------------LEEEEEEeeELLLLlllllLHHHHHHHHHHLLLlEEEEEEEeelhhh
Query -------------TEWLLCDfhVHTNXsdghlPLGEVVDLFGKHGVdVVSITDHivdrrt   47
ident                         |             |     |               
Sbjct meryenlfaqlndRREGAFV-pFVTLGdpgieQSLKIIDTLIDAGA-DALELGV------   52
DSSP  lhhhhhhhhhhhhLLLLEEE-eEEELLlllhhHHHHHHHHHHHLLL-LLEEEEL------


DSSP  hhhhhhllllllLLLL-------------------lLHHHHHHHHHHHHHHHHhhhlLEE
Query leqrkrngeplgAITE-------------------dKFQDYLKRLWREQKRAWeeygXIL   88
ident                                             |             | 
Sbjct ------------PFSDpladgptiqnanlrafaagvTPAQCFEMLALIREKHP----TIP   96
DSSP  ------------LLLLlllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL----LLL


DSSP  EeEEEEEEL-----------llleeeeeellllllllllLHHHHHHHHHHLLLEEEELLL
Query IpGVEITNN-----------tdlyhivavdvkeyvdpslPVEEIVEKLKEQNALVIAAHP  137
ident | |     |                                          |   |   |
Sbjct I-GLLMYANlvfnngidafyarceqvgvdsvlvadvpveESAPFRQAALRHNIAPIFICP  155
DSSP  E-EEEELHHhhhlllhhhhhhhhhhhllleeeellllhhHLHHHHHHHHHLLLEEEEEEL


DSSP  lllllllhhhHLLLLLLLLLL-EEEEEelleeLHHHHHLLL-----LEEE----------
Query drkklswylwANXERFKDTFD-AWEIAnrddlFNSVGVKKY-----RYVA----------  181
ident                                       |                     
Sbjct -----pnaddDLLRQVASYGRgYTYLL--alpLHHLIEKLKeyhaaPALQgfgisspeqv  208
DSSP  -----llllhHHHHHHHHHLLlLEEEL--lllHHHHHHHHHhhlllLEEEllllllhhhh


DSSP  -----------ELLL-LLHHhhlleeeeeeelllhhhhhhhhhhllleeeeELLL---
Query -----------NSDF-HELWhvyswktlvkseknieaikeairkntdvaiyLXRK---  224
ident             |                                             
Sbjct saavragaagaISGSaIVKI-----------ieknlaspkqmlaelrsfvsAMKAasr  255
DSSP  hhhhhhllleeEELLhHHHH-----------hhhllllhhhhhhhhhhhhhHHHHlll


No 46: Query=2anuA Sbjct=3mtwA Z-score=4.7

back to top
DSSP  -------------------------------------------------------lEEEE
Query -------------------------------------------------------tEWLL    5
ident                                                            |
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEEL-LLLL----------llllLHHHHHHHHHHLL---LLEEEEEEeeelhhhhhhh
Query CDFHVH-TNXS----------dghlPLGEVVDLFGKHG---VDVVSITDhivdrrtleqr   51
ident  | |||                             |        |               
Sbjct IDMHVHlDSLAevggynsleysdrfWSVVQTANAKKTLeagFTTVRNVG-----------  109
DSSP  EEEEELlLLLLlllhhhhhhllhhhHHHHHHHHHHHHHhllEEEEEELL-----------


DSSP  hhllllllllllllhhhHHHHHHHHHHHHHH--HHLLEEEEE-EEEEELLL---------
Query krngeplgaitedkfqdYLKRLWREQKRAWE--EYGXILIPG-VEITNNTD---------   99
ident                                    |                        
Sbjct ----------------aADYDDVGLREAIDAgyVPGPRIVTAaISFGATGGhcdstffpp  153
DSSP  ----------------lLLLHHHHHHHHHHLllLLLLEEEELlLLEELLLLllllllllh


DSSP  -------leeeeeelllLLLL------------------------------llLLHHHHH
Query -------lyhivavdvkEYVD------------------------------psLPVEEIV  122
ident                    |                                       |
Sbjct smdqknpfnsdspdearKAVRtlkkygaqvixicatggvfsrgnepgqqqltyEEMKAVV  213
DSSP  hhllllllllllhhhhhHHHHhhhhlllleeeeellllllllllllllllllhHHHHHHH


DSSP  HHHHHLLLEEEELLLlllllLLHHHHLlllLLLLLLEE--------------------EE
Query EKLKEQNALVIAAHPdrkklSWYLWANxerFKDTFDAW--------------------EI  162
ident          | |                       |                        
Sbjct DEAHMAGIKVAAHAH-----GASGIRE--aVRAGVDTIehaslvddegiklavqkgayFS  266
DSSP  HHHHHLLLEEEEEEL-----LHHHHHH--hHHLLLLEEeelllllhhhhhhhhhhlleEE


DSSP  EE------------------------------lleeLHHHHHLLLLEEEELLLLLHH--H
Query AN------------------------------rddlFNSVGVKKYRYVANSDFHELW--H  190
ident                                     |          |   |        
Sbjct MDiyntdytqaegkkngvlednlrkdrdigelqrenFRKALKAGVKMVYGTDAGIYPhgD  326
DSSP  LLlllhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhHHHHHHHLLEEELLLLLLLLLllL


DSSP  HLLE-----------------EEEEeelllhhhHHHH-----------------hhhlll
Query VYSW-----------------KTLVkseknieaIKEA-----------------irkntd  216
ident                       ||                                    
Sbjct NAKQfavmvrygatplqaiqsATLT----aaeaLGRSkdvgqvavgrygdmiavagdpla  382
DSSP  HHHHhhhhhhllllhhhhhhhLLHH----hhhhHLLLllllllllllllleeeellllll


DSSP  eeeeELLL--------------
Query vaiyLXRK--------------  224
ident     |                 
Sbjct dvttLEKPvfvmkggavvkapx  404
DSSP  lhhhHHLLleeeelleeeelll


No 47: Query=2anuA Sbjct=3irsA Z-score=4.7

back to top
DSSP  leEEEEEEEELLLL----------------------------llllLLHHHHHHHHHHLL
Query teWLLCDFHVHTNX----------------------------sdghLPLGEVVDLFGKHG   32
ident       ||                                        |          |
Sbjct --LKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAG   58
DSSP  --LLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLL


DSSP  LLEEEEEEEEELHhhhhhhhhllllLLLLlllLHHHHHHHHHHHHHhhhhhhllEEEEE-
Query VDVVSITDHIVDRrtleqrkrngepLGAItedKFQDYLKRLWREQKraweeygxILIPG-   91
ident                          ||        |                     |  
Sbjct IEQGVCVGRNSSV------------LGSV---SNADVAAVAKAYPD--------KFHPVg   95
DSSP  LLEEEEELLEELL------------LEEL---LHHHHHHHHHHLLL--------LEEEEe


DSSP  ------eeeeelllleeeeeelllllLLLL-----------llhhhhhhhhhHLLLE---
Query ------veitnntdlyhivavdvkeyVDPS-----------lpveeiveklkEQNAL---  131
ident                             |                               
Sbjct sieaatrkeamaqmqeildlgirivnLEPGvwatpmhvddrrlyplyafcedNGIPVimm  155
DSSP  elllllhhhhhhhhhhhhhllllleeELHHhlllllllllhhhhhhhhhhhhLLLLEeee


DSSP  ----------------------------EEELLlllllllLHHHHLLLLLL--LLLLEEE
Query ----------------------------VIAAHpdrkklsWYLWANXERFK--DTFDAWE  161
ident                             |   |       |                   
Sbjct tggnagpditytnpehidrvlgdfpdltVVSSH-----gnWPWVQEIIHVAfrRPNLYLS  210
DSSP  llllllllhhhhlhhhhhhhhhhlllllEEEEH-----hhLLLHHHHHHHHhhLLLEEEE


DSSP  eeELLEE-------LHHHHHLLL--LEEEELLLLLhhHHLL----------------eeE
Query iaNRDDL-------FNSVGVKKY--RYVANSDFHElwHVYS----------------wkT  196
ident               |          |                                  
Sbjct -pDMYLYnlpghadFIQAANSFLadRMLFGTAYPM-cPLKEytewfltlpikpdamekiL  268
DSSP  -lHHHHLllllhhhHHHHHLLHHhhLLLLLLLLLL-lLHHHhhhhhhlllllhhhhhhhH


DSSP  EEEelllhhHHHHhhhhllleeeeelll
Query LVKseknieAIKEairkntdvaiylxrk  224
ident                             
Sbjct HGN----aeRLLA-----------qagr  281
DSSP  LHH----hhHHHH-----------hlll


No 48: Query=2anuA Sbjct=2gwgA Z-score=4.6

back to top
DSSP  leeEEEEEEELLllllLLLL--------------------------------hHHHHH-H
Query tewLLCDFHVHTnxsdGHLP--------------------------------lGEVVD-L   27
ident       | | |        |                                        
Sbjct ---XIIDIHGHY----TTAPkaledwrnrqiagikdpsvxpkvselkisddelQASIIeN   53
DSSP  ---LLEEEEEEL----LLLLhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhHHHHHlL


DSSP  HHHLL----LLEEEEEE-EEELhhhhhhhhhllllllllLLLLHHHHHHHHHHHHHHHHh
Query FGKHG----VDVVSITD-HIVDrrtleqrkrngeplgaiTEDKFQDYLKRLWREQKRAWe   82
ident   |       |                                         |       
Sbjct QLKKXqergSDLTVFSPrAGDF---------------nvSSTWAAICNELCYRVSQLFP-   97
DSSP  HHHHHhhhlLLEEEEELlLLLH---------------hhHHHHHHHHHHHHHHHHHHLL-


DSSP  hhlLEEEEEE-----------------------------EEEELLlleeeeeelllllll
Query eygXILIPGV-----------------------------EITNNTdlyhivavdvkeyvd  113
ident       |                                                     
Sbjct ---DNFIGAAxlpqspgvdpktcipelekcvkeygfvaiNLNPDP-----sgghwtsppl  149
DSSP  ---LLEEEEEellllllllhhhhhhhhhhhhhllllleeEELLLL-----llllllllll


DSSP  lllLHHHHHHHHHHLLLEEEellllLLLL----lLHHHHLLL------------------
Query pslPVEEIVEKLKEQNALVIaahpdRKKL----sWYLWANXE------------------  151
ident        | ||  |                                              
Sbjct tdrIWYPIYEKXVELEIPAX-ihvsTGAHylnadTTAFXQCVagdlfkdfpelkfviphg  208
DSSP  llhHHHHHHHHHHHHLLLEE-elllLLLHhhhhhHHHHHHHHhllhhhhllllleeelhh


DSSP  -------------------------LLLLLLlEEEEeELLE--ELHHHHHLLL--LEEEE
Query -------------------------RFKDTFdAWEIaNRDD--LFNSVGVKKY--RYVAN  182
ident                                                             
Sbjct ggavpyhwgrfrglaqexkkplledHVLNNI-FFDT-CVYHqpGIDLLNTVIPvdNVLFA  266
DSSP  hlllhhhhhhhhhhhhhlllllhhhHLLLLE-EEEL-LLLLhhHHHHHHHHLLhhHEELL


DSSP  LLL-LLHH--------hhLLEE----------------EEEE----elllHHHHhhhhhh
Query SDF-HELW--------hvYSWK----------------TLVK----seknIEAIkeairk  213
ident |                    |                              |       
Sbjct SEXiGAVRgidprtgfyyDDTKryieastiltpeekqqIYEGnarrvyprLDAA------  320
DSSP  LLLlLLLLleelllleelLLLHhhhhhlllllhhhhhhHHLHhhhhhlhhHHHH------


DSSP  llleeeeelll
Query ntdvaiylxrk  224
ident            
Sbjct --lkakgkleh  329
DSSP  --hhhhhhhll


No 49: Query=2anuA Sbjct=3icjA Z-score=4.4

back to top
DSSP  ---------------------------------------------------------LEE
Query ---------------------------------------------------------TEW    3
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfVMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleEEE


DSSP  EEEEEEELlllllLLLL-------------------------------------------
Query LLCDFHVHtnxsdGHLP-------------------------------------------   20
ident    | | |                                                    
Sbjct AFFDSHLH---ldELGMslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwpt  117
DSSP  LEEEEEEL---hhHHHHhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   20
ident                                                             
Sbjct redldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiine  177
DSSP  hhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhh


DSSP  --------hhhHHHHHHHLL---LLEEEEEEeeelhhhhhhhhhllllllllllllhhhH
Query --------lgeVVDLFGKHG---VDVVSITDhivdrrtleqrkrngeplgaitedkfqdY   69
ident                        |  |                                 
Sbjct kiltvkdykhyIESAQEHLLslgVHSVGFMS---------------------------vG  210
DSSP  llllhhhhhhhHHHHHHHHHhllEEEEEEEE---------------------------eL


DSSP  HHHHHHHHHH-hhHHHLLEEEEEE--------------------------EEEEL-----
Query LKRLWREQKR-awEEYGXILIPGV--------------------------EITNN-----   97
ident  | |                                                        
Sbjct EKALKALFELereGRLKMNVFAYLspelldkleelnlgkfegrrlriwgvXLFVDgslga  270
DSSP  HHHHHHHHHHhhlLLLLLEEEEEElhhhhhhhhhhlllleellleeeeeeEEELLlllll


DSSP  ----llleeeeeellllllLLLL-LHHHHHHHHH-HLLLE--------------------
Query ----tdlyhivavdvkeyvDPSL-PVEEIVEKLK-EQNAL--------------------  131
ident                            |  |  |                          
Sbjct rtallsepytdnpttsgelVMNKdEIVEVIERAKpLGLDVavhaigdkavdvaldafeea  330
DSSP  lllllllllllllllllllLLLHhHHHHHHHHHLlLLLEEeeeellhhhhhhhhhhhhhh


DSSP  ---EEELLLLllllllhhhHLLLLLLLLLLEEEeEELLE--------------------e
Query ---VIAAHPDrkklswylwANXERFKDTFDAWEiANRDD--------------------l  168
ident        |              || |        |                         
Sbjct efsGRIEHAS-----lvrdDQLERIKELKVRIS-AQPHFivsdwwivnrvgeerakwayr  384
DSSP  lllLEEEELL-----lllhHHHHHHHHHLLEEE-ELLLHhhhlllhhhhhhhhhhhhlll


DSSP  LHHHHhLLLLEEEELLLLLhHHHLL-------------------------eEEEE--eel
Query FNSVGvKKYRYVANSDFHElWHVYS-------------------------wKTLV--kse  201
ident                |                                            
Sbjct LKTLS-SITKLGFSTDSPI-EPADPwvsidaavnryvvdpgervsreealhLYTHgsaqv  442
DSSP  HHHHH-HHLLEEELLLLLL-LLLLHhhhhhhhhhlllllhhhlllhhhhhhHLLHhhhhh


DSSP  llHHHH---hhhhhhllleeeeelll
Query knIEAI---keairkntdvaiylxrk  224
ident    |                      
Sbjct tlAEDLgklergfraeyiildrdplk  468
DSSP  llLLLLlllllllllleeeellllll


No 50: Query=2anuA Sbjct=4c5yA Z-score=4.4

back to top
DSSP  ----------------------------------------------------------le
Query ----------------------------------------------------------te    2
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  EEEEEEEE-LLLL------------lllllLHHHHHHHHHHLL---LLEEEEEEeeelhh
Query WLLCDFHV-HTNX------------sdghlPLGEVVDLFGKHG---VDVVSITDhivdrr   46
ident   | | |                                                     
Sbjct PGLWDCHMhFGGDddyyndytsglathpasSGARLARGCWEALqngYTSYRDLA------  114
DSSP  ELEEEEEElLLLLlllllllhhhhhllhhhHHHHHHHHHHHHHhllEEEEEELL------


DSSP  hhhhhhhllllllllllllhhhhhhHHHHHHHHH--hHHHLLEEEEE-EEEEELLLL---
Query tleqrkrngeplgaitedkfqdylkRLWREQKRA--wEEYGXILIPG-VEITNNTDL---  100
ident                                |        |                   
Sbjct ------------------------gYGCEVAKAIndgTIVGPNVYSSgAALSQTAGHgdi  150
DSSP  ------------------------lLHHHHHHHHhllLLLLLEEEELlLEEELLLLLlll


DSSP  -----------------------------------eeeeeelLLLL--------------
Query -----------------------------------yhivavdVKEY--------------  111
ident                                                             
Sbjct falpagevlgsygvmnprpgywgagplciadgveevrravrlQIRRgakvixvmasggvm  210
DSSP  llllhhhhhhhhlllllllllllllleeelllhhhhhhhhhhHHHHlllleeeellllll


DSSP  ---------llllLLHHHHHHHHHHLLLEEEELLllllllllhhHHLLLLLLL-LLLEEE
Query ---------vdpsLPVEEIVEKLKEQNALVIAAHpdrkklswylWANXERFKD-TFDAWE  161
ident                   |||    ||  | |             |             |
Sbjct srddnpnfaqfspEELKVIVEEAARQNRIVSAHV--------hgKAGIMAAIKaGCKSLE  262
DSSP  llllllllllllhHHHHHHHHHHHHLLLLEEEEE--------llHHHHHHHHHhLLLEEE


DSSP  EeelleELHH-hHHLLL-----LEEE----------------------------------
Query IanrddLFNS-vGVKKY-----RYVA----------------------------------  181
ident                        |||                                  
Sbjct H----vSYADeeVWELMkekgiLYVAtrsvieiflasngeglvkeswaklqaladshlka  318
DSSP  E----lLLLLhhHHHHHhhhllEEELlhhhhhhhhhhllllllllhhhlllhhhhhhhhh


DSSP  -------------ELLLLlhHHHLLE----------------eeEEEE-----lllHHHH
Query -------------NSDFHelWHVYSW----------------ktLVKS-----eknIEAI  207
ident                |                                            
Sbjct yqgaikagvtialGTDTApgGPTALElqfaverggmtpleaikaATANaplsvgpqAPLT  378
DSSP  hhhhhhlllleelLLLLLllLLLHHHhhhhhhlllllhhhhhhhHLLLhhhhhhhhLLLL


DSSP  -----------------------------------------hhhhhhllleeeeelll
Query -----------------------------------------keairkntdvaiylxrk  224
ident                                                           
Sbjct gqlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 51: Query=2anuA Sbjct=3iacA Z-score=4.3

back to top
DSSP  -----------------------leEEEEEEEELLlllllllLHHHH-------------
Query -----------------------teWLLCDFHVHTnxsdghlPLGEV-------------   24
ident                              ||| |           |              
Sbjct atfxtedfllkndiartlyhkyaapXPIYDFHCHL-------SPQEIaddrrfdnlgqiw   53
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLL-------LHHHHhhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   24
ident                                                             
Sbjct legdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfg  113
DSSP  hllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllll


DSSP  -----------------------------HHHHHHLLLLEEEEEEEEelhhhhhhhhhll
Query -----------------------------VDLFGKHGVDVVSITDHIvdrrtleqrkrng   55
ident                                      |  |  ||               
Sbjct itgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTDDP-------------  160
DSSP  lllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLLLL-------------


DSSP  llllllllllHHHHhHHHHHHHHHhhHHHLLEEEEEEEEEElllleeeeeellllllLLL
Query eplgaitedkFQDYlKRLWREQKRawEEYGXILIPGVEITNntdlyhivavdvkeyvDPS  115
ident                                   |                         
Sbjct ----------IDSL-EYHRQIAAD--DSIDIEVAPSWRPDK----------------VFK  191
DSSP  ----------LLLL-HHHHHHHHL--LLLLLEEELLLLLHH----------------HHL


DSSP  L-----------------------------------------------------------
Query L-----------------------------------------------------------  116
ident                                                             
Sbjct Ieldgfvdylrkleaaadvsitrfddlrqaltrrldhfaacgcrasdhgietlrfapvpd  251
DSSP  Lllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhhlllleeeeeellllllllll


DSSP  ----------------------------LHHHHHHHHHHLLLEEEELLL-----------
Query ----------------------------PVEEIVEKLKEQNALVIAAHP-----------  137
ident                                                             
Sbjct daqldailgkrlagetlseleiaqfttaVLVWLGRQYAARGWVXQLHIGairnnntrxfr  311
DSSP  hhhhhhhhhhhhllllllhhhhhhhhhhHHHHHHHHHHHHLLEEEEEELeellllhhhhh


DSSP  -------llLLLLlhhhhLLLLLLL--------llLEEE---------------------
Query -------drKKLSwylwaNXERFKD--------tfDAWE---------------------  161
ident                      |  |                                   
Sbjct llgpdtgfdSIGDnniswALSRLLDsxdvtnelpkTILYclnprdnevlatxignfqgpg  371
DSSP  hhlllllllEELLlllhhHHHHHHHhhhlllllleEEEEellhhhhhhhhhhhhhlllll


DSSP  --------EEELLEE----LHHHHHLL-------lleEEELLLLLHHHHLLE--------
Query --------IANRDDL----FNSVGVKK-------yryVANSDFHELWHVYSW--------  194
ident                                          |                  
Sbjct iagkvqfgSGWWFNDqkdgXLRQLEQLsqxgllsqfvGXLTDSRSFLSYTRHeyfrrilc  431
DSSP  lllleeelLLLHHHLlhhhHHHHHHHHhhhllhhhllLLLLLLLLLLLLHHHhhhhhhhh


DSSP  ------------------------eeEEEElllhhHHHHhhhhllleeeeelll
Query ------------------------ktLVKSeknieAIKEairkntdvaiylxrk  224
ident                                                       
Sbjct nllgqwaqdgeipddeaxlsrxvqdiCFNN---aqRYFT-------------ik  469
DSSP  hhhhhhhhlllllllhhhhhhhhhhhHLHH---hhHHLL-------------ll


No 52: Query=2anuA Sbjct=1j5sA Z-score=4.3

back to top
DSSP  ----------------------leeeEEEEEELLlllllllLHHHH--------------
Query ----------------------tewlLCDFHVHTnxsdghlPLGEV--------------   24
ident                             | | |                           
Sbjct hmflgedylltnraavrlfnevkdlpIVDPHNHL-------DAKDIvenkpwndiweveg   53
DSSP  llllllllllllhhhhhhhhhhllllEEELLLLL-------LHHHHhhllllllhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   24
ident                                                             
Sbjct atdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnik  113
DSSP  lllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllll


DSSP  ------------------------hhHHHHLLLLEEEEEEEEelhhhhhhhhhlllllll
Query ------------------------vdLFGKHGVDVVSITDHIvdrrtleqrkrngeplga   60
ident                           |     |     ||                    
Sbjct kviseetaeeiweetkkklpemtpqkLLRDMKVEILCTTDDP------------------  155
DSSP  llllhhhhhhhhhhhhhhlllllhhhHHHHLLEEEEELLLLL------------------


DSSP  lllllHHHHhHHHHHHHHHHHhhhLLEEEEEEEEE--ELLL-------------------
Query itedkFQDYlKRLWREQKRAWeeyGXILIPGVEIT--NNTD-------------------   99
ident                         |    |        | |                   
Sbjct -----VSTL-EHHRKAKEAVE---GVTILPTWRPDraMNVDkegwreyvekmgerygedt  206
DSSP  -----LLLL-HHHHHHHHHLL---LLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllll


DSSP  -leeeeeelllLLLL---------------------------------------------
Query -lyhivavdvkEYVD---------------------------------------------  113
ident                                                             
Sbjct stldgflnalwKSHEhfkehgcvasdhallepsvyyvdenraravhekafsgekltqdei  266
DSSP  llhhhhhhhhhHHHHhhhllllleeeeeelllllllllhhhhhhhhhhhlllllllhhhh


DSSP  ---llLLHHHHHHHHHHLLLEEEELLLlLLLL--------------------llhhhHLL
Query ---psLPVEEIVEKLKEQNALVIAAHPdRKKL--------------------swylwANX  150
ident                 | |                                         
Sbjct ndykaFMMVQFGKMNQETNWVTQLHIG-ALRDyrdslfktlgpdsggdistnflriaEGL  325
DSSP  hhhhhHHHHHHHHHHHHHLLEEEEEEL-EELLllhhhhhhlllllllleelllllhhHHH


DSSP  LLLLL-----lLLEEEEeelleELHHHHHLL-----LLEEE-------------------
Query ERFKD-----tFDAWEIanrddLFNSVGVKK-----YRYVA-------------------  181
ident   |                                     |                   
Sbjct RYFLNefdgklKIVLYV-ldptHLPTISTIArafpnVYVGApwwfndspfgmemhlkyla  384
DSSP  HHHHHhlllllLEEEEE-llhhHHHHHHHHHhhlllEEELLlllllllhhhhhhhhhhhh


DSSP  -----------ELLLLLHHHHL-------------------------------leeeEEE
Query -----------NSDFHELWHVY-------------------------------swktLVK  199
ident              |   |                                          
Sbjct svdllynlagmVTDSRKLLSFGsrtemfrrvlsnvvgemvekgqipikearelvkhvSYD  444
DSSP  llllhhhllllLLLLLLLLHHHhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhHLH


DSSP  ElllhhHHHHhhhhllleeeeelll
Query SeknieAIKEairkntdvaiylxrk  224
ident       |                  
Sbjct G---pkALFF---------------  451
DSSP  H---hhHHHL---------------


No 53: Query=2anuA Sbjct=3giqA Z-score=4.1

back to top
DSSP  -----------------------------------------------------lEEEEEE
Query -----------------------------------------------------tEWLLCD    7
ident                                                            |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  EEELLlllllllLHHHhhhhhHHLL----LLEEEEEEEEelhhhhhhhhHLLLLLLL--l
Query FHVHTnxsdghlPLGEvvdlfGKHG----VDVVSITDHIvdrrtleqrkRNGEPLGA--i   61
ident  | |                            |                           
Sbjct VHGHD------dLMFV-ekpdLRWKtsqgITTVVVGNCG--vsaapaplPGNTAAALall  111
DSSP  LLLLL------lLHHH-hlllLHHHhlllEEEEEELLLL--llllllllLLLLLHHHhhh


DSSP  llllhHHHHHHHHHHH-HHHHhhhLLEEEEEE----------------------------
Query tedkfQDYLKRLWREQ-KRAWeeyGXILIPGV----------------------------   92
ident                                |                            
Sbjct getplFADVPAYFAALdAQRP---MINVAALVghanlrlaamrdpqaaptaaeqqamqdm  168
DSSP  lllllLLLHHHHHHHHhHLLL---LLEEEEEEehhhhhhhhlllllllllhhhhhhhhhh


DSSP  ------------EEEELllleeeeeellllllllLLLHHHHHHHHHHLLLE---------
Query ------------EITNNtdlyhivavdvkeyvdpSLPVEEIVEKLKEQNAL---------  131
ident                                       |       |   |         
Sbjct lqaaleagavgfSTGLA---------yqpgavaqAAELEGLARVAAERRRLhtshirnea  219
DSSP  hhhhhhhllleeEEELL---------lllhhhllHHHHHHHHHHHHHLLLEeeeelllll


DSSP  --------------------EEELLLlLLLL------llhhHHLLLLLL--LLLLEEEeE
Query --------------------VIAAHPdRKKL------swylWANXERFK--DTFDAWEiA  163
ident                         |                 ||  |        |    
Sbjct dgveaaveevlaigrgtgcaTVVSHH-KCMMpqnwgrsratLANIDRAReqGVEVALD-I  277
DSSP  llhhhhhhhhhhhhhhhlleEEELLL-LLLLhhhlllhhhhHHHHHHHHhlLLLEEEE-E


DSSP  ELLE--------------------------------------------------------
Query NRDD--------------------------------------------------------  167
ident                                                             
Sbjct YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapaga  337
DSSP  LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleee


DSSP  ---------ELHHHHhlLLLEEEELLLL-----LHHH-HLLE------------------
Query ---------LFNSVGvkKYRYVANSDFH-----ELWH-VYSW------------------  194
ident                         ||              |                   
Sbjct iyfamdedeVKRIFQ--HPCCMVGSDGLpndarPHPRlWGSFtrvlgryvrearlmtleq  395
DSSP  eeelllhhhHHHHHH--LLLEEELLLLLlllllLLLHhHHHHhhhhhhhhhhlllllhhh


DSSP  ---eEEEE-------ELLL-hhhhhhhhhhllleeeeELLL-------------------
Query ---kTLVK-------SEKN-ieaikeairkntdvaiyLXRK-------------------  224
ident                 |                      |                    
Sbjct avarMTALparvfgfAERGvlqpgawadvvvfdpdtvADRAtwdeptlasvgiagvlvng  455
DSSP  hhhhHLHHhhhhhllLLLLllllllllleeeelllllLLLLllllllllllleeeeeell


DSSP  --------------------
Query --------------------  224
ident                     
Sbjct aevfpqppadgrpgqvlrax  475
DSSP  eeeellllllllllllllll


No 54: Query=2anuA Sbjct=2a3lA Z-score=3.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------------------leEEEEE-EEELL--------
Query ---------------------------------------teWLLCD-FHVHT--------   12
ident                                              |    |         
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDtHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEeEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   12
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  -----------------------lllllllLHHHHHHHHHHLLLLEEEEEEEEELHHhhh
Query -----------------------nxsdghlPLGEVVDLFGKHGVDVVSITDHIVDRRtle   49
ident                                   |                 |  |    
Sbjct nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRISIYGRK---  297
DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEELLLLL---


DSSP  hhhhllllllllLLLLHHHHHHhhHHHHhhhhhhhlLEEEEEEEEEELLL----------
Query qrkrngeplgaiTEDKFQDYLKrlWREQkraweeygXILIPGVEITNNTD----------   99
ident               |                                             
Sbjct ----------msEWDQLASWIVnnDLYS--------ENVVWLIQLPRLYNiykdmgivts  339
DSSP  ----------llHHHHHHHHHHllLLLL--------LLEEEEEEEELLHHhhllllllll


DSSP  ---------------------------------------------------leeeeeell
Query ---------------------------------------------------lyhivavdv  108
ident                                                             
Sbjct fqnildnifiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtn  399
DSSP  lhhhhhhhllhhhhhhhlhhhllllhhhhlleeeeeeellllllllllllllllllllll


DSSP  llllllllLHHHHHHHHHHL----------LLEEEELLllllllllhhHHLLLLLLLLLL
Query keyvdpslPVEEIVEKLKEQ----------NALVIAAHpdrkklswylWANXERFKDTFD  158
ident          |      |                                        |  
Sbjct afnpafsyYVYYCYANLYVLnklreskgmtTITLRPHS-----geagdIDHLAATFLTCH  454
DSSP  lllllhhhHHHHHHHHHHHHhhhhllllllLLEELLLL-----lllllLHHHHHHHHHLL


DSSP  EEEEeelleELHH----hHHLL----LLEEE-----------------------------
Query AWEIanrddLFNS----vGVKK----YRYVA-----------------------------  181
ident                                                             
Sbjct SIAH----gINLRkspvlQYLYylaqIGLAMsplsnnslfldyhrnpfpvfflrglnvsl  510
DSSP  LLLL----lHHHHhlhhhHHHHhhhlLLEEElhhhhlllllllllllhhhhhhlllleee


DSSP  ELLLLL-----HHHHL---------------leeeEEEE---llLHHH------------
Query NSDFHE-----LWHVY---------------swktLVKS---ekNIEA------------  206
ident   |                                                         
Sbjct STDDPLqihltKEPLVeeysiaasvwklsacdlceIARNsvyqsGFSHalkshwigkdyy  570
DSSP  LLLLHHhhlllLLHHHhhhhhhhhhhlllhhhhhhHHHHhhhhlLLLHhhhhhhllllll


DSSP  ----------------------------hhhhhhhllleeeeelll
Query ----------------------------ikeairkntdvaiylxrk  224
ident                                               
Sbjct krgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 55: Query=2anuA Sbjct=4dziC Z-score=3.7

back to top
DSSP  -lEEEEEEEEELLLL---------------------------------------------
Query -tEWLLCDFHVHTNX---------------------------------------------   14
ident        |   |                                                
Sbjct alNYRVIDVDNHYYEpldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  llLLLEEEEEEELLLllllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  -------------------------------lllllLHHHhhHHHHHLL----LLEEEEE
Query -------------------------------sdghlPLGEvvDLFGKHG----VDVVSIT   39
ident                                           |                 
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNR--DARIAVMdeqdIETAFML  118
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLH--HHHHHHHhhhlEEEEEEE


DSSP  E--eEELHhhhhhhhhllllllllLLLLHHHHHHHHHH--HHHHhhhhhLLEEEEE----
Query D--hIVDRrtleqrkrngeplgaiTEDKFQDYLKRLWR--EQKRaweeyGXILIPG----   91
ident                         |          |       |         |      
Sbjct PtfgCGVE-------ealkhdieaTMASVHAFNLWLDEdwGFDR----pDHRIIAApivs  167
DSSP  LlhhHHHH-------hhllllhhhHHHHHHHHHHHHHHhlLLLL----lLLLEEELllll


DSSP  ---------------------EEEEELLlleeeeeelllllllllLLHH----hhHHHHH
Query ---------------------VEITNNTdlyhivavdvkeyvdpsLPVE----eiVEKLK  126
ident                      |                                    | 
Sbjct ladptraveevdfvlargaklVLVRPAP---------vpglvkprSLGDrshdpvWARLA  218
DSSP  lllhhhhhhhhhhhhhlllllEELLLLL---------llllllllLLLLhhhhhhHHHHH


DSSP  HLLLE------------------------------------------------------E
Query EQNAL------------------------------------------------------V  132
ident |                                                           
Sbjct EAGVPvgfhlsdsgylhiaaawggakdpldqvllddraihdtmasmivhgvftrhpklkA  278
DSSP  HHLLLeeeellllllhhhhhhllllllhhhhhhhllhhhhhhhhhhhhllhhhhlllllE


DSSP  EELLLLllllllhHHHLLL--------------------LLLLLLlEEEEEelLEELH-H
Query IAAHPDrkklswyLWANXE--------------------RFKDTFdAWEIAnrDDLFN-S  171
ident                                                             
Sbjct VSIENG-----syFVHRLIkrlkkaantqpqyfpedpveQLRNNV-WIAPY--YEDDLpE  330
DSSP  EEELLL-----llHHHHHHhhhhhhhhhlhhhllllhhhHHHHHE-EELLL--LLLLHhH


DSSP  HHHLLL--LEEEELLLLLHH-HHLL------------eeeeeeelllhHHHHHhhhhlll
Query VGVKKY--RYVANSDFHELW-HVYS------------wktlvksekniEAIKEairkntd  216
ident              ||                                             
Sbjct LARVIGvdKILFGSDWPHGEgLASPvsftaelkgfsesdirkimrdnaLDLLG-------  383
DSSP  HHHHHLhhHLLLLLLLLLLLlLLLHhhhhhhhllllhhhhhhhhlhhhHHHHL-------


DSSP  eeeeelll
Query vaiylxrk  224
ident         
Sbjct ---vqvgs  388
DSSP  ---lllll


No 56: Query=2anuA Sbjct=3e74A Z-score=3.7

back to top
DSSP  -------------------------------------------------LEEEEEEEEEL
Query -------------------------------------------------TEWLLCDFHVH   11
ident                                                        | | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvVSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleEEELEEEEEEL


DSSP  LlllllllLHHHHHHHHHHLLLLEEEEEEEeelhhhhhhhhhllllLLLL-LLLLHHHHH
Query TnxsdghlPLGEVVDLFGKHGVDVVSITDHivdrrtleqrkrngepLGAI-TEDKFQDYL   70
ident                   | |                         | |           
Sbjct I-------GYETGTRAAAKGGITTXIEXPL--------------nqLPATvDRASIELKF   99
DSSP  L-------LHHHHHHHHHHLLEEEEEELLL--------------llLLLLlLHHHHHHHH


DSSP  HHHHHHHhhhhhhhlLEEEeEEEEE-----------------------ELLLleeeeeel
Query KRLWREQkraweeygXILIpGVEIT-----------------------NNTDlyhivavd  107
ident                                                             
Sbjct DAAKGKL-------tIDAA-QLGGLvsynidrlheldevgvvgfxcfvRDVN--------  143
DSSP  HHHLLLL-------lLEEE-ELEELlllllllhhhhhhhlllleeeelLLLL--------


DSSP  llllllllLLHHHHHHHHHhllleEEEL---------------------------lllll
Query vkeyvdpsLPVEEIVEKLKeqnalVIAA---------------------------hpdrk  140
ident                |        |                                   
Sbjct ---dwqffKGAQKLGELGQ----pVLVHcenalicdelgeeakregrvtahdyvasrpvf  196
DSSP  ---hhhhhHHHHHHHHHLL----lEEEElllhhhhhhhhhhhhhhllllhhhhhhlllhh


DSSP  llLLHHHHLLLLL--------------------------llllLEEEeEELLEE------
Query klSWYLWANXERF--------------------------kdtfDAWEiANRDDL------  168
ident                                               |             
Sbjct teVEAIRRVLYLAkvagcrlhvchvsspegveevtrarqegqdITCE-SCPHYFvldtdq  255
DSSP  hhHHHHHHHHHHHhhhllleeelllllhhhhhhhhhhhhllllEEEE-ELLHHHhllhhh


DSSP  ----------------------LHHHHHLLLLEEEELLLLL----------------HHH
Query ----------------------FNSVGVKKYRYVANSDFHE----------------LWH  190
ident                                     ||                      
Sbjct feeigtlakcsppirdlenqkgXWEKLFNGEIDCLVSDHSPcppexkagnixkawggIAG  315
DSSP  hhhhlhhhllllllllhhhhhhHHHHHHLLLLLEELLLLLLllllllllllllllllLLL


DSSP  H---------------------lleEEEE----------------eELLL----------
Query V---------------------yswKTLV----------------kSEKN----------  203
ident                                                             
Sbjct LqscxdvxfdeavqkrgxslpxfgkLXATnaadifglqqkgriapgKDADfvfiqpnssy  375
DSSP  HhhhhhhhhhhhlllllllhhhhhhHHLHhhhhhllllllllllllLLLLeeeeelllle


DSSP  ---------------------------------hhhhhhhhhhllleeeeelll
Query ---------------------------------ieaikeairkntdvaiylxrk  224
ident                                                       
Sbjct vltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  ellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 57: Query=2anuA Sbjct=3cjpA Z-score=3.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct liidghthvilpvekhikimdeagvdktilfstsihpetavnlrdvkkemkklndvvngk   60
DSSP  lleeeeeellllhhhhhhhhhhhllleeeeelllllhhhlllhhhhhhhhhhhhhhhlll


DSSP  ---------------------leEEEEEEeELLLL----lllllLHHHH-HHHHhhllll
Query ---------------------teWLLCDFhVHTNX----sdghlPLGEV-VDLFgkhgvd   34
ident                             |                  |  |         
Sbjct tnsmidvrrnsikeltnviqaypSRYVGF-GNVPVglsendtnsYIEENiVNNK------  113
DSSP  llllhhhhhhhhhhhhhhhhhllLLEEEE-ELLLLlllhhhhhhHHHHHlLLLL------


DSSP  eEEEE-EEEELHhhhhhhhhllllllllLLLLHHHHHHHHHHHHhhhhhhhlleEEEEEE
Query vVSIT-DHIVDRrtleqrkrngeplgaiTEDKFQDYLKRLWREQkraweeygxiLIPGVE   93
ident  | |                                 |                |     
Sbjct lVGIGeLTPASG----------------QIKSLKPIFKYSMDSG---------sLPIWIH  148
DSSP  lLEEEeELLLLL----------------LHHHHHHHHHHHHHLL---------lLLEEEL


DSSP  EEELllleeeeeelllLLLL---------------lllLHHHHHHHHHHLL-LEEEELLl
Query ITNNtdlyhivavdvkEYVD---------------pslPVEEIVEKLKEQN-ALVIAAHp  137
ident   |             |                          ||  ||           
Sbjct AFNP-----lvlqdikEIAElckafpkvpvilghmggsNWMTAVELAKEIQnLYLDTSA-  202
DSSP  LLLL-----llhhhhhHHHHhhhhllllleeehhhhhhHHHHHHHHHHHLLlEEEELLL-


DSSP  lllllllhhHHLLLLLLLLL------LEEEEEELleELHHHHHLLlleeeelllllhhhh
Query drkklswylWANXERFKDTF------DAWEIANRddLFNSVGVKKyryvansdfhelwhv  191
ident                 |                                           
Sbjct ---------YFSTFVLKIVInelplkCIFGTDMPfgDLQLSIEAI---------------  238
DSSP  ---------LLLHHHHHHHHhhllllEELLLLLLllLHHHHHHHH---------------


DSSP  lleeeeeeelllhhhhhhHHHHllleeeeelll
Query yswktlvkseknieaikeAIRKntdvaiylxrk  224
ident                                  
Sbjct ---kkmsndsyvanavlgDNIS------rllni  262
DSSP  ---hhhlllhhhhhhhhlHHHH------hhhll


No 58: Query=2anuA Sbjct=3ooqA Z-score=3.3

back to top
DSSP  -------------------------------------------------LEEEEEEEEEL
Query -------------------------------------------------TEWLLCDFHVH   11
ident                                                        | | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkfLFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleEEELEEEEEEL


DSSP  -----------lLLLL-----------lllLHHHhhHHHHHLL---LLEEEEEE-EEELh
Query -----------tNXSD-----------ghlPLGEvvDLFGKHG---VDVVSITD-HIVDr   45
ident                                               |  | |        
Sbjct iglfeegvgyyySDGNeatdpvtphvkaldGFNPqdPAIERALaggVTSVXIVPgSANP-  119
DSSP  lllllllllhhhLLLLlllllllllllhhhHLLLllHHHHHHHlllEEEEEELLlLLLL-


DSSP  hhhhhhhhllllllllllllhhhhhhhhhHHHHHHhhhhlleeeEEEEEEELL-------
Query rtleqrkrngeplgaitedkfqdylkrlwREQKRAweeygxiliPGVEITNNT-------   98
ident                                              |              
Sbjct ----------------vggqgsvikfrsiIVEECI-----vkdpAGLKXAFGEnpkrvyg  158
DSSP  ----------------eeeeeeeeellllLHHHHE-----eeeeEEEEEELLHhhhhhhh


DSSP  ----------------------------------------lleeeeeellLLLL------
Query ----------------------------------------dlyhivavdvKEYV------  112
ident                                                             
Sbjct erkqtpstrxgtagvirdyftkvknyxkkkelaqkegkeftetdlkxevgEXVLrkkipa  218
DSSP  hlllllllhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHllllle


DSSP  -------llllLHHHHH--HHHHhllleEEELLllllllllHHHHLLLLLLLLLLEEEeE
Query -------dpslPVEEIV--EKLKeqnalVIAAHpdrkklswYLWANXERFKDTFDAWEiA  163
ident                |                |                           
Sbjct rxhahraddilTAIRIAeeFGFN-----LVIEH------gtEAYKISKVLAEKKIPVV-V  266
DSSP  eeeellhhhhhHHHHHHhhHLLL-----EEEEE------llLHHHHHHHHHHHLLLEE-E


DSSP  ELLE--------------eLHHHHHLLLLEEEELLLLLhHHHLL---------------e
Query NRDD--------------lFNSVGVKKYRYVANSDFHElWHVYS---------------w  194
ident                                   |                         
Sbjct GPLLtfrtklelkdltxetIAKLLKDGVLIALXCDHPViPLEFAtvqaataxrygakeed  326
DSSP  LLLLlllllhhhllllllhHHHHHHLLLLEEELLLLLLlLHHHHhhhhhhhhhhlllhhh


DSSP  eeeeeelllhhhHHHH----------------------------hhhllleeeeelll
Query ktlvkseknieaIKEA----------------------------irkntdvaiylxrk  224
ident                                                           
Sbjct llkiltvnpakiLGLEdrigsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  hhhlllhhhhhhLLLLllllllllllllleeeelllllllllleeeeeelleeeeell


No 59: Query=2anuA Sbjct=2qpxA Z-score=3.1

back to top
DSSP  ---------leEEEEEEEELLllllllLLHH-----------------------------
Query ---------teWLLCDFHVHTnxsdghLPLG-----------------------------   22
ident              | | | |       |  |                             
Sbjct gxddlsefvdqVPLLDHHCHF------LIDGkvpnrddrlaqvsteadkdypladtknrl   54
DSSP  lllllhhhhhhLLEEEEEELL------LLLLllllhhhhhhhhlllllllllhhhhlllh


DSSP  -----------------------------hhhhhhHHLL-LLEEEEEEEeelhhhhhhhh
Query -----------------------------evvdlfGKHG-VDVVSITDHivdrrtleqrk   52
ident                                      |       |              
Sbjct ayhgflalakefaldannplaaxndpgyatynhriFGHFhFKELLIDTG-----------  103
DSSP  hhhhhhhhhhhhllllllllllllhhhhhhhhhhhHHHLlEEEEEEELL-----------


DSSP  hllllllllllllhhhhhhHHHHHHHHHHhhhlLEEEEE---------------------
Query rngeplgaitedkfqdylkRLWREQKRAWeeygXILIPG---------------------   91
ident                     |                                       
Sbjct -----------fvpddpilDLDQTAELVG----IPVKAIyrlethaedfxlehdnfaaww  148
DSSP  -----------llllllllLHHHHHHHHL----LLEEEEeehhhhhhhhhlllllhhhhh


DSSP  -----------------eEEEE--LLLL--------------------------------
Query -----------------vEITN--NTDL--------------------------------  100
ident                            |                                
Sbjct qafsndvkqakahgfvgfXSIAayRVGLhlepvnvieaaagfdtwkhsgekrltskplid  208
DSSP  hhhhhhhhllllllllleEELHhhHLLLllllllhhhhhhhhhhhhhhlllllllhhhhh


DSSP  ------------------------eeeeeelllllllllLLHHHHHHHHHhlllEEEELL
Query ------------------------yhivavdvkeyvdpsLPVEEIVEKLKeqnaLVIAAH  136
ident                                                |       |   |
Sbjct yxlyhvapfiiaqdxplqfhvgygdadtdxylgnpllxrDYLKAFTKKGL----KVVLLH  264
DSSP  hhhhhhhhhhhhhllleeeeellllllllhhhllhhhhhHHHHHHHHHLL----LEEEEE


DSSP  LLLlllllhhhhllLLLLLL-LLEEEeEELLE---------ELHHHHHLLL--LEEEELL
Query PDRkklswylwanxERFKDT-FDAWEiANRDD---------LFNSVGVKKY--RYVANSD  184
ident                                |          ||         |    ||
Sbjct CYP-----yhreagYLASVFpNLYFD-ISLLDnlgpsgasrVFNEAVELAPytRILFASD  318
DSSP  LLL-----lhhhhhHHHHHLlLEEEE-LLLHHhhlhhhhhhHHHHHLLLLLhhHEELLLL


DSSP  LL-LHHH-HLLE----------------------------EEEE-------eELLLhhhh
Query FH-ELWH-VYSW----------------------------KTLV-------kSEKNieai  207
ident                                                             
Sbjct AStYPEXyGLAArqfkqalvahfnqlpfvdlaqkkawinaICWQtsaklyhqEREL----  374
DSSP  LLlLHHHhHHHHhhhhhhhhhhhhllllllhhhhhhhhhhHHLHhhhhhlllHHHH----


DSSP  hhhhhhllleeeeelll
Query keairkntdvaiylxrk  224
ident                  
Sbjct ---------------rv  376
DSSP  ---------------ll