Results: dupa

Query: 2a3lA

MOLECULE: AMP DEAMINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  2a3l-A 68.4  0.0  616   616  100 PDB  MOLECULE: AMP DEAMINASE;                                             
   2:  1a4m-A 19.3  2.9  293   349   16 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
   3:  1k6w-A 15.4  3.2  268   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   4:  2oof-A 15.3  3.9  276   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   5:  4cqb-A 14.3  3.5  278   402    8 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   6:  2paj-A 14.1  3.8  260   421   14 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   7:  3ls9-A 14.0  3.6  275   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   8:  2imr-A 13.6  3.6  247   380   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
   9:  3icj-A 13.3  3.7  275   468    8 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  10:  1j6p-A 13.1  3.4  243   407   15 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  11:  2y1h-B 12.4  3.5  232   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  12:  4c5y-A 12.3  3.4  240   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  13:  3mkv-A 12.3  3.4  238   414   11 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  14:  3mtw-A 12.0  3.7  245   404   10 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  15:  1yrr-B 11.9  3.8  237   334    9 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  16:  1bf6-A 11.7  4.0  240   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  17:  2vc5-A 11.5  4.2  242   314    9 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  18:  2uz9-A 11.3  3.8  262   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  19:  3cjp-A 11.2  3.7  213   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  20:  3gg7-A 11.2  3.5  215   243    9 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  21:  3nqb-A 11.1  3.6  234   587   12 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  22:  2ogj-A 11.0  3.6  235   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  23:  2ob3-A 10.9  4.1  247   329    8 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  24:  3k2g-B 10.7  4.2  249   358    9 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  25:  2vun-A 10.5  3.9  227   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  26:  4hk5-D 10.5  3.9  235   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  27:  4mup-B 10.4  3.6  213   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  28:  4dlf-A 10.4  4.0  225   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  29:  4rdv-B 10.2  3.6  260   451   12 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  30:  2ffi-A  9.7  3.7  217   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  31:  1gkp-A  9.7  4.0  243   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  32:  3gri-A  9.7  3.9  227   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  33:  3ooq-A  9.7  4.1  217   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  34:  1v77-A  9.6  3.3  175   202   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  35:  3giq-A  9.6  4.2  247   475   11 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  36:  3irs-A  9.5  3.9  211   281    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  37:  4ofc-A  9.3  3.9  222   335   12 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  38:  4b3z-D  9.3  3.8  240   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  39:  2dvt-A  9.1  3.8  221   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  40:  3pnu-A  9.0  4.1  218   338    7 PDB  MOLECULE: DIHYDROOROTASE;                                            
  41:  1itq-A  8.8  3.9  235   369    6 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  42:  2gwg-A  8.7  4.4  237   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  43:  1onx-A  8.5  4.1  238   390   13 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  44:  2qpx-A  8.5  4.8  244   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  45:  4qrn-A  8.4  4.0  219   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  46:  3e74-A  8.1  4.1  221   429   12 PDB  MOLECULE: ALLANTOINASE;                                              
  47:  1a5k-C  7.7  3.8  220   566   14 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  48:  4dzi-C  7.6  4.3  229   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3qy6-A  7.3  4.0  180   247   10 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1j5s-A  7.3  4.5  257   451    8 PDB  MOLECULE: URONATE ISOMERASE;                                         
  51:  3iac-A  6.6  4.7  265   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  1bks-A  6.5  3.9  174   255    6 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  53:  3au2-A  6.2  3.6  174   575   13 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3f2b-A  6.1  3.4  158   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  3dcp-A  5.9  3.4  163   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  56:  1m65-A  5.7  3.7  167   234    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  57:  2anu-A  3.8  3.5  133   224    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  3.2  4.1  135   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  2.5  4.7  130   284    6 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=2a3lA Sbjct=2a3lA Z-score=68.4

back to top
DSSP  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLLLLLLLL
Query QPDPIAADILRKEPEQETFVRLNVPLEVPTSDEVEAYKCLQECLELRKRYVFQETVAPWE   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QPDPIAADILRKEPEQETFVRLNVPLEVPTSDEVEAYKCLQECLELRKRYVFQETVAPWE   60
DSSP  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLLLLLLLLL


DSSP  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHLLLHH
Query KEEPFAHYPQGKSDHCFEMQDGVVHVFANKDAKEDLFPVADATAFFTDLHHVLKVIAAGN  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KEEPFAHYPQGKSDHCFEMQDGVVHVFANKDAKEDLFPVADATAFFTDLHHVLKVIAAGN  120
DSSP  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHLLLHH


DSSP  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLLLLEEEEEEELLLLLLHHHH
Query IRTLCHRRLVLLEQKFNLHLMLNADKEFLAQKSAPHRDFYNVRKVDTHVHHSACMNQKHL  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IRTLCHRRLVLLEQKFNLHLMLNADKEFLAQKSAPHRDFYNVRKVDTHVHHSACMNQKHL  180
DSSP  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLLLLEEEEEEELLLLLLHHHH


DSSP  HHHHHHHHHLLLLLLLEEELLEEELHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLL
Query LRFIKSKLRKEPDEVVIFRDGTYLTLREVFESLDLTGYDLNVDLLDVHADKSTFHRFDKF  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LRFIKSKLRKEPDEVVIFRDGTYLTLREVFESLDLTGYDLNVDLLDVHADKSTFHRFDKF  240
DSSP  HHHHHHHHHLLLLLLLEEELLEEELHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLL


DSSP  HHHHLLLLLLHHHHHHLLLLLLLLLLLHHHHHHHHHHHHLLLLLEEEEEEEELLLLLLLH
Query NLKYNPCGQSRLREIFLKQDNLIQGRFLGEITKQVFSDLEASKYQMAEYRISIYGRKMSE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NLKYNPCGQSRLREIFLKQDNLIQGRFLGEITKQVFSDLEASKYQMAEYRISIYGRKMSE  300
DSSP  HHHHLLLLLLHHHHHHLLLLLLLLLLLHHHHHHHHHHHHLLLLLEEEEEEEELLLLLLLH


DSSP  HHHHHHHHHLLLLLLLLEEEEEEEELLHHHHLLLLLLLLLHHHHHHHLLHHHHHHHLHHH
Query WDQLASWIVNNDLYSENVVWLIQLPRLYNIYKDMGIVTSFQNILDNIFIPLFEATVDPDS  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct WDQLASWIVNNDLYSENVVWLIQLPRLYNIYKDMGIVTSFQNILDNIFIPLFEATVDPDS  360
DSSP  HHHHHHHHHLLLLLLLLEEEEEEEELLHHHHLLLLLLLLLHHHHHHHLLHHHHHHHLHHH


DSSP  LLLLHHHHLLEEEEEEELLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHH
Query HPQLHVFLKQVVGFDLVDDESKPERRPTKHMPTPAQWTNAFNPAFSYYVYYCYANLYVLN  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HPQLHVFLKQVVGFDLVDDESKPERRPTKHMPTPAQWTNAFNPAFSYYVYYCYANLYVLN  420
DSSP  LLLLHHHHLLEEEEEEELLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHH


DSSP  HHHLLLLLLLLEELLLLLLLLLLHHHHHHHHHLLLLLLLHHHHHLHHHHHHHHHHLLLEE
Query KLRESKGMTTITLRPHSGEAGDIDHLAATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLA  480
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KLRESKGMTTITLRPHSGEAGDIDHLAATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLA  480
DSSP  HHHLLLLLLLLEELLLLLLLLLLHHHHHHHHHLLLLLLLHHHHHLHHHHHHHHHHLLLEE


DSSP  ELHHHHLLLLLLLLLLLHHHHHHLLLLEEELLLLHHHHLLLLLHHHHHHHHHHHHHLLLH
Query MSPLSNNSLFLDYHRNPFPVFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSA  540
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MSPLSNNSLFLDYHRNPFPVFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSA  540
DSSP  ELHHHHLLLLLLLLLLLHHHHHHLLLLEEELLLLHHHHLLLLLHHHHHHHHHHHHHLLLH


DSSP  HHHHHHHHHHHHHLLLLHHHHHHHLLLLLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHHH
Query CDLCEIARNSVYQSGFSHALKSHWIGKDYYKRGPDGNDIHKTNVPHIRVEFRDTIWKEEM  600
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CDLCEIARNSVYQSGFSHALKSHWIGKDYYKRGPDGNDIHKTNVPHIRVEFRDTIWKEEM  600
DSSP  HHHHHHHHHHHHHLLLLHHHHHHHLLLLLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHHH


DSSP  HHHLLLLLLLLLLLLL
Query QQVYLGKAVISDEVVP  616
ident ||||||||||||||||
Sbjct QQVYLGKAVISDEVVP  616
DSSP  HHHLLLLLLLLLLLLL


No 2: Query=2a3lA Sbjct=1a4mA Z-score=19.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLLlEEEEEEELLLLLlhhhH
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNVrKVDTHVHHSACMnqkhL  180
ident                                       |    ||  |||          
Sbjct -----------------------------------tpaFNKP-KVELHVHLDGAI----K   20
DSSP  -----------------------------------lllLLLL-EEEEEEEHHHLL----L


DSSP  HHHHHHHhhlllllLLEEelleeelhhhhhhhhlllLLLL--LLLLlllllllllllllL
Query LRFIKSKlrkepdeVVIFrdgtyltlrevfesldltGYDL--NVDLldvhadkstfhrfD  238
ident    |                                                        
Sbjct PETILYF-----gkKRGI---------------alpADTVeeLRNI---igmdkplslpG   57
DSSP  HHHHHHH-----hhHHLL---------------lllLLLHhhHHHH---hlllllllhhH


DSSP  LLHHHhlllllLHHHHhHLLLllllLLLLHHHHHHHHHHHHLlLLLE-EEEEEEELL---
Query KFNLKynpcgqSRLREiFLKQdnliQGRFLGEITKQVFSDLEaSKYQ-MAEYRISIY---  294
ident                                 |                 | | |     
Sbjct FLAKF------DYYMP-VIAG----CREAIKRIAYEFVEMKA-KEGVvYVEVRYSPHlla  105
DSSP  HHLLH------HHHHH-HHLL----LHHHHHHHHHHHHHHHH-HLLEeEEEEEELLHhhl


DSSP  -lLLLL----------HHHHHHHHHhllLLLL-------LLEEEEEEEELLHhhhlllll
Query -gRKMS----------EWDQLASWIvnnDLYS-------ENVVWLIQLPRLYniykdmgi  336
ident                   |                      |       |          
Sbjct nsKVDPmpwnqtegdvTPDDVVDLV--nQGLQegeqafgIKVRSILCCMRHQ--------  155
DSSP  llLLLLlhhhllllllLHHHHHHHH--hHHHHhhhhhhlLEEEEEEEEELLL--------


DSSP  llllhHHHHHHLLhhhhhhhlhhhllllhHHHL-LEEEEEEELLLLLLLlllllllllll
Query vtsfqNILDNIFIplfeatvdpdshpqlhVFLK-QVVGFDLVDDESKPErrptkhmptpa  395
ident                                    ||  ||  ||               
Sbjct ----pSWSLEVLE-------------lckKYNQkTVVAMDLAGDETIEG-----------  187
DSSP  ----hHHHHHHHH-------------hhhHLLLlLEEEEEEELLLLLLL-----------


DSSP  llllllllLHHH-HHHHHHHHHHHHHhhhlllllllLEELLLLLLLLLLHHHHHHHH--H
Query qwtnafnpAFSY-YVYYCYANLYVLNklreskgmttITLRPHSGEAGDIDHLAATFL--T  452
ident                   |                 |    | || |             
Sbjct --------SSLFpGHVEAYEGAVKNG----------IHRTVHAGEVGSPEVVREAVDilK  229
DSSP  --------HHHLhHHHHHHHHHHHHL----------LEEEEEELLLLLHHHHHHHHHllL


DSSP  LLLLLLLHHHHHLHHHHHHHHHHLLLEEELHHHHLL-LLLLL-LLLLHHHHHHLLLLEEE
Query CHSIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNS-LFLDY-HRNPFPVFFLRGLNVSL  510
ident      ||        |              | |       |         |     | ||
Sbjct TERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLtGAWDPkTTHAVVRFKNDKANYSL  289
DSSP  LLEEEELHHHHHLHHHHHHHHHLLLEEEELHHHHHHlLLLLLlLLLHHHHHHHLLLLEEE


DSSP  LLLLHHHHLLlllHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHLLLLHHHHHHHLLllll
Query STDDPLQIHLtkePLVEEYSIAASVWKLSACDLCEIARNSVYQSGFSHALKSHWIGkdyy  570
ident  |||||        |   |                   |    |      |         
Sbjct NTDDPLIFKS---TLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLE----  342
DSSP  LLLLLLLLLL---LHHHHHHHHHHLLLLLHHHHHHHHHHHHHLLLLLHHHHHHHHH----


DSSP  lllhhhllHHHHLllhhhhhhhhhhhhhhhhhhlllllllllllll
Query krgpdgndIHKTNvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                               
Sbjct ------rlYREYQ---------------------------------  349
DSSP  ------hhHHHLL---------------------------------


No 3: Query=2a3lA Sbjct=1k6wA Z-score=15.4

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
ident                                                             
Sbjct ------------------alqtiinarlpGEEGlwqihlqdgkisaidaqsgvmpitens   42
DSSP  ------------------llleeeeelllLLLLeeeeeeelleeeeeeeellllllllle


DSSP  ---lLLLLllLLLEEEEEEELLLLLLHhhhhhhhhhhhhllllllleeelleeelhhhhh
Query ---aPHRDfyNVRKVDTHVHHSACMNQkhllrfiksklrkepdevvifrdgtyltlrevf  210
ident               |  | |                                        
Sbjct ldaeQGLV--IPPFVEPHIHLDTTQTA---------------------------------   67
DSSP  eellLLEE--ELLEEEEEELLLLLLLL---------------------------------


DSSP  hhhllllllLLLLLllllllllllllLLLLhhhhlllllLHHHHHHlllllllLLLLHHH
Query esldltgydLNVDLldvhadkstfhrFDKFnlkynpcgqSRLREIFlkqdnliQGRFLGE  270
ident           |               |                                 
Sbjct -------gqPNWNQ--------sgtlFEGI------erwAERKALL-------THDDVKQ   99
DSSP  -------llLLLLL--------lllhHHHH------hhhHLLHHHL-------LHHHHHH


DSSP  HHHHHHHHHLLLLLEEEEEEEELLllllLHHHhHHHHHHllLLLL--LLEEEEEEEEL--
Query ITKQVFSDLEASKYQMAEYRISIYgrkmSEWDqLASWIVnnDLYS--ENVVWLIQLPR--  326
ident    |      |   |                  |                          
Sbjct RAWQTLKWQIANGIQHVRTHVDVS---dATLTaLKAMLEvkQEVApwIDLQIVAFPQEgi  156
DSSP  HHHHHHHHHHHLLEEEEEEEEELL---lLLLHhHHHHHHhhHHHLllLEEEEEEELLLll


DSSP  LHHHhlllllllllhHHHHHHLLhhhhhhhlhhhllllhhhhlLEEEEEEEllllllLLL
Query LYNIykdmgivtsfqNILDNIFIplfeatvdpdshpqlhvflkQVVGFDLVddeskpERR  386
ident |              |                                           |
Sbjct LSYP-----------NGEALLEE----------------alrlGADVVGAI--phfeFTR  187
DSSP  LLLL-----------LHHHHHHH----------------hhhlLLLEEEEL--hhhlLLH


DSSP  LllllllllllllllllLHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLLL--LLLH
Query PtkhmptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmttITLRPHSGEA--GDID  444
ident                            |                     |  |       
Sbjct E----------------YGVESLHKTFALAQKYD----------RLIDVHCDEIddEQSR  221
DSSP  H----------------HHHHHHHHHHHHHHHHL----------LEEEEEELLLllLLLL


DSSP  HHHHHHHHL--------LLLLLLHHHHH-----LHHHHHHHHHHLLLEEELHHHHLLLLL
Query HLAATFLTC--------HSIAHGINLRK-----SPVLQYLYYLAQIGLAMSPLSNNSLFL  491
ident                      |              |  |     |     || |  |  
Sbjct FVETVAALAhhegmgarVTASHTTAMHSyngayTSRLFRLLKMSGINFVANPLVNIHLQG  281
DSSP  HHHHHHHHHhhhllhhhEEEEELHHHHHllhhhHHHHHHHHHHHLLEEEELHHHHHHHLL


DSSP  ------lLLLL-LHHHHHHLLLLEEELLLLHH----HHLLllLHHHHHHHHHHHHHLL--
Query ------dYHRN-PFPVFFLRGLNVSLSTDDPL----QIHLtkEPLVEEYSIAASVWKL--  538
ident                     | ||    ||                        |  |  
Sbjct rfdtypkRRGItRVKEMLESGINVCFGHDDVFdpwyPLGT--ANMLQVLHMGLHVCQLmg  339
DSSP  lllllllLLLLlLHHHHHHLLLLEEELLLLLLllllLLLL--LLHHHHHHHHHHHLLLll


DSSP  --LHHHHHHH-HHHHHHHLLLLHhhhhhHLLLL--------lllllhhhllhhhhlllhh
Query --SACDLCEI-ARNSVYQSGFSHalkshWIGKD--------yykrgpdgndihktnvphi  587
ident      |        |                                             
Sbjct ygQINDGLNLiTHHSARTLNLQD-----YGIAAgnsanliilpaengfdalrrqvpvrys  394
DSSP  hhHHHHHHHHhLHHHHHHLLLLL-----LLLLLllllleeeellllhhhhhhhlllllee


DSSP  hhhhhhhhhhhhhhhhlllllllllllll
Query rvefrdtiwkeemqqvylgkavisdevvp  616
ident                              
Sbjct vrggkviastqpaqttvyleqpeaidykr  423
DSSP  eelleeeeellllleeeellleeeellll


No 4: Query=2a3lA Sbjct=2oofA Z-score=15.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
ident                                                             
Sbjct -------lncervwlnvtpatlrsdladyGLLEphalgvhegrihalvpxqdlkypahwq   53
DSSP  -------lllleeeeeeeellllllllllLLLLleeeeeelleeeeeeehhhllllllle


DSSP  ---LLLLlllLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhhhhh
Query ---APHRdfyNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlrevf  210
ident                | | |                                        
Sbjct dxkGKLV---TPGLIDCHTHLI--------------------------------------   72
DSSP  ellLLEE---EELEEEEEELLL--------------------------------------


DSSP  hhhllllllllLLLLLL---llLLLL--LLLLLlLHHHhllllllhhhhhhlLLLLllLL
Query esldltgydlnVDLLDV---haDKST--FHRFDkFNLKynpcgqsrlreiflKQDNliQG  265
ident                                                             
Sbjct ------fagsrAEEFELrqkgvPYAEiaRKGGG-IIST------------vrATRA-aSE  112
DSSP  ------lllllHHHHHHhhhllLHHHhhHLLLL-HHHH------------hhHHHH-lLH


DSSP  LLHHHHHHHHHHHHLlLLLE-EEEEEEElllllllHHHHHHHHHHllLLLL----LLEEE
Query RFLGEITKQVFSDLEaSKYQ-MAEYRISiygrkmsEWDQLASWIVnnDLYS----ENVVW  320
ident   | |        |         |                                 |  
Sbjct DQLFELALPRVKSLI-REGVtTVEIKSG----yglTLEDELKXLRvaRRLGealpIRVKT  167
DSSP  HHHHHHHHHHHHHHH-HHLEeEEEEELL----lllLHHHHHHHHHhhHHHHhhllLEEEE


DSSP  EEE-EELLHHHHLlllllLLLHHHHHHHLLHHhhhhhlhhhllllHHHHllEEEEEEElL
Query LIQ-LPRLYNIYKdmgivTSFQNILDNIFIPLfeatvdpdshpqlHVFLkqVVGFDLVdD  379
ident            |               |                    |      |    
Sbjct TLLaAHAVPPEYR-----DDPDSWVETICQEI--------ipaaaEAGL--ADAVDVF-C  211
DSSP  EEEeELLLLHHHL-----LLHHHHHHHHHHLH--------hhhhhHLLL--LLEEEEE-E


DSSP  LLLllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLL
Query ESKperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSGE  439
ident |                                |                      |   
Sbjct EHI--------------------gfSLAQTEQVYLAADQYG----------LAVKGHXDQ  241
DSSP  LLL--------------------llLHHHHHHHHHHHHHLL----------LEEEEEELL


DSSP  LLLLHHHHHHHHH-LLLLLLLHHHhhLHHHHHHHHHHLLLEEELHHHHLLLLLLllLLLH
Query AGDIDHLAATFLT-CHSIAHGINLrkSPVLQYLYYLAQIGLAMSPLSNNSLFLDyhRNPF  498
ident                 |  |   |   |                |     |       | 
Sbjct LSNLGGSTLAANFgALSVDHLEYL--DPEGIQALAHRGVVATLLPTAFYFLKET--KLPP  297
DSSP  LLLLLHHHHHHHLlLLEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHLLLL--LLLL


DSSP  HH-HHHLLLLEEELLLLH---HHHLllllHHHHHHHHHHHHHLLLHHHHHHHH-HHHHHH
Query PV-FFLRGLNVSLSTDDP---LQIHltkePLVEEYSIAASVWKLSACDLCEIA-RNSVYQ  553
ident  |     |     | |       |      |      |     |          |     
Sbjct VVaLRKAGVPXAVSSDINpgtAPIV----SLRXAXNXACTLFGLTPVEAXAGVtRHAARA  353
DSSP  HHhHHHLLLLEEELLLLLlllLLLL----LHHHHHHHHHHHHLLLHHHHHHHLlHHHHHH


DSSP  LLLlHHHHhhHLLLLLLlllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllllllll
Query SGFsHALKshWIGKDYYkrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisde  613
ident  |                                                          
Sbjct LGE-QEQL--GQLRVGX----------ladflvwncghpaelsyligvdqlvsrvvngee  400
DSSP  LLL-LLLL--LLLLLLL----------llleeeellllllhhhhlllllleeeeeellee


DSSP  lll
Query vvp  616
ident    
Sbjct tlh  403
DSSP  lll


No 5: Query=2a3lA Sbjct=4cqbA Z-score=14.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
ident                                                             
Sbjct --------------skdfdliirnaylseKDSVydigivgdriikieakiegtvkdeida   46
DSSP  --------------llleeeeeeeeeellLLEEeeeeeelleeeeeelllllleeeeeel


DSSP  lLLLLllLLLEEEEEEELLLLLlhhHHHHhhhhhhhllllllleeelleeelhhhhhhhh
Query aPHRDfyNVRKVDTHVHHSACMnqkHLLRfiksklrkepdevvifrdgtyltlrevfesl  213
ident            || | |                                           
Sbjct kGNLV--SPGFVDAHTHMDKSF--tSTGE-------------------------------   71
DSSP  lLLLE--EELEEEEEELHHHLL--lLLLL-------------------------------


DSSP  llllllLLLLLLLLlllllllllLLLLHHHHLLllllhhhhhhlLLLLllLLLLHHHHHH
Query dltgydLNVDLLDVhadkstfhrFDKFNLKYNPcgqsrlreiflKQDNliQGRFLGEITK  273
ident                                                |            
Sbjct ------RLPKFWSR---------PYTRDAAIED--------glkYYKN-aTHEEIKRHVI  107
DSSP  ------LLLLLLLL---------LLLHHHHHHH--------hhhHHHH-lLHHHHHHHHH


DSSP  HHHHHHLLLLLEEEEEEEELLLllllHHHHHHHHHhllLLLL-----LLEEEEEEEE-LL
Query QVFSDLEASKYQMAEYRISIYGrkmsEWDQLASWIvnnDLYS-----ENVVWLIQLP-RL  327
ident                                                             
Sbjct EHAHMQVLHGTLYTRTHVDVDS---vAKTKAVEAV--lEAKEelkdlIDIQVVAFAQsGF  162
DSSP  HHHHHHHHLLEEEEEEEEELLL---lLLLHHHHHH--hHHHHhllllLEEEEEEELLlLL


DSSP  HHHHlllllllllhHHHHHHLLhhhhhhhlhhhllllhhhHLLEEEEEEElLLLLlllll
Query YNIYkdmgivtsfqNILDNIFIplfeatvdpdshpqlhvfLKQVVGFDLVdDESKperrp  387
ident                    |                             | |        
Sbjct FVDL----------ESESLIRK----------------slDMGCDLVGGV-DPAT-----  190
DSSP  LLLL----------LHHHHHHH----------------hhHHLLLEEELL-LLLL-----


DSSP  llllllllllllllLLLHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLLL--LLLHH
Query tkhmptpaqwtnafNPAFSYYVYYCYANLYVLNklreskgmttITLRPHSGEA--GDIDH  445
ident                         |                       |           
Sbjct -------------rENNVEGSLDLCFKLAKEYD----------VDIDYHIHDIgtVGVYS  227
DSSP  -------------lLLLHHHHHHHHHHHHHHLL----------LEEEEEELLLhhHHHHH


DSSP  HHHHHHHL--------LLLLLLHHHH-----HLHHHHHHHHHHLLLEEELHHHHllllll
Query LAATFLTC--------HSIAHGINLR-----KSPVLQYLYYLAQIGLAMSPLSNnslfld  492
ident                     |                 ||            |       
Sbjct INRLAQKTiengykgrVTTSHAWCFAdapseWLDEAIPLYKDSGMKFVTCFSST------  281
DSSP  HHHHHHHHhhllllllEEEEELLHHHhllhhHHHHHHHHHHHHLLEEEEELLLL------


DSSP  LLLLLHHHHHHLLLLEEELLLLH----HHHLllLLHHHHHHHHHHHHHLL----LHHHHH
Query YHRNPFPVFFLRGLNVSLSTDDP----LQIHltKEPLVEEYSIAASVWKL----SACDLC  544
ident     |       | |     |                |    |      |          
Sbjct PPTMPVIKLLEAGINLGCASDNIrdfwVPFG--NGDMVQGALIETQRLELktnrDLGLIW  339
DSSP  LLLLLHHHHHHLLLEEEEELLLLllllLLLL--LLLHHHHHHHHHHHHLLllhhHHHHHH


DSSP  HH-HHHHHHHLLLlhhhHHHHL-LLLLllllhhhllhhhhlllhhhhhhhhhhhhhhhhh
Query EI-ARNSVYQSGFshalKSHWI-GKDYykrgpdgndihktnvphirvefrdtiwkeemqq  602
ident            |                                                
Sbjct KMiTSEGARVLGI----EKNYGiEVGK-------kadlvvlnslspqwaiidqakrlcvi  388
DSSP  HHhLHHHHHHHLL----HHHLLlLLLL-------llleeeellllhhhhhhhllleeeee


DSSP  hlllllllllllll
Query vylgkavisdevvp  616
ident               
Sbjct kngriivkdeviva  402
DSSP  elleeeeelleell


No 6: Query=2a3lA Sbjct=2pajA Z-score=14.1

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhHHHHHhhHHHL--------------------------
Query irtlchrrlvlleqkfnlhlmlnADKEFlaQKSA--------------------------  154
ident                                                             
Sbjct ------pstlirnaaaimtggrgTADDP-sRVPGpdirivgdtidaigalaprpgetivd   53
DSSP  ------leeeeellleellllllLLLLL-lLLLLlleeeelleeeeellllllllleeee


DSSP  --LLLLllLLLEEEEEEELLLL-LLHHhhhhhhhhhhhllllllleeelleeelhhhhhh
Query --PHRDfyNVRKVDTHVHHSAC-MNQKhllrfiksklrkepdevvifrdgtyltlrevfe  211
ident             | || |                                          
Sbjct atDCVI--YPAWVNTHHHLFQSlLKGE---------------------------------   78
DSSP  llLLEE--EELEELLLLLHHHHhLLLL---------------------------------


DSSP  hhlllllllllllllllllllllllllllhhhhllllllhHHHHHlllllllLLLLHHHH
Query sldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrLREIFlkqdnliQGRFLGEI  271
ident                                          |  |         |     
Sbjct ---------------------------------------pFRALF-------DERRFRLA   92
DSSP  ---------------------------------------lLHHHL-------LHHHHHHH


DSSP  HHHHHHHHLlLLLE-EEEEEEELLLLLllhhhHHHHHHhllLLLL---LLEEEEEEEELL
Query TKQVFSDLEaSKYQ-MAEYRISIYGRKmsewdQLASWIvnnDLYS---ENVVWLIQLPRL  327
ident        |               |                           | |      
Sbjct ARIGLIELA-RSGCaTVADHNYVYYPG--mpfDSSAIL--fEEAEklgLRFVLLRGGATQ  147
DSSP  HHHHHHHHH-LLLEeEEEELLLLLLLL--lllLHHHHH--hHHHHhllLEEEEEELLLLL


DSSP  HHHhLLLLL-llllhhHHHHHLLHHHHhhhlhhhllllHHHHL------LEEEEEEELll
Query YNIyKDMGI-vtsfqnILDNIFIPLFEatvdpdshpqlHVFLK------QVVGFDLVDde  380
ident                  ||                                |        
Sbjct TRQ-LEADLptalrpeTLDAYVADIER---------laARYHDaspramRRVVMAPTT--  195
DSSP  LLL-LLLLLlhhhlllLHHHHHHHHHH---------hhHHLLLllllllEEEEELLLL--


DSSP  llllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLll
Query skperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSGea  440
ident                                  |    |                |    
Sbjct -------------------vlysiSPREMRETAAVARRLG----------LRMHSHLS--  224
DSSP  -------------------lllllLHHHHHHHHHHHHHLL----------LEEEEELL--


DSSP  lLLHHHHHH-HHHL----LLLLLLHHHhhLHHHHHHHHHHLLLEEELHHHHLLLllllll
Query gDIDHLAAT-FLTC----HSIAHGINLrkSPVLQYLYYLAQIGLAMSPLSNNSLfldyhr  495
ident       |              ||            |      | |  | ||  |      
Sbjct -GKSPVAFCgEHDWlgsdVWYAHLVKV--DADEIALLAQTGTGVAHCPQSNGRL------  275
DSSP  -LLLHHHHHhHLLLllllEEEELLLLL--LHHHHHHHHHHLLEEEELHHHHHLL------


DSSP  lLHHHHHHLLLLEEELLLLHHHHLllLLHHHHHHHHHHHHHL---LLHHHHHHHH-HHHH
Query nPFPVFFLRGLNVSLSTDDPLQIHltKEPLVEEYSIAASVWK---LSACDLCEIA-RNSV  551
ident  |       |  ||   |              |             |             
Sbjct -PVREMADAGVPVSIGVDGAASNE--AADMISEVHMTWLAQRarlASIAEVIHWGtAGGA  332
DSSP  -LLLLHHHHLLLEEELLLHHHHLL--LLLHHHHHHHHHHHHHhllLLHHHHHHHHlHHHH


DSSP  HHLLLlHHHH------HHHL-------------------llllllllhhhllhhhhlllh
Query YQSGFsHALK------SHWI-------------------gkdyykrgpdgndihktnvph  586
ident    |               |                                        
Sbjct RVMGL-DEVGkvavgyAADIavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvv  391
DSSP  HHHLL-LLLLllllllLLLEeeeelllhhhlllllhhhhhhhllllleeeeeeelleeee


DSSP  hhhhhhhhhhhhhhhhhlllllllllllll
Query irvefrdtiwkeemqqvylgkavisdevvp  616
ident                               
Sbjct vddliegvdikelggearrvvrellrevvv  421
DSSP  ellllllllhhhhhhhhhhhhhhhhhhhhl


No 7: Query=2a3lA Sbjct=3ls9A Z-score=14.0

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                                             
Sbjct ---------------------------milirGLTRVItfddqereledadilidgpkiv   33
DSSP  ---------------------------leeeeEEEEEEllllllleeeeeeeeeelleee


DSSP  --------------------llLLLEEEEEEELLLLLLHhhhhhhhhhhhhlllllllee
Query --------------------fyNVRKVDTHVHHSACMNQkhllrfiksklrkepdevvif  198
ident                              | |                            
Sbjct avgkdlsdrsvsrtidgrgmiaLPGLINSHQHLYEGAMR---------------------   72
DSSP  eeellllllllleeeellleeeEELEEEEEELHHHHHHL---------------------


DSSP  elleeelhhhhhhhhllllllllLLLLllllllllllllLLLHHHHL-LLLLlhhhHHHL
Query rdgtyltlrevfesldltgydlnVDLLdvhadkstfhrfDKFNLKYN-PCGQsrlrEIFL  257
ident                                                   |       | 
Sbjct -----------------------AIPQ-----lervtmaSWLEGVLTrSAGW-wrdGKFG  103
DSSP  -----------------------LLHH-----hllllhhHHHHHHHHhHHHH-hhlLLLL


DSSP  lllllllLLLHHHHHHHHHHHHLlLLLE-EEEEEEELLllLLLHhHHHHHHHhlLLLL--
Query kqdnliqGRFLGEITKQVFSDLEaSKYQ-MAEYRISIYgrKMSEwDQLASWIvnNDLY--  314
ident             |    |                           |              
Sbjct -------PDVIREVARAVLLESL-LGGItTVADQHLFF-pGATA-DSYIDAT-iEAATdl  152
DSSP  -------HHHHHHHHHHHHHHHH-HLLEeEEEEEELLL-lLLLL-LLHHHHH-hHHHHhh


DSSP  LLLEEEEEEEELLH------HHHLllllllllhhHHHHHLLHHHHhhhlhhhllllHHHH
Query SENVVWLIQLPRLY------NIYKdmgivtsfqnILDNIFIPLFEatvdpdshpqlHVFL  368
ident             |                       |                       
Sbjct GIRFHAARSSMTLGkseggfCDDL-------fvePVDRVVQHCLG---------liDQYH  196
DSSP  LLEEEEEELLLLLLhhhlllLLHH-------hllLHHHHHHHHHH---------hhHHHL


DSSP  L------LEEEEEEELLLllllllllllllllllllllllllHHHHHHHHHHHHHHHHhh
Query K------QVVGFDLVDDEskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNkl  422
ident                                                             
Sbjct EpepfgmVRIALGPCGVP----------------------ydKPELFEAFAQMAADYD--  232
DSSP  LllllllEEEEELLLLLL----------------------llLHHHHHHHHHHHHHHL--


DSSP  hlllllllLEELLLLLLLLLL---------HHHHHH-HHHL----LLLLLLHHhHHLHhH
Query reskgmttITLRPHSGEAGDI---------DHLAAT-FLTC----HSIAHGINlRKSPvL  468
ident           |  |  |  |                            ||          
Sbjct --------VRLHTHFYEPLDAgmsdhlygmTPWRFLeKHGWasdrVWLAHAVV-PPRE-E  282
DSSP  --------LEEEEEELLLLHHhhhhhhhllLHHHHHhHLLLllllEEEEELLL-LLHH-H


DSSP  HHHHHHHLLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLHHHHLllllHHHH
Query QYLYYLAQIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDPLQIHltkePLVE  527
ident       |    |                 |       |  |   |            |  
Sbjct IPEFADAGVAIAHLIAPDLrMGWG---LAPIREYLDAGITVGFGTTGSASND--ggNLLG  337
DSSP  HHHHHHHLLEEEELHHHHHhLLLL---LLLHHHHHHLLLEEEELLLLLLLLL--llLHHH


DSSP  HHHHHHHHH----------LLLHHHHHHH-HHHHHHHLLLlHHHHhhHLLLLL-------
Query EYSIAASVW----------KLSACDLCEI-ARNSVYQSGFsHALKshWIGKDY-------  569
ident     ||              |||  |     | |    |    |                
Sbjct DLRLAALAHrpadpnepekWLSARELLRMaTRGSAECLGR-PDLG--VLEEGRaadiacw  394
DSSP  HHHHHHHHLhhhllllhhhLLLHHHHHHHlLHHHHHHLLL-LLLL--LLLLLLllleeee


DSSP  ------------llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query ------------ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                            
Sbjct rldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  elllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 8: Query=2a3lA Sbjct=2imrA Z-score=13.6

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH-------------------------hhlL
Query irtlchrrlvlleqkfnlhlmlnadkeFLAQ-------------------------ksaP  155
ident                                                             
Sbjct -----------htprlltcdvlytgaqSPGGvvvvgetvaaaghpdelrrqyphaaeerA   49
DSSP  -----------lleeeeeeleeelleeLLEEeeeelleeeeeelhhhhhhhlllleeeeL


DSSP  LLLLLlLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhhll
Query HRDFYnVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldl  215
ident          |  | |                                             
Sbjct GAVIA-PPPVNAHTHLD-------------------------------------------   65
DSSP  LLEEL-LLLLEEEEELL-------------------------------------------


DSSP  lllllllllllllllllllllllllhHHHLL-------llllhhhhHHLLlllllllllH
Query tgydlnvdlldvhadkstfhrfdkfnLKYNP-------cgqsrlreIFLKqdnliqgrfL  268
ident                                                 |           
Sbjct ------------------------msAYEFQalpyfqwipevvirgRHLR---------G   92
DSSP  ------------------------llHHHHHhlhhhhllhhhhhhhLLLL---------H


DSSP  HHHHHHHHHHHLLLLLEEEEEEEElllllllhhhhHHHHHhllLLLLLLEEEEEEEELLH
Query GEITKQVFSDLEASKYQMAEYRISiygrkmsewdqLASWIvnnDLYSENVVWLIQLPRLY  328
ident           |                                                 
Sbjct VAAAQAGADTLTRLGAGGVGDIVW--------apeVMDAL--lAREDLSGTLYFEVLNPF  142
DSSP  HHHHHHHHHHHHHLLLLLEEEEEL--------lhhHHHHH--hLLLLLLEEEEEEELLLL


DSSP  hhhllllllLLLHHHHHHHLLHHHHhhhlhhhlllLHHHHL--LEEEEEEELLLllllll
Query niykdmgivTSFQNILDNIFIPLFEatvdpdshpqLHVFLK--QVVGFDLVDDEskperr  386
ident                       |                       |             
Sbjct --------pDKADEVFAAARTHLER----------WRRLERpgLRLGLSPHTPF------  178
DSSP  --------hHHHHHHHHHHHHHHHH----------HHLLLLllEEEEEEELLLL------


DSSP  llllllllllllllllllHHHHHHHHHHHHHHHhhhhllllllLLEELLLLLL-LLLL--
Query ptkhmptpaqwtnafnpaFSYYVYYCYANLYVLnklreskgmtTITLRPHSGE-AGDI--  443
ident                                               |  |  |       
Sbjct ----------------tvSHRLMRLLSDYAAGE----------GLPLQIHVAEhPTELem  212
DSSP  ----------------llLHHHHHHHHHHHHHH----------LLLLEEEELLlHHHHhh


DSSP  ---------------------------------HHHHHHH-----HHLLLLLLLHHHhhL
Query ---------------------------------DHLAATF-----LTCHSIAHGINLrkS  465
ident                                                     |  |    
Sbjct frtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelgvlAARPTLVHMVNV--T  270
DSSP  hhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhllhHHLLEEEELLLL--L


DSSP  HHHHHHHHHHLLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLHHHHLllllH
Query PVLQYLYYLAQIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDPLQIHltkeP  524
ident |        |       | ||             | |   |  | | ||           
Sbjct PDDIARVARAGCAVVTCPRSNHhLECG---TFDWPAFAAAGVEVALGTDSVASGE--tlN  325
DSSP  HHHHHHHHHHLLLEEELHHHHHhLLLL---LLLHHHHHHLLLLEEELLLLHHHHL--llL


DSSP  HHHHHHHHHHHHL-LLHHHHHHHH-HHHHHHLLllhhhhhhHLLLLlllllhhhllhhhh
Query LVEEYSIAASVWK-LSACDLCEIA-RNSVYQSGfshalkshWIGKDyykrgpdgndihkt  582
ident   ||   |      |    |   |        |                           
Sbjct VREEVTFARQLYPgLDPRVLVRAAvKGGQRVVG--------TPFLR--------------  363
DSSP  LHHHHHHHHHHLLlLLHHHHHHHHhHHHHHHHL--------LLLLL--------------


DSSP  lllhhhhhhhhhhhhhhhhhhlllllllllllll
Query nvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                   
Sbjct -----------------rgetwqegfrwelsrdl  380
DSSP  -----------------llllllhhhlhhhllll


No 9: Query=2a3lA Sbjct=3icjA Z-score=13.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                                             
Sbjct --------------------------cmkaliNGTIYTsfspvkkvsglvisnervlyag   34
DSSP  --------------------------leeeeeLLEEEEeelleeeeleeeeelleeeeee


DSSP  ----------------------llLLLEEEEEEELLLLLLHhHHHH--------------
Query ----------------------fyNVRKVDTHVHHSACMNQkHLLR--------------  182
ident                              | | |                          
Sbjct dsstalriaelaggeiidlkgkfvMPAFFDSHLHLDELGMS-LEMVdlrgvksmeelver   93
DSSP  lhhhhhhhhhhhlleeeelllleeEELEEEEEELHHHHHHH-HHLEellllllhhhhhhh


DSSP  -hhHHHH-----hllllllleeelleeelhHHHHhhhlllllllllLLLLLLLL------
Query -fiKSKL-----rkepdevvifrdgtyltlREVFesldltgydlnvDLLDVHAD------  230
ident                                                   |         
Sbjct vkkGRGRiifgfgwdqdelgrwptredldvIDRP-------vflyrRCFHVAVMnskmid  146
DSSP  hhlLLLLleeeeeelhhhhlllllhhhhllLLLL-------eeeeeLLLLEEEElhhhhh


DSSP  -------------LLLLLLLlllhhhhlLLLLlhhhhhhllLLLLLLLLLHHHHHHHHHH
Query -------------KSTFHRFdkfnlkynPCGQsrlreiflkQDNLIQGRFLGEITKQVFS  277
ident                                                             
Sbjct llnlkpskdfdesTGIVRER------alEESR------kiiNEKILTVKDYKHYIESAQE  194
DSSP  hhllllllleellLLEEEHH------hhHHHH------hhhHHLLLLHHHHHHHHHHHHH


DSSP  HHLLLLLEEEEEEEELllllllhhhHHHHHHHLLL---LLLLLEEEEEEEellhhhhlll
Query DLEASKYQMAEYRISIygrkmsewdQLASWIVNND---LYSENVVWLIQLprlyniykdm  334
ident  |                                        ||                
Sbjct HLLSLGVHSVGFMSVG--------eKALKALFELEregRLKMNVFAYLSP----------  236
DSSP  HHHHLLEEEEEEEEEL--------hHHHHHHHHHHhllLLLLEEEEEELH----------


DSSP  llllllhhhhhHHLLHHHHHHhlhhhllllhhhhlLEEEEEEE-LLLL------------
Query givtsfqnildNIFIPLFEATvdpdshpqlhvflkQVVGFDLV-DDES------------  381
ident                 | |                   |  |  |               
Sbjct -----------ELLDKLEELN-----lgkfegrrlRIWGVXLFvDGSLgartallsepyt  280
DSSP  -----------HHHHHHHHHL-----llleellleEEEEEEEElLLLLllllllllllll


DSSP  ----lLLLLlllllllllllllllllLHHHHHHHHHHHHHHHHhhhlllllllLEELLLL
Query ----kPERRptkhmptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmttITLRPHS  437
ident                                          |                | 
Sbjct dnpttSGEL----------------vMNKDEIVEVIERAKPLG----------LDVAVHA  314
DSSP  lllllLLLL----------------lLLHHHHHHHHHHHLLLL----------LEEEEEE


DSSP  LlllLLHHHHHHHHHL------LLLLLLHHHhhLHHHHHHHHHHLLLEEELHHHHLLLLL
Query GeagDIDHLAATFLTC------HSIAHGINLrkSPVLQYLYYLAQIGLAMSPLSNNSLFL  491
ident                         | |                        |    |   
Sbjct I---GDKAVDVALDAFeeaefsGRIEHASLV--RDDQLERIKELKVRISAQPHFIVSDWW  369
DSSP  L---LHHHHHHHHHHHhhhlllLEEEELLLL--LHHHHHHHHHHLLEEEELLLHHHHLLL


DSSP  L---------llLLLHHHHHHlLLLEEELLLLhHHHLlllLHHHHHHHHHHHH-------
Query D---------yhRNPFPVFFLrGLNVSLSTDDpLQIHltkEPLVEEYSIAASV-------  535
ident                             |||                  |          
Sbjct IvnrvgeerakwAYRLKTLSS-ITKLGFSTDS-PIEP---ADPWVSIDAAVNRyvvdpge  424
DSSP  HhhhhhhhhhhhLLLHHHHHH-HLLEEELLLL-LLLL---LLHHHHHHHHHHLllllhhh


DSSP  HLLLHhHHHHH-HHHHHHHLLLLHhhhhhHLLLLLllllhhhllhhhhlllhhhhhhhhh
Query WKLSAcDLCEI-ARNSVYQSGFSHalkshWIGKDYykrgpdgndihktnvphirvefrdt  594
ident                |                                            
Sbjct RVSRE-EALHLyTHGSAQVTLAED---lgKLERGF-------------------------  455
DSSP  LLLHH-HHHHHlLHHHHHHLLLLL---llLLLLLL-------------------------


DSSP  hhhhhhhhhlllllllllllll
Query iwkeemqqvylgkavisdevvp  616
ident                       
Sbjct ---------raeyiildrdplk  468
DSSP  ---------llleeeellllll


No 10: Query=2a3lA Sbjct=1j6pA Z-score=13.1

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                                             
Sbjct --------------------------hhxiigNCLILKdfssepfwgaveiengtikrvl   34
DSSP  --------------------------leeeeeEEEELLlllllleeeeeeeelleeeeee


DSSP  -------------llLLLEEEEEEELLLLLLHHhhhhhhhhhhhllllllleeelleeel
Query -------------fyNVRKVDTHVHHSACMNQKhllrfiksklrkepdevvifrdgtylt  205
ident                      || |                                   
Sbjct qgevkvdldlsgklvXPALFNTHTHAPXTLLRG---------------------------   67
DSSP  elllllleellleeeEELEEEEEELHHHHHHLL---------------------------


DSSP  hhhhhhhhlllllllLLLLllllllllllllLLLLHHhhllllllHHHHhHLLLllllll
Query lrevfesldltgydlNVDLldvhadkstfhrFDKFNLkynpcgqsRLREiFLKQdnliqg  265
ident                                                    |        
Sbjct ---------------VAED---------lsfEEWLFS-----kvlPIED-RLTE------   91
DSSP  ---------------LLLL---------llhHHHHHL-----lhhHHHL-LLLH------


DSSP  LLHHHHHHHHHHHHLlLLLE-EEEEEEElllllllhhhhhhhhhhllLLLL--LLEE-EE
Query RFLGEITKQVFSDLEaSKYQ-MAEYRISiygrkmsewdqlaswivnnDLYS--ENVV-WL  321
ident       |                                                     
Sbjct KXAYYGTILAQXEXA-RHGIaGFVDXYF-------------heewiaKAVRdfGXRAlLT  137
DSSP  HHHHHHHHHHHHHHH-LLLEeEEEEEEL-------------lhhhhhHHHHhhLLEEeEE


DSSP  EEEeLLHHhhllllllllLHHHhhHHLLhhhhhhhlhhhllllHHHHL----LEEEEEEE
Query IQLpRLYNiykdmgivtsFQNIldNIFIplfeatvdpdshpqlHVFLK----QVVGFDLV  377
ident   |    |                                              |||   
Sbjct RGL-VDSN----------GDDG--GRLE---------enlklyNEWNGfegrIFVGFGPH  175
DSSP  EEE-LLLL----------LLLL--LHHH---------hhhhhhHHHLLhhhlEEEEEEEL


DSSP  LllllllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLL
Query DdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHS  437
ident                               |          ||               | 
Sbjct S----------------------pylcSEEYLKRVFDTAKSLN----------APVTIHL  203
DSSP  L----------------------llllLHHHHHHHHHHHHHHL----------LLEEEEE


DSSP  LLL--LLLHhHHHHHHH-----lLLLLLLHHHHHLhhHHHHHHHHLLLEEELHHHHL-LL
Query GEA--GDIDhLAATFLT-----cHSIAHGINLRKSpvLQYLYYLAQIGLAMSPLSNN-SL  489
ident  |      | |               ||   |                    | ||    
Sbjct YETskEEYD-LEDILNIglkevkTIAAHCVHLPER--YFGVLKDIPFFVSHNPASNLkLG  260
DSSP  LLLllLLLL-LHHHHLLllllllEEEEELLLLLHH--HHHHHLLLLEEEEELHHHHHhLL


DSSP  LLlllLLLHHHHHHLLLLEEELLLLHHHHLllllHHHHHHHHHHHHHL------LLHHHH
Query FLdyhRNPFPVFFLRGLNVSLSTDDPLQIHltkePLVEEYSIAASVWK------LSACDL  543
ident        |       |  | | ||           |  |   |    |      |     
Sbjct NG---IAPVQRXIEHGXKVTLGTDGAASNN--slNLFFEXRLASLLQKaqnprnLDVNTC  315
DSSP  LL---LLLHHHHHHLLLEEEELLLLLLLLL--llLHHHHHHHHHHHHHllllllLLHHHH


DSSP  HHHH-HHHHHHLLLLhhhhhhHLLL-----------------------llllllhhhllh
Query CEIA-RNSVYQSGFShalkshWIGK-----------------------dyykrgpdgndi  579
ident             ||                                              
Sbjct LKXVtYDGAQAXGFK-----sGKIEegwnadlvvidldlpexfpvqniknhlvhafsgev  370
DSSP  HHHHlHHHHHHHLLL-----lLLLLlllllleeeeelllhhhllhhhhhhhhhhllllll


DSSP  hhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query hktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                      
Sbjct fatxvagkwiyfdgeyptidseevkrelariekelys  407
DSSP  leeeelleeeeellllllllhhhhhhhhhhhhhhhhl


No 11: Query=2a3lA Sbjct=2y1hB Z-score=12.4

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllLLLEEEEEEELLLlllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfyNVRKVDTHVHHSAcmnqkhl  180
ident                                          |  || | | ||       
Sbjct ----------------------------------------GVGLVDCHCHLSA-------   13
DSSP  ----------------------------------------LLLEEEEEELLLL-------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   13
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllHHHHHHHHHHHHLLLLLEEEEEEEELLlllllH
Query nlkynpcgqsrlreiflkqdnliqgrfLGEITKQVFSDLEASKYQMAEYRISIYgrkmsE  300
ident                                   |                        |
Sbjct -------------------------pdFDRDLDDVLEKAKKANVVALVAVAEHS----gE   44
DSSP  -------------------------hhHLLLHHHHHHHHHHLLEEEEEELLLLH----hH


DSSP  HHHHHhhhhlllLLLLLEEEEEEEELLHhhhllllllllLHHHHHHHLLHHHHhhhlhhh
Query WDQLAswivnndLYSENVVWLIQLPRLYniykdmgivtsFQNILDNIFIPLFEatvdpds  360
ident              |   |                         ||               
Sbjct FEKIM---qlseRYNGFVLPCLGVHPVQ----gldqrsvTLKDLDVALPIIEN-------   90
DSSP  HHHHH---hhhhHLLLLEEEEELLLLEE----lllleelLHHHHHHHHHHHHH-------


DSSP  llllhhHHLLEEE-EEEEllLLLL--LLLLlllllllllllllLLLL-HHHHHHHHHHHH
Query hpqlhvFLKQVVG-FDLVddESKP--ERRPtkhmptpaqwtnaFNPA-FSYYVYYCYANL  416
ident                        |                                    
Sbjct ------YKDRLLAiGEVG-lDFSPrfAGTG-------------EQKEeQRQVLIRQIQLA  130
DSSP  ------HLLLLLEeEEEE-eELLLllLLLH-------------HHHHhHHHHHHHHHHHH


DSSP  HHHHhhhlllllllLEELLLLlLLLLLHHHHHHH--HHLL-LLLLLHHHHHlhhHHHHHH
Query YVLNklreskgmttITLRPHSgEAGDIDHLAATF--LTCH-SIAHGINLRKspvLQYLYY  473
ident   ||               ||                                       
Sbjct KRLN----------LPVNVHS-RSAGRPTINLLQeqGAEKvLLHAFDGRPS---VAMEGV  176
DSSP  HHHL----------LLEEEEE-ELLHHHHHHHHHhlLLLLeEEELLLLLHH---HHHHHH


DSSP  HHLLLEEELhHHHLLllllLLLL--LHHHHHhlLLLEEELLLLHHHHLL-----llLHHH
Query LAQIGLAMSpLSNNSlfldYHRN--PFPVFFlrGLNVSLSTDDPLQIHL-----tkEPLV  526
ident  |         |                          | || |                
Sbjct RAGYFFSIP-PSIIR----SGQKqkLVKQLP--LTSICLETDSPALGPEkqvrnepWNIS  229
DSSP  HLLLEEEEL-HHHHL----LHHHhhHHHHLL--HHHEEELLLLLLLLLLllllllhHHHH


DSSP  HHHHHHHHHHLLLHHHH-HHHHHHHHHHL-LLLHHHhhhhlllllllllhhhllhhhhll
Query EEYSIAASVWKLSACDL-CEIARNSVYQS-GFSHALkshwigkdyykrgpdgndihktnv  584
ident       | |   |          |         | |                        
Sbjct ISAEYIAQVKGISVEEViEVTTQNALKLFpKLRHLL------------------------  265
DSSP  HHHHHHHHHHLLLHHHHhHHHHHHHHHHLlLHHHHL------------------------


DSSP  lhhhhhhhhhhhhhhhhhhlllllllllllll
Query phirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                 
Sbjct --------------------------------  265
DSSP  --------------------------------


No 12: Query=2a3lA Sbjct=4c5yA Z-score=12.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
ident                                                             
Sbjct -----------deakvtiiyagllipgdgEPLRnaalvisdkiiafvgseadipkkylrs   49
DSSP  -----------lllleeeeeeeeelllllLLEEeeeeeeelleeeeeeehhhllhhhhhh


DSSP  ------lLLLLlllLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhh
Query ------aPHRDfynVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlr  207
ident        |          | | |                                     
Sbjct tqsthrvPVLM---PGLWDCHMHFG-----------------------------------   71
DSSP  llleeeeEEEE---ELEEEEEELLL-----------------------------------


DSSP  hhhhhhlllllllLLLLllllllllllllllllhhhhllllllhhHHHHllllllllLLL
Query evfesldltgydlNVDLldvhadkstfhrfdkfnlkynpcgqsrlREIFlkqdnliqGRF  267
ident                                                             
Sbjct ---------gdddYYND------------------------ytsgLATH--------PAS   90
DSSP  ---------llllLLLL------------------------lhhhHHLL--------HHH


DSSP  HHHHHHHHHHHHLLLLLEEEEEEEelllllllhhhhhhhhhhlLLLL-----LLLEEEE-
Query LGEITKQVFSDLEASKYQMAEYRIsiygrkmsewdqlaswivnNDLY-----SENVVWL-  321
ident  |              |                                     ||    
Sbjct SGARLARGCWEALQNGYTSYRDLA------------gygcevaKAINdgtivGPNVYSSg  138
DSSP  HHHHHHHHHHHHHHLLEEEEEELL------------llhhhhhHHHHlllllLLEEEELl


DSSP  EEEELLH----hhhlLLLL---------------------lllLHHHHHHHLLHhhhhhh
Query IQLPRLY----niykDMGI---------------------vtsFQNILDNIFIPlfeatv  356
ident   |              |                                          
Sbjct AALSQTAghgdifalPAGEvlgsygvmnprpgywgagplciadGVEEVRRAVRL------  192
DSSP  LEEELLLllllllllLHHHhhhhhlllllllllllllleeellLHHHHHHHHHH------


DSSP  lhhhllllhhhHLLEEEEEEE-LLLLllllllllllllllllllllllLHHHHHHHHHHH
Query dpdshpqlhvfLKQVVGFDLV-DDESkperrptkhmptpaqwtnafnpAFSYYVYYCYAN  415
ident                                                             
Sbjct ---------qiRRGAKVIXVMaSGGV-----------msrddnpnfaqFSPEELKVIVEE  232
DSSP  ---------hhHHLLLLEEEElLLLL-----------lllllllllllLLHHHHHHHHHH


DSSP  HHHHhhhhllllllLLEELLLLLlllLLHHHHHHHH-HLLLLLLLHHHHhlHHHHHHHHH
Query LYVLnklreskgmtTITLRPHSGeagDIDHLAATFL-TCHSIAHGINLRksPVLQYLYYL  474
ident                     |           |     | |  |            |   
Sbjct AARQ----------NRIVSAHVH---GKAGIMAAIKaGCKSLEHVSYAD--EEVWELMKE  277
DSSP  HHHL----------LLLEEEEEL---LHHHHHHHHHhLLLEEEELLLLL--HHHHHHHHH


DSSP  HLLLEEELHHHHLL------------------LLLLllLLLHHHHHHLLLLEEELLLLHh
Query AQIGLAMSPLSNNS------------------LFLDyhRNPFPVFFLRGLNVSLSTDDPl  516
ident   |                                |            |    | ||   
Sbjct KGILYVATRSVIEIflasngeglvkeswaklqALADshLKAYQGAIKAGVTIALGTDTA-  336
DSSP  HLLEEELLHHHHHHhhhhllllllllhhhlllHHHHhhHHHHHHHHHLLLLEELLLLLL-


DSSP  hhllllLHHHHHHHHHHHHHLLLHHHHHHH-HHHHhHHLL--LLHHHHhhHLLLLL----
Query qihltkEPLVEEYSIAASVWKLSACDLCEI-ARNSvYQSG--FSHALKshWIGKDY----  569
ident        |   |   |                 |    |                |    
Sbjct ----pgGPTALELQFAVERGGMTPLEAIKAaTANA-PLSVgpQAPLTG--QLREGYeadv  389
DSSP  ----llLLLHHHHHHHHHLLLLLHHHHHHHhLLLH-HHHHhhHLLLLL--LLLLLLllle


DSSP  llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                
Sbjct ialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  eeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 13: Query=2a3lA Sbjct=3mkvA Z-score=12.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLLL---------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRDF---------------------  159
ident                                      |                      
Sbjct -------------------------lttflfrNGALLDPdhpdllqgfeiliedgfirev   35
DSSP  -------------------------lleeeeeEEEELLLllllleeeeeeeeelleeeee


DSSP  -------------------lLLLEEEEEEELLlLLLHhhhhhhhhhhhhllllllleeel
Query -------------------yNVRKVDTHVHHSaCMNQkhllrfiksklrkepdevvifrd  200
ident                          | |||                              
Sbjct sdkpikssnahvidvkgktiMPGLIDLHVHVV-AIEF-----------------------   71
DSSP  ellllllllleeeelllleeEELEEEEEELLL-LLLL-----------------------


DSSP  leeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhHHHHllll
Query gtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlREIFlkqd  260
ident                                                             
Sbjct -----------------------------------------------nlprvATLP----   80
DSSP  -----------------------------------------------lhhhhLLLL----


DSSP  llllLLLHHHHHHHHHHHHLLLLLEEEEEEEElllllllhhhhhhhhhhllLLLL-----
Query nliqGRFLGEITKQVFSDLEASKYQMAEYRISiygrkmsewdqlaswivnnDLYS-----  315
ident                                                             
Sbjct ----NVLVTLRAVPIMRAMLRRGFTTVRDAGG-------------agypfkQAVEsglve  123
DSSP  ----HHHHHHHHHHHHHHHHHLLEEEEEELLL-------------llhhhhHHHHlllll


DSSP  -LLEEEEE-EEELLH------hhhlLLLL---------------lllLHHHHHHHLLHhh
Query -ENVVWLI-QLPRLY------niykDMGI---------------vtsFQNILDNIFIPlf  352
ident           |               |                                 
Sbjct gPRLFVSGrALSQTGghadprarsdYMPPdspcgccvrvgalgrvadGVDEVRRAVRE--  181
DSSP  lLEEEELLlEEELLLllllllllllLLLLllllllllllllleeellLHHHHHHHHHH--


DSSP  hhhhlhhhllllhhhhlLEEEEEEE---------lLLLLlllllllllllllllllllll
Query eatvdpdshpqlhvflkQVVGFDLV---------dDESKperrptkhmptpaqwtnafnp  403
ident                                                             
Sbjct -------------elqmGADQIXIMasggvasptdPVGV-------------------fg  209
DSSP  -------------hhhhLLLLEEEEllllllllllLLLL-------------------ll


DSSP  LHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLllllLHHHHHHHH-HLLLLLLLHHH
Query AFSYYVYYCYANLYVLNklreskgmttITLRPHSGeagdIDHLAATFL-TCHSIAHGINL  462
ident           |                     |          |         | ||   
Sbjct YSEDEIRAIVAEAQGRG----------TYVLAHAY---tPAAIARAVRcGVRTIEHGNLI  256
DSSP  LLHHHHHHHHHHHHLLL----------LLEEEEEL---lHHHHHHHHHlLLLEEEELLLL


DSSP  HhlHHHHHHHHHHLLLEEELHHHHLL-------------------LLLLLlLLLHHHHHH
Query RksPVLQYLYYLAQIGLAMSPLSNNS-------------------LFLDYhRNPFPVFFL  503
ident         |                                                   
Sbjct D--DETARLVAEHGAYVVPTLVTYDAlasegekyglppesiakiaDVHGAgLHSIEIMKR  314
DSSP  L--HHHHHHHHHHLLEEELLHHHHHHhhhhlllllllhhhhllhhHHHLLhHHHHHHHHH


DSSP  LLLLEEELLLLHHHHLlllLHHHHHHHHHHhhHLLLHHHHHHHHH-HHHHHLLLlhhhHH
Query RGLNVSLSTDDPLQIHltkEPLVEEYSIAAsvWKLSACDLCEIAR-NSVYQSGFshalKS  562
ident  |      ||              |  | |    ||       |   |    |       
Sbjct AGVKMGFGTDLLGEAQ---RLQSDEFRILA--EVLSPAEVIASATiVSAEVLGM----QD  365
DSSP  HLLLLLLLLLLLHHHH---HHLLHHHHHHH--LLLLHHHHHHHLLhHHHHHLLL----LL


DSSP  HH-LLLLlllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query HW-IGKDyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                        
Sbjct KLgRIVP------gahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  LLlLLLL------llllleeeellllllllllllllllllleeeelleeeeelll


No 14: Query=2a3lA Sbjct=3mtwA Z-score=12.0

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                  |   |                      
Sbjct -------------------------aeikavsAARLLDvasgkyvdnplvivtdgritsi   35
DSSP  -------------------------lleeeeeEEEEEElllleeeeleeeeeelleeeee


DSSP  -------------------llLLLEEEEEEELLlLLLHhhhhhhhhhhhhllllllleee
Query -------------------fyNVRKVDTHVHHSaCMNQkhllrfiksklrkepdevvifr  199
ident                           | |||                             
Sbjct gkkgdavpagatavdlpgvtlLPGLIDMHVHLD-SLAE----------------------   72
DSSP  eellllllllleeeeeeeeeeEELEEEEEELLL-LLLL----------------------


DSSP  lleeelhhhhhhhhllllllllLLLLLllllllllllllllhhhhllllllhHHHHHlll
Query dgtyltlrevfesldltgydlnVDLLDvhadkstfhrfdkfnlkynpcgqsrLREIFlkq  259
ident                                                     |       
Sbjct ---------------------vGGYNS-------------------------LEYSD---   83
DSSP  ---------------------lLHHHH-------------------------HHLLH---


DSSP  llllllLLHHHHHHHHHHHHLlLLLE-EEEEEEElllllllhhhhhhhhhhllLLLL---
Query dnliqgRFLGEITKQVFSDLEaSKYQ-MAEYRISiygrkmsewdqlaswivnnDLYS---  315
ident       ||                                              |     
Sbjct ------RFWSVVQTANAKKTL-EAGFtTVRNVGA-------------adyddvGLREaid  123
DSSP  ------HHHHHHHHHHHHHHH-HLLEeEEEELLL-------------lllhhhHHHHhhh


DSSP  ------LLEEEE-EEEELLH-----hhhlLLLL-----lllLHHHHHHHLLHhhhhhhlh
Query ------ENVVWL-IQLPRLY-----niykDMGI-----vtsFQNILDNIFIPlfeatvdp  358
ident          |   |                                              
Sbjct agyvpgPRIVTAaISFGATGghcdstffpPSMDqknpfnsdSPDEARKAVRT--------  175
DSSP  llllllLEEEELlLLEELLLlllllllllHHHLllllllllLHHHHHHHHHH--------


DSSP  hhllllHHHHllEEEEEEE-LLLLlllllllllllllllllllllllHHHHHHHHHHHHH
Query dshpqlHVFLkqVVGFDLV-DDESkperrptkhmptpaqwtnafnpaFSYYVYYCYANLY  417
ident                                                             
Sbjct -----lKKYG--AQVIXICaTGGV-----------fsrgnepgqqqlTYEEMKAVVDEAH  217
DSSP  -----hHHLL--LLEEEEElLLLL-----------llllllllllllLHHHHHHHHHHHH


DSSP  HHhhhhllllllLLEELLLLLLlllLHHHHHHHH-HLLLLLLLHHHhhLHHHHHHHHHHL
Query VLnklreskgmtTITLRPHSGEagdIDHLAATFL-TCHSIAHGINLrkSPVLQYLYYLAQ  476
ident              |    |                    | |            |     
Sbjct MA----------GIKVAAHAHG---ASGIREAVRaGVDTIEHASLV--DDEGIKLAVQKG  262
DSSP  HL----------LLEEEEEELL---HHHHHHHHHlLLLEEEELLLL--LHHHHHHHHHHL


DSSP  LLEEELHHHHL------------------LLLLlLLLL--LHHHHHHLLLLEEELLLLhH
Query IGLAMSPLSNN------------------SLFLdYHRN--PFPVFFLRGLNVSLSTDDpL  516
ident     |                                    |      |      ||   
Sbjct AYFSMDIYNTDytqaegkkngvlednlrkDRDI-GELQreNFRKALKAGVKMVYGTDA-G  320
DSSP  LEEELLLLLHHhhhhhhhhhlllhhhhhhHHHH-HHHHhhHHHHHHHHLLEEELLLLL-L


DSSP  HHLlllLHHHHHHHHHHHhHLLLHHHHHHHH-HHHHHHLLLlHHHHhhHLLLLlllllhh
Query QIHltkEPLVEEYSIAASvWKLSACDLCEIA-RNSVYQSGFsHALKshWIGKDyykrgpd  575
ident                               |        |                    
Sbjct IYP--hGDNAKQFAVMVR-YGATPLQAIQSAtLTAAEALGR-SKDV--GQVAV-------  367
DSSP  LLL--lLLHHHHHHHHHH-LLLLHHHHHHHLlHHHHHHHLL-LLLL--LLLLL-------


DSSP  hllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query gndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                          
Sbjct ----grygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  ----llllleeeelllllllhhhhhllleeeelleeeelll


No 15: Query=2a3lA Sbjct=1yrrB Z-score=11.9

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                                             
Sbjct -----------------------------yalTQGRIFtgheflddhavviadgliksvc   31
DSSP  -----------------------------leeELLEEElllleelleeeeeelleeeeee


DSSP  -----------------lLLLLEEEEEEElllLLLHhhhhhhhhhhhhllllllleeell
Query -----------------fYNVRKVDTHVHhsaCMNQkhllrfiksklrkepdevvifrdg  201
ident                         |                                   
Sbjct pvaelppeieqrslngaiLSPGFIDVQLN---GCGG------------------------   64
DSSP  ehhhlllllleeelllleEEELEEEEEEL---EELL------------------------


DSSP  eeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhHHHHLLlll
Query tyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlREIFLKqdn  261
ident                                                             
Sbjct -----------------------------------------------vqfnDTAEAV---   74
DSSP  -----------------------------------------------eellLLLLLL---


DSSP  llllllHHHHHHHHHHHHLLLLLEEEEEEEELLLllLLHHHHHHHHHHLL-LLLLLLEE-
Query liqgrfLGEITKQVFSDLEASKYQMAEYRISIYGrkMSEWDQLASWIVNN-DLYSENVV-  319
ident         |         | |                    |                  
Sbjct ------SVETLEIMQKANEKSGCTNYLPTLITTS--DELMKQGVRVMREYlAKHPNQALg  126
DSSP  ------LHHHHHHHHHHHHLLLEEEEEEEELLLL--HHHHHHHHHHHHHHhHHLLLLLLl


DSSP  EEEEEELLhhhhlllllllllhhhhHHHLLHHhhhhhlhhhllllhhHHLLEEEEEEell
Query WLIQLPRLyniykdmgivtsfqnilDNIFIPLfeatvdpdshpqlhvFLKQVVGFDLvdd  379
ident      | |                       |                        |   
Sbjct LHLEGPWL----------------nAALVDFL-------------ceNADVITKVTL---  154
DSSP  EEEELLLL----------------lLHHHHHH-------------hhLHHHEEEEEE---


DSSP  lllllllllllllllllllllllllHHHHHHHHHHHHHHHhhhhllllllLLEELLLLll
Query eskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLnklreskgmtTITLRPHSge  439
ident                                     |              |        
Sbjct ------------------------aPEMVPAEVISKLANA----------GIVVSAGH-s  179
DSSP  ------------------------lHHHLLHHHHHHHHHH----------LLEEEELL-l


DSSP  LLLLHHHHHHHH-HLLLLLLLH--hhHHLH------hHHHHHHhhLLLEEELH-HHHLll
Query AGDIDHLAATFL-TCHSIAHGI--nlRKSP------vLQYLYYlaQIGLAMSP-LSNNsl  489
ident         | |        |                          |             
Sbjct NATLKEAKAGFRaGITFATHLYnampYITGrepglagAILDEA--DIYCGIIAdGLHV--  235
DSSP  LLLHHHHHHHHHhLEEEELLLLllllLLLLlllhhhhHHHHLL--LLEEEEELlLLLL--


DSSP  lllLLLLlHHHHHHLLL-LEEELLLLHHHHLllllHHHHHHHHHHHHHLLLHHHHHHHH-
Query fldYHRNpFPVFFLRGL-NVSLSTDDPLQIHltkePLVEEYSIAASVWKLSACDLCEIA-  547
ident       |              | ||             |                   | 
Sbjct ---DYAN-IRNAKRLKGdKLCLVTDATSGSS---lTMIEGVRNLVEHCGIALDEVLRMAt  288
DSSP  ---LHHH-HHHHHHHHHhHEEEELLLLLLLL---lLHHHHHHHHHHHHLLLHHHHHHHHl


DSSP  HHHHHHLLLlHHHHhhHLLLLLllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllll
Query RNSVYQSGFsHALKshWIGKDYykrgpdgndihktnvphirvefrdtiwkeemqqvylgk  607
ident        |                                                    
Sbjct LYPARAIGV-EKRL-gTLAAGK---------------------vanltaftpdfkitkti  325
DSSP  HHHHHHLLL-LLLL-lLLLLLL---------------------llleeeellllleeeee


DSSP  lllllllll
Query avisdevvp  616
ident          
Sbjct vngnevvtq  334
DSSP  elleeeeel


No 16: Query=2a3lA Sbjct=1bf6A Z-score=11.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHSacmnqkhl  180
ident                                                | |          
Sbjct -------------------------------------sfdpTGYTLAHEHLH--------   15
DSSP  -------------------------------------llllLLEEEEEELLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   15
DSSP  ------------------------------------------------------------


DSSP  hhhhLLLLLLhhhHHHLLlllllllllHHHHHHHHHHHHLLLLLE-EEEEEEELLlllll
Query nlkyNPCGQSrlrEIFLKqdnliqgrfLGEITKQVFSDLEASKYQ-MAEYRISIYgrkms  299
ident                                                       |     
Sbjct --idLSGFKN---NVDCR--------lDQYAFICQEMNDLMTRGVrNVIEMTNRY-----   57
DSSP  --eeLHHHHL---LHHHE--------eLLHHHHHHHHHHHHHLLEeEEEELLLHH-----


DSSP  hhhhHHHHHhlLLLL---LLLEEEEEEEEL--LHHHHlllllLLLL-HHHHHHHLLHHHH
Query ewdqLASWIvnNDLY---SENVVWLIQLPR--LYNIYkdmgiVTSF-QNILDNIFIPLFE  353
ident      |      |       |||                    |   |            
Sbjct -mgrNAQFM--LDVMretGINVVACTGYYQdaFFPEH----vATRSvQELAQEMVDEIEQ  110
DSSP  -hllLHHHH--HHHHhhhLLEEEEEELLLLhhHLLLH----hHHLLhHHHHHHHHHHHHL


DSSP  HhhlhhhlllLHHHHllEEEEE-EELLLLLllllllllllllllllllllLLHHHHHHHH
Query AtvdpdshpqLHVFLkqVVGFD-LVDDESKperrptkhmptpaqwtnafnPAFSYYVYYC  412
ident                            | |                    |         
Sbjct G-------idGTELK--AGIIAeIGTSEGK------------------itPLEEKVFIAA  143
DSSP  L-------llLLLLL--EEEEEeEELLLLL------------------llHHHHHHHHHH


DSSP  HHHHHHHHhhhlllllllLEELLLLLLLLllhHHHHHHHH---------LLLLLLLH--H
Query YANLYVLNklreskgmttITLRPHSGEAGdidHLAATFLT---------CHSIAHGI--N  461
ident                        |                              |     
Sbjct ALAHNQTG----------RPISTHTSFST---MGLEQLALlqahgvdlsRVTVGHCDlkD  190
DSSP  HHHHHHHL----------LLEEEELHHHL---LHHHHHHHhhhllllhhHEEELLLLllL


DSSP  HHHlhhHHHHHHHHLLLEEE-LHHHhlLLLLLLLLL--LHHHHHHLLL--LEEELLLL--
Query LRKspvLQYLYYLAQIGLAM-SPLSnnSLFLDYHRN--PFPVFFLRGL--NVSLSTDD--  514
ident                                              |||   | || |   
Sbjct NLD---NILKMIDLGAYVQFdTIGK--NSYYPDEKRiaMLHALRDRGLlnRVMLSMDItr  245
DSSP  LHH---HHHHHHHLLLEEEElLLLL--LLLLLHHHHhhHHHHHHHLLLhhHEEELLLLll


DSSP  ------hHHHLlllLHHH-HHHHHHHHHhLLLHHHHHHHH-HHHHHHLLllhhhhhhhll
Query ------pLQIHltkEPLV-EEYSIAASVwKLSACDLCEIA-RNSVYQSGfshalkshwig  566
ident                 |              |  |       |                 
Sbjct rshlkanGGYG--yDYLLtTFIPQLRQS-GFSQADVDVMLrENPSQFFQ-----------  291
DSSP  hhhlhhhLLLL--lLHHHhLHHHHHHHL-LLLHHHHHHHHlHHHHHHLL-----------


DSSP  lllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query kdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                   
Sbjct --------------------------------------------------  291
DSSP  --------------------------------------------------


No 17: Query=2a3lA Sbjct=2vc5A Z-score=11.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                                | |          
Sbjct --------------------------mriplvgkdsieskdiGFTLIHEHLR--------   26
DSSP  --------------------------llllllllllllhhhlLLEELLLLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   26
DSSP  ------------------------------------------------------------


DSSP  hhHHLLLLLL--HHHHHHlllllllllLLHHHHHHHHHHHHLLLLLEEEEEEEELLllll
Query nlKYNPCGQS--RLREIFlkqdnliqgRFLGEITKQVFSDLEASKYQMAEYRISIYgrkm  298
ident                                                             
Sbjct --VFSEAVRQqwPHLYNE---------DEEFRNAVNEVKRAMQFGVKTIVDPTVMG----   71
DSSP  --LLLHHHHHhlHHHLLH---------HHHHHHHHHHHHHHHHLLLLEEEELLLLL----


DSSP  lhhhhHHHHHHllLLLL---LLEEEEEEEEL--LHHHHLllllLLLL-HHHHHHHLLHHH
Query sewdqLASWIVnnDLYS---ENVVWLIQLPR--LYNIYKdmgiVTSF-QNILDNIFIPLF  352
ident                      | |             |            | |       
Sbjct --lgrDIRFME--KVVKatgINLVAGTGIYIyiDLPFYF----LNRSiDEIADLFIHDIK  123
DSSP  --lllLHHHHH--HHHHlllLEEEELEELLLllLLLHHH----LLLLhHHHHHHHHHHHH


DSSP  HHhhlhhhlllLHHHHllEEEEEEEllLLLLlllllllllllllllllllLLHHHHHHHH
Query EAtvdpdshpqLHVFLkqVVGFDLVddESKPerrptkhmptpaqwtnafnPAFSYYVYYC  412
ident |                                                           
Sbjct EG-------iqGTLNK--AGFVXIA-aDEPG-----------------itKDVEKVIRAA  156
DSSP  LL-------llLLLLL--LLLEEEE-lLLLL-----------------llHHHHHHHHHH


DSSP  HHHHHHHHhhhlllllllLEELLLLLlLLLLhHHHHHHHHL---------LLLLLLHhhH
Query YANLYVLNklreskgmttITLRPHSGeAGDIdHLAATFLTC---------HSIAHGInlR  463
ident                        ||  |                        | |     
Sbjct AIANKETK----------VPIITHSN-AHNN-TGLEQQRILteegvdpgkILIGHLGdtD  204
DSSP  HHHHHHHL----------LLEEEELL-LLLL-HHHHHHHHHhhllllhhhEEELLHHhlL


DSSP  HLHhHHHHHHHHLLLEE-ELHHHhlLLLLLLLLL--LHHHHHHLLL--LEEELLLLHH--
Query KSPvLQYLYYLAQIGLA-MSPLSnnSLFLDYHRN--PFPVFFLRGL--NVSLSTDDPL--  516
ident                           |||               |       | |     
Sbjct NID-YIKKIADKGSFIGlDRYGL--DLFLPVDKRneTTLRLIKDGYsdKIMISHDYCCti  261
DSSP  LHH-HHHHHHHLLLEEEeLLLLL--LLLLLHHHHhhHHHHHHHLLLllLEEELLLLLLll


DSSP  ----------hhlllllHHHHHHHHHHHHHL---LLHHHHHHHH-HHHHHHLlllhhhhh
Query ----------qihltkePLVEEYSIAASVWK---LSACDLCEIA-RNSVYQSgfshalks  562
ident                               |           |   |             
Sbjct dwgtakpeykpklaprwSITLIFEDTIPFLKrngVNEEVIATIFkENPKKFF--------  313
DSSP  llllllhhhhhhhllllLLLHHHHLHHHHHHlllLLHHHHHHHHlHHHHHHL--------


DSSP  hhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query hwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                       
Sbjct -----------------------------------------------------s  314
DSSP  -----------------------------------------------------l


No 18: Query=2a3lA Sbjct=2uz9A Z-score=11.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLLL---------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRDF---------------------  159
ident                                                             
Sbjct ---------------------------plahiFRGTFVHstwtcpmevlrdhllgvsdsg   33
DSSP  ---------------------------llleeEEEEEEEllllllleeeeeeeeeellll


DSSP  ---------------------------------lLLLEEEEEEELLLL-LLHHhhhhhhh
Query ---------------------------------yNVRKVDTHVHHSAC-MNQKhllrfik  185
ident                                       |||| | |              
Sbjct kivfleeasqqeklakewcfkpceirelshheffMPGLVDTHIHASQYsFAGS-------   86
DSSP  leeeeeehhhhhhhhhhhlllhhheeellllleeEELEEEEEEEHHHHhHLLL-------


DSSP  hhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllLLLH-HHH
Query sklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfDKFN-LKY  244
ident                                                             
Sbjct ---------------------------------------------sidlpllEWLTkYTF  101
DSSP  ---------------------------------------------lllllhhHHHHhLHH


DSSP  LlllllhhhhhhlLLLLlllLLLHHHHHHHHHHHHLlLLLE-EEEEEEELllllllHHHH
Query NpcgqsrlreiflKQDNliqGRFLGEITKQVFSDLEaSKYQ-MAEYRISIygrkmsEWDQ  303
ident                 |     |  |    |            | |   |        | 
Sbjct P---------aehRFQN---IDFAEEVYTRVVRRTL-KNGTtTACYFATI------HTDS  142
DSSP  H---------hhhHHHL---HHHHHHHHHHHHHHHH-HLLEeEEEEELLL------LHHH


DSSP  HHhhhhllLLLL--LLEE-EEEEEELLHHHHLlllllllLHHHHHHHLLHHHHhhhlhhh
Query LAswivnnDLYS--ENVV-WLIQLPRLYNIYKdmgivtsFQNILDNIFIPLFEatvdpds  360
ident         |                 |                         |       
Sbjct SL---llaDITDkfGQRAfVGKVCMDLNDTFP--eyketTEESIKETERFVSE-------  190
DSSP  HH---hhhHHHHhhLLEEeEELEELLLLLLLL--lllllHHHHHHHHHHHHHH-------


DSSP  lllLHHHhLLEEEEEEELllllllllllllllllllllllllllHHHHHHHHHHHHHHHH
Query hpqLHVFlKQVVGFDLVDdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLN  420
ident                                                             
Sbjct -mlQKNYsRVKPIVTPRF----------------------slscSETLMGELGNIAKTRD  227
DSSP  -hhHHLLlLEEEEEEELL----------------------hhhlLHHHHHHHHHHHHHHL


DSSP  hhhlllllllLEELLLLLL---LLLL---------HHHHHHHHH-----lLLLLLLHHHH
Query klreskgmttITLRPHSGE---AGDI---------DHLAATFLT-----cHSIAHGINLR  463
ident                |  |                                  |||  | 
Sbjct ----------LHIQSHISEnrdEVEAvknlypsykNYTSVYDKNnlltnkTVMAHGCYLS  277
DSSP  ----------LEEEEEELLlhhHHHHhhhhlllllLHHHHHHHLllllllEEEEELLLLL


DSSP  hlHHHHHHHHHHLLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLhHHHLlll
Query ksPVLQYLYYLAQIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDpLQIHltk  522
ident                 |  | ||                        | ||         
Sbjct --AEELNVFHERGASIAHCPNSNLsLSSG---FLNVLEVLKHEVKIGLGTDV-AGGY--s  329
DSSP  --HHHHHHHHHHLLEEEELHHHHHhLLLL---LLLHHHHHHLLLEEEELLLL-LLLL--l


DSSP  lHHHHHHHHHHHHH-----------LLLHHHHHHH-HHHHHHHLLLlHHHHhhHLLLLLL
Query ePLVEEYSIAASVW-----------KLSACDLCEI-ARNSVYQSGFsHALKshWIGKDYY  570
ident          |  |             |                 |               
Sbjct ySMLDAIRRAVMVSnillinkvnekSLTLKEVFRLaTLGGSQALGL-DGEI--GNFEVGK  386
DSSP  lLHHHHHHHHHHHHhhhhhllllllLLLHHHHHHHhLHHHHHHLLL-LLLL--LLLLLLL


DSSP  ------------lllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query ------------krgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                           
Sbjct efdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  llleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 19: Query=2a3lA Sbjct=3cjpA Z-score=11.2

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                              | | |          
Sbjct ------------------------------------------LIIDGHTHVI--------   10
DSSP  ------------------------------------------LLEEEEEELL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   10
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEE--------
Query nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRIS--------  292
ident                                                             
Sbjct -----------------------------lPVEKHIKIMDEAGVDKTILFSTsihpetav   41
DSSP  -----------------------------lLHHHHHHHHHHHLLLEEEEELLlllhhhll


DSSP  -------------------lLLLLlLHHHHH-HHHHhllLLLLLLEEEEEEEELLHhhhl
Query -------------------iYGRKmSEWDQL-ASWIvnnDLYSENVVWLIQLPRLYniyk  332
ident                                          |    |     |       
Sbjct nlrdvkkemkklndvvngktNSMI-DVRRNSiKELTnviQAYPSRYVGFGNVPVGL----   96
DSSP  lhhhhhhhhhhhhhhhllllLLLH-HHHHHHhHHHHhhhHHLLLLEEEEELLLLLL----


DSSP  lllllllLHHHHHHHLLHHhhhhhlhhhllllHHHHllEEEEE-EELLLlllllllllll
Query dmgivtsFQNILDNIFIPLfeatvdpdshpqlHVFLkqVVGFD-LVDDEskperrptkhm  391
ident          |                             ||   |               
Sbjct -------SENDTNSYIEEN------------iVNNK--LVGIGeLTPAS-----------  124
DSSP  -------LHHHHHHHHHHH------------lLLLL--LLEEEeELLLL-----------


DSSP  llllllllllllLHHHHHHHHHHHHHHHHhhhllllllLLEELLLlLLLL-LLHHHHHHH
Query ptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmtTITLRPHsGEAG-DIDHLAATF  450
ident                                             |               
Sbjct ------------GQIKSLKPIFKYSMDSG---------SLPIWIH-AFNPlVLQDIKEIA  162
DSSP  ------------LLHHHHHHHHHHHHHLL---------LLLEEEL-LLLLlLHHHHHHHH


DSSP  HHL-------LLLLL-LHHHHHLhhHHHHHHHHL-LLEEELHHhhllllLLLLllLHHHH
Query LTC-------HSIAH-GINLRKSpvLQYLYYLAQ-IGLAMSPLsnnslfLDYHrnPFPVF  501
ident   |           | |           |    |   |  |                   
Sbjct ELCkafpkvpVILGHmGGSNWMT--AVELAKEIQnLYLDTSAY------FSTF--VLKIV  212
DSSP  HHHhhlllllEEEHHhHHHHHHH--HHHHHHHLLlEEEELLLL------LLHH--HHHHH


DSSP  HHLL-lLEEELLLLHHhhlllllHHHHHHHHHHHHHlLLHHHHHHHH-HHHHHhLLLLhh
Query FLRG-lNVSLSTDDPLqihltkePLVEEYSIAASVWkLSACDLCEIA-RNSVYqSGFSha  559
ident            || |         |                        |          
Sbjct INELplKCIFGTDMPF------gDLQLSIEAIKKMS-NDSYVANAVLgDNISR-LLNI--  262
DSSP  HHHLllLEELLLLLLL------lLHHHHHHHHHHHL-LLHHHHHHHHlHHHHH-HHLL--


DSSP  hhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query lkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                          
Sbjct ---------------------------------------------------------  262
DSSP  ---------------------------------------------------------


No 20: Query=2a3lA Sbjct=3gg7A Z-score=11.2

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLLlllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSAcmnqkhl  180
ident                                              | |||          
Sbjct ------------------------------------------SLIDFHVHLDL-------   11
DSSP  ------------------------------------------LLEEEEELHHH-------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   11
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllhhHHHHHHHHHHLLLLlEEEEEEEELLLllllh
Query nlkynpcgqsrlreiflkqdnliqgrflgEITKQVFSDLEASKyQMAEYRISIYGrkmse  300
ident                                   |    |                    
Sbjct ----------------------------yPDPVAVARACEERQ-LTVLSVTTTPA-----   37
DSSP  ----------------------------lLLHHHHHHHHHHLL-LEEEELLLLHH-----


DSSP  hhhHHHHHHlllLLLLLEEEEEEEEL-LHHHHlllllllllhHHHHHHLLHHhhhhhlhh
Query wdqLASWIVnndLYSENVVWLIQLPR-LYNIYkdmgivtsfqNILDNIFIPLfeatvdpd  359
ident                  |                          |      |        
Sbjct --aWRGTLA-laAGRPHVWTALGFHPeVVSER---------aADLPWFDRYL--------   77
DSSP  --hHHHHHH-hhLLLLLEEELLLLLHhHLLLL---------hHHLHHHHHHH--------


DSSP  hllllhhhhllEEEE-EEELlLLLLLllllllllllllllllLLLL-HHHHHHHHHHHHH
Query shpqlhvflkqVVGF-DLVDdESKPErrptkhmptpaqwtnaFNPA-FSYYVYYCYANLY  417
ident                         |                                   
Sbjct ---------peTRFVgEVGL-DGSPS--------------lrGTWTqQFAVFQHILRRCE  113
DSSP  ---------hhLLEEeEEEL-LLLHH--------------hhHHHHhHHHHHHHHHHHHH


DSSP  HHHhhhllllllLLEELLLLlLLLLLHHHHHHHHH----LLLLLLLHHHHHlhhHHHHHH
Query VLNklreskgmtTITLRPHSgEAGDIDHLAATFLT----CHSIAHGINLRKspvLQYLYY  473
ident                |  ||        |                               
Sbjct DHG---------GRILSIHS-RRAESEVLNCLEANprsgTPILHWYSGSVT---ELRRAI  160
DSSP  HLL---------LEEEEEEL-LLLHHHHHHHHHHLhhheEEEEELLLLLHH---HHHHHH


DSSP  HHLLLEEELhHHHLlllllLLLL--LHHHHHhlLLLEEELLLLHHHHLL----llLHHHH
Query LAQIGLAMSpLSNNslfldYHRN--PFPVFFlrGLNVSLSTDDPLQIHL----tkEPLVE  527
ident                                     |   || |                
Sbjct SLGCWFSVG-PTMV----rTQKGaaLIRSMP--RDRVLTETDGPFLELDgqaalpWDVKS  213
DSSP  HLLLEEEEL-HHHH----lLHHHhhHHHHLL--HHHEEELLLLLLLEELleellhHHHHH


DSSP  HHHHHHHHHLLL-HHHHHHHHHHHHHHLlllhhhhhhhlllllllllhhhllhhhhlllh
Query EYSIAASVWKLS-ACDLCEIARNSVYQSgfshalkshwigkdyykrgpdgndihktnvph  586
ident         |             |                                     
Sbjct VVEGLSKIWQIPaSEVERIVKENVSRLL--------------------------------  241
DSSP  HHHHHHHHHLLLhHHHHHHHHHHHHHHH--------------------------------


DSSP  hhhhhhhhhhhhhhhhhlllllllllllll
Query irvefrdtiwkeemqqvylgkavisdevvp  616
ident                               
Sbjct ----------------------------gt  243
DSSP  ----------------------------hl


No 21: Query=2a3lA Sbjct=3nqbA Z-score=11.1

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhlllllllllLLL
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvaPWE   60
ident                                                          |  
Sbjct --------------------------------------------------------ePAD    4
DSSP  --------------------------------------------------------lLHH


DSSP  LLlllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query KEepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct LN------------------------------------------------------ddtl   10
DSSP  HL------------------------------------------------------lhhh


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHHL--------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKSA--------------------------  154
ident                                  |                          
Sbjct raravaaargdqrfdvlitggtlvdvvtgELRPAdigivgaliasvhepasrrdaaqvid   70
DSSP  hhhhhhhhhlllleeeeeelleeelllllLEEELeeeeelleeeeeellllllleeeeee


DSSP  --LLLLllLLLEEEEEEELLLLLlhhhhhhhhhhhhhllllllleeelleeelhhhhhhh
Query --PHRDfyNVRKVDTHVHHSACMnqkhllrfiksklrkepdevvifrdgtyltlrevfes  212
ident              ||| |                                          
Sbjct agGAYV--SPGLIDTHXHIESSX-------------------------------------   91
DSSP  llLLEE--EELEEEEEELHHHHL-------------------------------------


DSSP  hlllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHH
Query ldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeIT  272
ident                                                             
Sbjct ---------------------------------------------------------iTP   94
DSSP  ---------------------------------------------------------lLH


DSSP  HHHHHHHLlLLLE-EEEEEEEllllllLHHHhHHHHHhlLLLL--LLLEEEEEEEE--LL
Query KQVFSDLEaSKYQ-MAEYRISiygrkmSEWDqLASWIvnNDLY--SENVVWLIQLP--RL  327
ident                               |    |               |        
Sbjct AAYAAAVV-ARGVtTIVWDPH-efgnvHGVD-GVRWA-aKAIEnlPLRAILLAPSCvpSA  150
DSSP  HHHHHHHH-LLLEeEEEELLH-hhhhhHLHH-HHHHH-hHHHLllLLEEEEEELLLllLL


DSSP  HHHHLllllllllhhHHHHHLLhhhhhhhlhhhllllhhhHLLEEEE-EEELllllllll
Query YNIYKdmgivtsfqnILDNIFIplfeatvdpdshpqlhvfLKQVVGF-DLVDdeskperr  386
ident                                              |              
Sbjct PGLER-----ggadfDAAILAD---------------llsWPEIGGIaEIXN--------  182
DSSP  LLLLL-----lllllLHHHHHH---------------hhlLLLEEEEeEELL--------


DSSP  llllllllllllllllllHHHH------HHHHHHHHHHHHhhhlllllllLEELLLLlLL
Query ptkhmptpaqwtnafnpaFSYY------VYYCYANLYVLNklreskgmttITLRPHSgEA  440
ident                                                        |    
Sbjct ------------------XRGVierdprXSGIVQAGLAAE----------KLVCGHA-RG  213
DSSP  ------------------HHHHhlllhhHHHHHHHHHHHL----------LEEEELL-LL


DSSP  LLLHHHHHHHH-HLLLLLLLH---HHHHlhhhHHHHhhhlLLEEELhHHHLllllLLLLL
Query GDIDHLAATFL-TCHSIAHGI---NLRKspvlQYLYylaqIGLAMSpLSNNslflDYHRN  496
ident      | |       |         |                      |           
Sbjct LKNADLNAFXAaGVSSDHELVsgeDLXA---kLRAG----LTIELR-GSHD----HLLPE  261
DSSP  LLHHHHHHHHHlLLLEELLLLlhhHHHH---hHHLL----LEEEEE-LLLH----HHHHH


DSSP  lHHHHH---HLLL-LEEELLLLHHH-HLLLLLHHHHHHHHHHHhHLLLHHHHHHHH-HHH
Query pFPVFF---LRGL-NVSLSTDDPLQ-IHLTKEPLVEEYSIAASvWKLSACDLCEIA-RNS  550
ident  |             | | |||      |    |            |        |  | 
Sbjct -FVAALntlGHLPqTVTLCTDDVFPdDLLQGGGLDDVVRRLVR-YGLKPEWALRAAtLNA  319
DSSP  -HHHHHhhhLLLLlLEEEELLLLLHhHHHHLLLHHHHHHHHHH-LLLLHHHHHHHHlHHH


DSSP  HHHLlLLHHHhhhHLLLLL-----------------------------------------
Query VYQSgFSHALkshWIGKDY-----------------------------------------  569
ident          |    |                                             
Sbjct AQRL-GRSDL--gLIAAGRradivvfedlngfsarhvlasgravaeggrxlvdiptcdtt  376
DSSP  HHHH-LLLLL--lLLLLLLllleeeellllllleeeeeelleeeeelleelllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  569
ident                                                             
Sbjct vlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxis  436
DSSP  hhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  569
ident                                                             
Sbjct vthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgg  496
DSSP  eellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhlll


DSSP  --------------------------------------------llllhhhllhhhhlll
Query --------------------------------------------ykrgpdgndihktnvp  585
ident                                                             
Sbjct gxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfga  556
DSSP  eeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhll


DSSP  hhhhhhhhhhhhhhhhhhlllllllllllll
Query hirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                
Sbjct tlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllllleelllleeelllleeellleeel


No 22: Query=2a3lA Sbjct=2ogjA Z-score=11.0

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHHLLL------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKSAPH------------------------  156
ident                                 |                           
Sbjct --------------qapilltnvkpvgfgKGASQSStdiliggdgkiaavgsalqapadt   46
DSSP  --------------llleeeeeeeellllLLLLLLLeeeeellllleeeeelllllllle


DSSP  ----lllLLLLEEEEEEEL-----LLLLlhhhhhhhhhhhhhllllllleeelleeelhh
Query ----rdfYNVRKVDTHVHH-----SACMnqkhllrfiksklrkepdevvifrdgtyltlr  207
ident             || |||                                          
Sbjct qridaafISPGWVDLHVHIwhggtDISI--------------------------------   74
DSSP  eelllleEEELEEEEEELLlllllLLLL--------------------------------


DSSP  hhhhhhlllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllll
Query evfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrf  267
ident                                                             
Sbjct ------------------------------------------------------------   74
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhHHHH-HLLLLLEEEEE-EEELllllllhHHHHHHHHhlLLLL---LLLEEEEE
Query lgeitkqVFSD-LEASKYQMAEY-RISIygrkmseWDQLASWIvnNDLY---SENVVWLI  322
ident          |                                           |      
Sbjct -------RPSEcGAERGVTTLVDaGSAG-------EANFHGFR--EYIIepsRERIKAFL  118
DSSP  -------LHHHlLHHHLEEEEEEeLLLL-------LLLHHHHH--HHLLlllLLEEEEEE


DSSP  EE------------ELLHhhhlllllllllHHHHhhHLLHHHHhhhlhhhllllHHHHLL
Query QL------------PRLYniykdmgivtsfQNILdnIFIPLFEatvdpdshpqlHVFLKQ  370
ident  |                                        |                 
Sbjct NLgsiglvacnrvpELRD------------IKDI--DLDRILE---------cyAENSEH  155
DSSP  ELllllllllllllLLLL------------HHHL--LHHHHHH---------hhHLLLLL


DSSP  EEEEEEElLLLLlllllllllllllllllllLLLHHHHHHHHHHHHHHHHhhhlllllll
Query VVGFDLVdDESKperrptkhmptpaqwtnafNPAFSYYVYYCYANLYVLNklreskgmtt  430
ident  ||                                   |         |           
Sbjct IVGLXVR-ASHV-----------------itGSWGVTPVKLGKKIAKILK----------  187
DSSP  EEEEEEE-ELHH-----------------hhLLLLLHHHHHHHHHHHHHL----------


DSSP  LEELLLLlLLLLlhHHHHHHHHL---LLLLLLH------HHHHLHHHHHHHHHHL-LLEE
Query ITLRPHSgEAGDidHLAATFLTC---HSIAHGI------NLRKSPVLQYLYYLAQ-IGLA  480
ident      |                        |               |  |      | | 
Sbjct VPXXVHV-GEPP-aLYDEVLEILgpgDVVTHCFngksgsSIXEDEDLFNLAERCEgIRLD  245
DSSP  LLEEEEE-LLLL-lLHHHHHHHLlllLEEELLLllllllLLLLLHHHHHHHHHLLlLEEE


DSSP  ELHHHHLllllllLLLLHHHHHH-LLLLEEELLLLHHHHLLL-lLHHHHHHHHHHHhHLL
Query MSPLSNNslfldyHRNPFPVFFL-RGLNVSLSTDDPLQIHLT-kEPLVEEYSIAASvWKL  538
ident                           |  | |||            |    |   |    
Sbjct IGHGGAS-----fSFKVAEAAIArGLLPFSISTDLHGHSXNFpvWDLATTXSKLLS-VDX  299
DSSP  LLLLLLL-----lLHHHHHHHHHlLLLLLLLLLLLLLLLLLLllLLHHHHHHHHHH-LLL


DSSP  LHHHHHHHH-HHHHHhLLLLHhhhhhhLLLL--------lllllhhhllhhhhlllhhhh
Query SACDLCEIA-RNSVYqSGFSHalkshwIGKD--------yykrgpdgndihktnvphirv  589
ident       |   ||                                                
Sbjct PFENVVEAVtRNPAS-VIRLD------XENRldvgqradftvfdlvdadleatdsngdvs  352
DSSP  LHHHHHHLLlHHHHH-HLLLL------LLLLllllllleeeeeeeeeeeeeeelllllee


DSSP  hhhhhhhhhhhhhhlllllllllllll
Query efrdtiwkeemqqvylgkavisdevvp  616
ident                            
Sbjct rlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeeeeelleeeellllllll


No 23: Query=2a3lA Sbjct=2ob3A Z-score=10.9

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                               || |          
Sbjct ---------------------------drintvrgpitiseaGFTLTHEHIC--------   25
DSSP  ---------------------------lleeelleeelhhhhLLEEEEELLE--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   25
DSSP  ------------------------------------------------------------


DSSP  hhHHLLL--lLLHHHHHHllllllllLLLHHHHHHHHHHHHLlLLLE-EEEEEEELLlll
Query nlKYNPC--gQSRLREIFlkqdnliqGRFLGEITKQVFSDLEaSKYQ-MAEYRISIYgrk  297
ident                              | |                            
Sbjct --GSSAGflrAWPEFFGS--------RKALAEKAVRGLRRAR-AAGVrTIVDVSTFD---   71
DSSP  --ELLLLhhhHLHHHHLL--------HHHHHHHHHHHHHHHH-HLLLlEEEELLLHH---


DSSP  llhhhhHHHHHHllLLLL--LLEEEEE-eEELLHhhHLLLllLLLL-HHHHHHHLLHHHH
Query msewdqLASWIVnnDLYS--ENVVWLI-qLPRLYniYKDMgiVTSF-QNILDNIFIPLFE  353
ident         |                    |         |                    
Sbjct ---igrDVSLLA--EVSRaaDVHIVAAtgLWFDP--PLSM--RLRSvEELTQFFLREIQY  122
DSSP  ---hllLHHHHH--HHHHhhLLEEELEeeLLLLL--LHHH--HLLLhHHHHHHHHHHHHL


DSSP  HhhlhhhlllLHHHHllEEEEEEElLLLLlllllllllllllllllllLLLHHHHHHHHH
Query AtvdpdshpqLHVFLkqVVGFDLVdDESKperrptkhmptpaqwtnafNPAFSYYVYYCY  413
ident                             |                    |          
Sbjct G-------ieDTGIR--AGIIXVA-TTGK------------------aTPFQELVLKAAA  154
DSSP  L-------llLLLLL--LLEEEEE-LLLL------------------lLHHHHHHHHHHH


DSSP  HHHHHHHhhhlllllllLEELLLLLLLLLlhHHHHHHHH---------LLLLLLL-HHHH
Query ANLYVLNklreskgmttITLRPHSGEAGDidHLAATFLT---------CHSIAHG-INLR  463
ident                       |                            | |      
Sbjct RASLATG----------VPVTTHTAASQR--DGEQQAAIfeseglspsRVCIGHSdDTDD  202
DSSP  HHHHHHL----------LLEEEELLHHHL--HHHHHHHHhhhllllhhHEEELLHhHLLL


DSSP  HLhhHHHHHHHHLLLEEE-LHHH------------hlLLLLLLLLL--LHHHHHHLLL--
Query KSpvLQYLYYLAQIGLAM-SPLS------------nnSLFLDYHRN--PFPVFFLRGL--  506
ident  |                                                      |   
Sbjct LS--YLTALAARGYLIGLdHIPYsaiglednasasalLGIRSWQTRalLIKALIDQGYmk  260
DSSP  HH--HHHHHHHLLLEEEElLLLLllllllllhhhhhhHLLLLHHHHhhHHHHHHHLLLhh


DSSP  LEEELLLL--------------hHHHLLL-lLHHH-HHHHHHHHHhLLLHHHHHHHH-HH
Query NVSLSTDD--------------pLQIHLT-kEPLV-EEYSIAASVwKLSACDLCEIA-RN  549
ident     | |                                             |  |   |
Sbjct QILVSNDWtfgfssyvtnimdvmDRVNPDgmAFIPlRVIPFLREK-GVPQETLAGITvTN  319
DSSP  HEEELLLLlleellllllhhhhhHHHLLLhhHHHHhLHHHHHHHL-LLLHHHHHHHHlHH


DSSP  HHHHLLllhhhhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllll
Query SVYQSGfshalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkav  609
ident                                                             
Sbjct PARFLS------------------------------------------------------  325
DSSP  HHHHHL------------------------------------------------------


DSSP  lllllll
Query isdevvp  616
ident        
Sbjct ---ptlr  329
DSSP  ---llll


No 24: Query=2a3lA Sbjct=3k2gB Z-score=10.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllLLLLll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqeTVAPwe   60
ident                                                             
Sbjct --------------------------------------------slselspchvRSGR--   14
DSSP  --------------------------------------------llllllllllLLLE--


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------   14
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                                | |          
Sbjct -----------------------------ixtvdgpipssalGHTLXHEHLQ--------   37
DSSP  -----------------------------eeelleeeehhhlLLEELLLLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhllllllLLLLLLlllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydLNVDLLdvhadkstfhrfdkf  240
ident                                             |               
Sbjct --------------ndcrcwwnppqeperqylaeapisiEILSEL---------------   68
DSSP  --------------eelhhhllllllhhhhhhhhllllhHHHHHH---------------


DSSP  hhhhlllllLHHHhhHLLLllllllllHHHHHHHHHHHHLLLLLEEEEEEEELLlllllh
Query nlkynpcgqSRLReiFLKQdnliqgrfLGEITKQVFSDLEASKYQMAEYRISIYgrkmse  300
ident                                         |                   
Sbjct ---rqdpfvNKHN--IALD--------DLDLAIAEVKQFAAVGGRSIVDPTCRG------  109
DSSP  ---hllhhhLLLL--LEEL--------LHHHHHHHHHHHHHLLLLEEEELLLLL------


DSSP  hhhHHHHHHllLLLL---LLEEEEEEEELL--HHHHllllllLLLH--hhhHHHLLHHHH
Query wdqLASWIVnnDLYS---ENVVWLIQLPRL--YNIYkdmgivTSFQ--nilDNIFIPLFE  353
ident                     ||                             | |     |
Sbjct igrDPVKLR--RISAetgVQVVXGAGYYLAssXPET-----aARLSaddiaDEIVAEALE  162
DSSP  lllLHHHHH--HHHHhhlLEEEELLLLLLHhhLLHH-----hHLLLhhhhhHHHHHHHHL


DSSP  HhhlhhhlllLHHHHllEEEE-EEELLLLllllllllllllllllllllLLLHHHHHHHH
Query AtvdpdshpqLHVFLkqVVGF-DLVDDESkperrptkhmptpaqwtnafNPAFSYYVYYC  412
ident                                                             
Sbjct G-------tdGTDAR--IGLIgEIGVSSD-------------------fTAEEEKSLRGA  194
DSSP  L-------llLLLLL--LLLEeEELLLLL-------------------lLHHHHHHHHHH


DSSP  HHHHHHHHhhhlllllllLEELLLLLLLLLlhHHHHHHHHL---------LLLLLLHHHH
Query YANLYVLNklreskgmttITLRPHSGEAGDidHLAATFLTC---------HSIAHGINLR  463
ident                     |  |                              |     
Sbjct ARAQVRTG----------LPLXVHLPGWFR--LAHRVLDLVeeegadlrhTVLCHXNPSH  242
DSSP  HHHHHHHL----------LLEEELLLLLLL--LHHHHHHHHhhllllhhhEEELLLHHHL


DSSP  HLHHHHHHHHHHLLLEEE-LHHH------hllLLLLLLLL--LHHHHHHLLL--LEEELL
Query KSPVLQYLYYLAQIGLAM-SPLS------nnsLFLDYHRN--PFPVFFLRGL--NVSLST  512
ident   || |         |                                  |      || 
Sbjct XDPVYQATLAQRGAFLEFdXIGXdffyadqgvQCPSDDEVarAILGLADHGYldRILLSH  302
DSSP  LLHHHHHHHHHHLLEEEElLLLLlleelllleELLLHHHHhhHHHHHHHLLLhhHEEELL


DSSP  LL-HHHH-----llllLHHH-HHHHHHHHhHLLLHHHHHHHH-HHHHHHLlllhhhhhhh
Query DD-PLQI-----hltkEPLV-EEYSIAASvWKLSACDLCEIA-RNSVYQSgfshalkshw  564
ident |                               |    |      |               
Sbjct DVfVKXXltryggngyAFVTkHFLPRLRR-HGLDDAALETLXvTNPRRVF----------  351
DSSP  LLlLHHHlhhhlllllLHHHhLHHHHHHH-LLLLHHHHHHHHlHHHHHHH----------


DSSP  llllLLLLLhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query igkdYYKRGpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                     
Sbjct --daSIEGH-------------------------------------------  358
DSSP  --llLLLLL-------------------------------------------


No 25: Query=2a3lA Sbjct=2vunA Z-score=10.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHLL-------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqKSAP-------------------------  155
ident                                                             
Sbjct -------------------------sktiikNIGKivsgdikspvlqadtivvedgliaa   35
DSSP  -------------------------leeeeeLLLEeellllllleellleeeeelleeee


DSSP  --------------------LLLLllLLEEEEEEELL---lllLHHHHhhhhhhhhhlll
Query --------------------HRDFynVRKVDTHVHHS---acmNQKHLlrfiksklrkep  192
ident                               ||||| |       ||              
Sbjct iggeelmkdagdatiidaagSTVT--PGLLDTHVHVSggdyapRQKTM------------   81
DSSP  eelhhhhlllllleeeelllLEEE--ELEEEEEELLLllleehHHLEE------------


DSSP  lllleeelleeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhh
Query devvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrl  252
ident                                                             
Sbjct ------------------------------------------------------------   81
DSSP  ------------------------------------------------------------


DSSP  hhhhlllllllllllhhhhhhHHHHHHLlLLLE-EEEEEEE-----lLLLLLLHHHHHHH
Query reiflkqdnliqgrflgeitkQVFSDLEaSKYQ-MAEYRIS-----iYGRKMSEWDQLAS  306
ident                         |               |                   
Sbjct ---------------------DFISSAL-HGGVtTMISAGSphfpgrPKDAAGTKALAIT  119
DSSP  ---------------------LHHHHHH-LLLEeEEEELLLllllllLLLHHHHHHHHHH


DSSP  HHH-llLLLL--LLEEE-EEEEellhhhhlllllllllhhhHHHHLLHHHHhhhlhhhll
Query WIV-nnDLYS--ENVVW-LIQLprlyniykdmgivtsfqniLDNIFIPLFEatvdpdshp  362
ident               |      |                            |         
Sbjct LSKsyyNARPagVKVHGgAVIL------------------eKGLTEEDFIE---------  152
DSSP  HHHhhhHLLHhhLEEELlEELL------------------lLLLLHHHHHH---------


DSSP  llHHHHllEEEE-EEELllllllllllllllllllllllllllHHHHHHHHHHHHHHHhh
Query qlHVFLkqVVGF-DLVDdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLnk  421
ident         |                                                   
Sbjct -mKKEG--VWIVgEVGL----------------------gtikNPEDAAPMVEWAHKH--  185
DSSP  -hHHLL--LLEEeEELL----------------------llllLHHHHHHHHHHHHHL--


DSSP  hhllllllLLEELLLLLLL----LLLHHHHHHHH-HLLLLLLL-----HHHHhlhHHHHH
Query lreskgmtTITLRPHSGEA----GDIDHLAATFL-TCHSIAHG-----INLRkspVLQYL  471
ident               | |                        |                  
Sbjct --------GFKVQMHTGGTsipgSSTVTADDVIKtKPDVVSHInggptAISV---QEVDR  234
DSSP  --------LLEEEEELLLLllllLLLLLHHHHHHhLLLEEELLlllllLLLH---HHHHH


DSSP  HHH-HLLLEEELhHHHLllllllllLLHHHHHHLL------lLEEELLLLHHHHLlllLH
Query YYL-AQIGLAMSpLSNNslfldyhrNPFPVFFLRG------lNVSLSTDDPLQIHltkEP  524
ident                 |                |         |    | |         
Sbjct IMDeTDFAMEIV-QCGN-------pKIADYVARRAaekgqlgRVIFGNDAPSGTGlipLG  286
DSSP  HHHhLLLEEEEE-LLLL-------hHHHHHHHHHHhhhllhhHEEEELLLLLLLLlllLH


DSSP  HHHHHHHHHHHHLLLHHHHHHH-HHHHHHHLLLLHhhhhhHLLLLL----------llll
Query LVEEYSIAASVWKLSACDLCEI-ARNSVYQSGFSHalkshWIGKDY----------ykrg  573
ident         ||               ||    |         |                  
Sbjct ILRNMCQIASMSDIDPEVAVCMaTGNSTAVYGLNT----gVIAPGKeadliimdtplgsv  342
DSSP  HHHHHHHHHHHLLLLHHHHHHHhLHHHHHHHLLLL----lLLLLLLllleeeeellllll


DSSP  hhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query pdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                            
Sbjct aedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  lllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 26: Query=2a3lA Sbjct=4hk5D Z-score=10.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllLLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfyNVRKVDTHVHHSacmnqkhl  180
ident                                             || | |          
Sbjct ----------------------------------------TPVVVDIHTHMY--------   12
DSSP  ----------------------------------------LLLLEEEEEEEL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhHLLLlllLLLLllllllllllllllLLL
Query lrfiksklrkepdevvifrdgtyltlrevfesLDLTgydLNVDlldvhadkstfhrfDKF  240
ident                                                             
Sbjct -------------ppsyiamlekrqtiplvrtFPQA---DEPR-------------lILL   43
DSSP  -------------lhhhhhhhhlllllleeeeELLE---EEEE-------------eELL


DSSP  H-------hhhlllllLHHHhhhlllllllllllhhHHHHHHHHHHLLLLLEEEEEEE--
Query N-------lkynpcgqSRLReiflkqdnliqgrflgEITKQVFSDLEASKYQMAEYRI--  291
ident                                         |                   
Sbjct SselaaldaaladpaaKLPG---------rplsthfASLAQKMHFMDTNGIRVSVISLan   94
DSSP  HhhhhhhhhhhhllllLLLL---------eellhhhLLHHHHHHHHHHLLLLEEEEEEll


DSSP  -eLLLL----LLLHHHHHHHHHhlllLLLL-LEEEEEEEellhhhhlllllllllhHHHH
Query -sIYGR----KMSEWDQLASWIvnndLYSE-NVVWLIQLprlyniykdmgivtsfqNILD  345
ident                |                      |                    |
Sbjct pwFDFLapdeAPGIADAVNAEFsdmcAQHVgRLFFFAAL--------------plsAPVD  140
DSSP  llLLLLllllHHHHHHHHHHHHhhhhHLLLlLEEEEEEL--------------lllLLHH


DSSP  HHLLHHHhhhhlhhhllllhhHHLLEEEEEEELlllllllllllllllllllllllLLLH
Query NIFIPLFeatvdpdshpqlhvFLKQVVGFDLVDdeskperrptkhmptpaqwtnafNPAF  405
ident                       ||   |  |                             
Sbjct AVKASIE-----------rvkNLKYCRGIILGT--------------------sglGKGL  169
DSSP  HHHHHHH-----------hhhLLLLEEEEEELL--------------------lllLLLL


DSSP  HH-hHHHHHHHHHHHhhhhllllllLLEELLL----------------------------
Query SY-yVYYCYANLYVLnklreskgmtTITLRPH----------------------------  436
ident                                |                            
Sbjct DDphLLPVFEAVADA----------KLLVFLHphyglpnevygprseeyghvlplalgfp  219
DSSP  LLhhHHHHHHHHHHL----------LLEEEELllllllhhhhlllhhhlllhhhhhlhhh


DSSP  llLLLL-LHHHH-HHHH----HLLLLLL-LHHH-HHLH----------------------
Query sgEAGD-IDHLA-ATFL----TCHSIAH-GINL-RKSP----------------------  466
ident                |          || |  |                           
Sbjct meTTIAvARMYMaGVFDhvrnLQMLLAHsGGTLpFLAGriescivhdghlvktgkvpkdr  279
DSSP  hhHHHHhHHHHHlLHHHhlllLLEEEHHhHLLHhHHHHhhhhhhhllhhhhhllllllll


DSSP  -HHHHHHHhHLLLEEELHHhhlllllllllLLHHHHHHLLL--LEEELLLLHhHHLL---
Query -VLQYLYYlAQIGLAMSPLsnnslfldyhrNPFPVFFLRGL--NVSLSTDDPlQIHL---  520
ident           || |                                  || |        
Sbjct rTIWTVLK-EQIYLDAVIY---------seVGLQAAIASSGadRLMFGTDHP-FFPPiee  328
DSSP  lLHHHHHH-HLEEEELLLL---------lhHHHHHHHHHHLhhHEELLLLLL-LLLLlll


DSSP  ----LLLHHHHHHHHHHHhHLLL-HHHHHHHH-HHHHHHlLLLHHHHHHhlllllllllh
Query ----TKEPLVEEYSIAASvWKLS-ACDLCEIA-RNSVYQsGFSHALKSHwigkdyykrgp  574
ident                           |       | |       |   |           
Sbjct dvqgPWDSSRLNAQAVIK-AVGEgSSDAAAVMgLNAVRV-LSLKAELEH-----------  375
DSSP  llllLLHHHHHHHHHHHH-HHLLlLHHHHHHHlHHHHHH-LLLHHHHHH-----------


DSSP  hhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query dgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                           
Sbjct -------------------------------------hhhhh  380
DSSP  -------------------------------------hhhhl


No 27: Query=2a3lA Sbjct=4mupB Z-score=10.4

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLL-LEEEEEEELLllllhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNV-RKVDTHVHHSacmnqkh  179
ident                                              |||  |         
Sbjct ---------------------------lvrklsgtapnPAFPrGAVDTQMHMY-------   26
DSSP  ---------------------------lllllllllllLLLLlLLEELLLLLL-------


DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll
Query llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
ident                                                             
Sbjct ------------------------------------------------------------   26
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllhhhhhhlLLLL--llllllhhHHHHHHHHHHLLLLLE-EEEEEE---EL
Query fnlkynpcgqsrlreiflKQDN--liqgrflgEITKQVFSDLEASKYQ-MAEYRI---SI  293
ident                                          |                  
Sbjct ---------------lpgYPALpggpglppgaLPGPEDYRRLMQWLGIdRVIITQgnaHQ   71
DSSP  ---------------lllLLLLllllllllllLLLHHHHHHHHHHHLLlEEEEELlhhHL


DSSP  LLllllhhhhhhhhhhlllLLLLLEEEEEEeellhhhhlllllllllhhhHHHHllhHHH
Query YGrkmsewdqlaswivnndLYSENVVWLIQlprlyniykdmgivtsfqniLDNIfipLFE  353
ident                       |                                     
Sbjct RD--------ngntlacvaEMGEAAHAVVI-------------------iDATT---TEK  101
DSSP  LL--------lhhhhhhhhHHHHHEEEEEL-------------------lLLLL---LHH


DSSP  HhhlhhhllllHHHH-LLEEEEEEELLlllllllllllllllllllllllllHHHHHHHH
Query AtvdpdshpqlHVFL-KQVVGFDLVDDeskperrptkhmptpaqwtnafnpaFSYYVYYC  412
ident                    ||    |                                  
Sbjct D---------mEKLTaAGTVGARIMDL--------------------pggavNLSELDAV  132
DSSP  H---------hHHHHhLLEEEEEEELL--------------------lllllLHHHHHHH


DSSP  HHHHHHHhhhhllllllLLEELLLLLLLLLLHHHHHHHHH--lLLLL-LLHH------hh
Query YANLYVLnklreskgmtTITLRPHSGEAGDIDHLAATFLT--cHSIA-HGIN------lr  463
ident                             |  |||              ||          
Sbjct DERAHAA----------DWMVAVQFDGNGLLDHLPRLQKIrsrWVFDhHGKFfkgirtdg  182
DSSP  HHHHHHL----------LLEEEEELLHHHHHHHHHHHHLLlleEEELhHHHLllllllll


DSSP  HLHHHHHHHHHHL-LLEEELhhHHLLLLLL---LLLL--LHHHHHHLL-lLEEELLLLHH
Query KSPVLQYLYYLAQ-IGLAMSplSNNSLFLD---YHRN--PFPVFFLRG-lNVSLSTDDPL  516
ident                                  |        |            |  | 
Sbjct PEMAALLKLIDRGnLWFKFA--GVYESSRKswpYADVaaFSRVIAAHApeRIVWGTNWPH  240
DSSP  HHHHHHHHHHHHLlEEEEEL--LHHHLLLLlllLHHHhhHHHHHHHHLhhHEEELLLLLL


DSSP  HH-----lLLLLhhHHHHHHHHHhHLLLHHHHHHHHH-HHHHHLLLLHHhhhhhllllll
Query QI-----hLTKEplVEEYSIAASvWKLSACDLCEIAR-NSVYQSGFSHAlkshwigkdyy  570
ident                         |             |       |             
Sbjct NSvretaaYPDD--ARLAELTLG-WLPDEAARHRALVeNPEALFKLSPV-----------  286
DSSP  LLlllhhhLLLH--HHHHHHHHL-LLLLHHHHHHHHLhHHHHHHLLLLL-----------


DSSP  lllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query krgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                               
Sbjct ----------------------------------------------  286
DSSP  ----------------------------------------------


No 28: Query=2a3lA Sbjct=4dlfA Z-score=10.4

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHSacmnqkhl  180
ident                                              | | |          
Sbjct -----------------------------------------ALRIDSHQHFW--------   11
DSSP  -----------------------------------------LLLEEEEELLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllLL
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdKF  240
ident                                                             
Sbjct ---------------------------------------------------ryraadyPW   20
DSSP  ---------------------------------------------------lllhhhlLL


DSSP  HHhhllllllhhhhHHLLlllllllllhhhHHHHHHHHHLLLLLEEEEEEE-ELLLllll
Query NLkynpcgqsrlreIFLKqdnliqgrflgeITKQVFSDLEASKYQMAEYRI-SIYGrkms  299
ident                                         |                   
Sbjct IG------agmgvlARDY------------LPDALHPLMHAQALGASIAVQaRAGR----   58
DSSP  LL------lllhhhLLLL------------LHHHHHHHHHHLLLLEEEEELlLLLH----


DSSP  hhhhHHHHHhlllLLLLLE-EEEEEEellhhhhlllllllllhhHHHHHLLHHHHhhhlh
Query ewdqLASWIvnndLYSENV-VWLIQLprlyniykdmgivtsfqnILDNIFIPLFEatvdp  358
ident                                                       |     
Sbjct detaFLLEL---aCDEARIaAVVGWE----------------dlRAPQLAERVAE-----   94
DSSP  hhhhHHHHH---hLLLLLEeEEEELL----------------llLLLLHHHHHHL-----


DSSP  hhlllLHHHhlLEEEEEEELlLLLLLllllllllllllllllllLLHHH-hHHHHHHHHH
Query dshpqLHVFlkQVVGFDLVDdESKPErrptkhmptpaqwtnafnPAFSY-yVYYCYANLY  417
ident               ||                                        | | 
Sbjct -----WRGT--KLRGFRHQL-QDEAD----------------vrAFVDDadFARGVAWLQ  130
DSSP  -----LLLL--LEEEEEELH-HHLLL----------------hhHHHHLhhHHHHHHHHH


DSSP  HHhhhhllllllLLEELLLLlLLLL-LHHHHHHHHH---lLLLL-LLHH-----------
Query VLnklreskgmtTITLRPHSgEAGD-IDHLAATFLT---cHSIA-HGIN-----------  461
ident                            |  |               |             
Sbjct AN----------DYVYDVLV-FERQlPDVQAFCARHdahwLVLDhAGKPalaefdrddta  179
DSSP  HL----------LLEEEELL-LHHHhHHHHHHHHHLllllEEEHhHHLLlhhhllllllh


DSSP  ---HHHLhhHHHHHHHHLLLEEEL-HHHHLL-----lllLLLLL--LHHHHHHLLL--LE
Query ---LRKSpvLQYLYYLAQIGLAMS-PLSNNS-----lflDYHRN--PFPVFFLRGL--NV  508
ident     |    |  |  |       |               |                    
Sbjct larWRAA--LRELAALPHVVCKLSgLVTEADwrrglrasDLRHIeqCLDAALDAFGpqRL  237
DSSP  hhhHHHH--HHHHHLLLLEEEEELlLLLLLLllllllhhHHHHHhhHHHHHHHHHLhhHE


DSSP  EELLL--LHHHHLlLLLHHHHHHHHHHHHhLLLHHHHHHHH-HHHHHHLLLLhhhhhhhl
Query SLSTD--DPLQIHlTKEPLVEEYSIAASVwKLSACDLCEIA-RNSVYQSGFShalkshwi  565
ident     |    |                |    |||                          
Sbjct MFGSDwpVCLLAA-SYDEVASLVERWAES-RLSAAERSALWgGTAARCYALP--------  287
DSSP  EELLLllHHHHLL-LHHHHHHHHHHHHHH-HLLHHHHHHHLlHHHHHHLLLL--------


DSSP  llllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query gkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                    
Sbjct ---------------------------------------------------  287
DSSP  ---------------------------------------------------


No 29: Query=2a3lA Sbjct=4rdvB Z-score=10.2

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                  |                          
Sbjct -----------------------------saiFAERALlpegwarnvrfeisadgvlaei   31
DSSP  -----------------------------leeEEEEEEelleeeeeeeeeellllleeee


DSSP  --------------llLLLEEEEEEELLLLLLHhhhhhhhhhhhhllllllleeelleee
Query --------------fyNVRKVDTHVHHSACMNQkhllrfiksklrkepdevvifrdgtyl  204
ident                        | |                                  
Sbjct rpdanadgaerlggavLPGMPNLHSHAFQRAMA---------------------------   64
DSSP  elllllllleelllleEELEEEEEELHHHHHHL---------------------------


DSSP  lhhhhhhhhlllllllLLLLllllllllllllLLLLHHHhllllllhHHHHHlllllllL
Query tlrevfesldltgydlNVDLldvhadkstfhrFDKFNLKynpcgqsrLREIFlkqdnliQ  264
ident                                      |                      
Sbjct ---------------gLAEV----agnpndsfWTWRELM------yrMVARL-------S   92
DSSP  ---------------lLLLL----lllllllhHHHHHHH------hhHHLLL-------L


DSSP  LLLHHHHHHHHHHHHLLLLLEEEEEEEE-----lllllLLHHhHHHHHHhllLLLL---L
Query GRFLGEITKQVFSDLEASKYQMAEYRIS-----iygrkMSEWdQLASWIvnnDLYS---E  316
ident       |  |         |                        |   |      |    
Sbjct PEQIEVIACQLYIEMLKAGYTAVAEFHYvhhdldgrsyADPA-ELSLRI--sRAASaagI  149
DSSP  HHHHHHHHHHHHHHHHHHLEEEEEEEELllllllllllLLLL-HHHHHH--hHHHHhhlL


DSSP  LEEEEEEEELL----HHHHlllllllllhhHHHHHLLHHHhhhhlhhhlllLHHHH--LL
Query NVVWLIQLPRL----YNIYkdmgivtsfqnILDNIFIPLFeatvdpdshpqLHVFL--KQ  370
ident     |  |                              |                     
Sbjct GLTLLPVLYSHagfgGQPA--segqrrfinGSEAYLELLQ---------rlRAPLEaaGH  198
DSSP  EEEEEELLLLEeellLEEL--lhhhlllllLHHHHHHHHH---------hhHHHHHhhLL


DSSP  EEEEEEELLLllllllllllllllllllllllllHHHHHHHHHHhhHHHHhhhllllllL
Query VVGFDLVDDEskperrptkhmptpaqwtnafnpaFSYYVYYCYAnlYVLNklreskgmtT  430
ident   |                                        |                
Sbjct SLGLCFHSLR----------------------avTPQQIATVLA--AGHD---------D  225
DSSP  EELEEELLLL----------------------llLHHHHHHHHL--LLLL---------L


DSSP  LEELLLLLL-LLLL---------HHHHHHHHH-----lLLLLLLHHHhhLHHHHHHHHHH
Query ITLRPHSGE-AGDI---------DHLAATFLT-----cHSIAHGINLrkSPVLQYLYYLA  475
ident      |  |                |                |       |         
Sbjct LPVHIHIAEqQKEVddcqawsgrRPLQWLYENvavdqrWCLVHATHA--DPAEVAAMARS  283
DSSP  LLEEEEELLlHHHHhhhhhhhllLHHHHHHHHllllllEEEEELLLL--LHHHHHHHHHH


DSSP  LLLEEELHHHHL-LLLLlllLLLHHHHHHLLLLEEELLLLHHhhllllLHHHHHHHHHHH
Query QIGLAMSPLSNN-SLFLdyhRNPFPVFFLRGLNVSLSTDDPLqihltkEPLVEEYSIAAS  534
ident                       |   |   |       |            |||      
Sbjct GAVAGLCLSTEAnLGDG---IFPATDFLAQGGRLGIGSDSHV-----sLSVVEELRWLEY  335
DSSP  LLEEEELHHHHHhLLLL---LLLHHHHHHLLLEEEELLLLLL-----lLLHHHHHHHHHH


DSSP  HHL---------------lLHHHHHHHHHH-HHHHLLLLhhhhhhHLLLLL---------
Query VWK---------------lSACDLCEIARN-SVYQSGFShalkshWIGKDY---------  569
ident                        |   |        |                       
Sbjct GQRlrdrkrnrlyrddqpmIGRTLYDAALAgGAQALGQP----igSLAVGRradllvldg  391
DSSP  HHHhhhlllllllllllllHHHHHHHHHHHhHHHHHLLL----llLLLLLLllleeeell


DSSP  -------------llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query -------------ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                             
Sbjct ndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  llhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 30: Query=2a3lA Sbjct=2ffiA Z-score=9.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                              | | |          
Sbjct ---------------------------------------lhlTAIDSHAHVF--------   13
DSSP  ---------------------------------------lllLLEELLLLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   13
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhHHHHllllLLLLL---llhhhHHHHHHHHHLLLLLEEEEEEE---ELL
Query nlkynpcgqsrlREIFlkqdNLIQG---rflgeITKQVFSDLEASKYQMAEYRI---SIY  294
ident             |          |                 | |                
Sbjct -----------sRGLN----LASQRryapnydaPLGDYLGQLRAHGFSHGVLVQpsfLGT   58
DSSP  -----------lHHHH----HHLLLllllllllLHHHHHHHHHHLLLLEELLLLlhhHLL


DSSP  LllllhhhhhhhhhhlllLLLLLEEEEEEEellhhhhlllllllllhhHHHHhLLHHhhh
Query GrkmsewdqlaswivnndLYSENVVWLIQLprlyniykdmgivtsfqnILDNiFIPLfea  354
ident                              |                    |         
Sbjct D--------nryllsalqTVPGQLRGVVXL------------------ERDV-EQAT---   88
DSSP  L--------lhhhhhhhhHLLLLLLLLLLL------------------LLLL-LHHH---


DSSP  hhlhhhllllHHHH-LLEEEEEEELLlLLLLlllllllllllllllllllLHHH--hHHH
Query tvdpdshpqlHVFL-KQVVGFDLVDDeSKPErrptkhmptpaqwtnafnpAFSY--yVYY  411
ident                  | |  |                                     
Sbjct ---------lAEXArLGVRGVRLNLX-GQDX-------------------PDLTgaqWRP  119
DSSP  ---------hHHHHlLLLLEEELLLL-LLLL-------------------LLLLlllLHH


DSSP  HHHHHHHhhhhhllllllLLEELLLLLLLLL-LHHHHHHHHH--LLLLL-LLHH------
Query CYANLYVlnklreskgmtTITLRPHSGEAGD-IDHLAATFLT--CHSIA-HGIN------  461
ident                               |      |         |   |        
Sbjct LLERIGE-----------QGWHVELHRQVADiPVLVRALQPYglDIVIDhFGRPdarrgl  168
DSSP  HHHHHHH-----------HLLEEEELLLLLLhHHHHHHHLLLllLEEELhHHLLllllll


DSSP  ---hHHLHhhHHHHhHHLLLEEELHHHHLLL--llLLLLL--LHHHHHHLLL--LEEELL
Query ---lRKSPvlQYLYyLAQIGLAMSPLSNNSL--flDYHRN--PFPVFFLRGL--NVSLST  512
ident                        |                                    
Sbjct gqpgFAEL-lTLSG-RGKVWVKVSGIYRLQGspeeNLAFArqALCALEAHYGaeRLXWGS  226
DSSP  llllHHHH-lLLLL-LLLEEEEEELHHHLLLlhhhHHHHHhhHHHHHHHHLLhhHEEEEL


DSSP  LL-HHHHL-LLLL-HHHHHHHHHHhhhlLLHHHHHHHH-HHHHHHLLLLHHhhhhhllll
Query DD-PLQIH-LTKE-PLVEEYSIAAsvwkLSACDLCEIA-RNSVYQSGFSHAlkshwigkd  568
ident |    |          ||           ||               ||            
Sbjct DWpHTQHEsEVSFgSAVEQFEALG----CSAQLRQALLlDTARALFGFELE---------  273
DSSP  LLlLLLLLlLLLHhHHHHHHHHHL----LLHHHHHHHHlHHHHHHLLLLLL---------


DSSP  lllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query yykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                 
Sbjct ------------------------------------------------  273
DSSP  ------------------------------------------------


No 31: Query=2a3lA Sbjct=1gkpA Z-score=9.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLLL---------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRDF---------------------  159
ident                                                             
Sbjct ----------------------------plliKNGEIITadsrykadiyaegetitrigq   32
DSSP  ----------------------------leeeELLEEEElleeeeleeeelllllleeel


DSSP  -----------------lLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelle
Query -----------------yNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgt  202
ident                        | |||                                
Sbjct nleappgtevidatgkyvFPGFIDPHVHIY------------------------------   62
DSSP  lllllllleeeelllleeEELEEEEEELLL------------------------------


DSSP  eelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhHHHHLlllll
Query yltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlREIFLkqdnl  262
ident                                                             
Sbjct ------------------------------------------------lpFMATF-----   69
DSSP  ------------------------------------------------leELLEE-----


DSSP  lllllhhhHHHHHHHHHLLLLLEEEEEEEELLLLLlLHHHHHHHHHH-lLLLLLLLEEEE
Query iqgrflgeITKQVFSDLEASKYQMAEYRISIYGRKmSEWDQLASWIV-nNDLYSENVVWL  321
ident                                             |               
Sbjct -----akdTHETGSKAALMGGTTTYIEMCCPSRND-DALEGYQLWKSkaEGNSYCDYTFH  123
DSSP  -----lllLHHHHHHHHHHLLEEEEEEEELLLLLL-LHHHHHHHHHHhhLLLLLLEEEEE


DSSP  EEEELlhhhhlllllllllhhHHHHHLLHHHHhhhlhhhllllhhhHLLEEEEEEELLll
Query IQLPRlyniykdmgivtsfqnILDNIFIPLFEatvdpdshpqlhvfLKQVVGFDLVDDes  381
ident                              | |                    |       
Sbjct MAVSK----------------FDEKTEGQLRE------------ivADGISSFXIFLS--  153
DSSP  EELLL----------------LLLLHHHHHHH------------hhHLLLLEEEEEEL--


DSSP  lllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLL---
Query kperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSG---  438
ident                             |        |                |     
Sbjct ----------------yknffgvDDGEMYQTLRLAKELG----------VIVTAHCEnae  187
DSSP  ----------------lllllllLHHHHHHHHHHHHHHL----------LEEEEEELlhh


DSSP  ------------------------lLLLL-HHHHHHHHHL------LLLLLLH--HHHHl
Query ------------------------eAGDI-DHLAATFLTC------HSIAHGI--NLRKs  465
ident                                  |                |         
Sbjct lvgrlqqkllsegktgpewhepsrpEAVEaEGTARFATFLettgatGYVVHLSckPALD-  246
DSSP  hhhhhhhhhhhlllllhhhllllllHHHHhHHHHHHHHHHhhhlleEEELLLLlhHHHH-


DSSP  hhHHHHHHHH--lLLEEELHHHHLL-------------------LLLLLLLL-LHHHHHH
Query pvLQYLYYLA--qIGLAMSPLSNNS-------------------LFLDYHRN-PFPVFFL  503
ident              |                                 |            
Sbjct --AAMAAKARgvpIYIESVIPHFLLdktyaerggveamkyimspPLRDKRNQkVLWDALA  304
DSSP  --HHHHHHHLlllEEEEEEHHHHHLlhhhhhllhhhhhllllllLLLLLHHHhHHHHHHH


DSSP  LLLLEEELLLLHHH-----------------hllllLHHHHHHHHHH-HHHLLLHHHHHH
Query RGLNVSLSTDDPLQ-----------------ihltkEPLVEEYSIAA-SVWKLSACDLCE  545
ident  |      ||                          |  |        |   |       
Sbjct QGFIDTVGTDHCPFdteqkllgkeaftaipngipaiEDRVNLLYTYGvSRGRLDIHRFVD  364
DSSP  LLLLLEEELLLLLLlhhhhhhhlllhhhllllllllLLHHHHHHHHHlLLLLLLHHHHHH


DSSP  H-HHHHHHHLLLlHHHHhhHLLLLL------------------------llllhhhllhh
Query I-ARNSVYQSGFsHALKshWIGKDY------------------------ykrgpdgndih  580
ident           |     |   |                                       
Sbjct AaSTKAAKLFGL-FPRK-gTIAVGSdadlvvydpqyrgtisvktqhvnndyngfegfeid  422
DSSP  HhLHHHHHHLLL-LLLL-lLLLLLLllleeeeelllleellhhhllllllllllllleel


DSSP  hhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query ktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                     
Sbjct grpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  leeeeeeelleeeeelleelllllllllllllllll


No 32: Query=2a3lA Sbjct=3griA Z-score=9.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksAPHRD----------------------  158
ident                                                             
Sbjct ----------------------------xklikNGKVLqngelqqadilidgkvikqiap   32
DSSP  ----------------------------leeeeLLEEEelleeeeleeeeelleeeeeel


DSSP  ----------------llLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelle
Query ----------------fyNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgt  202
ident                       || |||                                
Sbjct aiepsngvdiidakghfvSPGFVDVHVHLR------------------------------   62
DSSP  lllllllleeeelllleeEELEEEEEELLL------------------------------


DSSP  eelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhhhhHLLLlll
Query yltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiFLKQdnl  262
ident                                                             
Sbjct ---------------------------------------------------epGGEY---   68
DSSP  ---------------------------------------------------llLLLL---


DSSP  lllllhhhHHHHHHHHHLlLLLE-EEEEEE----ELLLllllhHHHHHHHHH-lLLLLLL
Query iqgrflgeITKQVFSDLEaSKYQ-MAEYRI----SIYGrkmseWDQLASWIV-nNDLYSE  316
ident                                                        |    
Sbjct ------keTIETGTKAAA-RGGFtTVCPXPntrpVPDS-----VEHFEALQKliDDNAQV  116
DSSP  ------llLHHHHHHHHH-HLLEeEEEELLllllLLLL-----HHHHHHHHHhhHHHLLL


DSSP  LEEEEEEE---ELLHhhhlllllllllhhhhhHHLLHhhhhhhlhhhllllhhhHLLEEE
Query NVVWLIQL---PRLYniykdmgivtsfqnildNIFIPlfeatvdpdshpqlhvfLKQVVG  373
ident  |                                |                         
Sbjct RVLPYASIttrQLGK---------------elVDFPA---------------lvKEGAFA  146
DSSP  EELLLEELlhhHLLL---------------llLLHHH---------------hhLLLLLL


DSSP  EEEELLllllllllllllllllllllllllLHHHHHHHHHHHHHHHHhhhlllllllLEE
Query FDLVDDeskperrptkhmptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmttITL  433
ident |                                   |         |             
Sbjct FTDDGV----------------------gvQTASXXYEGXIEAAKVN----------KAI  174
DSSP  EEELLL----------------------llLLHHHHHHHHHHHHHHL----------LLE


DSSP  LLLLL-------------------------lLLLLHHHHHHHHH------LLLLLLLHH-
Query RPHSG-------------------------eAGDIDHLAATFLT------CHSIAHGIN-  461
ident   |                                   |   |            |    
Sbjct VAHCEdnsliyggaxhegkrskelgipgipnICESVQIARDVLLaeaagcHYHVCHVSTk  234
DSSP  EELLLlhhhllllleellhhhhhhllleellHHHHHHHHHHHHHhhhhllLEEELLLLLh


DSSP  -HHHLhhHHHHHH-HHLLLEEELHHH----------------hllLLLLLLLL-LHHHHH
Query -LRKSpvLQYLYY-LAQIGLAMSPLS----------------nnsLFLDYHRN-PFPVFF  502
ident                        |                                    
Sbjct eSVRV--IRDAKRaGIHVTAEVTPHHlllteddipgnnaiykxnpPLRSTEDReALLEGL  292
DSSP  hHHHH--HHHHHHlLLLEEEEELHHHhhllhhhlllllhhhllllLLLLHHHHhHHHHHH


DSSP  HLLLLEEELLLLH---------------HHHLllllHHHHHHHHHHHHHL----LLHHHH
Query LRGLNVSLSTDDP---------------LQIHltkePLVEEYSIAASVWK----LSACDL  543
ident | |      ||                   |                            |
Sbjct LDGTIDCIATDHAphardekaqpxekapFGIV----GSETAFPLLYTHFVkngdWTLQQL  348
DSSP  HLLLLLEELLLLLlllhhhhllllllllLLLL----LLLLHHHHHHHHHLllllLLHHHH


DSSP  HHHH-HHHHHHLLLLhhhhhhHLLL----llllllhhhllhhhhlllhhhhhhhhhhhhh
Query CEIA-RNSVYQSGFShalkshWIGK----dyykrgpdgndihktnvphirvefrdtiwke  598
ident                                                             
Sbjct VDYLtIKPCETFNLE----ygTLKEngyadltiidldseqeikgedflskadntpfigyk  404
DSSP  HHHHlHHHHHHLLLL----llLLLLllllleeeeelllleellhhhllllllllllllle


DSSP  hhhhhlllllllllllll
Query emqqvylgkavisdevvp  616
ident                   
Sbjct vygnpiltxvegevkfeg  422
DSSP  elleeeeeeelleeeeel


No 33: Query=2a3lA Sbjct=3ooqA Z-score=9.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
ident                                                             
Sbjct ---------------kilfknatvfpitsRPFKgdvlvsngkvekvgeniedpdaeivdl   45
DSSP  ---------------leeeeeeeelllllLLEEeeeeeelleeeeeelllllllleeeel


DSSP  llLLLLllLLEEEEEEELLLLLLhhHHHHhhhhhhhllllllleeelleeelhhhhhhhh
Query apHRDFynVRKVDTHVHHSACMNqkHLLRfiksklrkepdevvifrdgtyltlrevfesl  213
ident      |     || | |                                           
Sbjct tgKFLF--PGFVDAHSHIGLFEE--GVGY-------------------------------   70
DSSP  llLEEE--ELEEEEEELLLLLLL--LLLH-------------------------------


DSSP  lllllllllllllllllllllllllllhhHHLLllllhhhhhhlllllllllllhhhhHH
Query dltgydlnvdlldvhadkstfhrfdkfnlKYNPcgqsrlreiflkqdnliqgrflgeiTK  273
ident                                                             
Sbjct ------------------------yysdgNEAT------------dpvtphvkaldgfNP   94
DSSP  ------------------------hhlllLLLL------------llllllllhhhhlLL


DSSP  HHhHHHLLLL---LEEEEEEEElllllllhhhhhhhhhhlLLLLLLLeeeeeeeellhhh
Query QVfSDLEASK---YQMAEYRISiygrkmsewdqlaswivnNDLYSENvvwliqlprlyni  330
ident |     |                                                     
Sbjct QD-PAIERALaggVTSVXIVPG-sanpvggqgsvikfrsiIVEECIV-------------  139
DSSP  LL-HHHHHHHlllEEEEEELLL-lllleeeeeeeeellllLHHHHEE-------------


DSSP  hlllllllllhhhhhhhllhhhhhhhlhhhllllhhhhlLEEEEEEEllLLLLLllllll
Query ykdmgivtsfqnildnifiplfeatvdpdshpqlhvflkQVVGFDLVddESKPErrptkh  390
ident                                           |         |       
Sbjct --------------------------------------kDPAGLKXA-fGENPK------  154
DSSP  --------------------------------------eEEEEEEEE-lLHHHH------


DSSP  llllllllLLLLL----LHHHHHHHHHH--------------------------hHHHHH
Query mptpaqwtNAFNP----AFSYYVYYCYA--------------------------nLYVLN  420
ident             |                                               
Sbjct ---rvygeRKQTPstrxGTAGVIRDYFTkvknyxkkkelaqkegkeftetdlkxeVGEXV  211
DSSP  ---hhhhhLLLLLllhhHHHHHHHHHHHhhhhhhhhhhhhhhlllllllllhhhhHHHHH


DSSP  HHhllllllLLEELLLLLLlllLHHHHHHHHHL------LLLLLLHHHHHlhhHHHHHHH
Query KLreskgmtTITLRPHSGEagdIDHLAATFLTC------HSIAHGINLRKspvLQYLYYL  474
ident           |  | |       |                 | ||    |          
Sbjct LR------kKIPARXHAHR---ADDILTAIRIAeefgfnLVIEHGTEAYK---ISKVLAE  259
DSSP  HL------lLLLEEEEELL---HHHHHHHHHHHhhhlllEEEEELLLHHH---HHHHHHH


DSSP  HLLLEEE-LHHHhLLLL---LLLLlLLHHHHHHLLLLEEELLLLhHHHLlllLHHHHHHH
Query AQIGLAM-SPLSnNSLF---LDYHrNPFPVFFLRGLNVSLSTDDpLQIHltkEPLVEEYS  530
ident   |       |          |            |    |  |    |    |       
Sbjct KKIPVVVgPLLT-FRTKlelKDLTxETIAKLLKDGVLIALXCDH-PVIP--lEFATVQAA  315
DSSP  HLLLEEElLLLL-LLLLhhhLLLLlLHHHHHHHLLLLEEELLLL-LLLL--hHHHHHHHH


DSSP  HHhHHHLLLHHHHHHHH-HHHHHHLLLlHHHHhhHLLLLlllllhhhllhhhhlllhhhh
Query IAaSVWKLSACDLCEIA-RNSVYQSGFsHALKshWIGKDyykrgpdgndihktnvphirv  589
ident  |         ||  |   |     |                                  
Sbjct TA-XRYGAKEEDLLKILtVNPAKILGL-EDRI--GSIEP--------------gkdadlv  357
DSSP  HH-HHHLLLHHHHHHLLlHHHHHHLLL-LLLL--LLLLL--------------lllllee


DSSP  hhhhhhhhhhhhhhlllllllllllll
Query efrdtiwkeemqqvylgkavisdevvp  616
ident                            
Sbjct vwsghpfdxksvvervyidgvevfrre  384
DSSP  eelllllllllleeeeeelleeeeell


No 34: Query=2a3lA Sbjct=1v77A Z-score=9.6

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELL-LLLLhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHS-ACMNqkh  179
ident                                          |           |      
Sbjct -----------------------------------------VKFIEMDIRDKeAYEL---   16
DSSP  -----------------------------------------LLLEEEEELLHhHHHH---


DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll
Query llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
ident                                                             
Sbjct ------------------------------------------------------------   16
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllhhhhhhlllllllllllhhhhhhhhhhhhllLLLEEEEEEeelllllll
Query fnlkynpcgqsrlreiflkqdnliqgrflgeitkqvfsdleaSKYQMAEYRisiygrkms  299
ident                                                             
Sbjct ----------------------------------------akEWFDEVVVS---------   27
DSSP  ----------------------------------------hhHHLLEEEEE---------


DSSP  hhhhhhhhhhlllllllleeeeEEEELLhhhhlllllllllhhhhhhHLLHhhhhhhlhh
Query ewdqlaswivnndlysenvvwlIQLPRLyniykdmgivtsfqnildnIFIPlfeatvdpd  359
ident                       |                                     
Sbjct ----------------------IKFNEE------------------vDKEK---------   38
DSSP  ----------------------EEELLL------------------lLHHH---------


DSSP  hllllhHHHL--LEEEEEEELllllllllllllllllllllllllllHHHHHHHHHHHHH
Query shpqlhVFLK--QVVGFDLVDdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLY  417
ident          |    |   |                                |        
Sbjct ----lrEARKeyGKVAILLSN-------------------------pKPSLVRDTVQKFK   69
DSSP  ----hhHHHHhhLLEEEEEEL-------------------------lLHHHHHHHHHHLL


DSSP  hhhhhhllllllLLEELLLLlllLLLHHHHHHHHH-LLLLLLL------HHHHhlHHHHH
Query vlnklreskgmtTITLRPHSgeaGDIDHLAATFLT-CHSIAHG------INLRksPVLQY  470
ident                    |    |              |                ||  
Sbjct ------------SYLIYVES---NDLRVIRYSIEKgVDAIISPwvnrkdPGID--HVLAK  112
DSSP  ------------LLEEEEEL---LLHHHHHHHHHLlLLEEELLllllllLLLL--HHHHH


DSSP  HHHHHLLLEEELhHHHLLLL-----lLLLLL--LHHHHHHL-LLLEEELLLL-HHHHLll
Query LYYLAQIGLAMSpLSNNSLF-----lDYHRN--PFPVFFLR-GLNVSLSTDD-PLQIHlt  521
ident |       |  | |               |                 |            
Sbjct LMVKKNVALGFS-LRPLLYSnpyeraNLLRFmmKAWKLVEKyKVRRFLTSSAqEKWDV--  169
DSSP  HHHHHLLEEEEE-LHHHHHLlhhhhhHHHHHhhHHHHHHHHhLLLEEEELLLlLHHHL--


DSSP  lLHHHHHHHHHHHhHLLLHHHHHHH-HHHHHHHLLllhhhhhhhlllllllllhhhllhh
Query kEPLVEEYSIAASvWKLSACDLCEI-ARNSVYQSGfshalkshwigkdyykrgpdgndih  580
ident         |                                                   
Sbjct -RYPRDLISLGVV-IGMEIPQAKASiSMYPEIILK-------------------------  202
DSSP  -LLHHHHHHHHHH-LLLLHHHHHHLlLHHHHHHHL-------------------------


DSSP  hhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query ktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                     
Sbjct ------------------------------------  202
DSSP  ------------------------------------


No 35: Query=2a3lA Sbjct=3giqA Z-score=9.6

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                                             
Sbjct -------------------------ekldfkiTGGWIIdgtgaprrradlgvrdgriaai   35
DSSP  -------------------------lleeeeeELLEELllllllleeleeeeelleeeee


DSSP  -----------------lLLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeell
Query -----------------fYNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdg  201
ident                         | | |                               
Sbjct gelgahparhawdasgkiVAPGFIDVHGHDD-----------------------------   66
DSSP  elllllleeeeeelllleEEELEEELLLLLL-----------------------------


DSSP  eeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhhhhhlllll
Query tyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdn  261
ident                                                             
Sbjct ------------------------------------------------------------   66
DSSP  ------------------------------------------------------------


DSSP  llllllHHHHhHHHHhHHLLLLLEEEEEE----EELLLLL----------------lLHH
Query liqgrfLGEItKQVFsDLEASKYQMAEYR----ISIYGRK----------------mSEW  301
ident         |                                                   
Sbjct ----lmFVEK-PDLR-WKTSQGITTVVVGncgvSAAPAPLpgntaaalallgetplfADV  120
DSSP  ----lhHHHL-LLLH-HHHLLLEEEEEELllllLLLLLLLlllllhhhhhhllllllLLH


DSSP  HHHHHHHHLLlLLLLLEEEEEEEE----llHHHHLLllllLLLHHHHHHHLLhhhhhhhl
Query DQLASWIVNNdLYSENVVWLIQLP----rlYNIYKDmgivTSFQNILDNIFIplfeatvd  357
ident                ||  |                       |   |            
Sbjct PAYFAALDAQ-RPMINVAALVGHAnlrlaaMRDPQAaptaAEQQAMQDMLQA--------  171
DSSP  HHHHHHHHHL-LLLLEEEEEEEHHhhhhhhLLLLLLlllhHHHHHHHHHHHH--------


DSSP  hhhllllhhhhlLEEEEEEELLLllllllllllllllllllllllLLHHHHHHHHHHHHH
Query pdshpqlhvflkQVVGFDLVDDEskperrptkhmptpaqwtnafnPAFSYYVYYCYANLY  417
ident               |||                             |             
Sbjct --------aleaGAVGFSTGLAY------------------qpgaVAQAAELEGLARVAA  205
DSSP  --------hhhhLLLEEEEELLL------------------llhhHLLHHHHHHHHHHHH


DSSP  HHHhhhlllllllLEELLLL-lLLLL-LHHHHHHHHHL------LLLLLLHH-----hHH
Query VLNklreskgmttITLRPHS-gEAGD-IDHLAATFLTC------HSIAHGIN-----lRK  464
ident                   |   ||                        |           
Sbjct ERR----------RLHTSHIrnEADGvEAAVEEVLAIGrgtgcaTVVSHHKCmmpqnwGR  255
DSSP  HLL----------LEEEEELllLLLLhHHHHHHHHHHHhhhlleEEELLLLLllhhhlLL


DSSP  LHHHHHHHHHHL-----LLEEELHhHHLL-------------------------------
Query SPVLQYLYYLAQ-----IGLAMSPlSNNS-------------------------------  488
ident |         |        |   |    |                               
Sbjct SRATLANIDRAReqgveVALDIYP-YPGSstiliperaetiddiritwstphpecsgeyl  314
DSSP  HHHHHHHHHHHHhllllEEEEELL-LLEEeeellhhhllllllleeeeelllhhhllllh


DSSP  -------------------------LLLLllLLLHHHHHHlLLLEEELLLLH----HHHL
Query -------------------------LFLDyhRNPFPVFFLrGLNVSLSTDDP----LQIH  519
ident                             |         |          |          
Sbjct adiaarwgcdkttaarrlapagaiyFAMD--EDEVKRIFQ-HPCCMVGSDGLpndaRPHP  371
DSSP  hhhhhhhlllhhhhhhhhlleeeeeELLL--HHHHHHHHH-LLLEEELLLLLllllLLLL


DSSP  lllLHHHHHHH-HHHHHHL-LLHHHHHHHH-HHHHHHLLLlHHHHhhHLLLLL-------
Query ltkEPLVEEYS-IAASVWK-LSACDLCEIA-RNSVYQSGFsHALKshWIGKDY-------  569
ident                                       ||                    
Sbjct -rlWGSFTRVLgRYVREARlMTLEQAVARMtALPARVFGF-AERG--VLQPGAwadvvvf  427
DSSP  -hhHHHHHHHHhHHHHHLLlLLHHHHHHHHlHHHHHHHLL-LLLL--LLLLLLllleeee


DSSP  -llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query -ykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                 
Sbjct dpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  lllllllllllllllllllleeeeeelleeeellllllllllllllll


No 36: Query=2a3lA Sbjct=3irsA Z-score=9.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELL--------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHS--------  172
ident                                              |              
Sbjct -----------------------------------------LKIIDFRLRPPamgflnar   19
DSSP  -----------------------------------------LLLEELLLLLLlhhhhhlh


DSSP  -------------------lllLHHHhhhhhhhhhhllllllleeelleeelhhhhhhhh
Query -------------------acmNQKHllrfiksklrkepdevvifrdgtyltlrevfesl  213
ident                                                             
Sbjct iytrpdirnrftrqlgfepapsAEEK----------------------------------   45
DSSP  hhhlhhhhhhhhhhhlllllhhHHHL----------------------------------


DSSP  lllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHHH
Query dltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeITK  273
ident                                                             
Sbjct ---------------------------------------------------------SLE   48
DSSP  ---------------------------------------------------------LHH


DSSP  HHHHHHLLLLLEEEEEEEELLlllllhhhHHHHhhhlllLLLLLEEEEEEEELLhhhhll
Query QVFSDLEASKYQMAEYRISIYgrkmsewdQLASwivnndLYSENVVWLIQLPRLyniykd  333
ident   |    |                       |        |                   
Sbjct LMFEEMAAAGIEQGVCVGRNS--svlgsvSNADvaavakAYPDKFHPVGSIEAA------  100
DSSP  HHHHHHHHLLLLEEEEELLEE--llleelLHHHhhhhhhHLLLLEEEEEELLLL------


DSSP  llllllLHHHHHHHLLHhhhhhhlhhhllllhHHHLleEEEEEELLllllllllllllll
Query mgivtsFQNILDNIFIPlfeatvdpdshpqlhVFLKqvVGFDLVDDeskperrptkhmpt  393
ident                                           |                 
Sbjct ------TRKEAMAQMQE-------------ilDLGI--RIVNLEPG--------------  125
DSSP  ------LHHHHHHHHHH-------------hhHLLL--LLEEELHH--------------


DSSP  lllllllLLLLHHH-hHHHHHHHHHHHHhhhlllllllLEELLLLLLL-------LLLHH
Query paqwtnaFNPAFSY-yVYYCYANLYVLNklreskgmttITLRPHSGEA-------GDIDH  445
ident                  |  ||                |      |             |
Sbjct ----vwaTPMHVDDrrLYPLYAFCEDNG----------IPVIMMTGGNagpdityTNPEH  171
DSSP  ----hllLLLLLLLhhHHHHHHHHHHLL----------LLEEEELLLLllllhhhHLHHH


DSSP  HHHHHHH----LLLLLL-LHHHHHLhhHHHHHHHHL-LLEEELhHHHLllllLLLLL-LH
Query LAATFLT----CHSIAH-GINLRKSpvLQYLYYLAQ-IGLAMSpLSNNslflDYHRN-PF  498
ident                 |                      |                   |
Sbjct IDRVLGDfpdlTVVSSHgNWPWVQE--IIHVAFRRPnLYLSPD-MYLY----NLPGHaDF  224
DSSP  HHHHHHHllllLEEEEHhHLLLHHH--HHHHHHHLLlEEEELH-HHHL----LLLLHhHH


DSSP  HHHHHLLL--LEEELLLLhHHHLlllLHHHHHHHHHhhhhLLLHHHHHHHH-HHHHHhLL
Query PVFFLRGL--NVSLSTDDpLQIHltkEPLVEEYSIAasvwKLSACDLCEIA-RNSVYqSG  555
ident        |       |              |                  |   |      
Sbjct IQAANSFLadRMLFGTAY-PMCP--lKEYTEWFLTL----PIKPDAMEKILhGNAER-LL  276
DSSP  HHHHLLHHhhLLLLLLLL-LLLL--hHHHHHHHHLL----LLLHHHHHHHHlHHHHH-HH


DSSP  LLhhhhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllllllllll
Query FShalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevv  615
ident                                                             
Sbjct AQ--------------------------------------------------------ag  280
DSSP  HH--------------------------------------------------------ll


DSSP  l
Query p  616
ident  
Sbjct r  281
DSSP  l


No 37: Query=2a3lA Sbjct=4ofcA Z-score=9.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                            | | | |          
Sbjct ------------------------------------------MKIDIHSHIL--------   10
DSSP  ------------------------------------------LLEEEEEELL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct --------------------------------------------------pkewpdlkkr   20
DSSP  --------------------------------------------------llllllhhhh


DSSP  hhhhlLLLLLH-----HHHHhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEE---E
Query nlkynPCGQSR-----LREIflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRI---S  292
ident                                                             
Sbjct fgyggWVQLQHhskgeAKLL-kdgkvfrvvrencwDPEVRIREMDQKGVTVQALSTvpvM   79
DSSP  hllllLEEEEEeelleEEEE-elleeeeeeehhhlLHHHHHHHHHHHLLLEEEEELlhhH


DSSP  LLL-----LLLLHHHHHHHHH-hllLLLLLLEEEEEEEellhhhhlllllllllhHHHHH
Query IYG-----RKMSEWDQLASWI-vnnDLYSENVVWLIQLprlyniykdmgivtsfqNILDN  346
ident                 |          |    | |  |                      
Sbjct FSYwakpeDTLNLCQLLNNDLastvVSYPRRFVGLGTL---------------pmQAPEL  124
DSSP  HLLlllhhHHHHHHHHHHHHHhhhhHHLLLLEEEEELL---------------llLLHHH


DSSP  HLLHHHhhhhlhhhllllHHHHllEEEEEEEllllllllllllllllllllllllLLLHH
Query IFIPLFeatvdpdshpqlHVFLkqVVGFDLVddeskperrptkhmptpaqwtnafNPAFS  406
ident                           |                            |    
Sbjct AVKEME---------rcvKELG--FPGVQIG---------------------thvNEWDL  152
DSSP  HHHHHH---------hhhHLLL--LLEEEEE---------------------leeLLEEL


DSSP  HH--hHHHHHHHHHHhhhhllllllLLEELLLL------------------lLLLL-LHH
Query YY--vYYCYANLYVLnklreskgmtTITLRPHS------------------gEAGD-IDH  445
ident         ||    |             |  |                            
Sbjct NAqelFPVYAAAERL----------KCSLFVHPwdmqmdgrmakywlpwlvgMPAEtTIA  202
DSSP  LLhhhHHHHHHHHHH----------LLEEEEELllllllhhhhlllhhhhlhHHHHhHHH


DSSP  HHHHHH---------hLLLLLL-LHHH-HHLHH-------------------HHHHHHhh
Query LAATFL---------tCHSIAH-GINL-RKSPV-------------------LQYLYYla  475
ident                     || |                                    
Sbjct ICSMIMggvfekfpklKVCFAHgGGAFpFTVGRishgfsmrpdlcaqdnpmnPKKYLG--  260
DSSP  HHHHHLllhhhhllllLEEELHhHLLHhHHHHHhhhhhhhlhhhhlllllllHHHHLL--


DSSP  LLLEEELHHhhllllllLLLLlHHHHHHLLL--LEEELLLLHHHHllllLHHHHHHHHHh
Query QIGLAMSPLsnnslfldYHRNpFPVFFLRGL--NVSLSTDDPLQIhltkEPLVEEYSIAa  533
ident                                   | | || |                  
Sbjct SFYTDALVH--------DPLS-LKLLTDVIGkdKVILGTDYPFPL--geLEPGKLIESM-  308
DSSP  LLEEELLLL--------LHHH-HHHHHHHHLllLEELLLLLLLLL--llLLLLHHHHHL-


DSSP  hhHLLLHHHHHHHH-HHHHHHLLLLHHHHhhhlllllllllhhhllhhhhlllhhhhhhh
Query svWKLSACDLCEIA-RNSVYQSGFSHALKshwigkdyykrgpdgndihktnvphirvefr  592
ident                 |     |                                     
Sbjct --EEFDEETKNKLKaGNALAFLGLERKQF-------------------------------  335
DSSP  --LLLLHHHHHHHHlHHHHHHHLLLHHHL-------------------------------


DSSP  hhhhhhhhhhhlllllllllllll
Query dtiwkeemqqvylgkavisdevvp  616
ident                         
Sbjct ------------------------  335
DSSP  ------------------------


No 38: Query=2a3lA Sbjct=4b3zD Z-score=9.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
ident                                                             
Sbjct ---------------drllikggriinddQSLYadvyledglikqigenlivpggvktie   45
DSSP  ---------------leeeeeeeeeelllLEEEeeeeeelleeeeeellllllllleeee


DSSP  -lLLLLLllLLEEEEEEELLLlllhhhhhhhhhhhhhllllllleeelleeelhhhhhhh
Query -aPHRDFynVRKVDTHVHHSAcmnqkhllrfiksklrkepdevvifrdgtyltlrevfes  212
ident              |                                              
Sbjct anGRMVI--PGGIDVNTYLQK---------------------------------------   64
DSSP  llLLEEE--ELEEEEEELLLL---------------------------------------


DSSP  hlllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHH
Query ldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeIT  272
ident                                                             
Sbjct ------------------------------------------------------taadDF   70
DSSP  ------------------------------------------------------llllLH


DSSP  HHHHHHHLLLLLEEEEEEEELLLLLllHHHHHHHHHHLL-LLLL-LLEEEEEEEELlhhh
Query KQVFSDLEASKYQMAEYRISIYGRKmsEWDQLASWIVNN-DLYS-ENVVWLIQLPRlyni  330
ident  |           |                          |  |                
Sbjct FQGTRAALVGGTTMIIDHVVPEPGS--SLLTSFEKWHEAaDTKScCDYSLHVDITS----  124
DSSP  HHHHHHHHHLLEEEEEEEELLLLLL--LHHHHHHHHHHHhHLLLlLEEEEEEELLL----


DSSP  hlllllllllhhHHHHhLLHHHhhhhlhhhllllhhhhLLEEEEEEELLLllllllllll
Query ykdmgivtsfqnILDNiFIPLFeatvdpdshpqlhvflKQVVGFDLVDDEskperrptkh  390
ident                     |                 | |  |                
Sbjct -----------wYDGV-REELE-----------vlvqdKGVNSFQVYMAY----------  151
DSSP  -----------lLLLH-HHHHH-----------hhhhlLLLLEEEEELLL----------


DSSP  llllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLL------------
Query mptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSG------------  438
ident                    |     |  |                |              
Sbjct --------kdvyqmSDSQLYEAFTFLKGLG----------AVILVHAEngdliaqeqkri  193
DSSP  --------llllllLHHHHHHHHHHHHHHL----------LEEEEELLlhhhhhhhhhhh


DSSP  ----------------lLLLLHHHHHHHHHL------LLLLLLH---HHHHlhhHHHHHH
Query ----------------eAGDIDHLAATFLTC------HSIAHGI---NLRKspvLQYLYY  473
ident                                        |                    
Sbjct lemgitgpeghalsrpeELEAEAVFRAITIAgrincpVYITKVMsksAADI---IALARK  250
DSSP  hhllllllhhhhhhllhHHHHHHHHHHHHHHhhhlllEEEEEELlhhHHHH---HHHHHH


DSSP  -HHLLLEEELHHH--------------------hllLLLL-LLLL-LHHHHHHLLLLEEE
Query -LAQIGLAMSPLS--------------------nnsLFLD-YHRN-PFPVFFLRGLNVSL  510
ident             |                                         |     
Sbjct kGPLVFGEPIAASlgtdgthywsknwakaaafvtspPLSPdPTTPdYLTSLLACGDLQVT  310
DSSP  hLLLEEEEELHHHhhlllhhhhlllhhhhhhlllllLLLLlLLHHhHHHHHHHHLLLLLL


DSSP  LLLLH-------------------HHHLlllLHHHHHHHHHH-HHHLLLHHHHHHHH-HH
Query STDDP-------------------LQIHltkEPLVEEYSIAA-SVWKLSACDLCEIA-RN  549
ident                                |         |    |            |
Sbjct GSGHCpystaqkavgkdnftlipeGVNG--iEERMTVVWDKAvATGKMDENQFVAVTsTN  368
DSSP  LLLLLlllhhhhhhhlllhhhlllLLLL--lLLHHHHHHHHHlLLLLLLHHHHHHHHlHH


DSSP  HHHhLLLLhhhHHHH-LLLL----------------------------lllllhhhllhh
Query SVYqSGFShalKSHW-IGKD----------------------------yykrgpdgndih  580
ident                                                             
Sbjct AAK-IFNL---YPRKgRIAVgsdadvviwdpdklktitakshksaveynifegmechgsp  424
DSSP  HHH-HHLL---LLLLlLLLLllllleeeeeeeeeeelllllllllllllllllleeeeee


DSSP  hhlllhhhhhhhhhhhhhhhhhhlllllllllLLLL-----------------
Query ktnvphirvefrdtiwkeemqqvylgkavisdEVVP-----------------  616
ident                                 |                    
Sbjct lvvisqgkivfedgninvnkgmgrfiprkafpEHLYqrvkirnkvfglqgvsr  477
DSSP  eeeeelleeeeelleellllllllllllllllHHHHhhhhhhhhhllllllll


No 39: Query=2a3lA Sbjct=2dvtA Z-score=9.1

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllLLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfyNVRKVDTHVHHSacmnqkhl  180
ident                                            ||    |          
Sbjct ----------------------------------------MQGKVALEEHFA--------   12
DSSP  ----------------------------------------LLLEEEEEEEEL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhllllllLLLLLllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydLNVDLldvhadkstfhrfdkf  240
ident                                                             
Sbjct --------------------------ipetlqdsagfvpGDYWK----------------   30
DSSP  --------------------------lhhhhhhhlllllLLHHH----------------


DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLE-EEEEEE---ELLL-
Query nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQ-MAEYRI---SIYG-  295
ident                                       |                     
Sbjct -----------------------elqhrllDIQDTRLKLMDAHGIeTMILSLnapAVQAi   67
DSSP  -----------------------hhhhhhhLLLLHHHHHHHHLLEeEEEEEElllHHHHl


DSSP  ----LLLLHHHHHHHHHH-llLLLLLLEEEEEEEellhhhhlllllllllhhHHHHHLLH
Query ----RKMSEWDQLASWIV-nnDLYSENVVWLIQLprlyniykdmgivtsfqnILDNIFIP  350
ident                                  |                    |     
Sbjct pdrrKAIEIARRANDVLAeecAKRPDRFLAFAAL---------------plqDPDAATEE  112
DSSP  llhhHHHHHHHHHHHHHHhhhHHLLLLEEEEELL---------------lllLHHHHHHH


DSSP  HHhhhhlhhhllllHHHHllEEEEEEELlllllllllllllllllllLLLLLLlhhHHHH
Query LFeatvdpdshpqlHVFLkqVVGFDLVDdeskperrptkhmptpaqwTNAFNPafsYYVY  410
ident |                    ||                             |    |  
Sbjct LQ---------rcvNDLG--FVGALVNG---------------fsqeGDGQTP---LYYD  143
DSSP  HH---------hhhHLLL--LLEEEEEL---------------llllLLLLLL---LLLL


DSSP  H-hHHHHHHHHHHhlllllLLLEELLLL----------------------lLLLL-LHHH
Query Y-cYANLYVLNKLreskgmTTITLRPHS----------------------gEAGD-IDHL  446
ident    |                      |                         |     | 
Sbjct LpqYRPFWGEVEK------LDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtAVHA  197
DSSP  LhhHHHHHHHHHH------HLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhHHHH


DSSP  HHHHH---------hLLLLLL-LHHH-HHLH-------------------HHHHHHHhHL
Query AATFL---------tCHSIAH-GINL-RKSP-------------------VLQYLYYlAQ  476
ident                     | |  |                                  
Sbjct LRLMAsglfdehprlNIILGHmGEGLpYMMWridhrnawvklpprypakrRFMDYFN-EN  256
DSSP  HHHHHllhhhhllllLEEELHhHLLHhHHHHhhhhlllllllllllllllLHHHHHH-HH


DSSP  LLEEELHHhhllllllLLLLlHHHHHHLLL--LEEELLLLHHHHllllLHHHHHHHHHhh
Query IGLAMSPLsnnslfldYHRNpFPVFFLRGL--NVSLSTDDPLQIhltkEPLVEEYSIAas  534
ident      |                    |         ||| |                   
Sbjct FHITTSGN-------fRTQT-LIDAILEIGadRILFSTDWPFEN---iDHASDWFNAT--  303
DSSP  EEEELLLL-------lLHHH-HHHHHLLLLhhHEELLLLLLLLL---hHHHHHHHHHL--


DSSP  hhLLLHHHHHHHH-HHHHHHlLLLHhhhhhhlllllllllhhhllhhhhlllhhhhhhhh
Query vwKLSACDLCEIA-RNSVYQsGFSHalkshwigkdyykrgpdgndihktnvphirvefrd  593
ident        |   |   |                                            
Sbjct --SIAEADRVKIGrTNARRL-FKLD-----------------------------------  325
DSSP  --LLLHHHHHHHHlHHHHHH-LLLL-----------------------------------


DSSP  hhhhhhhhhhlllllllllllll
Query tiwkeemqqvylgkavisdevvp  616
ident                        
Sbjct -----------------------  325
DSSP  -----------------------


No 40: Query=2a3lA Sbjct=3pnuA Z-score=9.0

back to top
DSSP  llllllLLLLLLllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaADILRKepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------ENLYFQ------------------------------------------------    6
DSSP  ------LLLLLL------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    6
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllLLLLlLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphRDFYnVRKVDTHVHHSacmnqkhl  180
ident                                              | | |          
Sbjct ----------------------------------snAMKL-KNPLDMHLHLR--------   23
DSSP  ----------------------------------llLEEE-ELLEEEEELLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   23
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllHHHHHHHHHHHHllLLLEEEEEEEElllllllH
Query nlkynpcgqsrlreiflkqdnliqgrfLGEITKQVFSDLeaSKYQMAEYRISiygrkmsE  300
ident                                               |             
Sbjct ---------------------------DNQMLELIAPLS-aRDFCAAVIMPN--lipplC   53
DSSP  ---------------------------LHHHHHHHHHHH-hLLLLEEEELLL--lllllL


DSSP  HHHHHHHHhlLLLL------lLLEEEEEEEellhhhhlllllllllhhhhhhHLLHHHHH
Query WDQLASWIvnNDLY------sENVVWLIQLprlyniykdmgivtsfqnildnIFIPLFEA  354
ident                                                             
Sbjct NLEDLKAY-kMRILkackdenFTPLMTLFF--------------------knYDEKFLYS   92
DSSP  LHHHHHHH-hHHHHhhhllllLEEEEEEEL--------------------llLLHHHHHH


DSSP  hhlhhhllllhhhHLLEEEEEEE-LLLLlllllllllllllllllllllllhhHHHHH-h
Query tvdpdshpqlhvfLKQVVGFDLV-DDESkperrptkhmptpaqwtnafnpafsYYVYY-c  412
ident                   |  |                                      
Sbjct ------------aKDEIFGIXLYpAGIT------------------tnsnggvSSFDIey  122
DSSP  ------------hLLLLLEEEELlLLLL------------------lllllllLLLLHhh


DSSP  HHHHHHHHHHHllllllLLEELLLLL-----llLLLHHHHHHHHH-------lLLLLLLH
Query YANLYVLNKLReskgmtTITLRPHSG-----eaGDIDHLAATFLT-------cHSIAHGI  460
ident                   | |  |                                 |  
Sbjct LKPTLEAMSDL------NIPLLVHGEtndfvmdRESNFAKIYEKLakhfprlkIVMEHIT  176
DSSP  HHHHHHHHHHL------LLLEEELLLllllhhhLLHHHHHHHHHHhhhlllllEEELLLL


DSSP  HHHhlhhhHHHHHHHL-LLEEELHHH------------------hllLLLL-llLLLHHH
Query NLRkspvlQYLYYLAQ-IGLAMSPLS------------------nnsLFLD-yhRNPFPV  500
ident           |                                                 
Sbjct TKT----lCELLKDYEnLYATITLHHliitlddviggkmnphlfckpIAKRyedKEALCE  232
DSSP  LHH----hHHHHHHLLlEEEEELLHHhlllhhhhhlllllhhhllllLLLLhhhHHHHHH


DSSP  HHH-lLLLEEELLLLH--------HHHLlllLHHHHHHHHHHHHhLLLHHHHHHH-HHHH
Query FFL-rGLNVSLSTDDP--------LQIHltkEPLVEEYSIAASVwKLSACDLCEI-ARNS  550
ident         |    |                                 |   |      | 
Sbjct LAFsgYEKVMFGSDSAphpkgcaaGVFS--aPVILPVLAELFKQ-NSSEENLQKFlSDNT  289
DSSP  HHHllLLLEEELLLLLllllllllLLLL--hHHHHHHHHHHHHH-HLLHHHHHHHhLHHH


DSSP  HHHlLLLHhhHHHHlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllll
Query VYQsGFSHalKSHWigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavi  610
ident                                                             
Sbjct CKI-YDLK--FKED--------------kiltleekewqvpnvyedkynqvvpymageil  332
DSSP  HHH-HLLL--LLLL--------------leeeeellleelllleelllleelllllllee


DSSP  llllll
Query sdevvp  616
ident       
Sbjct kfqlkh  338
DSSP  lleell


No 41: Query=2a3lA Sbjct=1itqA Z-score=8.8

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllLLLL-LLEEEEeEELLllllhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrDFYN-VRKVDThVHHSacmnqkh  179
ident                                               |             
Sbjct -----------------------------dffrdeaeRIMRdSPVIDG-HNDL-------   23
DSSP  -----------------------------lhhhhhhhHHHLlLLEEEE-EELH-------


DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll
Query llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
ident                                                             
Sbjct ------------------------------------------------------------   23
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllhhhhhhLLLLLlLLLLL--hhHHHHH-----HHHHHLLLLLE-EEEEEE
Query fnlkynpcgqsrlreifLKQDNlIQGRF--lgEITKQ-----VFSDLEASKYQ-MAEYRI  291
ident                     |     |                                 
Sbjct ---------------pwQLLDM-FNNRLqderANLTTlagthTNIPKLRAGFVgGQFWSV   67
DSSP  ---------------hhHHHHH-HLLLLllhhHLLLLlllllLLHHHHHHLLEeEEEEEE


DSSP  ELL-----lLLLLHHHHHHHHHHlLLLL----------------------lLLEEEEEEE
Query SIY-----gRKMSEWDQLASWIVnNDLY----------------------sENVVWLIQL  324
ident                                                             
Sbjct YTPcdtqnkDAVRRTLEQMDVVH-RMCRmypetflyvtssagirqafregkVASLIGVEG  126
DSSP  LLLhhhlllLHHHHHHHHHHHHH-HHHHhlllleeelllhhhhhhhhhlllEEEEEEEEL


DSSP  ELlhhhhlllllllllhHHHHhHLLHHhhhhhlhhhllllhhhHLLEEEEEEELL-----
Query PRlyniykdmgivtsfqNILDnIFIPLfeatvdpdshpqlhvfLKQVVGFDLVDD-----  379
ident                    |      |                        |        
Sbjct GH------------sidSSLG-VLRAL---------------yQLGMRYLTLTHScntpw  158
DSSP  HH------------hllLLHH-HHHHH---------------hHLLEEEEELLLLlllll


DSSP  ---LLLL---LLLLlllllllllllllllLLHHH-hHHHHHHHHHHHHhhhlllllllLE
Query ---ESKP---ERRPtkhmptpaqwtnafnPAFSY-yVYYCYANLYVLNklreskgmttIT  432
ident                                            |  |             
Sbjct adnWLVDtgdSEPQ---------------SQGLSpfGQRVVKELNRLG----------VL  193
DSSP  lllHHHLlllLLLL---------------LLLLLhhHHHHHHHHHHHL----------LE


DSSP  ELLLLllllLLHHHHHHHHHL---LLLL-LLHH--------HHHLhhHHHHHHHHLLLEE
Query LRPHSgeagDIDHLAATFLTC---HSIA-HGIN--------LRKSpvLQYLYYLAQIGLA  480
ident                ||                                 |         
Sbjct IDLAH---vSVATMKATLQLSrapVIFShSSAYsvcasrrnVPDD--VLRLVKQTDSLVM  248
DSSP  EELLL---lLHHHHHHHHHHLlllLEELlLLLLllllllllLLHH--HHHHHHHHLLEEE


DSSP  ELhhHHLLlLLLL--------llLLHHHHHHLLL--LEEELLLLH--HHHLLL---lLHH
Query MSplSNNSlFLDY--------hrNPFPVFFLRGL--NVSLSTDDP--LQIHLT---kEPL  525
ident       |                              |    |                 
Sbjct VN--FYNN-YISCtnkanlsqvaDHLDHIKEVAGarAVGFGGDFDgvPRVPEGledvSKY  305
DSSP  EL--LLHH-HHLLlllllhhhhhHHHHHHHHHLLhhHEEELLLLLllLLLLLLllllLLH


DSSP  HHHHHHHHHHhLLLHHHHHHHH-HHHHHHLlllhhhhhhhlllllllllhhhllhhhhll
Query VEEYSIAASVwKLSACDLCEIA-RNSVYQSgfshalkshwigkdyykrgpdgndihktnv  584
ident                         |                                   
Sbjct PDLIAELLRR-NWTEAEVKGALaDNLLRVF---------------------------eav  337
DSSP  HHHHHHHHHL-LLLHHHHHHHHlHHHHHHH---------------------------hhh


DSSP  lhhhhhhhhhhhhhhhhhhlllllllllllll
Query phirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                 
Sbjct eqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhllllllllllllllhhhlllllllllllll


No 42: Query=2a3lA Sbjct=2gwgA Z-score=8.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                              | | |          
Sbjct ------------------------------------------XIIDIHGHYT--------   10
DSSP  ------------------------------------------LLEEEEEELL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   10
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhHHHH-----------------lllllLLLLL-LHHHHHHHH-HHHHLL
Query nlkynpcgqsrlREIF-----------------lkqdnLIQGR-FLGEITKQV-FSDLEA  281
ident                                       |      |              
Sbjct ----------taPKALedwrnrqiagikdpsvxpkvseLKISDdELQASIIENqLKKXQE   60
DSSP  ----------llLHHHhhhhhhhhhhhhlhhhlllhhhLLLLHhHHHHHHHLLhHHHHHH


DSSP  LLLEEEEEEEE--lllLLLLHHHHHHHH-hhllLLLLLLEEEEEEEeLLHHhhlllllll
Query SKYQMAEYRIS--iygRKMSEWDQLASW-ivnnDLYSENVVWLIQLpRLYNiykdmgivt  338
ident                                   |   |      |              
Sbjct RGSDLTVFSPRagdfnVSSTWAAICNELcyrvsQLFPDNFIGAAXLpQSPG---------  111
DSSP  HLLLEEEEELLlllhhHHHHHHHHHHHHhhhhhHHLLLLEEEEEELlLLLL---------


DSSP  llHHHHHhHLLHHHhhhhlhhhllllHHHHllEEEEEEELL-llLLLLllllllllllll
Query sfQNILDnIFIPLFeatvdpdshpqlHVFLkqVVGFDLVDD-esKPERrptkhmptpaqw  397
ident             |                    |   |  |                   
Sbjct --VDPKT-CIPELE---------kcvKEYG--FVAINLNPDpsgGHWT------------  145
DSSP  --LLHHH-HHHHHH---------hhhHLLL--LLEEEELLLlllLLLL------------


DSSP  lllllLLHHHhHHHHhHHHHHHHHHhlllllLLLEELLL-----lLLLLlLHHHHHHHH-
Query tnafnPAFSYyVYYCyANLYVLNKLreskgmTTITLRPH-----sGEAGdIDHLAATFL-  451
ident                    |             |    |                     
Sbjct -----SPPLT-DRIW-YPIYEKXVE------LEIPAXIHvstgahYLNAdTTAFXQCVAg  192
DSSP  -----LLLLL-LHHH-HHHHHHHHH------HLLLEEELlllllhHHHHhHHHHHHHHHl


DSSP  --------hLLLLLL-LHHH-HHLHHH---------hhhhHHHL--LLEEELHHhhllll
Query --------tCHSIAH-GINL-RKSPVL---------qylyYLAQ--IGLAMSPLsnnslf  490
ident             | | |                             |             
Sbjct dlfkdfpelKFVIPHgGGAVpYHWGRFrglaqexkkplleDHVLnnIFFDTCVY------  246
DSSP  lhhhhllllLEEELHhHLLLhHHHHHHhhhhhhlllllhhHHLLllEEEELLLL------


DSSP  llLLLLlHHHHHHLLL--LEEELLLLHHHHLLL------LLHHhhHHHHHHHHHLLLHHH
Query ldYHRNpFPVFFLRGL--NVSLSTDDPLQIHLT------KEPLveEYSIAASVWKLSACD  542
ident                   ||                                   |    
Sbjct --HQPG-IDLLNTVIPvdNVLFASEXIGAVRGIdprtgfYYDD--TKRYIEASTILTPEE  301
DSSP  --LHHH-HHHHHHHLLhhHEELLLLLLLLLLLEelllleELLL--LHHHHHHLLLLLHHH


DSSP  HHHHHHHHHHHLL--LLHHHHHHhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhh
Query LCEIARNSVYQSG--FSHALKSHwigkdyykrgpdgndihktnvphirvefrdtiwkeem  600
ident    |              |||                                       
Sbjct KQQIYEGNARRVYprLDAALKAK-------------------------------------  324
DSSP  HHHHHLHHHHHHLhhHHHHHHHH-------------------------------------


DSSP  hhhlllllllllllll
Query qqvylgkavisdevvp  616
ident                 
Sbjct -----------gkleh  329
DSSP  -----------hhhll


No 43: Query=2a3lA Sbjct=1onxA Z-score=8.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------
Query irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
ident                                    |                        
Sbjct --------------------midytaagftllQGAHLYapedrgicdvlvangkiiavas   40
DSSP  --------------------llllhhhlleeeEEEEEEllleeeeeeeeeelleeeeeel


DSSP  ------------------llLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeel
Query ------------------fyNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrd  200
ident                          | |||                              
Sbjct nipsdivpnctvvdlsgqilCPGFIDQHVHLI----------------------------   72
DSSP  lllllllllleeeelllleeEELEEEEEELLL----------------------------


DSSP  leeelhhhhhhhhlllllllllllllllllllllllllllhhHHLLLLLLhhhhhHLLLl
Query gtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlKYNPCGQSrlreiFLKQd  260
ident                                                |            
Sbjct -----------------------------------------gGGGEAGPT----tRTPE-   86
DSSP  -----------------------------------------lLLLLLLHH----hLLLL-


DSSP  lllllllhhhhhhhHHHHHLlLLLE-EEEEEEelLLLLllHHHHHHHhhhlLLLL--LLL
Query nliqgrflgeitkqVFSDLEaSKYQ-MAEYRIsiYGRKmsEWDQLASwivnNDLY--SEN  317
ident                 | |                         |        |      
Sbjct -------------vALSRLT-EAGVtSVVGLLgtDSIS-rHPESLLA--ktRALNeeGIS  129
DSSP  -------------lLHHHHH-HLLEeEEEELLllLLLL-lLHHHHHH--hhHHHHhhLLE


DSSP  EEEEEEEELlhhhhlllllllllhhhhhHHLLHHhhhhhlhhhllllhhhHLLEEEEEEE
Query VVWLIQLPRlyniykdmgivtsfqnildNIFIPLfeatvdpdshpqlhvfLKQVVGFDLV  377
ident    |                                                 | |    
Sbjct AWMLTGAYH----------------vpsRTITGS---------vekdvaiIDRVIGVXCA  164
DSSP  EEEEEELLL----------------lllLLLLLL---------hhhhhhhLLLEEEEEEE


DSSP  lLLLLlllllllllllllllllllLLLHHHHHHHHHHHHHHHHHHHLllllLLLEELLLL
Query dDESKperrptkhmptpaqwtnafNPAFSYYVYYCYANLYVLNKLREskgmTTITLRPHS  437
ident                              |      |   |   |             | 
Sbjct iSDHR------------------sAAPDVYHLANMAAESRVGGLLGG----KPGVTVFHM  202
DSSP  eLLLL------------------lLLLLHHHHHHHHHHHHHHHHHHL----LLLEEEEEE


DSSP  lLLLLLhHHHHHHHH---------LLLLLLLH----HHHHlhhhHHHHHHHlLLEEELhH
Query gEAGDIdHLAATFLT---------CHSIAHGI----NLRKspvlQYLYYLAqIGLAMSpL  484
ident         |                    |                              
Sbjct -GDSKK-ALQPIYDLlencdvpisKLLPTHVNrnvpLFEQ---aLEFARKG-GTIDIT-S  255
DSSP  -LLLLL-LLHHHHHHhhlllllhhHEEEELHHhlhhHHHH---hHHHHHLL-LLEEEE-L


DSSP  HHLllLLLLllLLHHHHHHLLL---LEEELLLL---------------hHHHLlllLHHH
Query SNNslFLDYhrNPFPVFFLRGL---NVSLSTDD---------------pLQIHltkEPLV  526
ident |                   |     | || |                        | | 
Sbjct SID--EPVApaEGIARAVQAGIplaRVTLSSDGngsqpffddegnlthiGVAG--fETLL  311
DSSP  LLL--LLLLhhHHHHHHHHLLLlhhHEEEELLLlleeeeellllleeeeEELL--lHHHH


DSSP  HHHHHHHHHHLLLHHHHHHH-HHHHHHHLLLlHHHHhhHLLLLLllllhhhllhhhhlll
Query EEYSIAASVWKLSACDLCEI-ARNSVYQSGFsHALKshWIGKDYykrgpdgndihktnvp  585
ident |           |  |                       |                    
Sbjct ETVQVLVKDYDFSISDALRPlTSSVAGFLNL-TGKG--EILPGN---------dadllvm  359
DSSP  HHHHHHHHHHLLLHHHHHHHhLHHHHHHLLL-LLLL--LLLLLL---------llleeee


DSSP  hhhhhhhhhhhhhhhhhhlllllllllllll
Query hirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                
Sbjct tpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  llllleeeeeelleeeeelleelllllllll


No 44: Query=2a3lA Sbjct=2qpxA Z-score=8.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhHHHHhhhhhlllLLLLLLLEEEEEEElllLLLHhhH
Query irtlchrrlvlleqkfnlhlmlnaDKEFlaqksaphRDFYNVRKVDTHVHhsaCMNQkhL  180
ident                                          |   | | |          
Sbjct ------------------------GXDD------lsEFVDQVPLLDHHCH---FLID--G   25
DSSP  ------------------------LLLL------lhHHHHHLLEEEEEEL---LLLL--L


DSSP  HHHhhhhhhllllllleeelleeelhhhhhhhhlllllllLLLLllllllllllllllLL
Query LRFiksklrkepdevvifrdgtyltlrevfesldltgydlNVDLldvhadkstfhrfdKF  240
ident                                         | |                 
Sbjct KVP-------------------------------------NRDD--------rlaqvsTE   40
DSSP  LLL-------------------------------------LHHH--------hhhhhlLL


DSSP  HH----------hhllllllhhhhhhlllllllllllhhhhhHHHHHHHLLLLLE-EEEE
Query NL----------kynpcgqsrlreiflkqdnliqgrflgeitKQVFSDLEASKYQ-MAEY  289
ident                                                             
Sbjct ADkdypladtknrlayhgflalakefaldannplaaxndpgyATYNHRIFGHFHFkELLI  100
DSSP  LLllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhHHHHHHHHHHLLEeEEEE


DSSP  EEElllllllhhhhhhhhhhllLLLL----LLEEEEEEEELlhhhhllllLLLLLHHHHH
Query RISiygrkmsewdqlaswivnnDLYS----ENVVWLIQLPRlyniykdmgIVTSFQNILD  345
ident                       |         |     |               |     
Sbjct DTG---------fvpddpildlDQTAelvgIPVKAIYRLET--haedfxlEHDNFAAWWQ  149
DSSP  ELL---------lllllllllhHHHHhhhlLLEEEEEEHHH--hhhhhhlLLLLHHHHHH


DSSP  HHLLHHHhhhhlhhhllllHHHHllEEEEEEE----llllllllllllllLLLLLLL--L
Query NIFIPLFeatvdpdshpqlHVFLkqVVGFDLV----ddeskperrptkhmPTPAQWT--N  399
ident                           |||                          |    
Sbjct AFSNDVK----------qaKAHG--FVGFXSIaayrvglhlepvnvieaaAGFDTWKhsG  197
DSSP  HHHHHHH----------llLLLL--LLLEEELhhhhlllllllllhhhhhHHHHHHHhhL


DSSP  LLLLLhHHHHHHHHHHHHHHHHHHllllllLLEELLLLLLL-----LLLHHHHHHHHH--
Query AFNPAfSYYVYYCYANLYVLNKLReskgmtTITLRPHSGEA-----GDIDHLAATFLT--  452
ident            |                     |  | |                     
Sbjct EKRLTsKPLIDYXLYHVAPFIIAQ------DXPLQFHVGYGdadtdXYLGNPLLXRDYlk  251
DSSP  LLLLLlHHHHHHHHHHHHHHHHHH------LLLEEEEELLLlllllHHHLLHHHHHHHhh


DSSP  -------lLLLLLLHHHHhlhhhHHHHHHH-LLLEEEL-HHHHLlllllLLLL--LHHHH
Query -------cHSIAHGINLRkspvlQYLYYLA-QIGLAMS-PLSNNslfldYHRN--PFPVF  501
ident             |           ||           |                  |   
Sbjct aftkkglkVVLLHCYPYH--reaGYLASVFpNLYFDISlLDNLG-----PSGAsrVFNEA  304
DSSP  hhhhhlllEEEEELLLLH--hhhHHHHHHLlLEEEELLlHHHHL-----HHHHhhHHHHH


DSSP  HHLLL--LEEELLLLHHHhllllLHHHHHHHHHHHHHL---------lLHHHHHHHH-HH
Query FLRGL--NVSLSTDDPLQihltkEPLVEEYSIAASVWK---------lSACDLCEIA-RN  549
ident              |                  |                      |    
Sbjct VELAPytRILFASDASTY-pexyGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICwQT  363
DSSP  LLLLLhhHEELLLLLLLL-hhhhHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHlHH


DSSP  HHHHlLLLHHHHHHhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllllll
Query SVYQsGFSHALKSHwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkav  609
ident |                                                           
Sbjct SAKL-YHQERELRV----------------------------------------------  376
DSSP  HHHH-LLLHHHHLL----------------------------------------------


DSSP  lllllll
Query isdevvp  616
ident        
Sbjct -------  376
DSSP  -------


No 45: Query=2a3lA Sbjct=4qrnA Z-score=8.4

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNVRKVDTHVHHSacmnqkhl  180
ident                                               |             
Sbjct ----------------------------smtqdlktggEQGYLRIATEEAFA--------   24
DSSP  ----------------------------llllllllllLLLLLLEEEEEEEL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   24
DSSP  ------------------------------------------------------------


DSSP  hhhhLLLLLL----------------HHHHHhlllllllllllhhhHHHH-HHHHHLLLL
Query nlkyNPCGQS----------------RLREIflkqdnliqgrflgeITKQ-VFSDLEASK  283
ident                                                       |  |  
Sbjct -treIIDVYLrmirdgtadkgmvslwGFYAQ-spseratqilerllDLGErRIADMDATG   82
DSSP  -lhhHHHHHHhhhhhllllhhhhhhhHHHHH-lllhhhhhhhhhhhLLLHhHHHHHHHLL


DSSP  LEEEEEEE---eLLLL-----LLLHHHHHHHHH-hllLLLLLLEEEEEEEellhhhhlll
Query YQMAEYRI---sIYGR-----KMSEWDQLASWI-vnnDLYSENVVWLIQLprlyniykdm  334
ident    |                                   |                    
Sbjct IDKAILALtspgVQPLhdldeARTLATRANDTLadacQKYPDRFIGMGTV----------  132
DSSP  LLEEEEEEllllLLLLllhhhHHHHHHHHHHHHhhhhHHLLLLEEELLLL----------


DSSP  llllllhHHHHHHLLhhhhhhhlhhhllllHHHHllEEEEEEELllllllllllllllll
Query givtsfqNILDNIFIplfeatvdpdshpqlHVFLkqVVGFDLVDdeskperrptkhmptp  394
ident                                       |                     
Sbjct -----apQDPEWSAR---------eihrgaRELG--FKGIQINS----------------  160
DSSP  -----llLLHHHHHH---------hhhhhhHLLL--LLLEEELL----------------


DSSP  lllllllLLLHhhHHHHhHHHHHHHHHHHllllllLLEELLL------------------
Query aqwtnafNPAFsyYVYYcYANLYVLNKLReskgmtTITLRPH------------------  436
ident                                       |  |                  
Sbjct -----htQGRY--LDEEfFDPIFRALVEV------DQPLYIHpatspdsmidpmleagld  207
DSSP  -----llLLLL--LLLHhHHHHHHHHHHH------LLLEEELlllllllllhhhhhhlll


DSSP  ---llLLLL-LHHHHHHHH---------hLLLLLL-LHHH-HHLH---------------
Query ---sgEAGD-IDHLAATFL---------tCHSIAH-GINL-RKSP---------------  466
ident             ||                    | |  |                    
Sbjct gaifgFGVEtGMHLLRLITigifdkypslQIMVGHmGEALpYWLYrldymhqagvrsqry  267
DSSP  llllhHHHHhHHHHHHHHHhlhhhhllllLEEELHhHHLHhHHHHhhhhhhhhhhhllll


DSSP  --------HHHHHHHhHLLLEEELHHhhlllllllllLLHHHHHHLLL--LEEELLLLHH
Query --------VLQYLYYlAQIGLAMSPLsnnslfldyhrNPFPVFFLRGL--NVSLSTDDPL  516
ident                        |                           |    | | 
Sbjct ermkplkkTIEGYLK-SNVLVTNSGV--------awePAIKFCQQVMGedRVMYAMDYPY  318
DSSP  llllllllLHHHHHH-HLEEEELLLL--------llhHHHHHHHHHHLhhHEELLLLLLL


DSSP  HHLlllLHHHHHHHHHhhhhLLLHHHHHHHH-HHHHHHLLLlhhhhhhhlllllllllhh
Query QIHltkEPLVEEYSIAasvwKLSACDLCEIA-RNSVYQSGFshalkshwigkdyykrgpd  575
ident |        |            ||         |                          
Sbjct QYV---ADEVRAMDAM----DMSAQTKKKFFqTNAEKWFKL-------------------  352
DSSP  LLL---HHHHHHHHLL----LLLHHHHHHHHlHHHHHHLLL-------------------


DSSP  hllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query gndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                          
Sbjct -----------------------------------------  352
DSSP  -----------------------------------------


No 46: Query=2a3lA Sbjct=3e74A Z-score=8.1

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH-------------------------lL
Query irtlchrrlvlleqkfnlhlmlnadkeflAQKS-------------------------aP  155
ident                              |                              
Sbjct -------------sfdliikngtvileneARVVdiavkggkiaaigqdlgdakevxdasG   47
DSSP  -------------leeeeeelleeellllEEELeeeeelleeeeeellllleeeeeellL


DSSP  LLLLllLLEEEEEEELlllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhhll
Query HRDFynVRKVDTHVHHsacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldl  215
ident          || | |                                             
Sbjct LVVS--PGXVDAHTHI--------------------------------------------   61
DSSP  LEEE--ELEEEEEELL--------------------------------------------


DSSP  lllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHHHHH
Query tgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeITKQV  275
ident                                                             
Sbjct -------------------------------------------------------GYETG   66
DSSP  -------------------------------------------------------LHHHH


DSSP  HHHHLLLLLEEEEEEEElllllllhHHHHHHHHHLL-LLLL-LLEEEEEEEELLhhhhll
Query FSDLEASKYQMAEYRISiygrkmseWDQLASWIVNN-DLYS-ENVVWLIQLPRLyniykd  333
ident                                                |  |         
Sbjct TRAAAKGGITTXIEXPL-nqlpatvDRASIELKFDAaKGKLtIDAAQLGGLVSY------  119
DSSP  HHHHHHLLEEEEEELLL-lllllllLHHHHHHHHHHhLLLLlLEEEELEELLLL------


DSSP  lllllllhhHHHHHLlhhhhhhhlhhhllllhhhHLLEEEEEEEllllllllllllllll
Query mgivtsfqnILDNIFiplfeatvdpdshpqlhvfLKQVVGFDLVddeskperrptkhmpt  393
ident            |                         ||||                   
Sbjct ---------NIDRLH----------------eldEVGVVGFXCF----------------  138
DSSP  ---------LLLLHH----------------hhhHHLLLLEEEE----------------


DSSP  lllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLL---------------
Query paqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSG---------------  438
ident                       |  |                |                 
Sbjct -------vrdvNDWQFFKGAQKLGELG----------QPVLVHCEnalicdelgeeakre  181
DSSP  -------llllLHHHHHHHHHHHHHHL----------LLEEEELLlhhhhhhhhhhhhhh


DSSP  ------------lLLLL-HHHHHHHHHL------LLLLLLH--HHHHlhhHHHHHHH--H
Query ------------eAGDI-DHLAATFLTC------HSIAHGI--NLRKspvLQYLYYL--A  475
ident                                       |                     
Sbjct grvtahdyvasrpVFTEvEAIRRVLYLAkvagcrLHVCHVSspEGVE---EVTRARQegQ  238
DSSP  llllhhhhhhlllHHHHhHHHHHHHHHHhhhlllEEELLLLlhHHHH---HHHHHHHllL


DSSP  LLLEEELhHHHL-----------------lLLLL---LLLL--LHHHHhhllLLEEELLL
Query QIGLAMSpLSNN-----------------sLFLD---YHRN--PFPVFflrgLNVSLSTD  513
ident  |                               |                      |  |
Sbjct DITCESC-PHYFvldtdqfeeigtlakcspPIRDlenQKGXweKLFNG----EIDCLVSD  293
DSSP  LEEEEEL-LHHHhllhhhhhhhlhhhllllLLLLhhhHHHHhhHHHLL----LLLEELLL


DSSP  LH----------------HHHLlllLHHHHHHH-HHHHHHLLLHHHHHHH-HHHHHHHLL
Query DP----------------LQIHltkEPLVEEYS-IAASVWKLSACDLCEI-ARNSVYQSG  555
ident                                    |      |        | |     |
Sbjct HSpcppexkagnixkawgGIAG--lQSCXDVXFdEAVQKRGXSLPXFGKLxATNAADIFG  351
DSSP  LLllllllllllllllllLLLL--hHHHHHHHHhHHLLLLLLLHHHHHHHhLHHHHHHLL


DSSP  LLHhhhhhHLLLLL--------------------llllhhhllhhhhlllhhhhhhhhhh
Query FSHalkshWIGKDY--------------------ykrgpdgndihktnvphirvefrdti  595
ident          |                                                  
Sbjct LQQ---kgRIAPGKdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgd  408
DSSP  LLL---llLLLLLLllleeeeelllleellhhhllllllllllllleelleeeeeeelle


DSSP  hhhhhhhhlllllllllllll
Query wkeemqqvylgkavisdevvp  616
ident                      
Sbjct viydieqgfpvapkgqfilkh  429
DSSP  eeeelllllllllllleelll


No 47: Query=2a3lA Sbjct=1a5kC Z-score=7.7

back to top
DSSP  ----------------------llllLLLLLLllllllllllllllllllllllllllhh
Query ----------------------qpdpIAADILrkepeqetfvrlnvplevptsdeveayk   38
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladteLWIEVE----------------------------   32
DSSP  leeehhhhhhhhlllllleeelllllLEEELL----------------------------


DSSP  hhhhhhhhhhllllllllllllllllllllllllllllllllllllllllllllllllll
Query clqeclelrkryvfqetvapwekeepfahypqgksdhcfemqdgvvhvfankdakedlfp   98
ident                                                             
Sbjct ------------------------------------------------------------   32
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlLLLL
Query vadatafftdlhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaPHRD  158
ident                                                             
Sbjct -----------------ddlttygeevkfgggkvirdgmgqgqmlaadcvdlvltnALIV   75
DSSP  -----------------eellllllllllllllllllllllllllhhhllleeeeeEEEE


DSSP  L------------------------------------------------lLLLEEEEEEE
Query F------------------------------------------------yNVRKVDTHVH  170
ident                                                        ||| |
Sbjct DhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaaegkivTAGGIDTHIH  135
DSSP  ElleeeeeeeeeelleeeeeeleellllllllleellllleeeelllleeEELEEEEEEE


DSSP  LLllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllll
Query HSacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhad  230
ident                                                             
Sbjct WI----------------------------------------------------------  137
DSSP  LL----------------------------------------------------------


DSSP  llllllllllhhhhllllllhhhhhhlllllllllllhhhhHHHHHHHHLlLLLE-EEEE
Query kstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeiTKQVFSDLEaSKYQ-MAEY  289
ident                                            |                
Sbjct -----------------------------------------CPQQAEEAL-VSGVtTMVG  155
DSSP  -----------------------------------------LLLHHHHHH-HHLEeEEEE


DSSP  ------------EEELllllllHHHHHHHHHHLlLLLLLLEEEEEEEELlhhhhllllll
Query ------------RISIygrkmsEWDQLASWIVNnDLYSENVVWLIQLPRlyniykdmgiv  337
ident                                   |    |   |                
Sbjct ggtgpaagthatTCTP------GPWYISRMLQAaDSLPVNIGLLGKGNV-----------  198
DSSP  elllllhhhhhlLLLL------HHHHHHHHHHHhLLLLLEEEEEEELLL-----------


DSSP  lllhhHHHHHLLhhhhhhhlhhhllllhhhhllEEEEEEELLllllllllllllllllll
Query tsfqnILDNIFIplfeatvdpdshpqlhvflkqVVGFDLVDDeskperrptkhmptpaqw  397
ident        |                         | |     |                  
Sbjct ----sQPDALRE----------------qvaagVIGLEIHED------------------  220
DSSP  ----lLHHHHHH----------------hhhhlLLEEEEEHH------------------


DSSP  lllllllHHHHHHHHHHHHHHHhhhhllllllLLEELLLL---lllLLLH-HHHHHHHHL
Query tnafnpaFSYYVYYCYANLYVLnklreskgmtTITLRPHS---geaGDID-HLAATFLTC  453
ident                                  |    ||      |     |||     
Sbjct ----wgaTPAAIDCALTVADEM----------DIQVALHSdtlnesGFVEdTLAAIGGRT  266
DSSP  ----hllLHHHHHHHHHHHHHH----------LLEEEEELllllllLLHHhHHHHHLLLL


DSSP  LLLLLLH--------HHHHlhhhhhhHHHHLLLEEELHHH--------------------
Query HSIAHGI--------NLRKspvlqylYYLAQIGLAMSPLS--------------------  485
ident     |                          |                            
Sbjct IHTFHTEgaggghapDIIT------aCAHPNILPSSTNPTlpytlntidehldmlmvchh  320
DSSP  EEELLLLllllllllLHHH------hHHLLLEEEEEEHHHllllllhhhhhhhhhhhhhl


DSSP  -----------hllLLLLllLLLHHHHHHLLLLEEELLLLHHHHLlllLHHHHHHHHHHH
Query -----------nnsLFLDyhRNPFPVFFLRGLNVSLSTDDPLQIHltkEPLVEEYSIAAS  534
ident                          |    |     | |                   | 
Sbjct ldpdiaedvafaesRIRRetIAAEDVLHDLGAFSLTSSDSQAMGR--vGEVILRTWQVAH  378
DSSP  lllllhhhhhllllLLLHhhHHHHHHHHHLLLLLEEELLLLLLLL--lLLHHHHHHHHHH


DSSP  HHL---------------lLHHHHHHH-HHHHHHHLLLLHHHHhhHLLLLL---------
Query VWK---------------lSACDLCEI-ARNSVYQSGFSHALKshWIGKDY---------  569
ident   |                           |     |  |      |             
Sbjct RMKvqrgalaeetgdndnfRVKRYIAKyTINPALTHGIAHEVG--SIEVGKladlvvwsp  436
DSSP  HHHhhhlllllllllllhhHHHHHHHLlLHHHHHHLLLLLLLL--LLLLLLllleeeelh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  569
ident                                                             
Sbjct affgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaa  496
DSSP  hhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhh


DSSP  -----------------------llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlll
Query -----------------------ykrgpdgndihktnvphirvefrdtiwkeemqqvylg  606
ident                                                             
Sbjct angvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadv  556
DSSP  hhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllll


DSSP  llllllllll
Query kavisdevvp  616
ident           
Sbjct lpmaqryflf  566
DSSP  llllllllll


No 48: Query=2a3lA Sbjct=4dziC Z-score=7.6

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLLLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNVRKVDTHVHHSacmnqkhl  180
ident                                         | |  |   |          
Sbjct --------------------------------------ALNYRVIDVDNHYY----epld   18
DSSP  --------------------------------------LLLLLEEEEEEELL----llll


DSSP  hhhhhhhhhllllllleEELLeeelhhhhhhhhlllllllllllllllllllLLLLLLLl
Query lrfiksklrkepdevviFRDGtyltlrevfesldltgydlnvdlldvhadksTFHRFDKf  240
ident                    ||                                       
Sbjct sftrhldkkfkrrgvqmLSDG-----------------------krtwavigDRVNHFI-   54
DSSP  lllllllhhhlllleeeEELL-----------------------lleeeeelLEELLLL-


DSSP  hhhhllllLLHHHHHH----------------------lllllllllllhhhHHHHHHHH
Query nlkynpcgQSRLREIF----------------------lkqdnliqgrflgeITKQVFSD  278
ident                                                             
Sbjct --------PNPTFDPIivpgcldllfrgeipdgvdpaslmkverladhpeyqNRDARIAV  106
DSSP  --------LLLLLLLEelllllhhhhhllllllllhhhllleelhhhlhhhlLHHHHHHH


DSSP  HLLLLLEEEEEEE--------------elLLLLlLHHHHHHHHHhlllLLLLLEEEEEEE
Query LEASKYQMAEYRI--------------siYGRKmSEWDQLASWIvnndLYSENVVWLIQL  324
ident         |                                                   
Sbjct MDEQDIETAFMLPtfgcgveealkhdieaTMASvHAFNLWLDEDwgfdRPDHRIIAAPIV  166
DSSP  HHHHLEEEEEEELlhhhhhhhhllllhhhHHHHhHHHHHHHHHHllllLLLLLEEELLLL


DSSP  ELLhhhhllllllllLHHHHHHHLLHHhhhhhlhhhllllhhhhLLEEEEEEElllllll
Query PRLyniykdmgivtsFQNILDNIFIPLfeatvdpdshpqlhvflKQVVGFDLVddeskpe  384
ident                                                             
Sbjct SLA------------DPTRAVEEVDFV---------------laRGAKLVLVR-------  192
DSSP  LLL------------LHHHHHHHHHHH---------------hhLLLLLEELL-------


DSSP  llllllllllllllLLLLLLHHH-hhHHHHHHHHHhhhhhllllllLLEELLL-------
Query rrptkhmptpaqwtNAFNPAFSY-yvYYCYANLYVlnklreskgmtTITLRPH-------  436
ident                               | |                   |       
Sbjct --------papvpgLVKPRSLGDrshDPVWARLAE----------aGVPVGFHlsdsgyl  234
DSSP  --------llllllLLLLLLLLLhhhHHHHHHHHH----------hLLLEEEEllllllh


DSSP  -----------------llLLLLLHHHHHHHH---------hlLLLLL--LHHHHH-LHH
Query -----------------sgEAGDIDHLAATFL---------tcHSIAH--GINLRK-SPV  467
ident                         |  |                                
Sbjct hiaaawggakdpldqvlldDRAIHDTMASMIVhgvftrhpklkAVSIEngSYFVHRlIKR  294
DSSP  hhhhhllllllhhhhhhhlLHHHHHHHHHHHHllhhhhlllllEEEELllLLHHHHhHHH


DSSP  H---------------HHHHHhHLLLEEELHHhhlllllllllLLHHHHHHLLL--LEEE
Query L---------------QYLYYlAQIGLAMSPLsnnslfldyhrNPFPVFFLRGL--NVSL  510
ident |                          |                  |             
Sbjct LkkaantqpqyfpedpVEQLR-NNVWIAPYYE-----------DDLPELARVIGvdKILF  342
DSSP  HhhhhhhlhhhllllhHHHHH-HHEEELLLLL-----------LLHHHHHHHHLhhHLLL


DSSP  LLLLHHHHLlllLHHHHHHhHHHHhhLLLHHHHHHHH-HHHHHHLlllhhhhhhhllllL
Query STDDPLQIHltkEPLVEEYsIAASvwKLSACDLCEIA-RNSVYQSgfshalkshwigkdY  569
ident   | |          |            |  |   |   |                    
Sbjct GSDWPHGEG--lASPVSFT-AELK--GFSESDIRKIMrDNALDLL------------gvQ  385
DSSP  LLLLLLLLL--lLLHHHHH-HHHL--LLLHHHHHHHHlHHHHHHH------------llL


DSSP  LLLlhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query YKRgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                
Sbjct VGS--------------------------------------------  388
DSSP  LLL--------------------------------------------


No 49: Query=2a3lA Sbjct=3qy6A Z-score=7.3

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrKVDTHVHHSacmnqkhl  180
ident                                              | | |          
Sbjct -------------------------------------------MIDIHCHIL--------    9
DSSP  -------------------------------------------LEELLLLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------    9
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllHHHHHHHHHHHHLlLLLE-EEEEEE--------
Query nlkynpcgqsrlreiflkqdnliqgrfLGEITKQVFSDLEaSKYQ-MAEYRI--------  291
ident                                                             
Sbjct -------------------pamddgagDSADSIEMARAAV-RQGIrTIIATPhhnngvyk   49
DSSP  -------------------llllllllLHHHHHHHHHHHH-HLLLlEEELLLeellllll


DSSP  ELLLllllhhhhhhHHHHlLLLL----LLLEEEEEeeellhhhhlllllllllhhhhhhh
Query SIYGrkmsewdqlaSWIVnNDLY----SENVVWLIqlprlyniykdmgivtsfqnildni  347
ident                      |        |                             
Sbjct NEPA----avreaaDQLN-KRLIkediPLHVLPGQ-------------------------   79
DSSP  LLHH----hhhhhhHHHH-HHHHhlllLLEEELLL-------------------------


DSSP  llhhhhhhhlhhhllllhhhhlleeeeEEELllllllllllllllllllllllllllhhh
Query fiplfeatvdpdshpqlhvflkqvvgfDLVDdeskperrptkhmptpaqwtnafnpafsy  407
ident                                                             
Sbjct ---------------------------EIRI-----------------------------   83
DSSP  ---------------------------EEEL-----------------------------


DSSP  hHHHHHHHHHHHHhhhlllllllleELLLLllLLLLHhhHHHHHHL---------LLLLL
Query yVYYCYANLYVLNklreskgmttitLRPHSgeAGDIDhlAATFLTC---------HSIAH  458
ident         |                                                |||
Sbjct -YGEVEQDLAKRQ---llslndtkyILIEF-pFDHVP--RYAEQLFydlqlkgyiPVIAH  136
DSSP  -LLLHHHHHHLLL---lllhhhlleEEEEL-lLLLLL--LLHHHHHhhhhhllleEEEEL


DSSP  LH---HHHHLhHHHHHHHHHLLLEEELHHH-hLLLLLLLLLlLHHHHHHLLLLEEELLLL
Query GI---NLRKSpVLQYLYYLAQIGLAMSPLS-nNSLFLDYHRnPFPVFFLRGLNVSLSTDD  514
ident        |    | |              |                     |      | 
Sbjct PErnrEIRENpSLLYHLVEKGAASQITSGSlaGIFGKQLKA-FSLRLVEANLIHFVASDA  195
DSSP  HHhlhHHHHLlHHHHHHHHLLLEEEEEHHHhlLLLLHHHHH-HHHHHHHLLLLLEEELLL


DSSP  H--HHHLllllHHHHHHHHHHHhHLLLHhHHHHHHHHHHHhLLLLHhhhhhhllllllll
Query P--LQIHltkePLVEEYSIAASvWKLSAcDLCEIARNSVYqSGFSHalkshwigkdyykr  572
ident               |           |         |                       
Sbjct HnvKTRN---fHTQEALYVLEK-EFGSE-LPYMLTENAEL-LLRNQ--------------  235
DSSP  LllLLLL---lLHHHHHHHHHH-HHLLH-HHHHHHHHHHH-HHLLL--------------


DSSP  lhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query gpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                             
Sbjct --------------------------------tifrqppqpvkr  247
DSSP  --------------------------------llllllllllll


No 50: Query=2a3lA Sbjct=1j5sA Z-score=7.3

back to top
DSSP  ------------LLLLLlllllllllllllllllllllllllllllllhhhhhhhhhhhh
Query ------------QPDPIaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrk   48
ident                                                             
Sbjct hmflgedylltnRAAVR-------------------------------------------   17
DSSP  llllllllllllHHHHH-------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllllllllllllllhhhhhhh
Query ryvfqetvapwekeepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftd  108
ident                                                             
Sbjct ------------------------------------------------------------   17
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllLLLLLLEEEEE
Query lhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaphrDFYNVRKVDTH  168
ident                                                         || |
Sbjct ----------------------------------------------lfnEVKDLPIVDPH   31
DSSP  ----------------------------------------------hhhHHLLLLEEELL


DSSP  EELL---------llllhHHHHHhhhhhhhllllllleeelleeelhHHHH-hhHLLLLL
Query VHHS---------acmnqKHLLRfiksklrkepdevvifrdgtyltlREVF-esLDLTGY  218
ident  |                                                          
Sbjct NHLDakdivenkpwndiwEVEGA-----------tdhyvwelmrrcgVSEEyitGSRSNK   80
DSSP  LLLLhhhhhhllllllhhHHHLL-----------llhhhhhhhhhllLLHHhllLLLLHH


DSSP  LLLlllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhhhhHHHHH
Query DLNvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeitkQVFSD  278
ident                                                             
Sbjct EKWlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKL  140
DSSP  HHHhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHH


DSSP  HLLLLLEEEEEEEELllllllhhhHHHHHHhlLLLL----LLLEEEEEEEE--LLHH--H
Query LEASKYQMAEYRISIygrkmsewdQLASWIvnNDLY----SENVVWLIQLP--RLYN--I  330
ident |   |                                                       
Sbjct LRDMKVEILCTTDDP--------vSTLEHH--RKAKeaveGVTILPTWRPDraMNVDkeG  190
DSSP  HHHLLEEEEELLLLL--------lLLLHHH--HHHHhhllLLEEELLLLLHhhHLLLllL


DSSP  HLL---------llllLLLHHHHHHHLLHHHhhhhlhhhllllhhhHLLEEEEEEELLLl
Query YKD---------mgivTSFQNILDNIFIPLFeatvdpdshpqlhvfLKQVVGFDLVDDEs  381
ident                       |                           |  |    | 
Sbjct WREyvekmgerygedtSTLDGFLNALWKSHE------------hfkEHGCVASDHALLE-  237
DSSP  HHHhhhhhhhhhllllLLHHHHHHHHHHHHH------------hhhLLLLLEEEEEELL-


DSSP  llllLLLLlLLLLLL-LLLL---------LLLL-HHHHHHHHHHHHHHhhhhhllllllL
Query kperRPTKhMPTPAQ-WTNA---------FNPA-FSYYVYYCYANLYVlnklreskgmtT  430
ident                    |                                       |
Sbjct -psvYYVD-ENRARAvHEKAfsgekltqdEINDyKAFMMVQFGKMNQE-----------T  284
DSSP  -lllLLLL-HHHHHHhHHHHlllllllhhHHHHhHHHHHHHHHHHHHH-----------H


DSSP  LEELLLLLLL------------------------LLLH-HHHHHHHH----LLLLLLLH-
Query ITLRPHSGEA------------------------GDID-HLAATFLT----CHSIAHGI-  460
ident          |                          |   |                   
Sbjct NWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAeGLRYFLNEfdgkLKIVLYVLd  344
DSSP  LLEEEEEELEellllhhhhhhlllllllleelllLLHHhHHHHHHHHllllLLEEEEELl


DSSP  --HHHHlhhHHHHHHHHL-LLEEELhhHHLLlllLLLL--LLHHHHHH--LLLLE-EELL
Query --NLRKspvLQYLYYLAQ-IGLAMSplSNNSlflDYHR--NPFPVFFL--RGLNV-SLST  512
ident    |                                                 |     |
Sbjct ptHLPT---ISTIARAFPnVYVGAP--WWFN--dSPFGmeMHLKYLASvdLLYNLaGMVT  397
DSSP  hhHHHH---HHHHHHHLLlEEELLL--LLLL--lLHHHhhHHHHHHHLllLHHHLlLLLL


DSSP  LLHHhhllllLHHHHHHHHHHHHHL-----------llHHHHHHH-HHHHHHHLLllhhh
Query DDPLqihltkEPLVEEYSIAASVWK-----------lsACDLCEI-ARNSVYQSGfshal  560
ident |                     |                                     
Sbjct DSRK-llsfgSRTEMFRRVLSNVVGemvekgqipikeaRELVKHVsYDGPKALFF-----  451
DSSP  LLLL-llhhhHHHHHHHHHHHHHHHhhhhlllllhhhhHHHHHHHhLHHHHHHHL-----


DSSP  hhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query kshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                         
Sbjct --------------------------------------------------------  451
DSSP  --------------------------------------------------------


No 51: Query=2a3lA Sbjct=3iacA Z-score=6.6

back to top
DSSP  -----llllLLLLllllllllllllllllllllllllllllhhhhhhhhhhhhlllllll
Query -----qpdpIAADilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqet   55
ident             |                                               
Sbjct atfxtedflLKND-----------------------------------------------   13
DSSP  lllllllllLLLH-----------------------------------------------


DSSP  llllllllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhh
Query vapwekeepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkv  115
ident                                                             
Sbjct ------------------------------------------------------------   13
DSSP  ------------------------------------------------------------


DSSP  lllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllLLLLLLLEEEEEEELL---
Query iaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaphRDFYNVRKVDTHVHHS---  172
ident                                                   | | | |   
Sbjct ----------------------------------iartlyhKYAAPXPIYDFHCHLSpqe   39
DSSP  ----------------------------------hhhhhhhHLLLLLLEEELLLLLLhhh


DSSP  ------llllhHHHHHhhhhhhhllllllleeelleeelHHHHH-hHHLLLLLLLL---l
Query ------acmnqKHLLRfiksklrkepdevvifrdgtyltLREVF-eSLDLTGYDLN---v  222
ident               |                          |          |       
Sbjct iaddrrfdnlgQIWLE----------gdhykwralrsagVDESLitGKETSDYEKYxawa   89
DSSP  hhhllllllhhHHHHL----------lllhhhhhhhhllLLHHHllLLLLLHHHHHhhhh


DSSP  llllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhhhhHHHHHHLLL
Query dlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeitkQVFSDLEAS  282
ident                                                             
Sbjct ntvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQX  149
DSSP  hhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHL


DSSP  LlEEEEEEEELllllllhHHHHhHHHHlLLLL----LLLEEEEEEEE--LLHH--HHLL-
Query KyQMAEYRISIygrkmseWDQLaSWIVnNDLY----SENVVWLIQLP--RLYN--IYKD-  333
ident                    | |                 |                  | 
Sbjct NvRXVGTTDDP-------IDSL-EYHR-QIAAddsiDIEVAPSWRPDkvFKIEldGFVDy  200
DSSP  LeEEEELLLLL-------LLLL-HHHH-HHHHllllLLEEELLLLLHhhHLLLllLHHHh


DSSP  --------llllLLLHHHHHHHLLHHHhhhhlhhhllllhhhHLLEEEEEEELLLLlLLL
Query --------mgivTSFQNILDNIFIPLFeatvdpdshpqlhvfLKQVVGFDLVDDESkPER  385
ident             | |          |                       |          
Sbjct lrkleaaadvsiTRFDDLRQALTRRLD------------hfaACGCRASDHGIETL-RFA  247
DSSP  hhhhhhhhllllLLHHHHHHHHHHHHH------------hhhHLLLLEEEEEELLL-LLL


DSSP  LLLlLLLLLLL-LLLL---------LLLL-HHHHHHHHHHHHHHhhhhhllllllLLEEL
Query RPTkHMPTPAQ-WTNA---------FNPA-FSYYVYYCYANLYVlnklreskgmtTITLR  434
ident                                                             
Sbjct PVP-DDAQLDAiLGKRlagetlselEIAQfTTAVLVWLGRQYAA-----------RGWVX  295
DSSP  LLL-LHHHHHHhHHHHhllllllhhHHHHhHHHHHHHHHHHHHH-----------HLLEE


DSSP  LLLLLL------------------------lLLHHHHHHHH-------HLLLLLLLH--h
Query PHSGEA------------------------gDIDHLAATFL-------TCHSIAHGI--n  461
ident      |                             |                |       
Sbjct QLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDsxdvtneLPKTILYCLnpr  355
DSSP  EEEELEellllhhhhhhhllllllleellllLHHHHHHHHHhhhllllLLEEEEEELlhh


DSSP  HHHL-hHHHHHHHH----hLLLEEElHHHHLllllLLLL--LLHHHHHHLLL---LEEEL
Query LRKS-pVLQYLYYL----aQIGLAMsPLSNNslflDYHR--NPFPVFFLRGL---NVSLS  511
ident                               |                   ||    |   
Sbjct DNEVlaTXIGNFQGpgiagKVQFGS-GWWFN---dQKDGxlRQLEQLSQXGLlsqFVGXL  411
DSSP  HHHHhhHHHHHLLLlllllLEEELL-LLHHH---lLHHHhhHHHHHHHHHLLhhhLLLLL


DSSP  LLLHHhhllLLLHHHHHHHHHHHHHL--------------llHHHHHHH-HHHHHHHLLl
Query TDDPLqihlTKEPLVEEYSIAASVWK--------------lsACDLCEI-ARNSVYQSGf  556
ident ||             |                                |   |       
Sbjct TDSRS---fLSYTRHEYFRRILCNLLgqwaqdgeipddeaxlSRXVQDIcFNNAQRYFT-  467
DSSP  LLLLL---lLLLHHHHHHHHHHHHHHhhhhhlllllllhhhhHHHHHHHhLHHHHHHLL-


DSSP  lhhhhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query shalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                             
Sbjct ----------------------------------------------------------ik  469
DSSP  ----------------------------------------------------------ll


No 52: Query=2a3lA Sbjct=1bksA Z-score=6.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllLLLLEEEEeEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfYNVRKVDThVHHSacmnqkhl  180
ident                                                             
Sbjct ---------------------------meryenlfaqlnDRREGAFV-PFVT--------   24
DSSP  ---------------------------lhhhhhhhhhhhHLLLLEEE-EEEE--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   24
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhHLLLlllllLLLHHHHHHHHHHHHllllleeEEEEEEL-------
Query nlkynpcgqsrlreiFLKQdnliqGRFLGEITKQVFSDLeaskyqmAEYRISI-------  293
ident                               |                             
Sbjct --------------lGDPG-----IEQSLKIIDTLIDAG------aDALELGVpfsdpla   59
DSSP  --------------lLLLL-----HHHHHHHHHHHHHLL------lLLEEEELlllllll


DSSP  -----------llllllHHHHHHHHHHLllLLLLLEEEEEEEELLhhhhlllllllllhh
Query -----------ygrkmsEWDQLASWIVNndLYSENVVWLIQLPRLyniykdmgivtsfqn  342
ident                     |                                       
Sbjct dgptiqnanlrafaagvTPAQCFEMLALirEKHPTIPIGLLMYAN-------------lv  106
DSSP  llhhhhhhhhhhhhhllLHHHHHHHHHHhhHHLLLLLEEEEELHH-------------hh


DSSP  HHHHHLLHHHhhhhlhhhllllhhhHLLEEEEEEELllllllllllllllllllllllll
Query ILDNIFIPLFeatvdpdshpqlhvfLKQVVGFDLVDdeskperrptkhmptpaqwtnafn  402
ident     |                       |      |                        
Sbjct FNNGIDAFYA------------rceQVGVDSVLVAD------------------------  130
DSSP  HLLLHHHHHH------------hhhHHLLLEEEELL------------------------


DSSP  llHHHHHHHHHHHHHHHHhhhlllllllLEELLlLLLLLLL-HHHHHHHHHLL-LLLLLh
Query paFSYYVYYCYANLYVLNklreskgmttITLRPhSGEAGDI-DHLAATFLTCH-SIAHGi  460
ident                  |          |             | |               
Sbjct -vPVEESAPFRQAALRHN----------IAPIF-ICPPNADdDLLRQVASYGRgYTYLL-  177
DSSP  -lLHHHLHHHHHHHHHLL----------LEEEE-EELLLLLhHHHHHHHHHLLlLEEEL-


DSSP  hhHHLHHHHHHHHHHLL-LEEELHHHhlllllllllllHHHHhhllllEEELLLLHHH--
Query nlRKSPVLQYLYYLAQI-GLAMSPLSnnslfldyhrnpFPVFflrglnVSLSTDDPLQ--  517
ident        |                                                    
Sbjct -aLPLHHLIEKLKEYHAaPALQGFGI---sspeqvsaaVRAG-----aAGAISGSAIVki  228
DSSP  -lLLHHHHHHHHHHHLLlLEEELLLL---llhhhhhhhHHHL-----lLEEEELLHHHhh


DSSP  ---------------hlllLLHHHHHHhhhhhhhlllhhhhhhhhhhhhhhllllhhhhh
Query ---------------ihltKEPLVEEYsiaasvwklsacdlceiarnsvyqsgfshalks  562
ident                                                             
Sbjct ieknlaspkqmlaelrsfvSAMKAASR---------------------------------  255
DSSP  hhhllllhhhhhhhhhhhhHHHHHLLL---------------------------------


DSSP  hhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query hwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                       
Sbjct ------------------------------------------------------  255
DSSP  ------------------------------------------------------


No 53: Query=2a3lA Sbjct=3au2A Z-score=6.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------------LLLLlllllllllllllllllllllllllllll
Query ---------------------------QPDPiaadilrkepeqetfvrlnvplevptsde   33
ident                             |                               
Sbjct yaalglpwippplredqgeveaalegrLPKL-----------------------------  331
DSSP  hhhlllllllhhhlllllhhhhhhlllLLLL-----------------------------


DSSP  lllhhhhhhhhhhhhlllllllllllllllllllllllllllllllllllllllllllll
Query veaykclqeclelrkryvfqetvapwekeepfahypqgksdhcfemqdgvvhvfankdak   93
ident                                                             
Sbjct ------------------------------------------------------------  331
DSSP  ------------------------------------------------------------


DSSP  llllllllhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
Query edlfpvadatafftdlhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqks  153
ident                                                             
Sbjct ------------------------------------------------------------  331
DSSP  ------------------------------------------------------------


DSSP  lllllLLLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhh
Query aphrdFYNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesl  213
ident           | |  ||                                           
Sbjct ----lELPQVKGDLQVHST-----------------------------------------  346
DSSP  ----lLHHHLLEEEEELLL-----------------------------------------


DSSP  lllllllllllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhHHH
Query dltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeITK  273
ident                                                             
Sbjct ---------------------------------------------------ysdgqnTLE  355
DSSP  ---------------------------------------------------llllllLHH


DSSP  HHHHHHLLLLLEEEEEeeelllllllhhhhhhhhhhlllllllleeeEEEE--ELLHhhh
Query QVFSDLEASKYQMAEYrisiygrkmsewdqlaswivnndlysenvvwLIQL--PRLYniy  331
ident           |                                           |     
Sbjct ELWEAAKTMGYRYLAV-------------------------------TDHSpaVRVA---  381
DSSP  HHHHHHHHHLLLEEEE-------------------------------EEELhhHHLL---


DSSP  lllllllllhhhhhhHLLHhhhhhhlhhhllllhhHHLL-----------eEEEEEElll
Query kdmgivtsfqnildnIFIPlfeatvdpdshpqlhvFLKQ-----------vVGFDLVdde  380
ident                                                     |       
Sbjct ------------ggpSPEE-----------alkrvGEIRrfnethgppyllAGAEVD---  415
DSSP  ------------lllLHHH-----------hhhhhHHHHhhhhhhllleeeEEEEEE---


DSSP  lllllllllllllllllllllllLHHHHHhhHHHHHHhhhhhhlllllllLEELLLL---
Query skperrptkhmptpaqwtnafnpAFSYYVyyCYANLYvlnklreskgmttITLRPHS---  437
ident                                                             
Sbjct ---------------------ihPDGTLD--YPDWVL----------relDLVLVSVhsr  442
DSSP  ---------------------llLLLLLL--LLHHHH----------lllLEEEEELlll


DSSP  ---lllLLLHHHHHHHHH--LLLLLLLH---------hhhHLHHHHHHHHHHLLLEEEL-
Query ---geaGDIDHLAATFLT--CHSIAHGI---------nlrKSPVLQYLYYLAQIGLAMS-  482
ident            |         |  ||                                  
Sbjct fnlpkaDQTKRLLKALENpfVHVLAHPTarllgrrapieaDWEAVFQKAKEKGVAVEIDg  502
DSSP  llllhhHHHHHHHHHHLLllLLEELLLLllllllllllllLHHHHHHHHHHHLLEEEEEl


DSSP  hHHHLllllllllLLHHHHHHLLLLEEELLLLHHhhllllLHHHHHHHHHHHHHlllhhH
Query pLSNNslfldyhrNPFPVFFLRGLNVSLSTDDPLqihltkEPLVEEYSIAASVWklsacD  542
ident                       ||  |||||                  |   |      
Sbjct yYDRM----dlpdDLARMAYGMGLWISLSTDAHQ--tdhlRFMELAVGTAQRAW-----I  551
DSSP  lLLLL----lllhHHHHHHHHLLLLEEEELLLLL--hhhhHHHHHHHHHHHHLL-----L


DSSP  HHHHhHHHHHhllllhhHHHHhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhh
Query LCEIaRNSVYqsgfshaLKSHwigkdyykrgpdgndihktnvphirvefrdtiwkeemqq  602
ident   |                                                         
Sbjct GPER-VLNTL-------DYED---------------------------------------  564
DSSP  LLLL-LHHHL-------LHHH---------------------------------------


DSSP  hlllllllllLLLL--
Query vylgkavisdEVVP--  616
ident                 
Sbjct -----llswlKARRgv  575
DSSP  -----hhhhhHLLLll


No 54: Query=2a3lA Sbjct=3f2bA Z-score=6.1

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct -------------------------------------------------------vrrle    5
DSSP  -------------------------------------------------------lllhh


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct tiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedaelmsgvk   65
DSSP  hlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhhhhlll


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllLLLL-LLEEEEeEELLllllhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrDFYN-VRKVDThVHHSacmnqkh  179
ident                                              |     |        
Sbjct kgmwvkvrgsvqndtfvrdlviiandlneiaanerqdTAPEgEKRVEL-HLHT-------  117
DSSP  llleeeeeeeeeeelllleeeeeeeeeeeelllllllLLLLlLLLLLL-LLLL-------


DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll
Query llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
ident                                                             
Sbjct ------------------------------------------------------------  117
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEELllllll
Query fnlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRISIygrkms  299
ident                                                             
Sbjct ----------------------pmsqmdavtSVTKLIEQAKKWGHPAIAVTDHA------  149
DSSP  ----------------------lllllllllLHHHHHHHHHHLLLLLEEELLLL------


DSSP  hhhhhhhhhhllLLLL----LLEEEEEEEEL--------lhhhhlllllllllhhHHHHh
Query ewdqlaswivnnDLYS----ENVVWLIQLPR--------lyniykdmgivtsfqnILDNi  347
ident                       |                                 |   
Sbjct ----vvqsfpeaYSAAkkhgMKVIYGLEANIvddpfhvtllaqnetglknlfklvSLSH-  204
DSSP  ----llllhhhhHHHHhhhlLLEEEEEEEEEellleeeeeeellhhhhhhhhhhhHHHH-


DSSP  llhhhhhhhlhhhllllhhhhlleeeeeeelllllllllllllllllllllllllllhhh
Query fiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtnafnpafsy  407
ident                                                             
Sbjct --------------------------------------------------iqyfhrvpri  214
DSSP  --------------------------------------------------llllllllle


DSSP  HHHHHHHHHhhhhhhhllllllLLEELlllllllllhhhhhhhhhllLLLL----LHHHh
Query YVYYCYANLyvlnklreskgmtTITLRphsgeagdidhlaatfltchSIAH----GINLr  463
ident                          |                                  
Sbjct PRSVLVKHR-------------DGLLV--------------------GSGCdkgeLFDN-  240
DSSP  EHHHHHHLL-------------LLEEE--------------------ELLLllllLLLL-


DSSP  hlhhHHHHhhhhlLLEEELHHHHLLLL--lLLLLL--LHHHHHHLL----LLEEELLLLH
Query kspvLQYLyylaqIGLAMSPLSNNSLF--lDYHRN--PFPVFFLRG----LNVSLSTDDP  515
ident                |   |          |              |      |       
Sbjct ----VEDI-arfyDFLEVHPPDVYKPLyvkDEEMIknIIRSIVALGekldIPVVATGNVH  295
DSSP  ----LLLL-hhhlLLEEELLHHHHLLLlllLHHHHhhHHHHHHHHHhhllLLEEELLLLL


DSSP  H---------------------------HHLLllLHHH-HHHHHHHhhhLLLHHHHHHH-
Query L---------------------------QIHLtkEPLV-EEYSIAAsvwKLSACDLCEI-  546
ident                                        |          |      || 
Sbjct YlnpedkiyrkilihsqgganplnrhelPDVY--FRTTnEMLDCFS---FLGPEKAKEIv  350
DSSP  LllhhhhhhhhhhhhllhhhllllllllLLLL--LLLHhHHHHHHH---HHHHHHHHHHh


DSSP  HHHHHHHL-LLLH-----------------------------------------------
Query ARNSVYQS-GFSH-----------------------------------------------  558
ident   |                                                         
Sbjct VDNTQKIAsLIGDvkpikdelytpriegadeeiremsyrrakeiygdplpklveerleke  410
DSSP  LHHHHHHHhLLLLlllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct lksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcp  470
DSSP  hhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct nckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsg  530
DSSP  lllleeellllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct eyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagc  590
DSSP  llhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct tgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldil  650
DSSP  llleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct ghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgt  710
DSSP  eehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct rfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyl  770
DSSP  hhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct iyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayv  830
DSSP  hhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  558
ident                                                             
Sbjct lmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakek  890
DSSP  hhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhh


DSSP  ----------------------------------------------hhhhhhllllllll
Query ----------------------------------------------alkshwigkdyykr  572
ident                                                             
Sbjct slltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivra  950
DSSP  hhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhh


DSSP  lhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query gpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                             
Sbjct reegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 55: Query=2a3lA Sbjct=3dcpA Z-score=5.9

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllllllLEEEEEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvRKVDTHVHHSacmnqkhl  180
ident                                            | | | |          
Sbjct ------------------------------------------XKRDGHTHTE--------   10
DSSP  ------------------------------------------LLEEEEELLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   10
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEE---------
Query nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRI---------  291
ident                                                             
Sbjct ----------------------fcphgthdDVEEXVLKAIELDFDEYSIVEhaplssefx   48
DSSP  ----------------------llllllllLHHHHHHHHHHLLLLEEEEEEellllhhhh


DSSP  -------------ELLLlllLHHHHHHHHhhlllLLLL---LEEEEEeeellhhhhllll
Query -------------SIYGrkmSEWDQLASWivnndLYSE---NVVWLIqlprlyniykdmg  335
ident              |      |                                       
Sbjct kntagdkeavttaSXAX---SDLPYYFKKxnhikKKYAsdlLIHIGF-------------   92
DSSP  hllllllhhhhllLLLH---HHHHHHHHHhhhhhHHLLlllEEEEEE-------------


DSSP  lllllhhhhhhhllhhhhhhhlhhhllllhhhhlleeeeEEELlllllllllllllllll
Query ivtsfqnildnifiplfeatvdpdshpqlhvflkqvvgfDLVDdeskperrptkhmptpa  395
ident                                                             
Sbjct ---------------------------------------EVDY-----------------   96
DSSP  ---------------------------------------EEEL-----------------


DSSP  lllllllllHHHHhHHHHHHHHHHHhhhlllllLLLE-eLLLL-----------------
Query qwtnafnpaFSYYvYYCYANLYVLNklreskgmTTIT-lRPHS-----------------  437
ident             |                                               
Sbjct ---------LIGY-EDFTRDFLNEY-------gPQTDdgVLSLhflegqggfrsidfsae  139
DSSP  ---------LLLL-HHHHHHHHHHH-------hHHLLeeEEELleeeelleeeellllhh


DSSP  ---------------lllLLLHHHHHHHHH------LLLLLLLH----------------
Query ---------------geaGDIDHLAATFLT------CHSIAHGI----------------  460
ident                                          |                  
Sbjct dynegivqfyggfeqaqlAYLEGVKQSIEAdlglfkPRRXGHISlcqkfqqffgedtsdf  199
DSSP  hhhhhlhhhhllhhhhhhHHHHHHHHHHHLllllllLLEELLLLhhhllhhhhlllhhhl


DSSP  ---hhhHLHHHHHHHHHHLLLEEELHhHHLLL-LLLL---lllLHHHHHHLLLLEEELLL
Query ---nlrKSPVLQYLYYLAQIGLAMSPlSNNSL-FLDY---hrnPFPVFFLRGLNVSLSTD  513
ident       |  |   |       |                                     |
Sbjct seevxeKFRVILALVKKRDYELDFNT-AGLFKpLCGEtyppkkIVTLASELQIPFVYGSD  258
DSSP  lhhhhhHHHHHHHHHHHHLLEEEEEL-HHHHLlLLLLllllhhHHHHHHHLLLLEEEELL


DSSP  LHHhhlllllHHHHHhHHHHHHHLllhhhhhhhhhhhhhhllllhhhhhhhlllllllll
Query DPLqihltkePLVEEySIAASVWKlsacdlceiarnsvyqsgfshalkshwigkdyykrg  573
ident                 |                                           
Sbjct SHG----vqdIGRGY-STYCQKLE------------------------------------  277
DSSP  LLL----hhhLLLLH-HHHHHHLL------------------------------------


DSSP  hhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query pdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                            
Sbjct -------------------------------------------  277
DSSP  -------------------------------------------


No 56: Query=2a3lA Sbjct=1m65A Z-score=5.7

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllEEEEeEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrKVDThVHHSacmnqkhl  180
ident                                             ||    |         
Sbjct ------------------------------------------yPVDL-HMHT--------    9
DSSP  ------------------------------------------lLEEL-LLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------    9
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhLLLLlllllllhhhHHHHHHHHHLLLLLEEEEEEEELLL-lllL
Query nlkynpcgqsrlreifLKQDnliqgrflgeITKQVFSDLEASKYQMAEYRISIYG-rkmS  299
ident                                                             
Sbjct ----------------VAST------haysTLSDYIAQAKQKGIKLFAITDHGPDmedaP   47
DSSP  ----------------LLLL------llllLHHHHHHHHHHHLLLEEEEEEELLLllllL


DSSP  HHHhHHHHHHllLLLLL----LEEEEEEEELLHhhhlllllllllhhhhhhHLLHhhhhh
Query EWDqLASWIVnnDLYSE----NVVWLIQLPRLYniykdmgivtsfqnildnIFIPlfeat  355
ident                           |                                 
Sbjct HHW-HFINMR--IWPRVvdgvGILRGIEANIKN------------vdgeidCSGK-----   87
DSSP  LLH-HHHHHH--HLLLEelleEEEEEEEEELLL------------llllllLLHH-----


DSSP  hlhhhllllhhhhllEEEEEEELL---llLLLLLLlllllllllllllllLLHHHHHHHH
Query vdpdshpqlhvflkqVVGFDLVDD---esKPERRPtkhmptpaqwtnafnPAFSYYVYYC  412
ident                                                    |        
Sbjct -----------mfdsLDLIIAGFHepvfaPHDKAT-------------ntQAMIATIASG  123
DSSP  -----------hhhhLLEEEEELLlllllLLLHHH-------------hhHHHHHHHHLL


DSSP  HhhhhhhhhhhlllllllleELLLLLLL----LLLH-HHHHHHHHLLLLLL--lhHHHH-
Query YanlyvlnklreskgmttitLRPHSGEA----GDID-HLAATFLTCHSIAH--giNLRK-  464
ident                                  |      |              | |  
Sbjct N------------------vHIISHPGNpkyeIDVKaVAEAAAKHQVALEInnssNCREv  165
DSSP  L------------------lLEELLLLLllllLLHHhHHHHHHHHLLEEEEelllLHHHh


DSSP  lhhHHHHHhhhlLLEEE-----------lHHHHlllllllllLLHHHHhHLLL-LEEEll
Query spvLQYLYylaqIGLAM-----------sPLSNnslfldyhrNPFPVFfLRGL-NVSLst  512
ident                |                                            
Sbjct aaaVRDAG----GWVALgsdshtaftmgeFEEC--------lKILDAV-DFPPeRILN--  210
DSSP  hhhHHHHL----LLEEEelllllhhhlllLHHH--------hHHHHHL-LLLHhHLHH--


DSSP  llhhhhlllllhhhhhhhhhhhhhlllhhhhhhhhhHHHHHLL--------lLHHHHHHH
Query ddplqihltkeplveeysiaasvwklsacdlceiarNSVYQSG--------fSHALKSHW  564
ident                                      |                |     
Sbjct ------------------------------------VSPRRLLnflesrgmaPIAEFADL  234
DSSP  ------------------------------------HLHHHHHhhhhhllllLLHHHLLL


DSSP  lllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query igkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                     
Sbjct ----------------------------------------------------  234
DSSP  ----------------------------------------------------


No 57: Query=2a3lA Sbjct=2anuA Z-score=3.8

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEeEEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDtHVHHSacmnqkhl  180
ident                                              |    |         
Sbjct ---------------------------------------teWLLCD-FHVHT--------   12
DSSP  ---------------------------------------leEEEEE-EEELL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   12
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEELLLLL---
Query nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRISIYGRK---  297
ident                                   |                 |  |    
Sbjct -----------------------nxsdghlPLGEVVDLFGKHGVDVVSITDHIVDRRtle   49
DSSP  -----------------------lllllllLHHHHHHHHHHLLLLEEEEEEEEELHHhhh


DSSP  ----------llHHHHHHHHHHllLLLL--------LLEEEEEEEELLHHhhllllllll
Query ----------msEWDQLASWIVnnDLYS--------ENVVWLIQLPRLYNiykdmgivts  339
ident               |                                             
Sbjct qrkrngeplgaiTEDKFQDYLKrlWREQkraweeygXILIPGVEITNNTD----------   99
DSSP  hhhhllllllllLLLLHHHHHHhhHHHHhhhhhhhlLEEEEEEEEEELLL----------


DSSP  lhhhhhhhllhhhhhhhlhhhllllhhhhlleeeeeeellllllllllllllllllllll
Query fqnildnifiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpaqwtn  399
ident                                                             
Sbjct ---------------------------------------------------lyhivavdv  108
DSSP  ---------------------------------------------------leeeeeell


DSSP  lllllhhhHHHHHHHHHHHHhhhhllllllLLEELLLL-----lllllLHHHHHHHHHLL
Query afnpafsyYVYYCYANLYVLnklreskgmtTITLRPHS-----geagdIDHLAATFLTCH  454
ident          |      |                                        |  
Sbjct keyvdpslPVEEIVEKLKEQ----------NALVIAAHpdrkklswylWANXERFKDTFD  158
DSSP  llllllllLHHHHHHHHHHL----------LLEEEELLllllllllhhHHLLLLLLLLLL


DSSP  LLLL----lHHHHhlhhhHHHHhhhlLLEEElhhhhlllllllllllhhhhhhlllleee
Query SIAH----gINLRkspvlQYLYylaqIGLAMsplsnnslfldyhrnpfpvfflrglnvsl  510
ident                                                             
Sbjct AWEIanrddLFNS----vGVKK----YRYVA-----------------------------  181
DSSP  EEEEeelleELHH----hHHLL----LLEEE-----------------------------


DSSP  LLLLHHhhlllLLHHHhhhhhhhhhhlllhhhhhhHHHHhhhhlLLLHhhhhhhllllll
Query STDDPLqihltKEPLVeeysiaasvwklsacdlceIARNsvyqsGFSHalkshwigkdyy  570
ident   |                                                         
Sbjct NSDFHE-----LWHVY---------------swktLVKS---ekNIEA------------  206
DSSP  ELLLLL-----HHHHL---------------leeeEEEE---llLHHH------------


DSSP  lllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query krgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                               
Sbjct ----------------------------ikeairkntdvaiylxrk  224
DSSP  ----------------------------hhhhhhhllleeeeelll


No 58: Query=2a3lA Sbjct=3e38A Z-score=3.2

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhLLLLlllLLLEEEEeEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksAPHRdfyNVRKVDThVHHSacmnqkhl  180
ident                                            | |    ||        
Sbjct ----------------------aqrrneiqvpdLDGY---TTLKCDF-HXHS--------   26
DSSP  ----------------------lllllllllllLLLL---EEEEEEL-LLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------   26
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllhhhhHHHHHHHHLLLLLEEEEEEE---ELLLLL
Query nlkynpcgqsrlreiflkqdnliqgrflgeiTKQVFSDLEASKYQMAEYRI---SIYGRK  297
ident                                                             
Sbjct -----------------------vfsdglvwPTVRVDEAYRDGLDAISLTEhieYRPHKQ   63
DSSP  -----------------------llllllllHHHHHHHHHHLLLLEELLEEellLLLLLL


DSSP  LlhHHHH-hhhhhlllLLLL----LEEEEeeeellhhhhlllllllllhhhhhhhllhhh
Query MseWDQL-aswivnndLYSE----NVVWLiqlprlyniykdmgivtsfqnildnifiplf  352
ident                    |                                        
Sbjct D--VVSDhnrsfdlcrEQAEklgiLLIKG-------------------------------   90
DSSP  L--LLLLllhhhhhhhHHHHhhllEELLE-------------------------------


DSSP  hhhhlhhhllllhhhhlleeeEEEElllllllllllllllllllllllllllhhhhhhhh
Query eatvdpdshpqlhvflkqvvgFDLVddeskperrptkhmptpaqwtnafnpafsyyvyyc  412
ident                                                             
Sbjct ---------------------SEIT-----------------------------------   94
DSSP  ---------------------EEEE-----------------------------------


DSSP  hhhhhhhhhhhlllllllleellllllllllHHHH-------------------------
Query yanlyvlnklreskgmttitlrphsgeagdiDHLA-------------------------  447
ident                                                             
Sbjct ------------------------------rAXAPghfnaiflsdsnpleqkdykdafre  124
DSSP  ------------------------------lLLLLleeeeelllllhhhllllhhhhhhh


DSSP  hhhhhLLLL-LLLH------hhHHLHHHHHHHHHHL-LLEEE-LHHHHLllllllllLLH
Query atfltCHSI-AHGI------nlRKSPVLQYLYYLAQ-IGLAM-SPLSNNslfldyhrNPF  498
ident            |           |        |                           
Sbjct akkqgAFXFwNHPGwdsqqpdtTKWWPEHTALYQEGcXHGIEvANGHLY-------xPEA  177
DSSP  hhhllLEEEeLLLLllllllllLLLLHHHHHHHHLLlLLEEEeEELLEE-------lLHH


DSSP  HHHHHLL-LLEEELLLL---hHHHLLL---LLHH-----------------------hhH
Query PVFFLRG-LNVSLSTDD---pLQIHLT---KEPL-----------------------veE  528
ident     |   |      |                                            
Sbjct IQWCLDKnLTXIGTSDIhqpiQTDYDFekgEHRTxtfvfakerslqgirealdnrrtaaY  237
DSSP  HHHHHHHlLEEEEELLLlllhHHHLLHhhlLLLLeeeeeellllhhhhhhhhhllleeeE


DSSP  HHHHH-------------------------------------------------------
Query YSIAA-------------------------------------------------------  533
ident                                                             
Sbjct FHELLigredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrd  297
DSSP  ELLEEellhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellle


DSSP  -----------------------------HHHLllhhhhhhhhhhhhhhllllhhhhhhh
Query -----------------------------SVWKlsacdlceiarnsvyqsgfshalkshw  564
ident                                                             
Sbjct xtlkphtrytvrigfkqgikggdvnfevtNFIV---------------------------  330
DSSP  eeellleeeeeeeeellllllleeeeeeeEEEE---------------------------


DSSP  lllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query igkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                     
Sbjct ----------------------------------------apdkglkytisl  342
DSSP  ----------------------------------------elleeeeeeeel


No 59: Query=2a3lA Sbjct=2yb1A Z-score=2.5

back to top
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll
Query qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh
Query keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllEEEEeEELLllllhhhh
Query irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrKVDThVHHSacmnqkhl  180
ident                                              |    ||        
Sbjct ------------------------------------------aNIDL-HFHS--------    9
DSSP  ------------------------------------------lLEEL-LLLL--------


DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll
Query lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
ident                                                             
Sbjct ------------------------------------------------------------    9
DSSP  ------------------------------------------------------------


DSSP  hhhhllllllhhhhhhlllllllllllhhhHHHHHHHHHLLLLLEEEEEEEELllllllh
Query nlkynpcgqsrlreiflkqdnliqgrflgeITKQVFSDLEASKYQMAEYRISIygrkmse  300
ident                                   |     |                   
Sbjct -----------------------rtsdgalTPTEVIDRAAARAPALLALTDHD-------   39
DSSP  -----------------------lllllllLHHHHHHHHHLLLLLEEEELLLL-------


DSSP  hhhhhhhhhlllLLLL----LEEEEEEEEL---------------------------LHH
Query wdqlaswivnndLYSE----NVVWLIQLPR---------------------------LYN  329
ident                                                             
Sbjct ---ctgglaeaaAAAArrgiPFLNGVEVSVswgrhtvhivglgidpaepalaaglksIRE   96
DSSP  ---llllhhhhhHHHHhlllLEEEEEEEEEeelleeeeeeeellllllhhhhhhhhhHHL


DSSP  HHLLLLLLLllhhhhhhhllhhhhhhhlhhhllllhhhhlleeeeeeellllllllllll
Query IYKDMGIVTsfqnildnifiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptk  389
ident                                                             
Sbjct GRLERARQM-gasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrk  155
DSSP  LHHHHHHHH-hhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhh


DSSP  llllllllLLLLLLlhhhHHHHHHHHHHHHhhhhllllllLLEELLL-LLLLLL-----L
Query hmptpaqwTNAFNPafsyYVYYCYANLYVLnklreskgmtTITLRPH-SGEAGD-----I  443
ident                                                  |          
Sbjct yltpgkpgYVSHQW---aSLEDAVGWIVGA----------GGMAVIAhPGRYDMgrtliE  202
DSSP  llllllllLLLLLL---lLHHHHHHHHHHL----------LLEEEELlHHHLLLlhhhhH


DSSP  HHHHHHHH-HLLLLLL---lhhhhhlhhhhhHHHHHLLLEEelhhhhlllllllllllhh
Query DHLAATFL-TCHSIAH---ginlrkspvlqyLYYLAQIGLAmsplsnnslfldyhrnpfp  499
ident              |                                              
Sbjct RLILDFQAaGGQGIEVasgshslddmhkfalHADRHGLYAS-------------------  243
DSSP  HHHHHHHHlLLLEEEEeellllhhhhhhhhhHHHHHLLEEE-------------------


DSSP  hhhhlllleeeLLLLhhhhlllllHHHHhhhhhhhhhlllhhhhhhhhhHHHHhLLLLhh
Query vfflrglnvslSTDDplqihltkePLVEeysiaasvwklsacdlceiarNSVYqSGFSha  559
ident              |                                              
Sbjct ----------sGSDF-hapgedvgHTED---------------lppicrPIWR-ELEA--  274
DSSP  ----------eELLL-llllllllLLLL---------------llllllLHHH-HLHH--


DSSP  hhhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll
Query lkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
ident                                                          
Sbjct -----------------------------------------------rilrpadaen  284
DSSP  -----------------------------------------------hlllllhhhl