Results: dupa

Query: 1yrrB

MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1yrr-B 62.2  0.0  334   334  100 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
   2:  2vun-A 28.7  2.7  301   385   16 PDB  MOLECULE: ENAMIDASE;                                                 
   3:  3nqb-A 28.4  2.7  292   587   21 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   4:  4b3z-D 28.2  3.3  307   477   17 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   5:  1gkp-A 27.9  3.3  309   458   19 PDB  MOLECULE: HYDANTOINASE;                                              
   6:  3giq-A 27.4  3.0  300   475   18 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   7:  1onx-A 27.2  2.9  302   390   19 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   8:  3ls9-A 26.7  3.5  308   453   15 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   9:  3e74-A 26.5  2.9  294   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  10:  2paj-A 26.4  3.4  304   421   13 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  11:  3mtw-A 26.0  3.2  298   404   18 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  12:  3gri-A 25.9  3.2  296   422   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  13:  2oof-A 25.8  3.5  307   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  14:  4cqb-A 25.4  3.5  310   402   14 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  15:  3mkv-A 25.0  3.0  289   414   17 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  16:  2uz9-A 24.5  3.5  301   444   16 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  17:  4c5y-A 24.2  3.2  287   436   18 PDB  MOLECULE: OCHRATOXINASE;                                             
  18:  1j6p-A 24.0  3.5  300   407   13 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  19:  1k6w-A 23.1  3.3  297   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  20:  3icj-A 22.8  3.3  283   468   18 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  21:  3ooq-A 22.5  3.1  267   384   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  22:  2ogj-A 22.5  3.6  296   379   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  23:  1a5k-C 22.3  2.7  293   566   15 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  24:  4rdv-B 22.2  3.6  293   451   15 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  25:  3cjp-A 16.5  3.0  211   262   10 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  26:  4dlf-A 16.2  3.1  213   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  27:  2imr-A 16.2  4.4  258   380    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  28:  2y1h-B 16.2  3.2  219   265   11 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  29:  4hk5-D 16.0  3.1  224   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  30:  4ofc-A 16.0  2.9  216   335   12 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  31:  1a4m-A 15.8  3.8  229   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  32:  2dvt-A 15.5  3.0  211   325   12 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  33:  1itq-A 15.4  3.0  217   369   13 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  34:  2ffi-A 15.4  3.1  212   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  3pnu-A 14.9  3.5  229   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  36:  4mup-B 14.8  3.3  212   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  37:  4qrn-A 14.5  3.0  212   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  38:  3irs-A 14.4  3.2  207   281   14 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  39:  2gwg-A 14.2  3.5  220   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  40:  1bf6-A 13.9  3.7  206   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  41:  3gg7-A 13.6  3.4  205   243   14 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  42:  3qy6-A 13.5  3.5  190   247   11 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  43:  4dzi-C 13.3  3.0  204   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  44:  3k2g-B 13.2  3.9  211   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  45:  2ob3-A 13.0  3.5  204   329   12 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  46:  2vc5-A 12.9  3.7  209   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  47:  1v77-A 12.1  3.1  175   202   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  48:  2a3l-A 11.9  3.8  237   616    9 PDB  MOLECULE: AMP DEAMINASE;                                             
  49:  2qpx-A 11.7  3.5  194   376   10 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  50:  1j5s-A 11.2  3.1  202   451   10 PDB  MOLECULE: URONATE ISOMERASE;                                         
  51:  3iac-A 10.9  3.4  208   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3au2-A 10.8  7.6  194   575   18 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  3f2b-A 10.6  6.8  178   994   12 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  1m65-A  8.9  3.6  180   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3dcp-A  8.5  3.7  174   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  56:  1bks-A  7.5  3.8  165   255   11 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  7.4  3.3  152   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  6.3  4.1  141   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  5.9  3.8  157   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1yrrB Sbjct=1yrrB Z-score=62.2

back to top
DSSP  LEEELLEEELLLLEELLEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEEEL
Query YALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLN   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQLN   60
DSSP  LEEELLEEELLLLEELLEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEEEL


DSSP  EELLEELLLLLLLLLHHHHHHHHHHHHLLLEEEEEEEELLLLHHHHHHHHHHHHHHHHHL
Query GCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKH  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKH  120
DSSP  EELLEELLLLLLLLLHHHHHHHHHHHHLLLEEEEEEEELLLLHHHHHHHHHHHHHHHHHL


DSSP  LLLLLLEEEELLLLLLHHHHHHHHLHHHEEEEEELHHHLLHHHHHHHHHHLLEEEELLLL
Query PNQALGLHLEGPWLNAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSN  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PNQALGLHLEGPWLNAALVDFLCENADVITKVTLAPEMVPAEVISKLANAGIVVSAGHSN  180
DSSP  LLLLLLEEEELLLLLLHHHHHHHHLHHHEEEEEELHHHLLHHHHHHHHHHLLEEEELLLL


DSSP  LLHHHHHHHHHHLEEEELLLLLLLLLLLLLLLHHHHHHHHLLLLEEEEELLLLLLLHHHH
Query ATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANI  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEADIYCGIIADGLHVDYANI  240
DSSP  LLHHHHHHHHHHLEEEELLLLLLLLLLLLLLLHHHHHHHHLLLLEEEEELLLLLLLHHHH


DSSP  HHHHHHHHHHEEEELLLLLLLLLLHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLL
Query RNAKRLKGDKLCLVTDATSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKR  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RNAKRLKGDKLCLVTDATSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKR  300
DSSP  HHHHHHHHHHEEEELLLLLLLLLLHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLL


DSSP  LLLLLLLLLLLEEEELLLLLEEEEEELLEEEEEL
Query LGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ  334
ident ||||||||||||||||||||||||||||||||||
Sbjct LGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ  334
DSSP  LLLLLLLLLLLEEEELLLLLEEEEEELLEEEEEL


No 2: Query=1yrrB Sbjct=2vunA Z-score=28.7

back to top
DSSP  --LEEELL-EEELL----LLEELlEEEEEELLEEEEEEEHHHL--LLLLLEEELLLLEEE
Query --YALTQG-RIFTG----HEFLDdHAVVIADGLIKSVCPVAEL--PPEIEQRSLNGAILS   51
ident           |  |             |  ||||                     |    
Sbjct skTIIKNIgKIVSGdiksPVLQA-DTIVVEDGLIAAIGGEELMkdAGDATIIDAAGSTVT   59
DSSP  leEEEELLlEEELLllllLEELL-LEEEEELLEEEEEELHHHHllLLLLEEEELLLLEEE


DSSP  ELEEEEEELEelleelllllllLLHHH-----hhHHHHHHHLLLEEEEEE-EELL-----
Query PGFIDVQLNGcggvqfndtaeaVSVET-----leIMQKANEKSGCTNYLP-TLIT-----  100
ident ||  |                                      | |              
Sbjct PGLLDTHVHV------------SGGDYaprqktmDFISSALHGGVTTMISaGSPHfpgrp  107
DSSP  ELEEEEEELL------------LLLLEehhhleeLHHHHHHLLLEEEEEElLLLLlllll


DSSP  LLHHHH-HHHHHHHHHHHHHL--LLLLLLEEEELLlllLHHHHHHHHLH--HHEEEEEEL
Query TSDELM-KQGVRVMREYLAKH--PNQALGLHLEGPwlnAALVDFLCENA--DVITKVTLA  155
ident                 |           |                 |     |       
Sbjct KDAAGTkALAITLSKSYYNARpaGVKVHGGAVILE--kGLTEEDFIEMKkeGVWIVGEVG  165
DSSP  LLHHHHhHHHHHHHHHHHHLLhhHLEEELLEELLL--lLLLHHHHHHHHhlLLLEEEEEL


DSSP  ---hHHLL--HHHHHHHHHHLLEEEELLL--------LLLHHHHHHHHhhlEEEELLLLL
Query ---pEMVP--AEVISKLANAGIVVSAGHS--------NATLKEAKAGFragITFATHLYN  202
ident           |         |  |               |                |   
Sbjct lgtiKNPEdaAPMVEWAHKHGFKVQMHTGgtsipgssTVTADDVIKTK---PDVVSHING  222
DSSP  llllLLHHhhHHHHHHHHHLLLEEEEELLllllllllLLLHHHHHHHL---LLEEELLLL


DSSP  ---LLLLLlllllhHHHHHHHLLLLEEEEELLllLLLHhHHHHHHHH-----HHHHEEEE
Query ---AMPYItgrepgLAGAILDEADIYCGIIADglHVDYaNIRNAKRL-----KGDKLCLV  254
ident    |              | || |    |                |              
Sbjct gptAISVQ------EVDRIMDETDFAMEIVQC--GNPK-IADYVARRaaekgQLGRVIFG  273
DSSP  lllLLLHH------HHHHHHHHLLLEEEEELL--LLHH-HHHHHHHHhhhhlLHHHEEEE


DSSP  LLLL-LLLLL--LHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLL
Query TDAT-SGSSL--TMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVekRLGTLAAGKVAN  311
ident  ||                       |       |||       |     |  | || | 
Sbjct NDAPsGTGLIplGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEAD  331
DSSP  LLLLlLLLLLllHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLL


DSSP  EEEELLL-----------------LLEEEEEELLEEEEEL--------------
Query LTAFTPD-----------------FKITKTIVNGNEVVTQ--------------  334
ident |                         |      |  |||               
Sbjct LIIMDTPlgsvaedamgaiaagdiPGISVVLIDGEAVVTKsrntppakraakil  385
DSSP  EEEEELLlllllllhhhhhhhlllLEEEEEEELLEEEELLllllllllllleel


No 3: Query=1yrrB Sbjct=3nqbA Z-score=28.4

back to top
DSSP  -------------------------LEEELLEEELLL--LEELlEEEEEELLEEEEEEEH
Query -------------------------YALTQGRIFTGH--EFLDdHAVVIADGLIKSVCPV   33
ident                             | |        |        |   || ||   
Sbjct epadlnddtlraravaaargdqrfdVLITGGTLVDVVtgELRP-ADIGIVGALIASVHEP   59
DSSP  llhhhllhhhhhhhhhhhhlllleeEEEELLEEELLLllLEEE-LEEEEELLEEEEEELL


DSSP  HHLLLLLLEEELLLLEEEELEEEEEELE-ELLEelllllllllhhHHHHHHHHHHLLLEE
Query AELPPEIEQRSLNGAILSPGFIDVQLNG-CGGVqfndtaeavsveTLEIMQKANEKSGCT   92
ident |            ||  ||| ||                      |      |    | |
Sbjct ASRRDAAQVIDAGGAYVSPGLIDTHXHIeSSXI------------TPAAYAAAVVARGVT  107
DSSP  LLLLLEEEEEELLLLEEEELEEEEEELHhHHLL------------LHHHHHHHHHLLLEE


DSSP  EEEEEEL--LLLHhHHHHHHHHHHHHhHHLLlLLLLEEEELL------------lllLHH
Query NYLPTLI--TTSDeLMKQGVRVMREYlAKHPnQALGLHLEGP------------wlnAAL  138
ident                               |     |                    || 
Sbjct TIVWDPHefGNVH-GVDGVRWAAKAI-ENLP-LRAILLAPSCvpsapglerggadfdAAI  164
DSSP  EEEELLHhhHHHH-LHHHHHHHHHHH-LLLL-LEEEEEELLLlllllllllllllllHHH


DSSP  HHHHHHLhHHEEE-EEEL-HHHL------LHHHHHHHHHHLLEEEELLLLLLHHHHHHHH
Query VDFLCENaDVITK-VTLA-PEMV------PAEVISKLANAGIVVSAGHSNATLKEAKAGF  190
ident    |      |           |                |   |             |  
Sbjct LADLLSW-PEIGGiAEIXnXRGVierdprXSGIVQAGLAAEKLVCGHARGLKNADLNAFX  223
DSSP  HHHHHLL-LLEEEeEEELlHHHHhlllhhHHHHHHHHHHHLLEEEELLLLLLHHHHHHHH


DSSP  HHLEEEElLLLLllllllllllhhHHHHHHLlLLEEEEELLlLLLLHHHHHHHHH---hh
Query RAGITFAtHLYNampyitgrepglAGAILDEaDIYCGIIADgLHVDYANIRNAKR---lk  247
ident  ||     |                 | |                       |       
Sbjct AAGVSSD-HELV--------sgedLXAKLRA-GLTIELRGS-HDHLLPEFVAALNtlghl  272
DSSP  HLLLLEE-LLLL--------lhhhHHHHHHL-LLEEEEELL-LHHHHHHHHHHHHhhlll


DSSP  HHHEEEELLLL----lllLLLHHHHHHHHHHHhLLLHHHHHHHHLHHHHHHLLLlLLLLL
Query GDKLCLVTDAT----sgsSLTMIEGVRNLVEHcGIALDEVLRMATLYPARAIGVeKRLGT  303
ident      | ||                || ||   |      || |||  |   |    || 
Sbjct PQTVTLCTDDVfpddllqGGGLDDVVRRLVRY-GLKPEWALRAATLNAAQRLGR-SDLGL  330
DSSP  LLLEEEELLLLlhhhhhhLLLHHHHHHHHHHL-LLLHHHHHHHHLHHHHHHHLL-LLLLL


DSSP  LLLLLLLLEEEELL--LLLEEEEEELLEEEEEL---------------------------
Query LAAGKVANLTAFTP--DFKITKTIVNGNEVVTQ---------------------------  334
ident  |||  |    |     |        |  |                              
Sbjct IAAGRRADIVVFEDlnGFSARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxan  390
DSSP  LLLLLLLLEEEELLllLLLEEEEEELLEEEEELleelllllllllhhhllllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  334
ident                                                             
Sbjct dflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttkt  450
DSSP  hhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  334
ident                                                             
Sbjct gfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtail  510
DSSP  eeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  334
ident                                                             
Sbjct plplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxg  570
DSSP  elllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellll


DSSP  -----------------
Query -----------------  334
ident                  
Sbjct iadvltgkvxespviev  587
DSSP  eeelllleeellleeel


No 4: Query=1yrrB Sbjct=4b3zD Z-score=28.2

back to top
DSSP  --LEEELLEEELLLLEELlEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEE
Query --YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQ   58
ident        |||      |    |   |||||        |        ||    || ||| 
Sbjct drLLIKGGRIINDDQSLY-ADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVN   59
DSSP  leEEEEEEEEELLLLEEE-EEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEE


DSSP  ELEelleeLLLLlllllhHHHHHHHHHHHLLLEEEEEEEELLLL-HHHHHHHHHHHHHHH
Query LNGcggvqFNDTaeavsvETLEIMQKANEKSGCTNYLPTLITTS-DELMKQGVRVMREYL  117
ident                           |    | |             |            
Sbjct TYL-----QKTA-----aDDFFQGTRAALVGGTTMIIDHVVPEPgSSLLTSFEKWHEAAD  109
DSSP  ELL-----LLLL-----lLLHHHHHHHHHHLLEEEEEEEELLLLlLLHHHHHHHHHHHHH


DSSP  HHLLLLLLlEEEELLLLLLHHHHHHHHLH--HHEEEEEELH------HHLL---HHHHHH
Query AKHPNQALgLHLEGPWLNAALVDFLCENA--DVITKVTLAP------EMVP---AEVISK  166
ident  |       ||             |                       |      |    
Sbjct TKSCCDYS-LHVDITSWYDGVREELEVLVqdKGVNSFQVYMaykdvyQMSDsqlYEAFTF  168
DSSP  LLLLLEEE-EEEELLLLLLLHHHHHHHHHhlLLLLEEEEELllllllLLLHhhhHHHHHH


DSSP  HHHHLLEEEELLL---------------------------------LLLHhHHHHHHH--
Query LANAGIVVSAGHS---------------------------------NATLkEAKAGFR--  191
ident |   | |                                        |    |       
Sbjct LKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeeleaEAVF-RAITIAGri  227
DSSP  HHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhhhhHHHH-HHHHHHHhh


DSSP  HLEEEELLLLLllllllllllhHHHHHHHLL----LLEEEEEL--LLLL-----------
Query AGITFATHLYNampyitgrepgLAGAILDEA----DIYCGIIA--DGLH-----------  234
ident       |                |  |              ||   |             
Sbjct NCPVYITKVMS---------ksAADIIALARkkgpLVFGEPIAasLGTDgthywsknwak  278
DSSP  LLLEEEEEELL---------hhHHHHHHHHHhhllLEEEEELHhhHHLLlhhhhlllhhh


DSSP  ---------------LLHHHHHHHHHHHhhHEEEELLLL------------------LLL
Query ---------------VDYANIRNAKRLKgdKLCLVTDAT------------------SGS  261
ident                                                           | 
Sbjct aaafvtspplspdptTPDYLTSLLACGD--LQVTGSGHCpystaqkavgkdnftlipEGV  336
DSSP  hhhllllllllllllHHHHHHHHHHHLL--LLLLLLLLLlllhhhhhhhlllhhhllLLL


DSSP  LL--LHHHHHHH-HHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL
Query SL--TMIEGVRN-LVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPD  318
ident          |    |                  |       | |  | |  |      ||
Sbjct NGieERMTVVWDkAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPD  396
DSSP  LLllLHHHHHHHhHLLLLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEE


DSSP  -------------------------LLEEEEEELLEEEEEL-------------------
Query -------------------------FKITKTIVNGNEVVTQ-------------------  334
ident                                |  |  |                      
Sbjct klktitakshksaveynifegmechGSPLVVISQGKIVFEDgninvnkgmgrfiprkafp  456
DSSP  eeeelllllllllllllllllleeeEEEEEEEELLEEEEELleellllllllllllllll


DSSP  ---------------------
Query ---------------------  334
ident                      
Sbjct ehlyqrvkirnkvfglqgvsr  477
DSSP  hhhhhhhhhhhhhllllllll


No 5: Query=1yrrB Sbjct=1gkpA Z-score=27.9

back to top
DSSP  -LEEELLEEELLLLEELlEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEEE
Query -YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL   59
ident       | | |                |       | ||  |     |    |||||   
Sbjct pLLIKNGEIITADSRYK-ADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHV   59
DSSP  lEEEELLEEEELLEEEE-LEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LeelleELLL--LLLLllhHHHHHHHHHHHLLLEEEEEEEELLL-LHHHHHHHHHHHHHH
Query NgcggvQFND--TAEAvsvETLEIMQKANEKSGCTNYLPTLITT-SDELMKQGVRVMREY  116
ident                |    | |   ||    | | |         |             
Sbjct H-----IYLPfmATFA--kDTHETGSKAALMGGTTTYIEMCCPSrNDDALEGYQLWKSKA  112
DSSP  L-----LLLEelLEEL--lLLHHHHHHHHHHLLEEEEEEEELLLlLLLHHHHHHHHHHHH


DSSP  HHHLLLLLLlEEEELLLLLLHHHHHHHHLH-HHEEEEEEL-------hHHLL--HHHHHH
Query LAKHPNQALgLHLEGPWLNAALVDFLCENA-DVITKVTLA-------pEMVP--AEVISK  166
ident            |             | |   | |                          
Sbjct EGNSYCDYT-FHMAVSKFDEKTEGQLREIVaDGISSFXIFlsyknffgVDDGemYQTLRL  171
DSSP  LLLLLLEEE-EEEELLLLLLLHHHHHHHHHhLLLLEEEEEelllllllLLHHhhHHHHHH


DSSP  HHHHLLEEEELLL---------------------------------LLLHhHHHHHHH--
Query LANAGIVVSAGHS---------------------------------NATLkEAKAGFR--  191
ident     |  | |                                      |           
Sbjct AKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaveaEGTA-RFATFLEtt  230
DSSP  HHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhhhHHHH-HHHHHHHhh


DSSP  HLEEEELLLLlllllllllllHHHHHHHHLL----LLEEEEEL--LLLL-----------
Query AGITFATHLYnampyitgrepGLAGAILDEA----DIYCGIIA--DGLH-----------  234
ident        ||                |          ||         |            
Sbjct GATGYVVHLS---------ckPALDAAMAAKargvPIYIESVIphFLLDktyaerggvea  281
DSSP  LLEEEELLLL---------lhHHHHHHHHHHhlllLEEEEEEHhhHHLLhhhhhllhhhh


DSSP  ------------lLHHHHHHHHHHHHhHEEEELLLL------------------LLLLL-
Query ------------vDYANIRNAKRLKGdKLCLVTDAT------------------SGSSL-  263
ident                     |           ||                     |    
Sbjct mkyimspplrdkrNQKVLWDALAQGF-IDTVGTDHCpfdteqkllgkeaftaipNGIPAi  340
DSSP  hlllllllllllhHHHHHHHHHHLLL-LLEEELLLLlllhhhhhhhlllhhhllLLLLLl


DSSP  -LHHHHHH-HHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELL----
Query -TMIEGVR-NLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTP----  317
ident            |             |    |   |   | || | |  | |    |    
Sbjct eDRVNLLYtYGVSRGRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPqyrg  400
DSSP  lLHHHHHHhHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELllle


DSSP  ---------------------LLLEEEEEELLEEEEEL--------------------
Query ---------------------DFKITKTIVNGNEVVTQ--------------------  334
ident                      |       | |   |                      
Sbjct tisvktqhvnndyngfegfeiDGRPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
DSSP  ellhhhllllllllllllleeLLEEEEEEELLEEEEELleelllllllllllllllll


No 6: Query=1yrrB Sbjct=3giqA Z-score=27.4

back to top
DSSP  ----LEEELLEEELLL--LEELlEEEEEELLEEEEEEEHHHLLllLLEEELLLLEEEELE
Query ----YALTQGRIFTGH--EFLDdHAVVIADGLIKSVCPVAELPpeIEQRSLNGAILSPGF   54
ident        | | |  |              || |         |         | |  |||
Sbjct ekldFKITGGWIIDGTgaPRRR-ADLGVRDGRIAAIGELGAHP-aRHAWDASGKIVAPGF   58
DSSP  lleeEEEELLEELLLLllLLEE-LEEEEELLEEEEEELLLLLL-eEEEEELLLLEEEELE


DSSP  EEEEELEelleelllllllLLHHHHHHHhHHHHLLLEEEEEEE----ELLLLHH------
Query IDVQLNGcggvqfndtaeaVSVETLEIMqKANEKSGCTNYLPT----LITTSDE------  104
ident |||                                | |                      
Sbjct IDVHGHD-----------dLMFVEKPDL-RWKTSQGITTVVVGncgvSAAPAPLpgntaa  106
DSSP  EELLLLL-----------lLHHHHLLLL-HHHHLLLEEEEEELllllLLLLLLLlllllh


DSSP  ---------HHHHHHHHHHHHHHHLL-LLLLlEEEELL----------------lllLHH
Query ---------LMKQGVRVMREYLAKHP-NQALgLHLEGP----------------wlnAAL  138
ident          |            |  |                                | 
Sbjct alallgetpLFADVPAYFAALDAQRPmINVA-ALVGHAnlrlaamrdpqaaptaaeqQAM  165
DSSP  hhhhhllllLLLLHHHHHHHHHHLLLlLEEE-EEEEHHhhhhhhlllllllllhhhhHHH


DSSP  HHHHHHLH-HHEEEEEEL-------hHHLL--HHHHHHHHHHLLEEEELLL-------LL
Query VDFLCENA-DVITKVTLA-------pEMVP--AEVISKLANAGIVVSAGHS-------NA  181
ident  | |                                   |                   |
Sbjct QDMLQAALeAGAVGFSTGlayqpgavAQAAelEGLARVAAERRRLHTSHIRneadgveAA  225
DSSP  HHHHHHHHhHLLLEEEEElllllhhhLLHHhhHHHHHHHHHLLLEEEEELLlllllhhHH


DSSP  LHhHHHHHHH--HLEEEELLLL-----lllLLLLllllhHHHHHHHLL----LLEEEEEL
Query TLkEAKAGFR--AGITFATHLY-----namPYITgrepgLAGAILDEA----DIYCGIIA  230
ident    |  |  |     |   |                       |             |  
Sbjct VE-EVLAIGRgtGCATVVSHHKcmmpqnwgRSRA-----TLANIDRAReqgvEVALDIYP  279
DSSP  HH-HHHHHHHhhLLEEEELLLLlllhhhllLHHH-----HHHHHHHHHhlllLEEEEELL


DSSP  LLLL--------------------------------------------------------
Query DGLH--------------------------------------------------------  234
ident                                                             
Sbjct YPGSstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiy  339
DSSP  LLEEeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeee


DSSP  --LLHHHHHHHHHhhHHHEEEELLLL----LLLLL---LHHHHHHHHH-HHHLLLHHHHH
Query --VDYANIRNAKRlkGDKLCLVTDAT----SGSSL---TMIEGVRNLV-EHCGIALDEVL  284
ident    |                   |                       | |     |    
Sbjct faMDEDEVKRIFQ--HPCCMVGSDGLpndaRPHPRlwgSFTRVLGRYVrEARLMTLEQAV  397
DSSP  elLLHHHHHHHHH--LLLEEELLLLLllllLLLLHhhhHHHHHHHHHHhHLLLLLHHHHH


DSSP  HHHLHHHHHHLLLlLLLLLLLLLLLLLEEEE-LLLL--------------LEEEEEELLE
Query RMATLYPARAIGVeKRLGTLAAGKVANLTAF-TPDF--------------KITKTIVNGN  329
ident    |  |||  |     | |  |  |    |                    |    ||| 
Sbjct ARMTALPARVFGF-AERGVLQPGAWADVVVFdPDTVadratwdeptlasvGIAGVLVNGA  456
DSSP  HHHLHHHHHHHLL-LLLLLLLLLLLLLEEEElLLLLllllllllllllllLEEEEEELLE


DSSP  EEEE--------------l
Query EVVT--------------q  334
ident ||                 
Sbjct EVFPqppadgrpgqvlrax  475
DSSP  EEELlllllllllllllll


No 7: Query=1yrrB Sbjct=1onxA Z-score=27.2

back to top
DSSP  ---------LEEELLEEELLLLEELlEEEEEELLEEEEEEEHhHLLL---LLLEEELLLL
Query ---------YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVaELPP---EIEQRSLNGA   48
ident            |                |  | | |  |                 | | 
Sbjct midytaagfTLLQGAHLYAPEDRGI-CDVLVANGKIIAVASN-IPSDivpNCTVVDLSGQ   58
DSSP  llllhhhllEEEEEEEEELLLEEEE-EEEEEELLEEEEEELL-LLLLlllLLEEEELLLL


DSSP  EEEELEEEEEELEelleELLLL--lllllhHHHHhhHHHHHLLLEEEEEEEE-LLLLhhH
Query ILSPGFIDVQLNGcggvQFNDT--aeavsvETLEimQKANEKSGCTNYLPTL-ITTSdeL  105
ident || |||||                                   | |     |        
Sbjct ILCPGFIDQHVHL----IGGGGeagpttrtPEVA--LSRLTEAGVTSVVGLLgTDSIsrH  112
DSSP  EEEELEEEEEELL----LLLLLlllhhhllLLLL--HHHHHHLLEEEEEELLlLLLLllL


DSSP  HHHHHHHHHHHHhHLLLLLlLEEE-ELLL---lllHHHHHHHHLHHHEEEEEELHH----
Query MKQGVRVMREYLaKHPNQAlGLHL-EGPW---lnaALVDFLCENADVITKVTLAPE----  157
ident         |         |                  |       |    |  |      
Sbjct PESLLAKTRALN-EEGISA-WMLTgAYHVpsrtitGSVEKDVAIIDRVIGVXCAISdhrs  170
DSSP  HHHHHHHHHHHH-HHLLEE-EEEEeLLLLllllllLLHHHHHHHLLLEEEEEEEELllll


DSSP  -----hLLHHHHHHHHHHL------LEEEELLLL--LLHHHHHHH---hHHLE--EEELL
Query -----mVPAEVISKLANAG------IVVSAGHSN--ATLKEAKAG---fRAGI--TFATH  199
ident         |         |       |           |             |     ||
Sbjct aapdvyHLANMAAESRVGGllggkpGVTVFHMGDskKALQPIYDLlencDVPIskLLPTH  230
DSSP  llllhhHHHHHHHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHhhllLLLHhhEEEEL


DSSP  LLllLLLLlllllhHHHHHHHLL--LLEEEEELLLLL--LLHHHHHHHH-HHHH-HHEEE
Query LYnaMPYItgrepgLAGAILDEA--DIYCGIIADGLH--VDYANIRNAK-RLKG-DKLCL  253
ident               |    |  |       |             |  |           |
Sbjct VN--RNVP------LFEQALEFArkGGTIDITSSIDEpvAPAEGIARAVqAGIPlARVTL  282
DSSP  HH--HLHH------HHHHHHHHHhlLLLEEEELLLLLllLHHHHHHHHHhLLLLhHHEEE


DSSP  ELLLL---------------LLLLLL-HHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLL
Query VTDAT---------------SGSSLT-MIEGVRNLVEHCGIALDEVLRMATLYPARAIGV  297
ident   |                          | |  ||          ||  |   |     
Sbjct SSDGNgsqpffddegnlthiGVAGFEtLLETVQVLVKDYDFSISDALRPLTSSVAGFLNL  342
DSSP  ELLLLleeeeellllleeeeEELLLHhHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLL


DSSP  lLLLLLLLLLLLLLEEEELLLLLEEEEEELLEEEEEL------------
Query eKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ------------  334
ident     |    |  | |   ||   |      |   |              
Sbjct -TGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDgkacvkgtfetd  390
DSSP  -LLLLLLLLLLLLLEEEELLLLLEEEEEELLEEEEELleelllllllll


No 8: Query=1yrrB Sbjct=3ls9A Z-score=26.7

back to top
DSSP  -LEEELL-EEELL---LLEELLEEEEEELLEEEEEEEHhHLLLLL-LEEELLLLEEEELE
Query -YALTQG-RIFTG---HEFLDDHAVVIADGLIKSVCPVaELPPEI-EQRSLNGAILSPGF   54
ident         |  |       | |    |    |  |                 | |  || 
Sbjct mILIRGLtRVITFddqERELEDADILIDGPKIVAVGKD-LSDRSVsRTIDGRGMIALPGL   59
DSSP  lEEEEEEeEEELLlllLLEEEEEEEEEELLEEEEEELL-LLLLLLlEEEELLLEEEEELE


DSSP  EEEEELE-ELLE-------------------------elllLLLL-LLHHHHHHHHHHHH
Query IDVQLNG-CGGV-------------------------qfndTAEA-VSVETLEIMQKANE   87
ident |        |                                    |  |          
Sbjct INSHQHLyEGAMraipqlervtmaswlegvltrsagwwrdgKFGPdVIREVARAVLLESL  119
DSSP  EEEEELHhHHHHlllhhhllllhhhhhhhhhhhhhhhhhllLLLHhHHHHHHHHHHHHHH


DSSP  LLLEEEEEEEELLL--LHHHhhHHHHHHHHHHHHLLLLlLLEEEELLL------------
Query KSGCTNYLPTLITT--SDELmkQGVRVMREYLAKHPNQaLGLHLEGPW------------  133
ident   | |                        |                              
Sbjct LGGITTVADQHLFFpgATAD--SYIDATIEAATDLGIR-FHAARSSMTlgkseggfcddl  176
DSSP  HLLEEEEEEEELLLllLLLL--LHHHHHHHHHHHHLLE-EEEEELLLLllhhhlllllhh


DSSP  ---llLHHHHHHHHLH-----------hHEEEEEELHHHLLHHHHHHHHHHL-----LEE
Query ---lnAALVDFLCENA-----------dVITKVTLAPEMVPAEVISKLANAG-----IVV  174
ident         |                    |            |     |           
Sbjct fvepvDRVVQHCLGLIdqyhepepfgmvRIALGPCGVPYDKPELFEAFAQMAadydvRLH  236
DSSP  hlllhHHHHHHHHHHHhhhlllllllleEEEELLLLLLLLLHHHHHHHHHHHhhhllEEE


DSSP  EEL-LLLLL--------hHHHHHHHHHLE----EEELLLLllLLLLlllllhhhHHHHHL
Query SAG-HSNAT--------lKEAKAGFRAGI----TFATHLYnaMPYItgrepglaGAILDE  221
ident                            |         |     |            |   
Sbjct THFyEPLDAgmsdhlygmTPWRFLEKHGWasdrVWLAHAV--VPPR--------EEIPEF  286
DSSP  EEElLLLHHhhhhhhhllLHHHHHHHLLLllllEEEEELL--LLLH--------HHHHHH


DSSP  L--LLEEEEELL--LLLLLhHHHHhhHHHHH---HHEEEELLLLLLLLL-LHHHHHHHHH
Query A--DIYCGIIAD--GLHVDyANIRnaKRLKG---DKLCLVTDATSGSSL-TMIEGVRNLV  273
ident |                          |            |               |   
Sbjct AdaGVAIAHLIApdLRMGW-GLAP--IREYLdagITVGFGTTGSASNDGgNLLGDLRLAA  343
DSSP  HhhLLEEEELHHhhHHLLL-LLLL--HHHHHhllLEEEELLLLLLLLLLlLHHHHHHHHH


DSSP  HHH----------LLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEELL------
Query EHC----------GIALDEVLRMATLYPARAIGVEkRLGTLAAGKVANLTAFTP------  317
ident                   | |||||   |   |    || |  |  |             
Sbjct LAHrpadpnepekWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvdrv  402
DSSP  HHLhhhllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhhhl


DSSP  --------------LLLEEEEEELLEEEEEL--------------------
Query --------------DFKITKTIVNGNEVVTQ--------------------  334
ident                       |||   |                      
Sbjct gvhdpaiglimtglSDRASLVVVNGQVLVENerpvladlerivanttalip  453
DSSP  llllhhhhhhhlllLLLLLEEEELLEEEEELleellllhhhhhhhhhhhll


No 9: Query=1yrrB Sbjct=3e74A Z-score=26.5

back to top
DSSP  ---LEEELLEEELLLLEELlEEEEEELLEEEEEEEhhHLLLLLLEEELLLLEEEELEEEE
Query ---YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPvaELPPEIEQRSLNGAILSPGFIDV   57
ident         |      |           | |        |    |     |   |||  | 
Sbjct sfdLIIKNGTVILENEARV-VDIAVKGGKIAAIGQ--DLGDAKEVXDASGLVVSPGXVDA   57
DSSP  leeEEEELLEEELLLLEEE-LEEEEELLEEEEEEL--LLLLEEEEEELLLLEEEELEEEE


DSSP  EELEelleelllllllllhhHHHHHHHHHHLLLEEEEEEEELLllHHHH--HHHHHHHHH
Query QLNGcggvqfndtaeavsveTLEIMQKANEKSGCTNYLPTLITtsDELM--KQGVRVMRE  115
ident                       |    |  | | |                         
Sbjct HTHI----------------GYETGTRAAAKGGITTXIEXPLN-qLPATvdRASIELKFD  100
DSSP  EELL----------------LHHHHHHHHHHLLEEEEEELLLL-lLLLLllHHHHHHHHH


DSSP  HHHHLL-LLLLlEEEELLlllLHHHHHHHHLH-HHEEEEEELH---HHLL-HHHHHHHHH
Query YLAKHP-NQALgLHLEGPwlnAALVDFLCENA-DVITKVTLAP---EMVP-AEVISKLAN  169
ident          |               | | |                          ||  
Sbjct AAKGKLtIDAA-QLGGLV---SYNIDRLHELDeVGVVGFXCFVrdvNDWQfFKGAQKLGE  156
DSSP  HHLLLLlLEEE-ELEELL---LLLLLLHHHHHhHLLLLEEEELlllLHHHhHHHHHHHHH


DSSP  HLLEEEELLLL---------------------------------LLHHHHHHHHHH-LEE
Query AGIVVSAGHSN---------------------------------ATLKEAKAGFRA-GIT  195
ident  |  |     |                                 |          |    
Sbjct LGQPVLVHCENalicdelgeeakregrvtahdyvasrpvfteveAIRRVLYLAKVAgCRL  216
DSSP  HLLLEEEELLLhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHHHHHHHHHlLLE


DSSP  EELLLLLllllllllllhHHHHHHHLL----LLEEEEEL--LLLL---------------
Query FATHLYNampyitgrepgLAGAILDEA----DIYCGIIA--DGLH---------------  234
ident    |                           || |        |                
Sbjct HVCHVSS---------peGVEEVTRARqegqDITCESCPhyFVLDtdqfeeigtlakcsp  267
DSSP  EELLLLL---------hhHHHHHHHHHhlllLEEEEELLhhHHLLhhhhhhhlhhhllll


DSSP  ------lLHHHHHHHHHHHhhHEEEELLLL---------------LLLLL--LHHH-HHH
Query ------vDYANIRNAKRLKgdKLCLVTDAT---------------SGSSL--TMIE-GVR  270
ident                        ||| |                  |             
Sbjct pirdlenQKGXWEKLFNGE--IDCLVSDHSpcppexkagnixkawGGIAGlqSCXDvXFD  325
DSSP  llllhhhHHHHHHHHHLLL--LLEELLLLLlllllllllllllllLLLLLhhHHHHhHHH


DSSP  HHHHHHLLLHHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLLEEEELLL------------
Query NLVEHCGIALDEVLRMATLYPARAIGVeKRLGTLAAGKVANLTAFTPD------------  318
ident   |   |  |           |   |     |  | || |      |             
Sbjct EAVQKRGXSLPXFGKLXATNAADIFGL-QQKGRIAPGKDADFVFIQPNssyvltnddley  384
DSSP  HHLLLLLLLHHHHHHHHLHHHHHHLLL-LLLLLLLLLLLLLEEEEELLlleellhhhlll


DSSP  -------------LLEEEEEELLEEEEEL----------------
Query -------------FKITKTIVNGNEVVTQ----------------  334
ident                |||||  |                      
Sbjct rhkvspyvgrtigARITKTILRGDVIYDIeqgfpvapkgqfilkh  429
DSSP  lllllllllleelLEEEEEEELLEEEEELllllllllllleelll


No 10: Query=1yrrB Sbjct=2pajA Z-score=26.4

back to top
DSSP  --LEEELL-EEELLL-------LEELLEEEEEELLEEEEEEEHhHLLLLLLEEELLLLEE
Query --YALTQG-RIFTGH-------EFLDDHAVVIADGLIKSVCPVaELPPEIEQRSLNGAIL   50
ident           | ||                 |    |          |            
Sbjct psTLIRNAaAIMTGGrgtaddpSRVPGPDIRIVGDTIDAIGAL-APRPGETIVDATDCVI   59
DSSP  leEEEELLlEELLLLlllllllLLLLLLLEEEELLEEEEELLL-LLLLLLEEEELLLLEE


DSSP  EELEEEEEELE-ELLE--ellLLLLL--lLHHHHHHHHHHHHLLLEEEEEEEELLLLHHH
Query SPGFIDVQLNG-CGGV--qfnDTAEA--vSVETLEIMQKANEKSGCTNYLPTLITTSDEL  105
ident  |                                 |       |||              
Sbjct YPAWVNTHHHLfQSLLkgepfRALFDerrFRLAARIGLIELARSGCATVADHNYVYYPGM  119
DSSP  EELEELLLLLHhHHHLlllllHHHLLhhhHHHHHHHHHHHHHLLLEEEEEELLLLLLLLL


DSSP  hhHHHHHHHHHHHHLLLLlLLEEEELLL----------------llLHHHHHHHHLH---
Query mkQGVRVMREYLAKHPNQaLGLHLEGPW----------------lnAALVDFLCENA---  146
ident          |   |       |   |                     | |      |   
Sbjct pfDSSAILFEEAEKLGLR-FVLLRGGATqtrqleadlptalrpetlDAYVADIERLAary  178
DSSP  llLHHHHHHHHHHHLLLE-EEEEELLLLllllllllllhhhllllhHHHHHHHHHHHhhl


DSSP  --------hHEEEE-EELH---HHLL-HHHHHHHHHHLLEEEELLL-llLHHHHHHhhHH
Query --------dVITKV-TLAP---EMVP-AEVISKLANAGIVVSAGHS-naTLKEAKAgfRA  192
ident                |            |        |       |              
Sbjct hdaspramrRVVMApTTVLysiSPREmRETAAVARRLGLRMHSHLSgksPVAFCGE--HD  236
DSSP  lllllllleEEEELlLLLLlllLHHHhHHHHHHHHHLLLEEEEELLlllHHHHHHH--LL


DSSP  LE--EEELLLLLllLLLLllllhhHHHHHHLlLLEEEEELL-LLLLlhhHHHHHHHHHHh
Query GI--TFATHLYNamPYITgrepglAGAILDEaDIYCGIIAD-GLHVdyaNIRNAKRLKGd  249
ident                                                    |        
Sbjct WLgsDVWYAHLV--KVDA----deIALLAQT-GTGVAHCPQsNGRL---PVREMADAGV-  285
DSSP  LLllLEEEELLL--LLLH----hhHHHHHHH-LLEEEELHHhHHLL---LLLLHHHHLL-


DSSP  HEEEELLLLlLLLL-LHHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHLLLLlLLLLLL
Query KLCLVTDATsGSSL-TMIEGVRNLVEHCG---IALDEVLRMATLYPARAIGVEkRLGTLA  305
ident       |         ||  |               ||    |   ||  |     |  |
Sbjct PVSIGVDGAaSNEAaDMISEVHMTWLAQRarlASIAEVIHWGTAGGARVMGLD-EVGKVA  344
DSSP  LEEELLLHHhHLLLlLHHHHHHHHHHHHHhllLLHHHHHHHHLHHHHHHHLLL-LLLLLL


DSSP  LLLLLLEEEE-------------LLLL-------LEEEEEELLEEEEEL-----------
Query AGKVANLTAF-------------TPDF-------KITKTIVNGNEVVTQ-----------  334
ident  |  |                                     |  ||             
Sbjct VGYAADIAVYrlddpryfglhdpAIGPvasggrpSVMALFSAGKRVVVDdliegvdikel  404
DSSP  LLLLLLEEEEelllhhhlllllhHHHHhhlllllEEEEEEELLEEEEELlllllllhhhh


DSSP  -----------------
Query -----------------  334
ident                  
Sbjct ggearrvvrellrevvv  421
DSSP  hhhhhhhhhhhhhhhhl


No 11: Query=1yrrB Sbjct=3mtwA Z-score=26.0

back to top
DSSP  ---LEEELLEEELLL--LEELLEEEEEELLEEEEEEEHHHLLLL-LLEEELLLLEEEELE
Query ---YALTQGRIFTGH--EFLDDHAVVIADGLIKSVCPVAELPPE-IEQRSLNGAILSPGF   54
ident     |    |          |   |   || | |        |       | |  | || 
Sbjct aeiKAVSAARLLDVAsgKYVDNPLVIVTDGRITSIGKKGDAVPAgATAVDLPGVTLLPGL   60
DSSP  lleEEEEEEEEEELLllEEEELEEEEEELLEEEEEEELLLLLLLlLEEEEEEEEEEEELE


DSSP  EEEEELEelleELLL----------LLLLLLhHHHHHHHHHHHLLLEEEEEEEELlllhh
Query IDVQLNGcggvQFND----------TAEAVSvETLEIMQKANEKSGCTNYLPTLIttsde  104
ident ||                            |        |     | |            
Sbjct IDMHVHL----DSLAevggynsleySDRFWS-VVQTANAKKTLEAGFTTVRNVGA-----  110
DSSP  EEEEELL----LLLLlllhhhhhhlLHHHHH-HHHHHHHHHHHHLLEEEEEELLL-----


DSSP  hhhhHHHHHHHHHHHLL-----lLLLLEE-EELLL-----------------------ll
Query lmkqGVRVMREYLAKHP-----nQALGLH-LEGPW-----------------------ln  135
ident                                                             
Sbjct ----ADYDDVGLREAIDagyvpgPRIVTAaISFGAtgghcdstffppsmdqknpfnsdsp  166
DSSP  ----LLLHHHHHHHHHHllllllLEEEELlLLEELlllllllllllhhhllllllllllh


DSSP  LHHHHHHHHLH-HHEEEEEELH---------------HHLL--HHHHHHHHHHLLEEEEL
Query AALVDFLCENA-DVITKVTLAP---------------EMVP--AEVISKLANAGIVVSAG  177
ident                                              |      ||| | | 
Sbjct DEARKAVRTLKkYGAQVIXICAtggvfsrgnepgqqqLTYEemKAVVDEAHMAGIKVAAH  226
DSSP  HHHHHHHHHHHhLLLLEEEEELlllllllllllllllLLHHhhHHHHHHHHHLLLEEEEE


DSSP  LllllHHHHHHHHHHLEEEELLLLllllllllllLHHHHHHHHLlLLEEEEELLLLL---
Query HsnatLKEAKAGFRAGITFATHLYnampyitgrePGLAGAILDEaDIYCGIIADGLH---  234
ident              |||     |                         |            
Sbjct A--hgASGIREAVRAGVDTIEHAS-------lvdDEGIKLAVQK-GAYFSMDIYNTDytq  276
DSSP  E--llHHHHHHHHHLLLLEEEELL-------lllHHHHHHHHHH-LLEEELLLLLHHhhh


DSSP  ---------------------lLHHHHHHHHHHHHhHEEEELLLLlLLLL-LHHHHHHHH
Query ---------------------vDYANIRNAKRLKGdKLCLVTDATsGSSL-TMIEGVRNL  272
ident                          | | |      |    |||                
Sbjct aegkkngvlednlrkdrdigelQRENFRKALKAGV-KMVYGTDAG-IYPHgDNAKQFAVM  334
DSSP  hhhhhhlllhhhhhhhhhhhhhHHHHHHHHHHHLL-EEELLLLLL-LLLLlLHHHHHHHH


DSSP  HhHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL--------LLEEEE
Query VeHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPD--------FKITKT  324
ident |   |         |||  | | |  |  |  | |      |   |         |    
Sbjct V-RYGATPLQAIQSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGDpladvttlEKPVFV  393
DSSP  H-HLLLLHHHHHHHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLLllllhhhhHLLLEE


DSSP  EELLEEEEEL-
Query IVNGNEVVTQ-  334
ident    |  |    
Sbjct MKGGAVVKAPx  404
DSSP  EELLEEEELLl


No 12: Query=1yrrB Sbjct=3griA Z-score=25.9

back to top
DSSP  -LEEELLEEELLLLEELlEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEEE
Query -YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL   59
ident       |      |        |    ||   |  |           |   |||| ||  
Sbjct xKLIKNGKVLQNGELQQ-ADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHV   59
DSSP  lEEEELLEEEELLEEEE-LEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LEelleELLLLLLLllhhHHHHHHHHHHLLLEEEEEEEELLllhhhHHHHHHHHHHHHHH
Query NGcggvQFNDTAEAvsveTLEIMQKANEKSGCTNYLPTLITtsdelMKQGVRVMREYLAK  119
ident                   | |   ||    | |   |   |                   
Sbjct HL----REPGGEYK---eTIETGTKAAARGGFTTVCPXPNTrpvpdSVEHFEALQKLIDD  112
DSSP  LL----LLLLLLLL---lLHHHHHHHHHHLLEEEEEELLLLlllllLHHHHHHHHHHHHH


DSSP  L-lLLLLlEEEE---LLLLlLHHHhHHHHLH-HHEEEEEE---lhHHLL--HHHHHHHHH
Query H-pNQALgLHLE---GPWLnAALVdFLCENA-DVITKVTL---apEMVP--AEVISKLAN  169
ident       |               ||              |             |     | 
Sbjct NaqVRVL-PYASittRQLG-KELV-DFPALVkEGAFAFTDdgvgvQTASxxYEGXIEAAK  169
DSSP  HllLEEL-LLEEllhHHLL-LLLL-LHHHHHlLLLLLEEElllllLLHHhhHHHHHHHHH


DSSP  HLLEEEELLL------------------------------LLLHhHHHHHHH--HLEEEE
Query AGIVVSAGHS------------------------------NATLkEAKAGFR--AGITFA  197
ident       |                                                     
Sbjct VNKAIVAHCEdnsliyggaxhegkrskelgipgipnicesVQIA-RDVLLAEaaGCHYHV  228
DSSP  HLLLEEELLLlhhhllllleellhhhhhhllleellhhhhHHHH-HHHHHHHhhLLLEEE


DSSP  LLLLlllllllllllHHHHHHHHLL----LLEEEEELLllLLLH----------------
Query THLYnampyitgrepGLAGAILDEA----DIYCGIIADglHVDY----------------  237
ident  |                  | |                 |                   
Sbjct CHVS---------tkESVRVIRDAKragiHVTAEVTPH--HLLLteddipgnnaiykxnp  277
DSSP  LLLL---------lhHHHHHHHHHHhlllLEEEEELHH--HHHLlhhhlllllhhhllll


DSSP  --------HHHHHHHHHHHhHEEEELLLL---------------LLLLLLhHHHHHHHHH
Query --------ANIRNAKRLKGdKLCLVTDAT---------------SGSSLTmIEGVRNLVE  274
ident                       |  ||                  |           |  
Sbjct plrstedrEALLEGLLDGT-IDCIATDHAphardekaqpxekapFGIVGS-ETAFPLLYT  335
DSSP  llllhhhhHHHHHHHHLLL-LLEELLLLLlllhhhhllllllllLLLLLL-LLHHHHHHH


DSSP  HH----LLLHHHHHHHHLHHHHHHLLLLllLLLLLLLLLLLEEEELL-------------
Query HC----GIALDEVLRMATLYPARAIGVEkrLGTLAAGKVANLTAFTP-------------  317
ident |        |       |  |      |   |||     | ||                 
Sbjct HFvkngDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLdseqeikgedfls  393
DSSP  HHllllLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELllleellhhhlll


DSSP  ------------LLLEEEEEELLEEEEEL
Query ------------DFKITKTIVNGNEVVTQ  334
ident                   | | |      
Sbjct kadntpfigykvYGNPILTXVEGEVKFEG  422
DSSP  lllllllllleeLLEEEEEEELLEEEEEL


No 13: Query=1yrrB Sbjct=2oofA Z-score=25.8

back to top
DSSP  ----LEEELLEEELLL------LEELLEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEE
Query ----YALTQGRIFTGH------EFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAIL   50
ident              |          |  ||     | |    |   |          |   
Sbjct lnceRVWLNVTPATLRsdladyGLLEPHALGVHEGRIHALVPXQDLKYPAHWQDXKGKLV   60
DSSP  llllEEEEEEEELLLLllllllLLLLLEEEEEELLEEEEEEEHHHLLLLLLLEELLLLEE


DSSP  EELEEEEEELEelleeLLLL---------------------------------LLLL--L
Query SPGFIDVQLNGcggvqFNDT---------------------------------AEAV--S   75
ident  || ||                                               |      
Sbjct TPGLIDCHTHL-----IFAGsraeefelrqkgvpyaeiarkgggiistvratrAASEdqL  115
DSSP  EELEEEEEELL-----LLLLllhhhhhhhhhlllhhhhhhllllhhhhhhhhhHLLHhhH


DSSP  HHHHHHHHHHHHLLLEEEEEEEEL-LLLHHHHHHHHHHHHHHHHHLLLLLLlEEEELLLL
Query VETLEIMQKANEKSGCTNYLPTLI-TTSDELMKQGVRVMREYLAKHPNQALgLHLEGPWL  134
ident  |      |     | |            |      || |      |       |     
Sbjct FELALPRVKSLIREGVTTVEIKSGyGLTLEDELKXLRVARRLGEALPIRVK-TTLLAAHA  174
DSSP  HHHHHHHHHHHHHHLEEEEEEELLlLLLHHHHHHHHHHHHHHHHHLLLEEE-EEEEEELL


DSSP  ------------lLHHHH-HHHHLH--HHEEEEEELH------HHLLHHHHHHHHHHLLE
Query ------------nAALVD-FLCENA--DVITKVTLAP------EMVPAEVISKLANAGIV  173
ident                         |       |                |       |  
Sbjct vppeyrddpdswvETICQeIIPAAAeaGLADAVDVFCehigfsLAQTEQVYLAADQYGLA  234
DSSP  llhhhlllhhhhhHHHHHlHHHHHHhlLLLLEEEEEEllllllHHHHHHHHHHHHHLLLE


DSSP  EEELL--lLLLHhHHHHHHHHLEEEELLLLlllllllllllhhHHHHHHLL---LLEEEE
Query VSAGH--sNATLkEAKAGFRAGITFATHLYnampyitgrepglAGAILDEA---DIYCGI  228
ident |                    |     ||                               
Sbjct VKGHXdqlSNLG-GSTLAANFGALSVDHLE-----------ylDPEGIQALahrGVVATL  282
DSSP  EEEEElllLLLL-HHHHHHHLLLLEEEELL-----------llLHHHHHHHhhhLLEEEE


DSSP  ELL-LLLL-LHHHHhhHHHHHH---HHEEEELLL-LLLL-LLLHHHHHHHHHHHHLLLHH
Query IAD-GLHV-DYANIrnAKRLKG---DKLCLVTDA-TSGS-SLTMIEGVRNLVEHCGIALD  281
ident                                 |                      |    
Sbjct LPTaFYFLkETKLP--PVVALRkagVPXAVSSDInPGTApIVSLRXAXNXACTLFGLTPV  340
DSSP  LHHhHHHLlLLLLL--LHHHHHhllLLEEELLLLlLLLLlLLLHHHHHHHHHHHHLLLHH


DSSP  HHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELL-----------llLEEEEEELLEE
Query EVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTP-----------dfKITKTIVNGNE  330
ident |     |   ||| |    || |  |  |                          ||| |
Sbjct EAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCghpaelsyligvdQLVSRVVNGEE  400
DSSP  HHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLllllhhhhlllllLEEEEEELLEE


DSSP  EEEl
Query VVTq  334
ident     
Sbjct TLH-  403
DSSP  LLL-


No 14: Query=1yrrB Sbjct=4cqbA Z-score=25.4

back to top
DSSP  -----LEEELLEEElllLEELLEEEEEELLEEEEEEEHhhLLLLL-LEEELLLLEEEELE
Query -----YALTQGRIFtghEFLDDHAVVIADGLIKSVCPVaeLPPEI-EQRSLNGAILSPGF   54
ident                  |        |    |                    |   ||||
Sbjct skdfdLIIRNAYLS---EKDSVYDIGIVGDRIIKIEAK--IEGTVkDEIDAKGNLVSPGF   55
DSSP  llleeEEEEEEEEL---LLLEEEEEEEELLEEEEEELL--LLLLEeEEEELLLLLEEELE


DSSP  EEEEELE--ELLE-----------------------elllLLLL-LLHHHHHHHHHHHHL
Query IDVQLNG--CGGV-----------------------qfndTAEA-VSVETLEIMQKANEK   88
ident  |                                       |                  
Sbjct VDAHTHMdkSFTStgerlpkfwsrpytrdaaiedglkyykNATHeEIKRHVIEHAHMQVL  115
DSSP  EEEEELHhhLLLLllllllllllllllhhhhhhhhhhhhhHLLHhHHHHHHHHHHHHHHH


DSSP  LLEEEEEEEELLLlHHHHHHHHHHHHHHHHHLL-LLLLLEEEE-LLLL--lLHHHHHHHH
Query SGCTNYLPTLITTsDELMKQGVRVMREYLAKHP-NQALGLHLE-GPWL--nAALVDFLCE  144
ident  |                   |    |                                 
Sbjct HGTLYTRTHVDVD-SVAKTKAVEAVLEAKEELKdLIDIQVVAFaQSGFfvdLESESLIRK  174
DSSP  LLEEEEEEEEELL-LLLLLHHHHHHHHHHHHLLlLLEEEEEEElLLLLlllLLHHHHHHH


DSSP  LH-HHEEEEEE-LHHH------LLHHHHHHHHH-HLLEEEELLLL---LLHHHHHHHHHH
Query NA-DVITKVTL-APEM------VPAEVISKLAN-AGIVVSAGHSN---ATLKEAKAGFRA  192
ident         |    |               |||                            
Sbjct SLdMGCDLVGGvDPATrennveGSLDLCFKLAKeYDVDIDYHIHDigtVGVYSINRLAQK  234
DSSP  HHhHLLLEEELlLLLLllllhhHHHHHHHHHHHhLLLEEEEEELLlhhHHHHHHHHHHHH


DSSP  L-------eEEELLLLllllLLLLLLLhhhhHHHHLL--LLEEEEELLllLLLHH-HHHH
Query G-------iTFATHLYnampYITGREPglagAILDEA--DIYCGIIADglHVDYA-NIRN  242
ident              |                 ||                           
Sbjct TiengykgrVTTSHAW-cfaDAPSEWL--deAIPLYKdsGMKFVTCFS--STPPTmPVIK  289
DSSP  HhhllllllEEEEELL-hhhHLLHHHH--hhHHHHHHhhLLEEEEELL--LLLLLlLHHH


DSSP  HHHHHHhHEEEELLLL----LLLLL-LHHHHHHHHHHHHLL----LHHHHHHHHLHHHHH
Query AKRLKGdKLCLVTDAT----SGSSL-TMIEGVRNLVEHCGI----ALDEVLRMATLYPAR  293
ident         |    |             |  |               |     | |   ||
Sbjct LLEAGI-NLGCASDNIrdfwVPFGNgDMVQGALIETQRLELktnrDLGLIWKMITSEGAR  348
DSSP  HHHLLL-EEEEELLLLllllLLLLLlLHHHHHHHHHHHHLLllhhHHHHHHHHHLHHHHH


DSSP  HLLLLLLLlLLLLLLLLLEEEELL---------LLLEEEEEELLEEEEEL-----
Query AIGVEKRLgTLAAGKVANLTAFTP---------DFKITKTIVNGNEVVTQ-----  334
ident   | ||       || | |                |    | ||   |       
Sbjct VLGIEKNY-GIEVGKKADLVVLNSlspqwaiidQAKRLCVIKNGRIIVKDeviva  402
DSSP  HHLLHHHL-LLLLLLLLLEEEELLllhhhhhhhLLLEEEEEELLEEEEELleell


No 15: Query=1yrrB Sbjct=3mkvA Z-score=25.0

back to top
DSSP  ---LEEELLEEELLLL--EELLEEEEEELLEEEEEEEhHHLL-LLLLEEELLLLEEEELE
Query ---YALTQGRIFTGHE--FLDDHAVVIADGLIKSVCPvAELP-PEIEQRSLNGAILSPGF   54
ident         |          |      | || |  |                 |    || 
Sbjct lttFLFRNGALLDPDHpdLLQGFEILIEDGFIREVSD-KPIKsSNAHVIDVKGKTIMPGL   59
DSSP  lleEEEEEEEELLLLLllLEEEEEEEEELLEEEEEEL-LLLLlLLLEEEELLLLEEEELE


DSSP  EEEEELEelleELLL----------LLLLlLHHHhHHHHHHHHLLLEEEEEEEELlllhh
Query IDVQLNGcggvQFND----------TAEAvSVETlEIMQKANEKSGCTNYLPTLIttsde  104
ident ||                                      |    | |            
Sbjct IDLHVHV----VAIEfnlprvatlpNVLV-TLRA-VPIMRAMLRRGFTTVRDAGG-----  108
DSSP  EEEEELL----LLLLllhhhhllllHHHH-HHHH-HHHHHHHHHLLEEEEEELLL-----


DSSP  hhhhhhhhHHHHHHHLL------lLLLLEEEELLL-------------------------
Query lmkqgvrvMREYLAKHP------nQALGLHLEGPW-------------------------  133
ident                                                             
Sbjct -------aGYPFKQAVEsglvegpRLFVSGRALSQtgghadprarsdymppdspcgccvr  161
DSSP  -------lLHHHHHHHHlllllllEEEELLLEEELlllllllllllllllllllllllll


DSSP  ---------llLHHHHHHHHLH--HHEEEEEELH------------HHLLHHHHHHHHHH
Query ---------lnAALVDFLCENA--DVITKVTLAP------------EMVPAEVISKLANA  170
ident                    |            |                    |      
Sbjct vgalgrvadgvDEVRRAVREELqmGADQIXIMASggvasptdpvgvFGYSEDEIRAIVAE  221
DSSP  lllleeelllhHHHHHHHHHHHhhLLLLEEEELLllllllllllllLLLLHHHHHHHHHH


DSSP  L----LEEEELLlllLHHHHHHHHHHLEEEELLLLlllllllllllhhhHHHHHLL--LL
Query G----IVVSAGHsnaTLKEAKAGFRAGITFATHLYnampyitgrepglaGAILDEA--DI  224
ident        | |     |        | |     |                      |    
Sbjct AqgrgTYVLAHA--yTPAAIARAVRCGVRTIEHGN----------liddETARLVAehGA  269
DSSP  HhlllLLEEEEE--lLHHHHHHHHHLLLLEEEELL----------lllhHHHHHHHhhLL


DSSP  EEEEELLLLL------------------------LLHHHHHHHHHHHHhHEEEELLLL-l
Query YCGIIADGLH------------------------VDYANIRNAKRLKGdKLCLVTDAT-s  259
ident |                                      |   ||    |    ||    
Sbjct YVVPTLVTYDalasegekyglppesiakiadvhgAGLHSIEIMKRAGV-KMGFGTDLLge  328
DSSP  EEELLHHHHHhhhhhlllllllhhhhllhhhhhlLHHHHHHHHHHHLL-LLLLLLLLLhh


DSSP  LLLLLHhHHHHHHHhhHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLL
Query GSSLTMiEGVRNLVehCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDF  319
ident    |      | |         ||   ||   |   |    ||    |  |         
Sbjct AQRLQS-DEFRILA--EVLSPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGNP  385
DSSP  HHHHLL-HHHHHHH--LLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLL


DSSP  ------------LEEEEEELLEEEEEL--
Query ------------KITKTIVNGNEVVTQ--  334
ident              |      |   |    
Sbjct lksvdcllgqgeHIPLVMKDGRLFVNEle  414
DSSP  llllllllllllLLLEEEELLEEEEELll


No 16: Query=1yrrB Sbjct=2uz9A Z-score=24.5

back to top
DSSP  ---LEEELlEEELLL-----LEELLEEEEEE-LLEEEEEEEHHHL--------LLLLLEE
Query ---YALTQgRIFTGH-----EFLDDHAVVIA-DGLIKSVCPVAEL--------PPEIEQR   43
ident                     | | ||       | |                     | |
Sbjct plaHIFRG-TFVHSTwtcpmEVLRDHLLGVSdSGKIVFLEEASQQeklakewcFKPCEIR   59
DSSP  lllEEEEE-EEEELLlllllEEEEEEEEEELlLLLEEEEEEHHHHhhhhhhhlLLHHHEE


DSSP  ELL-LLEEEELEEEEEEL--EELLE-----------------elLLLL---LLLLhHHHH
Query SLN-GAILSPGFIDVQLN--GCGGV-----------------qfNDTA---EAVSvETLE   80
ident  |       ||  |                                          |   
Sbjct ELShHEFFMPGLVDTHIHasQYSFAgssidlpllewltkytfpaEHRFqniDFAE-EVYT  118
DSSP  ELLlLLEEEELEEEEEEEhhHHHHLlllllllhhhhhhhlhhhhHHHHhlhHHHH-HHHH


DSSP  HHHHHHHLLLEEEEEEEELLllhhHHHHHHhHHHHHHHHLLLLlLLEEEELLLLL-----
Query IMQKANEKSGCTNYLPTLITtsdeLMKQGVrVMREYLAKHPNQaLGLHLEGPWLN-----  135
ident        | | |                          |              ||     
Sbjct RVVRRTLKNGTTTACYFATI----HTDSSL-LLADITDKFGQR-AFVGKVCMDLNdtfpe  172
DSSP  HHHHHHHHLLEEEEEEELLL----LHHHHH-HHHHHHHHHLLE-EEEELEELLLLlllll


DSSP  -----LHHHHHHHHLH----------hHEEEEEELHH-HLLH--HHHHHHHH-HLLEEEE
Query -----AALVDFLCENA----------dVITKVTLAPE-MVPA--EVISKLAN-AGIVVSA  176
ident                                                   |         
Sbjct ykettEESIKETERFVsemlqknysrvKPIVTPRFSLsCSETlmGELGNIAKtRDLHIQS  232
DSSP  llllhHHHHHHHHHHHhhhhhhlllleEEEEEELLHHhLLHHhhHHHHHHHHhHLLEEEE


DSSP  L-------------llllLHHHHHHHHHHLE----EEELLLLLllllllllllhhhHHHH
Query G-------------hsnaTLKEAKAGFRAGI----TFATHLYNampyitgrepglaGAIL  219
ident                                    |   |                    
Sbjct HisenrdeveavknlypsYKNYTSVYDKNNLltnkTVMAHGCY----------lsaEELN  282
DSSP  EelllhhhhhhhhhhlllLLLHHHHHHHLLLllllEEEEELLL----------llhHHHH


DSSP  HLL--LLEEEEELL----lLLLLHhHHHHHHHHHHhHEEEELLLLlLLLL-LHHHHHHHH
Query DEA--DIYCGIIAD----gLHVDYaNIRNAKRLKGdKLCLVTDATsGSSL-TMIEGVRNL  272
ident                          |          |  | ||   |     |    |  
Sbjct VFHerGASIAHCPNsnlslSSGFL-NVLEVLKHEV-KIGLGTDVA-GGYSySMLDAIRRA  339
DSSP  HHHhhLLEEEELHHhhhhlLLLLL-LHHHHHHLLL-EEEELLLLL-LLLLlLHHHHHHHH


DSSP  HHHH-----------LLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEE------
Query VEHC-----------GIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAF------  315
ident |                 | || | |||    | |     |    ||             
Sbjct VMVSnillinkvnekSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILInpkasd  399
DSSP  HHHHhhhhhllllllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEllllll


DSSP  ------------------LLLL-------LEEEEEELLEEEEE-l
Query ------------------TPDF-------KITKTIVNGNEVVT-q  334
ident                      |        |    | |  ||   
Sbjct spidlfygdffgdiseavIQKFlylgddrNIEEVYVGGKQVVPfs  444
DSSP  lllllllhhhhlllllhhHHHHhhhllhhHEEEEEELLEEEELll


No 17: Query=1yrrB Sbjct=4c5yA Z-score=24.2

back to top
DSSP  -----LEEELLEEELL-LLEELLEEEEEELLEEEEEEEHHHLLLLL-----LEEELllLE
Query -----YALTQGRIFTG-HEFLDDHAVVIADGLIKSVCPVAELPPEI-----EQRSLngAI   49
ident           |    |  | |   | || |  |  |   |  |                 
Sbjct deakvTIIYAGLLIPGdGEPLRNAALVISDKIIAFVGSEADIPKKYlrstqSTHRV--PV   58
DSSP  lllleEEEEEEEELLLlLLLEEEEEEEEELLEEEEEEEHHHLLHHHhhhllLEEEE--EE


DSSP  EEELEEEEEELEelleELLL----------LLLL-lLHHHHHHHHHHHHLLLEEEEEEEE
Query LSPGFIDVQLNGcggvQFND----------TAEA-vSVETLEIMQKANEKSGCTNYLPTL   98
ident | ||  |            |                |   |          | | |    
Sbjct LMPGLWDCHMHF----GGDDdyyndytsglATHPasSGARLARGCWEALQNGYTSYRDLA  114
DSSP  EEELEEEEEELL----LLLLllllllhhhhHLLHhhHHHHHHHHHHHHHHLLEEEEEELL


DSSP  llllhhhhhhhhhHHHHHHHHLL-----lLLLLEE-EELLL-------------------
Query ittsdelmkqgvrVMREYLAKHP-----nQALGLH-LEGPW-------------------  133
ident                 |                                           
Sbjct ------------gYGCEVAKAINdgtivgPNVYSSgAALSQtaghgdifalpagevlgsy  162
DSSP  ------------lLHHHHHHHHHllllllLEEEELlLEEELlllllllllllhhhhhhhh


DSSP  ------------------llLHHHHHHHHLHH--HEEEEEELH-------------HHLL
Query ------------------lnAALVDFLCENAD--VITKVTLAP-------------EMVP  160
ident                        |                                    
Sbjct gvmnprpgywgagplciadgVEEVRRAVRLQIrrGAKVIXVMAsggvmsrddnpnfAQFS  222
DSSP  lllllllllllllleeelllHHHHHHHHHHHHhhLLLLEEEELlllllllllllllLLLL


DSSP  HHHHHHHHHHL----LEEEELllllLHHHHHHHHHHLEEEELLLLlllllllllllhhhH
Query AEVISKLANAG----IVVSAGhsnaTLKEAKAGFRAGITFATHLYnampyitgrepglaG  216
ident  |               |||           |   ||     |                 
Sbjct PEELKVIVEEAarqnRIVSAH--vhGKAGIMAAIKAGCKSLEHVS----------yadeE  270
DSSP  HHHHHHHHHHHhhllLLEEEE--elLHHHHHHHHHHLLLEEEELL----------lllhH


DSSP  HHHHLL--LLEEEEELLLLL-----------------------lLHHHHHHHHHHHHhHE
Query AILDEA--DIYCGIIADGLH-----------------------vDYANIRNAKRLKGdKL  251
ident          |                                         |        
Sbjct VWELMKekGILYVATRSVIEiflasngeglvkeswaklqaladsHLKAYQGAIKAGV-TI  329
DSSP  HHHHHHhhLLEEELLHHHHHhhhhhllllllllhhhlllhhhhhHHHHHHHHHHLLL-LE


DSSP  EEELLLLlllLLLHhHHHHHHHHHHLLLHHHHHHHHLHHHHHHLL-LLLLLLLLLLLLLL
Query CLVTDATsgsSLTMiEGVRNLVEHCGIALDEVLRMATLYPARAIG-VEKRLGTLAAGKVA  310
ident  | ||       |        ||  |    |    ||       |      | |  |  |
Sbjct ALGTDTA-pgGPTA-LELQFAVERGGMTPLEAIKAATANAPLSVGpQAPLTGQLREGYEA  387
DSSP  ELLLLLL-llLLLH-HHHHHHHHLLLLLHHHHHHHHLLLHHHHHHhHLLLLLLLLLLLLL


DSSP  LEEEELLLL-----------LEEEEEELLEEEEEL--------------
Query NLTAFTPDF-----------KITKTIVNGNEVVTQ--------------  334
ident    |                  |     |                    
Sbjct DVIALEENPledikvfqepkAVTHVWKGGKLFKGPgigpwgedarnpfl  436
DSSP  LEEEELLLLlllhhhhhlhhHEEEEEELLEEEELLllllllllllllll


No 18: Query=1yrrB Sbjct=1j6pA Z-score=24.0

back to top
DSSP  --LEEELLEEELL-LLEELLEEEEEELLEEEEEEEHHHLllllLEEELLLLEEEELEEEE
Query --YALTQGRIFTG-HEFLDDHAVVIADGLIKSVCPVAELppeiEQRSLNGAILSPGFIDV   57
ident          |           || |  | || |              | |    |     
Sbjct hhXIIGNCLILKDfSSEPFWGAVEIENGTIKRVLQGEVK----VDLDLSGKLVXPALFNT   56
DSSP  leEEEEEEEELLLlLLLLEEEEEEEELLEEEEEEELLLL----LLEELLLEEEEELEEEE


DSSP  EELE-ELLE-----------------ellLLLLL--LLHHHHHHHHHHHHLLLEEEEEEE
Query QLNG-CGGV-----------------qfnDTAEA--VSVETLEIMQKANEKSGCTNYLPT   97
ident                                              |      |       
Sbjct HTHApXTLLrgvaedlsfeewlfskvlpiEDRLTekXAYYGTILAQXEXARHGIAGFVDX  116
DSSP  EELHhHHHHllllllllhhhhhhllhhhhHLLLLhhHHHHHHHHHHHHHHLLLEEEEEEE


DSSP  ELlllhhhhhhHHHHHHHHHHHLLLLlLLEEEELLL---llLHHHHHHHHLHH-------
Query LIttsdelmkqGVRVMREYLAKHPNQaLGLHLEGPW---lnAALVDFLCENAD-------  147
ident                              |                              
Sbjct YF---------HEEWIAKAVRDFGXR-ALLTRGLVDsngddGGRLEENLKLYNewngfeg  166
DSSP  EL---------LHHHHHHHHHHHLLE-EEEEEEELLlllllLLHHHHHHHHHHhhllhhh


DSSP  --HEEEEEELH--HHLL--HHHHHHHHHHLLEEEELL-----lLLLHHHHH-HHHHhLEE
Query --VITKVTLAP--EMVP--AEVISKLANAGIVVSAGH-----sNATLKEAK-AGFRaGIT  195
ident           |          |          |             |      |      
Sbjct riFVGFGPHSPylCSEEylKRVFDTAKSLNAPVTIHLyetskeEYDLEDILnIGLK-EVK  225
DSSP  leEEEEEELLLllLLHHhhHHHHHHHHHHLLLEEEEEllllllLLLLHHHHlLLLL-LLL


DSSP  E-ELLLLllLLLLlllllhhhHHHHHLL--LLEEEEELL-LLLL--LHHHHHHHHHHHHh
Query F-ATHLYnaMPYItgrepglaGAILDEA--DIYCGIIAD-GLHV--DYANIRNAKRLKGd  249
ident   | |                                    |      |           
Sbjct TiAAHCV--HLPE--------RYFGVLKdiPFFVSHNPAsNLKLgnGIAPVQRXIEHGX-  274
DSSP  EeEEELL--LLLH--------HHHHHHLllLEEEEELHHhHHHLllLLLLHHHHHHLLL-


DSSP  HEEEELLLLLLLLL-LHHHHHHHHHHHH------LLLHHHHHHHHLHHHHHHLLLllLLL
Query KLCLVTDATSGSSL-TMIEGVRNLVEHC------GIALDEVLRMATLYPARAIGVekRLG  302
ident |  | ||              |                   |   |   | | |     |
Sbjct KVTLGTDGAASNNSlNLFFEXRLASLLQkaqnprNLDVNTCLKXVTYDGAQAXGF--KSG  332
DSSP  EEEELLLLLLLLLLlLHHHHHHHHHHHHhlllllLLLHHHHHHHHLHHHHHHHLL--LLL


DSSP  LLLLLLLLLEEEEL-------------------LLLLEEEEEELLEEEEEL---------
Query TLAAGKVANLTAFT-------------------PDFKITKTIVNGNEVVTQ---------  334
ident     |  | |                              | | |               
Sbjct KIEEGWNADLVVIDldlpexfpvqniknhlvhaFSGEVFATXVAGKWIYFDgeyptidse  392
DSSP  LLLLLLLLLEEEEElllhhhllhhhhhhhhhhlLLLLLLEEEELLEEEEELlllllllhh


DSSP  ---------------
Query ---------------  334
ident                
Sbjct evkrelariekelys  407
DSSP  hhhhhhhhhhhhhhl


No 19: Query=1yrrB Sbjct=1k6wA Z-score=23.1

back to top
DSSP  --LEEELLEEElllLEELLEEEEEELLEEEEEEEHH-hlllLLLEEELLLLEEEELEEEE
Query --YALTQGRIFtghEFLDDHAVVIADGLIKSVCPVA-elppEIEQRSLNGAILSPGFIDV   57
ident         |                || |                         | |   
Sbjct alQTIINARLP---GEEGLWQIHLQDGKISAIDAQSgvmpiTENSLDAEQGLVIPPFVEP   57
DSSP  llLEEEEELLL---LLLLEEEEEEELLEEEEEEEELlllllLLLEEELLLLEEELLEEEE


DSSP  EELeelleELLL----------------------------LLLLLLhHHHHHHHHHHHLL
Query QLNgcggvQFND----------------------------TAEAVSvETLEIMQKANEKS   89
ident                                         |   |         |     
Sbjct HIH-----LDTTqtagqpnwnqsgtlfegierwaerkallTHDDVK-QRAWQTLKWQIAN  111
DSSP  EEL-----LLLLlllllllllllllhhhhhhhhhllhhhlLHHHHH-HHHHHHHHHHHHL


DSSP  LEEEEEEEELLLLHHH--HHHHHHHHHHHhhhLLLLLLLEEEELLLL------lLHHHHH
Query GCTNYLPTLITTSDEL--MKQGVRVMREYlakHPNQALGLHLEGPWL------nAALVDF  141
ident |              |   |    |  |     |   |                 ||   
Sbjct GIQHVRTHVDVSDATLtaLKAMLEVKQEV---APWIDLQIVAFPQEGilsypngEALLEE  168
DSSP  LEEEEEEEEELLLLLLhhHHHHHHHHHHH---LLLLEEEEEEELLLLllllllhHHHHHH


DSSP  HHHLHhhEEEEEELH--------HHLL-HHHHHHHHHHLLEEEELLL---llLHHHHHHH
Query LCENAdvITKVTLAP--------EMVP-AEVISKLANAGIVVSAGHS---naTLKEAKAG  189
ident           |   |                                             
Sbjct ALRLG--ADVVGAIPhfeftreyGVESlHKTFALAQKYDRLIDVHCDeiddeQSRFVETV  226
DSSP  HHHLL--LLEEEELHhhlllhhhHHHHhHHHHHHHHHHLLEEEEEELlllllLLLHHHHH


DSSP  HHHL-------eEEELLLLllllLLLLLLLhhhhHHHHLL--LLEEEEELL--LLLL---
Query FRAG-------iTFATHLYnampYITGREPglagAILDEA--DIYCGIIAD--GLHV---  235
ident               | |         |                |                
Sbjct AALAhhegmgarVTASHTT-amhSYNGAYT--srLFRLLKmsGINFVANPLvnIHLQgrf  283
DSSP  HHHHhhhllhhhEEEEELH-hhhHLLHHHH--hhHHHHHHhhLLEEEELHHhhHHHLlll


DSSP  -------lhhHHHHHHHHHHhHEEEELLLL----LLLL-LLHHHHHHHHHHHHL-----L
Query -------dyaNIRNAKRLKGdKLCLVTDAT----SGSS-LTMIEGVRNLVEHCG-----I  278
ident                        |   |             |          |       
Sbjct dtypkrrgitRVKEMLESGI-NVCFGHDDVfdpwYPLGtANMLQVLHMGLHVCQlmgygQ  342
DSSP  llllllllllLHHHHHHLLL-LEEELLLLLllllLLLLlLLHHHHHHHHHHHLLlllhhH


DSSP  LHHhHHHHHLHHHHHHLLlLLLLlLLLLLLLLLEEEELL---------LLLEEEEEELLE
Query ALDeVLRMATLYPARAIGvEKRLgTLAAGKVANLTAFTP---------DFKITKTIVNGN  329
ident   |  |   |   ||           |||  |||                        | 
Sbjct IND-GLNLITHHSARTLN-LQDY-GIAAGNSANLIILPAengfdalrrQVPVRYSVRGGK  399
DSSP  HHH-HHHHHLHHHHHHLL-LLLL-LLLLLLLLLEEEELLllhhhhhhhLLLLLEEEELLE


DSSP  EEEEL-------------------
Query EVVTQ-------------------  334
ident                         
Sbjct VIASTqpaqttvyleqpeaidykr  423
DSSP  EEEELlllleeeellleeeellll


No 20: Query=1yrrB Sbjct=3icjA Z-score=22.8

back to top
DSSP  --LEEELLEEELLL--LEELlEEEEEELLEEEEEEEHH---HLLL--LLLEEELLLLEEE
Query --YALTQGRIFTGH--EFLDdHAVVIADGLIKSVCPVA---ELPP--EIEQRSLNGAILS   51
ident    ||  | | |            ||                       |   | |    
Sbjct cmKALINGTIYTSFspVKKV-SGLVISNERVLYAGDSStalRIAElaGGEIIDLKGKFVM   59
DSSP  leEEEELLEEEEEEllEEEE-LEEEEELLEEEEEELHHhhhHHHHhhLLEEEELLLLEEE


DSSP  ELEEEEEELE--ELLE--------------------------------------------
Query PGFIDVQLNG--CGGV--------------------------------------------   65
ident | | |  |     |                                              
Sbjct PAFFDSHLHLdeLGMSlemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHhhHHHHhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  -------------------------------------------------------elllL
Query -------------------------------------------------------qfndT   70
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekI  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlL


DSSP  LLL-LLHHHHHHHHHHHHLLLEEEEEEEELlllhhhHHHHHHHHHHHH--HHLLlLLLLE
Query AEA-VSVETLEIMQKANEKSGCTNYLPTLIttsdelMKQGVRVMREYL--AKHPnQALGL  127
ident           |  |      |                        |              
Sbjct LTVkDYKHYIESAQEHLLSLGVHSVGFMSV------GEKALKALFELEreGRLK-MNVFA  232
DSSP  LLHhHHHHHHHHHHHHHHHLLEEEEEEEEE------LHHHHHHHHHHHhlLLLL-LEEEE


DSSP  EEELLllllhHHHHH---hHLHH-----HEEEEEELH-----------------------
Query HLEGPwlnaaLVDFL---cENAD-----VITKVTLAP-----------------------  156
ident  |        | | |              |  | |                         
Sbjct YLSPE-----LLDKLeelnLGKFegrrlRIWGVXLFVdgslgartallsepytdnpttsg  287
DSSP  EELHH-----HHHHHhhhlLLLEellleEEEEEEEELlllllllllllllllllllllll


DSSP  ----HHLL-HHHHHHHHHHLLEEEELL--lLLLHhHHHHHHH--HLEEEELLLLllLLLL
Query ----EMVP-AEVISKLANAGIVVSAGH--sNATLkEAKAGFR--AGITFATHLYnaMPYI  207
ident           |||      |  |        |    |   |          |        
Sbjct elvmNKDEiVEVIERAKPLGLDVAVHAigdKAVD-VALDAFEeaEFSGRIEHAS--LVRD  344
DSSP  llllLHHHhHHHHHHHLLLLLEEEEEEllhHHHH-HHHHHHHhhLLLLEEEELL--LLLH


DSSP  LllllhhHHHHHHLlLLEEEEELL-LLLL-------------lhhHHHHHHHHHhhHEEE
Query TgrepglAGAILDEaDIYCGIIAD-GLHV-------------dyaNIRNAKRLKgdKLCL  253
ident           |                                             ||  
Sbjct D-----qLERIKEL-KVRISAQPHfIVSDwwivnrvgeerakwayRLKTLSSIT--KLGF  396
DSSP  H-----hHHHHHHH-LLEEEELLLhHHHLllhhhhhhhhhhhhllLHHHHHHHL--LEEE


DSSP  ELLLLlLLLLLHHHHHHHHHHH------HLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLL
Query VTDATsGSSLTMIEGVRNLVEH------CGIALDEVLRMATLYPARAIGVEkRLGTLAAG  307
ident  ||                |              | |   |   |     |  || |  |
Sbjct STDSP-IEPADPWVSIDAAVNRyvvdpgERVSREEALHLYTHGSAQVTLAE-DLGKLERG  454
DSSP  LLLLL-LLLLLHHHHHHHHHHLllllhhHLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLL


DSSP  LLLLEEEELLLLleeeeeelleeeeel
Query KVANLTAFTPDFkitktivngnevvtq  334
ident   |       |                
Sbjct FRAEYIILDRDP-------------lk  468
DSSP  LLLLEEEELLLL-------------ll


No 21: Query=1yrrB Sbjct=3ooqA Z-score=22.5

back to top
DSSP  -LEEELLEEELLL-LEELlEEEEEELLEEEEEEEHhHLLLLLLEEELLLLEEEELEEEEE
Query -YALTQGRIFTGH-EFLDdHAVVIADGLIKSVCPVaELPPEIEQRSLNGAILSPGFIDVQ   58
ident          |           |    |    |       |  |   | |  | ||| |  
Sbjct kILFKNATVFPITsRPFK-GDVLVSNGKVEKVGEN-IEDPDAEIVDLTGKFLFPGFVDAH   58
DSSP  lEEEEEEEELLLLlLLEE-EEEEEELLEEEEEELL-LLLLLLEEEELLLLEEEELEEEEE


DSSP  ELEellEELL---LLLLLL----------------LHHHHHHHHHHHHLLLEEEEEEEEL
Query LNGcggVQFN---DTAEAV----------------SVETLEIMQKANEKSGCTNYLPTLI   99
ident         |                                         | |       
Sbjct SHI---GLFEegvGYYYSDgneatdpvtphvkaldGFNPQDPAIERALAGGVTSVXIVPG  115
DSSP  ELL---LLLLlllLHHHLLlllllllllllllhhhHLLLLLHHHHHHHLLLEEEEEELLL


DSSP  -lllhhhhhhhhhhhhhHHHHLlllLLLEeeellllllhhhhhhhhlhhhEEEEEEL---
Query -ttsdelmkqgvrvmreYLAKHpnqALGLhlegpwlnaalvdflcenadvITKVTLA---  155
ident                                                         |   
Sbjct sanpvggqgsvikfrsiIVEEC---IVKD---------------------PAGLKXAfge  151
DSSP  lllleeeeeeeeellllLHHHH---EEEE---------------------EEEEEEEllh


DSSP  -------------------hHHLLHHH----------------------------hHHHH
Query -------------------pEMVPAEV----------------------------iSKLA  168
ident                                                             
Sbjct npkrvygerkqtpstrxgtaGVIRDYFtkvknyxkkkelaqkegkeftetdlkxevGEXV  211
DSSP  hhhhhhhhlllllllhhhhhHHHHHHHhhhhhhhhhhhhhhhlllllllllhhhhhHHHH


DSSP  -HHLLEEEELL--lLLLHhHHHHHHH--HLEEEELLLLLllllllllllhhHHHHHHLlL
Query -NAGIVVSAGH--sNATLkEAKAGFR--AGITFATHLYNampyitgrepglAGAILDEaD  223
ident     |            |  |              |                        
Sbjct lRKKIPARXHAhraDDIL-TAIRIAEefGFNLVIEHGTE--------aykiSKVLAEK-K  261
DSSP  hLLLLLEEEEEllhHHHH-HHHHHHHhhLLLEEEEELLL--------hhhhHHHHHHH-L


DSSP  LEEEEE-LLLL-------lLLHHHHHHHHHHHHhHEEEELLLLllLLLL--HHHHHHHHh
Query IYCGII-ADGL-------hVDYANIRNAKRLKGdKLCLVTDATsgSSLT--MIEGVRNLv  273
ident |                       |            |  |                   
Sbjct IPVVVGpLLTFrtklelkdLTXETIAKLLKDGV-LIALXCDHP--VIPLefATVQAATA-  317
DSSP  LLEEELlLLLLlllhhhllLLLLHHHHHHHLLL-LEEELLLLL--LLLHhhHHHHHHHH-


DSSP  HHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLL-----LEEEEEELL
Query EHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDF-----KITKTIVNG  328
ident    |      |   |  ||   | | | |    || | |                    |
Sbjct XRYGAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSGHPfdxksVVERVYIDG  377
DSSP  HHHLLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLLlllllLEEEEEELL


DSSP  EEEEEL-
Query NEVVTQ-  334
ident  ||    
Sbjct VEVFRRe  384
DSSP  EEEEELl


No 22: Query=1yrrB Sbjct=2ogjA Z-score=22.5

back to top
DSSP  ---LEEELLEEELLL--LEELLEEEEEE-LLEEEEEEEHhHLLLLLLEEELLlLEEEELE
Query ---YALTQGRIFTGH--EFLDDHAVVIA-DGLIKSVCPVaELPPEIEQRSLNgAILSPGF   54
ident      ||                   |  || |  |       |   ||    |  ||| 
Sbjct qapILLTNVKPVGFGkgASQSSTDILIGgDGKIAAVGSA-LQAPADTQRIDA-AFISPGW   58
DSSP  lllEEEEEEEELLLLllLLLLLEEEEELlLLLEEEEELL-LLLLLLEEELLL-LEEEELE


DSSP  EEEEELEelleeLLLLLLlllhhhhhHHHHHHHLLLEEEEEEEELlllhhhHHHHHHHHH
Query IDVQLNGcggvqFNDTAEavsvetleIMQKANEKSGCTNYLPTLIttsdelMKQGVRVMR  114
ident  |                                 | |                      
Sbjct VDLHVHI-----WHGGTD-----isiRPSECGAERGVTTLVDAGS----agEANFHGFRE  104
DSSP  EEEEELL-----LLLLLL-----lllLHHHLLHHHLEEEEEEELL----llLLLHHHHHH


DSSP  HHHHHLLLLLlLEEEELL------------------lllLHHHHHHHHLHHHEEEEEELH
Query EYLAKHPNQAlGLHLEGP------------------wlnAALVDFLCENADVITKVTLAP  156
ident               |                                ||   |       
Sbjct YIIEPSRERI-KAFLNLGsiglvacnrvpelrdikdidlDRILECYAENSEHIVGLXVRA  163
DSSP  HLLLLLLLEE-EEEEELLlllllllllllllllhhhllhHHHHHHHHLLLLLEEEEEEEE


DSSP  ---------HHLLHHHHHHHHHHLLEEEELLL---LLLHhHHHHHHHhleEEELLLLL--
Query ---------EMVPAEVISKLANAGIVVSAGHS---NATLkEAKAGFRagiTFATHLYN--  202
ident                                         |            ||  |  
Sbjct shvitgswgVTPVKLGKKIAKILKVPXXVHVGeppALYD-EVLEILG-pgDVVTHCFNgk  221
DSSP  lhhhhllllLHHHHHHHHHHHHHLLLEEEEELlllLLHH-HHHHHLL-llLEEELLLLll


DSSP  -lLLLLLLLLLhhhHHHHHLLLLEEEEELLLLLLLHHHHHHHH--HHHHhhEEEELLLLL
Query -aMPYITGREPglaGAILDEADIYCGIIADGLHVDYANIRNAK--RLKGdkLCLVTDATS  259
ident                       |   |   |          |    |        ||   
Sbjct sgSSIXEDEDL--fNLAERCEGIRLDIGHGGASFSFKVAEAAIarGLLP--FSISTDLHG  277
DSSP  llLLLLLLHHH--hHHHHHLLLLEEELLLLLLLLLHHHHHHHHhlLLLL--LLLLLLLLL


DSSP  LLL----LLHHHHHHHHHHhHLLLHHHHHHHHLHHHHHHLLLLLLllLLLLLLLLLEEEE
Query GSS----LTMIEGVRNLVEhCGIALDEVLRMATLYPARAIGVEKRlgTLAAGKVANLTAF  315
ident  |              |          |    |  ||  |        |  |  |  | |
Sbjct HSXnfpvWDLATTXSKLLS-VDXPFENVVEAVTRNPASVIRLDXE-nRLDVGQRADFTVF  335
DSSP  LLLllllLLHHHHHHHHHH-LLLLHHHHHHLLLHHHHHHLLLLLL-lLLLLLLLLEEEEE


DSSP  LLL-------------------LLEEEEEELLEEEEEL------
Query TPD-------------------FKITKTIVNGNEVVTQ------  334
ident                       |                     
Sbjct DLVdadleatdsngdvsrlkrlFEPRYAVIGAEAIAASryipra  379
DSSP  EEEeeeeeeellllleeeeeeeEEEEEEEELLEEEELLllllll


No 23: Query=1yrrB Sbjct=1a5kC Z-score=22.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------LEEELLEEELLLLEELlEEEEEELLEEEEEEEH--------HHLLLL--LLEEE
Query ------YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPV--------AELPPE--IEQRS   44
ident         ||   |               || |                 |     |   
Sbjct aadcvdLVLTNALIVDHWGIVK-ADIGVKDGRIFAIGKAgnpdiqpnVTIPIGaaTEVIA  119
DSSP  hhhlllEEEEEEEEEELLEEEE-EEEEEELLEEEEEELEelllllllLLEELLllLEEEE


DSSP  LLLLEEEELEEEEEELEelleelllllllllhhHHHHHHHHHHLLLEEEEEEEE------
Query LNGAILSPGFIDVQLNGcggvqfndtaeavsveTLEIMQKANEKSGCTNYLPTL------   98
ident   | |   | ||                                || |            
Sbjct AEGKIVTAGGIDTHIHW----------------ICPQQAEEALVSGVTTMVGGGtgpaag  163
DSSP  LLLLEEEELEEEEEEEL----------------LLLLHHHHHHHHLEEEEEEELllllhh


DSSP  -llllhhHHHHHHHHHHHHHHHLLLLlLLEEEELLLllLHHHHHHHHLhhHEEEEEE---
Query -ittsdeLMKQGVRVMREYLAKHPNQaLGLHLEGPWlnAALVDFLCENadVITKVTL---  154
ident                |       |    ||   |                          
Sbjct thattctPGPWYISRMLQAADSLPVN-IGLLGKGNVsqPDALREQVAA--GVIGLEIhed  220
DSSP  hhhllllLHHHHHHHHHHHHLLLLLE-EEEEEELLLllHHHHHHHHHH--LLLEEEEehh


DSSP  --LHHHLLHHHHHHHHHHLLEEEELLLL----lLHHHHHHHHHHLEEEELLLLL--LLLL
Query --APEMVPAEVISKLANAGIVVSAGHSN----aTLKEAKAGFRAGITFATHLYN--AMPY  206
ident   |                | |                 |          |         
Sbjct wgATPAAIDCALTVADEMDIQVALHSDTlnesgFVEDTLAAIGGRTIHTFHTEGagGGHA  280
DSSP  hlLLHHHHHHHHHHHHHHLLEEEEELLLlllllLHHHHHHHHLLLLEEELLLLLllLLLL


DSSP  LlllllHHHHhHHHLLLLEEEEELLllLLLH-----------------------------
Query ItgrepGLAGaILDEADIYCGIIADglHVDY-----------------------------  237
ident                  |            |                             
Sbjct P-----DIIT-ACAHPNILPSSTNP--TLPYtlntidehldmlmvchhldpdiaedvafa  332
DSSP  L-----LHHH-HHHLLLEEEEEEHH--HLLLlllhhhhhhhhhhhhhllllllhhhhhll


DSSP  ---------HHHHHHH-HHHHhhEEEELLLLlLLLL-LHHHHHHHHHHHHL---------
Query ---------ANIRNAK-RLKGdkLCLVTDATsGSSL-TMIEGVRNLVEHCG---------  277
ident          |                  |          |                    
Sbjct esrirretiAAEDVLHdLGAF--SLTSSDSQaMGRVgEVILRTWQVAHRMKvqrgalaee  390
DSSP  lllllhhhhHHHHHHHhLLLL--LEEELLLLlLLLLlLHHHHHHHHHHHHHhhhllllll


DSSP  ------lLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL---LLEEEEEELL
Query ------iALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPD---FKITKTIVNG  328
ident                 |  ||   |     |    || | |    |     |    |  |
Sbjct tgdndnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAffgVKPATVIKGG  450
DSSP  lllllhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHhllLLLLEEEELL


DSSP  EEEEEL------------------------------------------------------
Query NEVVTQ------------------------------------------------------  334
ident                                                             
Sbjct MIAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsai  510
DSSP  EEEEEEellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhlllllee


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  334
ident                                                         
Sbjct avvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  eellllllllhhhllllllllleeelllllleeelleellllllllllllllllll


No 24: Query=1yrrB Sbjct=4rdvB Z-score=22.2

back to top
DSSP  LEEELLEEELLLLEELLEEEEEE-LLEEEEEEEHHHllllLLEEELLlLEEEELEEEEEE
Query YALTQGRIFTGHEFLDDHAVVIA-DGLIKSVCPVAElppeIEQRSLNgAILSPGFIDVQL   59
ident  |    |              |  ||      | |          |      ||      
Sbjct SAIFAERALLPEGWARNVRFEISaDGVLAEIRPDAN---aDGAERLG-GAVLPGMPNLHS   56
DSSP  LEEEEEEEEELLEEEEEEEEEELlLLLEEEEELLLL---lLLLEELL-LLEEELEEEEEE


DSSP  L--EELL--------------------eellLLLLLL--LHHHHHHHHHHHHLLLEEEEE
Query N--GCGG--------------------vqfnDTAEAV--SVETLEIMQKANEKSGCTNYL   95
ident                                                     | | |   
Sbjct HafQRAMaglaevagnpndsfwtwrelmyrmVARLSPeqIEVIACQLYIEMLKAGYTAVA  116
DSSP  LhhHHHHlllllllllllllhhhhhhhhhhhHLLLLHhhHHHHHHHHHHHHHHHLEEEEE


DSSP  EEELLLL------hhhhHHHHHHHHHHHHHLLLLlLLEEEELLL----------------
Query PTLITTS------delmKQGVRVMREYLAKHPNQaLGLHLEGPW----------------  133
ident                                    | |                      
Sbjct EFHYVHHdldgrsyadpAELSLRISRAASAAGIG-LTLLPVLYShagfggqpasegqrrf  175
DSSP  EEELLLLllllllllllLHHHHHHHHHHHHHLLE-EEEEELLLLeeellleellhhhlll


DSSP  --llLHHHHHHHHLH-------hHEEEEEELH--HHLL--HHHHHHhhHHLLEEEELL--
Query --lnAALVDFLCENA-------dVITKVTLAP--EMVP--AEVISKlaNAGIVVSAGH--  178
ident      |    |                             | |          |      
Sbjct ingsEAYLELLQRLRapleaaghSLGLCFHSLraVTPQqiATVLAA-gHDDLPVHIHIae  234
DSSP  lllhHHHHHHHHHHHhhhhhhllEELEEELLLllLLHHhhHHHHLL-lLLLLLEEEEEll


DSSP  -------------lLLLHHHHHHHHhhleEEELLLLllLLLLlllllhHHHHHHHLlLLE
Query -------------sNATLKEAKAGFragiTFATHLYnaMPYItgrepgLAGAILDEaDIY  225
ident                                  |                 |        
Sbjct qqkevddcqawsgrRPLQWLYENVAvdqrWCLVHAT--HADP-----aEVAAMARS-GAV  286
DSSP  lhhhhhhhhhhhllLHHHHHHHHLLllllEEEEELL--LLLH-----hHHHHHHHH-LLE


DSSP  EEEELL----lLLLLHhHHHHHHHHHHhHEEEELLLLllLLLLHHHHHHHHHHHHL----
Query CGIIAD----gLHVDYaNIRNAKRLKGdKLCLVTDATsgSSLTMIEGVRNLVEHCG----  277
ident  |                        |  |    |     ||   |  | |         
Sbjct AGLCLSteanlGDGIF-PATDFLAQGG-RLGIGSDSH--VSLSVVEELRWLEYGQRlrdr  342
DSSP  EEELHHhhhhlLLLLL-LHHHHHHLLL-EEEELLLLL--LLLLHHHHHHHHHHHHHhhhl


DSSP  -----------lLHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLLEEEE-----------
Query -----------iALDEVLRMATLYPARAIGVekRLGTLAAGKVANLTAF-----------  315
ident                     |    | | |     | || |  | |              
Sbjct krnrlyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLdgndpylasae  400
DSSP  llllllllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEEllllhhhhlll


DSSP  ----LLLL-------LEEEEEELLEEEEEL---------------------
Query ----TPDF-------KITKTIVNGNEVVTQ---------------------  334
ident                      | |  ||                       
Sbjct gdalLNRWlfaggdrQVRDVMVAGRWVVRDgrhageersarafvqvlgell  451
DSSP  lhhhHHHHhhhllhhHEEEEEELLEEEELLlllllhhhhhhhhhhhhhhhl


No 25: Query=1yrrB Sbjct=3cjpA Z-score=16.5

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                       ||    
Sbjct ----------------------------------------------------LIIDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  eelleelllllllllhHHHHHHHHHHHLLLEEEEEEEELL--------------------
Query gcggvqfndtaeavsvETLEIMQKANEKSGCTNYLPTLIT--------------------  100
ident                    |   |     |                              
Sbjct --------------viLPVEKHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkkln   54
DSSP  --------------llLLHHHHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhh


DSSP  --------LLHHHHHHHHHHHHHHHHHLLLLLLLeEEELLL--llLHHHHHHHHLH--HH
Query --------TSDELMKQGVRVMREYLAKHPNQALGlHLEGPW--lnAALVDFLCENA--DV  148
ident                             |    |     |             ||     
Sbjct dvvngktnSMIDVRRNSIKELTNVIQAYPSRYVG-FGNVPVglseNDTNSYIEENIvnNK  113
DSSP  hhhlllllLLHHHHHHHHHHHHHHHHHLLLLEEE-EELLLLlllhHHHHHHHHHHLllLL


DSSP  EEE-EEEL----hHHLLHHHHHHHHHHL-LEEEELL---LLLL-HHHHHHHHHH---LEE
Query ITK-VTLA----pEMVPAEVISKLANAG-IVVSAGH---SNAT-LKEAKAGFRA---GIT  195
ident       |                    |                 ||      |      
Sbjct LVGiGELTpasgqIKSLKPIFKYSMDSGsLPIWIHAfnpLVLQdIKEIAELCKAfpkVPV  173
DSSP  LLEeEEELlllllHHHHHHHHHHHHHLLlLLEEELLlllLLHHhHHHHHHHHHHlllLLE


DSSP  EELLLLLlLLLLlllllHHHHHHHHLLLLEEEEEllllLLLHHHHHHHHHHHHHHEEEEL
Query FATHLYNaMPYItgrepGLAGAILDEADIYCGIIadglHVDYANIRNAKRLKGDKLCLVT  255
ident    |                         |                        |    |
Sbjct ILGHMGG-SNWM-----TAVELAKEIQNLYLDTS---aYFSTFVLKIVINELPLKCIFGT  224
DSSP  EEHHHHH-HHHH-----HHHHHHHHLLLEEEELL---lLLLHHHHHHHHHHLLLLEELLL


DSSP  LLLllLLLLhHHHHHHHHHhHLLLHHHHHHHHLHHHHHHLLLlllllllllllllleeee
Query DATsgSSLTmIEGVRNLVEhCGIALDEVLRMATLYPARAIGVekrlgtlaagkvanltaf  315
ident |                                    |                      
Sbjct DMP--FGDL-QLSIEAIKK-MSNDSYVANAVLGDNISRLLNI------------------  262
DSSP  LLL--LLLH-HHHHHHHHH-HLLLHHHHHHHHLHHHHHHHLL------------------


DSSP  llllleeeeeelleeeeel
Query tpdfkitktivngnevvtq  334
ident                    
Sbjct -------------------  262
DSSP  -------------------


No 26: Query=1yrrB Sbjct=4dlfA Z-score=16.2

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
ident                                                       ||    
Sbjct ---------------------------------------------------ALRIDSHQH    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  eelleeLLLLL------------llllhhHHHHHHHHHHLLLEEEEEEEELLLLHHHHHH
Query gcggvqFNDTA------------eavsveTLEIMQKANEKSGCTNYLPTLITTSDELMKQ  108
ident       |                                                     
Sbjct ------FWRYRaadypwigagmgvlardyLPDALHPLMHAQALGASIAVQARAGRDETAF   63
DSSP  ------LLLLLhhhllllllllhhhllllLHHHHHHHHHHLLLLEEEEELLLLLHHHHHH


DSSP  HHHHHHHHhhhllLLLLLEEEELLLllLHHHHHHHHLH-HHEEEEEE---------lhHH
Query GVRVMREYlakhpNQALGLHLEGPWlnAALVDFLCENA-DVITKVTL---------apEM  158
ident                              |     |                        
Sbjct LLELACDE-----ARIAAVVGWEDLraPQLAERVAEWRgTKLRGFRHqlqdeadvrafVD  118
DSSP  HHHHHLLL-----LLEEEEEELLLLllLLHHHHHHLLLlLLEEEEEElhhhlllhhhhHH


DSSP  LL--HHHHHHHHHHLLEEEELL----lLLLHHHHHHHhHHLEEEELLLLLL---------
Query VP--AEVISKLANAGIVVSAGH----sNATLKEAKAGfRAGITFATHLYNA---------  203
ident     |     |     |                      |      |             
Sbjct DAdfARGVAWLQANDYVYDVLVferqlPDVQAFCARH-DAHWLVLDHAGKPalaefdrdd  177
DSSP  LHhhHHHHHHHHHLLLEEEELLlhhhhHHHHHHHHHL-LLLLEEEHHHHLLlhhhlllll


DSSP  ---lLLLLllllhhHHHHHHLLLLEEEEElLLLL-------------lLHHHHHHHHHHH
Query ---mPYITgrepglAGAILDEADIYCGIIaDGLH-------------vDYANIRNAKRLK  247
ident                          |                             |    
Sbjct talaRWRA-----aLRELAALPHVVCKLSgLVTEadwrrglrasdlrhIEQCLDAALDAF  232
DSSP  lhhhHHHH-----hHHHHHLLLLEEEEELlLLLLllllllllhhhhhhHHHHHHHHHHHH


DSSP  H-HHEEEELLLL---LLLLL--LHHHHHHHHHHhhLLLHHHHHHHHLHHHHHHLLLLlll
Query G-DKLCLVTDAT---SGSSL--TMIEGVRNLVEhcGIALDEVLRMATLYPARAIGVEkrl  301
ident |   |    |        |         |           |         ||        
Sbjct GpQRLMFGSDWPvclLAASYdeVASLVERWAES--RLSAAERSALWGGTAARCYALP---  287
DSSP  LhHHEEELLLLLhhhHLLLHhhHHHHHHHHHHH--HLLHHHHHHHLLHHHHHHLLLL---


DSSP  lllllllllleeeellllleeeeeelleeeeel
Query gtlaagkvanltaftpdfkitktivngnevvtq  334
ident                                  
Sbjct ---------------------------------  287
DSSP  ---------------------------------


No 27: Query=1yrrB Sbjct=2imrA Z-score=16.2

back to top
DSSP  -leeELLE--EELLLLEELLEEeeeelleeEEEE-----EHHHLLlLLLEEElLLLE-EE
Query -yalTQGR--IFTGHEFLDDHAvviadgliKSVC-----PVAELPpEIEQRSlNGAI-LS   51
ident             ||                                              
Sbjct htprLLTCdvLYTGAQSPGGVV----vvgeTVAAaghpdELRRQY-PHAAEE-RAGAvIA   54
DSSP  lleeEEEEleEELLEELLEEEE----eellEEEEeelhhHHHHHL-LLLEEE-ELLLeEL


DSSP  ELEEEEEELEelleeLLLL--------------------llLLLHhHHHHHHHHHHLLLE
Query PGFIDVQLNGcggvqFNDT--------------------aeAVSVeTLEIMQKANEKSGC   91
ident |                                                         | 
Sbjct PPPVNAHTHL-----DMSAyefqalpyfqwipevvirgrhlRGVA-AAQAGADTLTRLGA  108
DSSP  LLLLEEEEEL-----LLLHhhhhhlhhhhllhhhhhhhlllLHHH-HHHHHHHHHHHLLL


DSSP  EEEEEEELlllhhhHHHHHHHHHHHhhhlLLLLLLEEEELLL--------llLHHHHHHH
Query TNYLPTLIttsdelMKQGVRVMREYlakhPNQALGLHLEGPW--------lnAALVDFLC  143
ident                                    |  |             ||    | 
Sbjct GGVGDIVW------APEVMDALLAR----EDLSGTLYFEVLNpfpdkadevfAAARTHLE  158
DSSP  LLEEEEEL------LHHHHHHHHLL----LLLLEEEEEEELLllhhhhhhhhHHHHHHHH


DSSP  HLH-----hhEEEEEE-LHHH----LLHHHHHHHHHHLLEEEELL---------------
Query ENA-----dvITKVTL-APEM----VPAEVISKLANAGIVVSAGH---------------  178
ident                   |               |  |                      
Sbjct RWRrlerpglRLGLSPhTPFTvshrLMRLLSDYAAGEGLPLQIHVaehptelemfrtggg  218
DSSP  HHHlllllleEEEEEElLLLLllhhHHHHHHHHHHHHLLLLEEEElllhhhhhhhhhlll


DSSP  --------------------------lLLLHHHHH-HHHHhLEEEELLLLllLLLLllll
Query --------------------------sNATLKEAK-AGFRaGITFATHLYnaMPYItgre  211
ident                                                |            
Sbjct plwdnrmpalyphtlaevigrepgpdlTPVRYLDElGVLA-ARPTLVHMV--NVTP----  271
DSSP  llhhhllhhhllllhhhhhllllllllLHHHHHHHhLLHH-HLLEEEELL--LLLH----


DSSP  lhHHHHHHHLlLLEEEEELL----lLLLLhhHHHHHHHHHHhHEEEELLLLlLLLL-LHH
Query pgLAGAILDEaDIYCGIIAD----gLHVDyaNIRNAKRLKGdKLCLVTDATsGSSL-TMI  266
ident                                              | ||           
Sbjct -dDIARVARA-GCAVVTCPRsnhhlECGT-fDWPAFAAAGV-EVALGTDSVaSGETlNVR  327
DSSP  -hHHHHHHHH-LLLEEELHHhhhhlLLLL-lLHHHHHHLLL-LEEELLLLHhHHLLlLLH


DSSP  HHHHHHHHHHL-LLHHHHHHHHLHHHHHHLLlllllLLLLL--lllllEEEElllllEEE
Query EGVRNLVEHCG-IALDEVLRMATLYPARAIGvekrlGTLAA--gkvanLTAFtpdfkITK  323
ident | |                | |     |  |                             
Sbjct EEVTFARQLYPgLDPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRW-----ELS  377
DSSP  HHHHHHHHHLLlLLHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLH-----HHL


DSSP  Eeelleeeeel
Query Tivngnevvtq  334
ident            
Sbjct R--------dl  380
DSSP  L--------ll


No 28: Query=1yrrB Sbjct=2y1hB Z-score=16.2

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                     |  |    
Sbjct --------------------------------------------------GVGLVDCHCH   10
DSSP  --------------------------------------------------LLLEEEEEEL


DSSP  EelleeLLLLlllllhHHHHHHHHHHHLLLEEEEEEEELLLLhhHHHHHHHHHHHHhhhl
Query GcggvqFNDTaeavsvETLEIMQKANEKSGCTNYLPTLITTSdeLMKQGVRVMREYlakh  120
ident                   |        |                           |    
Sbjct L-----SAPD----fdRDLDDVLEKAKKANVVALVAVAEHSG--EFEKIMQLSERY----   55
DSSP  L-----LLHH----hlLLHHHHHHHHHHLLEEEEEELLLLHH--HHHHHHHHHHHL----


DSSP  LLLLlLEEEELLLL------------lLHHHHHHHHLHHHEEEE-EELH-----------
Query PNQAlGLHLEGPWL------------nAALVDFLCENADVITKV-TLAP-----------  156
ident         |                             |                     
Sbjct NGFV-LPCLGVHPVqgldqrsvtlkdlDVALPIIENYKDRLLAIgEVGLdfsprfagtge  114
DSSP  LLLE-EEEELLLLEelllleellhhhhHHHHHHHHHHLLLLLEEeEEEEellllllllhh


DSSP  ----HHLL-HHHHHHHHHHLLEEEELLLLLLHHHHHHHHHHLE--EEELLLLllLLLLll
Query ----EMVP-AEVISKLANAGIVVSAGHSNATLKEAKAGFRAGI--TFATHLYnaMPYItg  209
ident             |         |      |           |                  
Sbjct qkeeQRQVlIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAekVLLHAFD--GRPS--  170
DSSP  hhhhHHHHhHHHHHHHHHHLLLEEEEEELLHHHHHHHHHHLLLllEEEELLL--LLHH--


DSSP  lllhHHHHHHHLlLLEEEEEL-LLLL-LLHHHHHHHHhhhHHHEEEELLLLlLLLL----
Query repgLAGAILDEaDIYCGIIA-DGLH-VDYANIRNAKrlkGDKLCLVTDATsGSSL----  263
ident      |            |                         || ||           
Sbjct ----VAMEGVRA-GYFFSIPPsIIRSgQKQKLVKQLP---LTSICLETDSP-ALGPekqv  221
DSSP  ----HHHHHHHL-LLEEEELHhHHLLhHHHHHHHHLL---HHHEEELLLLL-LLLLllll


DSSP  -----LHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLL-LLLLLlllllllllleeeell
Query -----TMIEGVRNLVEHCGIALDEVLRMATLYPARAIG-VEKRLgtlaagkvanltaftp  317
ident                   ||   ||    |             |                
Sbjct rnepwNISISAEYIAQVKGISVEEVIEVTTQNALKLFPkLRHLL----------------  265
DSSP  lllhhHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHLLlHHHHL----------------


DSSP  llleeeeeelleeeeel
Query dfkitktivngnevvtq  334
ident                  
Sbjct -----------------  265
DSSP  -----------------


No 29: Query=1yrrB Sbjct=4hk5D Z-score=16.0

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                    |   |    
Sbjct --------------------------------------------------TPVVVDIHTH   10
DSSP  --------------------------------------------------LLLLEEEEEE


DSSP  eelleeLLLLLLL-----------------------------------------------
Query gcggvqFNDTAEA-----------------------------------------------   73
ident                                                             
Sbjct ------MYPPSYIamlekrqtiplvrtfpqadeprlillsselaaldaaladpaaklpgr   64
DSSP  ------ELLHHHHhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllllllle


DSSP  ---llhHHHHHHHHHHHLLLEEEEEEEE---LLLL------HHHHHHHHHHHHHHHHHLL
Query ---vsvETLEIMQKANEKSGCTNYLPTL---ITTS------DELMKQGVRVMREYLAKHP  121
ident         |          |       |                            | | 
Sbjct plsthfASLAQKMHFMDTNGIRVSVISLanpWFDFlapdeaPGIADAVNAEFSDMCAQHV  124
DSSP  ellhhhLLHHHHHHHHHHLLLLEEEEEElllLLLLlllllhHHHHHHHHHHHHHHHHLLL


DSSP  LLLLLeEEELLL--llLHHHHHHHHLHHH--EEEEEELHHHL--------LHHHHHHHHH
Query NQALGlHLEGPW--lnAALVDFLCENADV--ITKVTLAPEMV--------PAEVISKLAN  169
ident           |      |                  |                |    | 
Sbjct GRLFF-FAALPLsapvDAVKASIERVKNLkyCRGIILGTSGLgkglddphLLPVFEAVAD  183
DSSP  LLEEE-EEELLLlllhHHHHHHHHHHHLLllEEEEEELLLLLllllllhhHHHHHHHHHH


DSSP  HLLEEEELL------------------------------lLLLHHHH--HHHHHH--LEE
Query AGIVVSAGH------------------------------sNATLKEA--KAGFRA--GIT  195
ident |   |                                    |                  
Sbjct AKLLVFLHPhyglpnevygprseeyghvlplalgfpmettIAVARMYmaGVFDHVrnLQM  243
DSSP  LLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhhhhHHHHHHHhlLHHHHLllLLE


DSSP  EELLLLL-lllLLLLLL----------------lhhhhhhhHLLL-LEEEEELLLllllH
Query FATHLYN-ampYITGRE----------------pglagailDEAD-IYCGIIADGlhvdY  237
ident    |            |                             ||            
Sbjct LLAHSGGtlpfLAGRIEscivhdghlvktgkvpkdrrtiwtVLKEqIYLDAVIYS----E  299
DSSP  EEHHHHLlhhhHHHHHHhhhhllhhhhhllllllllllhhhHHHHlEEEELLLLL----H


DSSP  HHHHHHHHHHH-HHEEEELLLLLL----------lLLLHhHHHHHHHhHHLLL-HHHHHH
Query ANIRNAKRLKG-DKLCLVTDATSG----------sSLTMiEGVRNLVeHCGIA-LDEVLR  285
ident      |    | | |   ||                                        
Sbjct VGLQAAIASSGaDRLMFGTDHPFFppieedvqgpwDSSR-LNAQAVI-KAVGEgSSDAAA  357
DSSP  HHHHHHHHHHLhHHEELLLLLLLLlllllllllllHHHH-HHHHHHH-HHHLLlLHHHHH


DSSP  HHLHHHHHHLLLLLLLlllllLLLLleeeellllleeeeeelleeeeel
Query MATLYPARAIGVEKRLgtlaaGKVAnltaftpdfkitktivngnevvtq  334
ident    |   |       |                                 
Sbjct VMGLNAVRVLSLKAEL-----EHHH---------------------hhh  380
DSSP  HHLHHHHHHLLLHHHH-----HHHH---------------------hhl


No 30: Query=1yrrB Sbjct=4ofcA Z-score=16.0

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                       ||    
Sbjct ----------------------------------------------------MKIDIHSH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  ---------------------------------------eeLLEElllllllllhHHHHH
Query ---------------------------------------gcGGVQfndtaeavsvETLEI   81
ident                                                           | 
Sbjct ilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvRENC----------WDPEV   58
DSSP  llllllllhhhhhllllleeeeeeelleeeeeelleeeeeeEHHH----------LLHHH


DSSP  HHHHHHLLLEEEEEEEE---LLLL-------HHHHHHHHHHHHHHHHHLLLLLLLeEEEL
Query MQKANEKSGCTNYLPTL---ITTS-------DELMKQGVRVMREYLAKHPNQALGlHLEG  131
ident         | |                      |               |    |     
Sbjct RIREMDQKGVTVQALSTvpvMFSYwakpedtLNLCQLLNNDLASTVVSYPRRFVG-LGTL  117
DSSP  HHHHHHHHLLLEEEEELlhhHHLLlllhhhhHHHHHHHHHHHHHHHHHLLLLEEE-EELL


DSSP  LL-llLHHHHHHHHLH--HHEEEEEEL-------HHHL-LHHHHHHHHHHLLEEEELL--
Query PW-lnAALVDFLCENA--DVITKVTLA-------PEMV-PAEVISKLANAGIVVSAGH--  178
ident |       |              |                  |                 
Sbjct PMqapELAVKEMERCVkeLGFPGVQIGthvnewdLNAQeLFPVYAAAERLKCSLFVHPwd  177
DSSP  LLllhHHHHHHHHHHHhlLLLLEEEEEleelleeLLLHhHHHHHHHHHHHLLEEEEELll


DSSP  ---------------------LLLLHHHHH--HHHHH---LEEEELLLLL-lllLLLLLL
Query ---------------------SNATLKEAK--AGFRA---GITFATHLYN-ampYITGRE  211
ident                                   |           |             
Sbjct mqmdgrmakywlpwlvgmpaeTTIAICSMImgGVFEKfpkLKVCFAHGGGafpfTVGRIS  237
DSSP  llllhhhhlllhhhhlhhhhhHHHHHHHHHllLHHHHlllLLEEELHHHLlhhhHHHHHH


DSSP  ------------lhhhhhhhHLLLLEEEEEllllLLLHHHHHHHHHHHH-HHEEEELLLL
Query ------------pglagailDEADIYCGIIadglHVDYANIRNAKRLKG-DKLCLVTDAT  258
ident                          |          |           | ||  | ||  
Sbjct hgfsmrpdlcaqdnpmnpkkYLGSFYTDAL----VHDPLSLKLLTDVIGkDKVILGTDYP  293
DSSP  hhhhhlhhhhlllllllhhhHLLLLEEELL----LLLHHHHHHHHHHHLlLLEELLLLLL


DSSP  -LLLLLLHHHHHHHHHhhhLLLHHHHHHHHLHHHHHHLLLLLLLlllllllllleeeell
Query -SGSSLTMIEGVRNLVehcGIALDEVLRMATLYPARAIGVEKRLgtlaagkvanltaftp  317
ident      |                                | |                   
Sbjct fPLGELEPGKLIESME---EFDEETKNKLKAGNALAFLGLERKQ----------------  334
DSSP  lLLLLLLLLHHHHHLL---LLLHHHHHHHHLHHHHHHHLLLHHH----------------


DSSP  llleeeeeelleeeeel
Query dfkitktivngnevvtq  334
ident                  
Sbjct ----------------f  335
DSSP  ----------------l


No 31: Query=1yrrB Sbjct=1a4mA Z-score=15.8

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                             
Sbjct ----------------------------------------------tpafNKPKVELHVH   14
DSSP  ----------------------------------------------llllLLLEEEEEEE


DSSP  --EELL--------------------------------------------eellLLLL--
Query --GCGG--------------------------------------------vqfnDTAE--   72
ident   |                                                         
Sbjct ldGAIKpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympvIAGCre   74
DSSP  hhHLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhHLLLhh


DSSP  LLLHhHHHHHHHHHHLLLEEEEEEEELLLL--------------------HHHHHHHHHH
Query AVSVeTLEIMQKANEKSGCTNYLPTLITTS--------------------DELMKQGVRV  112
ident |              | |                                |         
Sbjct AIKR-IAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqtegdvtpDDVVDLVNQG  133
DSSP  HHHH-HHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhlllllllhHHHHHHHHHH


DSSP  HHHHHHHLLLLLlLEEEElLLLL-----LHHHHHHHHLHH-HEEEEEE-------lhHHL
Query MREYLAKHPNQAlGLHLEgPWLN-----AALVDFLCENAD-VITKVTL-------apEMV  159
ident   |             |                              |            
Sbjct LQEGEQAFGIKV-RSILC-CMRHqpswsLEVLELCKKYNQkTVVAMDLagdetiegsSLF  191
DSSP  HHHHHHHHLLEE-EEEEE-EELLlhhhhHHHHHHHHHLLLlLEEEEEEelllllllhHHL


DSSP  L--HHHHHHHHHHLLEEEEL-lllLLHHHHHHHHH-HLEEEELLLLlllLLLLllllhhH
Query P--AEVISKLANAGIVVSAG-hsnATLKEAKAGFR-AGITFATHLYnamPYITgrepglA  215
ident |   |        ||                            | |              
Sbjct PghVEAYEGAVKNGIHRTVHagevGSPEVVREAVDiLKTERVGHGYhtiEDEA-----lY  246
DSSP  HhhHHHHHHHHHHLLEEEEEelllLLHHHHHHHHHlLLLLEEEELHhhhHLHH-----hH


DSSP  HHHHHlLLLEEEEEL-LLLL------llHHHHHHHHHHhHHHEEEELLLLlLLLLLHHHH
Query GAILDeADIYCGIIA-DGLH------vdYANIRNAKRLkGDKLCLVTDATsGSSLTMIEG  268
ident    |                               |        | ||       |    
Sbjct NRLLK-ENMHFEVCPwSSYLtgawdpktTHAVVRFKND-KANYSLNTDDPlIFKSTLDTD  304
DSSP  HHHHH-LLLEEEELHhHHHHllllllllLLHHHHHHHL-LLLEEELLLLLlLLLLLHHHH


DSSP  HHHHHHHHLLLHHHHHHHhLHHHHHHLLL----LLLLL--LLLLllllleeeelllllee
Query VRNLVEHCGIALDEVLRMaTLYPARAIGV----EKRLG--TLAAgkvanltaftpdfkit  322
ident         |    |  |      |          | |                       
Sbjct YQMTKKDMGFTEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE----------------  347
DSSP  HHHHHHLLLLLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH----------------


DSSP  eeeelleeeeel
Query ktivngnevvtq  334
ident             
Sbjct ----------yq  349
DSSP  ----------ll


No 32: Query=1yrrB Sbjct=2dvtA Z-score=15.5

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                     |       
Sbjct --------------------------------------------------MQGKVALEEH   10
DSSP  --------------------------------------------------LLLEEEEEEE


DSSP  eelleeLLLLLLL----------------llhHHHHH-HHHHHHLLLEEEEEEEE--LLL
Query gcggvqFNDTAEA----------------vsvETLEI-MQKANEKSGCTNYLPTL--ITT  101
ident       |                                 |     |       |     
Sbjct ------FAIPETLqdsagfvpgdywkelqhrlLDIQDtRLKLMDAHGIETMILSLnaPAV   64
DSSP  ------ELLHHHHhhhlllllllhhhhhhhhhHLLLLhHHHHHHHLLEEEEEEEEllLHH


DSSP  L--------HHHHHHHHHHHHHHHHHLLLLLLlEEEELLL-llLHHHHHHHHLH--HHEE
Query S--------DELMKQGVRVMREYLAKHPNQALgLHLEGPW-lnAALVDFLCENA--DVIT  150
ident           |       |  |  || |   |      |     |    |          
Sbjct QaipdrrkaIEIARRANDVLAEECAKRPDRFL-AFAALPLqdpDAATEELQRCVndLGFV  123
DSSP  HhlllhhhhHHHHHHHHHHHHHHHHHLLLLEE-EEELLLLllhHHHHHHHHHHHhlLLLL


DSSP  EEEE-----------lhHHLL---HHHHHHHHHHLLEEEELL------------------
Query KVTL-----------apEMVP---AEVISKLANAGIVVSAGH------------------  178
ident                                                             
Sbjct GALVngfsqegdgqtplYYDLpqyRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwll  183
DSSP  EEEEellllllllllllLLLLhhhHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhl


DSSP  ---------LLLLhHHHHH-----hhHHLEEEELLLLL-lllLLLLLL------------
Query ---------SNATlKEAKA-----gfRAGITFATHLYN-ampYITGRE------------  211
ident                   |               |                         
Sbjct gptwafaqeTAVHaLRLMAsglfdehPRLNIILGHMGEglpyMMWRIDhrnawvklppry  243
DSSP  hhhlhhhhhHHHHhHHHHHllhhhhlLLLLEEELHHHLlhhhHHHHHHhlllllllllll


DSSP  lhhhhhhhHLLL-LEEEE-ELLLllllHHHHHHHHHHHH-HHEEEELLLLlLLLLL-HHH
Query pglagailDEAD-IYCGI-IADGlhvdYANIRNAKRLKG-DKLCLVTDATsGSSLT-MIE  267
ident                                  |    | |     ||            
Sbjct pakrrfmdYFNEnFHITTsGNFR----TQTLIDAILEIGaDRILFSTDWP-FENIDhASD  298
DSSP  lllllhhhHHHHhEEEELlLLLL----HHHHHHHHLLLLhHHEELLLLLL-LLLHHhHHH


DSSP  HHHHHhhhhLLLHHHHHHHHLHHHHHHLLLLllllllllllllleeeellllleeeeeel
Query GVRNLvehcGIALDEVLRMATLYPARAIGVEkrlgtlaagkvanltaftpdfkitktivn  327
ident           ||             |                                  
Sbjct WFNAT----SIAEADRVKIGRTNARRLFKLD-----------------------------  325
DSSP  HHHHL----LLLHHHHHHHHLHHHHHHLLLL-----------------------------


DSSP  leeeeel
Query gnevvtq  334
ident        
Sbjct -------  325
DSSP  -------


No 33: Query=1yrrB Sbjct=1itqA Z-score=15.4

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleEEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaiLSPGFIDVQLN   60
ident                                                       ||    
Sbjct --------------------------------------dffrdeaerimRDSPVIDGHND   22
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL


DSSP  eelleELLL--LLLLL----------lhhhhhHHHHHHHLLLEEEEEEEELLL-------
Query gcggvQFND--TAEAV----------svetleIMQKANEKSGCTNYLPTLITT-------  101
ident                                                    |        
Sbjct -----LPWQllDMFNNrlqderanlttlagthTNIPKLRAGFVGGQFWSVYTPcdtqnkd   77
DSSP  -----HHHHhhHHHLLllllhhhlllllllllLLHHHHHHLLEEEEEEEELLLhhhllll


DSSP  LHHHHHHHHHHHHHHHHHLL-------------------LLLLLEEEELLLllLHHHHHH
Query SDELMKQGVRVMREYLAKHP-------------------NQALGLHLEGPWlnAALVDFL  142
ident           |        |                     |     ||          |
Sbjct AVRRTLEQMDVVHRMCRMYPetflyvtssagirqafregKVASLIGVEGGHsiDSSLGVL  137
DSSP  HHHHHHHHHHHHHHHHHHLLlleeelllhhhhhhhhhllLEEEEEEEELHHhlLLLHHHH


DSSP  HHLH-HHEEEEEEL----------------------hHHLL--HHHHHHHHHHLLEEEEL
Query CENA-DVITKVTLA----------------------pEMVP--AEVISKLANAGIVVSAG  177
ident            ||                           |    |   |   |      
Sbjct RALYqLGMRYLTLThscntpwadnwlvdtgdsepqsqGLSPfgQRVVKELNRLGVLIDLA  197
DSSP  HHHHhLLEEEEELLllllllllllhhhllllllllllLLLHhhHHHHHHHHHHLLEEELL


DSSP  LLLLlhHHHHHHHHHL--eEEELLLL-------LLLLlllllllhhHHHHHHLL---LLE
Query HSNAtlKEAKAGFRAG--iTFATHLY-------NAMPyitgrepglAGAILDEA---DIY  225
ident |        ||            |                          |      |  
Sbjct HVSV--ATMKATLQLSrapVIFSHSSaysvcasRRNV---------PDDVLRLVkqtDSL  246
DSSP  LLLH--HHHHHHHHHLlllLEELLLLlllllllLLLL---------LHHHHHHHhhhLLE


DSSP  EEEEllLLLL----------LHHHHHHHHHHHH-HHEEEELLLL--LLLL------lLHH
Query CGIIadGLHV----------DYANIRNAKRLKG-DKLCLVTDAT--SGSS------lTMI  266
ident                             |   |        |                  
Sbjct VMVNfyNNYIsctnkanlsqVADHLDHIKEVAGaRAVGFGGDFDgvPRVPegledvsKYP  306
DSSP  EEELllHHHHlllllllhhhHHHHHHHHHHHLLhHHEEELLLLLllLLLLlllllllLHH


DSSP  HHHHHHHHHhLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee
Query EGVRNLVEHcGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
ident      |         ||         |                                 
Sbjct DLIAELLRR-NWTEAEVKGALADNLLRVFE----aveqasnltqapeeepipldqlggsc  361
DSSP  HHHHHHHHL-LLLHHHHHHHHLHHHHHHHH----hhhhllllllllllllllhhhlllll


DSSP  lleeeeel
Query ngnevvtq  334
ident         
Sbjct rthygyss  369
DSSP  llllllll


No 34: Query=1yrrB Sbjct=2ffiA Z-score=15.4

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
ident                                                       ||    
Sbjct -------------------------------------------------lhLTAIDSHAH   11
DSSP  -------------------------------------------------llLLLEELLLL


DSSP  eelleeLLLLLLL---------llhhHHHHHHHHHHLLLEEEEEEEEL--LLLHhhHHHH
Query gcggvqFNDTAEA---------vsveTLEIMQKANEKSGCTNYLPTLI--TTSDelMKQG  109
ident                            |          |              |      
Sbjct ------VFSRGLNlasqrryapnydaPLGDYLGQLRAHGFSHGVLVQPsfLGTD--NRYL   63
DSSP  ------LLLHHHHhhlllllllllllLHHHHHHHHHHLLLLEELLLLLhhHLLL--LHHH


DSSP  HHHHHHHHhhllllLLLEEEELLlllLHHHHHHHHLHH-HEEEEEE-----lhHHLL---
Query VRVMREYLakhpnqALGLHLEGPwlnAALVDFLCENAD-VITKVTL-----apEMVP---  160
ident                |                | | |      | |              
Sbjct LSALQTVP-----gQLRGVVXLE--rDVEQATLAEXARlGVRGVRLnlxgqdxPDLTgaq  116
DSSP  HHHHHHLL-----lLLLLLLLLL--lLLLHHHHHHHHLlLLLEEELlllllllLLLLlll


DSSP  -HHHHHHHHHHLLEEEELLL--LLLHhHHHHHHHH-LEEEELLLLLL--------lLLLL
Query -AEVISKLANAGIVVSAGHS--NATLkEAKAGFRA-GITFATHLYNA--------mPYIT  208
ident            |  |               |           |                 
Sbjct wRPLLERIGEQGWHVELHRQvaDIPV-LVRALQPYgLDIVIDHFGRPdarrglgqpGFAE  175
DSSP  lHHHHHHHHHHLLEEEELLLllLHHH-HHHHHLLLlLLEEELHHHLLlllllllllLHHH


DSSP  llllhHHHHhhHLLL-LEEEEElLLLL---------LLHHHHHHHHHHHH-HHEEEELL-
Query grepgLAGAilDEAD-IYCGIIaDGLH---------VDYANIRNAKRLKG-DKLCLVTD-  256
ident      |                                           |   |    | 
Sbjct -----LLTL--SGRGkVWVKVSgIYRLqgspeenlaFARQALCALEAHYGaERLXWGSDw  228
DSSP  -----HLLL--LLLLlEEEEEElHHHLlllhhhhhhHHHHHHHHHHHHLLhHHEEEELLl


DSSP  -LLLL---LLLL-HHHHHHHHHhhhlLLHHHHHHHHLHHHHHHLLLLLLlllllllllll
Query -ATSG---SSLT-MIEGVRNLVehcgIALDEVLRMATLYPARAIGVEKRlgtlaagkvan  311
ident   |      |     |    |                       | |             
Sbjct pHTQHeseVSFGsAVEQFEALG----CSAQLRQALLLDTARALFGFELE-----------  273
DSSP  lLLLLlllLLHHhHHHHHHHHL----LLHHHHHHHHLHHHHHHLLLLLL-----------


DSSP  eeeellllleeeeeelleeeeel
Query ltaftpdfkitktivngnevvtq  334
ident                        
Sbjct -----------------------  273
DSSP  -----------------------


No 35: Query=1yrrB Sbjct=3pnuA Z-score=14.9

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelLLLEEEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslNGAILSPGFIDVQLN   60
ident                                                |       |  | 
Sbjct ---------------------------------------enlyfqSNAMKLKNPLDMHLH   21
DSSP  ---------------------------------------llllllLLLEEEELLEEEEEL


DSSP  EelleellllllllLHHHHHHHHHHHHLlLEEEEEEEEL---LLLHhhHHHHHHHHHHHH
Query GcggvqfndtaeavSVETLEIMQKANEKsGCTNYLPTLI---TTSDelMKQGVRVMREYL  117
ident                   ||                                       |
Sbjct L------------rDNQMLELIAPLSAR-DFCAAVIMPNlipPLCN--LEDLKAYKMRIL   66
DSSP  L------------lLHHHHHHHHHHHHL-LLLEEEELLLlllLLLL--HHHHHHHHHHHH


DSSP  H--hllLLLLLEEEELLlllLHHHHHHHHLHHHEEEEEEL-------------hHHLL--
Query A--khpNQALGLHLEGPwlnAALVDFLCENADVITKVTLA-------------pEMVP--  160
ident       |      |           ||    | |    |                     
Sbjct KackdeNFTPLMTLFFK---NYDEKFLYSAKDEIFGIXLYpagittnsnggvssFDIEyl  123
DSSP  HhhlllLLEEEEEEELL---LLLHHHHHHHLLLLLEEEELllllllllllllllLLHHhh


DSSP  HHHHHHHHHHLLEEEELLLL---------lLHHHHHHHHHH---LEEEELLLLlllllll
Query AEVISKLANAGIVVSAGHSN---------aTLKEAKAGFRA---GITFATHLYnampyit  208
ident            |                    |                 |         
Sbjct KPTLEAMSDLNIPLLVHGETndfvmdresnFAKIYEKLAKHfprLKIVMEHIT-------  176
DSSP  HHHHHHHHHLLLLEEELLLLlllhhhllhhHHHHHHHHHHHlllLLEEELLLL-------


DSSP  llllHHHHHHHHLLLLEEEEELLllLLLH--------------------------HHHHH
Query grepGLAGAILDEADIYCGIIADglHVDY--------------------------ANIRN  242
ident      |     |    |  |     |                                  
Sbjct --tkTLCELLKDYENLYATITLH--HLIItlddviggkmnphlfckpiakryedkEALCE  232
DSSP  --lhHHHHHHHHLLLEEEEELLH--HHLLlhhhhhlllllhhhllllllllhhhhHHHHH


DSSP  HHhhhHHHEEEELLLL-------LLLLLL--HHHHHHHHHHHhLLLHHHHHHHHLHHHHH
Query AKrlkGDKLCLVTDAT-------SGSSLT--MIEGVRNLVEHcGIALDEVLRMATLYPAR  293
ident        |     |          |             |                     
Sbjct LAfsgYEKVMFGSDSAphpkgcaAGVFSApvILPVLAELFKQ-NSSEENLQKFLSDNTCK  291
DSSP  HHhllLLLEEELLLLLlllllllLLLLLHhhHHHHHHHHHHH-HLLHHHHHHHHLHHHHH


DSSP  HlLLLLLlllllllLLLLEEEELLL-------------------------LLEEEeeell
Query AiGVEKRlgtlaagKVANLTAFTPD-------------------------FKITKtivng  328
ident      |        |                                   |         
Sbjct I-YDLKF-------KEDKILTLEEKewqvpnvyedkynqvvpymageilkFQLKH-----  338
DSSP  H-HLLLL-------LLLLEEEEELLleelllleelllleellllllleelLEELL-----


DSSP  eeeeel
Query nevvtq  334
ident       
Sbjct ------  338
DSSP  ------


No 36: Query=1yrrB Sbjct=4mupB Z-score=14.8

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                     |  | |  
Sbjct ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
DSSP  ------------------------------------llllllllllllllLLLLEELLLL


DSSP  eelleELLLLLL---------lllhHHHHHHHHHHHLLLEEEEEEEEL--LLLHhhHHHH
Query gcggvQFNDTAE---------avsvETLEIMQKANEKSGCTNYLPTLI--TTSDelMKQG  109
ident                             |         |      |       |      
Sbjct -----MYLPGYPalpggpglppgalPGPEDYRRLMQWLGIDRVIITQGnaHQRD--NGNT   77
DSSP  -----LLLLLLLlllllllllllllLLHHHHHHHHHHHLLLEEEEELLhhHLLL--LHHH


DSSP  HHHHHHhhhhLLLLlLLEEEelllllLHHHH-HHHHLH-HHEEEEEEL-------hHHLL
Query VRVMREylakHPNQaLGLHLegpwlnAALVD-FLCENA-DVITKVTLA-------pEMVP  160
ident      |                    |                                 
Sbjct LACVAE----MGEA-AHAVV---iidATTTEkDMEKLTaAGTVGARIMdlpggavnLSEL  129
DSSP  HHHHHH----HHHH-EEEEE---lllLLLLHhHHHHHHhLLEEEEEEEllllllllHHHH


DSSP  HHHHHHHHHHLLEEEELLL----llLHHHHHHHhhHLEEEELLLLLllLLLL-LLLLhhh
Query AEVISKLANAGIVVSAGHS----naTLKEAKAGfrAGITFATHLYNamPYIT-GREPgla  215
ident   |      |   |            |               |       |         
Sbjct DAVDERAHAADWMVAVQFDgnglldHLPRLQKI--RSRWVFDHHGKffKGIRtDGPE--m  185
DSSP  HHHHHHHHHLLLEEEEELLhhhhhhHHHHHHLL--LLEEEELHHHHllLLLLlLLHH--h


DSSP  HHHHHLL---LLEEEEEllLLLL---------LHHHHHHHHHHHHHHEEEELLLL-----
Query GAILDEA---DIYCGIIadGLHV---------DYANIRNAKRLKGDKLCLVTDAT-----  258
ident  | |                              |  |             |        
Sbjct AALLKLIdrgNLWFKFA-gVYESsrkswpyadVAAFSRVIAAHAPERIVWGTNWPhnsvr  244
DSSP  HHHHHHHhhlLEEEEEL-lHHHLlllllllhhHHHHHHHHHHHLHHHEEELLLLLlllll


DSSP  ---LLLLLLhhHHHHHHHhhHLLLHHHHHHHHLHHHHHHLLLLLLllllllllllleeee
Query ---SGSSLTmiEGVRNLVehCGIALDEVLRMATLYPARAIGVEKRlgtlaagkvanltaf  315
ident                 |            |     |                        
Sbjct etaAYPDDA-rLAELTLG--WLPDEAARHRALVENPEALFKLSPV---------------  286
DSSP  lhhHLLLHH-hHHHHHHL--LLLLHHHHHHHHLHHHHHHHLLLLL---------------


DSSP  llllleeeeeelleeeeel
Query tpdfkitktivngnevvtq  334
ident                    
Sbjct -------------------  286
DSSP  -------------------


No 37: Query=1yrrB Sbjct=4qrnA Z-score=14.5

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeellllEEEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaILSPGFIDVQLN   60
ident                                                       |     
Sbjct --------------------------------------smtqdlktggEQGYLRIATEEA   22
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE


DSSP  eelleeLLLLLLL-----------------------------------llhHHHH-HHHH
Query gcggvqFNDTAEA-----------------------------------vsvETLE-IMQK   84
ident       |                                              |      
Sbjct ------FATREIIdvylrmirdgtadkgmvslwgfyaqspseratqilerlLDLGeRRIA   76
DSSP  ------ELLHHHHhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhhHLLLhHHHH


DSSP  HHHLLLEEEEEEEE--LLLL--------HHHHHHHHHHHHHHHHHLLLLLLLeEEELLL-
Query ANEKSGCTNYLPTL--ITTS--------DELMKQGVRVMREYLAKHPNQALGlHLEGPW-  133
ident      |       |                |             | |    |        
Sbjct DMDATGIDKAILALtsPGVQplhdldeaRTLATRANDTLADACQKYPDRFIG-MGTVAPq  135
DSSP  HHHHLLLLEEEEEEllLLLLllllhhhhHHHHHHHHHHHHHHHHHLLLLEEE-LLLLLLl


DSSP  llLHHHHHHHHLH--HHEEEEEE-----lhHHLL---HHHHHHHHHHLLEEEEL------
Query lnAALVDFLCENA--DVITKVTL-----apEMVP---AEVISKLANAGIVVSAG------  177
ident             |                              |                
Sbjct dpEWSAREIHRGAreLGFKGIQInshtqgrYLDEeffDPIFRALVEVDQPLYIHpatspd  195
DSSP  lhHHHHHHHHHHHhlLLLLLEEElllllllLLLLhhhHHHHHHHHHHLLLEEELllllll


DSSP  ---------------------LLLLlHHHHH-HHHH---hLEEEELLLLL-lllLLLLLL
Query ---------------------HSNAtLKEAK-AGFR---aGITFATHLYN-ampYITGRE  211
ident                           |       |           |             
Sbjct smidpmleagldgaifgfgveTGMHlLRLITiGIFDkypsLQIMVGHMGEalpyWLYRLD  255
DSSP  lllhhhhhhlllllllhhhhhHHHHhHHHHHhLHHHhlllLLEEELHHHHlhhhHHHHHH


DSSP  ----------------lhhhhhhhHLLL-LEEEE-ELLLllllHHHHHHHHHHHH-HHEE
Query ----------------pglagailDEAD-IYCGI-IADGlhvdYANIRNAKRLKG-DKLC  252
ident                                               |       | |   
Sbjct ymhqagvrsqryermkplkktiegYLKSnVLVTNsGVAW----EPAIKFCQQVMGeDRVM  311
DSSP  hhhhhhhhlllllllllllllhhhHHHHlEEEELlLLLL----HHHHHHHHHHHLhHHEE


DSSP  EELLLLlLLLLL-hHHHHHHHhhhhLLLHHHHHHHHLHHHHHHLLLllllllllllllll
Query LVTDATsGSSLT-mIEGVRNLvehcGIALDEVLRMATLYPARAIGVekrlgtlaagkvan  311
ident    |                                                        
Sbjct YAMDYP-YQYVAdeVRAMDAM----DMSAQTKKKFFQTNAEKWFKL--------------  352
DSSP  LLLLLL-LLLLHhhHHHHHLL----LLLHHHHHHHHLHHHHHHLLL--------------


DSSP  eeeellllleeeeeelleeeeel
Query ltaftpdfkitktivngnevvtq  334
ident                        
Sbjct -----------------------  352
DSSP  -----------------------


No 38: Query=1yrrB Sbjct=3irsA Z-score=14.4

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
ident                                                       ||  | 
Sbjct ---------------------------------------------------LKIIDFRLR    9
DSSP  ---------------------------------------------------LLLEELLLL


DSSP  EelleelLLLL---------------------llllhhHHHHHHHHHHLLLEEEEEEEEL
Query GcggvqfNDTA---------------------eavsveTLEIMQKANEKSGCTNYLPTLI   99
ident           |                            || |       |         
Sbjct P--pamgFLNAriytrpdirnrftrqlgfepapsaeekSLELMFEEMAAAGIEQGVCVGR   67
DSSP  L--llhhHHHLhhhhlhhhhhhhhhhhlllllhhhhhlLHHHHHHHHHHLLLLEEEEELL


DSSP  LLLhhhhhhHHHHHHHHHHHLLLLLLlEEEELL-lllLHHHHHHHHLH-HHEEEEEEL--
Query TTSdelmkqGVRVMREYLAKHPNQALgLHLEGP-wlnAALVDFLCENA-DVITKVTLA--  155
ident   |                  |                       |     |  | |   
Sbjct NSS-vlgsvSNADVAAVAKAYPDKFH-PVGSIEaatrKEAMAQMQEILdLGIRIVNLEpg  125
DSSP  EEL-lleelLHHHHHHHHHHLLLLEE-EEEELLlllhHHHHHHHHHHHhLLLLLEEELhh


DSSP  -------HHHL-LHHHHHHHHHHLLEEEELL--------lLLLHHHHHHHHHH---LEEE
Query -------PEMV-PAEVISKLANAGIVVSAGH--------sNATLKEAKAGFRA---GITF  196
ident                        || |                                 
Sbjct vwatpmhVDDRrLYPLYAFCEDNGIPVIMMTggnagpditYTNPEHIDRVLGDfpdLTVV  185
DSSP  hllllllLLLHhHHHHHHHHHHLLLLEEEELlllllllhhHHLHHHHHHHHHHlllLLEE


DSSP  ELLLLLlLLLLlllllhhHHHHHHLLLLEEEEE--LLLLllLHHHHHHHH-HHHHHHEEE
Query ATHLYNaMPYItgrepglAGAILDEADIYCGII--ADGLhvDYANIRNAK-RLKGDKLCL  253
ident   |                         |         |    |    |      |    
Sbjct SSHGNW-PWVQ-----eiIHVAFRRPNLYLSPDmyLYNL-pGHADFIQAAnSFLADRMLF  238
DSSP  EEHHHL-LLHH-----hhHHHHHHLLLEEEELHhhHLLL-lLHHHHHHHHlLHHHHLLLL


DSSP  ELLLLllLLLL--HHHHHHHHhhhhLLLHHHHHHHHLHHHHHHLLLllllllllllllll
Query VTDATsgSSLT--MIEGVRNLvehcGIALDEVLRMATLYPARAIGVekrlgtlaagkvan  311
ident  |             |    |     |  |           |                  
Sbjct GTAYP--MCPLkeYTEWFLTL----PIKPDAMEKILHGNAERLLAQ--------------  278
DSSP  LLLLL--LLLHhhHHHHHHLL----LLLHHHHHHHHLHHHHHHHHH--------------


DSSP  eeeellllleeeeeelleeeeel
Query ltaftpdfkitktivngnevvtq  334
ident                        
Sbjct --------------------agr  281
DSSP  --------------------lll


No 39: Query=1yrrB Sbjct=2gwgA Z-score=14.2

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                       ||    
Sbjct ----------------------------------------------------XIIDIHGH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  eelleELLLLLLL----------------------------lLHHHHH-HHHHHHHLLLE
Query gcggvQFNDTAEA----------------------------vSVETLE-IMQKANEKSGC   91
ident                                                     |     | 
Sbjct -----YTTAPKALedwrnrqiagikdpsvxpkvselkisddeLQASIIeNQLKKXQERGS   63
DSSP  -----LLLLLHHHhhhhhhhhhhhhlhhhlllhhhllllhhhHHHHHHlLHHHHHHHHLL


DSSP  EEEEEEEL----llLHHHHHHHHHHHHHHHHHLLLLLLLeEEEL----llllLHHHHHHH
Query TNYLPTLI----ttSDELMKQGVRVMREYLAKHPNQALGlHLEG----pwlnAALVDFLC  143
ident               |                  |    |                   | 
Sbjct DLTVFSPRagdfnvSSTWAAICNELCYRVSQLFPDNFIG-AAXLpqspgvdpKTCIPELE  122
DSSP  LEEEEELLlllhhhHHHHHHHHHHHHHHHHHHLLLLEEE-EEELlllllllhHHHHHHHH


DSSP  HLH--HHEEEEEE------------lHHHL-LHHHHHHHHHHLLEEEELL----------
Query ENA--DVITKVTL------------aPEMV-PAEVISKLANAGIVVSAGH----------  178
ident             |                        |     |                
Sbjct KCVkeYGFVAINLnpdpsgghwtsppLTDRiWYPIYEKXVELEIPAXIHVstgahylnad  182
DSSP  HHHhlLLLLEEEElllllllllllllLLLHhHHHHHHHHHHHLLLEEELLllllhhhhhh


DSSP  ---lLLLH-HHHHHhHHHLEEEELLLLLLL----llLLLLL--lhhhhhhhHLLL-LEEE
Query ---sNATL-KEAKAgFRAGITFATHLYNAM----pyITGRE--pglagailDEAD-IYCG  227
ident                |        |   |         |                 |   
Sbjct ttafXQCVaGDLFKdFPELKFVIPHGGGAVpyhwgrFRGLAqexkkplledHVLNnIFFD  242
DSSP  hhhhHHHHhLLHHHhLLLLLEEELHHHLLLhhhhhhHHHHHhhlllllhhhHLLLlEEEE


DSSP  EELLLLlLLHHHHHHHHhhhHHHEEEELLL-LLLL---------LLLHHHHHHHHhhhHL
Query IIADGLhVDYANIRNAKrlkGDKLCLVTDA-TSGS---------SLTMIEGVRNLvehCG  277
ident                      |                                      
Sbjct TCVYHQpGIDLLNTVIP---VDNVLFASEXiGAVRgidprtgfyYDDTKRYIEAS---TI  296
DSSP  LLLLLHhHHHHHHHHLL---HHHEELLLLLlLLLLleelllleeLLLLHHHHHHL---LL


DSSP  LLHHHHHHHHLHHHHHHLL-LLLLLlllllLLLLleeeellllleeeeeelleeeeel
Query IALDEVLRMATLYPARAIG-VEKRLgtlaaGKVAnltaftpdfkitktivngnevvtq  334
ident     |          |        |                                 
Sbjct LTPEEKQQIYEGNARRVYPrLDAAL-----KAKG--------------------kleh  329
DSSP  LLHHHHHHHHLHHHHHHLHhHHHHH-----HHHH--------------------hhll


No 40: Query=1yrrB Sbjct=1bf6A Z-score=13.9

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
ident                                                     |       
Sbjct -----------------------------------------------sfdpTGYTLAHEH   13
DSSP  -----------------------------------------------llllLLEEEEEEL


DSSP  EelleeLLLL--------LLLLLHHHHHHHHHHHHLLLEEEEEEEELLLlhhhhhhHHHH
Query GcggvqFNDT--------AEAVSVETLEIMQKANEKSGCTNYLPTLITTsdelmkqGVRV  112
ident         |                            |  |                   
Sbjct L-----HIDLsgfknnvdCRLDQYAFICQEMNDLMTRGVRNVIEMTNRY----mgrNAQF   64
DSSP  L-----LEELhhhhllhhHEELLHHHHHHHHHHHHHLLEEEEEELLLHH----hllLHHH


DSSP  HHHHHHHLLlLLLLEEEeLLLLL------------LHHHHHHHHLH--------hHEEEE
Query MREYLAKHPnQALGLHLeGPWLN------------AALVDFLCENA--------dVITKV  152
ident |                 |                  |                      
Sbjct MLDVMRETG-INVVACT-GYYQDaffpehvatrsvQELAQEMVDEIeqgidgtelKAGII  122
DSSP  HHHHHHHHL-LEEEEEE-LLLLHhhlllhhhhllhHHHHHHHHHHHhllllllllLEEEE


DSSP  -EELH-------hHLLH-HHHHHHHH-HLLEEEELLLlllhhHHHHHHHHL--------e
Query -TLAP-------eMVPA-EVISKLAN-AGIVVSAGHSnatlkEAKAGFRAG--------i  194
ident                          |  |   |   |                       
Sbjct aEIGTsegkitplEEKVfIAAALAHNqTGRPISTHTS--fstMGLEQLALLqahgvdlsr  180
DSSP  eEEELllllllhhHHHHhHHHHHHHHhHLLLEEEELH--hhlLHHHHHHHHhhllllhhh


DSSP  EEELLLLLllllllllllhhHHHHHHLL--LLEEEE-ELLL----LLLL-HHHHHHHHHH
Query TFATHLYNampyitgrepglAGAILDEA--DIYCGI-IADG----LHVD-YANIRNAKRL  246
ident     |                  ||       |                  |        
Sbjct VTVGHCDL---------kdnLDNILKMIdlGAYVQFdTIGKnsyyPDEKrIAMLHALRDR  231
DSSP  EEELLLLL---------lllHHHHHHHHhlLLEEEElLLLLllllLHHHhHHHHHHHHHL


DSSP  -HHHHEEEELLLL---------llllLLHH-HHHHHHHHHhLLLHHHHHHHHLHHHHHHL
Query -KGDKLCLVTDAT---------sgssLTMI-EGVRNLVEHcGIALDEVLRMATLYPARAI  295
ident        |  | |                       |    |     |  |    |    
Sbjct gLLNRVMLSMDITrrshlkanggygyDYLLtTFIPQLRQS-GFSQADVDVMLRENPSQFF  290
DSSP  lLHHHEEELLLLLlhhhlhhhlllllLHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHL


DSSP  Lllllllllllllllleeeellllleeeeeelleeeeel
Query Gvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
ident                                        
Sbjct Q--------------------------------------  291
DSSP  L--------------------------------------


No 41: Query=1yrrB Sbjct=3gg7A Z-score=13.6

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                       ||    
Sbjct ----------------------------------------------------SLIDFHVH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  eelleELLLLllllLHHHHHHHHHHHhllleEEEEEEELLLLhhHHHHHHHHHHhhhhhL
Query gcggvQFNDTaeavSVETLEIMQKANeksgcTNYLPTLITTSdeLMKQGVRVMReylakH  120
ident                |                  |    |                    
Sbjct -----LDLYP---dPVAVARACEERQ-----LTVLSVTTTPA--AWRGTLALAA-----G   48
DSSP  -----HHHLL---lHHHHHHHHHHLL-----LEEEELLLLHH--HHHHHHHHHL-----L


DSSP  LLLLlLEEEELLLL-------lLHHHHHHHHLHhhEEEEEEL-------------hHHLL
Query PNQAlGLHLEGPWL-------nAALVDFLCENAdvITKVTLA-------------pEMVP  160
ident         |                 |                               | 
Sbjct RPHV-WTALGFHPEvvseraadLPWFDRYLPET--RFVGEVGldgspslrgtwtqqFAVF  105
DSSP  LLLE-EELLLLLHHhllllhhhLHHHHHHHHHL--LEEEEEEllllhhhhhhhhhhHHHH


DSSP  HHHHHHHHHH-LLEEEELLLLLLHHHHHHHHHH--LEEE-ELLLLlllLLLLllllhHHH
Query AEVISKLANA-GIVVSAGHSNATLKEAKAGFRA--GITF-ATHLYnamPYITgrepgLAG  216
ident            |   |     |               |             |        
Sbjct QHILRRCEDHgGRILSIHSRRAESEVLNCLEANprSGTPiLHWYS---GSVT-----ELR  157
DSSP  HHHHHHHHHLlLEEEEEELLLLHHHHHHHHHHLhhHEEEeEELLL---LLHH-----HHH


DSSP  HHHHLlLLEEEEELL--LLLLLHHHHHHHhhhHHHHEEEELLLLlLLLL--------LHH
Query AILDEaDIYCGIIAD--GLHVDYANIRNAkrlKGDKLCLVTDATsGSSL--------TMI  266
ident                        | ||       |     ||      |           
Sbjct RAISL-GCWFSVGPTmvRTQKGAALIRSM---PRDRVLTETDGP-FLELdgqaalpwDVK  212
DSSP  HHHHL-LLEEEELHHhhLLHHHHHHHHHL---LHHHEEELLLLL-LLEElleellhhHHH


DSSP  HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee
Query EGVRNLVEHCGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
ident   |  |     |   || |       |  |                              
Sbjct SVVEGLSKIWQIPASEVERIVKENVSRLLG------------------------------  242
DSSP  HHHHHHHHHHLLLHHHHHHHHHHHHHHHHH------------------------------


DSSP  lleeeeel
Query ngnevvtq  334
ident         
Sbjct -------t  243
DSSP  -------l


No 42: Query=1yrrB Sbjct=3qy6A Z-score=13.5

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeelEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgFIDVQLN   60
ident                                                       ||    
Sbjct -----------------------------------------------------MIDIHCH    7
DSSP  -----------------------------------------------------LEELLLL


DSSP  EelleELLLlllllLHHHHHHHHHHHHLLLEEEEEEEELLL---lhhHHHHHHHHHHHHH
Query GcggvQFNDtaeavSVETLEIMQKANEKSGCTNYLPTLITT---sdeLMKQGVRVMREYL  117
ident         |            |  |    |      |                       
Sbjct I---lPAMD-dgagDSADSIEMARAAVRQGIRTIIATPHHNngvyknEPAAVREAADQLN   63
DSSP  L---lLLLL-llllLHHHHHHHHHHHHHLLLLEEELLLEELllllllLHHHHHHHHHHHH


DSSP  HHLL----lLLLLEEEEllllllhhhhhhhhlhhheeeeEELHHhllhhHHHHHHHH---
Query AKHP----nQALGLHLEgpwlnaalvdflcenadvitkvTLAPEmvpaeVISKLANA---  170
ident                 |                                           
Sbjct KRLIkedipLHVLPGQE----------------------IRIYG-----EVEQDLAKrql   96
DSSP  HHHHhllllLEEELLLE----------------------EELLL-----LHHHHHHLlll


DSSP  -----LLEEEELLL-LLLHHHHHHHHHHL-----eEEELLLLLlLLLLlllllhhhHHHH
Query -----GIVVSAGHS-NATLKEAKAGFRAG-----iTFATHLYNaMPYItgrepglaGAIL  219
ident                      |   |             |       |            
Sbjct lslndTKYILIEFPfDHVPRYAEQLFYDLqlkgyiPVIAHPER-NREI----renpSLLY  151
DSSP  llhhhLLEEEEELLlLLLLLLHHHHHHHHhhllleEEEELHHH-LHHH----hhllHHHH


DSSP  HLL--LLEEEEE---LLLLL--lLHHHHHHHHHHHHhHEEEELLLL--LLLLLLHHHHHH
Query DEA--DIYCGII---ADGLH--vDYANIRNAKRLKGdKLCLVTDAT--SGSSLTMIEGVR  270
ident           |      |       |                 ||           |   
Sbjct HLVekGAASQITsgsLAGIFgkqLKAFSLRLVEANL-IHFVASDAHnvKTRNFHTQEALY  210
DSSP  HHHhlLLEEEEEhhhHLLLLlhhHHHHHHHHHHLLL-LLEEELLLLllLLLLLLHHHHHH


DSSP  HHHHhhLLLHHHHHHHhLHHHHHHLLLLllllllllllllleeeellllleeeeeellee
Query NLVEhcGIALDEVLRMaTLYPARAIGVEkrlgtlaagkvanltaftpdfkitktivngne  330
ident  |               |                                          
Sbjct VLEK--EFGSELPYML-TENAELLLRNQ------------------------tifrqppq  243
DSSP  HHHH--HHLLHHHHHH-HHHHHHHHLLL------------------------llllllll


DSSP  eeel
Query vvtq  334
ident     
Sbjct pvkr  247
DSSP  llll


No 43: Query=1yrrB Sbjct=4dziC Z-score=13.3

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeellllEEEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaILSPGFIDVQLN   60
ident                                                  |    |||   
Sbjct ------------------------------------------------ALNYRVIDVDNH   12
DSSP  ------------------------------------------------LLLLLEEEEEEE


DSSP  eelleeLLLLLL------------------------------------------------
Query gcggvqFNDTAE------------------------------------------------   72
ident                                                             
Sbjct ------YYEPLDsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpg   66
DSSP  ------LLLLLLlllllllhhhlllleeeeelllleeeeelleellllllllllleelll


DSSP  ---------------------------lllhHHHHHHHHHHHLLLEEEEEEEEL------
Query ---------------------------avsvETLEIMQKANEKSGCTNYLPTLI------   99
ident                                                             
Sbjct cldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPTfgcgve  126
DSSP  llhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELLhhhhhh


DSSP  -----------lLLHHHHHHHHHHHHhhhhhLLLLLlLEEEELLL-llLHHHHHHHHLH-
Query -----------tTSDELMKQGVRVMReylakHPNQAlGLHLEGPW-lnAALVDFLCENA-  146
ident                                                    |        
Sbjct ealkhdieatmaSVHAFNLWLDEDWG--fdrPDHRI-IAAPIVSLadpTRAVEEVDFVLa  183
DSSP  hhllllhhhhhhHHHHHHHHHHHHLL--lllLLLLE-EELLLLLLllhHHHHHHHHHHHh


DSSP  HHEEEEEELHHHL-------------LHHHHHHHHHHLLEEEELL---------------
Query DVITKVTLAPEMV-------------PAEVISKLANAGIVVSAGH---------------  178
ident      |   |  |                |   || ||  |                   
Sbjct RGAKLVLVRPAPVpglvkprslgdrsHDPVWARLAEAGVPVGFHLsdsgylhiaaawgga  243
DSSP  LLLLLEELLLLLLlllllllllllhhHHHHHHHHHHHLLLEEEELlllllhhhhhhllll


DSSP  ------------LLLL-HHHHH--HHHH---hLEEEELLLL-llllllLLLL--------
Query ------------SNAT-LKEAK--AGFR---aGITFATHLY-nampyiTGRE--------  211
ident                           |                       |         
Sbjct kdpldqvllddrAIHDtMASMIvhGVFTrhpkLKAVSIENGsyfvhrlIKRLkkaantqp  303
DSSP  llhhhhhhhllhHHHHhHHHHHhlLHHHhlllLLEEEELLLllhhhhhHHHHhhhhhhlh


DSSP  -lhhhhhhhHLLL-LEEEEEllllLLLHhhHHHHHHHHH-HHEEEELLL-LLLL-LLLHh
Query -pglagailDEAD-IYCGIIadglHVDYanIRNAKRLKG-DKLCLVTDA-TSGS-SLTMi  266
ident                           |        |  | ||     |            
Sbjct qyfpedpveQLRNnVWIAPY----YEDD--LPELARVIGvDKILFGSDWpHGEGlASPV-  356
DSSP  hhllllhhhHHHHhEEELLL----LLLL--HHHHHHHHLhHHLLLLLLLlLLLLlLLHH-


DSSP  HHHHHHHhhhLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee
Query EGVRNLVehcGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
ident      |    |                  |                              
Sbjct SFTAELK---GFSESDIRKIMRDNALDLLG------------------------------  383
DSSP  HHHHHHL---LLLHHHHHHHHLHHHHHHHL------------------------------


DSSP  lleeeeel
Query ngnevvtq  334
ident         
Sbjct ---vqvgs  388
DSSP  ---lllll


No 44: Query=1yrrB Sbjct=3k2gB Z-score=13.2

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                     |       
Sbjct -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL


DSSP  EelleeLLLL--------------------------------------lLLLLHHHHHHH
Query GcggvqFNDT--------------------------------------aEAVSVETLEIM   82
ident        ||                                                   
Sbjct L-----QNDCrcwwnppqeperqylaeapisieilselrqdpfvnkhniALDDLDLAIAE   90
DSSP  L-----LEELhhhllllllhhhhhhhhllllhhhhhhhhllhhhlllllEELLHHHHHHH


DSSP  HHHHHLLLEEEEEEEELLLlhhhhhhHHHHHHHHHHHLLlLLLLEEEeLLLLL-------
Query QKANEKSGCTNYLPTLITTsdelmkqGVRVMREYLAKHPnQALGLHLeGPWLN-------  135
ident  |     |                       |   |            |  |        
Sbjct VKQFAAVGGRSIVDPTCRG----igrDPVKLRRISAETG-VQVVXGA-GYYLAssxpeta  144
DSSP  HHHHHHLLLLEEEELLLLL----lllLHHHHHHHHHHHL-LEEEELL-LLLLHhhllhhh


DSSP  -----LHHHHHHHHLH--------hHEEE-EEELHH-----HLLH--HHHHHHHH-HLLE
Query -----AALVDFLCENA--------dVITK-VTLAPE-----MVPA--EVISKLAN-AGIV  173
ident          |     |          |                              |  
Sbjct arlsaDDIADEIVAEAlegtdgtdaRIGLiGEIGVSsdftaEEEKslRGAARAQVrTGLP  204
DSSP  hlllhHHHHHHHHHHHhllllllllLLLLeEEELLLllllhHHHHhhHHHHHHHHhHLLL


DSSP  EEELLLlllhHHHHHHHHHL--------eEEELLLLLllllllllllhhhHHHHHLL--L
Query VSAGHSnatlKEAKAGFRAG--------iTFATHLYNampyitgrepglaGAILDEA--D  223
ident             |                |   |                      |   
Sbjct LXVHLP-gwfRLAHRVLDLVeeegadlrhTVLCHXNP--------shxdpVYQATLAqrG  255
DSSP  EEELLL-lllLLHHHHHHHHhhllllhhhEEELLLHH--------hlllhHHHHHHHhhL


DSSP  LEEEE-ELLL------------LLLL-HHHHHHHHH-HHHHHEEEELLLL--------LL
Query IYCGI-IADG------------LHVD-YANIRNAKR-LKGDKLCLVTDAT--------SG  260
ident                               |         |   |  |           |
Sbjct AFLEFdXIGXdffyadqgvqcpSDDEvARAILGLADhGYLDRILLSHDVFvkxxltryGG  315
DSSP  LEEEElLLLLlleelllleellLHHHhHHHHHHHHHlLLHHHEEELLLLLlhhhlhhhLL


DSSP  LL--LLHHHHHHHHHHHhLLLHHHHHHHHLHHHHHHlLLLLlllllllllllleeeelll
Query SS--LTMIEGVRNLVEHcGIALDEVLRMATLYPARAiGVEKrlgtlaagkvanltaftpd  318
ident              |  | |             | |                         
Sbjct NGyaFVTKHFLPRLRRH-GLDDAALETLXVTNPRRV-FDAS-------------------  354
DSSP  LLllHHHHLHHHHHHHL-LLLHHHHHHHHLHHHHHH-HLLL-------------------


DSSP  lleeeeeelleeeeel
Query fkitktivngnevvtq  334
ident                 
Sbjct ------------iegh  358
DSSP  ------------llll


No 45: Query=1yrrB Sbjct=2ob3A Z-score=13.0

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                     ||      
Sbjct -------------------------------------drintvrgpitiseaGFTLTHEH   23
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL


DSSP  EelleELLL-LLLL----------llhHHHHHHHHHHHLLLEEEEEEEELLLlhhhhhhH
Query GcggvQFND-TAEA----------vsvETLEIMQKANEKSGCTNYLPTLITTsdelmkqG  109
ident                            |            |                   
Sbjct I----CGSSaGFLRawpeffgsrkalaEKAVRGLRRARAAGVRTIVDVSTFD----igrD   75
DSSP  L----EELLlLHHHhlhhhhllhhhhhHHHHHHHHHHHHLLLLEEEELLLHH----hllL


DSSP  HHHHHHHHHHLLlLLLLEEEELLL---------llLHHHHHHHHLH--------HHEEEE
Query VRVMREYLAKHPnQALGLHLEGPW---------lnAALVDFLCENA--------DVITKV  152
ident |    |                               |  |                   
Sbjct VSLLAEVSRAAD-VHIVAATGLWFdpplsmrlrsvEELTQFFLREIqygiedtgIRAGII  134
DSSP  HHHHHHHHHHHL-LEEELEEELLLlllhhhhlllhHHHHHHHHHHHhlllllllLLLLEE


DSSP  EELH------hHLLH-HHHHHHHH-HLLEEEELLL---LLLHhHHHHHHHH-----leEE
Query TLAP------eMVPA-EVISKLAN-AGIVVSAGHS---NATLkEAKAGFRA-----giTF  196
ident   |                       |  |                | |           
Sbjct XVATtgkatpfQELVlKAAARASLaTGVPVTTHTAasqRDGE-QQAAIFESeglspsrVC  193
DSSP  EEELlllllhhHHHHhHHHHHHHHhHLLLEEEELLhhhLHHH-HHHHHHHHllllhhhEE


DSSP  ELLLLLllllllllllhhhHHHHHLL--LLEEE-EELL--------------------LL
Query ATHLYNampyitgrepglaGAILDEA--DIYCG-IIAD--------------------GL  233
ident   |                      |      |                           
Sbjct IGHSDD---------tddlSYLTALAarGYLIGlDHIPysaiglednasasallgirsWQ  244
DSSP  ELLHHH---------lllhHHHHHHHhlLLEEEeLLLLlllllllllhhhhhhhllllHH


DSSP  LLLHhHHHHHHHH-HHHHEEEELLLL------------------llllLLHH-HHHHHHH
Query HVDYaNIRNAKRL-KGDKLCLVTDAT------------------sgssLTMI-EGVRNLV  273
ident       |                | |                                | 
Sbjct TRAL-LIKALIDQgYMKQILVSNDWTfgfssyvtnimdvmdrvnpdgmAFIPlRVIPFLR  303
DSSP  HHHH-HHHHHHHLlLHHHEEELLLLLleellllllhhhhhhhhlllhhHHHHhLHHHHHH


DSSP  HHhLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeeelleeeee
Query EHcGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktivngnevvt  333
ident |  |             |||                                        
Sbjct EK-GVPQETLAGITVTNPARFLS----------------------------------ptl  328
DSSP  HL-LLLHHHHHHHHLHHHHHHHL----------------------------------lll


DSSP  l
Query q  334
ident  
Sbjct r  329
DSSP  l


No 46: Query=1yrrB Sbjct=2vc5A Z-score=12.9

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                     ||      
Sbjct ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL


DSSP  EelleeLLLLL-----------lllLHHHHHHHHHHHHLLLEEEEEEEELLLlhhhhhhH
Query GcggvqFNDTA-----------eavSVETLEIMQKANEKSGCTNYLPTLITTsdelmkqG  109
ident                                   |     |                   
Sbjct L-----RVFSEavrqqwphlynedeEFRNAVNEVKRAMQFGVKTIVDPTVMG----lgrD   75
DSSP  L-----LLLLHhhhhhlhhhllhhhHHHHHHHHHHHHHHLLLLEEEELLLLL----lllL


DSSP  HHHHHHHHHHLLLLLlLEEEeLLLL-----------lLHHHHHHHHLH--------hHEE
Query VRVMREYLAKHPNQAlGLHLeGPWL-----------nAALVDFLCENA--------dVIT  150
ident  | |                                     |                  
Sbjct IRFMEKVVKATGINL-VAGTgIYIYidlpfyflnrsiDEIADLFIHDIkegiqgtlnKAG  134
DSSP  HHHHHHHHHLLLLEE-EELEeLLLLllllhhhllllhHHHHHHHHHHHhllllllllLLL


DSSP  EEEEL-------hhHLLH-HHHHHHHH-HLLEEEELLL---LLLHHHHHHHHHH----lE
Query KVTLA-------peMVPA-EVISKLAN-AGIVVSAGHS---NATLKEAKAGFRA----gI  194
ident  |  |                                    |  |               
Sbjct FVXIAadepgitkdVEKViRAAAIANKeTKVPIITHSNahnNTGLEQQRILTEEgvdpgK  194
DSSP  LEEEElllllllhhHHHHhHHHHHHHHhHLLLEEEELLlllLHHHHHHHHHHHLlllhhH


DSSP  EEELLLLLllLLLLllllhhHHHHHHLlLLEEEEE-------llLLLLlHHHHHHHH-HH
Query TFATHLYNamPYITgrepglAGAILDEaDIYCGII-------adGLHVdYANIRNAK-RL  246
ident     ||      |          | |      |                           
Sbjct ILIGHLGD-tDNID-----yIKKIADK-GSFIGLDrygldlflpVDKR-NETTLRLIkDG  246
DSSP  EEELLHHH-lLLHH-----hHHHHHHL-LLEEEELlllllllllHHHH-HHHHHHHHhLL


DSSP  HHHHEEEELLLL-----------------LLLL-LLHHH-HHHHHHHHhLLLHHHHHHHH
Query KGDKLCLVTDAT-----------------SGSS-LTMIE-GVRNLVEHcGIALDEVLRMA  287
ident   ||     |                      |     |     |    |          
Sbjct YSDKIMISHDYCctidwgtakpeykpklaPRWSiTLIFEdTIPFLKRN-GVNEEVIATIF  305
DSSP  LLLLEEELLLLLlllllllllhhhhhhhlLLLLlLHHHHlHHHHHHLL-LLLHHHHHHHH


DSSP  LHHHHHHLLllllllllllllllleeeellllleeeeeelleeeeel
Query TLYPARAIGvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
ident    |                                           
Sbjct KENPKKFFS--------------------------------------  314
DSSP  LHHHHHHLL--------------------------------------


No 47: Query=1yrrB Sbjct=1v77A Z-score=12.1

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
ident                                                      ||     
Sbjct ---------------------------------------------------VKFIEMDIR    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  EELleelllllllllhhhhhhHHHHHHLLlEEEEEEEEL---lLLHHHHHHHHHHHhhhh
Query GCGgvqfndtaeavsvetleiMQKANEKSgCTNYLPTLI---tTSDELMKQGVRVMreyl  117
ident                                               |             
Sbjct DKE------------------AYELAKEW-FDEVVVSIKfneeVDKEKLREARKEY----   46
DSSP  LHH------------------HHHHHHHH-LLEEEEEEEelllLLHHHHHHHHHHH----


DSSP  hhllllllLEEEellllllhhhhhhhhlhhheeeEEELhHHLL--HHHHHHHhhHLLEEE
Query akhpnqalGLHLegpwlnaalvdflcenadvitkVTLApEMVP--AEVISKLanAGIVVS  175
ident                                                   |         
Sbjct -------gKVAI----------------------LLSN-PKPSlvRDTVQKF--KSYLIY   74
DSSP  -------lLEEE----------------------EEEL-LLHHhhHHHHHHL--LLLEEE


DSSP  ELlLLLLhHHHHHHHHHLEEEELLLLLlLLLLlllllhhHHHH--HHLLL---LEEEEEL
Query AGhSNATlKEAKAGFRAGITFATHLYNaMPYItgrepglAGAI--LDEAD---IYCGIIA  230
ident    ||            |                                      |   
Sbjct VE-SNDL-RVIRYSIEKGVDAIISPWV-NRKD------pGIDHvlAKLMVkknVALGFSL  125
DSSP  EE-LLLH-HHHHHHHHLLLLEEELLLL-LLLL------lLLLHhhHHHHHhhlLEEEEEL


DSSP  LLLL--------lLHHHHHHHHHHHH---HHEEEELLLL-lLLLLLHHHHHHHHHhHHLL
Query DGLH--------vDYANIRNAKRLKG---DKLCLVTDAT-sGSSLTMIEGVRNLVeHCGI  278
ident   |                 |  |         |   |                |   | 
Sbjct RPLLysnpyeranLLRFMMKAWKLVEkykVRRFLTSSAQekWDVRYPRDLISLGV-VIGM  184
DSSP  HHHHhllhhhhhhHHHHHHHHHHHHHhhlLLEEEELLLLlhHHLLLHHHHHHHHH-HLLL


DSSP  LHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeeelleeeeel
Query ALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
ident            ||                                           
Sbjct EIPQAKASISMYPEIILK--------------------------------------  202
DSSP  LHHHHHHLLLHHHHHHHL--------------------------------------


No 48: Query=1yrrB Sbjct=2a3lA Z-score=11.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------leeELLEEElllleelleeeeeelleeeeee
Query -----------------------------yalTQGRIFtgheflddhavviadgliksvc   31
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  ehhhlllllleeelllleEEELEEEEEEL---EELL------------------------
Query pvaelppeieqrslngaiLSPGFIDVQLN---GCGG------------------------   64
ident                         |                                   
Sbjct -----------------fYNVRKVDTHVHhsaCMNQkhllrfiksklrkepdevvifrdg  201
DSSP  -----------------lLLLLEEEEEEElllLLLHhhhhhhhhhhhhllllllleeell


DSSP  -----------------------------------------------eellLLLLLL---
Query -----------------------------------------------vqfnDTAEAV---   74
ident                                                             
Sbjct tyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlREIFLKqdn  261
DSSP  eeelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhHHHHLLlll


DSSP  ------LHHHHHHHHHHHHLLLEEEEEEEELLLL--HHHHHHHHHHHHHHhHHLLLLLLl
Query ------SVETLEIMQKANEKSGCTNYLPTLITTS--DELMKQGVRVMREYlAKHPNQALg  126
ident         |         | |                    |                  
Sbjct liqgrfLGEITKQVFSDLEASKYQMAEYRISIYGrkMSEWDQLASWIVNN-DLYSENVV-  319
DSSP  llllllHHHHHHHHHHHHLLLLLEEEEEEEELLLllLLHHHHHHHHHHLL-LLLLLLEE-


DSSP  EEEELLLL----------------lLHHHHHH-------------hhLHHHEEEEEE---
Query LHLEGPWL----------------nAALVDFL-------------ceNADVITKVTL---  154
ident      | |                       |                        |   
Sbjct WLIQLPRLyniykdmgivtsfqnilDNIFIPLfeatvdpdshpqlhvFLKQVVGFDLvdd  379
DSSP  EEEEEELLhhhhlllllllllhhhhHHHLLHHhhhhhlhhhllllhhHHLLEEEEEEell


DSSP  ------------------------lHHHLLHHHHHHHHHH----------LLEEEELL-l
Query ------------------------aPEMVPAEVISKLANA----------GIVVSAGH-s  179
ident                                     |              |        
Sbjct eskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLnklreskgmtTITLRPHSge  439
DSSP  lllllllllllllllllllllllllHHHHHHHHHHHHHHHhhhhllllllLLEELLLLll


DSSP  LLLHHHHHHHHHhLEEEELLLLllllLLLLlllhhhhHHHHLL--LLEEEEELlLLLL--
Query NATLKEAKAGFRaGITFATHLYnampYITGrepglagAILDEA--DIYCGIIAdGLHV--  235
ident         | |        |                          |             
Sbjct AGDIDHLAATFL-TCHSIAHGI--nlRKSP------vLQYLYYlaQIGLAMSP-LSNNsl  489
DSSP  LLLLHHHHHHHH-HLLLLLLLH--hhHHLH------hHHHHHHhhLLLEEELH-HHHLll


DSSP  ---LHHH-HHHHHHHHHhHEEEELLLLLLLL---lLHHHHHHHHHHHHLLLHHHHHHHHl
Query ---DYAN-IRNAKRLKGdKLCLVTDATSGSS---lTMIEGVRNLVEHCGIALDEVLRMAt  288
ident       |              | ||             |                   | 
Sbjct fldYHRNpFPVFFLRGL-NVSLSTDDPLQIHltkePLVEEYSIAASVWKLSACDLCEIA-  547
DSSP  lllLLLLlHHHHHHLLL-LEEELLLLHHHHLllllHHHHHHHHHHHHHLLLHHHHHHHH-


DSSP  HHHHHHLLL-LLLL-lLLLLLL---------------------llleeeellllleeeee
Query LYPARAIGV-EKRL-gTLAAGK---------------------vanltaftpdfkitkti  325
ident        |                                                    
Sbjct RNSVYQSGFsHALKshWIGKDYykrgpdgndihktnvphirvefrdtiwkeemqqvylgk  607
DSSP  HHHHHHLLLlHHHHhhHLLLLLllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhllll


DSSP  elleeeeel
Query vngnevvtq  334
ident          
Sbjct avisdevvp  616
DSSP  lllllllll


No 49: Query=1yrrB Sbjct=2qpxA Z-score=11.7

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleEEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaiLSPGFIDVQLN   60
ident                                                        |    
Sbjct ----------------------------------------gxddlsefvDQVPLLDHHCH   20
DSSP  ----------------------------------------lllllhhhhHHLLEEEEEEL


DSSP  E--------------------------------------------elleelllllllllh
Query G--------------------------------------------cggvqfndtaeavsv   76
ident                                                             
Sbjct Flidgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldannplaaxndp   80
DSSP  Lllllllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllllllllllhh


DSSP  hhhhhhhHHHHLLLEEEEEEEELLllhhhhhhhhhhhhhHHHHL----LLLLlLEEEELL
Query etleimqKANEKSGCTNYLPTLITtsdelmkqgvrvmreYLAKH----PNQAlGLHLEGP  132
ident                   |                     |                   
Sbjct gyatynhRIFGHFHFKELLIDTGF--------vpddpilDLDQTaelvGIPV-KAIYRLE  131
DSSP  hhhhhhhHHHHHLLEEEEEEELLL--------lllllllLHHHHhhhhLLLE-EEEEEHH


DSSP  --------------lllLHHHHHHHHLH-HHEEEEEEL----------------------
Query --------------wlnAALVDFLCENA-DVITKVTLA----------------------  155
ident                   |                                         
Sbjct thaedfxlehdnfaawwQAFSNDVKQAKaHGFVGFXSIaayrvglhlepvnvieaaagfd  191
DSSP  hhhhhhhlllllhhhhhHHHHHHHHLLLlLLLLLEEELhhhhlllllllllhhhhhhhhh


DSSP  ---------------hHHLLHHHHHHHHHHLLEEEELL-------------lLLLHHHHH
Query ---------------pEMVPAEVISKLANAGIVVSAGH-------------sNATLKEAK  187
ident                       |                                    |
Sbjct twkhsgekrltskpliDYXLYHVAPFIIAQDXPLQFHVgygdadtdxylgnpLLXRDYLK  251
DSSP  hhhhhlllllllhhhhHHHHHHHHHHHHHHLLLEEEEEllllllllhhhllhHHHHHHHH


DSSP  HHHHH-LEEEELLLLLllllllllllhhhHHHHHLLLLEEEEE--LLLLL-LLHHHHHHH
Query AGFRA-GITFATHLYNampyitgrepglaGAILDEADIYCGII--ADGLH-VDYANIRNA  243
ident |           | |                       |  |                 |
Sbjct AFTKKgLKVVLLHCYP-------yhreagYLASVFPNLYFDISllDNLGPsGASRVFNEA  304
DSSP  HHHHHlLLEEEEELLL-------lhhhhhHHHHHLLLEEEELLlhHHHLHhHHHHHHHHH


DSSP  HHHHH-HHEEEELLLL-llLLLL--HHHHHHHHhHHHL---------lLHHHHHHHHLHH
Query KRLKG-DKLCLVTDAT-sgSSLT--MIEGVRNLvEHCG---------iALDEVLRMATLY  290
ident   |          ||                 |                           
Sbjct VELAPyTRILFASDAStypEXYGlaARQFKQAL-VAHFnqlpfvdlaqKKAWINAICWQT  363
DSSP  LLLLLhHHEELLLLLLllhHHHHhhHHHHHHHH-HHHHhllllllhhhHHHHHHHHHLHH


DSSP  HHHHLLLLlLLLLLllllllleeeellllleeeeeelleeeeel
Query PARAIGVEkRLGTLaagkvanltaftpdfkitktivngnevvtq  334
ident  |     | |                                  
Sbjct SAKLYHQE-RELRV------------------------------  376
DSSP  HHHHLLLH-HHHLL------------------------------


No 50: Query=1yrrB Sbjct=1j5sA Z-score=11.2

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                        |    
Sbjct ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL


DSSP  EelleelllllllLLHHH------------------------------------------
Query GcggvqfndtaeaVSVET------------------------------------------   78
ident                                                             
Sbjct L------------DAKDIvenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnke   81
DSSP  L------------LHHHHhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhhh


DSSP  -------------------------------------------------------hHHHH
Query -------------------------------------------------------lEIMQ   83
ident                                                             
Sbjct kwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLL  141
DSSP  hhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHH


DSSP  HHHHlllEEEEEEEELLllhhhHHHHhHHHHHHHHHLLLLLLLEEEELL-----------
Query KANEksgCTNYLPTLITtsdelMKQGvRVMREYLAKHPNQALGLHLEGP-----------  132
ident              |                |                             
Sbjct RDMK---VEILCTTDDP-----VSTL-EHHRKAKEAVEGVTILPTWRPDramnvdkegwr  192
DSSP  HHLL---EEEEELLLLL-----LLLL-HHHHHHHHHLLLLEEELLLLLHhhhllllllhh


DSSP  ------------------lllLHHHHHHHHLHH-HEEEEEEL------------------
Query ------------------wlnAALVDFLCENAD-VITKVTLA------------------  155
ident                       ||                 |                  
Sbjct eyvekmgerygedtstldgflNALWKSHEHFKEhGCVASDHAllepsvyyvdenraravh  252
DSSP  hhhhhhhhhhllllllhhhhhHHHHHHHHHHHLlLLLEEEEEelllllllllhhhhhhhh


DSSP  -----------------hHHLLHHHHHHHHHHLLEEEELLLL------------------
Query -----------------pEMVPAEVISKLANAGIVVSAGHSN------------------  180
ident                                   |                         
Sbjct ekafsgekltqdeindykAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsgg  312
DSSP  hhhlllllllhhhhhhhhHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllll


DSSP  -------lLHHHHHHHHHH----LEEEELllllLLLLLlllllhhHHHHHHLL----LLE
Query -------aTLKEAKAGFRA----GITFAThlynAMPYItgrepglAGAILDEA----DIY  225
ident                                                 |   |      |
Sbjct distnflrIAEGLRYFLNEfdgkLKIVLY----VLDPT------hLPTISTIArafpNVY  362
DSSP  leelllllHHHHHHHHHHHllllLLEEEE----ELLHH------hHHHHHHHHhhllLEE


DSSP  EEEE----LLLLlLLHHHHHHHHH-HHHHHE-EEELLLL--llllLLHHHHHHHHHHHHL
Query CGII----ADGLhVDYANIRNAKR-LKGDKL-CLVTDAT--sgssLTMIEGVRNLVEHCG  277
ident  |                            |   |||               | |    |
Sbjct VGAPwwfnDSPF-GMEMHLKYLASvDLLYNLaGMVTDSRkllsfgSRTEMFRRVLSNVVG  421
DSSP  ELLLllllLLHH-HHHHHHHHHHLlLLHHHLlLLLLLLLlllhhhHHHHHHHHHHHHHHH


DSSP  -----------lLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee
Query -----------iALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
ident             |   |       |                                   
Sbjct emvekgqipikeARELVKHVSYDGPKALFF------------------------------  451
DSSP  hhhhlllllhhhHHHHHHHHHLHHHHHHHL------------------------------


DSSP  lleeeeel
Query ngnevvtq  334
ident         
Sbjct --------  451
DSSP  --------


No 51: Query=1yrrB Sbjct=3iacA Z-score=10.9

back to top
DSSP  -------------leeellEEELllleelleeeeeelleeeeeeehhhlllllleeelll
Query -------------yaltqgRIFTgheflddhavviadgliksvcpvaelppeieqrslng   47
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  leEEELEEEEEELEelleelllllllllHHHHH---------------------------
Query aiLSPGFIDVQLNGcggvqfndtaeavsVETLE---------------------------   80
ident         |                                                   
Sbjct --APXPIYDFHCHL-------------sPQEIAddrrfdnlgqiwlegdhykwralrsag   68
DSSP  --LLLLEEELLLLL-------------lHHHHHhllllllhhhhhhllllhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   80
ident                                                             
Sbjct vdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiw  128
DSSP  llhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhh


DSSP  ------------HHHHHHHLLLEEEEEEEELLllhhhHHHHhHHHHHHHHHL-LLLLLLE
Query ------------IMQKANEKSGCTNYLPTLITtsdelMKQGvRVMREYLAKH-PNQALGL  127
ident                             |                |   |          
Sbjct tqcneklatpafSARGIXQQXNVRXVGTTDDP-----IDSL-EYHRQIAADDsIDIEVAP  182
DSSP  hhhhhhhllhhhLHHHHHHHLLEEEEELLLLL-----LLLL-HHHHHHHHLLlLLLEEEL


DSSP  EEELLL-----------------------------llLHHHHHHHHLHH-HEEEEEEL--
Query HLEGPW-----------------------------lnAALVDFLCENAD-VITKVTLA--  155
ident                                       ||   |   |            
Sbjct SWRPDKvfkieldgfvdylrkleaaadvsitrfddlrQALTRRLDHFAAcGCRASDHGie  242
DSSP  LLLLHHhhllllllhhhhhhhhhhhhllllllhhhhhHHHHHHHHHHHHlLLLEEEEEel


DSSP  ----------------------------------hhhLLHHHHHHHHHHLLEEEeLLLL-
Query ----------------------------------pemVPAEVISKLANAGIVVSaGHSN-  180
ident                                      |        |  | |    |   
Sbjct tlrfapvpddaqldailgkrlagetlseleiaqfttaVLVWLGRQYAARGWVXQ-LHIGa  301
DSSP  lllllllllhhhhhhhhhhhhllllllhhhhhhhhhhHHHHHHHHHHHHLLEEE-EEELe


DSSP  ------------------------lLHHHHH-HHHHH-----LEEEELlllLLLLLLlll
Query ------------------------aTLKEAK-AGFRA-----GITFAThlyNAMPYItgr  210
ident                                                             
Sbjct irnnntrxfrllgpdtgfdsigdnnISWALSrLLDSXdvtneLPKTIL---YCLNPR---  355
DSSP  ellllhhhhhhhllllllleellllLHHHHHhHHHHHhllllLLEEEE---EELLHH---


DSSP  llhhhHHHHHLL---------LLEEEE---elLLLLLLHHHHHHHHHHHH--HHEEEELL
Query epglaGAILDEA---------DIYCGI---iaDGLHVDYANIRNAKRLKG--DKLCLVTD  256
ident                          |      |                         ||
Sbjct --dneVLATXIGnfqgpgiagKVQFGSgwwfnDQKDGXLRQLEQLSQXGLlsQFVGXLTD  413
DSSP  --hhhHHHHHHHhllllllllLEEELLllhhhLLHHHHHHHHHHHHHHLLhhHLLLLLLL


DSSP  LL-llLLLLHHHHHHHHHHHHL-------------lLHHHHHHHHLHHHHHHLLllllll
Query AT-sgSSLTMIEGVRNLVEHCG-------------iALDEVLRMATLYPARAIGvekrlg  302
ident      |        | |    |                  |         |         
Sbjct SRsflSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT------  467
DSSP  LLlllLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL------


DSSP  llllllllleeeellllleeeeeelleeeeel
Query tlaagkvanltaftpdfkitktivngnevvtq  334
ident                                 
Sbjct ------------------------------ik  469
DSSP  ------------------------------ll


No 52: Query=1yrrB Sbjct=3au2A Z-score=10.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ----------------------leeelleeelllleelleeeeeelleeeeeeEHHHLL-
Query ----------------------yaltqgriftgheflddhavviadgliksvcPVAELP-   37
ident                                                        |    
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleaIRALPGv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhHHLLLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   37
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   37
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ---------------------lllleeelllleeEELEEEEEELEelleELLLllllllh
Query ---------------------peieqrslngailSPGFIDVQLNGcggvQFNDtaeavsv   76
ident                                        | |          |       
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHS----TYSD-----gq  351
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELL----LLLL-----ll


DSSP  hHHHHHHHHHHLLLEEEEEEEELLL--------LHHHHHHHHHHHHHHHHHLLLLLLLEE
Query eTLEIMQKANEKSGCTNYLPTLITT--------SDELMKQGVRVMREYLAKHPNQALGLH  128
ident  |||    |    |      |            | |     |   |     |    |   
Sbjct nTLEELWEAAKTMGYRYLAVTDHSPavrvaggpSPEEALKRVGEIRRFNETHGPPYLLAG  411
DSSP  lLHHHHHHHHHHHLLLEEEEEEELHhhhlllllLHHHHHHHHHHHHHHHHHHLLLEEEEE


DSSP  EElLLLL----lhhHHHHHHLhhhEEEEEelhhhllhhhhhhhhhhlleeeELLLL----
Query LEgPWLN----aalVDFLCENadvITKVTlapemvpaevisklanagivvsAGHSN----  180
ident  |             |           |                                
Sbjct AE-VDIHpdgtldyPDWVLRE---LDLVL----------------------VSVHSrfnl  445
DSSP  EE-EELLlllllllLHHHHLL---LLEEE----------------------EELLLllll


DSSP  ---lLHHHHHHHHHHL-EEEELLLLLL------LLLLlllllhhHHHHHHL---LLLEEE
Query ---aTLKEAKAGFRAG-ITFATHLYNA------MPYItgrepglAGAILDE---ADIYCG  227
ident       |               |                       |             
Sbjct pkadQTKRLLKALENPfVHVLAHPTARllgrraPIEA------dWEAVFQKakeKGVAVE  499
DSSP  lhhhHHHHHHHHHLLLlLLEELLLLLLllllllLLLL------lHHHHHHHhhhHLLEEE


DSSP  EELLLLLL--LHHHHHHHHHHhHHHEEEELLLL-llLLLLHHHHHHHHHhHHLLLHHHhh
Query IIADGLHV--DYANIRNAKRLkGDKLCLVTDAT-sgSSLTMIEGVRNLVeHCGIALDEvl  284
ident |              | |    |    | |||        |   |        |      
Sbjct IDGYYDRMdlPDDLARMAYGM-GLWISLSTDAHqtdHLRFMELAVGTAQ-RAWIGPER--  555
DSSP  EELLLLLLllLHHHHHHHHHL-LLLEEEELLLLlhhHHHHHHHHHHHHH-HLLLLLLL--


DSSP  HHHLHhhhhhLLLLllllllllllllleeeellllleeeeeelleeeeel
Query RMATLyparaIGVEkrlgtlaagkvanltaftpdfkitktivngnevvtq  334
ident    ||                                             
Sbjct VLNTL-dyedLLSW-----------------------------lkarrgv  575
DSSP  LHHHL-lhhhHHHH-----------------------------hhlllll


No 53: Query=1yrrB Sbjct=3f2bA Z-score=10.6

back to top
DSSP  -----------------------------------------------------leeelle
Query -----------------------------------------------------yaltqgr    7
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  eelllleelleeeeeelleeeeeeehhhllLLLLEE---ellllEEEELEEEEEELEell
Query iftgheflddhavviadgliksvcpvaelpPEIEQR---slngaILSPGFIDVQLNGcgg   64
ident                                  |                    |     
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviianDLNEIAanerqdtaPEGEKRVELHLHT---  117
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeEEEEELllllllllLLLLLLLLLLLLL---


DSSP  eELLLLlllllhhHHHHHHHHHHLLLEEEEEEEELLllhhhhhHHHHHHHHHHHHLLLLL
Query vQFNDTaeavsveTLEIMQKANEKSGCTNYLPTLITtsdelmkQGVRVMREYLAKHPNQA  124
ident                        | |      |          |          ||    
Sbjct -PMSQM---davtSVTKLIEQAKKWGHPAIAVTDHA-----vvQSFPEAYSAAKKHGMKV  168
DSSP  -LLLLL---llllLHHHHHHHHHHLLLLLEEELLLL-----llLLHHHHHHHHHHHLLLE


DSSP  LlEEEELLL---lllhhhhhhhHLHH---------heeeeeelhhHLLHHHHHHHHhHLL
Query LgLHLEGPW---lnaalvdflcENAD---------vitkvtlapeMVPAEVISKLAnAGI  172
ident     ||                |                        |  |  |    | 
Sbjct I-YGLEANIvddpfhvtllaqnETGLknlfklvslshiqyfhrvpRIPRSVLVKHR-DGL  226
DSSP  E-EEEEEEEellleeeeeeellHHHHhhhhhhhhhhhllllllllLEEHHHHHHLL-LLE


DSSP  EEeellllllhhhhhhhhhhleeEELLllLLLLlllllllhhHHHHhHLLL--LEEEEEL
Query VVsaghsnatlkeakagfragitFATHlyNAMPyitgrepglAGAIlDEAD--IYCGIIA  230
ident  |                                             | |          
Sbjct LV---------------------GSGC--DKGE-------lfDNVE-DIARfyDFLEVHP  255
DSSP  EE---------------------ELLL--LLLL-------llLLLL-LLHHhlLLEEELL


DSSP  lLLLL----------LHHHHHHHHHHHH---HHEEEELLLL-------------------
Query dGLHV----------DYANIRNAKRLKG---DKLCLVTDAT-------------------  258
ident                    ||    |                                  
Sbjct -PDVYkplyvkdeemIKNIIRSIVALGEkldIPVVATGNVHylnpedkiyrkilihsqgg  314
DSSP  -HHHHlllllllhhhHHHHHHHHHHHHHhllLLEEELLLLLlllhhhhhhhhhhhhllhh


DSSP  ---------LLLLLLHH-HHHHHHHhhhLLLHHHHHHHHLHHHHHHLLL-----------
Query ---------SGSSLTMI-EGVRNLVehcGIALDEVLRMATLYPARAIGV-----------  297
ident                   |                                         
Sbjct anplnrhelPDVYFRTTnEMLDCFS---FLGPEKAKEIVVDNTQKIASLigdvkpikdel  371
DSSP  hllllllllLLLLLLLHhHHHHHHH---HHHHHHHHHHHLHHHHHHHHLlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct ytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvk  431
DSSP  lllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct kslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpd  491
DSSP  hhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct kncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyr  551
DSSP  lllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct agtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdym  611
DSSP  eeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct eiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpkt  671
DSSP  lhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct iptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqi  731
DSSP  lllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct sglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgk  791
DSSP  hhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct gltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasy  851
DSSP  lllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  297
ident                                                             
Sbjct ftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfkn  911
DSSP  hhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleell


DSSP  ----------------------------------------------llllllllllllll
Query ----------------------------------------------ekrlgtlaagkvan  311
ident                                                             
Sbjct idlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklskt  971
DSSP  llllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhh


DSSP  eeeellllleeeeeelleeeeel
Query ltaftpdfkitktivngnevvtq  334
ident                        
Sbjct lleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhllllllllllllllll


No 54: Query=1yrrB Sbjct=1m65A Z-score=8.9

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeelEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgFIDVQLN   60
ident                                                        |    
Sbjct ----------------------------------------------------yPVDLHMH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  eelleELLLLlllllhhHHHHHHHHHHLLLEEEEEEEELLL------LHHHHHHHHHhhH
Query gcggvQFNDTaeavsveTLEIMQKANEKSGCTNYLPTLITT------SDELMKQGVRvmR  114
ident          |       ||          |      |                       
Sbjct -----TVAST---haysTLSDYIAQAKQKGIKLFAITDHGPdmedapHHWHFINMRI--W   58
DSSP  -----LLLLL---llllLHHHHHHHHHHHLLLEEEEEEELLllllllLLHHHHHHHH--L


DSSP  HHHhhLLLLLLLEEEELLLL----llhhHHHHHHLhhhEEEEEelhhhllhhhhhhhhhh
Query EYLakHPNQALGLHLEGPWL----naalVDFLCENadvITKVTlapemvpaevisklana  170
ident                |                                            
Sbjct PRV--VDGVGILRGIEANIKnvdgeidcSGKMFDS---LDLII-----------------   96
DSSP  LLE--ELLEEEEEEEEEELLllllllllLHHHHHH---LLEEE-----------------


DSSP  lleeEELL---------lLLLHhHHHHHHHHLEE-EELLLLL-lLLLLlllllhhhHHHH
Query givvSAGH---------sNATLkEAKAGFRAGIT-FATHLYN-aMPYItgrepglaGAIL  219
ident        |            |     |    |      |  |                  
Sbjct ----AGFHepvfaphdkaTNTQ-AMIATIASGNVhIISHPGNpkYEID------vkAVAE  145
DSSP  ----EELLllllllllhhHHHH-HHHHHHHLLLLlEELLLLLllLLLL------hhHHHH


DSSP  H--LLLLEEEEEllllLLLHHHHHHHHHHHHhHEEEELLLLlllllLHHHHHHHHHHHHL
Query D--EADIYCGIIadglHVDYANIRNAKRLKGdKLCLVTDATsgsslTMIEGVRNLVEHCG  277
ident           |                   |    |  |          |          
Sbjct AaaKHQVALEIN--nsSNCREVAAAVRDAGG-WVALGSDSHtaftmGEFEECLKILDAVD  202
DSSP  HhhHHLLEEEEE--llLLHHHHHHHHHHHLL-LEEEELLLLlhhhlLLLHHHHHHHHHLL


DSSP  LLHHHhhHHHLH--HHHHHLLllllllllllllLLLEeeellllleeeeeelleeeeel
Query IALDEvlRMATL--YPARAIGvekrlgtlaagkVANLtaftpdfkitktivngnevvtq  334
ident                                   | |                      
Sbjct FPPER--ILNVSprRLLNFLE---srgmapiaeFADL----------------------  234
DSSP  LLHHH--LHHHLhhHHHHHHH---hllllllhhHLLL----------------------


No 55: Query=1yrrB Sbjct=3dcpA Z-score=8.5

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeLEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspGFIDVQLN   60
ident                                                        |    
Sbjct ----------------------------------------------------XKRDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  eelleELLLLLLLllhhHHHHHHHHHHLLLEEEEEEEELLL-------------------
Query gcggvQFNDTAEAvsveTLEIMQKANEKSGCTNYLPTLITT-------------------  101
ident       |            |             |                          
Sbjct ----tEFCPHGTH---dDVEEXVLKAIELDFDEYSIVEHAPlssefxkntagdkeavtta   61
DSSP  ----lLLLLLLLL---lLHHHHHHHHHHLLLLEEEEEEELLllhhhhhllllllhhhhll


DSSP  --LHHHHHHHHHHHHHHHHHLL--LLLLlEEEEllllllhhhhhhhhlhhheeeeEELHh
Query --SDELMKQGVRVMREYLAKHP--NQALgLHLEgpwlnaalvdflcenadvitkvTLAPe  157
ident                    |            |                           
Sbjct sxAXSDLPYYFKKXNHIKKKYAsdLLIH-IGFE----------------------VDYL-   97
DSSP  llLHHHHHHHHHHHHHHHHHLLllLEEE-EEEE----------------------EELL-


DSSP  HLLHHHHHHHHHHLL-----eeEELLLL--------------------------------
Query MVPAEVISKLANAGI-----vvSAGHSN--------------------------------  180
ident            |             |                                  
Sbjct IGYEDFTRDFLNEYGpqtddgvLSLHFLegqggfrsidfsaedynegivqfyggfeqaql  157
DSSP  LLLHHHHHHHHHHHHhhlleeeEELLEEeelleeeellllhhhhhhhlhhhhllhhhhhh


DSSP  lLHHHHHHH-HHHL----eEEELLLLLL----------lllLLLLL-lhhhHHHHHLL--
Query aTLKEAKAG-FRAG----iTFATHLYNA----------mpyITGRE-pglaGAILDEA--  222
ident   |   |                |                                    
Sbjct aYLEGVKQSiEADLglfkpRRXGHISLCqkfqqffgedtsdFSEEVxekfrVILALVKkr  217
DSSP  hHHHHHHHHhHLLLlllllLEELLLLHHhllhhhhlllhhhLLHHHhhhhhHHHHHHHhh


DSSP  LLEEEEEL-------lLLLL-LHHHHHHHHHHhHHHEEEELLLLlllLLLHhhHHHHHHH
Query DIYCGIIA-------dGLHV-DYANIRNAKRLkGDKLCLVTDATsgsSLTMieGVRNLVE  274
ident |               |           |  |         |           |      
Sbjct DYELDFNTaglfkplcGETYpPKKIVTLASEL-QIPFVYGSDSHgvqDIGR--GYSTYCQ  274
DSSP  LLEEEEELhhhhllllLLLLlLHHHHHHHHHL-LLLEEEELLLLlhhHLLL--LHHHHHH


DSSP  HHLllhhhhhhhhlhhhhhhllllllllllllllllleeeellllleeeeeelleeeeel
Query HCGialdevlrmatlyparaigvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
ident                                                             
Sbjct KLE---------------------------------------------------------  277
DSSP  HLL---------------------------------------------------------


No 56: Query=1yrrB Sbjct=1bksA Z-score=7.5

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeleEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfIDVQLN   60
ident                                                         |   
Sbjct -------------------------------------meryenlfaqlndrregAFVPFV   23
DSSP  -------------------------------------lhhhhhhhhhhhhllllEEEEEE


DSSP  eelleELLLLL-LLLLhHHHHHHHHHHhllleeEEEEEELLL------------------
Query gcggvQFNDTA-EAVSvETLEIMQKANeksgctNYLPTLITT------------------  101
ident         |   |            |         |                        
Sbjct -----TLGDPGiEQSL-KIIDTLIDAG-----aDALELGVPFsdpladgptiqnanlraf   72
DSSP  -----ELLLLLhHHHH-HHHHHHHHLL-----lLLEEEELLLlllllllhhhhhhhhhhh


DSSP  ----LHHHHHHHHHHHHHHHHhlllLLLLeEEELLL---llLHHHHHHHHLHH-HEEEEE
Query ----SDELMKQGVRVMREYLAkhpnQALGlHLEGPW---lnAALVDFLCENAD-VITKVT  153
ident                 ||             |              |           | 
Sbjct aagvTPAQCFEMLALIREKHP----TIPI-GLLMYAnlvfnNGIDAFYARCEQvGVDSVL  127
DSSP  hhllLHHHHHHHHHHHHHHLL----LLLE-EEEELHhhhhlLLHHHHHHHHHHhLLLEEE


DSSP  E--LHHHLLHHHHHHHHHHLLEEEEL-llLLLHHHHHHHHHHLEeEELLllllLLLLlll
Query L--APEMVPAEVISKLANAGIVVSAG-hsNATLKEAKAGFRAGItFATHlynaMPYItgr  210
ident     |    |          |        ||           |                 
Sbjct VadVPVEESAPFRQAALRHNIAPIFIcppNADDDLLRQVASYGRgYTYL----LALP---  180
DSSP  EllLLHHHLHHHHHHHHHLLLEEEEEellLLLHHHHHHHHHHLLlLEEE----LLLL---


DSSP  llhhHHHHHHLLLLEEEE---ELLLLLllhhhHHHHhhhhhhhEEEELLLL---------
Query epglAGAILDEADIYCGI---IADGLHvdyanIRNAkrlkgdkLCLVTDAT---------  258
ident                      |           |                          
Sbjct lhhlIEKLKEYHAAPALQgfgISSPEQ-vsaaVRAG------aAGAISGSAivkiieknl  233
DSSP  hhhhHHHHHHHLLLLEEElllLLLHHH-hhhhHHHL------lLEEEELLHhhhhhhhll


DSSP  -----------lllllLHHHHHhhhhhhhlllhhhhhhhhlhhhhhhlllllllllllll
Query -----------sgsslTMIEGVrnlvehcgialdevlrmatlyparaigvekrlgtlaag  307
ident                                                             
Sbjct aspkqmlaelrsfvsaMKAASR--------------------------------------  255
DSSP  llhhhhhhhhhhhhhhHHHLLL--------------------------------------


DSSP  lllleeeellllleeeeeelleeeeel
Query kvanltaftpdfkitktivngnevvtq  334
ident                            
Sbjct ---------------------------  255
DSSP  ---------------------------


No 57: Query=1yrrB Sbjct=2anuA Z-score=7.4

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
ident                                                        |    
Sbjct -------------------------------------------------tEWLLCDFHVH   11
DSSP  -------------------------------------------------lEEEEEEEEEL


DSSP  EelleELLLllllllhhHHHHHHHHHHLLLEEEEEEEELLL------------------L
Query GcggvQFNDtaeavsveTLEIMQKANEKSGCTNYLPTLITT------------------S  102
ident         |         |        | |      |                       
Sbjct T----NXSD-----ghlPLGEVVDLFGKHGVDVVSITDHIVdrrtleqrkrngeplgaiT   62
DSSP  L----LLLL-----lllLHHHHHHHHHHLLLLEEEEEEEEElhhhhhhhhhllllllllL


DSSP  HHHHHHHHHHHHHHHHHLL----LLLLlEEEELLLLLlhhhhhhhhlhhhEEEEeelhhH
Query DELMKQGVRVMREYLAKHP----NQALgLHLEGPWLNaalvdflcenadvITKVtlapeM  158
ident                                |                            
Sbjct EDKFQDYLKRLWREQKRAWeeygXILI-PGVEITNNT------dlyhivaVDVKeyvdpS  115
DSSP  LLLHHHHHHHHHHHHHHHHhhhlLEEE-EEEEEEELL------lleeeeeELLLlllllL


DSSP  LLH-HHHHHHHHHLLEEeellllllhhhhhhhhhhleeEELLL-llLLLLllllllHHHH
Query VPA-EVISKLANAGIVVsaghsnatlkeakagfragitFATHL-ynAMPYitgrepGLAG  216
ident  |  |   ||      |                      | |               |  
Sbjct LPVeEIVEKLKEQNALV---------------------IAAHPdrkKLSW------YLWA  148
DSSP  LLHhHHHHHHHHLLLEE---------------------EELLLlllLLLL------HHHH


DSSP  HHHHLLL--LEEE-EELLLllllhhhHHHHHHHHHhHEEEELLLLlllLLLHhhhhhhhh
Query AILDEAD--IYCG-IIADGlhvdyanIRNAKRLKGdKLCLVTDATsgsSLTMiegvrnlv  273
ident       |          |               |        |                 
Sbjct NXERFKDtfDAWEiANRDD------lFNSVGVKKY-RYVANSDFH-elWHVY--------  192
DSSP  LLLLLLLllLEEEeEELLE------eLHHHHHLLL-LEEEELLLL-lhHHHL--------


DSSP  hhhlllhhhhhhHHLHhhhhhlllLLLLlllllllllleeeellllleeeeeelleeeee
Query ehcgialdevlrMATLyparaigvEKRLgtlaagkvanltaftpdfkitktivngnevvt  333
ident                                                             
Sbjct ----------swKTLV-------kSEKN------------ieaikeairkntdvaiylxr  223
DSSP  ----------leEEEE-------eELLL------------hhhhhhhhhhllleeeeell


DSSP  l
Query q  334
ident  
Sbjct k  224
DSSP  l


No 58: Query=1yrrB Sbjct=2yb1A Z-score=6.3

back to top
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeelEEEEEEL
Query yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgFIDVQLN   60
ident                                                       ||    
Sbjct ----------------------------------------------------aNIDLHFH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  eelleeLLLLlLLLLHHHHHHHHHHHhlllEEEEEEEELLllhhhHHHHHHHHHHHHHHL
Query gcggvqFNDTaEAVSVETLEIMQKANeksgCTNYLPTLITtsdelMKQGVRVMREYLAKH  120
ident         |       |                   |           |        |  
Sbjct ----srTSDG-ALTPTEVIDRAAARA----PALLALTDHD-----CTGGLAEAAAAAARR   54
DSSP  ----llLLLL-LLLHHHHHHHHHLLL----LLEEEELLLL-----LLLLHHHHHHHHHHL


DSSP  LLLlLLEEEELLL---------------lllHHHHHH-----------------------
Query PNQaLGLHLEGPW---------------lnaALVDFL-----------------------  142
ident          |                                                  
Sbjct GIP-FLNGVEVSVswgrhtvhivglgidpaePALAAGlksiregrlerarqmgasleaag  113
DSSP  LLL-EEEEEEEEEeelleeeeeeeellllllHHHHHHhhhhhllhhhhhhhhhhhhhhll


DSSP  -----------------------------------------hhlhhheeeeeelhhhLLH
Query -----------------------------------------cenadvitkvtlapemVPA  161
ident                                                             
Sbjct iagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLE  173
DSSP  lllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllllllLHH


DSSP  HHHHHHHHHLLEEEELLLL-------lLHHHHHHHHHHLEEEELLLllllllllllllhH
Query EVISKLANAGIVVSAGHSN-------aTLKEAKAGFRAGITFATHLynampyitgrepgL  214
ident         ||      |                    ||                     
Sbjct DAVGWIVGAGGMAVIAHPGrydmgrtlIERLILDFQAAGGQGIEVA--sgshslddmhkF  231
DSSP  HHHHHHHHLLLEEEELLHHhllllhhhHHHHHHHHHHLLLLEEEEE--ellllhhhhhhH


DSSP  HHHHHHLlLLEEE--eelllllllhhhhhhHHHHhhHHEEeellllllllllhhhhhhhh
Query AGAILDEaDIYCG--iiadglhvdyanirnAKRLkgDKLClvtdatsgssltmiegvrnl  272
ident |         |                                                 
Sbjct ALHADRH-GLYASsgsdfhapgedvghtedLPPI--CRPI--------------------  268
DSSP  HHHHHHH-LLEEEeelllllllllllllllLLLL--LLLH--------------------


DSSP  hhhhlllhhhhhhhhlhhhHHHLLLllllllllLLLLlleeeellllleeeeeelleeee
Query vehcgialdevlrmatlypARAIGVekrlgtlaAGKVanltaftpdfkitktivngnevv  332
ident                     |                                       
Sbjct -------------------WRELEA--rilrpaDAEN-----------------------  284
DSSP  -------------------HHHLHH--hlllllHHHL-----------------------


DSSP  el
Query tq  334
ident   
Sbjct --  284
DSSP  --


No 59: Query=1yrrB Sbjct=3e38A Z-score=5.9

back to top
DSSP  -leeelleeELLLLeelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEE
Query -yaltqgriFTGHEflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQL   59
ident                                                         |   
Sbjct aqrrneiqvPDLDG------------------------------------yTTLKCDFHX   24
DSSP  lllllllllLLLLL------------------------------------lEEEEEELLL


DSSP  LeelleelllllLLLLHhHHHHHHHHHHlllEEEEEEEELLLLHH----hhHHHHHHHHH
Query NgcggvqfndtaEAVSVeTLEIMQKANEksgCTNYLPTLITTSDE----lmKQGVRVMRE  115
ident                                      |                 |    
Sbjct H-----svfsdgLVWPT-VRVDEAYRDG---LDAISLTEHIEYRPhkqdvvSDHNRSFDL   75
DSSP  L-----llllllLLLHH-HHHHHHHHLL---LLEELLEEELLLLLllllllLLLLHHHHH


DSSP  HHHHLL--LLLLLEEEELLLLLlhhhhhhhhlHHHEeeeeelhhhlLHHHHHHHHHHLLE
Query YLAKHP--NQALGLHLEGPWLNaalvdflcenADVItkvtlapemvPAEVISKLANAGIV  173
ident            |    |                                        |  
Sbjct CREQAEklGILLIKGSEITRAX-apghfnaifLSDS---npleqkdYKDAFREAKKQGAF  131
DSSP  HHHHHHhhLLEELLEEEEELLL-llleeeeelLLLL---hhhllllHHHHHHHHHHLLLE


DSSP  EEELLL---------LLLHHHHHHHHHH-LEEEELL---llLLLLlllllllhhHHHHHH
Query VSAGHS---------NATLKEAKAGFRA-GITFATH---lyNAMPyitgrepglAGAILD  220
ident     |               |  |                                  ||
Sbjct XFWNHPgwdsqqpdtTKWWPEHTALYQEgCXHGIEVanghlYXPE--------aIQWCLD  183
DSSP  EEELLLlllllllllLLLLHHHHHHHHLlLLLEEEEeelleELLH--------hHHHHHH


DSSP  LLlLEEEEelllllllhhhhhhhhhhhhhheeeELLLL---------lllLLLHhhhhhh
Query EAdIYCGIiadglhvdyanirnakrlkgdklclVTDAT---------sgsSLTMiegvrn  271
ident                                    |                        
Sbjct KN-LTXIG-------------------------TSDIHqpiqtdydfekgEHRT------  211
DSSP  HL-LEEEE-------------------------ELLLLllhhhhllhhhlLLLL------


DSSP  hhhhhlllhhhhhhhHLHH--------HHHHL-----------------------lllll
Query lvehcgialdevlrmATLY--------PARAI-----------------------gvekr  300
ident                                                             
Sbjct -------------xtFVFAkerslqgiREALDnrrtaayfhelligredllrpffekcvk  258
DSSP  -------------eeEEEEllllhhhhHHHHHllleeeeelleeellhhhhhhhhhhhee


DSSP  llllllllllleeeelLLLLE---------------------------------------
Query lgtlaagkvanltaftPDFKI---------------------------------------  321
ident                                                             
Sbjct ieevsrneqgvtlsitNVTDLvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikg  318
DSSP  eeeeeeelleeeeeeeELLLLleeeeelllllleellleeeellleeeeeeeeellllll


DSSP  -----------eeeeelleeeeel
Query -----------tktivngnevvtq  334
ident                         
Sbjct gdvnfevtnfivapdkglkytisl  342
DSSP  leeeeeeeeeeeelleeeeeeeel