Results: dupa

Query: 1v77A

MOLECULE: HYPOTHETICAL PROTEIN PH1877;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1v77-A 42.2  0.0  202   202  100 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
   2:  3mtw-A 17.2  2.8  188   404   15 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   3:  3mkv-A 16.5  2.8  185   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   4:  4c5y-A 16.2  2.8  187   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
   5:  2oof-A 16.0  2.6  178   403   10 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   6:  1k6w-A 14.5  3.0  185   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   7:  1m65-A 14.5  2.9  174   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   8:  2vun-A 14.2  2.6  178   385    7 PDB  MOLECULE: ENAMIDASE;                                                 
   9:  3au2-A 14.1  2.9  176   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  10:  4cqb-A 14.0  2.8  177   402    7 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  11:  2paj-A 13.8  2.8  175   421    6 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  12:  3qy6-A 13.8  2.9  181   247   14 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  13:  1j6p-A 13.7  2.7  182   407    5 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  14:  3ls9-A 13.5  2.8  180   453    8 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  15:  2imr-A 13.3  2.7  179   380    7 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  16:  4mup-B 13.1  3.1  181   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  17:  3icj-A 13.1  3.4  178   468    8 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  18:  4dlf-A 12.6  3.3  183   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  19:  3cjp-A 12.4  3.1  167   262   11 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  20:  2ogj-A 12.4  3.5  181   379    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  3dcp-A 12.3  2.7  164   277   12 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  22:  1yrr-B 12.1  3.1  175   334   10 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  23:  2y1h-B 12.0  3.3  172   265   10 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  24:  1bf6-A 11.8  3.4  177   291    5 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  25:  2uz9-A 11.8  2.9  179   444    9 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  26:  1a4m-A 11.8  3.4  181   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  27:  2ob3-A 11.7  3.5  179   329    6 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  28:  1gkp-A 11.6  3.8  182   458    9 PDB  MOLECULE: HYDANTOINASE;                                              
  29:  3gg7-A 11.5  3.1  168   243    7 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  30:  3f2b-A 11.4  3.3  161   994   12 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  31:  2ffi-A 11.4  3.3  178   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  32:  3k2g-B 11.4  3.5  176   358    7 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  33:  3ooq-A 11.3  3.3  171   384   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  34:  3nqb-A 11.3  3.3  173   587   12 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  35:  3gri-A 11.3  3.9  183   422   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  36:  4b3z-D 11.1  3.9  182   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  37:  2vc5-A 10.9  3.6  174   314    9 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  38:  4rdv-B 10.9  2.9  181   451    7 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  39:  3irs-A 10.5  3.6  169   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  40:  1onx-A 10.4  3.4  181   390   10 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  41:  3e74-A 10.4  3.9  183   429    9 PDB  MOLECULE: ALLANTOINASE;                                              
  42:  3giq-A 10.2  3.7  181   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  43:  4hk5-D 10.1  3.3  167   380    8 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  44:  1a5k-C 10.1  3.0  172   566    9 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  2a3l-A  9.6  3.3  175   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  46:  3pnu-A  9.4  3.5  179   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  47:  2dvt-A  9.3  3.4  162   325    6 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  48:  2qpx-A  9.0  3.7  170   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  49:  1itq-A  8.6  4.2  181   369    8 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  50:  4qrn-A  8.4  3.5  164   352    7 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  51:  4ofc-A  8.1  3.5  157   335    8 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  52:  2gwg-A  8.1  3.8  160   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  53:  4dzi-C  7.9  3.4  161   388    9 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  54:  2yb1-A  7.2  3.7  140   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  55:  1j5s-A  7.1  3.3  169   451    5 PDB  MOLECULE: URONATE ISOMERASE;                                         
  56:  3e38-A  6.8  3.5  135   342    5 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  57:  2anu-A  6.8  3.3  131   224   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3iac-A  5.3  3.7  158   469    7 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  59:  1bks-A  4.8  3.5  117   255   15 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1v77A Sbjct=1v77A Z-score=42.2

back to top
DSSP  LLLEEEEELLHHHHHHHHHHLLEEEEEEEELLLLLHHHHHHHHHHHLLEEEEEELLLHHH
Query VKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSL   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSL   60
DSSP  LLLEEEEELLHHHHHHHHHHLLEEEEEEEELLLLLHHHHHHHHHHHLLEEEEEELLLHHH


DSSP  HHHHHHHLLLLEEEEELLLHHHHHHHHHLLLLEEELLLLLLLLLLLLHHHHHHHHHHLLE
Query VRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVA  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVA  120
DSSP  HHHHHHHLLLLEEEEELLLHHHHHHHHHLLLLEEELLLLLLLLLLLLHHHHHHHHHHLLE


DSSP  EEEELHHHHHLLHHHHHHHHHHHHHHHHHHHHHLLLEEEELLLLLHHHLLLHHHHHHHHH
Query LGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGV  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGV  180
DSSP  EEEELHHHHHLLHHHHHHHHHHHHHHHHHHHHHLLLEEEELLLLLHHHLLLHHHHHHHHH


DSSP  HLLLLHHHHHHLLLHHHHHHHL
Query VIGMEIPQAKASISMYPEIILK  202
ident ||||||||||||||||||||||
Sbjct VIGMEIPQAKASISMYPEIILK  202
DSSP  HLLLLHHHHHHLLLHHHHHHHL


No 2: Query=1v77A Sbjct=3mtwA Z-score=17.2

back to top
DSSP  ---------------------------------------------------------LLL
Query ---------------------------------------------------------VKF    3
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE


DSSP  EEEEELLHH-----------------------HHHHHHHH-LLEEEEEE-----------
Query IEMDIRDKE-----------------------AYELAKEW-FDEVVVSI-----------   28
ident | |                                   |  |  |               
Sbjct IDMHVHLDSlaevggynsleysdrfwsvvqtaNAKKTLEAgFTTVRNVGaadyddvglre  120
DSSP  EEEEELLLLlllllhhhhhhllhhhhhhhhhhHHHHHHHLlEEEEEELLllllhhhhhhh


DSSP  -----------------EELL-----------------------------lLLHHHHHHH
Query -----------------KFNE-----------------------------eVDKEKLREA   42
ident                   |                                         
Sbjct aidagyvpgprivtaaiSFGAtgghcdstffppsmdqknpfnsdspdearkAVRTLKKYG  180
DSSP  hhhllllllleeeelllLEELlllllllllllhhhllllllllllhhhhhhHHHHHHHLL


DSSP  HhhhllEEEEEEL---------------LLHHHHHHHHHHLL--LLEEEEELLLHHHHHH
Query RkeygkVAILLSN---------------PKPSLVRDTVQKFK--SYLIYVESNDLRVIRY   85
ident         |                            |                   || 
Sbjct A-----QVIXICAtggvfsrgnepgqqqLTYEEMKAVVDEAHmaGIKVAAHAHGASGIRE  235
DSSP  L-----LEEEEELlllllllllllllllLLHHHHHHHHHHHHhlLLEEEEEELLHHHHHH


DSSP  HHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHL-----------LH
Query SIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYS-----------NP  133
ident     ||| |            |    || | |                          | 
Sbjct AVRAGVDTIEHAS------LVDDEGIKLAVQKGAYFSMDiYNTDYTQaegkkngvledNL  289
DSSP  HHHLLLLEEEELL------LLLHHHHHHHHHHLLEEELLlLLHHHHHhhhhhhlllhhHH


DSSP  HHHHHHHHHHHHHHHHHHHHLLLEEEELLLLLhHHLLLHhHHHHHHHHLLLLHHHHHHLL
Query YERANLLRFMMKAWKLVEKYKVRRFLTSSAQEkWDVRYPrDLISLGVVIGMEIPQAKASI  193
ident                   |  |       |                |  |    ||  | 
Sbjct RKDRDIGELQRENFRKALKAGVKMVYGTDAGIyPHGDNA-KQFAVMVRYGATPLQAIQSA  348
DSSP  HHHHHHHHHHHHHHHHHHHHLLEEELLLLLLLlLLLLHH-HHHHHHHHLLLLHHHHHHHL


DSSP  LHHHHHHHL-----------------------------------------------
Query SMYPEIILK-----------------------------------------------  202
ident        |                                                
Sbjct TLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  LHHHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeeelll


No 3: Query=1v77A Sbjct=3mkvA Z-score=16.5

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------VKFI    4
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE


DSSP  EEEELLH----------------------hHHHHHHHH-LLEEEEEE-------------
Query EMDIRDK----------------------eAYELAKEW-FDEVVVSI-------------   28
ident                                        |  |                 
Sbjct DLHVHVVaiefnlprvatlpnvlvtlravpIMRAMLRRgFTTVRDAGgagypfkqavesg  120
DSSP  EEEELLLlllllhhhhllllhhhhhhhhhhHHHHHHHLlEEEEEELLlllhhhhhhhhll


DSSP  ------------EELL----------------------------------------lLLH
Query ------------KFNE----------------------------------------eVDK   36
ident                                                             
Sbjct lvegprlfvsgrALSQtgghadprarsdymppdspcgccvrvgalgrvadgvdevrrAVR  180
DSSP  llllleeeelllEEELllllllllllllllllllllllllllllleeelllhhhhhhHHH


DSSP  HHHHHHHhhhllEEEEEEL--------------LLHH-HHHHHHHHLL--LLEEEEELLL
Query EKLREARkeygkVAILLSN--------------PKPS-LVRDTVQKFK--SYLIYVESND   79
ident | |           |                         |  |                
Sbjct EELQMGA-----DQIXIMAsggvasptdpvgvfGYSEdEIRAIVAEAQgrGTYVLAHAYT  235
DSSP  HHHHHLL-----LLEEEELllllllllllllllLLLHhHHHHHHHHHHllLLLEEEEELL


DSSP  HHHHHHHHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHL-------
Query LRVIRYSIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYS-------  131
ident    |      ||  |           ||   | |                          
Sbjct PAAIARAVRCGVRTIEHGN------LIDDETARLVAEHGAYVVPTlVTYDALAsegekyg  289
DSSP  HHHHHHHHHLLLLEEEELL------LLLHHHHHHHHHHLLEEELLhHHHHHHHhhlllll


DSSP  ----LHHHHHHHHHHHHHHHHHHHHHLLLEEEELLLLL--HHHLLlhhHHHHHHHHlLLL
Query ----NPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQE--KWDVRyprDLISLGVViGME  185
ident          |                 |                    |           
Sbjct lppeSIAKIADVHGAGLHSIEIMKRAGVKMGFGTDLLGeaQRLQS---DEFRILAE-VLS  345
DSSP  llhhHHLLHHHHHLLHHHHHHHHHHHLLLLLLLLLLLHhhHHHLL---HHHHHHHL-LLL


DSSP  HHHHHHLLLHHHHHHHL-------------------------------------------
Query IPQAKASISMYPEIILK-------------------------------------------  202
ident      ||        |                                            
Sbjct PAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkd  405
DSSP  HHHHHHHLLHHHHHHLLllllllllllllllleeeellllllllllllllllllleeeel


DSSP  ---------
Query ---------  202
ident          
Sbjct grlfvnele  414
DSSP  leeeeelll


No 4: Query=1v77A Sbjct=4c5yA Z-score=16.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLLEEEEELLHH-------------------------HHHHHHHH-LLEEEEEE------
Query VKFIEMDIRDKE-------------------------AYELAKEW-FDEVVVSI------   28
ident                                          |                  
Sbjct PGLWDCHMHFGGdddyyndytsglathpassgarlarGCWEALQNgYTSYRDLAgygcev  120
DSSP  ELEEEEEELLLLllllllllhhhhhllhhhhhhhhhhHHHHHHHLlEEEEEELLllhhhh


DSSP  -------------------EELL-------------------------------------
Query -------------------KFNE-------------------------------------   32
ident                                                             
Sbjct akaindgtivgpnvyssgaALSQtaghgdifalpagevlgsygvmnprpgywgagplcia  180
DSSP  hhhhhllllllleeeelllEEELlllllllllllhhhhhhhhlllllllllllllleeel


DSSP  -------lLLHHHHHHHHhhhllEEEEEEL---------------LLHHHHHHHHHHLL-
Query -------eVDKEKLREARkeygkVAILLSN---------------PKPSLVRDTVQKFK-   69
ident               |          |                     |      |     
Sbjct dgveevrrAVRLQIRRGA-----KVIXVMAsggvmsrddnpnfaqFSPEELKVIVEEAAr  235
DSSP  llhhhhhhHHHHHHHHLL-----LLEEEELlllllllllllllllLLHHHHHHHHHHHHh


DSSP  -LLEEEEELLLHHHHHHHHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHH
Query -SYLIYVESNDLRVIRYSIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRP  127
ident               |   |  |                |     ||  |           
Sbjct qNRIVSAHVHGKAGIMAAIKAGCKSLEHVS------YADEEVWELMKEKGILYVATrSVI  289
DSSP  lLLLEEEEELLHHHHHHHHHHLLLEEEELL------LLLHHHHHHHHHHLLEEELLhHHH


DSSP  HHHLL---------HHHHHH-HHHHHHHHHHHHHHHLLLEEEELLLLLHhhLLLHhHHHH
Query LLYSN---------PYERAN-LLRFMMKAWKLVEKYKVRRFLTSSAQEKwdVRYPrDLIS  177
ident                      |     ||     |  |   |                  
Sbjct EIFLAsngeglvkeSWAKLQaLADSHLKAYQGAIKAGVTIALGTDTAPG--GPTA-LELQ  346
DSSP  HHHHHhllllllllHHHLLLhHHHHHHHHHHHHHHLLLLEELLLLLLLL--LLLH-HHHH


DSSP  HHHHL-LLLHHHHHHLLLHHHHHHHL----------------------------------
Query LGVVI-GMEIPQAKASISMYPEIILK----------------------------------  202
ident   |   ||    |                                               
Sbjct FAVERgGMTPLEAIKAATANAPLSVGpqapltgqlregyeadvialeenpledikvfqep  406
DSSP  HHHHLlLLLHHHHHHHHLLLHHHHHHhhlllllllllllllleeeelllllllhhhhhlh


DSSP  ------------------------------
Query ------------------------------  202
ident                               
Sbjct kavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  hheeeeeelleeeellllllllllllllll


No 5: Query=1v77A Sbjct=2oofA Z-score=16.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  -LLLEEEEELLHH---------------------------------------------hh
Query -VKFIEMDIRDKE---------------------------------------------ay   14
ident     |                                                       
Sbjct tPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfelal  120
DSSP  eELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhllhhhhhhhhh


DSSP  HHHHHH----LLEEEEEEEellllLHHHHHHHHHHH----------LLEE----------
Query ELAKEW----FDEVVVSIKfneevDKEKLREARKEY----------GKVA----------   50
ident    |         |            |                    |            
Sbjct PRVKSLiregVTTVEIKSG--yglTLEDELKXLRVArrlgealpirVKTTllaahavppe  178
DSSP  HHHHHHhhhlEEEEEEELL--lllLHHHHHHHHHHHhhhhhhllleEEEEeeeellllhh


DSSP  ----------------------------EEEEL----LLHHHHHHHHHHLL--LLEEEEE
Query ----------------------------ILLSN----PKPSLVRDTVQKFK--SYLIYVE   76
ident                                                             
Sbjct yrddpdswveticqeiipaaaeagladaVDVFCehigFSLAQTEQVYLAADqyGLAVKGH  238
DSSP  hlllhhhhhhhhhhlhhhhhhhllllleEEEEEllllLLHHHHHHHHHHHHhlLLEEEEE


DSSP  L---LLHHHHHHHHHLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHLl
Query S---NDLRVIRYSIEKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYSn  132
ident       |         |                |           |              
Sbjct XdqlSNLGGSTLAANFGALSVDHLE------YLDPEGIQALAHRGVVATLLpTAFYFLK-  291
DSSP  ElllLLLLHHHHHHHLLLLEEEELL------LLLHHHHHHHHHHLLEEEELhHHHHHLL-


DSSP  hhhhhhHHHHHhhHHHHHHHHLLLEEEELLLLL--hHHLLlHHHHHHHHHH-LLLLHHHH
Query pyeranLLRFMmkAWKLVEKYKVRRFLTSSAQE--kWDVRyPRDLISLGVV-IGMEIPQA  189
ident                    |  |     |         |   |          |     |
Sbjct ------ETKLP--PVVALRKAGVPXAVSSDINPgtaPIVS-LRXAXNXACTlFGLTPVEA  342
DSSP  ------LLLLL--LHHHHHHLLLLEEELLLLLLlllLLLL-HHHHHHHHHHhHLLLHHHH


DSSP  HHLLLHHHHHHHL-----------------------------------------------
Query KASISMYPEIILK-----------------------------------------------  202
ident  |         |                                                
Sbjct XAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngeetl  402
DSSP  HHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlllllleeeeeelleell


DSSP  -
Query -  202
ident  
Sbjct h  403
DSSP  l


No 6: Query=1v77A Sbjct=1k6wA Z-score=14.5

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------VKFIEMDIR    9
ident                                                      | |  | 
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LHHH----------------------------------------HHHHHHH-LLEEEEEE
Query DKEA----------------------------------------YELAKEW-FDEVVVSI   28
ident                                                        |    
Sbjct LDTTqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtLKWQIANgIQHVRTHV  120
DSSP  LLLLlllllllllllllhhhhhhhhhllhhhllhhhhhhhhhhhHHHHHHLlEEEEEEEE


DSSP  ------------------------------EELLLL---------LHHHHHHHHhhhllE
Query ------------------------------KFNEEV---------DKEKLREARkeygkV   49
ident                                  |             | ||         
Sbjct dvsdatltalkamlevkqevapwidlqivaFPQEGIlsypngealLEEALRLGA-----D  175
DSSP  ellllllhhhhhhhhhhhhhlllleeeeeeELLLLLlllllhhhhHHHHHHLLL-----L


DSSP  EEEEELL-------LHHHHHHHHHHLL--LLEEEEELL-----lHHHHHHHHHLL-----
Query AILLSNP-------KPSLVRDTVQKFK--SYLIYVESN-----dLRVIRYSIEKG-----   90
ident                      |         || |          |              
Sbjct VVGAIPHfeftreyGVESLHKTFALAQkyDRLIDVHCDeiddeqSRFVETVAALAhhegm  235
DSSP  EEEELHHhlllhhhHHHHHHHHHHHHHhhLLEEEEEELllllllLLHHHHHHHHHhhhll


DSSP  --lLEEELLLLLLLL-lllLHHHHHHHHHHLLEEEEE-LHHHHH-LLHH-hhHHHHhhhh
Query --vDAIISPWVNRKD-pgiDHVLAKLMVKKNVALGFS-LRPLLY-SNPY-erANLLrfmm  144
ident                       |  |            |                     
Sbjct garVTASHTTAMHSYngayTSRLFRLLKMSGINFVANpLVNIHLqGRFDtypKRRG---i  292
DSSP  hhhEEEEELHHHHHLlhhhHHHHHHHHHHHLLEEEELhHHHHHHlLLLLlllLLLL---l


DSSP  hHHHHHHHHLLLEEEELLLLLH----HHLLLHHHHHHHHH-HLLL----LHHHHHHLLLH
Query kAWKLVEKYKVRRFLTSSAQEK----WDVRYPRDLISLGV-VIGM----EIPQAKASISM  195
ident    |                                  |  |        |      |  
Sbjct tRVKEMLESGINVCFGHDDVFDpwypLGTANMLQVLHMGLhVCQLmgygQINDGLNLITH  352
DSSP  lLHHHHHHLLLLEEELLLLLLLllllLLLLLHHHHHHHHHhHLLLllhhHHHHHHHHHLH


DSSP  HHHHHHL-----------------------------------------------------
Query YPEIILK-----------------------------------------------------  202
ident      |                                                      
Sbjct HSARTLNlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvy  412
DSSP  HHHHHLLllllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeee


DSSP  -----------
Query -----------  202
ident            
Sbjct leqpeaidykr  423
DSSP  llleeeellll


No 7: Query=1v77A Sbjct=1m65A Z-score=14.5

back to top
DSSP  llLEEEEELL----------HHHHHHHH-HHLLEEEEEEEELLL---lLHHHHHHHHHH-
Query vkFIEMDIRD----------KEAYELAK-EWFDEVVVSIKFNEE---vDKEKLREARKE-   45
ident                           ||                            |   
Sbjct -yPVDLHMHTvasthaystlSDYIAQAKqKGIKLFAITDHGPDMedapHHWHFINMRIWp   59
DSSP  -lLEELLLLLlllllllllhHHHHHHHHhHLLLEEEEEEELLLLllllLLHHHHHHHHLl


DSSP  ------hLLEEEEEELLL-HHHHhhHHHH--LLLL-EEEEEL-----------lLHHHHH
Query ------yGKVAILLSNPK-PSLVrdTVQK--FKSY-LIYVES-----------nDLRVIR   84
ident            |                   | |  ||                      
Sbjct rvvdgvgILRGIEANIKNvDGEI--DCSGkmFDSLdLIIAGFhepvfaphdkatNTQAMI  117
DSSP  leelleeEEEEEEEELLLlLLLL--LLLHhhHHHLlEEEEELlllllllllhhhHHHHHH


DSSP  HHHHLL-LLEEELLLLLLLLlLLLHHHHHHHHHHLLEEEEELHHhhhllhhhhhhhhhHH
Query YSIEKG-VDAIISPWVNRKDpGIDHVLAKLMVKKNVALGFSLRPllysnpyeranllrFM  143
ident   |  | |  |  |             |    |  |||                      
Sbjct ATIASGnVHIISHPGNPKYE-IDVKAVAEAAAKHQVALEINNSS--------------NC  162
DSSP  HHHHLLlLLEELLLLLLLLL-LLHHHHHHHHHHHLLEEEEELLL--------------LH


DSSP  HHHHHHHHHHLLLEEEELLLLLHHHLLlhhhHHHHHHHLL----LLHHHhhHLLLH--HH
Query MKAWKLVEKYKVRRFLTSSAQEKWDVRyprdLISLGVVIG----MEIPQakASISM--YP  197
ident       |        | |                    |                     
Sbjct REVAAAVRDAGGWVALGSDSHTAFTMG----EFEECLKILdavdFPPER--ILNVSprRL  216
DSSP  HHHHHHHHHHLLLEEEELLLLLHHHLL----LLHHHHHHHhhllLLHHH--LHHHLhhHH


DSSP  HHHHL-------------
Query EIILK-------------  202
ident    |              
Sbjct LNFLEsrgmapiaefadl  234
DSSP  HHHHHhllllllhhhlll


No 8: Query=1v77A Sbjct=2vunA Z-score=14.2

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------V    1
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE


DSSP  LLEEEEELLH-----------HHHHHHHHH-LLEEEEEEE-------ellllLHHHHHHH
Query KFIEMDIRDK-----------EAYELAKEW-FDEVVVSIK-------fneevDKEKLREA   42
ident                           |                          |      
Sbjct GLLDTHVHVSggdyaprqktmDFISSALHGgVTTMISAGSphfpgrpkdaagTKALAITL  120
DSSP  LEEEEEELLLllleehhhleeLHHHHHHLLlEEEEEELLLlllllllllhhhHHHHHHHH


DSSP  HHHH----------LLEE-----------------------EEEE---lLLHHHHHHHHH
Query RKEY----------GKVA-----------------------ILLS---nPKPSLVRDTVQ   66
ident  | |             |                                 |      | 
Sbjct SKSYynarpagvkvHGGAvilekglteedfiemkkegvwivGEVGlgtiKNPEDAAPMVE  180
DSSP  HHHHhhllhhhleeELLEelllllllhhhhhhhhhlllleeEEELllllLLHHHHHHHHH


DSSP  HLL--LLEEEEELL----------LHHHHHHHhhlLLLEEELLLL---LLLLLLLLhHHH
Query KFK--SYLIYVESN----------DLRVIRYSiekGVDAIISPWV---NRKDPGIDhVLA  111
ident                                      |                 |    
Sbjct WAHkhGFKVQMHTGgtsipgsstvTADDVIKT---KPDVVSHINGgptAISVQEVD-RIM  236
DSSP  HHHhlLLEEEEELLllllllllllLHHHHHHH---LLLEEELLLLlllLLLHHHHH-HHH


DSSP  HHHhhhLLEEEEELHHhhhllhhhhhhHHHHHHHHHHHHHHHLL--LEEEELLLLL--HH
Query KLMvkkNVALGFSLRPllysnpyeranLLRFMMKAWKLVEKYKV--RRFLTSSAQE--KW  167
ident         |                                     |      |      
Sbjct DET---DFAMEIVQCG-----------NPKIADYVARRAAEKGQlgRVIFGNDAPSgtGL  282
DSSP  HHL---LLEEEEELLL-----------LHHHHHHHHHHHHHHLLhhHEEEELLLLLllLL


DSSP  HLLLHHHHHHHHH-HLLLLHHHHHHLLLHHHHHHHL------------------------
Query DVRYPRDLISLGV-VIGMEIPQAKASISMYPEIILK------------------------  202
ident                       |                                     
Sbjct IPLGILRNMCQIAsMSDIDPEVAVCMATGNSTAVYGlntgviapgkeadliimdtplgsv  342
DSSP  LLLHHHHHHHHHHhHLLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeellllll


DSSP  -------------------------------------------
Query -------------------------------------------  202
ident                                            
Sbjct aedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  lllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 9: Query=1v77A Sbjct=3au2A Z-score=14.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -----------------------------------LLLEEEEELL---------HHHHHH
Query -----------------------------------VKFIEMDIRD---------KEAYEL   16
ident                                                        |  | 
Sbjct yaalglpwippplredqgeveaalegrlpkllelpQVKGDLQVHStysdgqntlEELWEA  360
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhHLLEEEEELLllllllllhHHHHHH


DSSP  HHHH-LLEEEEEEEEL-------LLLL--HHHHHHHHHHH-------LLEEEEEELLL-H
Query AKEW-FDEVVVSIKFN-------EEVD--KEKLREARKEY-------GKVAILLSNPK-P   58
ident ||        |                       | |                       
Sbjct AKTMgYRYLAVTDHSPavrvaggPSPEeaLKRVGEIRRFNethgppyLLAGAEVDIHPdG  420
DSSP  HHHHlLLEEEEEEELHhhhllllLLHHhhHHHHHHHHHHHhhhllleEEEEEEEELLLlL


DSSP  HHHhhHHHH-LLLL-EEEEELL---------LHHHHHHHHHLL-LLEEELLLL-------
Query SLVrdTVQK-FKSY-LIYVESN---------DLRVIRYSIEKG-VDAIISPWV-------   99
ident  |             |  |                     |   |     |         
Sbjct TLD--YPDWvLRELdLVLVSVHsrfnlpkadQTKRLLKALENPfVHVLAHPTArllgrra  478
DSSP  LLL--LLHHhHLLLlEEEEELLllllllhhhHHHHHHHHHLLLlLLEELLLLLlllllll


DSSP  LLLLlllLHHHHHHHHHHLLEEEEELHHHhhllhhhhhhhhhhHHHHHHHHHHHLLLEEE
Query NRKDpgiDHVLAKLMVKKNVALGFSLRPLlysnpyeranllrfMMKAWKLVEKYKVRRFL  159
ident                  | ||                                      |
Sbjct PIEA--dWEAVFQKAKEKGVAVEIDGYYD----------rmdlPDDLARMAYGMGLWISL  526
DSSP  LLLL--lHHHHHHHHHHHLLEEEEELLLL----------llllLHHHHHHHHHLLLLEEE


DSSP  ELLLLLHHHLLlhhHHHHHHHHLL--LLHHHhhHLLLH----hhHHHHL----
Query TSSAQEKWDVRyprDLISLGVVIG--MEIPQakASISM----ypEIILK----  202
ident    |      |                  |                       
Sbjct STDAHQTDHLR---FMELAVGTAQraWIGPE-rVLNTLdyedllSWLKArrgv  575
DSSP  ELLLLLHHHHH---HHHHHHHHHHhlLLLLL-lLHHHLlhhhhhHHHHLllll


No 10: Query=1v77A Sbjct=4cqbA Z-score=14.0

back to top
DSSP  ----------------------------------------------------LLLEEEEE
Query ----------------------------------------------------VKFIEMDI    8
ident                                                       |     
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE


DSSP  LLH--------------------------------------------HHHHHHHHH-LLE
Query RDK--------------------------------------------EAYELAKEW-FDE   23
ident                                                |            
Sbjct HMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrhviEHAHMQVLHgTLY  120
DSSP  LHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhhhhHHHHHHHHLlEEE


DSSP  EEEEE-------------------------------EELLLL---------LHHHHHHHH
Query VVVSI-------------------------------KFNEEV---------DKEKLREAR   43
ident                                                        |    
Sbjct TRTHVdvdsvaktkaveavleakeelkdlidiqvvaFAQSGFfvdleseslIRKSLDMGC  180
DSSP  EEEEEelllllllhhhhhhhhhhhhllllleeeeeeELLLLLlllllhhhhHHHHHHHLL


DSSP  hhhllEEEEEELL------LHHHHHHHHHHLL--LLEEEEELL-----LHHHHHHHHHLL
Query keygkVAILLSNP------KPSLVRDTVQKFK--SYLIYVESN-----DLRVIRYSIEKG   90
ident             |                  |     |              |     | 
Sbjct -----DLVGGVDPatrennVEGSLDLCFKLAKeyDVDIDYHIHdigtvGVYSINRLAQKT  235
DSSP  -----LEEELLLLllllllHHHHHHHHHHHHHhlLLEEEEEELllhhhHHHHHHHHHHHH


DSSP  -------lLEEELLLLLLLL-lllLHHHHHHHHHHLLEEEEELHHhhhllhhhhhhHHHH
Query -------vDAIISPWVNRKD-pgiDHVLAKLMVKKNVALGFSLRPllysnpyeranLLRF  142
ident               |               |                             
Sbjct iengykgrVTTSHAWCFADApsewLDEAIPLYKDSGMKFVTCFSS----------tPPTM  285
DSSP  hhllllllEEEEELLHHHHLlhhhHHHHHHHHHHHLLEEEEELLL----------lLLLL


DSSP  hhhHHHHHHHHLLLEEEELLLLL----hHHLLLHHHHHHHHHHLL-----lLHHHHHHLL
Query mmkAWKLVEKYKVRRFLTSSAQE----kWDVRYPRDLISLGVVIG-----mEIPQAKASI  193
ident                   |                                        |
Sbjct ---PVIKLLEAGINLGCASDNIRdfwvpFGNGDMVQGALIETQRLelktnrDLGLIWKMI  342
DSSP  ---LHHHHHHLLLEEEEELLLLLlllllLLLLLHHHHHHHHHHHHllllhhHHHHHHHHH


DSSP  LHHHHHHHL---------------------------------------------------
Query SMYPEIILK---------------------------------------------------  202
ident        |                                                    
Sbjct TSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  LHHHHHHHLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 11: Query=1v77A Sbjct=2pajA Z-score=13.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  LLLEEEEELLH-----------------------HHHHHHHHH-LLEEEE----------
Query VKFIEMDIRDK-----------------------EAYELAKEW-FDEVVV----------   26
ident                                                |            
Sbjct PAWVNTHHHLFqsllkgepfralfderrfrlaarIGLIELARSgCATVADhnyvyypgmp  120
DSSP  ELEELLLLLHHhhhllllllhhhllhhhhhhhhhHHHHHHHLLlEEEEEEllllllllll


DSSP  --------------------EEEELL--------------------LLLH--HHHHHHHH
Query --------------------SIKFNE--------------------EVDK--EKLREARK   44
ident                                                |            
Sbjct fdssailfeeaeklglrfvlLRGGATqtrqleadlptalrpetldaYVADieRLAARYHD  180
DSSP  llhhhhhhhhhhhllleeeeEELLLLllllllllllhhhllllhhhHHHHhhHHHHHLLL


DSSP  ----hhLLEEEEEELL----LHHHHHHHHHHLL--LLEEEEELLlhHHHHHHH--HLLL-
Query ----eyGKVAILLSNP----KPSLVRDTVQKFK--SYLIYVESNdlRVIRYSI--EKGV-   91
ident         |            |   | |                                
Sbjct aspramRRVVMAPTTVlysiSPREMRETAAVARrlGLRMHSHLSgkSPVAFCGehDWLGs  240
DSSP  llllllEEEEELLLLLllllLHHHHHHHHHHHHhlLLEEEEELLllLHHHHHHhlLLLLl


DSSP  -LEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHHllhhhhhhhhhhhhhHHHH
Query -DAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLYsnpyeranllrfmmkAWKL  149
ident                 |     |                                     
Sbjct dVWYAHLV------KVDADEIALLAQTGTGVAHCpQSNGRL---------------PVRE  279
DSSP  lEEEELLL------LLLHHHHHHHHHHLLEEEELhHHHHLL---------------LLLL


DSSP  HHHHLLLEEEELLLLL-hHHLLlHHHHHHHHHHLL----LLHHHHHHLLLHHHHHHHL--
Query VEKYKVRRFLTSSAQE-kWDVRyPRDLISLGVVIG----MEIPQAKASISMYPEIILK--  202
ident      |                                   |                  
Sbjct MADAGVPVSIGVDGAAsnEAAD-MISEVHMTWLAQrarlASIAEVIHWGTAGGARVMGld  338
DSSP  HHHHLLLEEELLLHHHhlLLLL-HHHHHHHHHHHHhhllLLHHHHHHHHLHHHHHHHLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct evgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddlieg  398
DSSP  lllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeellllll


DSSP  -----------------------
Query -----------------------  202
ident                        
Sbjct vdikelggearrvvrellrevvv  421
DSSP  llhhhhhhhhhhhhhhhhhhhhl


No 12: Query=1v77A Sbjct=3qy6A Z-score=13.8

back to top
DSSP  llLEEEEELL--------------HHHHHHHHH-HLLEEEEEEEELL---LLLHHHHHHH
Query vkFIEMDIRD--------------KEAYELAKE-WFDEVVVSIKFNE---EVDKEKLREA   42
ident    |                     |    |              |           |||
Sbjct --MIDIHCHIlpamddgagdsadsIEMARAAVRqGIRTIIATPHHNNgvyKNEPAAVREA   58
DSSP  --LEELLLLLllllllllllhhhhHHHHHHHHHlLLLEEELLLEELLlllLLLHHHHHHH


DSSP  HHHH------------LLEEEEEElLLHHhHHHHHHHLLLLE------EEEELL---LHH
Query RKEY------------GKVAILLSnPKPSlVRDTVQKFKSYL------IYVESN---DLR   81
ident                               |     |           |  |       |
Sbjct ADQLnkrlikediplhVLPGQEIR-IYGE-VEQDLAKRQLLSlndtkyILIEFPfdhVPR  116
DSSP  HHHHhhhhhhllllleEELLLEEE-LLLL-HHHHHHLLLLLLhhhlleEEEELLlllLLL


DSSP  HHHHHHHL-----LLLEEELLLLLLLLL---lLLHHHHHHHhhhlLEEEEELHH--HHHL
Query VIRYSIEK-----GVDAIISPWVNRKDP---gIDHVLAKLMvkknVALGFSLRP--LLYS  131
ident                  |  |  ||           |         |             
Sbjct YAEQLFYDlqlkgYIPVIAHPERNREIRenpsLLYHLVEKG----AASQITSGSlaGIFG  172
DSSP  LHHHHHHHhhhllLEEEEELHHHLHHHHhllhHHHHHHHLL----LEEEEEHHHhlLLLL


DSSP  lhhhhHHHHHHHHHHHHHHhhhlLLEEEELLLLLHH--HLLLhHHHHHHHHHlLLLHHHH
Query npyerANLLRFMMKAWKLVekykVRRFLTSSAQEKW--DVRYpRDLISLGVViGMEIPQA  189
ident        |  |               |  | |                            
Sbjct -----KQLKAFSLRLVEAN----LIHFVASDAHNVKtrNFHT-QEALYVLEK-EFGSELP  221
DSSP  -----HHHHHHHHHHHHLL----LLLEEELLLLLLLllLLLH-HHHHHHHHH-HHLLHHH


DSSP  HHLLlHHHHHHHL--------------
Query KASIsMYPEIILK--------------  202
ident         |  |               
Sbjct YMLT-ENAELLLRnqtifrqppqpvkr  247
DSSP  HHHH-HHHHHHHLllllllllllllll


No 13: Query=1v77A Sbjct=1j6pA Z-score=13.7

back to top
DSSP  --------------------------------------------------LLLEEEEELL
Query --------------------------------------------------VKFIEMDIRD   10
ident                                                             
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH


DSSP  H--------------------------------------HHHHHHHHH-LLEEEEE----
Query K--------------------------------------EAYELAKEW-FDEVVVS----   27
ident                                         |            |      
Sbjct PxtllrgvaedlsfeewlfskvlpiedrltekxayygtiLAQXEXARHgIAGFVDXyfhe  120
DSSP  HhhhhllllllllhhhhhhllhhhhhllllhhhhhhhhhHHHHHHHLLlEEEEEEEellh


DSSP  -----------------EEELL-------LLLH--HHHHHHHHH--hLLEEEEEEL---L
Query -----------------IKFNE-------EVDK--EKLREARKE--yGKVAILLSN---P   56
ident                                        |         |          
Sbjct ewiakavrdfgxralltRGLVDsngddggRLEEnlKLYNEWNGFegrIFVGFGPHSpylC  180
DSSP  hhhhhhhhhhlleeeeeEEELLlllllllHHHHhhHHHHHHLLHhhlEEEEEEELLlllL


DSSP  LHHHHHHHHHHLL--LLEEEEEL-----LLHHhHHHHHHLLL----LEEELLLlllllLL
Query KPSLVRDTVQKFK--SYLIYVES-----NDLRvIRYSIEKGV----DAIISPWvnrkdPG  105
ident             |                           |                   
Sbjct SEEYLKRVFDTAKslNAPVTIHLyetskEEYD-LEDILNIGLkevkTIAAHCV-----HL  234
DSSP  LHHHHHHHHHHHHhhLLLEEEEElllllLLLL-LHHHHLLLLllllEEEEELL-----LL


DSSP  LLhHHHHHHHHHLLEEEEE-LHHHHHLlhhhhhhHHHHhhhHHHHHHHHLLLEEEELLLL
Query IDhVLAKLMVKKNVALGFS-LRPLLYSnpyeranLLRFmmkAWKLVEKYKVRRFLTSSAQ  164
ident                        |                              |     
Sbjct PE-RYFGVLKDIPFFVSHNpASNLKLG-------NGIA---PVQRXIEHGXKVTLGTDGA  283
DSSP  LH-HHHHHHLLLLEEEEELhHHHHHLL-------LLLL---LHHHHHHLLLEEEELLLLL


DSSP  L-hHHLLLHhHHHHHHHHLL-------LLHHHHHHLLLHHHHHHHL--------------
Query E-kWDVRYPrDLISLGVVIG-------MEIPQAKASISMYPEIILK--------------  202
ident               |                                             
Sbjct AsnNSLNLF-FEXRLASLLQkaqnprnLDVNTCLKXVTYDGAQAXGfksgkieegwnadl  342
DSSP  LllLLLLHH-HHHHHHHHHHhllllllLLHHHHHHHHLHHHHHHHLllllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct vvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelarie  402
DSSP  eeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhh


DSSP  -----
Query -----  202
ident      
Sbjct kelys  407
DSSP  hhhhl


No 14: Query=1v77A Sbjct=3ls9A Z-score=13.5

back to top
DSSP  --------------------------------------------------------LLLE
Query --------------------------------------------------------VKFI    4
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE


DSSP  EEEELLH---------------------------------------------HHHHHHHH
Query EMDIRDK---------------------------------------------EAYELAKE   19
ident                                                             
Sbjct NSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevarAVLLESLL  120
DSSP  EEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhHHHHHHHH


DSSP  H-LLEEEEE------------------------------EEELL----------------
Query W-FDEVVVS------------------------------IKFNE----------------   32
ident      |                                                      
Sbjct GgITTVADQhlffpgatadsyidatieaatdlgirfhaaRSSMTlgkseggfcddlfvep  180
DSSP  LlEEEEEEEellllllllllhhhhhhhhhhhhlleeeeeELLLLllhhhlllllhhhlll


DSSP  ---LLLH--HHHHHHHH----hhLLEEEEEEL---LLHHHHHHHHHHLL--LLEEEEELL
Query ---EVDK--EKLREARK----eyGKVAILLSN---PKPSLVRDTVQKFK--SYLIYVESN   78
ident     |                     |         || |     |              
Sbjct vdrVVQHclGLIDQYHEpepfgmVRIALGPCGvpyDKPELFEAFAQMAAdyDVRLHTHFY  240
DSSP  hhhHHHHhhHHHHHHLLllllllEEEEELLLLlllLLHHHHHHHHHHHHhhLLEEEEEEL


DSSP  ------------lhHHHHHHH--HLLL--LEEELLLllllllLLLHHHHHHHHHHLLEEE
Query ------------dlRVIRYSI--EKGV--DAIISPWvnrkdpGIDHVLAKLMVKKNVALG  122
ident                  |                                      ||  
Sbjct epldagmsdhlygmTPWRFLEkhGWASdrVWLAHAV------VPPREEIPEFADAGVAIA  294
DSSP  lllhhhhhhhhhllLHHHHHHhlLLLLllEEEEELL------LLLHHHHHHHHHHLLEEE


DSSP  EE-LHHHHHLlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLL-hHHLLLHhHHHHHHH
Query FS-LRPLLYSnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQE-kWDVRYPrDLISLGV  180
ident       |                                                  |  
Sbjct HLiAPDLRMG--------WGLA--PIREYLDAGITVGFGTTGSAsnDGGNLL-GDLRLAA  343
DSSP  ELhHHHHHLL--------LLLL--LHHHHHHLLLEEEELLLLLLllLLLLHH-HHHHHHH


DSSP  HLL-----------LLHHHHHHLLLHHHHHHHL---------------------------
Query VIG-----------MEIPQAKASISMYPEIILK---------------------------  202
ident                                |                            
Sbjct LAHrpadpnepekwLSARELLRMATRGSAECLGrpdlgvleegraadiacwrldgvdrvg  403
DSSP  HHLhhhllllhhhlLLHHHHHHHLLHHHHHHLLlllllllllllllleeeeelllhhhll


DSSP  --------------------------------------------------
Query --------------------------------------------------  202
ident                                                   
Sbjct vhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 15: Query=1v77A Sbjct=2imrA Z-score=13.3

back to top
DSSP  ------------------------------------------------------LLLEEE
Query ------------------------------------------------------VKFIEM    6
ident                                                             
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE


DSSP  EELLH--------------------------------HHHHHHHHH-LLEEEEE------
Query DIRDK--------------------------------EAYELAKEW-FDEVVVS------   27
ident                                                   |         
Sbjct HTHLDmsayefqalpyfqwipevvirgrhlrgvaaaqAGADTLTRLgAGGVGDIvwapev  120
DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllllhhhhhhHHHHHHHHLlLLLEEEEellhhh


DSSP  ---------------EEELL----------llLHHHHHHHHHH---hLLEEEEEEL---L
Query ---------------IKFNE----------evDKEKLREARKE---yGKVAILLSN---P   56
ident                                     |   |                   
Sbjct mdallaredlsgtlyFEVLNpfpdkadevfaaARTHLERWRRLerpgLRLGLSPHTpftV  180
DSSP  hhhhhlllllleeeeEEELLllhhhhhhhhhhHHHHHHHHHLLllllEEEEEEELLlllL


DSSP  LHHHHHHHHHHLL--LLEEEEELL------------------------------------
Query KPSLVRDTVQKFK--SYLIYVESN------------------------------------   78
ident    | |                                                      
Sbjct SHRLMRLLSDYAAgeGLPLQIHVAehptelemfrtgggplwdnrmpalyphtlaevigre  240
DSSP  LHHHHHHHHHHHHhhLLLLEEEELllhhhhhhhhhlllllhhhllhhhllllhhhhhlll


DSSP  ---lhHHHHHHH----HLLLLEEELLLllllllLLLHHHHHHHHHHLLEEEEE-LHHHHH
Query ---dlRVIRYSI----EKGVDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS-LRPLLY  130
ident         ||                                      |           
Sbjct pgpdlTPVRYLDelgvLAARPTLVHMV------NVTPDDIARVARAGCAVVTCpRSNHHL  294
DSSP  lllllLHHHHHHhhllHHHLLEEEELL------LLLHHHHHHHHHHLLLEEELhHHHHHL


DSSP  LlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLLhhHLLLHHHHHHHHHHLL--LLHHH
Query SnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQEkwDVRYPRDLISLGVVIG--MEIPQ  188
ident                 |       |   |             |                 
Sbjct E--------CGTF--DWPAFAAAGVEVALGTDSVAsgETLNVREEVTFARQLYpgLDPRV  344
DSSP  L--------LLLL--LHHHHHHLLLLEEELLLLHHhhLLLLLHHHHHHHHHHLllLLHHH


DSSP  HHHLLLHHHHHHHL----------------------
Query AKASISMYPEIILK----------------------  202
ident                                     
Sbjct LVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  HHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 16: Query=1v77A Sbjct=4mupB Z-score=13.1

back to top
DSSP  ---------------LLLEEEEELL---------------------HHHHHHHHH--HLL
Query ---------------VKFIEMDIRD---------------------KEAYELAKE--WFD   22
ident                                                | |         |
Sbjct lvrklsgtapnpafpRGAVDTQMHMylpgypalpggpglppgalpgPEDYRRLMQwlGID   60
DSSP  lllllllllllllllLLLEELLLLLlllllllllllllllllllllHHHHHHHHHhhLLL


DSSP  EEEEEEEEllllLHHHhHHHHHHHL------LEEE----------------------EEE
Query EVVVSIKFneevDKEKlREARKEYG------KVAI----------------------LLS   54
ident  |                                                          
Sbjct RVIITQGN--ahQRDN-GNTLACVAemgeaaHAVViidatttekdmekltaagtvgaRIM  117
DSSP  EEEEELLH--hhLLLL-HHHHHHHHhhhhheEEEElllllllhhhhhhhhhlleeeeEEE


DSSP  L------LLHHhHHHHHHHLL--LLEEEEELL--LHHHHHhhHHLL--LLEEE-LLLLLL
Query N------PKPSlVRDTVQKFK--SYLIYVESN--DLRVIRysIEKG--VDAII-SPWVNR  101
ident                             |      |        |               
Sbjct DlpggavNLSE-LDAVDERAHaaDWMVAVQFDgnGLLDHLprLQKIrsRWVFDhHGKFFK  176
DSSP  LllllllLHHH-HHHHHHHHHhlLLEEEEELLhhHHHHHHhhHHLLllEEEELhHHHLLL


DSSP  LL---lllLHHHHHHHHHHLLEEEEElHHHHhLLHH-hHHHHHHHHHHHHHHHHhhlLLE
Query KD---pgiDHVLAKLMVKKNVALGFSlRPLLySNPY-eRANLLRFMMKAWKLVEkykVRR  157
ident            | ||    |    |       |      |    |             | 
Sbjct GIrtdgpeMAALLKLIDRGNLWFKFA-GVYEsSRKSwpYADVAAFSRVIAAHAP---ERI  232
DSSP  LLllllhhHHHHHHHHHHLLEEEEEL-LHHHlLLLLllLHHHHHHHHHHHHHLH---HHE


DSSP  EEELLLLL--------hHHLLlhHHHHHHHHhLLLLHHHHHHLLLHHHHHHHL----
Query FLTSSAQE--------kWDVRypRDLISLGVvIGMEIPQAKASISMYPEIILK----  202
ident                   |    |                       ||   |    
Sbjct VWGTNWPHnsvretaayPDDA--RLAELTLG-WLPDEAARHRALVENPEALFKlspv  286
DSSP  EELLLLLLlllllhhhlLLHH--HHHHHHHL-LLLLHHHHHHHHLHHHHHHHLllll


No 17: Query=1v77A Sbjct=3icjA Z-score=13.1

back to top
DSSP  -----------------------------------------------------------L
Query -----------------------------------------------------------V    1
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE


DSSP  LLEEEEELLHHH------------------------------------------------
Query KFIEMDIRDKEA------------------------------------------------   13
ident  |        |                                                 
Sbjct AFFDSHLHLDELgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHHhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   13
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhlll


DSSP  ------------hHHHHHH-LLEEEEEEE----------------------elllLLHH-
Query ------------yELAKEW-FDEVVVSIK----------------------fneeVDKE-   37
ident              |         |                                    
Sbjct tvkdykhyiesaqEHLLSLgVHSVGFMSVgekalkalfeleregrlkmnvfaylsPELLd  240
DSSP  lhhhhhhhhhhhhHHHHHLlEEEEEEEEElhhhhhhhhhhhhlllllleeeeeelHHHHh


DSSP  ----hhhhHHHH--HLLEEEEEEL--------------------------LLHHHHHHHH
Query ----klreARKE--YGKVAILLSN--------------------------PKPSLVRDTV   65
ident                      |                                      
Sbjct kleelnlgKFEGrrLRIWGVXLFVdgslgartallsepytdnpttsgelvMNKDEIVEVI  300
DSSP  hhhhhlllLEELllEEEEEEEEELllllllllllllllllllllllllllLLHHHHHHHH


DSSP  HHLL--LLEEEEELLLHHHHHHHHHLL-----LLEEELLLllllllLLLHHHHHHHHHHL
Query QKFK--SYLIYVESNDLRVIRYSIEKG-----VDAIISPWvnrkdpGIDHVLAKLMVKKN  118
ident    |       |                       |                        
Sbjct ERAKplGLDVAVHAIGDKAVDVALDAFeeaefSGRIEHAS------LVRDDQLERIKELK  354
DSSP  HHHLllLLEEEEEELLHHHHHHHHHHHhhhllLLEEEELL------LLLHHHHHHHHHHL


DSSP  LEEEEE-LHHHHHLLHHH---hhhhHHHHhhHHHHHHHhLLLEEEELLLLLhhHLLLHHH
Query VALGFS-LRPLLYSNPYE---ranlLRFMmkAWKLVEKyKVRRFLTSSAQEkwDVRYPRD  174
ident |                                |                       |  
Sbjct VRISAQpHFIVSDWWIVNrvgeeraKWAY--RLKTLSS-ITKLGFSTDSPI--EPADPWV  409
DSSP  LEEEELlLHHHHLLLHHHhhhhhhhHHLL--LHHHHHH-HLLEEELLLLLL--LLLLHHH


DSSP  HHHHHHH-------LLLLHHHHHHLLLHHHHHHHL------------------------
Query LISLGVV-------IGMEIPQAKASISMYPEIILK------------------------  202
ident  |   |               |                                     
Sbjct SIDAAVNryvvdpgERVSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
DSSP  HHHHHHHlllllhhHLLLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll


No 18: Query=1v77A Sbjct=4dlfA Z-score=12.6

back to top
DSSP  LLLEEEEELL------------------------hHHHHHHHHH-LLEEEEEEEElllLL
Query VKFIEMDIRD------------------------kEAYELAKEW-FDEVVVSIKFneeVD   35
ident    |                                   |                    
Sbjct ALRIDSHQHFwryraadypwigagmgvlardylpdALHPLMHAQaLGASIAVQAR---AG   57
DSSP  LLLEEEEELLllllhhhllllllllhhhlllllhhHHHHHHHHLlLLEEEEELLL---LL


DSSP  HHHHHHHHHHH------lLEEE------------------------EEELL-------LH
Query KEKLREARKEY------gKVAI------------------------LLSNP-------KP   58
ident                    |                                        
Sbjct RDETAFLLELAcdeariaAVVGwedlrapqlaervaewrgtklrgfRHQLQdeadvraFV  117
DSSP  HHHHHHHHHHHllllleeEEEEllllllllhhhhhhlllllleeeeEELHHhlllhhhHH


DSSP  HH--hHHHHHHLL--LLEEEEELL--LHHHHHHHHHLL---lLEEE-LLLLL--------
Query SL--vRDTVQKFK--SYLIYVESN--DLRVIRYSIEKG---vDAII-SPWVN--------  100
ident         |       |   |      |                                
Sbjct DDadfARGVAWLQanDYVYDVLVFerQLPDVQAFCARHdahwLVLDhAGKPAlaefdrdd  177
DSSP  HLhhhHHHHHHHHhlLLEEEELLLhhHHHHHHHHHHHLllllEEEHhHHLLLhhhlllll


DSSP  --LLLL--LLLHhHHHHHhhhLLEEEEElHHHHHL------LHHHHHHHHHHHHHHHHHH
Query --RKDP--GIDHvLAKLMvkkNVALGFSlRPLLYS------NPYERANLLRFMMKAWKLV  150
ident              || |     |    |                           |    
Sbjct taLARWraALRE-LAALP---HVVCKLS-GLVTEAdwrrglRASDLRHIEQCLDAALDAF  232
DSSP  lhHHHHhhHHHH-HHLLL---LEEEEEL-LLLLLLllllllLHHHHHHHHHHHHHHHHHH


DSSP  HhhllLEEEELLLLL---hHHLL-lHHHHHHHHHHlLLLHHHHHHLLLHHHHHHHL--
Query EkykvRRFLTSSAQE---kWDVR-yPRDLISLGVViGMEIPQAKASISMYPEIILK--  202
ident      |    |                                 |             
Sbjct G--pqRLMFGSDWPVcllaASYDevASLVERWAES-RLSAAERSALWGGTAARCYAlp  287
DSSP  L--hhHEEELLLLLHhhhlLLHHhhHHHHHHHHHH-HLLHHHHHHHLLHHHHHHLLll


No 19: Query=1v77A Sbjct=3cjpA Z-score=12.4

back to top
DSSP  lLLEEEEELLHH---hHHHHHH--HLLEEEEE----------------------------
Query vKFIEMDIRDKE---aYELAKE--WFDEVVVS----------------------------   27
ident    |                      |                                 
Sbjct -LIIDGHTHVILpvekHIKIMDeaGVDKTILFstsihpetavnlrdvkkemkklndvvng   59
DSSP  -LLEEEEEELLLlhhhHHHHHHhhLLLEEEEElllllhhhlllhhhhhhhhhhhhhhhll


DSSP  ------------------------------EEELLL--------lLHHHH-HHHHhhhll
Query ------------------------------IKFNEE--------vDKEKL-REARkeygk   48
ident                                                |            
Sbjct ktnsmidvrrnsikeltnviqaypsryvgfGNVPVGlsendtnsyIEENIvNNKL-----  114
DSSP  lllllhhhhhhhhhhhhhhhhhlllleeeeELLLLLllhhhhhhhHHHHLlLLLL-----


DSSP  EEEE-EELL--LHHHHHHHHHHLL---LLEEEEEL---LLHHHHHHHHHLL------LLE
Query VAIL-LSNP--KPSLVRDTVQKFK---SYLIYVES---NDLRVIRYSIEKG------VDA   93
ident | |  |                     |  |         |  |    |           
Sbjct VGIGeLTPAsgQIKSLKPIFKYSMdsgSLPIWIHAfnpLVLQDIKEIAELCkafpkvPVI  174
DSSP  LEEEeELLLllLHHHHHHHHHHHHhllLLLEEELLlllLLHHHHHHHHHHHhhllllLEE


DSSP  E-ELLLlllllLLLLhHHHHHHHHH-LLEEEEELhhhhhllhhhhhhHHHHHHHHHHHHH
Query I-ISPWvnrkdPGIDhVLAKLMVKK-NVALGFSLrpllysnpyeranLLRFMMKAWKLVE  151
ident                     |     |  |  |                           
Sbjct LgHMGG-----SNWM-TAVELAKEIqNLYLDTSA-----------yfSTFVLKIVINELP  217
DSSP  EhHHHH-----HHHH-HHHHHHHHLlLEEEELLL-----------llLHHHHHHHHHHLL


DSSP  hhllLEEEELLLLLhhHLLLhhHHHHHHHHLLLLHHHHHHLLLHHHHHHHL-
Query kykvRRFLTSSAQEkwDVRYprDLISLGVVIGMEIPQAKASISMYPEIILK-  202
ident                         |            | |         |  
Sbjct ---lKCIFGTDMPF--GDLQ--LSIEAIKKMSNDSYVANAVLGDNISRLLNi  262
DSSP  ---lLEELLLLLLL--LLHH--HHHHHHHHHLLLHHHHHHHHLHHHHHHHLl


No 20: Query=1v77A Sbjct=2ogjA Z-score=12.4

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------VKFIE    5
ident                                                             
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE


DSSP  EEELLH-------HHHHHHHH--HLLEEEEEE-------------------------EEL
Query MDIRDK-------EAYELAKE--WFDEVVVSI-------------------------KFN   31
ident                             |                               
Sbjct LHVHIWhggtdisIRPSECGAerGVTTLVDAGsageanfhgfreyiiepsrerikafLNL  120
DSSP  EEELLLlllllllLLHHHLLHhhLEEEEEEELllllllhhhhhhhllllllleeeeeEEL


DSSP  LL---------------------lLHHHHHHHHHhhLLEEEEEEL-------lLHHHHHH
Query EE---------------------vDKEKLREARKeyGKVAILLSN-------pKPSLVRD   63
ident                           |   |       |                  |  
Sbjct GSiglvacnrvpelrdikdidldrILECYAENSE--HIVGLXVRAshvitgswGVTPVKL  178
DSSP  LLllllllllllllllhhhllhhhHHHHHHLLLL--LEEEEEEEElhhhhlllLLHHHHH


DSSP  HHHHLL--LLEEEEELLLHH-HHHHHHHLLL--LEEELL-LLLLlLLLL--LHHHHHHHH
Query TVQKFK--SYLIYVESNDLR-VIRYSIEKGV--DAIISP-WVNRkDPGI--DHVLAKLMV  115
ident      |       |             |     |              |  |  |  |  
Sbjct GKKIAKilKVPXXVHVGEPPaLYDEVLEILGpgDVVTHCfNGKS-GSSIxeDEDLFNLAE  237
DSSP  HHHHHHhhLLLEEEEELLLLlLHHHHHHHLLllLEEELLlLLLL-LLLLllLHHHHHHHH


DSSP  HH-LLEEEEELHHHhhllhhhhhhHHHHHHHHH-HHHHhhlllEEEELLLLLHHH---lL
Query KK-NVALGFSLRPLlysnpyeranLLRFMMKAW-KLVEkykvrRFLTSSAQEKWD---vR  170
ident       |                        |                            
Sbjct RCeGIRLDIGHGGA--------sfSFKVAEAAIaRGLL----pFSISTDLHGHSXnfpvW  285
DSSP  HLlLLEEELLLLLL--------llLHHHHHHHHhLLLL----lLLLLLLLLLLLLllllL


DSSP  LHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHL----------------------------
Query YPRDLISLGVVIGMEIPQAKASISMYPEIILK----------------------------  202
ident       |                   |                                 
Sbjct DLATTXSKLLSVDXPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleat  345
DSSP  LHHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeee


DSSP  ----------------------------------
Query ----------------------------------  202
ident                                   
Sbjct dsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeelleeeellllllll


No 21: Query=1v77A Sbjct=3dcpA Z-score=12.3

back to top
DSSP  lLLEEEEELL-----------HHHHHHHHHH-LLEEEEEEEELLL---------------
Query vKFIEMDIRD-----------KEAYELAKEW-FDEVVVSIKFNEE---------------   33
ident                       |    | |  |||                         
Sbjct -XKRDGHTHTefcphgthddvEEXVLKAIELdFDEYSIVEHAPLSsefxkntagdkeavt   59
DSSP  -LLEEEEELLllllllllllhHHHHHHHHHLlLLEEEEEEELLLLhhhhhllllllhhhh


DSSP  ------lLHHHHHHHHHHHL---------LEEEEEELLL--HHHHHHHHHH-LLLL-EEE
Query ------vDKEKLREARKEYG---------KVAILLSNPK--PSLVRDTVQK-FKSY-LIY   74
ident        |                                     ||             
Sbjct tasxaxsDLPYYFKKXNHIKkkyasdlliHIGFEVDYLIgyEDFTRDFLNEyGPQTdDGV  119
DSSP  lllllhhHHHHHHHHHHHHHhhllllleeEEEEEEELLLllHHHHHHHHHHhHHHLlEEE


DSSP  EELL---------------------------------------LHHHHHH-hhhlLLLEE
Query VESN---------------------------------------DLRVIRY-siekGVDAI   94
ident                                                |            
Sbjct LSLHflegqggfrsidfsaedynegivqfyggfeqaqlaylegVKQSIEAdlglfKPRRX  179
DSSP  EELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhhhHHHHHHLlllllLLLEE


DSSP  ELLLLLL---------------lllllLHHHHHHHHHHLLEEEEELHHHHHLLhhhHHHH
Query ISPWVNR---------------kdpgiDHVLAKLMVKKNVALGFSLRPLLYSNpyeRANL  139
ident                              |   |  |    | |    |           
Sbjct GHISLCQkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNTAGLFKPL---CGET  236
DSSP  LLLLHHHllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEELHHHHLLL---LLLL


DSSP  hhHHHHHHHHHHHHLLLEEEELLLLLHHHLLlhhHHHHHHhHLLLlhhhhhhlllhhhhh
Query lrFMMKAWKLVEKYKVRRFLTSSAQEKWDVRyprDLISLGvVIGMeipqakasismypei  199
ident      |   |           |      |                               
Sbjct -yPPKKIVTLASELQIPFVYGSDSHGVQDIG--rGYSTYC-QKLE---------------  277
DSSP  -lLLHHHHHHHHHLLLLEEEELLLLLHHHLL--lLHHHHH-HHLL---------------


DSSP  hhl
Query ilk  202
ident    
Sbjct ---  277
DSSP  ---


No 22: Query=1v77A Sbjct=1yrrB Z-score=12.1

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------VKFIEMDIR    9
ident                                                      ||     
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL


DSSP  LHH------------------HHHHHHHH-LLEEEEEEEelllLLHHHHHHHHHHH----
Query DKE------------------AYELAKEW-FDEVVVSIKfneeVDKEKLREARKEY----   46
ident                                               |             
Sbjct GCGgvqfndtaeavsvetleiMQKANEKSgCTNYLPTLI---tTSDELMKQGVRVMreyl  117
DSSP  EELleelllllllllhhhhhhHHHHHHLLlEEEEEEEEL---lLLHHHHHHHHHHHhhhh


DSSP  -------lLEEE----------------------EEEL-LLHHhhHHHHHHL--LLLEEE
Query -------gKVAI----------------------LLSN-PKPSlvRDTVQKF--KSYLIY   74
ident                                                   |         
Sbjct akhpnqalGLHLegpwlnaalvdflcenadvitkVTLApEMVP--AEVISKLanAGIVVS  175
DSSP  hhllllllLEEEellllllhhhhhhhhlhhheeeEEELhHHLL--HHHHHHHhhHLLEEE


DSSP  EE-LLLH-HHHHHHHHLLLLEEELLLL-LLLL------lLLLHhhHHHHHhhlLEEEEEL
Query VE-SNDL-RVIRYSIEKGVDAIISPWV-NRKD------pGIDHvlAKLMVkknVALGFSL  125
ident    ||            |                                      |   
Sbjct AGhSNATlKEAKAGFRAGITFATHLYNaMPYItgrepglAGAI--LDEAD---IYCGIIA  230
DSSP  ELlLLLLhHHHHHHHHHLEEEELLLLLlLLLLlllllhhHHHH--HHLLL---LEEEEEL


DSSP  HHHHhllhhhhhhHHHHHHHHHHHHHhhlLLEEEELLLLlhHHLLLHHHHHHHHH-HLLL
Query RPLLysnpyeranLLRFMMKAWKLVEkykVRRFLTSSAQekWDVRYPRDLISLGV-VIGM  184
ident   |                 |  |         |   |                |   | 
Sbjct DGLH--------vDYANIRNAKRLKG---DKLCLVTDAT-sGSSLTMIEGVRNLVeHCGI  278
DSSP  LLLL--------lLHHHHHHHHHHHH---HHEEEELLLL-lLLLLLHHHHHHHHHhHHLL


DSSP  LHHHHHHLLLHHHHHHHL--------------------------------------
Query EIPQAKASISMYPEIILK--------------------------------------  202
ident            ||                                           
Sbjct ALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  LHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeeelleeeeel


No 23: Query=1v77A Sbjct=2y1hB Z-score=12.0

back to top
DSSP  -LLLEEEEELLHH---------hhhHHHHH-LLEEEEEEE--------------------
Query -VKFIEMDIRDKE---------ayeLAKEW-FDEVVVSIK--------------------   29
ident  |                        ||       |                        
Sbjct gVGLVDCHCHLSApdfdrdlddvleKAKKAnVVALVAVAEhsgefekimqlseryngfvl   60
DSSP  lLLEEEEEELLLLhhhlllhhhhhhHHHHLlEEEEEELLLlhhhhhhhhhhhhhllllee


DSSP  -----ELLL-------------lLHHHHHHHHHhhLLEE-EEEELL--------------
Query -----FNEE-------------vDKEKLREARKeyGKVA-ILLSNP--------------   56
ident                                       |                     
Sbjct pclgvHPVQgldqrsvtlkdldvALPIIENYKD--RLLAiGEVGLDfsprfagtgeqkee  118
DSSP  eeellLLEElllleellhhhhhhHHHHHHHHLL--LLLEeEEEEEEllllllllhhhhhh


DSSP  LHHHHHHHHHHLL--LLEEEEELLL--HHHHHHHHHLLL--LEEELLLllllllLLLHhH
Query KPSLVRDTVQKFK--SYLIYVESND--LRVIRYSIEKGV--DAIISPWvnrkdpGIDHvL  110
ident          |  |       | |       |    | |                |     
Sbjct QRQVLIRQIQLAKrlNLPVNVHSRSagRPTINLLQEQGAekVLLHAFD------GRPS-V  171
DSSP  HHHHHHHHHHHHHhhLLLEEEEEELlhHHHHHHHHHLLLllEEEELLL------LLHH-H


DSSP  HHHHHHHLLEEEEELHHHhhllhhhhhhHHHHHHHHHHHHHhhllLEEEELLLLL-----
Query AKLMVKKNVALGFSLRPLlysnpyeranLLRFMMKAWKLVEkykvRRFLTSSAQE-----  165
ident |   |                             |  |          |           
Sbjct AMEGVRAGYFFSIPPSII----------RSGQKQKLVKQLP--ltSICLETDSPAlgpek  219
DSSP  HHHHHHLLLEEEELHHHH----------LLHHHHHHHHHLL--hhHEEELLLLLLlllll


DSSP  -hHHLLL-HHHHHHHHHHLL--lLHHHHHHLlLHHHHHHHL------
Query -kWDVRY-PRDLISLGVVIG--mEIPQAKASiSMYPEIILK------  202
ident                                                
Sbjct qvRNEPWnISISAEYIAQVKgisVEEVIEVT-TQNALKLFPklrhll  265
DSSP  llLLLHHhHHHHHHHHHHHHlllHHHHHHHH-HHHHHHHLLlhhhhl


No 24: Query=1v77A Sbjct=1bf6A Z-score=11.8

back to top
DSSP  ----LLLEEEEELLH------------------hhhhHHHHH----LLEEEEEEE-----
Query ----VKFIEMDIRDK------------------eayeLAKEW----FDEVVVSIK-----   29
ident                                                  |          
Sbjct sfdpTGYTLAHEHLHidlsgfknnvdcrldqyaficqEMNDLmtrgVRNVIEMTNrymgr   60
DSSP  llllLLEEEEEELLLeelhhhhllhhheellhhhhhhHHHHHhhllEEEEEELLLhhhll


DSSP  ----------------------ELLL----------------lLHHHHHH---hhHHHLL
Query ----------------------FNEE----------------vDKEKLRE---arKEYGK   48
ident                                                             
Sbjct naqfmldvmretginvvactgyYQDAffpehvatrsvqelaqeMVDEIEQgidgtELKAG  120
DSSP  lhhhhhhhhhhhlleeeeeellLLHHhlllhhhhllhhhhhhhHHHHHHLlllllLLLEE


DSSP  EEEEEELL-------LHHHHHHHHHHLL--LLEEEEELLlhHHHHHHHHLL--------l
Query VAILLSNP-------KPSLVRDTVQKFK--SYLIYVESNdlRVIRYSIEKG--------v   91
ident                                  |                          
Sbjct IIAEIGTSegkitplEEKVFIAAALAHNqtGRPISTHTSfsTMGLEQLALLqahgvdlsr  180
DSSP  EEEEEELLlllllhhHHHHHHHHHHHHHhhLLLEEEELHhhLLHHHHHHHHhhllllhhh


DSSP  LEEELLLLlllLLLLLhhHHHHHHHHLLEEEEE-LHHHhhllhhhHHHHHHHHHHHHHHH
Query DAIISPWVnrkDPGIDhvLAKLMVKKNVALGFS-LRPLlysnpyeRANLLRFMMKAWKLV  150
ident                |      |        |                            
Sbjct VTVGHCDL---KDNLD--NILKMIDLGAYVQFDtIGKN-------SYYPDEKRIAMLHAL  228
DSSP  EEELLLLL---LLLHH--HHHHHHHLLLEEEELlLLLL-------LLLLHHHHHHHHHHH


DSSP  HHHLL--LEEEELLLLLH--------HHLLlhhHHHH-HHHHLL---LLHHHHHHLLLHH
Query EKYKV--RRFLTSSAQEK--------WDVRyprDLIS-LGVVIG---MEIPQAKASISMY  196
ident        |  |                       |                         
Sbjct RDRGLlnRVMLSMDITRRshlkanggYGYD---YLLTtFIPQLRqsgFSQADVDVMLREN  285
DSSP  HHLLLhhHEEELLLLLLHhhlhhhllLLLL---HHHHlHHHHHHhllLLHHHHHHHHLHH


DSSP  HHHHHL
Query PEIILK  202
ident |     
Sbjct PSQFFQ  291
DSSP  HHHHLL


No 25: Query=1v77A Sbjct=2uz9A Z-score=11.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  --------LLLEEEEELLH---------------------------------------hH
Query --------VKFIEMDIRDK---------------------------------------eA   13
ident                |                                            
Sbjct lshheffmPGLVDTHIHASqysfagssidlpllewltkytfpaehrfqnidfaeevytrV  120
DSSP  llllleeeELEEEEEEEHHhhhhllllllllhhhhhhhlhhhhhhhhhlhhhhhhhhhhH


DSSP  HHHHHHH-LLEEEEEE-------------------------EELL--------------L
Query YELAKEW-FDEVVVSI-------------------------KFNE--------------E   33
ident                                                             
Sbjct VRRTLKNgTTTACYFAtihtdssllladitdkfgqrafvgkVCMDlndtfpeyketteeS  180
DSSP  HHHHHHLlEEEEEEELlllhhhhhhhhhhhhhhlleeeeelEELLlllllllllllhhhH


DSSP  LLH--HHHHHH---hHHHLLEEEEEEL---LLHHHHHHHHHHLL--LLEEEEELL-----
Query VDK--EKLREA---rKEYGKVAILLSN---PKPSLVRDTVQKFK--SYLIYVESN-----   78
ident          |         |              |        |     |          
Sbjct IKEteRFVSEMlqknYSRVKPIVTPRFslsCSETLMGELGNIAKtrDLHIQSHISenrde  240
DSSP  HHHhhHHHHHHhhhlLLLEEEEEEELLhhhLLHHHHHHHHHHHHhhLLEEEEEELllhhh


DSSP  ----------lhHHHHHHHHLLL----LEEELLLllllllLLLHHHHHHHHHHLLEEEEE
Query ----------dlRVIRYSIEKGV----DAIISPWvnrkdpGIDHVLAKLMVKKNVALGFS  124
ident                                                             
Sbjct veavknlypsykNYTSVYDKNNLltnkTVMAHGC------YLSAEELNVFHERGASIAHC  294
DSSP  hhhhhhhlllllLHHHHHHHLLLllllEEEEELL------LLLHHHHHHHHHHLLEEEEL


DSSP  -LHHHHHLlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLlhhHLLLHHHHHHHHHHLL
Query -LRPLLYSnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQekwDVRYPRDLISLGVVIG  183
ident     |  |          |       | |  |   |              | |   |   
Sbjct pNSNLSLS--------SGFL--NVLEVLKHEVKIGLGTDVA-ggYSYSMLDAIRRAVMVS  343
DSSP  hHHHHHLL--------LLLL--LHHHHHHLLLEEEELLLLL-llLLLLHHHHHHHHHHHH


DSSP  ------------LLHHHHHHLLLHHHHHHHL-----------------------------
Query ------------MEIPQAKASISMYPEIILK-----------------------------  202
ident                              |                              
Sbjct nillinkvneksLTLKEVFRLATLGGSQALGldgeignfevgkefdailinpkasdspid  403
DSSP  hhhhhlllllllLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllllllll


DSSP  -----------------------------------------
Query -----------------------------------------  202
ident                                          
Sbjct lfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  lllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 26: Query=1v77A Sbjct=1a4mA Z-score=11.8

back to top
DSSP  -----LLLEEEEELLH--------------------------------------------
Query -----VKFIEMDIRDK--------------------------------------------   11
ident          |                                                  
Sbjct tpafnKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
DSSP  lllllLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl


DSSP  ---------------------HHHHHHHHH-LLEEEEE----------------------
Query ---------------------EAYELAKEW-FDEVVVS----------------------   27
ident                      |  |         | |                       
Sbjct kfdyympviagcreaikriayEFVEMKAKEgVVYVEVRysphllanskvdpmpwnqtegd  120
DSSP  lhhhhhhhhlllhhhhhhhhhHHHHHHHHLlEEEEEEEellhhhllllllllhhhlllll


DSSP  ----------------------------EEELL----LLLH--HHHHHHHHHHLlEEEEE
Query ----------------------------IKFNE----EVDK--EKLREARKEYGkVAILL   53
ident                                            |           ||  |
Sbjct vtpddvvdlvnqglqegeqafgikvrsiLCCMRhqpsWSLEvlELCKKYNQKTV-VAMDL  179
DSSP  llhhhhhhhhhhhhhhhhhhhlleeeeeEEEELllhhHHHHhhHHHHHLLLLLE-EEEEE


DSSP  E-----llLHHH--HHHHHHHLL--LLEEEEEL---LLHHHHHHHHHL-LLLEEELLlll
Query S-----npKPSL--VRDTVQKFK--SYLIYVES---NDLRVIRYSIEK-GVDAIISPwvn  100
ident                               |         | |                 
Sbjct AgdetiegSSLFpgHVEAYEGAVknGIHRTVHAgevGSPEVVREAVDIlKTERVGHG---  236
DSSP  ElllllllHHHLhhHHHHHHHHHhhLLEEEEEElllLLHHHHHHHHHLlLLLEEEEL---


DSSP  lllLLLL--HHHHHHHHHHLLEEEEEL-HHHHHLlhhHHHHhhhhhHHHHHHHHHHLLLE
Query rkdPGID--HVLAKLMVKKNVALGFSL-RPLLYSnpyERANllrfmMKAWKLVEKYKVRR  157
ident            |     | |           |                |       |   
Sbjct ---YHTIedEALYNRLLKENMHFEVCPwSSYLTG-awDPKT-----THAVVRFKNDKANY  287
DSSP  ---HHHHhlHHHHHHHHHLLLEEEELHhHHHHLL-llLLLL-----LLHHHHHHHLLLLE


DSSP  EEELLLlLHHHlLLHHHHHHHHH-HLLLLHHHHHHLlLHHHHHHH---------------
Query FLTSSAqEKWDvRYPRDLISLGV-VIGMEIPQAKASiSMYPEIIL---------------  201
ident  |                        |      |                          
Sbjct SLNTDD-PLIFkSTLDTDYQMTKkDMGFTEEEFKRL-NINAAKSSflpeeekkellerly  345
DSSP  EELLLL-LLLLlLLHHHHHHHHHhLLLLLHHHHHHH-HHHHHHLLlllhhhhhhhhhhhh


DSSP  ---l
Query ---k  202
ident     
Sbjct reyq  349
DSSP  hhll


No 27: Query=1v77A Sbjct=2ob3A Z-score=11.7

back to top
DSSP  --------------lLLEEEEELLH-------------------------hHHHHHHH-H
Query --------------vKFIEMDIRDK-------------------------eAYELAKE-W   20
ident                 |                                      |    
Sbjct drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkalaekavrGLRRARAaG   60
DSSP  lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhhhhhhhhhHHHHHHHlL


DSSP  LLEEEEEEE--------------------------ELLL---------------lLHHHH
Query FDEVVVSIK--------------------------FNEE---------------vDKEKL   39
ident     |                                                       
Sbjct VRTIVDVSTfdigrdvsllaevsraadvhivaatgLWFDpplsmrlrsveeltqfFLREI  120
DSSP  LLEEEELLLhhhlllhhhhhhhhhhhlleeeleeeLLLLllhhhhlllhhhhhhhHHHHH


DSSP  -------HHHHhhhllEEEEEEL------lLHHHHHHHHHHLL--LLEEEEELL-lHHHH
Query -------REARkeygkVAILLSN------pKPSLVRDTVQKFK--SYLIYVESN-dLRVI   83
ident                   |                                      |  
Sbjct qygiedtGIRA-----GIIXVATtgkatpfQELVLKAAARASLatGVPVTTHTAasQRDG  175
DSSP  hllllllLLLL-----LEEEEELlllllhhHHHHHHHHHHHHHhhLLLEEEELLhhHLHH


DSSP  HHHHHLL--------lLEEELLLLllllLLLLhHHHHHHHHHLLEEEEE-LHHHhhLLHH
Query RYSIEKG--------vDAIISPWVnrkdPGIDhVLAKLMVKKNVALGFS-LRPLlySNPY  134
ident                   |                           |             
Sbjct EQQAAIFeseglspsrVCIGHSDD----TDDL-SYLTALAARGYLIGLDhIPYS--AIGL  228
DSSP  HHHHHHHhhllllhhhEEELLHHH----LLLH-HHHHHHHHLLLEEEELlLLLL--LLLL


DSSP  ---------hHHHHHHHHHHHHHHHHHHLL--LEEEELLLLL-----------------h
Query ---------eRANLLRFMMKAWKLVEKYKV--RRFLTSSAQE-----------------k  166
ident                       |                                     
Sbjct ednasasallGIRSWQTRALLIKALIDQGYmkQILVSNDWTFgfssyvtnimdvmdrvnp  288
DSSP  lllhhhhhhhLLLLHHHHHHHHHHHHHLLLhhHEEELLLLLLeellllllhhhhhhhhll


DSSP  HHLLlhhHHHH-HHHHLL---LLHHHHHHLLLHHHHHHHL----
Query WDVRyprDLIS-LGVVIG---MEIPQAKASISMYPEIILK----  202
ident                                   |   |     
Sbjct DGMA---FIPLrVIPFLRekgVPQETLAGITVTNPARFLSptlr  329
DSSP  LHHH---HHHHlHHHHHHhllLLHHHHHHHHLHHHHHHHLllll


No 28: Query=1v77A Sbjct=1gkpA Z-score=11.6

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------VKFIEMDIR    9
ident                                                      ||     
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  LH-------------HHHHHHHHH-LLEEEEE----------------------------
Query DK-------------EAYELAKEW-FDEVVVS----------------------------   27
ident                     |                                       
Sbjct IYlpfmatfakdtheTGSKAALMGgTTTYIEMccpsrnddalegyqlwkskaegnsycdy  120
DSSP  LLleelleellllhhHHHHHHHHLlEEEEEEEelllllllhhhhhhhhhhhhllllllee


DSSP  ---EEELLL------lLHHHHHHHHhhhlleEEEEEL-------LLHHHHHHHHHHLL--
Query ---IKFNEE------vDKEKLREARkeygkvAILLSN-------PKPSLVRDTVQKFK--   69
ident                   |                                 |    |  
Sbjct tfhMAVSKFdektegqLREIVADGI-----sSFXIFLsyknffgVDDGEMYQTLRLAKel  175
DSSP  eeeEELLLLlllhhhhHHHHHHLLL-----lEEEEEElllllllLLHHHHHHHHHHHHhh


DSSP  LLEEEEELLL-------------------------------HHHHHHHHHLL-----LLE
Query SYLIYVESND-------------------------------LRVIRYSIEKG-----VDA   93
ident                                                             
Sbjct GVIVTAHCENaelvgrlqqkllsegktgpewhepsrpeaveAEGTARFATFLettgaTGY  235
DSSP  LLEEEEEELLhhhhhhhhhhhhhlllllhhhllllllhhhhHHHHHHHHHHHhhhllEEE


DSSP  EELLLLlllLLLLLhhHHHHHH-HHLLEEEEELHHHHHLLHH-----------------H
Query IISPWVnrkDPGIDhvLAKLMV-KKNVALGFSLRPLLYSNPY-----------------E  135
ident           |  |                      |    |                  
Sbjct VVHLSC---KPALD-aAMAAKArGVPIYIESVIPHFLLDKTYaerggveamkyimspplR  291
DSSP  ELLLLL---HHHHH-hHHHHHHlLLLEEEEEEHHHHHLLHHHhhllhhhhhllllllllL


DSSP  HHHHHHHHHHHHHHHHhhlllEEEELLLLL------------------hHHLL--LHHHH
Query RANLLRFMMKAWKLVEkykvrRFLTSSAQE------------------kWDVR--YPRDL  175
ident           |                                                |
Sbjct DKRNQKVLWDALAQGF----iDTVGTDHCPfdteqkllgkeaftaipngIPAIedRVNLL  347
DSSP  LLHHHHHHHHHHHLLL----lLEEELLLLLllhhhhhhhlllhhhllllLLLLllHHHHH


DSSP  HHHHH-hlLLLHHHHHHLLLHHHHHHHL--------------------------------
Query ISLGV-viGMEIPQAKASISMYPEIILK--------------------------------  202
ident    ||      |       |                                        
Sbjct YTYGVsrgRLDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktq  407
DSSP  HHHHLlllLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhhl


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  202
ident                                                    
Sbjct hvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lllllllllllleelleeeeeeelleeeeelleelllllllllllllllll


No 29: Query=1v77A Sbjct=3gg7A Z-score=11.5

back to top
DSSP  lLLEEEEELLH------HHHHHHHHHLLEEEEEEEellllLHHHHHHHHHHH-----lLE
Query vKFIEMDIRDK------EAYELAKEWFDEVVVSIKfneevDKEKLREARKEY-----gKV   49
ident    |                    |    |               |              
Sbjct -SLIDFHVHLDlypdpvAVARACEERQLTVLSVTT-----TPAAWRGTLALAagrphvWT   54
DSSP  -LLEEEEELHHhlllhhHHHHHHHHLLLEEEELLL-----LHHHHHHHHHHHllllleEE


DSSP  EE----------------------------EEELL-----------LHHHHHHHHHHLL-
Query AI----------------------------LLSNP-----------KPSLVRDTVQKFK-   69
ident |                                                           
Sbjct ALgfhpevvseraadlpwfdrylpetrfvgEVGLDgspslrgtwtqQFAVFQHILRRCEd  114
DSSP  LLlllhhhllllhhhlhhhhhhhhhlleeeEEELLllhhhhhhhhhHHHHHHHHHHHHHh


DSSP  --LLEEEEELL-LHHHHHHHHHL----lLLEEELLLllllllLLLHhHHHHHHHHLLEEE
Query --SYLIYVESN-DLRVIRYSIEK----gVDAIISPWvnrkdpGIDHvLAKLMVKKNVALG  122
ident          |           |                    |                 
Sbjct hgGRILSIHSRrAESEVLNCLEAnprsgTPILHWYS------GSVT-ELRRAISLGCWFS  167
DSSP  llLEEEEEELLlLHHHHHHHHHHlhhheEEEEELLL------LLHH-HHHHHHHLLLEEE


DSSP  EELhhhhhllhhhhhhHHHHHHHHHHHHHhhllLEEEELLLL-----lHHHL-LLHHHHH
Query FSLrpllysnpyeranLLRFMMKAWKLVEkykvRRFLTSSAQ-----eKWDV-RYPRDLI  176
ident                                  |                          
Sbjct VGP----------tmvRTQKGAALIRSMP--rdRVLTETDGPfleldgQAALpWDVKSVV  215
DSSP  ELH----------hhhLLHHHHHHHHHLL--hhHEEELLLLLlleellEELLhHHHHHHH


DSSP  HHHHHLL-lLHHHHHHLLLHHHHHHHL-
Query SLGVVIG-mEIPQAKASISMYPEIILK-  202
ident      |                   |  
Sbjct EGLSKIWqiPASEVERIVKENVSRLLGt  243
DSSP  HHHHHHHllLHHHHHHHHHHHHHHHHHl


No 30: Query=1v77A Sbjct=3f2bA Z-score=11.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -----------------------------------------------LLLEEEEELL---
Query -----------------------------------------------VKFIEMDIRD---   10
ident                                                 |  |        
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTpms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLlll


DSSP  --------HHHHHHHHHH-LLEEEEEEEElllllhhHHHHHhHHHL----------LEEE
Query --------KEAYELAKEW-FDEVVVSIKFneevdkeKLREArKEYG----------KVAI   51
ident             | || |      |                  |                
Sbjct qmdavtsvTKLIEQAKKWgHPAIAVTDHA-------VVQSF-PEAYsaakkhgmkvIYGL  172
DSSP  lllllllhHHHHHHHHHLlLLLEEELLLL-------LLLLH-HHHHhhhhhhllleEEEE


DSSP  EEElLLHH-----------------------------------HHHHHHHHLLLLeeeee
Query LLSnPKPS-----------------------------------LVRDTVQKFKSYliyve   76
ident                                                 |           
Sbjct EAN-IVDDpfhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKHRDGL-----  226
DSSP  EEE-EELLleeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHLLLLE-----


DSSP  lllhhhhhhhhhllLLEEEL----LLLLllllllLHHHHHHHhhhlLEEEEEL-hHHHHL
Query sndlrvirysiekgVDAIIS----PWVNrkdpgiDHVLAKLMvkknVALGFSL-rPLLYS  131
ident                            |          |         |           
Sbjct --------------LVGSGCdkgeLFDN------VEDIARFY----DFLEVHPpdVYKPL  262
DSSP  --------------EEELLLllllLLLL------LLLLHHHL----LLEEELLhhHHLLL


DSSP  LHHHHHHHHHHHHHHHHHHHHHLLLEEEELLLLLHH------------------------
Query NPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKW------------------------  167
ident                  | ||       |                               
Sbjct YVKDEEMIKNIIRSIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhe  322
DSSP  LLLLHHHHHHHHHHHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllll


DSSP  ----HLLLHHHHHHHHHHllLLHHHHHHLLLHHHHHHHL---------------------
Query ----DVRYPRDLISLGVVigMEIPQAKASISMYPEIILK---------------------  202
ident       |                  ||         |                       
Sbjct lpdvYFRTTNEMLDCFSF--LGPEKAKEIVVDNTQKIASligdvkpikdelytpriegad  380
DSSP  llllLLLLHHHHHHHHHH--HHHHHHHHHHLHHHHHHHHlllllllllllllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct eeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylv  440
DSSP  hhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct gsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtk  500
DSSP  eelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct ykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvad  560
DSSP  leeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct ktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiq  620
DSSP  hhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhlllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct ypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvm  680
DSSP  lhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct gifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdv  740
DSSP  hlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct wlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeae  800
DSSP  llllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct mrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfd  860
DSSP  hhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct ldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqat  920
DSSP  hhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct efvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrg  980
DSSP  lleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhll


DSSP  --------------
Query --------------  202
ident               
Sbjct cldslpdhnqlslf  994
DSSP  llllllllllllll


No 31: Query=1v77A Sbjct=2ffiA Z-score=11.4

back to top
DSSP  --LLLEEEEELL---------------------hHHHHHHHHH-LLEEEEEEEEllllLH
Query --VKFIEMDIRD---------------------kEAYELAKEW-FDEVVVSIKFneevDK   36
ident      |                                      |   |           
Sbjct lhLTAIDSHAHVfsrglnlasqrryapnydaplgDYLGQLRAHgFSHGVLVQPS--flGT   58
DSSP  llLLLEELLLLLllhhhhhhllllllllllllhhHHHHHHHHLlLLEELLLLLH--hhLL


DSSP  HHhHHHHHHH------LLEE----------------------EEEEL---lLHHH----h
Query EKlREARKEY------GKVA----------------------ILLSN---pKPSL----v   61
ident    |                                        |       | |     
Sbjct DN-RYLLSALqtvpgqLRGVvxlerdveqatlaexarlgvrgVRLNLxgqdXPDLtgaqw  117
DSSP  LL-HHHHHHHhhllllLLLLllllllllhhhhhhhhllllleEELLLllllLLLLlllll


DSSP  HHHHHHL--LLLEEEEELL---LHHHHHHHHHL-LLLEEE-LLLLL------LLLL-lLL
Query RDTVQKF--KSYLIYVESN---DLRVIRYSIEK-GVDAII-SPWVN------RKDP-gID  107
ident |                          |          |                     
Sbjct RPLLERIgeQGWHVELHRQvadIPVLVRALQPYgLDIVIDhFGRPDarrglgQPGFaeLL  177
DSSP  HHHHHHHhhHLLEEEELLLlllHHHHHHHHLLLlLLEEELhHHLLLllllllLLLHhhHL


DSSP  HHhhHHHHhhLLEEEEElHHHH-HLLHHHH-HHHHHHHHHHHHHHHhhlLLEEEELLLLL
Query HVlaKLMVkkNVALGFSlRPLL-YSNPYER-ANLLRFMMKAWKLVEkykVRRFLTSSAQE  165
ident            |    |         | |  |                  |    |    
Sbjct TL--SGRG--KVWVKVS-GIYRlQGSPEENlAFARQALCALEAHYG--aERLXWGSDWPH  230
DSSP  LL--LLLL--LEEEEEE-LHHHlLLLHHHHhHHHHHHHHHHHHHLL--hHHEEEELLLLL


DSSP  -----hHHLLlhhHHHHhhhHLLLLHHHHHHLLLHHHHHHHL----
Query -----kWDVRyprDLISlgvVIGMEIPQAKASISMYPEIILK----  202
ident                       |       |               
Sbjct tqheseVSFGsavEQFE---ALGCSAQLRQALLLDTARALFGfele  273
DSSP  llllllLLHHhhhHHHH---HHLLLHHHHHHHHLHHHHHHLLllll


No 32: Query=1v77A Sbjct=3k2gB Z-score=11.4

back to top
DSSP  --------------------------lLLEEEEELLH-----------------------
Query --------------------------vKFIEMDIRDK-----------------------   11
ident                                                             
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQndcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhlll


DSSP  -------------------------hhhhHHHHH----LLEEEEEEE-------------
Query -------------------------eayeLAKEW----FDEVVVSIK-------------   29
ident                                |          |                 
Sbjct sieilselrqdpfvnkhnialddldlaiaEVKQFaavgGRSIVDPTCrgigrdpvklrri  120
DSSP  lhhhhhhhhllhhhllllleellhhhhhhHHHHHhhllLLEEEELLLllllllhhhhhhh


DSSP  --------------ELLL----------------lLHHHH-------HHHHhhhlLEEEE
Query --------------FNEE----------------vDKEKL-------REARkeygKVAIL   52
ident                                                             
Sbjct saetgvqvvxgagyYLASsxpetaarlsaddiadeIVAEAlegtdgtDARI----GLIGE  176
DSSP  hhhhlleeeellllLLHHhllhhhhlllhhhhhhhHHHHHhllllllLLLL----LLEEE


DSSP  EELL------LHHHHHHHHHHLL--LLEEEEEL--LLHHhHHHHHHLL--------lLEE
Query LSNP------KPSLVRDTVQKFK--SYLIYVES--NDLRvIRYSIEKG--------vDAI   94
ident                |              |                             
Sbjct IGVSsdftaeEEKSLRGAARAQVrtGLPLXVHLpgWFRL-AHRVLDLVeeegadlrhTVL  235
DSSP  ELLLllllhhHHHHHHHHHHHHHhhLLLEEELLllLLLL-HHHHHHHHhhllllhhhEEE


DSSP  ELLLlllllLLLL-HHHHHHHHHHLLEEEE-ELHHhHHLL--hhhhhhHHHHHHHHHHHH
Query ISPWvnrkdPGID-HVLAKLMVKKNVALGF-SLRPlLYSN--pyeranLLRFMMKAWKLV  150
ident          |     |           | |                         |    
Sbjct CHXN-----PSHXdPVYQATLAQRGAFLEFdXIGX-DFFYadqgvqcpSDDEVARAILGL  289
DSSP  LLLH-----HHLLlHHHHHHHHHHLLEEEElLLLL-LLEElllleellLHHHHHHHHHHH


DSSP  HHHLL--LEEEELLLLLH-------HHLLLhhHHHH-HHHHLL---LLHHHHHHLLLHHH
Query EKYKV--RRFLTSSAQEK-------WDVRYprDLIS-LGVVIG---MEIPQAKASISMYP  197
ident        |  |      |                                         |
Sbjct ADHGYldRILLSHDVFVKxxltrygGNGYA--FVTKhFLPRLRrhgLDDAALETLXVTNP  347
DSSP  HHLLLhhHEEELLLLLLHhhlhhhlLLLLL--HHHHlHHHHHHhllLLHHHHHHHHLHHH


DSSP  HHHHL------
Query EIILK------  202
ident            
Sbjct RRVFDasiegh  358
DSSP  HHHHLllllll


No 33: Query=1v77A Sbjct=3ooqA Z-score=11.3

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------VKFIEMDIR    9
ident                                                      |      
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  LH----------------------------------HHHHHHHHH-LLEEEEEEE-ELLL
Query DK----------------------------------EAYELAKEW-FDEVVVSIK-FNEE   33
ident                                      | | |       |       |  
Sbjct IGlfeegvgyyysdgneatdpvtphvkaldgfnpqdPAIERALAGgVTSVXIVPGsANPV  120
DSSP  LLlllllllhhhlllllllllllllllhhhhlllllHHHHHHHLLlEEEEEELLLlLLLE


DSSP  L-----lhhhhhhhhHHHLL--EEEEEEL-------------------lLHHHHH-----
Query V-----dkeklrearKEYGK--VAILLSN-------------------pKPSLVR-----   62
ident                    |                                  |     
Sbjct GgqgsvikfrsiiveECIVKdpAGLKXAFgenpkrvygerkqtpstrxgTAGVIRdyftk  180
DSSP  EeeeeeeelllllhhHHEEEeeEEEEEELlhhhhhhhhhlllllllhhhHHHHHHhhhhh


DSSP  ------------------------hhhHHLL---LLEEEEELLLHHHHHHHHHLL-----
Query ------------------------dtvQKFK---SYLIYVESNDLRVIRYSIEKG-----   90
ident                                                |   |        
Sbjct vknyxkkkelaqkegkeftetdlkxevGEXVlrkKIPARXHAHRADDILTAIRIAeefgf  240
DSSP  hhhhhhhhhhhhhlllllllllhhhhhHHHHhllLLLEEEEELLHHHHHHHHHHHhhhll


DSSP  LLEEELLLlllllLLLLhhHHHHHHHHLLEEEEELhHHHHLLhhhhHHHHhhhHHHHHHH
Query VDAIISPWvnrkdPGIDhvLAKLMVKKNVALGFSLrPLLYSNpyerANLLrfmMKAWKLV  150
ident    |                 |    |          |          |           
Sbjct NLVIEHGT-----EAYK--ISKVLAEKKIPVVVGP-LLTFRTklelKDLT---XETIAKL  289
DSSP  LEEEEELL-----LHHH--HHHHHHHHLLLEEELL-LLLLLLlhhhLLLL---LLHHHHH


DSSP  HHHLLLEEEELLLLlhhHLLLHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHL--------
Query EKYKVRRFLTSSAQekwDVRYPRDLISLGVVIGMEIPQAKASISMYPEIILK--------  202
ident  |  |   |                       |             |  ||         
Sbjct LKDGVLIALXCDHP-viPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGledrigsi  348
DSSP  HHLLLLEEELLLLL-llLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLllllllll


DSSP  ------------------------------------
Query ------------------------------------  202
ident                                     
Sbjct epgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  llllllleeeelllllllllleeeeeelleeeeell


No 34: Query=1v77A Sbjct=3nqbA Z-score=11.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  -----------------LLLEEEEELLHHH-------hHHHHHH-LLEEEEEEE-ellll
Query -----------------VKFIEMDIRDKEA-------yELAKEW-FDEVVVSIK-fneev   34
ident                     |                            |          
Sbjct srrdaaqvidaggayvsPGLIDTHXHIESSxitpaayaAAVVARgVTTIVWDPHefgnvh  120
DSSP  lllleeeeeelllleeeELEEEEEELHHHHlllhhhhhHHHHLLlEEEEEELLHhhhhhh


DSSP  LHHHHHHHHHHH------lLEEE----------------------------------EEE
Query DKEKLREARKEY------gKVAI----------------------------------LLS   54
ident      | | |                                                  
Sbjct GVDGVRWAAKAIenlplraILLApscvpsapglerggadfdaailadllswpeiggiAEI  180
DSSP  LHHHHHHHHHHHllllleeEEEEllllllllllllllllllhhhhhhhhlllleeeeEEE


DSSP  LLLHHH------hHHHHHHLL--LLEEEEELLLHH--HHHHHHHLLLLEEELLLLlllLL
Query NPKPSL------vRDTVQKFK--SYLIYVESNDLR--VIRYSIEKGVDAIISPWVnrkDP  104
ident                 ||       |       |           ||             
Sbjct XNXRGVierdprxSGIVQAGLaaEKLVCGHARGLKnaDLNAFXAAGVSSDHELVS---GE  237
DSSP  LLHHHHhlllhhhHHHHHHHHhhLLEEEELLLLLLhhHHHHHHHLLLLEELLLLL---HH


DSSP  LLLhhHHHHHhhhlLEEEEELHHHhhllhhhhhHHHHHHHHHHHHhhHHLL-LEEEELLL
Query GIDhvLAKLMvkknVALGFSLRPLlysnpyeraNLLRFMMKAWKLveKYKV-RRFLTSSA  163
ident                                   ||     |             |    
Sbjct DLX-aKLRAG----LTIELRGSHD---------HLLPEFVAALNT-lGHLPqTVTLCTDD  282
DSSP  HHH-hHHHLL----LEEEEELLLH---------HHHHHHHHHHHH-hLLLLlLEEEELLL


DSSP  LLHHH----LLLHhHHHHHHHHLLLLHHHHHHLLLHHHHHHHL-----------------
Query QEKWD----VRYPrDLISLGVVIGMEIPQAKASISMYPEIILK-----------------  202
ident     |         |     |  |     |           |                  
Sbjct VFPDDllqgGGLD-DVVRRLVRYGLKPEWALRAATLNAAQRLGrsdlgliaagrradivv  341
DSSP  LLHHHhhhlLLHH-HHHHHHHHLLLLHHHHHHHHLHHHHHHHLlllllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct fedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakv  401
DSSP  ellllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhlllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct rlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwng  461
DSSP  eeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct afattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsda  521
DSSP  eeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeellllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct pleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxe  581
DSSP  lhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeel


DSSP  ------
Query ------  202
ident       
Sbjct spviev  587
DSSP  lleeel


No 35: Query=1v77A Sbjct=3griA Z-score=11.3

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------VKFIEMDIR    9
ident                                                      |      
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL


DSSP  LH-----------hHHHHHHHH-LLEEEEEE-----------------------------
Query DK-----------eAYELAKEW-FDEVVVSI-----------------------------   28
ident                   |    |  |                                 
Sbjct LRepggeyketietGTKAAARGgFTTVCPXPntrpvpdsvehfealqkliddnaqvrvlp  120
DSSP  LLlllllllllhhhHHHHHHHLlEEEEEELLllllllllhhhhhhhhhhhhhhllleell


DSSP  --EELL------LLLH-HHHHHHHhhhllEEEEEE--LLLH-HHHHHHHHHLL--LLEEE
Query --KFNE------EVDK-EKLREARkeygkVAILLS--NPKP-SLVRDTVQKFK--SYLIY   74
ident              ||      |        |           |               | 
Sbjct yaSITTrqlgkeLVDFpALVKEGA-----FAFTDDgvGVQTaSXXYEGXIEAAkvNKAIV  175
DSSP  leELLHhhllllLLLHhHHHLLLL-----LLEEELllLLLLhHHHHHHHHHHHhhLLLEE


DSSP  EELLL----------------------------HHHHHHHHHLL-----LLEEELLLLll
Query VESND----------------------------LRVIRYSIEKG-----VDAIISPWVnr  101
ident     |                               |                       
Sbjct AHCEDnsliyggaxhegkrskelgipgipniceSVQIARDVLLAeaagcHYHVCHVST--  233
DSSP  ELLLLhhhllllleellhhhhhhllleellhhhHHHHHHHHHHHhhhllLEEELLLLL--


DSSP  lLLLLLhhHHHHHH-HHLLEEEEELHHHHHLLHH--------------HHHHHHHHHHHH
Query kDPGIDhvLAKLMV-KKNVALGFSLRPLLYSNPY--------------ERANLLRFMMKA  146
ident                   |        ||                               
Sbjct -KESVR-vIRDAKRaGIHVTAEVTPHHLLLTEDDipgnnaiykxnpplRSTEDREALLEG  291
DSSP  -HHHHH-hHHHHHHlLLLEEEEELHHHHHLLHHHlllllhhhllllllLLHHHHHHHHHH


DSSP  HHHHhhhlLLEEEELLLLL---------------hHHLL--LHHHHHHHHH-hllLLHHH
Query WKLVekykVRRFLTSSAQE---------------kWDVR--YPRDLISLGV-vigMEIPQ  188
ident                                              |    |        |
Sbjct LLDG----TIDCIATDHAPhardekaqpxekapfgIVGSetAFPLLYTHFVkngdWTLQQ  347
DSSP  HHLL----LLLEELLLLLLllhhhhllllllllllLLLLllHHHHHHHHHLllllLLHHH


DSSP  HHHLLLHHHHHHHL----------------------------------------------
Query AKASISMYPEIILK----------------------------------------------  202
ident         |                                                   
Sbjct LVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigykvyg  407
DSSP  HHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllllllleell


DSSP  ---------------
Query ---------------  202
ident                
Sbjct npiltxvegevkfeg  422
DSSP  eeeeeeelleeeeel


No 36: Query=1v77A Sbjct=4b3zD Z-score=11.1

back to top
DSSP  ----------------------------------------------------LLLEEEEE
Query ----------------------------------------------------VKFIEMDI    8
ident                                                        |    
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  LLHH-----hhHHHHHH----LLEEEEEE-------------------------------
Query RDKE-----ayELAKEW----FDEVVVSI-------------------------------   28
ident                                                             
Sbjct YLQKtaaddffQGTRAAlvggTTMIIDHVvpepgsslltsfekwheaadtksccdyslhv  120
DSSP  LLLLlllllhhHHHHHHhhllEEEEEEEElllllllhhhhhhhhhhhhhllllleeeeee


DSSP  EELLL------lLHHHH-HHHHhhhllEEEEEEL-------LLHHHHHHHHHHLL--LLE
Query KFNEE------vDKEKL-REARkeygkVAILLSN-------PKPSLVRDTVQKFK--SYL   72
ident                                             |         |     
Sbjct DITSWydgvreeLEVLVqDKGV-----NSFQVYMaykdvyqMSDSQLYEAFTFLKglGAV  175
DSSP  ELLLLlllhhhhHHHHHhLLLL-----LEEEEELlllllllLLHHHHHHHHHHHHhhLLE


DSSP  EEEELLL-------------------------------HHHHHHHHHLL-----LLEEEL
Query IYVESND-------------------------------LRVIRYSIEKG-----VDAIIS   96
ident | |                                          |           |  
Sbjct ILVHAENgdliaqeqkrilemgitgpeghalsrpeeleAEAVFRAITIAgrincPVYITK  235
DSSP  EEEELLLhhhhhhhhhhhhhllllllhhhhhhllhhhhHHHHHHHHHHHhhhllLEEEEE


DSSP  LLLlllLLLLLhhHHHHHH-HHLLEEEEELHH-HHHLLH------------------hHH
Query PWVnrkDPGIDhvLAKLMV-KKNVALGFSLRP-LLYSNP------------------yER  136
ident           |   |        |                                    
Sbjct VMS---KSAAD-iIALARKkGPLVFGEPIAASlGTDGTHywsknwakaaafvtspplsPD  291
DSSP  ELL---HHHHH-hHHHHHHhLLLEEEEELHHHhHLLLHHhhlllhhhhhhllllllllLL


DSSP  HHHHHHHHHHHHHHhhhlLLEEEELLLLL------------------HHHLLLhhHHHHH
Query ANLLRFMMKAWKLVekykVRRFLTSSAQE------------------KWDVRYprDLISL  178
ident                         |                                   
Sbjct PTTPDYLTSLLACG----DLQVTGSGHCPystaqkavgkdnftlipeGVNGIE--ERMTV  345
DSSP  LLHHHHHHHHHHHL----LLLLLLLLLLLllhhhhhhhlllhhhlllLLLLLL--LHHHH


DSSP  HHHLL-----LLHHHHHHLLLHHHHHHHL-------------------------------
Query GVVIG-----MEIPQAKASISMYPEIILK-------------------------------  202
ident           |   |  |  |     |                                 
Sbjct VWDKAvatgkMDENQFVAVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitaks  405
DSSP  HHHHHlllllLLHHHHHHHHLHHHHHHHLllllllllllllllleeeeeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct hksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpehlyqrvki  465
DSSP  llllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllhhhhhhhhh


DSSP  ------------
Query ------------  202
ident             
Sbjct rnkvfglqgvsr  477
DSSP  hhhhllllllll


No 37: Query=1v77A Sbjct=2vc5A Z-score=10.9

back to top
DSSP  ---------------lLLEEEEELLH------------------------HHHHHHHH-H
Query ---------------vKFIEMDIRDK------------------------EAYELAKE-W   20
ident                  |                                     |    
Sbjct mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeefrnavNEVKRAMQfG   60
DSSP  llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhhhhhHHHHHHHHlL


DSSP  LLEEEEEEE--------------------------ELLL-----------------lLHH
Query FDEVVVSIK--------------------------FNEE-----------------vDKE   37
ident     |                                                       
Sbjct VKTIVDPTVmglgrdirfmekvvkatginlvagtgIYIYidlpfyflnrsideiadlFIH  120
DSSP  LLEEEELLLllllllhhhhhhhhhlllleeeeleeLLLLllllhhhllllhhhhhhhHHH


DSSP  HH-------HHHHhhhllEEEEEEL-------lLHHHHHHHHHHLL--LLEEEEELL-LH
Query KL-------REARkeygkVAILLSN-------pKPSLVRDTVQKFK--SYLIYVESN-DL   80
ident                                       |      |     |   ||   
Sbjct DIkegiqgtLNKA-----GFVXIAAdepgitkdVEKVIRAAAIANKetKVPIITHSNaHN  175
DSSP  HHhllllllLLLL-----LLEEEELllllllhhHHHHHHHHHHHHHhhLLLEEEELLlLL


DSSP  HHHHHHHHLL--------lLEEELLLLllllLLLLhHHHHHHHHHLLEEEEE-LHHHhhl
Query RVIRYSIEKG--------vDAIISPWVnrkdPGIDhVLAKLMVKKNVALGFS-LRPLlys  131
ident                      |                 |    |    |          
Sbjct NTGLEQQRILteegvdpgkILIGHLGD----TDNI-DYIKKIADKGSFIGLDrYGLD---  227
DSSP  LHHHHHHHHHhhllllhhhEEELLHHH----LLLH-HHHHHHHHLLLEEEELlLLLL---


DSSP  lhhhhhhHHHHHHHHHHHHHHHLL--LEEEELLLLL-----------------hHHLLlh
Query npyeranLLRFMMKAWKLVEKYKV--RRFLTSSAQE-----------------kWDVRyp  172
ident                     |                                 |     
Sbjct ----lflPVDKRNETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykpklaprWSIT--  281
DSSP  ----lllLHHHHHHHHHHHHHLLLllLEEELLLLLLllllllllhhhhhhhlllLLLL--


DSSP  hHHHHHHHHLL----LLHHHHHHLLLHHHHHHHL
Query rDLISLGVVIG----MEIPQAKASISMYPEIILK  202
ident                             |     
Sbjct -LIFEDTIPFLkrngVNEEVIATIFKENPKKFFS  314
DSSP  -HHHHLHHHHHhlllLLHHHHHHHHLHHHHHHLL


No 38: Query=1v77A Sbjct=4rdvB Z-score=10.9

back to top
DSSP  ------------------------------------------------LLLEEEEELLH-
Query ------------------------------------------------VKFIEMDIRDK-   11
ident                                                             
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHh


DSSP  -----------------------------------------HHHHHHHHH-LLEEEEE--
Query -----------------------------------------EAYELAKEW-FDEVVVS--   27
ident                                            |          |     
Sbjct ramaglaevagnpndsfwtwrelmyrmvarlspeqieviacQLYIEMLKAgYTAVAEFhy  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhhhhhHHHHHHHHHlEEEEEEEel


DSSP  ----------------------------------EEELL---------------------
Query ----------------------------------IKFNE---------------------   32
ident                                                             
Sbjct vhhdldgrsyadpaelslrisraasaagigltllPVLYShagfggqpasegqrrfingse  180
DSSP  llllllllllllllhhhhhhhhhhhhhlleeeeeELLLLeeellleellhhhllllllhh


DSSP  -LLLH-HHHHHHHH-HHLLEEEEEELL---LHHHHHHHHHH-LLLLEEEEELL-------
Query -EVDK-EKLREARK-EYGKVAILLSNP---KPSLVRDTVQK-FKSYLIYVESN-------   78
ident         ||                     |                            
Sbjct aYLELlQRLRAPLEaAGHSLGLCFHSLravTPQQIATVLAAgHDDLPVHIHIAeqqkevd  240
DSSP  hHHHHhHHHHHHHHhHLLEELEEELLLlllLHHHHHHHHLLlLLLLLEEEEELllhhhhh


DSSP  ---------LHHHHHHhHHLL-LLEEELLLllllllLLLHHHHHHHHHHLLEEEEEL-HH
Query ---------DLRVIRYsIEKG-VDAIISPWvnrkdpGIDHVLAKLMVKKNVALGFSL-RP  127
ident           |                           |      |       |  |   
Sbjct dcqawsgrrPLQWLYEnVAVDqRWCLVHAT------HADPAEVAAMARSGAVAGLCLsTE  294
DSSP  hhhhhhlllHHHHHHHhLLLLlLEEEEELL------LLLHHHHHHHHHHLLEEEELHhHH


DSSP  HHHLlhhhhhhhHHHHhhHHHHHHHHLLLEEEELLLLlhhHLLLHHHHHHHHHHLL----
Query LLYSnpyeranlLRFMmkAWKLVEKYKVRRFLTSSAQekwDVRYPRDLISLGVVIG----  183
ident                             |    |                          
Sbjct ANLG--------DGIF--PATDFLAQGGRLGIGSDSH---VSLSVVEELRWLEYGQrlrd  341
DSSP  HHLL--------LLLL--LHHHHHHLLLEEEELLLLL---LLLLHHHHHHHHHHHHhhhh


DSSP  ------------lLHHHHHHLLLHHHHHHHL-----------------------------
Query ------------mEIPQAKASISMYPEIILK-----------------------------  202
ident                              |                              
Sbjct rkrnrlyrddqpmIGRTLYDAALAGGAQALGqpigslavgrradllvldgndpylasaeg  401
DSSP  lllllllllllllHHHHHHHHHHHHHHHHHLllllllllllllleeeellllhhhhllll


DSSP  --------------------------------------------------
Query --------------------------------------------------  202
ident                                                   
Sbjct dallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  hhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 39: Query=1v77A Sbjct=3irsA Z-score=10.5

back to top
DSSP  LLLEEEEELLHH-------------------------------------hhhHHHHH-LL
Query VKFIEMDIRDKE-------------------------------------ayeLAKEW-FD   22
ident  | |    |                                                   
Sbjct LKIIDFRLRPPAmgflnariytrpdirnrftrqlgfepapsaeekslelmfeEMAAAgIE   60
DSSP  LLLEELLLLLLLhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllhhhhhhHHHHLlLL


DSSP  EEEEEE-----------------------------EELL-------lLLHHHHHHHHhhh
Query EVVVSI-----------------------------KFNE-------eVDKEKLREARkey   46
ident   |                                               | |       
Sbjct QGVCVGrnssvlgsvsnadvaavakaypdkfhpvgSIEAatrkeamaQMQEILDLGI---  117
DSSP  EEEEELleellleellhhhhhhhhhhlllleeeeeELLLllhhhhhhHHHHHHHLLL---


DSSP  lleEEEEEL-------LLHH-hHHHHHHHL--LLLEEEEEL----------lLHHHHHHH
Query gkvAILLSN-------PKPS-lVRDTVQKF--KSYLIYVES----------nDLRVIRYS   86
ident       |                                                 |   
Sbjct --rIVNLEPgvwatpmHVDDrrLYPLYAFCedNGIPVIMMTggnagpditytNPEHIDRV  175
DSSP  --lLEEELHhhlllllLLLLhhHHHHHHHHhhLLLLEEEELlllllllhhhhLHHHHHHH


DSSP  HHL---LLLEEE-LLLLLLlLLLLLhhHHHHHHhhLLEEEEELHHHhhllhhhHHHHHHH
Query IEK---GVDAII-SPWVNRkDPGIDhvLAKLMVkkNVALGFSLRPLlysnpyeRANLLRF  142
ident                |       |    |      |  |                     
Sbjct LGDfpdLTVVSShGNWPWV-QEIIH--VAFRRP--NLYLSPDMYLY-------NLPGHAD  223
DSSP  HHHlllLLEEEEhHHLLLH-HHHHH--HHHHLL--LEEEELHHHHL-------LLLLHHH


DSSP  HHHHH-HHHHhhlLLEEEELLLLLhhHLLL--HHHHHHHhhhlLLLHHHHHHLLLHHHHH
Query MMKAW-KLVEkykVRRFLTSSAQEkwDVRY--PRDLISLgvviGMEIPQAKASISMYPEI  199
ident    |          |                       |                   | 
Sbjct FIQAAnSFLA---DRMLFGTAYPM--CPLKeyTEWFLTL----PIKPDAMEKILHGNAER  274
DSSP  HHHHHlLHHH---HLLLLLLLLLL--LLHHhhHHHHHLL----LLLHHHHHHHHLHHHHH


DSSP  HHL----
Query ILK----  202
ident  |     
Sbjct LLAqagr  281
DSSP  HHHhlll


No 40: Query=1v77A Sbjct=1onxA Z-score=10.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  -LLLEEEEELLH-------------HHHH-HHHHH-LLEEEEEEE---------------
Query -VKFIEMDIRDK-------------EAYE-LAKEW-FDEVVVSIK---------------   29
ident    ||                    |       |     ||                   
Sbjct cPGFIDQHVHLIggggeagpttrtpEVALsRLTEAgVTSVVGLLGtdsisrhpesllakt  120
DSSP  eELEEEEEELLLlllllllhhhlllLLLHhHHHHLlEEEEEELLLlllllllhhhhhhhh


DSSP  ----------------ELLLLLHH------HHHHhhHHHLlEEEEEEL-------LLHHH
Query ----------------FNEEVDKE------KLREarKEYGkVAILLSN-------PKPSL   60
ident                                                        |    
Sbjct ralneegisawmltgaYHVPSRTItgsvekDVAI--IDRV-IGVXCAIsdhrsaaPDVYH  177
DSSP  hhhhhhlleeeeeeelLLLLLLLLlllhhhHHHH--LLLE-EEEEEEElllllllLLHHH


DSSP  HHHHHHHLL--------LLEEEEELL-LHHHHHHHHHL--------LLLEEELLLLLllL
Query VRDTVQKFK--------SYLIYVESN-DLRVIRYSIEK--------GVDAIISPWVNrkD  103
ident                                                         |   
Sbjct LANMAAESRvggllggkPGVTVFHMGdSKKALQPIYDLlencdvpiSKLLPTHVNRN--V  235
DSSP  HHHHHHHHHhhhhhhllLLEEEEEELlLLLLLHHHHHHhhlllllhHHEEEELHHHL--H


DSSP  LLLLhHHHHHHHHHLlEEEEELHHHhhllhhhhhhhHHHH-HHHHHHHH-HHLL--LEEE
Query PGIDhVLAKLMVKKNvALGFSLRPLlysnpyeranlLRFM-MKAWKLVE-KYKV--RRFL  159
ident |           |                                           |  |
Sbjct PLFE-QALEFARKGG-TIDITSSID-----------EPVApAEGIARAVqAGIPlaRVTL  282
DSSP  HHHH-HHHHHHHLLL-LEEEELLLL-----------LLLLhHHHHHHHHhLLLLhhHEEE


DSSP  ELLLLL--------------hHHLLLhhHHHHHHHHLL----LLHHHHHHLLLHHHHHHH
Query TSSAQE--------------kWDVRYprDLISLGVVIG----MEIPQAKASISMYPEIIL  201
ident  |                           |     |        |  |           |
Sbjct SSDGNGsqpffddegnlthigVAGFE--TLLETVQVLVkdydFSISDALRPLTSSVAGFL  340
DSSP  ELLLLLeeeeellllleeeeeELLLH--HHHHHHHHHHhhhlLLHHHHHHHHLHHHHHHL


DSSP  L-------------------------------------------------
Query K-------------------------------------------------  202
ident                                                   
Sbjct Nltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  Llllllllllllllleeeellllleeeeeelleeeeelleelllllllll


No 41: Query=1v77A Sbjct=3e74A Z-score=10.4

back to top
DSSP  ---------------------------------------------------LLLEEEEEL
Query ---------------------------------------------------VKFIEMDIR    9
ident                                                             
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL


DSSP  LHH--HHHHHHH-HLLEEEEEE--------------------------------EELLLL
Query DKE--AYELAKE-WFDEVVVSI--------------------------------KFNEEV   34
ident          |                                                  
Sbjct IGYetGTRAAAKgGITTXIEXPlnqlpatvdrasielkfdaakgkltidaaqlgGLVSYN  120
DSSP  LLHhhHHHHHHHlLEEEEEELLlllllllllhhhhhhhhhhhlllllleeeeleELLLLL


DSSP  ---LHHHHHHHHhhhllEEEEEEL--LLHHHHHHHHHHLL--LLEEEEELL---------
Query ---DKEKLREARkeygkVAILLSN--PKPSLVRDTVQKFK--SYLIYVESN---------   78
ident      |           |                  ||         |            
Sbjct idrLHELDEVGV-----VGFXCFVrdVNDWQFFKGAQKLGelGQPVLVHCEnalicdelg  175
DSSP  lllHHHHHHHLL-----LLEEEELllLLHHHHHHHHHHHHhhLLLEEEELLlhhhhhhhh


DSSP  ----------------------LHHHHHHHHHLL-----LLEEELLLLlllLLLLLhhHH
Query ----------------------DLRVIRYSIEKG-----VDAIISPWVnrkDPGIDhvLA  111
ident                           ||                         |      
Sbjct eeakregrvtahdyvasrpvftEVEAIRRVLYLAkvagcRLHVCHVSS---PEGVE-eVT  231
DSSP  hhhhhhllllhhhhhhlllhhhHHHHHHHHHHHHhhhllLEEELLLLL---HHHHH-hHH


DSSP  HHHH-HHLLEEEEELHHHHHLLHH---------------HHHHHHHHHHHHHHHHhhhll
Query KLMV-KKNVALGFSLRPLLYSNPY---------------ERANLLRFMMKAWKLVekykv  155
ident                                           |      |          
Sbjct RARQeGQDITCESCPHYFVLDTDQfeeigtlakcsppirDLENQKGXWEKLFNGE-----  286
DSSP  HHHHlLLLEEEEELLHHHHLLHHHhhhhlhhhlllllllLHHHHHHHHHHHHLLL-----


DSSP  lEEEELLLLL----------------hHHLLL-HHHHHHHHH-hlLLLHHHHHHLLLHHH
Query rRFLTSSAQE----------------kWDVRY-PRDLISLGV-viGMEIPQAKASISMYP  197
ident    | |                                   |   |   |          
Sbjct iDCLVSDHSPcppexkagnixkawggiAGLQScXDVXFDEAVqkrGXSLPXFGKLXATNA  346
DSSP  lLEELLLLLLlllllllllllllllllLLHHHhHHHHHHHHLlllLLLHHHHHHHHLHHH


DSSP  HHHHL-------------------------------------------------------
Query EIILK-------------------------------------------------------  202
ident   |                                                         
Sbjct ADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilr  406
DSSP  HHHLLlllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeel


DSSP  -----------------------
Query -----------------------  202
ident                        
Sbjct gdviydieqgfpvapkgqfilkh  429
DSSP  leeeeelllllllllllleelll


No 42: Query=1v77A Sbjct=3giqA Z-score=10.2

back to top
DSSP  -------------------------------------------------------LLLEE
Query -------------------------------------------------------VKFIE    5
ident                                                          || 
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE


DSSP  EEELLHH------hhHHHHH-HLLEEEEEEE-----------------------------
Query MDIRDKE------ayELAKE-WFDEVVVSIK-----------------------------   29
ident     |                    |||                                
Sbjct VHGHDDLmfvekpdlRWKTSqGITTVVVGNCgvsaapaplpgntaaalallgetplfadv  120
DSSP  LLLLLLLhhhhllllHHHHLlLEEEEEELLLllllllllllllllhhhhhhllllllllh


DSSP  ---------------------ELLL----------------------lLHHHHHHHHhhh
Query ---------------------FNEE----------------------vDKEKLREARkey   46
ident                                                     |       
Sbjct payfaaldaqrpminvaalvgHANLrlaamrdpqaaptaaeqqamqdmLQAALEAGA---  177
DSSP  hhhhhhhhhllllleeeeeeeHHHHhhhhlllllllllhhhhhhhhhhHHHHHHHLL---


DSSP  llEEEEEEL-------lLHHHHHHHHHHLL--LLEEEEELLL-----HHHHHHHHHLL--
Query gkVAILLSN-------pKPSLVRDTVQKFK--SYLIYVESND-----LRVIRYSIEKG--   90
ident   |                               |                      |  
Sbjct --VGFSTGLayqpgavaQAAELEGLARVAAerRRLHTSHIRNeadgvEAAVEEVLAIGrg  235
DSSP  --LEEEEELllllhhhlLHHHHHHHHHHHHhlLLEEEEELLLllllhHHHHHHHHHHHhh


DSSP  ---LLEEELLLLL---LLLLllLHHHHHHHHHH-----LLEEEEELHHHH----------
Query ---VDAIISPWVN---RKDPgiDHVLAKLMVKK-----NVALGFSLRPLL----------  129
ident                                        |||     |            
Sbjct tgcATVVSHHKCMmpqNWGR--SRATLANIDRAreqgvEVALDIYPYPGSstiliperae  293
DSSP  hllEEEELLLLLLlhhHLLL--HHHHHHHHHHHhhlllLEEEEELLLLEEeeellhhhll


DSSP  --------------------------------------------HLLHhhhhhHHHHHHH
Query --------------------------------------------YSNPyeranLLRFMMK  145
ident                                                             
Sbjct tiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaIYFA----mDEDEVKR  349
DSSP  llllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeEEEL----lLHHHHHH


DSSP  HHHHHhhhllLEEEELLLLL-----HHHL-LLHHHHHHHHH--HLLLLHHHHHHLLLHHH
Query AWKLVekykvRRFLTSSAQE-----KWDV-RYPRDLISLGV--VIGMEIPQAKASISMYP  197
ident                |                        |     |   || |     |
Sbjct IFQHP-----CCMVGSDGLPndarpHPRLwGSFTRVLGRYVreARLMTLEQAVARMTALP  404
DSSP  HHHLL-----LEEELLLLLLlllllLLHHhHHHHHHHHHHHhhLLLLLHHHHHHHHLHHH


DSSP  HHHHL-------------------------------------------------------
Query EIILK-------------------------------------------------------  202
ident                                                             
Sbjct ARVFGfaergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppa  464
DSSP  HHHHLlllllllllllllleeeelllllllllllllllllllleeeeeelleeeelllll


DSSP  -----------
Query -----------  202
ident            
Sbjct dgrpgqvlrax  475
DSSP  lllllllllll


No 43: Query=1v77A Sbjct=4hk5D Z-score=10.1

back to top
DSSP  -LLLEEEEELL-------------------------------------------------
Query -VKFIEMDIRD-------------------------------------------------   10
ident                                                             
Sbjct tPVVVDIHTHMyppsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  lLLLEEEEEEEllhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  -------------hHHHHHHHH-HLLEEEEEEE--ELLL--------lLHHHHHHHHHHH
Query -------------kEAYELAKE-WFDEVVVSIK--FNEE--------vDKEKLREARKEY   46
ident                             | |                       |     
Sbjct lpgrplsthfaslaQKMHFMDTnGIRVSVISLAnpWFDFlapdeapgiADAVNAEFSDMC  120
DSSP  llleellhhhllhhHHHHHHHHlLLLEEEEEELllLLLLlllllhhhhHHHHHHHHHHHH


DSSP  ------lLEEE---------------------------EEELL----LHHH--hHHHHHH
Query ------gKVAI---------------------------LLSNP----KPSL--vRDTVQK   67
ident                                        |                    
Sbjct aqhvgrlFFFAalplsapvdavkasiervknlkycrgiILGTSglgkGLDDphlLPVFEA  180
DSSP  hllllleEEEEellllllhhhhhhhhhhhhlllleeeeEELLLllllLLLLhhhHHHHHH


DSSP  L--LLLEEEEEL----------------------------LLHHHHHH--------hhhl
Query F--KSYLIYVES----------------------------NDLRVIRY--------siek   89
ident       |                                                     
Sbjct VadAKLLVFLHPhyglpnevygprseeyghvlplalgfpmETTIAVARmymagvfdhvrn  240
DSSP  HhhLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhHHHHHHHHhhhllhhhhlll


DSSP  LLLEEE-LLLLlllllLLLHH-------------------------HHHHHHhHLLEEEE
Query GVDAII-SPWVnrkdpGIDHV-------------------------LAKLMVkKNVALGF  123
ident        |                                                 |  
Sbjct LQMLLAhSGGT-----LPFLAgriescivhdghlvktgkvpkdrrtIWTVLK-EQIYLDA  294
DSSP  LLEEEHhHHLL-----HHHHHhhhhhhhhllhhhhhllllllllllHHHHHH-HLEEEEL


DSSP  ELhhhhhllhhhhhhhHHHHHHHHHHHHhhllLEEEELLLLLHH----------HLLLhh
Query SLrpllysnpyeranlLRFMMKAWKLVEkykvRRFLTSSAQEKW----------DVRYpr  173
ident                       |         |                     |     
Sbjct VI------------ysEVGLQAAIASSG--adRLMFGTDHPFFPpieedvqgpwDSSR--  338
DSSP  LL------------llHHHHHHHHHHHL--hhHEELLLLLLLLLllllllllllHHHH--


DSSP  HHHHHHHHlLLLH--HHHHHLLLHHHHHHHL------------
Query DLISLGVViGMEI--PQAKASISMYPEIILK------------  202
ident                  | |         |             
Sbjct LNAQAVIK-AVGEgsSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  HHHHHHHH-HHLLllHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 44: Query=1v77A Sbjct=1a5kC Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ------LLLEEEEELLH--HHHHHHHHH-LLEEEEEE--------eellllLHHHHHHHH
Query ------VKFIEMDIRDK--EAYELAKEW-FDEVVVSI--------kfneevDKEKLREAR   43
ident          |   |        | |        |                          
Sbjct egkivtAGGIDTHIHWIcpQQAEEALVSgVTTMVGGGtgpaagthattctpGPWYISRML  180
DSSP  llleeeELEEEEEEELLllLHHHHHHHHlEEEEEEELllllhhhhhlllllHHHHHHHHH


DSSP  HHH------LLEE---------------------EEEEL---LLHHHHHHHHHHLL--LL
Query KEY------GKVA---------------------ILLSN---PKPSLVRDTVQKFK--SY   71
ident                                             |               
Sbjct QAAdslpvnIGLLgkgnvsqpdalreqvaagvigLEIHEdwgATPAAIDCALTVADemDI  240
DSSP  HHHllllleEEEEeelllllhhhhhhhhhhllleEEEEHhhlLLHHHHHHHHHHHHhhLL


DSSP  EEEEELL-------LHHHHHHHhHLLLlEEELLLLL----LLLLLLlhhhHHHHhhhlLE
Query LIYVESN-------DLRVIRYSiEKGVdAIISPWVN----RKDPGIdhvlAKLMvkknVA  120
ident      |                                    |       |         
Sbjct QVALHSDtlnesgfVEDTLAAIgGRTI-HTFHTEGAggghAPDIIT--acAHPN----IL  293
DSSP  EEEEELLlllllllHHHHHHHHlLLLE-EELLLLLLllllLLLHHH--hhHLLL----EE


DSSP  EEEELHH----hhHLLH------------------------hHHHHHHHHHHHHHHHHHh
Query LGFSLRP----llYSNP------------------------yERANLLRFMMKAWKLVEk  152
ident                                            |            |   
Sbjct PSSTNPTlpytlnTIDEhldmlmvchhldpdiaedvafaesrIRRETIAAEDVLHDLGA-  352
DSSP  EEEEHHHllllllHHHHhhhhhhhhhllllllhhhhhlllllLLHHHHHHHHHHHHLLL-


DSSP  hlllEEEELLLLLhhHLLL-HHHHhHHHHH----------------lllLHHHHHHLLLH
Query ykvrRFLTSSAQEkwDVRY-PRDLiSLGVV----------------igmEIPQAKASISM  195
ident         |  |    |                                      |    
Sbjct ---fSLTSSDSQAmgRVGEvILRT-WQVAHrmkvqrgalaeetgdndnfRVKRYIAKYTI  408
DSSP  ---lLEEELLLLLllLLLLhHHHH-HHHHHhhhhhhlllllllllllhhHHHHHHHLLLH


DSSP  HHHHHHL-----------------------------------------------------
Query YPEIILK-----------------------------------------------------  202
ident  |                                                          
Sbjct NPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpq  468
DSSP  HHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct pvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhns  528
DSSP  lleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhlllll


DSSP  --------------------------------------
Query --------------------------------------  202
ident                                       
Sbjct lqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllleeelllllleeelleellllllllllllllllll


No 45: Query=1v77A Sbjct=2a3lA Z-score=9.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------------------LLLEEEEELLHhHHHH---
Query -----------------------------------------VKFIEMDIRDKeAYEL---   16
ident                                          |           |      
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHS-ACMNqkh  179
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELL-LLLLhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   16
ident                                                             
Sbjct llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll


DSSP  ----------------------------------------hhHHLLEEEEE---------
Query ----------------------------------------akEWFDEVVVS---------   27
ident                                                             
Sbjct fnlkynpcgqsrlreiflkqdnliqgrflgeitkqvfsdleaSKYQMAEYRisiygrkms  299
DSSP  lhhhhllllllhhhhhhlllllllllllhhhhhhhhhhhhllLLLEEEEEEeelllllll


DSSP  ----------------------EEELLL------------------lLHHH---------
Query ----------------------IKFNEE------------------vDKEK---------   38
ident                       |                                     
Sbjct ewdqlaswivnndlysenvvwlIQLPRLyniykdmgivtsfqnildnIFIPlfeatvdpd  359
DSSP  hhhhhhhhhhlllllllleeeeEEEELLhhhhlllllllllhhhhhhHLLHhhhhhhlhh


DSSP  ----hhHHHHhhLLEEEEEEL-------------------------lLHHHHHHHHHHLL
Query ----lrEARKeyGKVAILLSN-------------------------pKPSLVRDTVQKFK   69
ident          |    |   |                                |        
Sbjct shpqlhVFLK--QVVGFDLVDdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLY  417
DSSP  hllllhHHHL--LEEEEEEELllllllllllllllllllllllllllHHHHHHHHHHHHH


DSSP  ------------LLEEEEEL---LLHHHHHHHHHLlLLEEELLllllllLLLL--HHHHH
Query ------------SYLIYVES---NDLRVIRYSIEKgVDAIISPwvnrkdPGID--HVLAK  112
ident                    |    |              |                ||  
Sbjct vlnklreskgmtTITLRPHSgeaGDIDHLAATFLT-CHSIAHG------INLRksPVLQY  470
DSSP  hhhhhhllllllLLEELLLLlllLLLHHHHHHHHH-LLLLLLL------HHHHhlHHHHH


DSSP  HHHHHLLEEEEE-LHHHHHLlhhhhhHHHHHhhHHHHHHHHhLLLEEEELLLlLHHHL--
Query LMVKKNVALGFS-LRPLLYSnpyeraNLLRFmmKAWKLVEKyKVRRFLTSSAqEKWDV--  169
ident |       |  | |               |                 |            
Sbjct LYYLAQIGLAMSpLSNNSLF-----lDYHRN--PFPVFFLR-GLNVSLSTDD-PLQIHlt  521
DSSP  HHHHHLLLEEELhHHHLLLL-----lLLLLL--LHHHHHHL-LLLEEELLLL-HHHHLll


DSSP  -LLHHHHHHHHHH-LLLLHHHHHHLlLHHHHHHHL-------------------------
Query -RYPRDLISLGVV-IGMEIPQAKASiSMYPEIILK-------------------------  202
ident         |                                                   
Sbjct kEPLVEEYSIAASvWKLSACDLCEI-ARNSVYQSGfshalkshwigkdyykrgpdgndih  580
DSSP  lLHHHHHHHHHHHhHLLLHHHHHHH-HHHHHHHLLllhhhhhhhlllllllllhhhllhh


DSSP  ------------------------------------
Query ------------------------------------  202
ident                                     
Sbjct ktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 46: Query=1v77A Sbjct=3pnuA Z-score=9.4

back to top
DSSP  ------------LLLEEEEELLH------hHHHHHHHHLLEEEEEEE-elllLLHHHHHH
Query ------------VKFIEMDIRDK------eAYELAKEWFDEVVVSIK-fneeVDKEKLRE   41
ident                  |               |    |   |            | |  
Sbjct enlyfqsnamklKNPLDMHLHLRdnqmlelIAPLSARDFCAAVIMPNlipplCNLEDLKA   60
DSSP  llllllllleeeELLEEEEELLLlhhhhhhHHHHHHLLLLEEEELLLlllllLLHHHHHH


DSSP  HHHH-----------HLLE-------------------EEEEEL-----------lLHHH
Query ARKE-----------YGKV-------------------AILLSN-----------pKPSL   60
ident                                        | |                  
Sbjct YKMRilkackdenftPLMTlffknydekflysakdeifGIXLYPagittnsnggvsSFDI  120
DSSP  HHHHhhhhhllllleEEEEeelllllhhhhhhhlllllEEEELLllllllllllllLLLH


DSSP  --hHHHHHHLL--LLEEEEELL-----------LHHHHHHHHHL---LLLEEELLLllll
Query --vRDTVQKFK--SYLIYVESN-----------DLRVIRYSIEK---GVDAIISPWvnrk  102
ident      |            |                                         
Sbjct eylKPTLEAMSdlNIPLLVHGEtndfvmdresnFAKIYEKLAKHfprLKIVMEHIT----  176
DSSP  hhhHHHHHHHHhlLLLEEELLLllllhhhllhhHHHHHHHHHHHlllLLEEELLLL----


DSSP  LLLLLHhHHHHhhHHLLEEEEELHHHHHLLHHH-------------hhHHHHHHHHHHHH
Query DPGIDHvLAKLmvKKNVALGFSLRPLLYSNPYE-------------raNLLRFMMKAWKL  149
ident        | |     |      |  |                                 |
Sbjct TKTLCE-LLKD--YENLYATITLHHLIITLDDViggkmnphlfckpiaKRYEDKEALCEL  233
DSSP  LHHHHH-HHHH--LLLEEEEELLHHHLLLHHHHhlllllhhhllllllLLHHHHHHHHHH


DSSP  hhhhLLLEEEELLLLL--------hHHLL-LHHHHHHHHHhlLLLHHHHHHLLLHHHHHH
Query vekyKVRRFLTSSAQE--------kWDVR-YPRDLISLGVviGMEIPQAKASISMYPEII  200
ident            |                      |  |               |     |
Sbjct afsgYEKVMFGSDSAPhpkgcaagvFSAPvILPVLAELFK-qNSSEENLQKFLSDNTCKI  292
DSSP  hhllLLLEEELLLLLLlllllllllLLHHhHHHHHHHHHH-hHLLHHHHHHHHLHHHHHH


DSSP  HL--------------------------------------------
Query LK--------------------------------------------  202
ident                                               
Sbjct YDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  HLllllllleeeeellleelllleelllleellllllleelleell


No 47: Query=1v77A Sbjct=2dvtA Z-score=9.3

back to top
DSSP  -LLLEEEEELL-----------------------------hHHHHHHHHH-LLEEEEEEE
Query -VKFIEMDIRD-----------------------------kEAYELAKEW-FDEVVVSIK   29
ident                                              |           |  
Sbjct mQGKVALEEHFaipetlqdsagfvpgdywkelqhrlldiqdTRLKLMDAHgIETMILSLN   60
DSSP  lLLEEEEEEEEllhhhhhhhlllllllhhhhhhhhhhllllHHHHHHHHLlEEEEEEEEL


DSSP  E-----------llllLHHHHHHHHHHH------LLEE----------------------
Query F-----------neevDKEKLREARKEY------GKVA----------------------   50
ident                           |                                 
Sbjct ApavqaipdrrkaieiARRANDVLAEECakrpdrFLAFaalplqdpdaateelqrcvndl  120
DSSP  LlhhhhlllhhhhhhhHHHHHHHHHHHHhhllllEEEEellllllhhhhhhhhhhhhhll


DSSP  ----EEEELL----------LHHH--hhhhHHHL--LLLEEEEEL---------------
Query ----ILLSNP----------KPSL--vrdtVQKF--KSYLIYVES---------------   77
ident      |                 |                 |                  
Sbjct gfvgALVNGFsqegdgqtplYYDLpqyrpfWGEVekLDVPFYLHPrnplpqdsriydghp  180
DSSP  llleEEEELLllllllllllLLLLhhhhhhHHHHhhHLLLEEEELllllhhhlhhhlllh


DSSP  -----------LLHHHHHHH--------hhlLLLEEE-LLLLlllllLLLHH--------
Query -----------NDLRVIRYS--------iekGVDAII-SPWVnrkdpGIDHV--------  109
ident                                                             
Sbjct wllgptwafaqETAVHALRLmasglfdehprLNIILGhMGEG-----LPYMMwridhrna  235
DSSP  hhlhhhlhhhhHHHHHHHHHhhllhhhhlllLLEEELhHHLL-----HHHHHhhhhhlll


DSSP  -------------HHHHHHHHlLEEEEELHhhhhllhhhhhhHHHHHHHHHHHHHhhllL
Query -------------LAKLMVKKnVALGFSLRpllysnpyeranLLRFMMKAWKLVEkykvR  156
ident                            |                     |         |
Sbjct wvklpprypakrrFMDYFNEN-FHITTSGN-----------fRTQTLIDAILEIG--adR  281
DSSP  lllllllllllllHHHHHHHH-EEEELLLL-----------lLHHHHHHHHLLLL--hhH


DSSP  EEEELLLLLhhHLLL--HHHHHHHhhhlLLLHHHHHHLLLHHHHHHHL--
Query RFLTSSAQEkwDVRY--PRDLISLgvviGMEIPQAKASISMYPEIILK--  202
ident                                                |  
Sbjct ILFSTDWPF--ENIDhaSDWFNAT----SIAEADRVKIGRTNARRLFKld  325
DSSP  EELLLLLLL--LLHHhhHHHHHHL----LLLHHHHHHHHLHHHHHHLLll


No 48: Query=1v77A Sbjct=2qpxA Z-score=9.0

back to top
DSSP  -----------LLLEEEEELLHH-------------------------------------
Query -----------VKFIEMDIRDKE-------------------------------------   12
ident            |                                                
Sbjct gxddlsefvdqVPLLDHHCHFLIdgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
DSSP  lllllhhhhhhLLEEEEEELLLLllllllhhhhhhhhlllllllllhhhhlllhhhhhhh


DSSP  -------------------------hhhHHHH-HLLEEEEE-------------------
Query -------------------------ayeLAKE-WFDEVVVS-------------------   27
ident                                   | |                       
Sbjct alakefaldannplaaxndpgyatynhrIFGHfHFKELLIDtgfvpddpildldqtaelv  120
DSSP  hhhhhhllllllllllllhhhhhhhhhhHHHHlLEEEEEEElllllllllllhhhhhhhh


DSSP  -------EEELLL--------------------llHHHHHHHHhhhllEEEEEELL----
Query -------IKFNEE--------------------vdKEKLREARkeygkVAILLSNP----   56
ident                                    |            |           
Sbjct gipvkaiYRLETHaedfxlehdnfaawwqafsndvKQAKAHGF-----VGFXSIAAyrvg  175
DSSP  llleeeeEEHHHHhhhhhlllllhhhhhhhhhhhhHLLLLLLL-----LLEEELHHhhll


DSSP  -------------------------------lhHHHHHHHHHLL--LLEEEEEL------
Query -------------------------------kpSLVRDTVQKFK--SYLIYVES------   77
ident                                                             
Sbjct lhlepvnvieaaagfdtwkhsgekrltskplidYXLYHVAPFIIaqDXPLQFHVgygdad  235
DSSP  lllllllhhhhhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHhhLLLEEEEEllllll


DSSP  ------LLHHHhHHHHHL-----LLLEEELLLLllllLLLL-hHHHHHhhHHLLEEEEE-
Query ------NDLRViRYSIEK-----GVDAIISPWVnrkdPGID-hVLAKLmvKKNVALGFS-  124
ident       | |   |                               ||      |     | 
Sbjct tdxylgNPLLX-RDYLKAftkkgLKVVLLHCYP----YHREagYLASV--FPNLYFDISl  288
DSSP  llhhhlLHHHH-HHHHHHhhhhlLLEEEEELLL----LHHHhhHHHHH--LLLEEEELLl


DSSP  -LHHHHhllhhhhHHHHHHHHHHHHHHHhhLLLEEEELLLL-LHHHLL-lHHHHHHHHHH
Query -LRPLLysnpyerANLLRFMMKAWKLVEkyKVRRFLTSSAQ-EKWDVR-yPRDLISLGVV  181
ident                  |    |  |      |    | |           |      | 
Sbjct lDNLGP-------SGASRVFNEAVELAP--YTRILFASDAStYPEXYGlaARQFKQALVA  339
DSSP  hHHHLH-------HHHHHHHHHHLLLLL--HHHEELLLLLLlLHHHHHhhHHHHHHHHHH


DSSP  LL---------llHHHHHHLLLHHHHHHHL-------
Query IG---------meIPQAKASISMYPEIILK-------  202
ident                   |                  
Sbjct HFnqlpfvdlaqkKAWINAICWQTSAKLYHqerelrv  376
DSSP  HHhllllllhhhhHHHHHHHHLHHHHHHLLlhhhhll


No 49: Query=1v77A Sbjct=1itqA Z-score=8.6

back to top
DSSP  -------------LLLEEEEELLH------------------------HHHH-HHHH-HL
Query -------------VKFIEMDIRDK------------------------EAYE-LAKE-WF   21
ident                 |                                           
Sbjct dffrdeaerimrdSPVIDGHNDLPwqlldmfnnrlqderanlttlagtHTNIpKLRAgFV   60
DSSP  lhhhhhhhhhhllLLEEEEEELHHhhhhhhhllllllhhhllllllllLLLHhHHHHlLE


DSSP  LEEEEEEE----ellllLHHHHHHHHHHH------------------------------l
Query DEVVVSIK----fneevDKEKLREARKEY------------------------------g   47
ident      |                 |                                    
Sbjct GGQFWSVYtpcdtqnkdAVRRTLEQMDVVhrmcrmypetflyvtssagirqafregkvas  120
DSSP  EEEEEEELllhhhllllHHHHHHHHHHHHhhhhhhlllleeelllhhhhhhhhhllleee


DSSP  LEEE------------------------EEEL---------------------lLHHH-H
Query KVAI------------------------LLSN---------------------pKPSL-V   61
ident                              |                          |   
Sbjct LIGVegghsidsslgvlralyqlgmrylTLTHscntpwadnwlvdtgdsepqsqGLSPfG  180
DSSP  EEEEelhhhllllhhhhhhhhhlleeeeELLLlllllllllhhhllllllllllLLLHhH


DSSP  HHHHHHLL--LLEEEEELLLHHHHHHHHHLL--lLEEE-LLLL--LLLLlLLLHHHHHHH
Query RDTVQKFK--SYLIYVESNDLRVIRYSIEKG--vDAII-SPWV--NRKDpGIDHVLAKLM  114
ident    |        ||                         |                  | 
Sbjct QRVVKELNrlGVLIDLAHVSVATMKATLQLSrapVIFShSSAYsvCASRrNVPDDVLRLV  240
DSSP  HHHHHHHHhhLLEEELLLLLHHHHHHHHHHLlllLEELlLLLLllLLLLlLLLHHHHHHH


DSSP  HHHLLEEEEElHHHH-hllHHHHHhhhHHHHHHHHHHHHHLL--LEEEELLLL-------
Query VKKNVALGFSlRPLL-ysnPYERAnllRFMMKAWKLVEKYKV--RRFLTSSAQ-------  164
ident                                                             
Sbjct KQTDSLVMVN-FYNNyiscTNKAN--lSQVADHLDHIKEVAGarAVGFGGDFDgvprvpe  297
DSSP  HHHLLEEEEL-LLHHhhllLLLLL--hHHHHHHHHHHHHHLLhhHEEELLLLLlllllll


DSSP  lhHHLLLHHHhhhHHHHLL---LLHHHHHHLLLHHHHHHHL-------------------
Query ekWDVRYPRDlisLGVVIG---MEIPQAKASISMYPEIILK-------------------  202
ident    ||    |   |              |                               
Sbjct glEDVSKYPD---LIAELLrrnWTEAEVKGALADNLLRVFEaveqasnltqapeeepipl  354
DSSP  llLLLLLHHH---HHHHHHhllLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllh


DSSP  ---------------
Query ---------------  202
ident                
Sbjct dqlggscrthygyss  369
DSSP  hhlllllllllllll


No 50: Query=1v77A Sbjct=4qrnA Z-score=8.4

back to top
DSSP  -------------LLLEEEEELL-------------------------------------
Query -------------VKFIEMDIRD-------------------------------------   10
ident                 |                                           
Sbjct smtqdlktggeqgYLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  lllllllllllllLLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  -----------hHHHHHHHH-HLLEEEEEEE--ELLL---------lLHHHHHHHHHHH-
Query -----------kEAYELAKE-WFDEVVVSIK--FNEE---------vDKEKLREARKEY-   46
ident                        |                                    
Sbjct tqilerlldlgeRRIADMDAtGIDKAILALTspGVQPlhdldeartlATRANDTLADACq  120
DSSP  hhhhhhhhlllhHHHHHHHHlLLLEEEEEELllLLLLlllhhhhhhhHHHHHHHHHHHHh


DSSP  -----lLEEE--------------------------EEEL-----LLHH-hhhHHHHHL-
Query -----gKVAI--------------------------LLSN-----PKPS-lvrDTVQKF-   68
ident                                                             
Sbjct kypdrfIGMGtvapqdpewsareihrgarelgfkgiQINShtqgrYLDEeffdPIFRALv  180
DSSP  hlllleEELLllllllhhhhhhhhhhhhhlllllleEELLlllllLLLLhhhhHHHHHHh


DSSP  -LLLEEEEEL-------------------------LLHHHHHHH--------hhlLLLEE
Query -KSYLIYVES-------------------------NDLRVIRYS--------iekGVDAI   94
ident       |                                                     
Sbjct eVDQPLYIHPatspdsmidpmleagldgaifgfgvETGMHLLRLitigifdkypsLQIMV  240
DSSP  hHLLLEEELLllllllllhhhhhhlllllllhhhhHHHHHHHHHhhhlhhhhlllLLEEE


DSSP  ELlllllllLLLLHH-------------------------HHHHHHHHlLEEEEELhhhh
Query ISpwvnrkdPGIDHV-------------------------LAKLMVKKnVALGFSLrpll  129
ident                                                  |    |     
Sbjct GH----mgeALPYWLyrldymhqagvrsqryermkplkktIEGYLKSN-VLVTNSG----  291
DSSP  LH----hhhLHHHHHhhhhhhhhhhhhlllllllllllllHHHHHHHL-EEEELLL----


DSSP  hllhhhhhhhhhhHHHHHHHHHHHLL--LEEEELLLLLhhHLLLhHHHHHHHHHlLLLHH
Query ysnpyeranllrfMMKAWKLVEKYKV--RRFLTSSAQEkwDVRYpRDLISLGVViGMEIP  187
ident                 | |         |                           |   
Sbjct -----------vaWEPAIKFCQQVMGedRVMYAMDYPY--QYVA-DEVRAMDAM-DMSAQ  336
DSSP  -----------llLHHHHHHHHHHHLhhHEELLLLLLL--LLLH-HHHHHHHLL-LLLHH


DSSP  HHHHLLLHHHHHHHL-
Query QAKASISMYPEIILK-  202
ident   |       |   | 
Sbjct TKKKFFQTNAEKWFKl  352
DSSP  HHHHHHLHHHHHHLLl


No 51: Query=1v77A Sbjct=4ofcA Z-score=8.1

back to top
DSSP  llLEEEEELL----------------------------------------------HHHH
Query vkFIEMDIRD----------------------------------------------KEAY   14
ident    |                                                     |  
Sbjct -mKIDIHSHIlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdPEVR   59
DSSP  -lLEEEEEELlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhhllHHHH


DSSP  HHHHH--HLLEEEEEEE--ELLL---------lLHHHHHHHHHHH------lLEEE----
Query ELAKE--WFDEVVVSIK--FNEE---------vDKEKLREARKEY------gKVAI----   51
ident               |                                             
Sbjct IREMDqkGVTVQALSTVpvMFSYwakpedtlnlCQLLNNDLASTVvsyprrfVGLGtlpm  119
DSSP  HHHHHhhLLLEEEEELLhhHHLLlllhhhhhhhHHHHHHHHHHHHhhlllleEEEEllll


DSSP  ----------------------EEELL----LHHH--hHHHHHHLL--LLEEEEEL----
Query ----------------------LLSNP----KPSL--vRDTVQKFK--SYLIYVES----   77
ident                                                      |      
Sbjct qapelavkemercvkelgfpgvQIGTHvnewDLNAqelFPVYAAAErlKCSLFVHPwdmq  179
DSSP  llhhhhhhhhhhhhhllllleeEEELEelleELLLhhhHHHHHHHHhhLLEEEEELllll


DSSP  ------------------LLHHHHHHH--------hhlllLEEE-LLLLlllllLLLHH-
Query ------------------NDLRVIRYS--------iekgvDAII-SPWVnrkdpGIDHV-  109
ident                        |                                  | 
Sbjct mdgrmakywlpwlvgmpaETTIAICSMimggvfekfpklkVCFAhGGGA-----FPFTVg  234
DSSP  llhhhhlllhhhhlhhhhHHHHHHHHHhlllhhhhlllllEEELhHHLL-----HHHHHh


DSSP  --------------------hhHHHHhhLLEEEEElhhhhhllhhhhhhhhhhHHHHHHH
Query --------------------laKLMVkkNVALGFSlrpllysnpyeranllrfMMKAWKL  149
ident                       |                                   ||
Sbjct rishgfsmrpdlcaqdnpmnpkKYLG--SFYTDAL----------------vhDPLSLKL  276
DSSP  hhhhhhhhlhhhhlllllllhhHHLL--LLEEELL----------------llLHHHHHH


DSSP  HHHHLL--LEEEELLLLLhhhlllhhHHHHHHHHL-LLLHHHHHHLLLHHHHHHHL----
Query VEKYKV--RRFLTSSAQEkwdvryprDLISLGVVI-GMEIPQAKASISMYPEIILK----  202
ident            |                  |                       |     
Sbjct LTDVIGkdKVILGTDYPF---plgelEPGKLIESMeEFDEETKNKLKAGNALAFLGlerk  333
DSSP  HHHHHLllLEELLLLLLL---lllllLLLHHHHHLlLLLHHHHHHHHLHHHHHHHLllhh


DSSP  --
Query --  202
ident   
Sbjct qf  335
DSSP  hl


No 52: Query=1v77A Sbjct=2gwgA Z-score=8.1

back to top
DSSP  lLLEEEEELLH------------------------------------------HHHHHHH
Query vKFIEMDIRDK------------------------------------------EAYELAK   18
ident    |                                                        
Sbjct -XIIDIHGHYTtapkaledwrnrqiagikdpsvxpkvselkisddelqasiieNQLKKXQ   59
DSSP  -LLEEEEEELLlllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHHHHH


DSSP  H-HLLEEEE-----eeeellllLHHHHHHHHHHH------LLEE----------------
Query E-WFDEVVV-----sikfneevDKEKLREARKEY------GKVA----------------   50
ident |   |  |                                   |                
Sbjct ErGSDLTVFspragdfnvsstwAAICNELCYRVSqlfpdnFIGAaxlpqspgvdpktcip  119
DSSP  HhLLLEEEEelllllhhhhhhhHHHHHHHHHHHHhhllllEEEEeellllllllhhhhhh


DSSP  -------------EEEELL---------LHHH--hHHHHHHLL--LLEEEEE--------
Query -------------ILLSNP---------KPSL--vRDTVQKFK--SYLIYVE--------   76
ident              | |                        |                   
Sbjct elekcvkeygfvaINLNPDpsgghwtspPLTDriwYPIYEKXVelEIPAXIHvstgahyl  179
DSSP  hhhhhhhllllleEEELLLlllllllllLLLLhhhHHHHHHHHhhLLLEEELlllllhhh


DSSP  -LLLHhHHHH--------hhhlLLLEEE-LLLLlllllLLLH--------------HHHH
Query -SNDLrVIRY--------siekGVDAII-SPWVnrkdpGIDH--------------VLAK  112
ident                           |              |               |  
Sbjct nADTT-AFXQcvagdlfkdfpeLKFVIPhGGGA-----VPYHwgrfrglaqexkkpLLED  233
DSSP  hHHHH-HHHHhhhllhhhhlllLLEEELhHHLL-----LHHHhhhhhhhhhhllllLHHH


DSSP  HHHhHLLEEEEELHhhhhllhhhhhhHHHHHHHHHHHHHhhlLLEEEELLL-LLHH----
Query LMVkKNVALGFSLRpllysnpyeranLLRFMMKAWKLVEkykVRRFLTSSA-QEKW----  167
ident      |                                          |           
Sbjct HVL-NNIFFDTCVY------------HQPGIDLLNTVIP--vDNVLFASEXiGAVRgidp  278
DSSP  HLL-LLEEEELLLL------------LHHHHHHHHHHLL--hHHEELLLLLlLLLLleel


DSSP  -hlllhhHHHHHHHHL-LLLHHHHHHLLLHHHHHHHL--------------
Query -dvryprDLISLGVVI-GMEIPQAKASISMYPEIILK--------------  202
ident        |                                           
Sbjct rtgfyydDTKRYIEAStILTPEEKQQIYEGNARRVYPrldaalkakgkleh  329
DSSP  llleellLLHHHHHHLlLLLHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll


No 53: Query=1v77A Sbjct=4dziC Z-score=7.9

back to top
DSSP  ---LLLEEEEELLH----------------------------------------------
Query ---VKFIEMDIRDK----------------------------------------------   11
ident       |  |                                                  
Sbjct alnYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  lllLLEEEEEEELLlllllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  -----------------------------------------hhhHHHHHH-LLEEEEEEE
Query -----------------------------------------eayELAKEW-FDEVVVSIK   29
ident                                                 |           
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeyqnrdariAVMDEQdIETAFMLPT  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhhllhhhhhHHHHHHlEEEEEEELL


DSSP  --ELLL------------lLHHHHHHHHHHH--------LLEE-----------------
Query --FNEE------------vDKEKLREARKEY--------GKVA-----------------   50
ident      |                                    |                 
Sbjct fgCGVEealkhdieatmasVHAFNLWLDEDWgfdrpdhrIIAApivsladptraveevdf  180
DSSP  hhHHHHhhllllhhhhhhhHHHHHHHHHHHLllllllllEEELlllllllhhhhhhhhhh


DSSP  --------EEEElLLHH------------hhhhhHHHL--LLLEEEEEL-----------
Query --------ILLSnPKPS------------lvrdtVQKF--KSYLIYVES-----------   77
ident          |   | |                                            
Sbjct vlargaklVLVR-PAPVpglvkprslgdrshdpvWARLaeAGVPVGFHLsdsgylhiaaa  239
DSSP  hhhlllllEELL-LLLLlllllllllllhhhhhhHHHHhhHLLLEEEELlllllhhhhhh


DSSP  ----------------LLHHHHHHH--------hhlLLLEEELLLlllllLLLLHHH---
Query ----------------NDLRVIRYS--------iekGVDAIISPWvnrkdPGIDHVL---  110
ident                                          |                  
Sbjct wggakdpldqvllddrAIHDTMASMivhgvftrhpkLKAVSIENG----sYFVHRLIkrl  295
DSSP  llllllhhhhhhhllhHHHHHHHHHhhllhhhhlllLLEEEELLL----lLHHHHHHhhh


DSSP  ---------------hHHHHhHLLEEEEELhhhhhllhhhhhhhHHHHHHHHHHHHhhll
Query ---------------aKLMVkKNVALGFSLrpllysnpyeranlLRFMMKAWKLVEkykv  155
ident                       ||                                    
Sbjct kkaantqpqyfpedpvEQLR-NNVWIAPYY--------------EDDLPELARVIG--vd  338
DSSP  hhhhhhlhhhllllhhHHHH-HHEEELLLL--------------LLLHHHHHHHHL--hh


DSSP  LEEEELLLLLHHH-LLLHhHHHHHHHhlLLLHHHHHHLLLHHHHHHHL-----
Query RRFLTSSAQEKWD-VRYPrDLISLGVviGMEIPQAKASISMYPEIILK-----  202
ident      |                      |                 |      
Sbjct KILFGSDWPHGEGlASPV-SFTAELK--GFSESDIRKIMRDNALDLLGvqvgs  388
DSSP  HLLLLLLLLLLLLlLLHH-HHHHHHL--LLLHHHHHHHHLHHHHHHHLlllll


No 54: Query=1v77A Sbjct=2yb1A Z-score=7.2

back to top
DSSP  llLEEEEELL---------HHHHHHHHHH-LLEEEEEEEElllllhhhHHHHhHHHL---
Query vkFIEMDIRD---------KEAYELAKEW-FDEVVVSIKFneevdkekLREArKEYG---   47
ident    |                |    |                            |     
Sbjct -aNIDLHFHSrtsdgaltpTEVIDRAAARaPALLALTDHD-------cTGGL-AEAAaaa   51
DSSP  -lLEELLLLLllllllllhHHHHHHHHLLlLLEEEELLLL-------lLLLH-HHHHhhh


DSSP  -------LEEEEEELL------------lhhhhHHHHHHL--------------------
Query -------KVAILLSNP------------kpslvRDTVQKF--------------------   68
ident              |                                              
Sbjct arrgipfLNGVEVSVSwgrhtvhivglgidpaePALAAGLksiregrlerarqmgaslea  111
DSSP  hhlllleEEEEEEEEEelleeeeeeeellllllHHHHHHHhhhhllhhhhhhhhhhhhhh


DSSP  ----------------------------------------------llleeeeelllhhh
Query ----------------------------------------------ksyliyvesndlrv   82
ident                                                             
Sbjct agiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwas  171
DSSP  lllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllllll


DSSP  HHHHHHLLL-----LEEELLLLLLLLlllLHHHHHHHHH-HLLEEE-EELHHhhhllhhh
Query IRYSIEKGV-----DAIISPWVNRKDpgiDHVLAKLMVK-KNVALG-FSLRPllysnpye  135
ident         |       |  |            |               |           
Sbjct LEDAVGWIVgaggmAVIAHPGRYDMGrtlIERLILDFQAaGGQGIEvASGSH--------  223
DSSP  HHHHHHHHHhllleEEELLHHHLLLLhhhHHHHHHHHHHlLLLEEEeEELLL--------


DSSP  hhhHHHHHHHHHHHHHHHLLLEEEELLLLLH-HHLLlhhhHHHHHHhllllhhhhhhlll
Query ranLLRFMMKAWKLVEKYKVRRFLTSSAQEK-WDVRyprdLISLGVvigmeipqakasis  194
ident     |  | |               |       ||        |                
Sbjct ---SLDDMHKFALHADRHGLYASSGSDFHAPgEDVG---hTEDLPP-----------icr  266
DSSP  ---LHHHHHHHHHHHHHHLLEEEEELLLLLLlLLLL---lLLLLLL-----------lll


DSSP  HHHHHHHL----------
Query MYPEIILK----------  202
ident                   
Sbjct PIWRELEArilrpadaen  284
DSSP  LHHHHLHHhlllllhhhl


No 55: Query=1v77A Sbjct=1j5sA Z-score=7.1

back to top
DSSP  ------------------------LLLEEEEELLH-------------------------
Query ------------------------VKFIEMDIRDK-------------------------   11
ident                                                             
Sbjct hmflgedylltnraavrlfnevkdLPIVDPHNHLDakdivenkpwndiwevegatdhyvw   60
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLLhhhhhhllllllhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   11
ident                                                             
Sbjct elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh


DSSP  ----------------hhhhhhhHHLLEEEEEEeelllllhhHHHHhHHHH---------
Query ----------------eayelakEWFDEVVVSIkfneevdkeKLREaRKEY---------   46
ident                                                             
Sbjct aeeiweetkkklpemtpqkllrdMKVEILCTTD---------DPVStLEHHrkakeaveg  171
DSSP  hhhhhhhhhhhlllllhhhhhhhLLEEEEELLL---------LLLLlLHHHhhhhhhlll


DSSP  ---LLEE----------------------------------------------------E
Query ---GKVA----------------------------------------------------I   51
ident                                                             
Sbjct vtiLPTWrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcvaS  231
DSSP  leeELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhllllleE


DSSP  EEEL---------------------------------lLHHHHHHHHHHLL--LLEEEEE
Query LLSN---------------------------------pKPSLVRDTVQKFK--SYLIYVE   76
ident                                       |                     
Sbjct DHALlepsvyyvdenraravhekafsgekltqdeindyKAFMMVQFGKMNQetNWVTQLH  291
DSSP  EEEElllllllllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHhhLLEEEEE


DSSP  LL---------------------------LHHHHHHHHHLL----LLEEELllLLLLLL-
Query SN---------------------------DLRVIRYSIEKG----VDAIISpwVNRKDP-  104
ident                                   ||                        
Sbjct IGalrdyrdslfktlgpdsggdistnflrIAEGLRYFLNEFdgklKIVLYV--LDPTHLp  349
DSSP  ELeellllhhhhhhlllllllleelllllHHHHHHHHHHHLllllLEEEEE--LLHHHHh


DSSP  LLLHHHHHHhhhHLLEEEEELHHHhhllhhhHHHH-HHHHHHHHHHHHhhLLLEEEELLL
Query GIDHVLAKLmvkKNVALGFSLRPLlysnpyeRANL-LRFMMKAWKLVEkyKVRRFLTSSA  163
ident  |           ||  |                                          
Sbjct TISTIARAF---PNVYVGAPWWFN------dSPFGmEMHLKYLASVDL-lYNLAGMVTDS  399
DSSP  HHHHHHHHL---LLEEELLLLLLL------lLHHHhHHHHHHHHLLLL-hHHLLLLLLLL


DSSP  LLHHHLL-LHHHHHHHHHHLL------------lLHHHHHHLLLHHHHHHHL
Query QEKWDVR-YPRDLISLGVVIG------------mEIPQAKASISMYPEIILK  202
ident                                        |      |     
Sbjct RKLLSFGsRTEMFRRVLSNVVgemvekgqipikeARELVKHVSYDGPKALFF  451
DSSP  LLLLHHHhHHHHHHHHHHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL


No 56: Query=1v77A Sbjct=3e38A Z-score=6.8

back to top
DSSP  ----------------LLLEEEEELL---------HHHHHHHHHH-LLEEEEEEEEL---
Query ----------------VKFIEMDIRD---------KEAYELAKEW-FDEVVVSIKFN---   31
ident                                          |     |            
Sbjct aqrrneiqvpdldgytTLKCDFHXHSvfsdglvwpTVRVDEAYRDgLDAISLTEHIEyrp   60
DSSP  llllllllllllllleEEEEELLLLLllllllllhHHHHHHHHHLlLLEELLEEELLlll


DSSP  -llllhHHHHHHHHHHL----------LEEEEEEL---------------------lLHH
Query -eevdkEKLREARKEYG----------KVAILLSN---------------------pKPS   59
ident                                                             
Sbjct hkqdvvSDHNRSFDLCReqaeklgillIKGSEITRaxapghfnaiflsdsnpleqkdYKD  120
DSSP  llllllLLLLHHHHHHHhhhhhhlleeLLEEEEELllllleeeeelllllhhhllllHHH


DSSP  HHHHHHHHLllleeeeelllhhhhhhhhhllLLEEELLL--LLLL-LLLLLhHHHHHHHH
Query LVRDTVQKFksyliyvesndlrvirysiekgVDAIISPW--VNRK-DPGIDhVLAKLMVK  116
ident   |                                  |                      
Sbjct AFREAKKQG---------------------aFXFWNHPGwdSQQPdTTKWW-PEHTALYQ  158
DSSP  HHHHHHHLL---------------------lEEEELLLLllLLLLlLLLLL-HHHHHHHH


DSSP  HL--LEEE-EELHHhhhllhhhhhhhhhhHHHHHHHHHHHLLLEEEELLLLLHH----hl
Query KN--VALG-FSLRPllysnpyeranllrfMMKAWKLVEKYKVRRFLTSSAQEKW----dv  169
ident                                 |             ||            
Sbjct EGcxHGIEvANGHL--------------yXPEAIQWCLDKNLTXIGTSDIHQPIqtdydf  204
DSSP  LLllLEEEeEELLE--------------eLLHHHHHHHHHLLEEEEELLLLLLHhhhllh


DSSP  llhHHHHhhhhhllllhhhhhhlLLHH---------hhHHHL------------------
Query rypRDLIslgvvigmeipqakasISMY---------peIILK------------------  202
ident                                                             
Sbjct ekgEHRT---------------xTFVFakerslqgireALDNrrtaayfhelligredll  249
DSSP  hhlLLLL---------------eEEEEellllhhhhhhHHHLlleeeeelleeellhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  202
ident                                                             
Sbjct rpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvr  309
DSSP  hhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeee


DSSP  ---------------------------------
Query ---------------------------------  202
ident                                  
Sbjct igfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeellllllleeeeeeeeeeeelleeeeeeeel


No 57: Query=1v77A Sbjct=2anuA Z-score=6.8

back to top
DSSP  --LLLEEEEELL---------HHHHHHHH-HHLLEEEEEEEELLL---------------
Query --VKFIEMDIRD---------KEAYELAK-EWFDEVVVSIKFNEE---------------   33
ident                       |   |      | |                        
Sbjct teWLLCDFHVHTnxsdghlplGEVVDLFGkHGVDVVSITDHIVDRrtleqrkrngeplga   60
DSSP  leEEEEEEEELLllllllllhHHHHHHHHhLLLLEEEEEEEEELHhhhhhhhhlllllll


DSSP  ----lLHHHHHHHHHHH----------LLEEEEEELLL------------hhHHHHhhhh
Query ----vDKEKLREARKEY----------GKVAILLSNPK------------psLVRDtvqk   67
ident          |     |                   |                        
Sbjct itedkFQDYLKRLWREQkraweeygxiLIPGVEITNNTdlyhivavdvkeyvDPSL----  116
DSSP  lllllHHHHHHHHHHHHhhhhhhhlleEEEEEEEEELLlleeeeeellllllLLLL----


DSSP  lllleeeeelllhhHHHHHHHLL-----lLEEELL-llLLLLLLL--LHHHHHHHhhhlL
Query fksyliyvesndlrVIRYSIEKG-----vDAIISP-wvNRKDPGI--DHVLAKLMvkknV  119
ident                     ||            |                         
Sbjct --------------PVEEIVEKLkeqnalVIAAHPdrkKLSWYLWanXERFKDTF----D  158
DSSP  --------------LHHHHHHHHhhllleEEELLLlllLLLLHHHhlLLLLLLLL----L


DSSP  EEE-EELHHhhhllhhhhhhhhhhHHHHHHHhhhhLLLEEEELLLLLHHHLLlhhhhhhh
Query ALG-FSLRPllysnpyeranllrfMMKAWKLvekyKVRRFLTSSAQEKWDVRyprdlisl  178
ident |                                  | |    |   | | |         
Sbjct AWEiANRDD--------------lFNSVGVK----KYRYVANSDFHELWHVY--------  192
DSSP  EEEeEELLE--------------eLHHHHHL----LLLEEEELLLLLHHHHL--------


DSSP  hhhllllhhhhhhlLLHH----hhHHHL---------------
Query gvvigmeipqakasISMY----peIILK---------------  202
ident                          |                 
Sbjct -----------swkTLVKseknieAIKEairkntdvaiylxrk  224
DSSP  -----------leeEEEEelllhhHHHHhhhhllleeeeelll


No 58: Query=1v77A Sbjct=3iacA Z-score=5.3

back to top
DSSP  -------------------------lllEEEEELLH------------------------
Query -------------------------vkfIEMDIRDK------------------------   11
ident                                                             
Sbjct atfxtedfllkndiartlyhkyaapxpiYDFHCHLSpqeiaddrrfdnlgqiwlegdhyk   60
DSSP  llllllllllllhhhhhhhhhlllllleEELLLLLLhhhhhhllllllhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   11
ident                                                             
Sbjct wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll


DSSP  ---------------------hhhhhhhHHLLEEEE------------------------
Query ---------------------eayelakEWFDEVVV------------------------   26
ident                                  |                          
Sbjct pdtaesiwtqcneklatpafsargixqqXNVRXVGTtddpidsleyhrqiaaddsidiev  180
DSSP  hhhhhhhhhhhhhhhllhhhlhhhhhhhLLEEEEELllllllllhhhhhhhhllllllee


DSSP  --EEEELLL-------------------------------lLHHHHHHHHHHhLLEEEEE
Query --SIKFNEE-------------------------------vDKEKLREARKEyGKVAILL   53
ident   |                                          |       |  |   
Sbjct apSWRPDKVfkieldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAAC-GCRASDH  239
DSSP  elLLLLHHHhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHL-LLLEEEE


DSSP  EL--LLHH-----------------------------HHHHHHHHLLLL-----EEEEEL
Query SN--PKPS-----------------------------LVRDTVQKFKSY-----LIYVES   77
ident                                           |     |           
Sbjct GIetLRFApvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYaargwVXQLHI  299
DSSP  EEllLLLLllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHhhhllEEEEEE


DSSP  L--------------------------LHHHHHHHHHL------LLLEEELLlLLLLLL-
Query N--------------------------DLRVIRYSIEK------GVDAIISPwVNRKDP-  104
ident                                                 |     |  |  
Sbjct GairnnntrxfrllgpdtgfdsigdnnISWALSRLLDSxdvtneLPKTILYC-LNPRDNe  358
DSSP  LeellllhhhhhhhllllllleellllLHHHHHHHHHHhhllllLLEEEEEE-LLHHHHh


DSSP  LLLHhHHHHHHH---hlLEEEEE-lHHHHHLlhhHHHHHHhhHHHHHHHHHhhlllEEEE
Query GIDHvLAKLMVK---knVALGFS-lRPLLYSnpyERANLLrfMMKAWKLVEkykvrRFLT  160
ident                       |                                     
Sbjct VLAT-XIGNFQGpgiagKVQFGSgwWFNDQK---DGXLRQ--LEQLSQXGL--lsqFVGX  410
DSSP  HHHH-HHHHLLLlllllLEEELLllHHHLLH---HHHHHH--HHHHHHHLL--hhhLLLL


DSSP  LLLLL---HHHLL---------------lhhhhhhhhhhlllLHHHHH-HLLLhhhHHHH
Query SSAQE---KWDVR---------------yprdlislgvvigmEIPQAK-ASISmypEIIL  201
ident                                                             
Sbjct LTDSRsflSYTRHeyfrrilcnllgqwaqdgeipddeaxlsrXVQDICfNNAQ---RYFT  467
DSSP  LLLLLlllLLHHHhhhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHlHHHH---HHLL


DSSP  L-
Query K-  202
ident   
Sbjct Ik  469
DSSP  Ll


No 59: Query=1v77A Sbjct=1bksA Z-score=4.8

back to top
DSSP  llleeeeellhhhhhhhhHHLLEEEEEEEELLL----lLHHHHHHHHHHhLLEEEEEELL
Query vkfiemdirdkeayelakEWFDEVVVSIKFNEE----vDKEKLREARKEyGKVAILLSNP   56
ident                          |                        |  |  |  |
Sbjct ------meryenlfaqlnDRREGAFVPFVTLGDpgieqSLKIIDTLIDA-GADALELGVP   53
DSSP  ------lhhhhhhhhhhhHLLLLEEEEEEELLLllhhhHHHHHHHHHHL-LLLLEEEELL


DSSP  -----------------------LHHHHHHHHHHLL----LLEEEEELLlHHHH-----h
Query -----------------------KPSLVRDTVQKFK----SYLIYVESNdLRVI-----r   84
ident                         |                  |                
Sbjct fsdpladgptiqnanlrafaagvTPAQCFEMLALIRekhpTIPIGLLMY-ANLVfnngid  112
DSSP  llllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHhhllLLLEEEEEL-HHHHhlllhh


DSSP  hhHHLL----LLEEELLLLlllllllLHHHHHHHHHHLLEEEEELhhHHHLlhhhhhhhh
Query ysIEKG----VDAIISPWVnrkdpgiDHVLAKLMVKKNVALGFSLrpLLYSnpyeranll  140
ident           ||      |                  | |  |                 
Sbjct afYARCeqvgVDSVLVADV---pveeSAPFRQAALRHNIAPIFIC--PPNA---------  158
DSSP  hhHHHHhhhlLLEEEELLL---lhhhLHHHHHHHHHLLLEEEEEE--LLLL---------


DSSP  hhhhhhhhhhhhhllLEEEELllllhhhlllhHHHHHHHHhllllhhhHHHLL-------
Query rfmmkawklvekykvRRFLTSsaqekwdvrypRDLISLGVvigmeipqAKASI-------  193
ident                |                  ||              |         
Sbjct ---dddllrqvasygRGYTYL------lalplHHLIEKLK-------eYHAAPalqgfgi  202
DSSP  ---lhhhhhhhhhhlLLLEEE------llllhHHHHHHHH-------hHLLLLeeellll


DSSP  --------------------------------------------lhhhhhhhl
Query --------------------------------------------smypeiilk  202
ident                                                      
Sbjct sspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
DSSP  llhhhhhhhhhhllleeeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll