Results: dupa

Query: 1onxA

MOLECULE: ISOASPARTYL DIPEPTIDASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1onx-A 74.8  0.0  390   390  100 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   2:  2vun-A 31.4  2.6  321   385   17 PDB  MOLECULE: ENAMIDASE;                                                 
   3:  3nqb-A 30.4  3.3  315   587   19 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   4:  1gkp-A 29.5  2.7  332   458   18 PDB  MOLECULE: HYDANTOINASE;                                              
   5:  2paj-A 29.1  3.1  320   421   16 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   6:  3giq-A 29.0  3.0  321   475   18 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   7:  4cqb-A 28.3  3.5  328   402   14 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  3gri-A 28.1  2.9  314   422   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
   9:  3e74-A 28.1  2.7  314   429   20 PDB  MOLECULE: ALLANTOINASE;                                              
  10:  4b3z-D 27.7  2.8  333   477   15 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  11:  3mtw-A 27.7  3.0  309   404   18 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  12:  3ls9-A 27.4  3.2  327   453   19 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  13:  3mkv-A 27.3  3.0  306   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  14:  1yrr-B 27.2  2.9  302   334   19 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  15:  1j6p-A 26.9  3.3  313   407   16 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  16:  2oof-A 25.7  3.5  312   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  17:  1k6w-A 25.4  3.5  316   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  18:  2ogj-A 24.7  3.1  303   379   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  19:  3ooq-A 24.5  3.0  281   384   24 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  20:  4c5y-A 24.3  3.4  306   436   18 PDB  MOLECULE: OCHRATOXINASE;                                             
  21:  2uz9-A 23.7  3.5  311   444   16 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  22:  3icj-A 23.0  3.2  289   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  23:  4rdv-B 22.9  3.3  313   451   16 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  24:  1a5k-C 21.1  3.1  313   566   17 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  25:  1bf6-A 20.1  2.7  241   291   17 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  26:  2ob3-A 19.1  3.1  236   329   17 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  27:  3k2g-B 19.0  2.7  242   358   16 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  28:  2vc5-A 18.3  3.2  238   314   18 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  29:  3pnu-A 17.2  3.2  247   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  2y1h-B 16.6  2.8  223   265   16 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  31:  2ffi-A 16.6  2.9  230   273   15 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  32:  3cjp-A 16.6  2.6  211   262   16 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  33:  2imr-A 16.3  4.6  279   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  34:  2qpx-A 16.0  3.2  227   376   15 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  35:  4mup-B 16.0  3.3  227   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  36:  4dlf-A 15.8  3.1  229   287   13 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  37:  3irs-A 15.6  3.1  226   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  38:  2dvt-A 15.3  2.9  224   325   11 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  39:  4qrn-A 15.3  2.9  225   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  40:  1itq-A 15.0  2.9  228   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  41:  4hk5-D 14.9  3.1  230   380   14 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  42:  4ofc-A 14.5  3.0  224   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  43:  1a4m-A 14.4  3.4  232   349   12 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  44:  3gg7-A 13.9  3.1  213   243   15 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  45:  2gwg-A 13.3  3.9  223   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  46:  1j5s-A 12.5  3.3  223   451   10 PDB  MOLECULE: URONATE ISOMERASE;                                         
  47:  4dzi-C 12.5  3.5  221   388   14 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  3qy6-A 12.4  3.0  191   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  49:  3iac-A 12.0  3.2  224   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  1v77-A 10.4  3.4  181   202   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  3dcp-A  8.7  3.4  177   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  52:  2a3l-A  8.5  4.1  238   616   13 PDB  MOLECULE: AMP DEAMINASE;                                             
  53:  1m65-A  8.2  3.9  192   234   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3au2-A  8.2  7.2  193   575   13 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  3f2b-A  7.7  7.7  183   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.7  3.8  174   255   11 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  6.0  3.5  150   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  3e38-A  6.0  3.5  155   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2yb1-A  6.0  3.7  151   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1onxA Sbjct=1onxA Z-score=74.8

back to top
DSSP  LLLLHHHLLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLLLLLLLEEEELLLLEE
Query MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQIL   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQIL   60
DSSP  LLLLHHHLLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLLLLLLLEEEELLLLEE


DSSP  EELEEEEEELLLLLLLLLLHHHLLLLLLHHHHHHLLEEEEEELLLLLLLLLLHHHHHHHH
Query CPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKT  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKT  120
DSSP  EELEEEEEELLLLLLLLLLHHHLLLLLLHHHHHHLLEEEEEELLLLLLLLLLHHHHHHHH


DSSP  HHHHHHLLEEEEEEELLLLLLLLLLLLHHHHHHHLLLEEEEEEEELLLLLLLLLHHHHHH
Query RALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVXCAISDHRSAAPDVYHLAN  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RALNEEGISAWMLTGAYHVPSRTITGSVEKDVAIIDRVIGVXCAISDHRSAAPDVYHLAN  180
DSSP  HHHHHHLLEEEEEEELLLLLLLLLLLLHHHHHHHLLLEEEEEEEELLLLLLLLLHHHHHH


DSSP  HHHHHHHHHHHHLLLLEEEEEELLLLLLLHHHHHHHHLLLLLHHHEEEELHHHLHHHHHH
Query MAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQ  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQ  240
DSSP  HHHHHHHHHHHHLLLLEEEEEELLLLLLLHHHHHHHHLLLLLHHHEEEELHHHLHHHHHH


DSSP  HHHHHHLLLLEEEELLLLLLLLHHHHHHHHHHLLLLHHHEEEELLLLLEEEEELLLLLEE
Query ALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLT  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLT  300
DSSP  HHHHHHLLLLEEEELLLLLLLLHHHHHHHHHHLLLLHHHEEEELLLLLEEEEELLLLLEE


DSSP  EEEELLLHHHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEL
Query HIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT  360
DSSP  EEEELLLHHHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEL


DSSP  LLLLEEEEEELLEEEEELLEELLLLLLLLL
Query PELRIEQVYARGKLMVKDGKACVKGTFETD  390
ident ||||||||||||||||||||||||||||||
Sbjct PELRIEQVYARGKLMVKDGKACVKGTFETD  390
DSSP  LLLLEEEEEELLEEEEELLEELLLLLLLLL


No 2: Query=1onxA Sbjct=2vunA Z-score=31.4

back to top
DSSP  llllhhhLLEEEEEE-EEELL----LEEEEEEEEEELLEEEEEELL-LLLLlLLLLEEEE
Query midytaaGFTLLQGA-HLYAP----EDRGICDVLVANGKIIAVASN-IPSDiVPNCTVVD   54
ident          |                        |  | | |        |     |  |
Sbjct -------SKTIIKNIgKIVSGdiksPVLQADTIVVEDGLIAAIGGEeLMKD-AGDATIID   52
DSSP  -------LEEEEELLlEEELLllllLEELLLEEEEELLEEEEEELHhHHLL-LLLLEEEE


DSSP  LLLLEEEELEEEEEELL----LLLLllllhhhLLLLLLHHHHHHLLEEEEEE-LLLLlLL
Query LSGQILCPGFIDQHVHL----IGGGgeagpttRTPEVALSRLTEAGVTSVVG-LLGTdSI  109
ident   |    ||  | |||                       |     |||            
Sbjct AAGSTVTPGLLDTHVHVsggdYAPR-------QKTMDFISSALHGGVTTMISaGSPH-FP  104
DSSP  LLLLEEEELEEEEEELLllllEEHH-------HLEELHHHHHHLLLEEEEEElLLLL-LL


DSSP  LL---------LHHHHHHHHHHHHHHLLEEE-EEEEllLLLLllllLLHHHHhHHLLlEE
Query SR---------HPESLLAKTRALNEEGISAW-MLTGayHVPSrtitGSVEKDvAIIDrVI  159
ident  |             |          |                               | 
Sbjct GRpkdaagtkaLAITLSKSYYNARPAGVKVHgGAVI-lEKGL--teEDFIEM-KKEG-VW  159
DSSP  LLlllhhhhhhHHHHHHHHHHHLLHHHLEEElLEEL-lLLLL--lhHHHHHH-HHLL-LL


DSSP  EEEEEEllllLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLL-----LLLL-HHHH
Query GVXCAIsdhrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDS-----KKAL-QPIY  213
ident  |                 | |       |           | |                
Sbjct IVGEVG---lGTIKNPEDAAPMVEWAHKHG------FKVQMHTGGTsipgsSTVTaDDVI  210
DSSP  EEEEEL---lLLLLLHHHHHHHHHHHHHLL------LEEEEELLLLlllllLLLLhHHHH


DSSP  HHHhlllllhhHEEEELHH---HLHHhHHHHHHHHHL-LLLEEEELLLLLLLlHHHHHHH
Query DLLencdvpisKLLPTHVN---RNVPlFEQALEFARK-GGTIDITSSIDEPVaPAEGIAR  269
ident                 | |                        |               |
Sbjct KTK--------PDVVSHINggpTAIS-VQEVDRIMDEtDFAMEIVQCGNPKI-ADYVARR  260
DSSP  HHL--------LLEEELLLlllLLLL-HHHHHHHHHHlLLEEEEELLLLHHH-HHHHHHH


DSSP  HHHLLlLHHHEEEELLLLLEEeeellllleeeeeELLLHHHHHHHHHHHHHHLLLHHHHH
Query AVQAGiPLARVTLSSDGNGSQpffddegnlthigVAGFETLLETVQVLVKDYDFSISDAL  329
ident |   |  | ||    |                         |          |     | 
Sbjct AAEKG-QLGRVIFGNDAPSGT-------------GLIPLGILRNMCQIASMSDIDPEVAV  306
DSSP  HHHHL-LHHHEEEELLLLLLL-------------LLLLLHHHHHHHHHHHHLLLLHHHHH


DSSP  HHHLHHHHHHLLLlLLLLLLLLLLLLEEEELLL-----------------LLEEEEEELL
Query RPLTSSVAGFLNLtGKGEILPGNDADLLVMTPE-----------------LRIEQVYARG  372
ident    |        |   | | ||  |||  |                      |  |   |
Sbjct CMATGNSTAVYGL-NTGVIAPGKEADLIIMDTPlgsvaedamgaiaagdiPGISVVLIDG  365
DSSP  HHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELLlllllllhhhhhhhlllLEEEEEEELL


DSSP  EEEEELLE--elllllllll
Query KLMVKDGK--acvkgtfetd  390
ident    |                
Sbjct EAVVTKSRntppakraakil  385
DSSP  EEEELLLLllllllllleel


No 3: Query=1onxA Sbjct=3nqbA Z-score=30.4

back to top
DSSP  ----lllLHHH------------lLEEEEEEEEELL--LEEEEEEEEEELLEEEEEEL-L
Query ----midYTAA------------gFTLLQGAHLYAP--EDRGICDVLVANGKIIAVAS-N   41
ident         |                 |  |  |           |       |  |    
Sbjct epadlndDTLRaravaaargdqrfDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpA   60
DSSP  llhhhllHHHHhhhhhhhhlllleEEEEELLEEELLllLLEEELEEEEELLEEEEEELlL


DSSP  LLLLllllLEEEELLLLEEEELEEEEEELLLLllllllhhhlLLLL--LHHHHHHLLEEE
Query IPSDivpnCTVVDLSGQILCPGFIDQHVHLIGgggeagpttrTPEV--ALSRLTEAGVTS   99
ident    |      | |  |    || || | |                           ||| 
Sbjct SRRD---aAQVIDAGGAYVSPGLIDTHXHIES---------sXITPaaYAAAVVARGVTT  108
DSSP  LLLL---eEEEEELLLLEEEELEEEEEELHHH---------hLLLHhhHHHHHHLLLEEE


DSSP  EEELLLLL-LLLL--LHHHHHHHHHhhhHHLLEEEEEEELLLLL--------lllllLLH
Query VVGLLGTD-SISR--HPESLLAKTRalnEEGISAWMLTGAYHVP--------srtitGSV  148
ident  |                               |  |                       
Sbjct IVWDPHEFgNVHGvdGVRWAAKAIE---NLPLRAILLAPSCVPSapglerggadfdaAIL  165
DSSP  EEELLHHHhHHHLhhHHHHHHHHHL---LLLLEEEEEELLLLLLllllllllllllhHHH


DSSP  HHHHHhLLLEEEEE-EEELlllllLLLH---HHHHHHHHHHHHHHhhhlllLEEEEEELL
Query EKDVAiIDRVIGVX-CAISdhrsaAPDV---YHLANMAAESRVGGllggkpGVTVFHMGD  204
ident            |                                            |   
Sbjct ADLLS-WPEIGGIAeIXNX-----RGVIerdPRXSGIVQAGLAAE------KLVCGHARG  213
DSSP  HHHHL-LLLEEEEEeELLH-----HHHHlllHHHHHHHHHHHHHL------LEEEELLLL


DSSP  L-lllLHHHHHHhhlllllhhHEEEELHhHLHHHHHHHHHHHhllLLEEEELLLLLllLH
Query S-kkaLQPIYDLlencdvpisKLLPTHVnRNVPLFEQALEFArkgGTIDITSSIDEpvAP  263
ident      |                                |       ||    | |     
Sbjct LknadLNAFXAA--------gVSSDHEL-VSGEDLXAKLRAG---LTIELRGSHDH--LL  259
DSSP  LlhhhHHHHHHL--------lLLEELLL-LLHHHHHHHHHLL---LEEEEELLLHH--HH


DSSP  HHHHHHHHHLLLLHHHEEEELLLLLeeeeellllleeeeEELL--lHHHHHHHHHHHHhH
Query AEGIARAVQAGIPLARVTLSSDGNGsqpffddegnlthiGVAG--fETLLETVQVLVKdY  321
ident  |  |     |     |||  |                          |   |  ||  |
Sbjct PEFVAALNTLGHLPQTVTLCTDDVF--------------PDDLlqgGGLDDVVRRLVR-Y  304
DSSP  HHHHHHHHHHLLLLLLEEEELLLLL--------------HHHHhhlLLHHHHHHHHHH-L


DSSP  LLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEELL--LLLEEEEEELLEEEEELL
Query DFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTP--ELRIEQVYARGKLMVKDG  379
ident       |||  |   |  |     | |  |  ||  |           | | |      |
Sbjct GLKPEWALRAATLNAAQRLGRSDLGLIAAGRRADIVVFEDlnGFSARHVLASGRAVAEGG  364
DSSP  LLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLllLLLEEEEEELLEEEEELL


DSSP  EELLLLLL----------------------------------------------------
Query KACVKGTF----------------------------------------------------  387
ident    |                                                        
Sbjct RXLVDIPTcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdg  424
DSSP  EELLLLLLlllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  387
ident                                                             
Sbjct fvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdx  484
DSSP  eellllleeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  387
ident                                                             
Sbjct alaanavigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewq  544
DSSP  hhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhllll


DSSP  ----------------------------------------lll
Query ----------------------------------------etd  390
ident                                            
Sbjct ppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  lllllhhhhhlllllllllleelllleeelllleeellleeel


No 4: Query=1onxA Sbjct=1gkpA Z-score=29.5

back to top
DSSP  llllhhhlLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLllLLLLEEEELLLLEE
Query midytaagFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSdiVPNCTVVDLSGQIL   60
ident           |           |   |       |     |      |   | |  |   
Sbjct --------PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEA--PPGTEVIDATGKYV   50
DSSP  --------LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLL--LLLLEEEELLLLEE


DSSP  EELEEEEEELLlLLLLlllHHHLLLLL---LHHHHHHLLEEEEEELLLLLLLL---lLHH
Query CPGFIDQHVHLiGGGGeagPTTRTPEV---ALSRLTEAGVTSVVGLLGTDSIS---rHPE  114
ident  ||||| |||           |                | |                   
Sbjct FPGFIDPHVHI-YLPF---MATFAKDThetGSKAALMGGTTTYIEMCCPSRNDdaleGYQ  106
DSSP  EELEEEEEELL-LLEE---LLEELLLLhhhHHHHHHHLLEEEEEEEELLLLLLlhhhHHH


DSSP  HHHHHHHHhhHHLLEEEEEEeLLLLLlllllLLHHHHhHHLLlEEEEEEEElllLLLL--
Query SLLAKTRAlnEEGISAWMLTgAYHVPsrtitGSVEKDvAIIDrVIGVXCAIsdhRSAA--  172
ident     |                |         |               |            
Sbjct LWKSKAEG--NSYCDYTFHM-AVSKFdekteGQLREI-VADG-ISSFXIFL---SYKNff  158
DSSP  HHHHHHLL--LLLLEEEEEE-ELLLLlllhhHHHHHH-HHLL-LLEEEEEE---LLLLll


DSSP  -LLHHHHHHHHHHHHHHHhhhlllLEEEEEEL---------------------------L
Query -PDVYHLANMAAESRVGGllggkpGVTVFHMG---------------------------D  204
ident   |              |           |                              
Sbjct gVDDGEMYQTLRLAKELG------VIVTAHCEnaelvgrlqqkllsegktgpewhepsrP  212
DSSP  lLLHHHHHHHHHHHHHHL------LEEEEEELlhhhhhhhhhhhhhlllllhhhlllllL


DSSP  LLLL---LHHHHHHHHlLLLLhhHEEEELHHhLHHHHHHHHHHHHLL--LLEEEELLLL-
Query SKKA---LQPIYDLLEnCDVPisKLLPTHVNrNVPLFEQALEFARKG--GTIDITSSID-  258
ident               ||            |     |    |      |    |        
Sbjct EAVEaegTARFATFLE-TTGA--TGYVVHLS-CKPALDAAMAAKARGvpIYIESVIPHFl  268
DSSP  HHHHhhhHHHHHHHHH-HHLL--EEEELLLL-LHHHHHHHHHHHHLLllEEEEEEHHHHh


DSSP  -------------------------LLLL-HHHHHHHHHhllllhhhEEEELLLLLE---
Query -------------------------EPVA-PAEGIARAVqagiplarVTLSSDGNGS---  289
ident                                    |            |   |       
Sbjct ldktyaerggveamkyimspplrdkRNQKvLWDALAQGF-------iDTVGTDHCPFdte  321
DSSP  llhhhhhllhhhhhlllllllllllHHHHhHHHHHHLLL-------lLEEELLLLLLlhh


DSSP  eeeellllLEEEEE-ELLL-HHHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLL-LLL
Query qpffddegNLTHIG-VAGF-ETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLT-GKG  346
ident                               |      |           |    |   ||
Sbjct qkllgkeaFTAIPNgIPAIeDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFpRKG  381
DSSP  hhhhhlllHHHLLLlLLLLlLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLlLLL


DSSP  LLLLLLLLLEEEELLL-------------------------LLEEEEEELLEEEEELLEE
Query EILPGNDADLLVMTPE-------------------------LRIEQVYARGKLMVKDGKA  381
ident  |  | |||| |  |                           |   |  |||  | ||  
Sbjct TIAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfeidGRPSVVTVRGKVAVRDGQF  441
DSSP  LLLLLLLLLEEEEELLlleellhhhllllllllllllleelLEEEEEEELLEEEEELLEE


DSSP  LLLLL--------llll
Query CVKGT--------fetd  390
ident                  
Sbjct VGEKGwgkllrrepmyf  458
DSSP  LLLLLllllllllllll


No 5: Query=1onxA Sbjct=2pajA Z-score=29.1

back to top
DSSP  llllhhhLLEEEEEE-EEELL--------LEEEEEEEEEELLEEEEEElLLLLllLLLLE
Query midytaaGFTLLQGA-HLYAP--------EDRGICDVLVANGKIIAVAsNIPSdiVPNCT   51
ident          ||   |                    |       | |          |  |
Sbjct -------PSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIG-ALAP--RPGET   50
DSSP  -------LEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEEL-LLLL--LLLLE


DSSP  EEELLLLEEEELEEEEEELLLLL---llLLLHHH-----llLLLL-HHHHHHLLEEEEEE
Query VVDLSGQILCPGFIDQHVHLIGG---ggEAGPTT-----rtPEVA-LSRLTEAGVTSVVG  102
ident  ||       |     | ||                          |  |   |   |  
Sbjct IVDATDCVIYPAWVNTHHHLFQSllkgePFRALFderrfrlAARIgLIELARSGCATVAD  110
DSSP  EEELLLLEEEELEELLLLLHHHHhllllLLHHHLlhhhhhhHHHHhHHHHHLLLEEEEEE


DSSP  LLLlLLLL-llhHHHHHHHHHHHHHLLEEEEEEeLLLL------------------llLL
Query LLGtDSIS-rhpESLLAKTRALNEEGISAWMLTgAYHV------------------psRT  143
ident              |           |     |                            
Sbjct HNY-VYYPgmpfDSSAILFEEAEKLGLRFVLLR-GGATqtrqleadlptalrpetldaYV  168
DSSP  LLL-LLLLllllLHHHHHHHHHHHLLLEEEEEE-LLLLllllllllllhhhllllhhhHH


DSSP  LLllHHHHhHHLL--------LEEEEE-EEELlllLLLLlHHHHHHHHHHHHHHHhhhll
Query ITgsVEKDvAIID--------RVIGVX-CAISdhrSAAPdVYHLANMAAESRVGGllggk  194
ident      |   |           |                         ||  |  |     
Sbjct AD--IERL-AARYhdaspramRRVVMApTTVL---YSIS-PREMRETAAVARRLG-----  216
DSSP  HH--HHHH-HHHLllllllllEEEEELlLLLL---LLLL-HHHHHHHHHHHHHLL-----


DSSP  lLEEEEEELllLLLLHHHHHHHhlllllHHHEEEELHhHLHHhhHHHHHHHHLL-LLEEE
Query pGVTVFHMGdsKKALQPIYDLLencdvpISKLLPTHVnRNVPlfEQALEFARKG-GTIDI  253
ident       |    |                 |     |    |                   
Sbjct -LRMHSHLS-gKSPVAFCGEHD----wlGSDVWYAHL-VKVD--ADEIALLAQTgTGVAH  267
DSSP  -LEEEEELL-lLLHHHHHHHLL----llLLLEEEELL-LLLL--HHHHHHHHHHlLEEEE


DSSP  EL-LLLLLllhhhHHHHHHhLLLLhhHEEEELLlLLEEeeellllleeeeeELLL-HHHH
Query TS-SIDEPvapaeGIARAVqAGIPlaRVTLSSDgNGSQpffddegnlthigVAGF-ETLL  311
ident    |                       |    |                   |       
Sbjct CPqSNGRL-----PVREMA-DAGV--PVSIGVD-GAAS------------nEAADmISEV  306
DSSP  LHhHHHLL-----LLLLHH-HHLL--LEEELLL-HHHH------------lLLLLhHHHH


DSSP  HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEEL-----------
Query ETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT-----------  360
ident             ||       |   |    |   |    |  ||  |             
Sbjct HMTWLAQRARLASIAEVIHWGTAGGARVMGLDEVGKVAVGYAADIAVYRlddpryfglhd  366
DSSP  HHHHHHHHHLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEEElllhhhlllll


DSSP  -LLLL--------EEEEEELLEEEEELLEelLLLLLLL------------------l
Query -PELR--------IEQVYARGKLMVKDGKacVKGTFET------------------d  390
ident                     ||  | |      |                       
Sbjct pAIGPvasggrpsVMALFSAGKRVVVDDL--IEGVDIKelggearrvvrellrevvv  421
DSSP  hHHHHhhllllleEEEEEELLEEEEELLL--LLLLLHHhhhhhhhhhhhhhhhhhhl


No 6: Query=1onxA Sbjct=3giqA Z-score=29.0

back to top
DSSP  llllhHHLLEEEEEEEEELL--LEEEEEEEEEELLEEEEEElLLLLLLLllLEEEELLLL
Query midytAAGFTLLQGAHLYAP--EDRGICDVLVANGKIIAVAsNIPSDIVpnCTVVDLSGQ   58
ident              |          |   |  |  | | |                | || 
Sbjct -----EKLDFKITGGWIIDGtgAPRRRADLGVRDGRIAAIG-ELGAHPA--RHAWDASGK   52
DSSP  -----LLEEEEEELLEELLLllLLLEELEEEEELLEEEEEE-LLLLLLE--EEEEELLLL


DSSP  EEEELEEEEEELLLLllllllhhhllLLLLHHHHHHLLEEEEEELLL-------------
Query ILCPGFIDQHVHLIGgggeagpttrtPEVALSRLTEAGVTSVVGLLG-------------  105
ident |  ||||| | |                  |   |  | | ||                 
Sbjct IVAPGFIDVHGHDDL--------mfvEKPDLRWKTSQGITTVVVGNCgvsaapaplpgnt  104
DSSP  EEEELEEELLLLLLL--------hhhHLLLLHHHHLLLEEEEEELLLlllllllllllll


DSSP  -lLLLL-------lLHHHHHHHHHHhhHHLLEEEEEEELLLLL---------------ll
Query -tDSIS-------rHPESLLAKTRAlnEEGISAWMLTGAYHVP---------------sr  142
ident                     |   |     |    | |                      
Sbjct aaALALlgetplfaDVPAYFAALDA-qRPMINVAALVGHANLRlaamrdpqaaptaaeqq  163
DSSP  lhHHHHhlllllllLHHHHHHHHHH-lLLLLEEEEEEEHHHHHhhhlllllllllhhhhh


DSSP  lllLLHHHHHHHLllEEEEEEEElLLLL-LLLLHHHHHHHHHHHHHHHhhhlllLEEEEE
Query titGSVEKDVAIIdrVIGVXCAIsDHRS-AAPDVYHLANMAAESRVGGllggkpGVTVFH  201
ident                  |           |      |   |                  |
Sbjct amqDMLQAALEAG--AVGFSTGL-AYQPgAVAQAAELEGLARVAAERR------RLHTSH  214
DSSP  hhhHHHHHHHHHL--LLEEEEEL-LLLLhHHLLHHHHHHHHHHHHHLL------LEEEEE


DSSP  E-LLLL---LLLHHHHHHHHlLLLLhhHEEEELHHHL----HHHHHHHHHHHHLL-----
Query M-GDSK---KALQPIYDLLEnCDVPisKLLPTHVNRN----VPLFEQALEFARKG-----  248
ident           |                     |               |           
Sbjct IrNEADgveAAVEEVLAIGR-GTGC--ATVVSHHKCMmpqnWGRSRATLANIDRAreqgv  271
DSSP  LlLLLLlhhHHHHHHHHHHH-HHLL--EEEELLLLLLlhhhLLLHHHHHHHHHHHhhlll


DSSP  -LLEEEeLLLL-------------------------------------------------
Query -GTIDItSSID-------------------------------------------------  258
ident     ||                                                      
Sbjct eVALDI-YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaar  330
DSSP  lEEEEE-LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhh


DSSP  -------------LLLLhHHHHHHhhhllllhHHEEEELLLLLEeeeellllleeeEEEL
Query -------------EPVApAEGIARavqagiplARVTLSSDGNGSqpffddegnlthIGVA  305
ident              |                        |||                   
Sbjct rlapagaiyfamdEDEV-KRIFQH--------PCCMVGSDGLPN-----------dARPH  370
DSSP  hhlleeeeeelllHHHH-HHHHHL--------LLEEELLLLLLL-----------lLLLL


DSSP  --LLHHHHHHHHHHHHHHL-LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEELLL
Query --GFETLLETVQVLVKDYD-FSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPE  362
ident               |          |    |   |        |   ||  ||  |  | 
Sbjct prLWGSFTRVLGRYVREARlMTLEQAVARMTALPARVFGFAERGVLQPGAWADVVVFDPD  430
DSSP  lhHHHHHHHHHHHHHHHLLlLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLEEEELLL


DSSP  L---------------LEEEEEELLEEEEElleELLLLL-----llll
Query L---------------RIEQVYARGKLMVKdgkACVKGT-----fetd  390
ident                  |  |   |                       
Sbjct TvadratwdeptlasvGIAGVLVNGAEVFP---QPPADGrpgqvlrax  475
DSSP  LlllllllllllllllLEEEEEELLEEEEL---LLLLLLlllllllll


No 7: Query=1onxA Sbjct=4cqbA Z-score=28.3

back to top
DSSP  lllLHHHlLEEEEEEEEEllLEEEEEEEEEELLEEEEEELLLLlllLLLLEEEELLLLEE
Query midYTAAgFTLLQGAHLYapEDRGICDVLVANGKIIAVASNIPsdiVPNCTVVDLSGQIL   60
ident               | |   |     |       ||     |           |  |   
Sbjct ---SKDF-DLIIRNAYLS--EKDSVYDIGIVGDRIIKIEAKIE---GTVKDEIDAKGNLV   51
DSSP  ---LLLE-EEEEEEEEEL--LLLEEEEEEEELLEEEEEELLLL---LLEEEEEELLLLLE


DSSP  EELEEEEEELLLLL-------------------lLLLL-HHHL---------lLLLL-HH
Query CPGFIDQHVHLIGG-------------------gGEAG-PTTR---------tPEVA-LS   90
ident  ||| | | |                                                  
Sbjct SPGFVDAHTHMDKSftstgerlpkfwsrpytrdaAIEDgLKYYknatheeikrHVIEhAH  111
DSSP  EELEEEEEELHHHLlllllllllllllllllhhhHHHHhHHHHhhllhhhhhhHHHHhHH


DSSP  HHHHLLEEEEEELLLllLLLL---LHHHHHHHHHHHHhHLLEEEEEEELLLLL--lllll
Query RLTEAGVTSVVGLLGtdSISR---HPESLLAKTRALNeEGISAWMLTGAYHVP--srtit  145
ident      |                    |  |     |    |       |           
Sbjct MQVLHGTLYTRTHVD-vDSVAktkAVEAVLEAKEELK-DLIDIQVVAFAQSGFfvdlese  169
DSSP  HHHHLLEEEEEEEEE-lLLLLllhHHHHHHHHHHHLL-LLLEEEEEEELLLLLlllllhh


DSSP  LLHHHHHHHLllEEEEEEEELLLlLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELL-
Query GSVEKDVAIIdrVIGVXCAISDHrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGD-  204
ident     |          |                |                      |  | 
Sbjct SLIRKSLDMG--CDLVGGVDPAT-RENNVEGSLDLCFKLAKEYD------VDIDYHIHDi  220
DSSP  HHHHHHHHHL--LLEEELLLLLL-LLLLHHHHHHHHHHHHHHLL------LEEEEEELLl


DSSP  LLLL---LHHHHHHHHLLLlLHHHEEEELHHHLHH----hhhhhHHHHHL-LLLEEEELL
Query SKKA---LQPIYDLLENCDvPISKLLPTHVNRNVP----lfeqaLEFARK-GGTIDITSS  256
ident                             |                      |       |
Sbjct GTVGvysINRLAQKTIENG-YKGRVTTSHAWCFADapsewldeaIPLYKDsGMKFVTCFS  279
DSSP  HHHHhhhHHHHHHHHHHLL-LLLLEEEEELLHHHHllhhhhhhhHHHHHHhLLEEEEELL


DSSP  L-LLLLlhhhHHHHHHhLLLLhhHEEEELLLLLEEEeellllleeeeEELLLHhHHHHHH
Query I-DEPVapaeGIARAVqAGIPlaRVTLSSDGNGSQPffddegnlthiGVAGFEtLLETVQ  315
ident                             ||                              
Sbjct StPPTM----PVIKLL-EAGI--NLGCASDNIRDFW----------vPFGNGD-MVQGAL  321
DSSP  LlLLLL----LHHHHH-HLLL--EEEEELLLLLLLL----------lLLLLLL-HHHHHH


DSSP  HHH----hHHLLLHHHHHHHHLHHHHHHLL-LLLLlLLLLLLLLLEEEELL---------
Query VLV----kDYDFSISDALRPLTSSVAGFLN-LTGKgEILPGNDADLLVMTP---------  361
ident                      ||  |  |        |  |  ||| |            
Sbjct IETqrlelKTNRDLGLIWKMITSEGARVLGiEKNY-GIEVGKKADLVVLNSlspqwaiid  380
DSSP  HHHhhhllLLHHHHHHHHHHHLHHHHHHHLlHHHL-LLLLLLLLLEEEELLllhhhhhhh


DSSP  LLLEEEEEELLEEEEELLEELLlllllll
Query ELRIEQVYARGKLMVKDGKACVkgtfetd  390
ident       |   |   |||            
Sbjct QAKRLCVIKNGRIIVKDEVIVA-------  402
DSSP  LLLEEEEEELLEEEEELLEELL-------


No 8: Query=1onxA Sbjct=3griA Z-score=28.1

back to top
DSSP  llllhhhlLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLllLLLLEEEELLLLEE
Query midytaagFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSdiVPNCTVVDLSGQIL   60
ident           |               | |     |   |  |           |  |   
Sbjct --------XKLIKNGKVLQNGELQQADILIDGKVIKQIAPAIEP--SNGVDIIDAKGHFV   50
DSSP  --------LEEEELLEEEELLEEEELEEEEELLEEEEEELLLLL--LLLLEEEELLLLEE


DSSP  EELEEEEEELLLLllllllhhhLLLLL--LHHHHHHLLEEEEEELLLllllLLLH-----
Query CPGFIDQHVHLIGgggeagpttRTPEV--ALSRLTEAGVTSVVGLLGtdsiSRHP-----  113
ident  ||| | ||||                          | | |            |     
Sbjct SPGFVDVHVHLRE-----pggeYKETIetGTKAAARGGFTTVCPXPN---tRPVPdsveh  102
DSSP  EELEEEEEELLLL-----llllLLLLHhhHHHHHHHLLEEEEEELLL---lLLLLllhhh


DSSP  -HHHHHHHHHHHhhLLEEEEEEE---lLLLLLLLlllLHHHHHhhLLLEEEEEEEelllL
Query -ESLLAKTRALNeeGISAWMLTG---aYHVPSRTitgSVEKDVaiIDRVIGVXCAisdhR  169
ident  | |                                      |                 
Sbjct fEALQKLIDDNA--QVRVLPYASittrQLGKELV---DFPALV--KEGAFAFTDD----G  151
DSSP  hHHHHHHHHHHL--LLEELLLEEllhhHLLLLLL---LHHHHH--LLLLLLEEEL----L


DSSP  LLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEEL-------------------------L
Query SAAPDVYHLANMAAESRVGGllggkpGVTVFHMG-------------------------D  204
ident               |              | |                            
Sbjct VGVQTASXXYEGXIEAAKVN------KAIVAHCEdnsliyggaxhegkrskelgipgipN  205
DSSP  LLLLLHHHHHHHHHHHHHHL------LLEEELLLlhhhllllleellhhhhhhllleelL


DSSP  LLLL--LHHHHHHHHlLLLLhhHEEEELHhHLHHHHHHHHHHHHLL--LLEEEELLLL--
Query SKKA--LQPIYDLLEnCDVPisKLLPTHVnRNVPLFEQALEFARKG--GTIDITSSID--  258
ident             | |            ||              | |   |   |      
Sbjct ICESvqIARDVLLAE-AAGC--HYHVCHV-STKESVRVIRDAKRAGihVTAEVTPHHLll  261
DSSP  HHHHhhHHHHHHHHH-HHLL--LEEELLL-LLHHHHHHHHHHHHLLllEEEEELHHHHhl


DSSP  -----------------------LLLLHhHHHHHHhhllllhhhEEEELLLLLEeeeell
Query -----------------------EPVAPaEGIARAvqagiplarVTLSSDGNGSqpffdd  295
ident                              ||                  |          
Sbjct teddipgnnaiykxnpplrstedREALL-EGLLDG-------tiDCIATDHAPHardeka  313
DSSP  lhhhlllllhhhllllllllhhhHHHHH-HHHHLL-------llLEELLLLLLLlhhhhl


DSSP  llLEEEEEELLL-HHHH-HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLL
Query egNLTHIGVAGF-ETLL-ETVQVLVKDYDFSISDALRPLTSSVAGFLNLTgKGEILPGND  353
ident              ||         ||  |         ||       ||   |       
Sbjct qpXEKAPFGIVGsETAFpLLYTHFVKNGDWTLQQLVDYLTIKPCETFNLE-YGTLKENGY  372
DSSP  llLLLLLLLLLLlLLHHhHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLL-LLLLLLLLL


DSSP  LLEEEELLL-------------------------LLEEEEEELLEEEEELleelllllll
Query ADLLVMTPE-------------------------LRIEQVYARGKLMVKDgkacvkgtfe  388
ident |||                                        |                
Sbjct ADLTIIDLDseqeikgedflskadntpfigykvyGNPILTXVEGEVKFEG----------  422
DSSP  LLEEEEELLlleellhhhllllllllllllleelLEEEEEEELLEEEEEL----------


DSSP  ll
Query td  390
ident   
Sbjct --  422
DSSP  --


No 9: Query=1onxA Sbjct=3e74A Z-score=28.1

back to top
DSSP  llllhhHLLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLlllllLEEEELLLLEE
Query midytaAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSdivpnCTVVDLSGQIL   60
ident                           |  |  ||| |              | | ||   
Sbjct ------SFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGD----aKEVXDASGLVV   50
DSSP  ------LEEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLL----eEEEEELLLLEE


DSSP  EELEEEEEELLllllllllhhhllLLLL-HHHHHHLLEEEEEELLLLLllLLLH------
Query CPGFIDQHVHLiggggeagpttrtPEVA-LSRLTEAGVTSVVGLLGTDsiSRHP------  113
ident  ||  | | |                          | |                     
Sbjct SPGXVDAHTHI-------------GYETgTRAAAKGGITTXIEXPLNQ--LPATvdrasi   95
DSSP  EELEEEEEELL-------------LHHHhHHHHHHLLEEEEEELLLLL--LLLLllhhhh


DSSP  HHHHHHHHHhhHHLLEEEEEEEllLLLLllllLLHHHHhHHLLlEEEEEEEElllllLLL
Query ESLLAKTRAlnEEGISAWMLTGayHVPSrtitGSVEKDvAIIDrVIGVXCAIsdhrsAAP  173
ident |             | |  | |                      | | ||          
Sbjct ELKFDAAKG--KLTIDAAQLGG-lVSYN---iDRLHEL-DEVG-VVGFXCFV-----RDV  142
DSSP  HHHHHHHLL--LLLLEEEELEE-lLLLL---lLLHHHH-HHHL-LLLEEEEL-----LLL


DSSP  LHHHHHHHHHHHHHHHhhhlllLEEEEEELLLL---------------------------
Query DVYHLANMAAESRVGGllggkpGVTVFHMGDSK---------------------------  206
ident         |      |           |                                
Sbjct NDWQFFKGAQKLGELG------QPVLVHCENALicdelgeeakregrvtahdyvasrpvf  196
DSSP  LHHHHHHHHHHHHHHL------LLEEEELLLHHhhhhhhhhhhhhllllhhhhhhlllhh


DSSP  ---LLLHHHHHHHHLLLLlhhHEEEELHHhlhhHHHHHHHHHHLL-----LLEEEELLll
Query ---KALQPIYDLLENCDVpisKLLPTHVNrnvpLFEQALEFARKG-----GTIDITSSid  258
ident     |      |          |   ||       |   |  |        |        
Sbjct tevEAIRRVLYLAKVAGC---RLHVCHVS----SPEGVEEVTRARqegqdITCESCPH--  247
DSSP  hhhHHHHHHHHHHHHHLL---LEEELLLL----LHHHHHHHHHHHhllllEEEEELLH--


DSSP  lllLHHH-------------------------hHHHHHHlLLLHhhEEEELLLLLEeeee
Query epvAPAE-------------------------gIARAVQaGIPLarVTLSSDGNGSqpff  293
ident                                                 | ||        
Sbjct ---YFVLdtdqfeeigtlakcsppirdlenqkgXWEKLF-NGEI--DCLVSDHSPCppex  301
DSSP  ---HHHLlhhhhhhhlhhhllllllllhhhhhhHHHHHH-LLLL--LEELLLLLLLllll


DSSP  llllLEEEEEE-LLLHHHH-HHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLL
Query ddegNLTHIGV-AGFETLL-ETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPG  351
ident          |  ||            |     |            |    |  || | ||
Sbjct kagnIXKAWGGiAGLQSCXdVXFDEAVQKRGXSLPXFGKLXATNAADIFGLQQKGRIAPG  361
DSSP  llllLLLLLLLlLLHHHHHhHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLL


DSSP  LLLLEEEELLL-------------------------LLEEEEEELLEEEEELL-EELLLL
Query NDADLLVMTPE-------------------------LRIEQVYARGKLMVKDG-KACVKG  385
ident  |||     |                           ||     ||           |  
Sbjct KDADFVFIQPNssyvltnddleyrhkvspyvgrtigARITKTILRGDVIYDIEqGFPVAP  421
DSSP  LLLLEEEEELLlleellhhhllllllllllllleelLEEEEEEELLEEEEELLlLLLLLL


DSSP  ---lllll
Query ---tfetd  390
ident         
Sbjct kgqfilkh  429
DSSP  llleelll


No 10: Query=1onxA Sbjct=4b3zD Z-score=27.7

back to top
DSSP  llllhhhLLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLllLLLLLEEEELLLLEE
Query midytaaGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPsdIVPNCTVVDLSGQIL   60
ident           |  |            ||    | |     |               |   
Sbjct -------DRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI--VPGGVKTIEANGRMV   51
DSSP  -------LEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLL--LLLLLEEEELLLLEE


DSSP  EELEEEEEELLLLllllllhhHLLLLL--LHHHHHHLLEEEEEELLllLLLL-----lLH
Query CPGFIDQHVHLIGgggeagptTRTPEV--ALSRLTEAGVTSVVGLLgtDSIS-----rHP  113
ident  || ||    |          |               | |                    
Sbjct IPGGIDVNTYLQK--------TAADDFfqGTRAALVGGTTMIIDHV--VPEPgsslltSF  101
DSSP  EELEEEEEELLLL--------LLLLLHhhHHHHHHHLLEEEEEEEE--LLLLlllhhhHH


DSSP  HHHHHHHHHHHhhLLEEEEEEeLLLLLlllllLLHHHHHHHLLlEEEEEEEElLLLL-LL
Query ESLLAKTRALNeeGISAWMLTgAYHVPsrtitGSVEKDVAIIDrVIGVXCAIsDHRS-AA  172
ident |                                  |  |     |               
Sbjct EKWHEAADTKS--CCDYSLHV-DITSWydgvrEELEVLVQDKG-VNSFQVYM-AYKDvYQ  156
DSSP  HHHHHHHHLLL--LLEEEEEE-ELLLLlllhhHHHHHHHHLLL-LLEEEEEL-LLLLlLL


DSSP  LLHHHHHHHHHHHHHHHhhhlllLEEEEEEL----------------------------L
Query PDVYHLANMAAESRVGGllggkpGVTVFHMG----------------------------D  204
ident      |          |       |   |                               
Sbjct MSDSQLYEAFTFLKGLG------AVILVHAEngdliaqeqkrilemgitgpeghalsrpE  210
DSSP  LLHHHHHHHHHHHHHHL------LEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllH


DSSP  LLLL--LHHHHHHHHLLLLlhhHEEEELHHhLHHHHHHHHHHHHL--LLLEEEELL--LL
Query SKKA--LQPIYDLLENCDVpisKLLPTHVNrNVPLFEQALEFARK--GGTIDITSS--ID  258
ident    |                      | |               |               
Sbjct ELEAeaVFRAITIAGRINC---PVYITKVM-SKSAADIIALARKKgpLVFGEPIAAslGT  266
DSSP  HHHHhhHHHHHHHHHHHLL---LEEEEEEL-LHHHHHHHHHHHHHllLEEEEELHHhhHL


DSSP  LL------------------------lLHHHHHHHHHhlllLHHHEEEELLLLLE---ee
Query EP------------------------vAPAEGIARAVqagiPLARVTLSSDGNGS---qp  291
ident                             |                    |          
Sbjct DGthywsknwakaaafvtspplspdptTPDYLTSLLA----CGDLQVTGSGHCPYstaqk  322
DSSP  LLhhhhlllhhhhhhllllllllllllHHHHHHHHHH----HLLLLLLLLLLLLLlhhhh


DSSP  eellllLEEEEEELL-LHHH-HHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLL-LLLLL
Query ffddegNLTHIGVAG-FETL-LETVQVLVKDYDFSISDALRPLTSSVAGFLNLT-GKGEI  348
ident                  |          |                  |   ||   || |
Sbjct avgkdnFTLIPEGVNgIEERmTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYpRKGRI  382
DSSP  hhhlllHHHLLLLLLlLLLHhHHHHHHHLLLLLLLHHHHHHHHLHHHHHHHLLLlLLLLL


DSSP  LLLLLLLEEEELLL-------------------------LLEEEEEELLEEEEELLEELL
Query LPGNDADLLVMTPE-------------------------LRIEQVYARGKLMVKDGKACV  383
ident   | |||     |                               |   ||    ||   |
Sbjct AVGSDADVVIWDPDklktitakshksaveynifegmechGSPLVVISQGKIVFEDGNINV  442
DSSP  LLLLLLLEEEEEEEeeeelllllllllllllllllleeeEEEEEEEELLEEEEELLEELL


DSSP  LLL----------------------------llll
Query KGT----------------------------fetd  390
ident                                    
Sbjct NKGmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  LLLlllllllllllhhhhhhhhhhhhhllllllll


No 11: Query=1onxA Sbjct=3mtwA Z-score=27.7

back to top
DSSP  llllhhHLLEEEEEEEEELL--LEEEE-EEEEEELLEEEEEELLLLLlLLLLLEEEELLL
Query midytaAGFTLLQGAHLYAP--EDRGI-CDVLVANGKIIAVASNIPSdIVPNCTVVDLSG   57
ident       |       | |             | |  | |               | ||| |
Sbjct ------AEIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKKGDA-VPAGATAVDLPG   53
DSSP  ------LLEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEELLLL-LLLLLEEEEEEE


DSSP  LEEEELEEEEEELLLLL-lLLLLHHH-------llLLLL-HHHHHHLLEEEEEELLllll
Query QILCPGFIDQHVHLIGG-gGEAGPTT-------rtPEVA-LSRLTEAGVTSVVGLLgtds  108
ident   | || || ||||                        |      ||| | |        
Sbjct VTLLPGLIDMHVHLDSLaeVGGYNSLeysdrfwsvVQTAnAKKTLEAGFTTVRNVG----  109
DSSP  EEEEELEEEEEELLLLLllLLHHHHHhllhhhhhhHHHHhHHHHHHLLEEEEEELL----


DSSP  lllLHHHHHHHHHHHHH---HLLEEEEEEELLLL-----------------------lll
Query isrHPESLLAKTRALNE---EGISAWMLTGAYHV-----------------------psr  142
ident              |       |                                      
Sbjct --aADYDDVGLREAIDAgyvPGPRIVTAAISFGAtgghcdstffppsmdqknpfnsdspd  167
DSSP  --lLLLHHHHHHHHHHLlllLLLEEEELLLLEELlllllllllllhhhllllllllllhh


DSSP  lllLLHHHHHHHLllEEEEEEEELLL--------lllLLLHHHHHHHHHHHHHHHhhhll
Query titGSVEKDVAIIdrVIGVXCAISDH--------rsaAPDVYHLANMAAESRVGGllggk  194
ident      |             |                             |    |     
Sbjct earKAVRTLKKYG--AQVIXICATGGvfsrgnepgqqQLTYEEMKAVVDEAHMAG-----  220
DSSP  hhhHHHHHHHHLL--LLEEEEELLLLlllllllllllLLLHHHHHHHHHHHHHLL-----


DSSP  lLEEEEEELLllLLLHHHHHHHhlllllhhHEEEELHHhlhhHHHH-HHHHHHL-LLLEE
Query pGVTVFHMGDskKALQPIYDLLencdvpisKLLPTHVNrnvpLFEQ-ALEFARK-GGTID  252
ident       |                            |      |        |   |    
Sbjct -IKVAAHAHG-aSGIREAVRAG--------VDTIEHAS----LVDDeGIKLAVQkGAYFS  266
DSSP  -LEEEEEELL-hHHHHHHHHLL--------LLEEEELL----LLLHhHHHHHHHhLLEEE


DSSP  EELLLL-----------------------LLLLHhHHHHHHHHLLLlhhHEEEELLLLLe
Query ITSSID-----------------------EPVAPaEGIARAVQAGIplaRVTLSSDGNGs  289
ident                                    |    |  ||          |    
Sbjct MDIYNTdytqaegkkngvlednlrkdrdiGELQR-ENFRKALKAGV---KMVYGTDAGI-  321
DSSP  LLLLLHhhhhhhhhhhlllhhhhhhhhhhHHHHH-HHHHHHHHHLL---EEELLLLLLL-


DSSP  eeeellllleeeeeELLLHhHHHHHHHHHhHHLLLHHHHHHHHLHHHHHHLLL-LLLLLL
Query qpffddegnlthigVAGFEtLLETVQVLVkDYDFSISDALRPLTSSVAGFLNL-TGKGEI  348
ident                           | |  |      |    |   |  |      |  
Sbjct --------------YPHGD-NAKQFAVMV-RYGATPLQAIQSATLTAAEALGRsKDVGQV  365
DSSP  --------------LLLLL-HHHHHHHHH-HLLLLHHHHHHHLLHHHHHHHLLlLLLLLL


DSSP  LLLLLLLEEEELLLL--------LEEEEEELLEEEEELleelllllllll
Query LPGNDADLLVMTPEL--------RIEQVYARGKLMVKDgkacvkgtfetd  390
ident   |   |                    |   |                  
Sbjct AVGRYGDMIAVAGDPladvttleKPVFVMKGGAVVKAP-----------x  404
DSSP  LLLLLLLEEEELLLLlllhhhhhLLLEEEELLEEEELL-----------l


No 12: Query=1onxA Sbjct=3ls9A Z-score=27.4

back to top
DSSP  llllhhhlLEEEEEE-EEELL---LEEEE-EEEEEELLEEEEEELLLLLLLLllLEEEEL
Query midytaagFTLLQGA-HLYAP---EDRGI-CDVLVANGKIIAVASNIPSDIVpnCTVVDL   55
ident           |  |          |      | |    || ||        |      | 
Sbjct --------MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDRSV--SRTIDG   50
DSSP  --------LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLLLL--LEEEEL


DSSP  LLLEEEELEEEEEELLLL------------------llLLLL-HHHL-----------lL
Query SGQILCPGFIDQHVHLIG------------------ggGEAG-PTTR-----------tP   85
ident  | |  || |  | ||                                            
Sbjct RGMIALPGLINSHQHLYEgamraipqlervtmaswlegVLTRsAGWWrdgkfgpdvireV  110
DSSP  LLEEEEELEEEEEELHHHhhhlllhhhllllhhhhhhhHHHHhHHHHhlllllhhhhhhH


DSSP  LLL-HHHHHHLLEEEEEELLLlLLLL-llhHHHHHHHHHHHHHLLEEEEEEeLLLL----
Query EVA-LSRLTEAGVTSVVGLLGtDSIS-rhpESLLAKTRALNEEGISAWMLTgAYHV----  139
ident   | |      | | |                  |   |    ||               
Sbjct ARAvLLESLLGGITTVADQHL-FFPGatadSYIDATIEAATDLGIRFHAAR-SSMTlgks  168
DSSP  HHHhHHHHHHLLEEEEEEEEL-LLLLllllLHHHHHHHHHHHHLLEEEEEE-LLLLllhh


DSSP  ------------LLLLllLLHHHHHhHLLL--------EEEEEEEELLllLLLLlhHHHH
Query ------------PSRTitGSVEKDVaIIDR--------VIGVXCAISDhrSAAPdvYHLA  179
ident               |                        |             |      
Sbjct eggfcddlfvepVDRV-vQHCLGLI-DQYHepepfgmvRIALGPCGVP--YDKP--ELFE  222
DSSP  hlllllhhhlllHHHH-hHHHHHHH-HHHLllllllleEEEELLLLLL--LLLH--HHHH


DSSP  HHHHHHHHHHhhhlllLEEEEEE---lLLLL--------LLHHHHHHHhllllLHHHEEE
Query NMAAESRVGGllggkpGVTVFHM---gDSKK--------ALQPIYDLLencdvPISKLLP  228
ident   |                  |     |                                
Sbjct AFAQMAADYD------VRLHTHFyeplDAGMsdhlygmtPWRFLEKHG----wASDRVWL  272
DSSP  HHHHHHHHHL------LEEEEEEllllHHHHhhhhhlllHHHHHHHLL----lLLLLEEE


DSSP  ELHhHLHHhhHHHHHHHHLLLLEEEE-LLLL--LLLLhhHHHHHHHhLLLLhhHEEEELL
Query THVnRNVPlfEQALEFARKGGTIDIT-SSID--EPVApaEGIARAVqAGIPlaRVTLSSD  285
ident  |     |  |   |||  |  |                  |            |     
Sbjct AHA-VVPP-rEEIPEFADAGVAIAHLiAPDLrmGWGL--APIREYL-DAGI--TVGFGTT  325
DSSP  EEL-LLLL-hHHHHHHHHHLLEEEELhHHHHhlLLLL--LLHHHHH-HLLL--EEEELLL


DSSP  LLLEeeeellllleeeeeELLLHhHHHHHHHHHHHH----------LLLHHHHHHHHLHH
Query GNGSqpffddegnlthigVAGFEtLLETVQVLVKDY----------DFSISDALRPLTSS  335
ident |  |                |   ||                      |    ||  |  
Sbjct GSAS--------------NDGGN-LLGDLRLAALAHrpadpnepekWLSARELLRMATRG  370
DSSP  LLLL--------------LLLLL-HHHHHHHHHHHLhhhllllhhhLLLHHHHHHHLLHH


DSSP  HHHHLLLLLLLLLLLLLLLLEEEELL--------------------llLEEEEEELLEEE
Query VAGFLNLTGKGEILPGNDADLLVMTP--------------------elRIEQVYARGKLM  375
ident  |  |     |    |  ||                            |   |   |   
Sbjct SAECLGRPDLGVLEEGRAADIACWRLdgvdrvgvhdpaiglimtglsdRASLVVVNGQVL  430
DSSP  HHHHLLLLLLLLLLLLLLLLEEEEELllhhhlllllhhhhhhhlllllLLLEEEELLEEE


DSSP  EELLEELLLL--LLLL------l
Query VKDGKACVKG--TFET------d  390
ident |                      
Sbjct VENERPVLADleRIVAnttalip  453
DSSP  EELLEELLLLhhHHHHhhhhhll


No 13: Query=1onxA Sbjct=3mkvA Z-score=27.3

back to top
DSSP  llllhhHLLEEEEEEEEELLL---EEEEEEEEEELLEEEEEELLLLllLLLLLEEEELLL
Query midytaAGFTLLQGAHLYAPE---DRGICDVLVANGKIIAVASNIPsdIVPNCTVVDLSG   57
ident           |     |  |           |   | |  |          |  | |  |
Sbjct ------LTTFLFRNGALLDPDhpdLLQGFEILIEDGFIREVSDKPI--KSSNAHVIDVKG   52
DSSP  ------LLEEEEEEEEELLLLlllLEEEEEEEEELLEEEEEELLLL--LLLLLEEEELLL


DSSP  LEEEELEEEEEELLLL-LLLLllHHHL--------LLLL-LHHHHHHLLEEEEEELLlll
Query QILCPGFIDQHVHLIG-GGGEagPTTR--------TPEV-ALSRLTEAGVTSVVGLLgtd  107
ident     || || |||          |              |         | | |       
Sbjct KTIMPGLIDLHVHVVAiEFNL--PRVAtlpnvlvtLRAVpIMRAMLRRGFTTVRDAG---  107
DSSP  LEEEELEEEEEELLLLlLLLH--HHHLlllhhhhhHHHHhHHHHHHHLLEEEEEELL---


DSSP  lllllhhhHHHHHHHHHH---HLLEEEEEEELLLL-------------------------
Query sisrhpesLLAKTRALNE---EGISAWMLTGAYHV-------------------------  139
ident               |      ||        |                            
Sbjct ------gaGYPFKQAVESglvEGPRLFVSGRALSQtgghadprarsdymppdspcgccvr  161
DSSP  ------llLHHHHHHHHLlllLLLEEEELLLEEELlllllllllllllllllllllllll


DSSP  ---------llllllLLHHHHHHHLllEEEEEEEELL---------LLLLlLLHHHHHHH
Query ---------psrtitGSVEKDVAIIdrVIGVXCAISD---------HRSAaPDVYHLANM  181
ident                  |             |   |                        
Sbjct vgalgrvadgvdevrRAVREELQMG--ADQIXIMASGgvasptdpvGVFG-YSEDEIRAI  218
DSSP  lllleeelllhhhhhHHHHHHHHHL--LLLEEEELLLlllllllllLLLL-LLHHHHHHH


DSSP  HHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHHhlllllhhHEEEELHHhlhHHHH-H
Query AAESRVGGllggkpGVTVFHMGDskKALQPIYDLLencdvpisKLLPTHVNrnvPLFE-Q  240
ident  ||    |           |      |                     | |         
Sbjct VAEAQGRG------TYVLAHAYT-pAAIARAVRCG--------VRTIEHGN---LIDDeT  260
DSSP  HHHHHLLL------LLEEEEELL-hHHHHHHHHLL--------LLEEEELL---LLLHhH


DSSP  HHHHHHLLLLEEEELLLL-----------------------LLLLhHHHHHHHHhLLLLh
Query ALEFARKGGTIDITSSID-----------------------EPVApAEGIARAVqAGIPl  277
ident |   |  |     |                                   |          
Sbjct ARLVAEHGAYVVPTLVTYdalasegekyglppesiakiadvHGAG-LHSIEIMK-RAGV-  317
DSSP  HHHHHHHLLEEELLHHHHhhhhhhlllllllhhhhllhhhhHLLH-HHHHHHHH-HHLL-


DSSP  hHEEEELLLLLeeeeellllleeeeEELL-LHHHHHHHHHHhhhhlLLHHHHHHHHLHHH
Query aRVTLSSDGNGsqpffddegnlthiGVAG-FETLLETVQVLvkdydFSISDALRPLTSSV  336
ident        |  |                                    |        |   
Sbjct -KMGFGTDLLG--------------EAQRlQSDEFRILAEV-----LSPAEVIASATIVS  357
DSSP  -LLLLLLLLLH--------------HHHHhLLHHHHHHHLL-----LLHHHHHHHLLHHH


DSSP  HHHLLLL-LLLLLLLLLLLLEEEELLLL------------LEEEEEELLEEEEELleell
Query AGFLNLT-GKGEILPGNDADLLVMTPEL------------RIEQVYARGKLMVKDgkacv  383
ident |  |      | | ||  || ||                  |  |   | | |       
Sbjct AEVLGMQdKLGRIVPGAHADVLVVDGNPlksvdcllgqgeHIPLVMKDGRLFVNE-----  412
DSSP  HHHLLLLlLLLLLLLLLLLLEEEELLLLllllllllllllLLLEEEELLEEEEEL-----


DSSP  lllllll
Query kgtfetd  390
ident        
Sbjct -----le  414
DSSP  -----ll


No 14: Query=1onxA Sbjct=1yrrB Z-score=27.2

back to top
DSSP  llllhhhllEEEEEEEEELLLEEEE-EEEEEELLEEEEEELL-LLLLlllLLEEEELLLL
Query midytaagfTLLQGAHLYAPEDRGI-CDVLVANGKIIAVASN-IPSDivpNCTVVDLSGQ   58
ident            |                |  | | |  |                 | | 
Sbjct ---------YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVaELPP---EIEQRSLNGA   48
DSSP  ---------LEEELLEEELLLLEELlEEEEEELLEEEEEEEHhHLLL---LLLEEELLLL


DSSP  EEEELEEEEEELL----LLLLLlllhhhllLLLL--HHHHHHLLEEEEEELLlLLLLllL
Query ILCPGFIDQHVHL----IGGGGeagpttrtPEVA--LSRLTEAGVTSVVGLLgTDSIsrH  112
ident || |||||                                   | |     |        
Sbjct ILSPGFIDVQLNGcggvQFNDT--aeavsvETLEimQKANEKSGCTNYLPTL-ITTSdeL  105
DSSP  EEEELEEEEEELEelleELLLL--lllllhHHHHhhHHHHHLLLEEEEEEEE-LLLLhhH


DSSP  HHHHHHHHHHHH-HHLLEE-EEEEeLLLLllllllLLHHHHHHHLLLEEEEEEEELllll
Query PESLLAKTRALN-EEGISA-WMLTgAYHVpsrtitGSVEKDVAIIDRVIGVXCAISdhrs  170
ident         |         |                  |       |    |  |      
Sbjct MKQGVRVMREYLaKHPNQAlGLHL-EGPW---lnaALVDFLCENADVITKVTLAPE----  157
DSSP  HHHHHHHHHHHHhHLLLLLlLEEE-ELLL---lllHHHHHHHHLHHHEEEEEELHH----


DSSP  llllhhHHHHHHHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHhhllLLLHhhEEEEL
Query aapdvyHLANMAAESRVGGllggkpGVTVFHMGDskKALQPIYDLlencDVPIskLLPTH  230
ident         |         |       |           |             |     ||
Sbjct -----mVPAEVISKLANAG------IVVSAGHSN--ATLKEAKAG---fRAGI--TFATH  199
DSSP  -----hLLHHHHHHHHHHL------LEEEELLLL--LLHHHHHHH---hHHLE--EEELL


DSSP  HH--HLHH------HHHHHHHHHhlLLLEEEELLLLLllLHHHHHHHHHhLLLLhHHEEE
Query VN--RNVP------LFEQALEFArkGGTIDITSSIDEpvAPAEGIARAVqAGIPlARVTL  282
ident               |    |  |       |             |  |           |
Sbjct LYnaMPYItgrepgLAGAILDEA--DIYCGIIADGLH--VDYANIRNAK-RLKG-DKLCL  253
DSSP  LLllLLLLlllllhHHHHHHHLL--LLEEEEELLLLL--LLHHHHHHHH-HHHH-HHEEE


DSSP  ELLLLleeeeellllleeeeEELLLHhHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLL
Query SSDGNgsqpffddegnlthiGVAGFEtLLETVQVLVKDYDFSISDALRPLTSSVAGFLNL  342
ident   |                          | |  ||          ||  |   |     
Sbjct VTDAT---------------SGSSLT-MIEGVRNLVEHCGIALDEVLRMATLYPARAIGV  297
DSSP  ELLLL---------------LLLLLL-HHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLL


DSSP  -LLLLLLLLLLLLLEEEELLLLLEEEEEELLEEEEELleelllllllll
Query -TGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDgkacvkgtfetd  390
ident     |    |  | |   ||   |      |   |              
Sbjct eKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ------------  334
DSSP  lLLLLLLLLLLLLLEEEELLLLLEEEEEELLEEEEEL------------


No 15: Query=1onxA Sbjct=1j6pA Z-score=26.9

back to top
DSSP  llllhhhLLEEEEEEEEE-LLLE-EEEEEEEEELLEEEEEELLLLLlllllleEEELLLL
Query midytaaGFTLLQGAHLY-APED-RGICDVLVANGKIIAVASNIPSdivpnctVVDLSGQ   58
ident                              |   || |  |               |||| 
Sbjct -------HHXIIGNCLILkDFSSePFWGAVEIENGTIKRVLQGEVK------vDLDLSGK   47
DSSP  -------LEEEEEEEEELlLLLLlLEEEEEEEELLEEEEEEELLLL------lLEELLLE


DSSP  EEEELEEEEEELLLL-------------llLLLL-HHHL--------lLLLL--HHHHHH
Query ILCPGFIDQHVHLIG-------------ggGEAG-PTTR--------tPEVA--LSRLTE   94
ident    |     | |                                                
Sbjct LVXPALFNTHTHAPXtllrgvaedlsfeewLFSKvLPIEdrltekxayYGTIlaQXEXAR  107
DSSP  EEEELEEEEEELHHHhhhllllllllhhhhHHLLhHHHHllllhhhhhHHHHhhHHHHHL


DSSP  LLEEEEEELLllllllllhhHHHHHHHHHHHHLLEEEEEEeLLLL------lLLLLlllH
Query AGVTSVVGLLgtdsisrhpeSLLAKTRALNEEGISAWMLTgAYHV------pSRTItgsV  148
ident  |    |                    |    |  |                        
Sbjct HGIAGFVDXY---------fHEEWIAKAVRDFGXRALLTR-GLVDsngddggRLEE---N  154
DSSP  LLEEEEEEEE---------lLHHHHHHHHHHHLLEEEEEE-EELLlllllllHHHH---H


DSSP  HHHHhHLLL------EEEEEEEELlllLLLLLhHHHHHHHHHHHHHHhhhlllLEEEEEE
Query EKDVaIIDR------VIGVXCAISdhrSAAPDvYHLANMAAESRVGGllggkpGVTVFHM  202
ident  |               |                 |                      | 
Sbjct LKLY-NEWNgfegriFVGFGPHSP---YLCSE-EYLKRVFDTAKSLN------APVTIHL  203
DSSP  HHHH-HHHLlhhhleEEEEEELLL---LLLLH-HHHHHHHHHHHHHL------LLEEEEE


DSSP  L---LLLLLLHHHHHHHhllllLHHHEEEELHHHLhhHHHHhHHHHHLL-LLEEEE-LLL
Query G---DSKKALQPIYDLLencdvPISKLLPTHVNRNvpLFEQaLEFARKG-GTIDIT-SSI  257
ident          |  |            |    |                           | 
Sbjct YetsKEEYDLEDILNIG----lKEVKTIAAHCVHL--PERY-FGVLKDIpFFVSHNpASN  256
DSSP  LlllLLLLLLHHHHLLL----lLLLLEEEEELLLL--LHHH-HHHHLLLlEEEEELhHHH


DSSP  L---LLLLhhhHHHHHHHLLLlhhHEEEELLLLLEeeeellllleeeeeELLLHhHHHHH
Query D---EPVApaeGIARAVQAGIplaRVTLSSDGNGSqpffddegnlthigVAGFEtLLETV  314
ident        |      |    |     |||  ||  |                    |    
Sbjct LklgNGIA---PVQRXIEHGX---KVTLGTDGAAS--------------NNSLN-LFFEX  295
DSSP  HhllLLLL---LHHHHHHLLL---EEEELLLLLLL--------------LLLLL-HHHHH


DSSP  HHHHHHH------LLLHHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEELL-------
Query QVLVKDY------DFSISDALRPLTSSVAGFLNLtGKGEILPGNDADLLVMTP-------  361
ident                     |   |   |        | |  |  ||| |          
Sbjct RLASLLQkaqnprNLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVIDLdlpexfp  354
DSSP  HHHHHHHhlllllLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELllhhhll


DSSP  ------------llLEEEEEELLEEEEELLEELLL-lLLLL-----------l
Query ------------elRIEQVYARGKLMVKDGKACVK-gTFET-----------d  390
ident                       ||    ||                       
Sbjct vqniknhlvhafsgEVFATXVAGKWIYFDGEYPTIdsEEVKrelariekelys  407
DSSP  hhhhhhhhhhllllLLLEEEELLEEEEELLLLLLLlhHHHHhhhhhhhhhhhl


No 16: Query=1onxA Sbjct=2oofA Z-score=25.7

back to top
DSSP  llllhhHLLEEEEEEEEELL-------LEEEEEEEEEELLEEEEEELL--llLLLLllle
Query midytaAGFTLLQGAHLYAP-------EDRGICDVLVANGKIIAVASN--ipSDIVpnct   51
ident                                     |  | | |                
Sbjct -----lNCERVWLNVTPATLrsdladyGLLEPHALGVHEGRIHALVPXqdlkYPAH----   51
DSSP  -----lLLLEEEEEEEELLLlllllllLLLLLEEEEEELLEEEEEEEHhhllLLLL----


DSSP  EEELLLLEEEELEEEEEELLLL-----------------------llLLLL-HHHL----
Query VVDLSGQILCPGFIDQHVHLIG-----------------------ggGEAG-PTTR----   83
ident   |  |    || || | |||                          |            
Sbjct WQDXKGKLVTPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkggGIIStVRATraas  111
DSSP  LEELLLLEEEELEEEEEELLLLllllhhhhhhhhhlllhhhhhhlllLHHHhHHHHhhll


DSSP  -----lLLLL-HHHHHHLLEEEEEELLLlLLLL--LLHHHHHHHHHHHHHHLLEEEEEE-
Query -----tPEVA-LSRLTEAGVTSVVGLLGtDSIS--RHPESLLAKTRALNEEGISAWMLT-  134
ident               |   ||| |    |            |    |      |       
Sbjct edqlfeLALPrVKSLIREGVTTVEIKSG-YGLTleDELKXLRVARRLGEALPIRVKTTLl  170
DSSP  hhhhhhHHHHhHHHHHHHLEEEEEEELL-LLLLhhHHHHHHHHHHHHHHHLLLEEEEEEe


DSSP  ELLL-----------lLLLLllLLHHHHhHHLLLEEEEEEEElLLLLLLLLhhHHHHHHH
Query GAYH-----------vPSRTitGSVEKDvAIIDRVIGVXCAIsDHRSAAPDvyHLANMAA  183
ident  |                           |       |      |               
Sbjct AAHAvppeyrddpdswVETIcqEIIPAA-AEAGLADAVDVFC-EHIGFSLA--QTEQVYL  226
DSSP  EELLllhhhlllhhhhHHHHhhLHHHHH-HHLLLLLEEEEEE-LLLLLLHH--HHHHHHH


DSSP  HHHHHHhhhlllLEEEEEE-LLLLLL-LHHHhhhhhllllLHHHEEEELHHHlhhHHHHH
Query ESRVGGllggkpGVTVFHM-GDSKKA-LQPIydllencdvPISKLLPTHVNRnvpLFEQA  241
ident      |           |    |                     |   |      |    
Sbjct AADQYG------LAVKGHXdQLSNLGgSTLA--------aNFGALSVDHLEY---LDPEG  269
DSSP  HHHHLL------LEEEEEElLLLLLLhHHHH--------hHLLLLEEEELLL---LLHHH


DSSP  HHHHHLLLL-EEEELLLL----LLLLhhhHHHHHHhLLLLhhHEEEELLLlLEEEeelll
Query LEFARKGGT-IDITSSID----EPVApaeGIARAVqAGIPlaRVTLSSDGnGSQPffdde  296
ident        |              |                       |||           
Sbjct IQALAHRGVvATLLPTAFyflkETKL--pPVVALR-KAGV--PXAVSSDI-NPGT-----  318
DSSP  HHHHHHHLLeEEELHHHHhhllLLLL--lLHHHHH-HLLL--LEEELLLL-LLLL-----


DSSP  lleeeeeELLL-HHHHHHHHHhhhhHLLLHhHHHHHHLHHHHHHLLL-LLLLLLLLLLLL
Query gnlthigVAGF-ETLLETVQVlvkdYDFSIsDALRPLTSSVAGFLNL-TGKGEILPGNDA  354
ident                                 |    |   |  |      |    |  |
Sbjct ------aPIVSlRXAXNXACT--lfGLTPV-EAXAGVTRHAARALGEqEQLGQLRVGXLA  369
DSSP  ------lLLLLhHHHHHHHHH--hhLLLHH-HHHHHLLHHHHHHLLLlLLLLLLLLLLLL


DSSP  LEEEE-LLLL----------LEEEEEELLEEEEElleelllllllll
Query DLLVM-TPEL----------RIEQVYARGKLMVKdgkacvkgtfetd  390
ident | ||                        |                  
Sbjct DFLVWnCGHPaelsyligvdQLVSRVVNGEETLH-------------  403
DSSP  LEEEElLLLLlhhhhlllllLEEEEEELLEELLL-------------


No 17: Query=1onxA Sbjct=1k6wA Z-score=25.4

back to top
DSSP  llllhhhLLEEEEEEEEellLEEE-EEEEEEELLEEEEEELL---LLLLllllLEEEELL
Query midytaaGFTLLQGAHLyapEDRG-ICDVLVANGKIIAVASN---IPSDivpnCTVVDLS   56
ident               | |                ||| |        |          |  
Sbjct -------ALQTIINARL---PGEEgLWQIHLQDGKISAIDAQsgvMPIT----ENSLDAE   46
DSSP  -------LLLEEEEELL---LLLLlEEEEEEELLEEEEEEEElllLLLL----LLEEELL


DSSP  LLEEEELEEEEEELLLLL---------------lLLLL-HHHL---------lLLLL-HH
Query GQILCPGFIDQHVHLIGG---------------gGEAG-PTTR---------tPEVA-LS   90
ident      | |   | ||                   |                       | 
Sbjct QGLVIPPFVEPHIHLDTTqtagqpnwnqsgtlfeGIERwAERKallthddvkqRAWQtLK  106
DSSP  LLEEELLEEEEEELLLLLlllllllllllllhhhHHHHhHLLHhhllhhhhhhHHHHhHH


DSSP  HHHHLLEEEEEELLLlLLLL--LLHHHHHHHHHHHHhHLLEEEEEEELLLLL--lllllL
Query RLTEAGVTSVVGLLGtDSIS--RHPESLLAKTRALNeEGISAWMLTGAYHVP--srtitG  146
ident      |   |       |          |          |                    
Sbjct WQIANGIQHVRTHVD-VSDAtlTALKAMLEVKQEVA-PWIDLQIVAFPQEGIlsypngeA  164
DSSP  HHHHLLEEEEEEEEE-LLLLllHHHHHHHHHHHHHL-LLLEEEEEEELLLLLlllllhhH


DSSP  LHHHHHHHLllEEEEEEEElllLLLL---LLHHHHHHHHHHHHHHHhhhlllLEEEEE-E
Query SVEKDVAIIdrVIGVXCAIsdhRSAA---PDVYHLANMAAESRVGGllggkpGVTVFH-M  202
ident   |           |                |  |    |                 |  
Sbjct LLEEALRLG--ADVVGAIP---HFEFtreYGVESLHKTFALAQKYD------RLIDVHcD  213
DSSP  HHHHHHHLL--LLEEEELH---HHLLlhhHHHHHHHHHHHHHHHHL------LEEEEEeL


DSSP  LLL--LLLL-HHHHHHHhlLLLLHHHEEEELHH-HLHH---hhhhhHHHHHL-LLLEEEE
Query GDS--KKAL-QPIYDLLenCDVPISKLLPTHVN-RNVP---lfeqaLEFARK-GGTIDIT  254
ident                |              |                      |      
Sbjct EIDdeQSRFvETVAALA-hHEGMGARVTASHTTaMHSYngaytsrlFRLLKMsGINFVAN  272
DSSP  LLLllLLLHhHHHHHHH-hHHLLHHHEEEEELHhHHHLlhhhhhhhHHHHHHhLLEEEEL


DSSP  -LLLL-----------LLLLhhhHHHHHHhLLLLhhHEEEELLLLLEEEeellllleeee
Query -SSID-----------EPVApaeGIARAVqAGIPlaRVTLSSDGNGSQPffddegnlthi  302
ident                                      |    |                 
Sbjct pLVNIhlqgrfdtypkRRGI--tRVKEML-ESGI--NVCFGHDDVFDPW----------y  317
DSSP  hHHHHhhlllllllllLLLL--lLHHHHH-HLLL--LEEELLLLLLLLL----------l


DSSP  EELLLHhHHHHHHH-----hhHHHLLLHhHHHHHHLHHHHHHLLLLLLlLLLLLLLLLEE
Query GVAGFEtLLETVQV-----lvKDYDFSIsDALRPLTSSVAGFLNLTGKgEILPGNDADLL  357
ident         |              |     | |   |   |  |||     |  || | | 
Sbjct PLGTAN-MLQVLHMglhvcqlMGYGQIN-DGLNLITHHSARTLNLQDY-GIAAGNSANLI  374
DSSP  LLLLLL-HHHHHHHhhhhlllLLHHHHH-HHHHHHLHHHHHHLLLLLL-LLLLLLLLLEE


DSSP  EELL---------LLLEEEEEELLEEEEELL-------eelllllllll
Query VMTP---------ELRIEQVYARGKLMVKDG-------kacvkgtfetd  390
ident                        ||                        
Sbjct ILPAengfdalrrQVPVRYSVRGGKVIASTQpaqttvyleqpeaidykr  423
DSSP  EELLllhhhhhhhLLLLLEEEELLEEEEELLllleeeellleeeellll


No 18: Query=1onxA Sbjct=2ogjA Z-score=24.7

back to top
DSSP  llllhhHLLEEEEEEEEELLL---EEEEEEEEEE-LLEEEEEELLLLlllLLLLEEEELL
Query midytaAGFTLLQGAHLYAPE---DRGICDVLVA-NGKIIAVASNIPsdiVPNCTVVDLS   56
ident           ||                 | |    ||| || |       |  |     
Sbjct ------QAPILLTNVKPVGFGkgaSQSSTDILIGgDGKIAAVGSALQ---APADTQRIDA   51
DSSP  ------LLLEEEEEEEELLLLlllLLLLEEEEELlLLLEEEEELLLL---LLLLEEELLL


DSSP  lLEEEELEEEEEELLLLllllllhhhLLLLLLHHH-HHHLLEEEEEELLLllllllLHHH
Query gQILCPGFIDQHVHLIGgggeagpttRTPEVALSR-LTEAGVTSVVGLLGtdsisrHPES  115
ident      ||  | |||                   |    | |||  |              
Sbjct -AFISPGWVDLHVHIWH-------ggTDISIRPSEcGAERGVTTLVDAGS--ageaNFHG  101
DSSP  -LEEEELEEEEEELLLL-------llLLLLLLHHHlLHHHLEEEEEEELL--llllLHHH


DSSP  HHH-HHHHHhhhLLEEEEEEEllllLLLL-----------------llLLHHHHHHHL-L
Query LLA-KTRALneeGISAWMLTGayhvPSRT-----------------itGSVEKDVAII-D  156
ident                                                        |    
Sbjct FREyIIEPS---RERIKAFLN----LGSIglvacnrvpelrdikdidlDRILECYAENsE  154
DSSP  HHHhLLLLL---LLEEEEEEE----LLLLlllllllllllllhhhllhHHHHHHHHLLlL


DSSP  LEEEEEEEELLLLL--LLLLH-HHHHHHHHHHHhhhhhhlllLEEEEEELLLLLLLHHHH
Query RVIGVXCAISDHRS--AAPDV-YHLANMAAESRvggllggkpGVTVFHMGDSKKALQPIY  213
ident    | |   |                  |                  | |          
Sbjct HIVGLXVRASHVITgsWGVTPvKLGKKIAKILK---------VPXXVHVGEPPALYDEVL  205
DSSP  LEEEEEEEELHHHHllLLLHHhHHHHHHHHHHL---------LLEEEEELLLLLLHHHHH


DSSP  HHhhlllllHHHEEEELHHH-LHHHHH--------HHHHHhhLLLLEEEELLLLlllLHH
Query DLlencdvpISKLLPTHVNR-NVPLFE--------QALEFarKGGTIDITSSIDepvAPA  264
ident                ||                   |      |   ||           
Sbjct EI------lGPGDVVTHCFNgKSGSSIxededlfnLAERC--EGIRLDIGHGGA--sFSF  255
DSSP  HH------lLLLLEEELLLLlLLLLLLlllhhhhhHHHHL--LLLEEELLLLLL--lLLH


DSSP  HHHHHHHHLLLLhhHEEEELLLLleeeeellllleeeeEELL---LHHHHHHHHHHHhHH
Query EGIARAVQAGIPlaRVTLSSDGNgsqpffddegnlthiGVAG---FETLLETVQVLVkDY  321
ident      |   |        | |                 |         |  |   |    
Sbjct KVAEAAIARGLL--PFSISTDLH---------------GHSXnfpVWDLATTXSKLL-SV  297
DSSP  HHHHHHHHLLLL--LLLLLLLLL---------------LLLLlllLLLHHHHHHHHH-HL


DSSP  LLLHHHHHHHHLHHHHHHLLLLLllLLLLLLLLLEEEELLL-------------------
Query DFSISDALRPLTSSVAGFLNLTGkgEILPGNDADLLVMTPE-------------------  362
ident |          |   |    |        |  ||  |                       
Sbjct DXPFENVVEAVTRNPASVIRLDXenRLDVGQRADFTVFDLVdadleatdsngdvsrlkrl  357
DSSP  LLLHHHHHHLLLHHHHHHLLLLLllLLLLLLLLEEEEEEEEeeeeeeellllleeeeeee


DSSP  LLEEEEEELLEEeEELLeelllllllll
Query LRIEQVYARGKLmVKDGkacvkgtfetd  390
ident                             
Sbjct FEPRYAVIGAEA-IAAS-----ryipra  379
DSSP  EEEEEEEELLEE-EELL-----llllll


No 19: Query=1onxA Sbjct=3ooqA Z-score=24.5

back to top
DSSP  llllhhhlLEEEEEEEEELL-LEEEEEEEEEELLEEEEEELLLLLLlllLLEEEELLLLE
Query midytaagFTLLQGAHLYAP-EDRGICDVLVANGKIIAVASNIPSDivpNCTVVDLSGQI   59
ident           |   |            |||| |||   |  ||          ||| |  
Sbjct --------KILFKNATVFPItSRPFKGDVLVSNGKVEKVGENIEDP---DAEIVDLTGKF   49
DSSP  --------LEEEEEEEELLLlLLLEEEEEEEELLEEEEEELLLLLL---LLEEEELLLLE


DSSP  EEELEEEEEELLLLLllllLHHHLL----------------LLLL----HHHHHHLLEEE
Query LCPGFIDQHVHLIGGggeaGPTTRT----------------PEVA----LSRLTEAGVTS   99
ident | ||| | | |        |                               |    ||||
Sbjct LFPGFVDAHSHIGLFeegvGYYYSDgneatdpvtphvkaldGFNPqdpaIERALAGGVTS  109
DSSP  EEELEEEEEELLLLLllllLHHHLLlllllllllllllhhhHLLLllhhHHHHHLLLEEE


DSSP  EEELLLlllllllhhhhhhhhhhhhhhlleeeeeeeLLLLLL----llllllhhhhhhhl
Query VVGLLGtdsisrhpesllaktralneegisawmltgAYHVPS----rtitgsvekdvaii  155
ident |    |                                                      
Sbjct VXIVPG------------------------------SANPVGgqgsvikfrsiiveeciv  139
DSSP  EEELLL------------------------------LLLLEEeeeeeeelllllhhhhee


DSSP  LLEEEEEEEELlLLLL--------------LLLHhHHHHH--------------------
Query DRVIGVXCAISdHRSA--------------APDVyHLANM--------------------  181
ident     |   |                                                   
Sbjct KDPAGLKXAFG-ENPKrvygerkqtpstrxGTAG-VIRDYftkvknyxkkkelaqkegke  197
DSSP  EEEEEEEEELL-HHHHhhhhhlllllllhhHHHH-HHHHHhhhhhhhhhhhhhhhhllll


DSSP  ---------hHHHHHHHHhhlllLEEEEEELLllLLLHHHHHHHHLLLLlhhHEEEELHH
Query ---------aAESRVGGLlggkpGVTVFHMGDskKALQPIYDLLENCDVpisKLLPTHVN  232
ident            |                |               |        |   |  
Sbjct ftetdlkxevGEXVLRKK-----IPARXHAHR-aDDILTAIRIAEEFGF---NLVIEHGT  248
DSSP  lllllhhhhhHHHHHLLL-----LLEEEEELL-hHHHHHHHHHHHHHLL---LEEEEELL


DSSP  hlhhHHHHHH-HHHHLLLLEEEELLLLL-------LLLHhHHHHHHHHLLLlhhHEEEEL
Query rnvpLFEQAL-EFARKGGTIDITSSIDE-------PVAPaEGIARAVQAGIplaRVTLSS  284
ident              | |                        | ||     |       |  
Sbjct ----EAYKISkVLAEKKIPVVVGPLLTFrtklelkDLTX-ETIAKLLKDGV---LIALXC  300
DSSP  ----LHHHHHhHHHHHLLLEEELLLLLLlllhhhlLLLL-LHHHHHHHLLL---LEEELL


DSSP  LLLLeeeeellllleeeeeeLLLHHHHHHHHHHHhHHLLLHHHHHHHHLHHHHHHLLL-L
Query DGNGsqpffddegnlthigvAGFETLLETVQVLVkDYDFSISDALRPLTSSVAGFLNL-T  343
ident |                      |            |     | |  ||   |  | |  
Sbjct DHPV----------------IPLEFATVQAATAX-RYGAKEEDLLKILTVNPAKILGLeD  343
DSSP  LLLL----------------LLHHHHHHHHHHHH-HHLLLHHHHHHLLLHHHHHHLLLlL


DSSP  LLLLLLLLLLLLEEEELLLL-----LEEEEEELLEEEEELleelllllllll
Query GKGEILPGNDADLLVMTPEL-----RIEQVYARGKLMVKDgkacvkgtfetd  390
ident   | | || |||| |            | ||  |                  
Sbjct RIGSIEPGKDADLVVWSGHPfdxksVVERVYIDGVEVFRR-----------e  384
DSSP  LLLLLLLLLLLLEEEELLLLlllllLEEEEEELLEEEEEL-----------l


No 20: Query=1onxA Sbjct=4c5yA Z-score=24.3

back to top
DSSP  llllhHHLLEEEEEEEEELLL--EEEEEEEEEELLEEEEEELL--LLLLLLLLL-EEEEL
Query midytAAGFTLLQGAHLYAPE--DRGICDVLVANGKIIAVASN--IPSDIVPNC-TVVDL   55
ident       |  |      |                   |  | |   ||             
Sbjct ----dEAKVTIIYAGLLIPGDgePLRNAALVISDKIIAFVGSEadIPKKYLRSTqSTHRV   56
DSSP  ----lLLLEEEEEEEEELLLLllLEEEEEEEEELLEEEEEEEHhhLLHHHHHHLlLEEEE


DSSP  llLEEEELEEEEEELLLLLlllLLHHHL------------lLLLL-HHHHHHLLEEEEEE
Query sgQILCPGFIDQHVHLIGGggeAGPTTR------------tPEVA-LSRLTEAGVTSVVG  102
ident     | ||  | | |  |                                   | ||   
Sbjct --PVLMPGLWDCHMHFGGD--dDYYNDYtsglathpassgaRLARgCWEALQNGYTSYRD  112
DSSP  --EEEEELEEEEEELLLLL--lLLLLLLhhhhhllhhhhhhHHHHhHHHHHHLLEEEEEE


DSSP  LLllllllllhhHHHHHHHHHHH---HLLEEEEEEELLLL--------------------
Query LLgtdsisrhpeSLLAKTRALNE---EGISAWMLTGAYHV--------------------  139
ident |                  | |     |        |                       
Sbjct LA---------gYGCEVAKAINDgtiVGPNVYSSGAALSQtaghgdifalpagevlgsyg  163
DSSP  LL---------lLHHHHHHHHHLlllLLLEEEELLLEEELlllllllllllhhhhhhhhl


DSSP  ------------------llllllLLHHHHhHHLLlEEEEEEEELLL--------lllLL
Query ------------------psrtitGSVEKDvAIIDrVIGVXCAISDH--------rsaAP  173
ident                           |             |   |               
Sbjct vmnprpgywgagplciadgveevrRAVRLQ-IRRG-AKVIXVMASGGvmsrddnpnfaQF  221
DSSP  llllllllllllleeelllhhhhhHHHHHH-HHHL-LLLEEEELLLLlllllllllllLL


DSSP  LHHHHHHHHHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHHhlllllhhHEEEELHHh
Query DVYHLANMAAESRVGGllggkpGVTVFHMGDskKALQPIYDLLencdvpisKLLPTHVNr  233
ident     |     |                |                            ||  
Sbjct SPEELKVIVEEAARQN------RIVSAHVHG-kAGIMAAIKAG--------CKSLEHVS-  265
DSSP  LHHHHHHHHHHHHHLL------LLEEEEELL-hHHHHHHHHHL--------LLEEEELL-


DSSP  lhhHHHH-HHHHHHLLL-LEEEELLLL----------------------LLLLhhHHHHH
Query nvpLFEQ-ALEFARKGG-TIDITSSID----------------------EPVApaEGIAR  269
ident           |     |     | |                                   
Sbjct ---YADEeVWELMKEKGiLYVATRSVIeiflasngeglvkeswaklqalADSH-lKAYQG  321
DSSP  ---LLLHhHHHHHHHHLlEEELLHHHHhhhhhhllllllllhhhlllhhHHHH-hHHHHH


DSSP  HHHLLLlhhHEEEELLLLleeeeellllleeeeeelLLHHHhHHHHHHHHHHLLLHHHHH
Query AVQAGIplaRVTLSSDGNgsqpffddegnlthigvaGFETLlETVQVLVKDYDFSISDAL  329
ident |  ||       |  |                    |  |     |  |         | 
Sbjct AIKAGV---TIALGTDTA-----------------pGGPTA-LELQFAVERGGMTPLEAI  360
DSSP  HHHLLL---LEELLLLLL-----------------lLLLLH-HHHHHHHHLLLLLHHHHH


DSSP  HHHLHHHHHHLL--LLLLLLLLLLLLLLEEEELLLL-----------LEEEEEELLEEEE
Query RPLTSSVAGFLN--LTGKGEILPGNDADLLVMTPEL-----------RIEQVYARGKLMV  376
ident    |              |    |  ||                       |   |||  
Sbjct KAATANAPLSVGpqAPLTGQLREGYEADVIALEENPledikvfqepkAVTHVWKGGKLFK  420
DSSP  HHHLLLHHHHHHhhLLLLLLLLLLLLLLEEEELLLLlllhhhhhlhhHEEEEEELLEEEE


DSSP  ELleELLL---llllll
Query KDgkACVK---gtfetd  390
ident                  
Sbjct GP-gIGPWgedarnpfl  436
DSSP  LL-lLLLLlllllllll


No 21: Query=1onxA Sbjct=2uz9A Z-score=23.7

back to top
DSSP  llllhhHLLEEEEEeEEELL-----LEEEE-EEEEEE-LLEEEEEELL----lLLLLLLL
Query midytaAGFTLLQGaHLYAP-----EDRGI-CDVLVA-NGKIIAVASN----iPSDIVPN   49
ident              |                     |   |||                  
Sbjct ------PLAHIFRG-TFVHStwtcpMEVLRdHLLGVSdSGKIVFLEEAsqqekLAKEWCF   53
DSSP  ------LLLEEEEE-EEEELlllllLEEEEeEEEEELlLLLEEEEEEHhhhhhHHHHHLL


DSSP  --lEEEELL-LLEEEELEEEEEELLLLL------------------LLLL------lhhh
Query --cTVVDLS-GQILCPGFIDQHVHLIGG------------------GGEA------gptt   82
ident        ||      ||  | | |                         |          
Sbjct kpcEIRELShHEFFMPGLVDTHIHASQYsfagssidlpllewltkyTFPAehrfqnidfa  113
DSSP  lhhHEEELLlLLEEEELEEEEEEEHHHHhhllllllllhhhhhhhlHHHHhhhhhlhhhh


DSSP  llLLLL-HHHHHHLLEEEEEELLLllllllLHHHHHHHHHHHHHHLLEEEEEEeLLLL--
Query rtPEVA-LSRLTEAGVTSVVGLLGtdsisrHPESLLAKTRALNEEGISAWMLTgAYHV--  139
ident          |    | |             |  | |         |  |           
Sbjct eeVYTRvVRRTLKNGTTTACYFAT-----iHTDSSLLLADITDKFGQRAFVGK-VCMDln  167
DSSP  hhHHHHhHHHHHHLLEEEEEEELL-----lLHHHHHHHHHHHHHHLLEEEEEL-EELLll


DSSP  ------------LLLLllllHHHHHHHLL------LEEEEEEEELlllLLLLlHHHHHHH
Query ------------PSRTitgsVEKDVAIID------RVIGVXCAISdhrSAAPdVYHLANM  181
ident                      |  |              |    |               
Sbjct dtfpeyketteeSIKE----TERFVSEMLqknysrVKPIVTPRFS---LSCS-ETLMGEL  219
DSSP  lllllllllhhhHHHH----HHHHHHHHHhhllllEEEEEEELLH---HHLL-HHHHHHH


DSSP  HHHHHHHHhhhlllLEEEEEEL----LLLL----------LLHHHHHHHhlllllHHHEE
Query AAESRVGGllggkpGVTVFHMG----DSKK----------ALQPIYDLLencdvpISKLL  227
ident                    |                                     |  
Sbjct GNIAKTRD------LHIQSHISenrdEVEAvknlypsyknYTSVYDKNN----llTNKTV  269
DSSP  HHHHHHHL------LEEEEEELllhhHHHHhhhhllllllHHHHHHHLL----llLLLEE


DSSP  EELHHhlhhHHHH-HHHHHHL-LLLEEEE-LLLL--LLLLhhHHHHHHHhLLLLhhHEEE
Query PTHVNrnvpLFEQ-ALEFARK-GGTIDIT-SSID--EPVApaEGIARAVqAGIPlaRVTL  282
ident   |            |      |  |     |                           |
Sbjct MAHGC----YLSAeELNVFHErGASIAHCpNSNLslSSGF--LNVLEVL-KHEV--KIGL  320
DSSP  EEELL----LLLHhHHHHHHHhLLEEEELhHHHHhlLLLL--LLHHHHH-HLLL--EEEE


DSSP  ELLLLLeeeeellllleeeeeeLLLHhHHHHHHHHHHHH-----------LLLHHHHHHH
Query SSDGNGsqpffddegnlthigvAGFEtLLETVQVLVKDY-----------DFSISDALRP  331
ident   |  |                      |      |                      | 
Sbjct GTDVAG---------------gYSYS-MLDAIRRAVMVSnillinkvnekSLTLKEVFRL  364
DSSP  LLLLLL---------------lLLLL-HHHHHHHHHHHHhhhhhllllllLLLHHHHHHH


DSSP  HLHHHHHHLLL-LLLLLLLLLLLLLEEEE------------------------LLLL---
Query LTSSVAGFLNL-TGKGEILPGNDADLLVM------------------------TPEL---  363
ident  |      | |    |    |   |                                   
Sbjct ATLGGSQALGLdGEIGNFEVGKEFDAILInpkasdspidlfygdffgdiseavIQKFlyl  424
DSSP  HLHHHHHHLLLlLLLLLLLLLLLLLEEEElllllllllllllhhhhlllllhhHHHHhhh


DSSP  ----LEEEEEELLEEEeelleELLLllllll
Query ----RIEQVYARGKLMvkdgkACVKgtfetd  390
ident      || ||  ||                 
Sbjct gddrNIEEVYVGGKQV-----VPFS------  444
DSSP  llhhHEEEEEELLEEE-----ELLL------


No 22: Query=1onxA Sbjct=3icjA Z-score=23.0

back to top
DSSP  llllhhhLLEEEEEEEEELL---LEEEeEEEEEELLEEEEEEL--LLLL--LLLLlLEEE
Query midytaaGFTLLQGAHLYAP---EDRGiCDVLVANGKIIAVAS--NIPS--DIVPnCTVV   53
ident            |     |                |                         
Sbjct -------CMKALINGTIYTSfspVKKV-SGLVISNERVLYAGDssTALRiaELAG-GEII   51
DSSP  -------LEEEEELLEEEEEellEEEE-LEEEEELLEEEEEELhhHHHHhhHHHL-LEEE


DSSP  ELLLLEEEELEEEEEELLLL----------------------------------------
Query DLSGQILCPGFIDQHVHLIG----------------------------------------   73
ident || |    | | | | ||                                          
Sbjct DLKGKFVMPAFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqde  111
DSSP  ELLLLEEEELEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhh


DSSP  ----------------------------------------------------llllLLHH
Query ----------------------------------------------------gggeAGPT   81
ident                                                             
Sbjct lgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraLEES  171
DSSP  hlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhHHHH


DSSP  HL------------lLLLL--HHHHHHLLEEEEEELLllllllllHHHHHHHHHHHH---
Query TR------------tPEVA--LSRLTEAGVTSVVGLLgtdsisrhPESLLAKTRALN---  124
ident                         |   || ||             |  |     |    
Sbjct RKiinekiltvkdykHYIEsaQEHLLSLGVHSVGFMS-------vGEKALKALFELEreg  224
DSSP  HHhhhhllllhhhhhHHHHhhHHHHHHLLEEEEEEEE-------eLHHHHHHHHHHHhll


DSSP  HHLLEEEEEEElllllLLLLLLLhhhhhHHLL----LEEEEEEEELL-------------
Query EEGISAWMLTGayhvpSRTITGSvekdvAIID----RVIGVXCAISD-------------  167
ident                                     |  |||                  
Sbjct RLKMNVFAYLS-----PELLDKLeelnlGKFEgrrlRIWGVXLFVDGslgartallsepy  279
DSSP  LLLLEEEEEEL-----HHHHHHHhhhllLLEEllleEEEEEEEELLLlllllllllllll


DSSP  -------LLLLlLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLllLLLHHHHHHHHlLL
Query -------HRSAaPDVYHLANMAAESRVGGllggkpGVTVFHMGDskKALQPIYDLLEnCD  220
ident                             |           |     ||     |  |   
Sbjct tdnpttsGELV-MNKDEIVEVIERAKPLG------LDVAVHAIG-dKAVDVALDAFE-EA  330
DSSP  lllllllLLLL-LLHHHHHHHHHHHLLLL------LEEEEEELL-hHHHHHHHHHHH-HH


DSSP  LLHhhEEEELHhHLHHhhHHHHHHHHL-LLLEEEELLLL---------------LLLLhh
Query VPIskLLPTHVnRNVPlfEQALEFARK-GGTIDITSSID---------------EPVApa  264
ident          |    |      ||        |                            
Sbjct EFS--GRIEHA-SLVR--DDQLERIKElKVRISAQPHFIvsdwwivnrvgeeraKWAY--  383
DSSP  LLL--LEEEEL-LLLL--HHHHHHHHHhLLEEEELLLHHhhlllhhhhhhhhhhHHLL--


DSSP  hHHHHHHHLlllhhHEEEELLLLLeeeeellllleeeeeeLLLHhHHHHHHHHHHH----
Query eGIARAVQAgiplaRVTLSSDGNGsqpffddegnlthigvAGFEtLLETVQVLVKD----  320
ident                   | |                                |      
Sbjct -RLKTLSSI----tKLGFSTDSPI----------------EPAD-PWVSIDAAVNRyvvd  421
DSSP  -LHHHHHHH----lLEEELLLLLL----------------LLLL-HHHHHHHHHHLllll


DSSP  --hlLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLEEEELLLLleeeeeelleeeeel
Query --ydFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELrieqvyargklmvkd  378
ident      |   ||   |   |        |    |  |                        
Sbjct pgerVSREEALHLYTHGSAQVTLAEDLGKLERGFRAEYIILDRDP---------------  466
DSSP  hhhlLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLEEEELLLL---------------


DSSP  leelllllllll
Query gkacvkgtfetd  390
ident             
Sbjct ----------lk  468
DSSP  ----------ll


No 23: Query=1onxA Sbjct=4rdvB Z-score=22.9

back to top
DSSP  llllhhhllEEEEEEEEELL-LEEEEEEEEEE-LLEEEEEE--LLLLLlllllleEEELl
Query midytaagfTLLQGAHLYAP-EDRGICDVLVA-NGKIIAVA--SNIPSdivpnctVVDLs   56
ident                    |              |         |             | 
Sbjct ---------SAIFAERALLPeGWARNVRFEISaDGVLAEIRpdANADG-------AERL-   43
DSSP  ---------LEEEEEEEEELlEEEEEEEEEELlLLLEEEEEllLLLLL-------LEEL-


DSSP  LLEEEELEEEEEELLLL---------------------llLLLLHHHL-----lLLLL--
Query GQILCPGFIDQHVHLIG---------------------ggGEAGPTTR-----tPEVA--   88
ident |    ||    | |                                              
Sbjct GGAVLPGMPNLHSHAFQramaglaevagnpndsfwtwrelMYRMVARLspeqieVIACql  103
DSSP  LLLEEELEEEEEELHHHhhhlllllllllllllhhhhhhhHHHHHLLLlhhhhhHHHHhh


DSSP  HHHHHHLLEEEEEELLLlLLLL-------llHHHHHHHHHHHHHHLLEEEEEEeLLLL--
Query LSRLTEAGVTSVVGLLGtDSIS-------rhPESLLAKTRALNEEGISAWMLTgAYHV--  139
ident       || | |                    |  |   ||    ||    |        
Sbjct YIEMLKAGYTAVAEFHY-VHHDldgrsyadpAELSLRISRAASAAGIGLTLLP-VLYSha  161
DSSP  HHHHHHHLEEEEEEEEL-LLLLlllllllllLHHHHHHHHHHHHHLLEEEEEE-LLLLee


DSSP  --------------LLLLllLLHHHHHHHLL--------LEEEEEEEEllllLLLLlHHH
Query --------------PSRTitGSVEKDVAIID--------RVIGVXCAIsdhrSAAPdVYH  177
ident                                                      |      
Sbjct gfggqpasegqrrfINGS--EAYLELLQRLRapleaaghSLGLCFHSL----RAVT-PQQ  214
DSSP  ellleellhhhlllLLLH--HHHHHHHHHHHhhhhhhllEELEEELLL----LLLL-HHH


DSSP  HHHHHHHhhHHHHhhlllLEEEEEEL----LLLL--------LLHHH-HHHHhllllLHH
Query LANMAAEsrVGGLlggkpGVTVFHMG----DSKK--------ALQPI-YDLLencdvPIS  224
ident  |   |                 |                   ||               
Sbjct IATVLAA--GHDD-----LPVHIHIAeqqkEVDDcqawsgrrPLQWLyENVA-----VDQ  262
DSSP  HHHHHLL--LLLL-----LLEEEEELllhhHHHHhhhhhlllHHHHHhHHLL-----LLL


DSSP  HEEEELHHhlhhHHHH-HHHHHHLLLL-EEEE-LLLL--LLLLhhHHHHHHHhLLLLhhH
Query KLLPTHVNrnvpLFEQ-ALEFARKGGT-IDIT-SSID--EPVApaEGIARAVqAGIPlaR  279
ident      |                   |       |                   |     |
Sbjct RWCLVHAT----HADPaEVAAMARSGAvAGLClSTEAnlGDGI--FPATDFL-AQGG--R  313
DSSP  LEEEEELL----LLLHhHHHHHHHHLLeEEELhHHHHhlLLLL--LLHHHHH-HLLL--E


DSSP  EEEELLLLleeeeellllleeeeeeLLLHhHHHHHHHH---------hhHHLL------L
Query VTLSSDGNgsqpffddegnlthigvAGFEtLLETVQVL---------vkDYDF------S  324
ident     ||                          |    |                      
Sbjct LGIGSDSH-----------------VSLS-VVEELRWLeygqrlrdrkrNRLYrddqpmI  355
DSSP  EEELLLLL-----------------LLLL-HHHHHHHHhhhhhhhhlllLLLLllllllH


DSSP  HHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEELL----------------------l
Query ISDALRPLTSSVAGFLNLtGKGEILPGNDADLLVMTP----------------------e  362
ident             |  |     |    |  |||||                          
Sbjct GRTLYDAALAGGAQALGQ-PIGSLAVGRRADLLVLDGndpylasaegdallnrwlfaggd  414
DSSP  HHHHHHHHHHHHHHHHLL-LLLLLLLLLLLLEEEELLllhhhhllllhhhhhhhhhhllh


DSSP  lLEEEEEELLEEEEELLEELLLlLLLL---------l
Query lRIEQVYARGKLMVKDGKACVKgTFET---------d  390
ident      |   |   | ||                    
Sbjct rQVRDVMVAGRWVVRDGRHAGEeRSARafvqvlgell  451
DSSP  hHEEEEEELLEEEELLLLLLLHhHHHHhhhhhhhhhl


No 24: Query=1onxA Sbjct=1a5kC Z-score=21.1

back to top
DSSP  --------------------------------------------------------lLLL
Query --------------------------------------------------------mIDY    4
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgQML   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleelllllllllllllllllllllllLLL


DSSP  HH-hlLEEEEEEEEELLLEEEEEEEEEELLEEEEEeLLLL---------lLLLLLLEEEE
Query TA-agFTLLQGAHLYAPEDRGICDVLVANGKIIAVaSNIP---------sDIVPNCTVVD   54
ident  |      |  |           |  |  | | |                 |     |  
Sbjct AAdcvDLVLTNALIVDHWGIVKADIGVKDGRIFAI-GKAGnpdiqpnvtiPIGAATEVIA  119
DSSP  HHhllLEEEEEEEEEELLEEEEEEEEEELLEEEEE-ELEEllllllllleELLLLLEEEE


DSSP  LLLLEEEELEEEEEELLLLllllllhhhlllLLLHHHHHHLLEEEEEELL---lLLLL--
Query LSGQILCPGFIDQHVHLIGgggeagpttrtpEVALSRLTEAGVTSVVGLL---gTDSI--  109
ident   | |   | || | | |                       |||  ||            
Sbjct AEGKIVTAGGIDTHIHWIC------------PQQAEEALVSGVTTMVGGGtgpaAGTHat  167
DSSP  LLLLEEEELEEEEEEELLL------------LLHHHHHHHHLEEEEEEELllllHHHHhl


DSSP  -----llLHHHHHHHHHHHhhhLLEEEEEEElllLLLLlllLLHHHHHHHLllEEEEEEE
Query -----srHPESLLAKTRALneeGISAWMLTGayhVPSRtitGSVEKDVAIIdrVIGVXCA  164
ident             |     |         |       |          ||    |||    
Sbjct tctpgpwYISRMLQAADSL---PVNIGLLGK--gNVSQ--pDALREQVAAG--VIGLEIH  218
DSSP  llllhhhHHHHHHHHHLLL---LLEEEEEEE--lLLLL--hHHHHHHHHHL--LLEEEEE


DSSP  EllllLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLLL--LLLHHHHHHHhlllLL
Query IsdhrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDSK--KALQPIYDLLencdVP  222
ident                                     |                       
Sbjct E----DWGATPAAIDCALTVADEMD------IQVALHSDTLNesGFVEDTLAAI----GG  264
DSSP  H----HHLLLHHHHHHHHHHHHHHL------LEEEEELLLLLllLLHHHHHHHH----LL


DSSP  HHhEEEELHHHL-----HHHHhHHHHHhhLLLLEEEELLLL-------------------
Query ISkLLPTHVNRN-----VPLFeQALEFarKGGTIDITSSID-------------------  258
ident        |               |            |                       
Sbjct RT-IHTFHTEGAggghaPDII-TACAH--PNILPSSTNPTLpytlntidehldmlmvchh  320
DSSP  LL-EEELLLLLLlllllLLHH-HHHHL--LLEEEEEEHHHLlllllhhhhhhhhhhhhhl


DSSP  --------------------LLLLhHHHHHHHHhllllhhhEEEELLLLLEeeeelllll
Query --------------------EPVApAEGIARAVqagiplarVTLSSDGNGSqpffddegn  298
ident                                             |||             
Sbjct ldpdiaedvafaesrirretIAAE-DVLHDLGA-------fSLTSSDSQAM---------  363
DSSP  lllllhhhhhlllllllhhhHHHH-HHHHHLLL-------lLEEELLLLLL---------


DSSP  eeeeeeLLLHHHHHHHHHHHHHHL---------------LLHHHHHHHHLHHHHHHLLL-
Query lthigvAGFETLLETVQVLVKDYD---------------FSISDALRPLTSSVAGFLNL-  342
ident                                        |         |   |      
Sbjct ------GRVGEVILRTWQVAHRMKvqrgalaeetgdndnFRVKRYIAKYTINPALTHGIa  417
DSSP  ------LLLLLHHHHHHHHHHHHHhhhlllllllllllhHHHHHHHHLLLHHHHHHLLLl


DSSP  LLLLLLLLLLLLLEEEELLLLL---EEEEEELLEEEEEL--------------lEELL--
Query TGKGEILPGNDADLLVMTPELR---IEQVYARGKLMVKD--------------gKACV--  383
ident    | |  |  ||| |  |         |   |                           
Sbjct HEVGSIEVGKLADLVVWSPAFFgvkPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfg  477
DSSP  LLLLLLLLLLLLLEEEELHHHLlllLLEEEELLEEEEEEellllllllllllleEEELhh


DSSP  LLLL--------------------------------------------------------
Query KGTF--------------------------------------------------------  387
ident                                                             
Sbjct ALGSarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvda  537
DSSP  HLHHhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeell


DSSP  --------------------------lll
Query --------------------------etd  390
ident                              
Sbjct qtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllleeelleellllllllllllllllll


No 25: Query=1onxA Sbjct=1bf6A Z-score=20.1

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ---------------------------------------------------------sfd    3
DSSP  ---------------------------------------------------------lll


DSSP  eELEEEEEELLLLLLL-LLLHHHLLLL---lLHHHHHHL---LEEEEEELLlllllLLLH
Query cPGFIDQHVHLIGGGG-EAGPTTRTPE---vALSRLTEA---GVTSVVGLLgtdsiSRHP  113
ident   |    | ||                               ||  |             
Sbjct pTGYTLAHEHLHIDLSgFKNNVDCRLDqyafICQEMNDLmtrGVRNVIEMT---nrYMGR   60
DSSP  lLLEEEEEELLLEELHhHHLLHHHEELlhhhHHHHHHHHhhlLEEEEEELL---lhHHLL


DSSP  hhHHHHHHHHHHH-LLEEEEEEELLLL----------llllllLLHHHHHHHL-----LL
Query esLLAKTRALNEE-GISAWMLTGAYHV----------psrtitGSVEKDVAII-----DR  157
ident             | ||     || |                                   
Sbjct --NAQFMLDVMREtGINVVACTGYYQDaffpehvatrsvqelaQEMVDEIEQGidgteLK  118
DSSP  --LHHHHHHHHHHhLLEEEEEELLLLHhhlllhhhhllhhhhhHHHHHHHHLLlllllLL


DSSP  EEEEE-EEELLLlLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLlLLLLHHHHHHH
Query VIGVX-CAISDHrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDsKKALQPIYDLL  216
ident          |               |      |           |       |     | 
Sbjct AGIIAeIGTSEGkITPLEEKVFIAAALAHNQTG------RPISTHTSFsTMGLEQLALLQ  172
DSSP  EEEEEeEELLLLlLLHHHHHHHHHHHHHHHHHL------LLEEEELHHhLLHHHHHHHHH


DSSP  HlLLLLHHHEEEELHHHLHhHHHHHHHHHHLLLLEEEE-LLLL-LLLL--HHHHHHHHHH
Query EnCDVPISKLLPTHVNRNVpLFEQALEFARKGGTIDIT-SSID-EPVA--PAEGIARAVQ  272
ident     |  |     |           |     |                            
Sbjct A-HGVDLSRVTVGHCDLKD-NLDNILKMIDLGAYVQFDtIGKNsYYPDekRIAMLHALRD  230
DSSP  H-LLLLHHHEEELLLLLLL-LHHHHHHHHHLLLEEEELlLLLLlLLLHhhHHHHHHHHHH


DSSP  LLLlHHHEEEELLLLLeeeeellllleeeEEEL------LLHHHH-HHHHHHHHhHLLLH
Query AGIpLARVTLSSDGNGsqpffddegnlthIGVA------GFETLL-ETVQVLVKdYDFSI  325
ident  |  | || || |                          |   ||      |     || 
Sbjct RGL-LNRVMLSMDITR-------------RSHLkanggyGYDYLLtTFIPQLRQ-SGFSQ  275
DSSP  LLL-HHHEEELLLLLL-------------HHHLhhhlllLLLHHHhLHHHHHHH-LLLLH


DSSP  HHHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeelleeeeelleellll
Query SDALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkg  385
ident  |    |      |                                              
Sbjct ADVDVMLRENPSQFFQ--------------------------------------------  291
DSSP  HHHHHHHLHHHHHHLL--------------------------------------------


DSSP  lllll
Query tfetd  390
ident      
Sbjct -----  291
DSSP  -----


No 26: Query=1onxA Sbjct=2ob3A Z-score=19.1

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct -----------------------------------------------drintvrgpitis   13
DSSP  -----------------------------------------------lleeelleeelhh


DSSP  eeLEEEEEELLLLL----llllLHHH------llLLLL-HHHHHHLLEEEEEELLlllll
Query cpGFIDQHVHLIGG----ggeaGPTT------rtPEVA-LSRLTEAGVTSVVGLLgtdsi  109
ident   ||   | |  |                       |  | |   |||   |        
Sbjct eaGFTLTHEHICGSsagflrawPEFFgsrkalaeKAVRgLRRARAAGVRTIVDVS---tf   70
DSSP  hhLLEEEEELLEELlllhhhhlHHHHllhhhhhhHHHHhHHHHHHLLLLEEEELL---lh


DSSP  lLLHHhhHHHHHHHHHH-LLEEEEEEELLLLL--------lllllLLHHHHHHHL-----
Query sRHPEslLAKTRALNEE-GISAWMLTGAYHVP--------srtitGSVEKDVAII-----  155
ident                          ||    |                            
Sbjct dIGRD--VSLLAEVSRAaDVHIVAATGLWFDPplsmrlrsveeltQFFLREIQYGiedtg  128
DSSP  hHLLL--HHHHHHHHHHhLLEEELEEELLLLLlhhhhlllhhhhhHHHHHHHHLLlllll


DSSP  LLEEEEEEEELLLlLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLLLLLLHHHHHH
Query DRVIGVXCAISDHrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDSKKALQPIYDL  215
ident  |    | |             |   |  |   |           |   |          
Sbjct IRAGIIXVATTGK-ATPFQELVLKAAARASLATG------VPVTTHTAASQRDGEQQAAI  181
DSSP  LLLLEEEEELLLL-LLHHHHHHHHHHHHHHHHHL------LLEEEELLHHHLHHHHHHHH


DSSP  HHLLLLLHHHEEEELHHHLHHhHHHHHHHHHLLLLEEEE-LLLL---------------L
Query LENCDVPISKLLPTHVNRNVPlFEQALEFARKGGTIDIT-SSID---------------E  259
ident  |      |     |              |  |  |                        
Sbjct FESEGLSPSRVCIGHSDDTDD-LSYLTALAARGYLIGLDhIPYSaiglednasasallgI  240
DSSP  HHHLLLLHHHEEELLHHHLLL-HHHHHHHHHLLLEEEELlLLLLlllllllhhhhhhhlL


DSSP  LLL--HHHHHHHHHHLLLlHHHEEEELLLLleeeeellllleeEEEE----lLLHHHH-H
Query PVA--PAEGIARAVQAGIpLARVTLSSDGNgsqpffddegnltHIGV----aGFETLL-E  312
ident       |  |      |        | |                        |       
Sbjct RSWqtRALLIKALIDQGY-MKQILVSNDWT--fgfssyvtnimDVMDrvnpdGMAFIPlR  297
DSSP  LLHhhHHHHHHHHHHLLL-HHHEEELLLLL--leellllllhhHHHHhhlllHHHHHHhL


DSSP  HHHHHHHhHLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeell
Query TVQVLVKdYDFSISDALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyarg  372
ident     |                   | ||                                
Sbjct VIPFLRE-KGVPQETLAGITVTNPARFLS-------------------------------  325
DSSP  HHHHHHH-LLLLHHHHHHHHLHHHHHHHL-------------------------------


DSSP  eeeeelleelllllllll
Query klmvkdgkacvkgtfetd  390
ident                   
Sbjct --------------ptlr  329
DSSP  --------------llll


No 27: Query=1onxA Sbjct=3k2gB Z-score=19.0

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct -----------------------------------slselspchvrsgrixtvdgpipss   25
DSSP  -----------------------------------llllllllllllleeeelleeeehh


DSSP  eeLEEEEEELLLLLL-LLLL------------------------------HHHLLLL---
Query cpGFIDQHVHLIGGG-GEAG------------------------------PTTRTPE---   86
ident   |    | ||                                                 
Sbjct alGHTLXHEHLQNDCrCWWNppqeperqylaeapisieilselrqdpfvnKHNIALDdld   85
DSSP  hlLLEELLLLLLEELhHHLLllllhhhhhhhhllllhhhhhhhhllhhhlLLLLEELlhh


DSSP  lLHHHHHHL---LEEEEEELLlllllLLLHhhHHHHHHHHHHH-LLEEEEEEELLLL---
Query vALSRLTEA---GVTSVVGLLgtdsiSRHPesLLAKTRALNEE-GISAWMLTGAYHV---  139
ident  |          |  | |                 | |    | |       | |     
Sbjct lAIAEVKQFaavGGRSIVDPT---crGIGR--DPVKLRRISAEtGVQVVXGAGYYLAssx  140
DSSP  hHHHHHHHHhhlLLLEEEELL---llLLLL--LHHHHHHHHHHhLLEEEELLLLLLHhhl


DSSP  -------llllllLLHHHHHHHL-----LLEEEEE-EEELLLlLLLLLHHHHHHHHHHHH
Query -------psrtitGSVEKDVAII-----DRVIGVX-CAISDHrSAAPDVYHLANMAAESR  186
ident                              |         |     |     |   |    
Sbjct petaarlsaddiaDEIVAEALEGtdgtdARIGLIGeIGVSSD-FTAEEEKSLRGAARAQV  199
DSSP  lhhhhlllhhhhhHHHHHHHHLLlllllLLLLLEEeELLLLL-LLHHHHHHHHHHHHHHH


DSSP  HHHhhhlllLEEEEEELLLLLLLHHHHHHHHLLLLLHHHEEEELHHHLHHHHHHHHHHHH
Query VGGllggkpGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFAR  246
ident   |           |            || |            | |            | 
Sbjct RTG------LPLXVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHXNPSHXDPVYQATLAQ  253
DSSP  HHL------LLEEELLLLLLLLHHHHHHHHHHLLLLHHHEEELLLHHHLLLHHHHHHHHH


DSSP  LLLLEEEE-LLLL---------LLLL--HHHHHHHHHHLLLlHHHEEEELLLLLeeeeel
Query KGGTIDIT-SSID---------EPVA--PAEGIARAVQAGIpLARVTLSSDGNGsqpffd  294
ident  |          |          |     |  |      |  | |  || |         
Sbjct RGAFLEFDxIGXDffyadqgvqCPSDdeVARAILGLADHGY-LDRILLSHDVFV------  306
DSSP  HLLEEEELlLLLLleelllleeLLLHhhHHHHHHHHHHLLL-HHHEEELLLLLL------


DSSP  lllleeeeEELL-------LHHHH-HHHHHHHhHHLLLHHHHHHHHLHHHHHHLLlllll
Query degnlthiGVAG-------FETLL-ETVQVLVkDYDFSISDALRPLTSSVAGFLNltgkg  346
ident                               |                             
Sbjct --------KXXLtryggngYAFVTkHFLPRLR-RHGLDDAALETLXVTNPRRVFD-----  352
DSSP  --------HHHLhhhllllLLHHHhLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL-----


DSSP  llllllllleeeellllleeeeeelleeeeelleelllllllll
Query eilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                             
Sbjct --------------------------------------asiegh  358
DSSP  --------------------------------------llllll


No 28: Query=1onxA Sbjct=2vc5A Z-score=18.3

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ----------------------------------------------mriplvgkdsiesk   14
DSSP  ----------------------------------------------llllllllllllhh


DSSP  eeLEEEEEELLlLLLLlLLHH---------hllLLLL--HHHHHHLLEEEEEELLLLLll
Query cpGFIDQHVHLiGGGGeAGPT---------trtPEVA--LSRLTEAGVTSVVGLLGTDsi  109
ident   ||   | ||      |                       |    ||   |        
Sbjct diGFTLIHEHL-RVFSeAVRQqwphlynedeefRNAVneVKRAMQFGVKTIVDPTVMG--   71
DSSP  hlLLEELLLLL-LLLLhHHHHhlhhhllhhhhhHHHHhhHHHHHHLLLLEEEELLLLL--


DSSP  lLLHHhhHHHHHHHHHH-LLEEEEEEELLL----------lllllllLLHHHHHHHL---
Query sRHPEslLAKTRALNEE-GISAWMLTGAYH----------vpsrtitGSVEKDVAII---  155
ident                   ||     || |                       |       
Sbjct -LGRD--IRFMEKVVKAtGINLVAGTGIYIyidlpfyflnrsideiaDLFIHDIKEGiqg  128
DSSP  -LLLL--HHHHHHHHHLlLLEEEELEELLLlllllhhhllllhhhhhHHHHHHHHLLlll


DSSP  --LLEEEEEEEElLLLLLL-LLHHHHHHHHHHHHHHHhhhlllLEEEEEELLLLLL-LHH
Query --DRVIGVXCAIsDHRSAA-PDVYHLANMAAESRVGGllggkpGVTVFHMGDSKKA-LQP  211
ident        || |  |               |                  |        |  
Sbjct tlNKAGFVXIAA-DEPGITkDVEKVIRAAAIANKETK------VPIITHSNAHNNTgLEQ  181
DSSP  llLLLLLEEEEL-LLLLLLhHHHHHHHHHHHHHHHHL------LLEEEELLLLLLHhHHH


DSSP  HHHHHHlLLLLHHHEEEELHHHLHHhHHHHHHHHHLLLLEEEE-LLLL-LLLL--HHHHH
Query IYDLLEnCDVPISKLLPTHVNRNVPlFEQALEFARKGGTIDIT-SSID-EPVA--PAEGI  267
ident    | |   |   | |  |              | ||  |       |         |  
Sbjct QRILTE-EGVDPGKILIGHLGDTDN-IDYIKKIADKGSFIGLDrYGLDlFLPVdkRNETT  239
DSSP  HHHHHH-LLLLHHHEEELLHHHLLL-HHHHHHHHHLLLEEEELlLLLLlLLLHhhHHHHH


DSSP  HHHHHLLLlHHHEEEELLLLleeeeellllleEEEE---------eLLLHHHH-HHHHHH
Query ARAVQAGIpLARVTLSSDGNgsqpffddegnlTHIG---------vAGFETLL-ETVQVL  317
ident  |    |        | |                                     |   |
Sbjct LRLIKDGY-SDKIMISHDYC-------ctidwGTAKpeykpklaprWSITLIFeDTIPFL  291
DSSP  HHHHHLLL-LLLEEELLLLL-------lllllLLLLhhhhhhhlllLLLLHHHhLHHHHH


DSSP  HHhHLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeelleeeee
Query VKdYDFSISDALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyargklmvk  377
ident                      |                                      
Sbjct KR-NGVNEEVIATIFKENPKKFFS------------------------------------  314
DSSP  HL-LLLLHHHHHHHHLHHHHHHLL------------------------------------


DSSP  lleelllllllll
Query dgkacvkgtfetd  390
ident              
Sbjct -------------  314
DSSP  -------------


No 29: Query=1onxA Sbjct=3pnuA Z-score=17.2

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeeLLLL-E
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdLSGQ-I   59
ident                                                             
Sbjct --------------------------------------------------enlyFQSNaM   10
DSSP  --------------------------------------------------llllLLLLlE


DSSP  EEELEEEEEELLLLllllllhhhLLLL-lLHHHHHHlLEEEEEELLLllLLLLL--HHHH
Query LCPGFIDQHVHLIGgggeagpttRTPE-vALSRLTEaGVTSVVGLLGtdSISRH--PESL  116
ident       | | ||                              |       |      | |
Sbjct KLKNPLDMHLHLRD---------NQMLelIAPLSAR-DFCAAVIMPN--LIPPLcnLEDL   58
DSSP  EEELLEEEEELLLL---------HHHHhhHHHHHHL-LLLEEEELLL--LLLLLllHHHH


DSSP  HHHHHHHHHH----LLEEEEEEeLLLLLlllllLLHHHHHhhlLLEEEEEEEeLLLL---
Query LAKTRALNEE----GISAWMLTgAYHVPsrtitGSVEKDVaiiDRVIGVXCAiSDHR---  169
ident  |                 |                       |   | |          
Sbjct KAYKMRILKAckdeNFTPLMTL-FFKNY---deKFLYSAK---DEIFGIXLY-PAGIttn  110
DSSP  HHHHHHHHHHhlllLLEEEEEE-ELLLL---lhHHHHHHL---LLLLEEEEL-LLLLlll


DSSP  ---LLLLLHH-HHHHHHHHHHHHHhhhlllLEEEEEELLLL-------LLLHHHHHHHHL
Query ---SAAPDVY-HLANMAAESRVGGllggkpGVTVFHMGDSK-------KALQPIYDLLEN  218
ident             |                      |                    |   
Sbjct sngGVSSFDIeYLKPTLEAMSDLN------IPLLVHGETNDfvmdresNFAKIYEKLAKH  164
DSSP  lllLLLLLLHhHHHHHHHHHHHLL------LLEEELLLLLLlhhhllhHHHHHHHHHHHH


DSSP  LLLLhhHEEEELHHhlhhhHHHHHHHHHLL--LLEEEELL-LLLL---------------
Query CDVPisKLLPTHVNrnvplFEQALEFARKG--GTIDITSS-IDEP---------------  260
ident       |    |            |           ||                      
Sbjct FPRL--KIVMEHIT-----TKTLCELLKDYenLYATITLHhLIITlddviggkmnphlfc  217
DSSP  LLLL--LEEELLLL-----LHHHHHHHHHLllEEEEELLHhHLLLhhhhhlllllhhhll


DSSP  -------llhhHHHHHhhhllllHHHEEEELLLLLEeeeellllleEEEEE-LLLHHHH-
Query -------vapaEGIARavqagipLARVTLSSDGNGSqpffddegnlTHIGV-AGFETLL-  311
ident                           |   ||                          | 
Sbjct kpiakryedkeALCEL---afsgYEKVMFGSDSAPH--------pkGCAAGvFSAPVILp  266
DSSP  llllllhhhhhHHHHH---hhllLLLEEELLLLLLL--------llLLLLLlLLHHHHHh


DSSP  HHHHHHHHhhLLLHHHHHHHHLHHHHHHLLLLLlllllllLLLLEEEELL----------
Query ETVQVLVKdyDFSISDALRPLTSSVAGFLNLTGkgeilpgNDADLLVMTP----------  361
ident             |       |         |              |              
Sbjct VLAELFKQ--NSSEENLQKFLSDNTCKIYDLKF-------KEDKILTLEEkewqvpnvye  317
DSSP  HHHHHHHH--HLLHHHHHHHHLHHHHHHHLLLL-------LLLLEEEEELlleellllee


DSSP  ---------------LLLEEEeeelleeeeelleelllllllll
Query ---------------ELRIEQvyargklmvkdgkacvkgtfetd  390
ident                                             
Sbjct dkynqvvpymageilKFQLKH-----------------------  338
DSSP  lllleellllllleeLLEELL-----------------------


No 30: Query=1onxA Sbjct=2y1hB Z-score=16.6

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  EELEEEEEELLLLllllllhhhLLLL----lLHHHHHHLLEEEEEELLLlllllLLHHHH
Query CPGFIDQHVHLIGgggeagpttRTPE----vALSRLTEAGVTSVVGLLGtdsisRHPESL  116
ident   |  | | ||                     |     | |   |            |  
Sbjct GVGLVDCHCHLSA---------PDFDrdlddVLEKAKKANVVALVAVAE---hsGEFEKI   48
DSSP  LLLEEEEEELLLL---------HHHLllhhhHHHHHHHLLEEEEEELLL---lhHHHHHH


DSSP  HHHHHHHHhhlLEEEEEEELLLL------------lllLLLLlhhhhHHHL-LLEEEE-E
Query LAKTRALNeegISAWMLTGAYHV------------psrTITGsvekdVAII-DRVIGV-X  162
ident        |          |   |                             ||      
Sbjct MQLSERYN---GFVLPCLGVHPVqgldqrsvtlkdldvALPI-----IENYkDRLLAIgE  100
DSSP  HHHHHHLL---LLEEEEELLLLEelllleellhhhhhhHHHH-----HHHHlLLLLEEeE


DSSP  EEELLL------llLLLL-HHHHHHHHHHHHHHHhhhlllLEEEEEELLLllLLHHHHHH
Query CAISDH------rsAAPD-VYHLANMAAESRVGGllggkpGVTVFHMGDSkkALQPIYDL  215
ident                       |                      |          |  |
Sbjct VGLDFSprfagtgeQKEEqRQVLIRQIQLAKRLN------LPVNVHSRSA--GRPTINLL  152
DSSP  EEEELLllllllhhHHHHhHHHHHHHHHHHHHHL------LLEEEEEELL--HHHHHHHH


DSSP  HHlllLLHHHEEEELHhHLHHhhHHHHHHHHLLLLEEEELLL-LLLLLhhHHHHHHhhll
Query LEncdVPISKLLPTHVnRNVPlfEQALEFARKGGTIDITSSI-DEPVApaEGIARAvqag  274
ident  |       | |        |    | |  | |    |  ||                  
Sbjct QE---QGAEKVLLHAF-DGRP--SVAMEGVRAGYFFSIPPSIiRSGQK-qKLVKQL----  201
DSSP  HH---LLLLLEEEELL-LLLH--HHHHHHHHLLLEEEELHHHhLLHHH-hHHHHHL----


DSSP  lLHHHEEEELLLLLeeeeellllleeEEEELLLHHHHHHHHHHHHHHLLLHHHH-HHHHl
Query iPLARVTLSSDGNGsqpffddegnltHIGVAGFETLLETVQVLVKDYDFSISDA-LRPLt  333
ident  ||    |  |                                      |          
Sbjct -PLTSICLETDSPA--------lgpeKQVRNEPWNISISAEYIAQVKGISVEEViEVTT-  251
DSSP  -LHHHEEELLLLLL--------llllLLLLLLHHHHHHHHHHHHHHHLLLHHHHhHHHH-


DSSP  HHHHHHLL-LLLLlllllllllleeeellllleeeeeelleeeeelleelllllllll
Query SSVAGFLN-LTGKgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident          |                                                
Sbjct QNALKLFPkLRHL--------------------------------------------l  265
DSSP  HHHHHHLLlHHHH--------------------------------------------l


No 31: Query=1onxA Sbjct=2ffiA Z-score=16.6

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct -----------------------------------------------------------l    1
DSSP  -----------------------------------------------------------l


DSSP  eELEEEEEELLL-----lllllLLHHHLLLLLL--HHHHHHLLEEEEEELLLLLLLllLH
Query cPGFIDQHVHLI-----ggggeAGPTTRTPEVA--LSRLTEAGVTSVVGLLGTDSIsrHP  113
ident     || | |                         |  |   |    |            
Sbjct hLTAIDSHAHVFsrglnlasqrRYAPNYDAPLGdyLGQLRAHGFSHGVLVQPSFLG-tDN   60
DSSP  lLLLEELLLLLLlhhhhhhlllLLLLLLLLLHHhhHHHHHHLLLLEELLLLLHHHL-lLL


DSSP  HHHHHHHHHHHhhllEEEEEEEllLLLLllllllhHHHHHHL--LLEEEEEEEeLLLLlL
Query ESLLAKTRALNeegiSAWMLTGayHVPSrtitgsvEKDVAII--DRVIGVXCAiSDHRsA  171
ident   ||                                   |      | ||          
Sbjct RYLLSALQTVP---gQLRGVVX--LERD-----veQATLAEXarLGVRGVRLN-LXGQ-D  108
DSSP  HHHHHHHHHLL---lLLLLLLL--LLLL-----llHHHHHHHhlLLLLEEELL-LLLL-L


DSSP  LLLH--HHHHHHHHHHHHHHhhhlllLEEEEEELllLLLLHHHHHHHhllLLLHhHEEEE
Query APDV--YHLANMAAESRVGGllggkpGVTVFHMGdsKKALQPIYDLLencDVPIsKLLPT  229
ident  ||                |           |             |              
Sbjct XPDLtgAQWRPLLERIGEQG------WHVELHRQ-vADIPVLVRALQ---PYGL-DIVID  157
DSSP  LLLLllLLLHHHHHHHHHHL------LEEEELLL-lLLHHHHHHHHL---LLLL-LEEEL


DSSP  LHHHLH-------HHHHHHHHHhHLLL-LEEEElLLLLL--------lLHHHHHHHHHHL
Query HVNRNV-------PLFEQALEFaRKGG-TIDITsSIDEP--------vAPAEGIARAVQA  273
ident |  |         | |   |     |         |                        
Sbjct HFGRPDarrglgqPGFAELLTLsGRGKvWVKVS-GIYRLqgspeenlaFARQALCALEAH  216
DSSP  HHHLLLlllllllLLHHHHLLLlLLLLeEEEEE-LHHHLlllhhhhhhHHHHHHHHHHHH


DSSP  lLLHHHEEEELLLLLEEEeellllleeeEEELLLH-HHHHHhHHHHhhhlLLHHHHHHHH
Query gIPLARVTLSSDGNGSQPffddegnlthIGVAGFE-TLLETvQVLVkdydFSISDALRPL  332
ident      |    ||    |                |          |      |       |
Sbjct -YGAERLXWGSDWPHTQH----------ESEVSFGsAVEQF-EALG----CSAQLRQALL  260
DSSP  -LLHHHEEEELLLLLLLL----------LLLLLHHhHHHHH-HHHL----LLHHHHHHHH


DSSP  LHHHHHHLLLLLllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query TSSVAGFLNLTGkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                                           
Sbjct LDTARALFGFEL---------------------------------------------e  273
DSSP  LHHHHHHLLLLL---------------------------------------------l


No 32: Query=1onxA Sbjct=3cjpA Z-score=16.6

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLlllllllhhhllLLLL--HHHHHHLLEEEEEELLLLL-----------
Query cpGFIDQHVHLIggggeagpttrtPEVA--LSRLTEAGVTSVVGLLGTD-----------  107
ident     || | | |              |        ||||                     
Sbjct --LIIDGHTHVI------------LPVEkhIKIMDEAGVDKTILFSTSIhpetavnlrdv   46
DSSP  --LLEEEEEELL------------LLHHhhHHHHHHHLLLEEEEELLLLlhhhlllhhhh


DSSP  --------------------lllLLHHHHHHHHHHHHhhlLEEEEEEElLLLL--lllll
Query --------------------sisRHPESLLAKTRALNeegISAWMLTGaYHVP--srtit  145
ident                             |     |                |        
Sbjct kkemkklndvvngktnsmidvrrNSIKELTNVIQAYP---SRYVGFGN-VPVGlsendtn  102
DSSP  hhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHLL---LLEEEEEL-LLLLllhhhhh


DSSP  LLHHHHHHHLLlEEEEE-EEELLlllllLLHHhHHHHHHHHHHHHhhhllLLEEEEEE-L
Query GSVEKDVAIIDrVIGVX-CAISDhrsaaPDVYhLANMAAESRVGGllggkPGVTVFHM-G  203
ident    |          |                  |      |   |           |   
Sbjct SYIEENIVNNK-LVGIGeLTPAS----gQIKS-LKPIFKYSMDSG-----SLPIWIHAfN  151
DSSP  HHHHHHLLLLL-LLEEEeELLLL----lLHHH-HHHHHHHHHHLL-----LLLEEELLlL


DSSP  LLL-LLLHHHHHHHHllLLLHHHEEEELHHHLhhHHHHHHHHHHLL--LLEEEElLLLLl
Query DSK-KALQPIYDLLEncDVPISKLLPTHVNRNvpLFEQALEFARKG--GTIDITsSIDEp  260
ident          |  |      |       |          | | |        |        
Sbjct PLVlQDIKEIAELCK--AFPKVPVILGHMGGS--NWMTAVELAKEIqnLYLDTS-AYFSt  206
DSSP  LLLhHHHHHHHHHHH--HLLLLLEEEHHHHHH--HHHHHHHHHHHLllEEEELL-LLLLh


DSSP  LLHHHHHHHHhhllllHHHEEEELLLLLeeeeellllleeeeeeLLLH-HHHHHHHHHhh
Query VAPAEGIARAvqagipLARVTLSSDGNGsqpffddegnlthigvAGFE-TLLETVQVLvk  319
ident       |                 |                                   
Sbjct FVLKIVINEL------PLKCIFGTDMPF----------------GDLQlSIEAIKKMS--  242
DSSP  HHHHHHHHHL------LLLEELLLLLLL----------------LLHHhHHHHHHHHL--


DSSP  hhlLLHHHHHHHHLHHHHHHLLLllllllllllllleeeellllleeeeeelleeeeell
Query dydFSISDALRPLTSSVAGFLNLtgkgeilpgndadllvmtpelrieqvyargklmvkdg  379
ident         |   |       ||                                      
Sbjct ---NDSYVANAVLGDNISRLLNI-------------------------------------  262
DSSP  ---LLHHHHHHHHLHHHHHHHLL-------------------------------------


DSSP  eelllllllll
Query kacvkgtfetd  390
ident            
Sbjct -----------  262
DSSP  -----------


No 33: Query=1onxA Sbjct=2imrA Z-score=16.3

back to top
DSSP  llllhhhlleEEEEEE--EELLLEEEEEEEEEelleEEEEEL----LLLLLLLllleeEE
Query midytaagftLLQGAH--LYAPEDRGICDVLVangkIIAVAS----NIPSDIVpnctvVD   54
ident                   ||         | |      | |                   
Sbjct --------htPRLLTCdvLYTGAQSPGGVVVV--geTVAAAGhpdeLRRQYPH----aAE   46
DSSP  --------llEEEEEEleEELLEELLEEEEEE--llEEEEEElhhhHHHHLLL----lEE


DSSP  LLLL-EEEELEEEEEELLlLLLLL--------------llhhHLLL----LLLH-HHHHH
Query LSGQ-ILCPGFIDQHVHLiGGGGE--------------agptTRTP----EVAL-SRLTE   94
ident         |     | ||                                  |    || 
Sbjct ERAGaVIAPPPVNAHTHL-DMSAYefqalpyfqwipevvirgRHLRgvaaAQAGaDTLTR  105
DSSP  EELLlEELLLLLEEEEEL-LLLHHhhhhlhhhhllhhhhhhhLLLLhhhhHHHHhHHHHH


DSSP  LLEEEEEELLllllllLLHHHHHHHHHHhhhHLLEEEEEEeLLLL---------LLLLlL
Query AGVTSVVGLLgtdsisRHPESLLAKTRAlneEGISAWMLTgAYHV---------PSRTiT  145
ident  |   |            ||   |       |  |                         
Sbjct LGAGGVGDIV------WAPEVMDALLAR---EDLSGTLYF-EVLNpfpdkadevFAAA-R  154
DSSP  LLLLLEEEEE------LLHHHHHHHHLL---LLLLEEEEE-EELLllhhhhhhhHHHH-H


DSSP  LLHhHHHHHLL---LEEEEEEEELLllllLLLHHHHHHHHHHHHHHHhhhlllLEEEEEE
Query GSVeKDVAIID---RVIGVXCAISDhrsaAPDVYHLANMAAESRVGGllggkpGVTVFHM  202
ident                  |                            |           | 
Sbjct THL-ERWRRLErpgLRLGLSPHTPF----TVSHRLMRLLSDYAAGEG------LPLQIHV  203
DSSP  HHH-HHHHLLLlllEEEEEEELLLL----LLLHHHHHHHHHHHHHHL------LLLEEEE


DSSP  L----LLLL----------------------------------LLHHHHHHHhlllLLHH
Query G----DSKK----------------------------------ALQPIYDLLencdVPIS  224
ident                                                   |         
Sbjct AehptELEMfrtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDELG---vLAAR  260
DSSP  LllhhHHHHhhhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHHL---lHHHL


DSSP  hEEEELHhHLHHhhHHHHHHHHL-LLLEEEE-LLLL--LLLLHhhHHHHHHhLLLLhhHE
Query kLLPTHVnRNVPlfEQALEFARK-GGTIDIT-SSID--EPVAPaeGIARAVqAGIPlaRV  280
ident      |   ||             |        |    |             |      |
Sbjct -PTLVHM-VNVT--PDDIARVARaGCAVVTCpRSNHhlECGTF--DWPAFA-AAGV--EV  311
DSSP  -LEEEEL-LLLL--HHHHHHHHHhLLLEEELhHHHHhlLLLLL--LHHHHH-HLLL--LE


DSSP  EEELLLLLEeeeellllleeeeeeLLLHhHHHHHHHHHHHHL-LLHHHHHHHHLHHHHHH
Query TLSSDGNGSqpffddegnlthigvAGFEtLLETVQVLVKDYD-FSISDALRPLTSSVAGF  339
ident  |  |   |                      | |      |         |         
Sbjct ALGTDSVAS--------------gETLN-VREEVTFARQLYPgLDPRVLVRAAVKGGQRV  356
DSSP  EELLLLHHH--------------hLLLL-LHHHHHHHHHHLLlLLHHHHHHHHHHHHHHH


DSSP  LLllllLLLLL--lllllEEEElllLLEEeeeelleeeeelleelllllllll
Query LNltgkGEILP--gndadLLVMtpeLRIEqvyargklmvkdgkacvkgtfetd  390
ident          |                                           
Sbjct VG----TPFLRrgetwqeGFRW---ELSR----------------------dl  380
DSSP  HL----LLLLLllllllhHHLH---HHLL----------------------ll


No 34: Query=1onxA Sbjct=2qpxA Z-score=16.0

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct --------------------------------------------------gxddlsefvd   10
DSSP  --------------------------------------------------lllllhhhhh


DSSP  EELEEEEEELLLL--------------lllLLLHH-------------------------
Query CPGFIDQHVHLIG--------------gggEAGPT-------------------------   81
ident      | | |                                                  
Sbjct QVPLLDHHCHFLIdgkvpnrddrlaqvsteADKDYpladtknrlayhgflalakefalda   70
DSSP  HLLEEEEEELLLLllllllhhhhhhhhlllLLLLLlhhhhlllhhhhhhhhhhhhhllll


DSSP  ---------hlllllLHHHHHHLLEEEEEELLLLLlllllhhhhhHHHHHHHHH-LLEEE
Query ---------trtpevALSRLTEAGVTSVVGLLGTDsisrhpesllAKTRALNEE-GISAW  131
ident                                 |                   |  ||   
Sbjct nnplaaxndpgyatyNHRIFGHFHFKELLIDTGFV-----pddpiLDLDQTAELvGIPVK  125
DSSP  llllllllhhhhhhhHHHHHHHLLEEEEEEELLLL-----lllllLLHHHHHHHhLLLEE


DSSP  EEEEllllLLLL-----------------llLLHHHHhHHLLlEEEEEEEELlllLLLL-
Query MLTGayhvPSRT-----------------itGSVEKDvAIIDrVIGVXCAISdhrSAAP-  173
ident                                  |           | |            
Sbjct AIYR----LETHaedfxlehdnfaawwqafsNDVKQA-KAHG-FVGFXSIAA---YRVGl  176
DSSP  EEEE----HHHHhhhhhlllllhhhhhhhhhHHHHLL-LLLL-LLLEEELHH---HHLLl


DSSP  ------------------------------LHHHHHHHHHHHHHHHhhhlllLEEEEEEL
Query ------------------------------DVYHLANMAAESRVGGllggkpGVTVFHMG  203
ident                                 | |   |                 || |
Sbjct hlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQD------XPLQFHVG  230
DSSP  llllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHL------LLEEEEEL


DSSP  -------LLLLLLHHHHHHHHLL-LLLHhHEEEELHHHlhhHHHHHHHHHHLL--LLEEE
Query -------DSKKALQPIYDLLENC-DVPIsKLLPTHVNRnvpLFEQALEFARKG--GTIDI  253
ident                  | |         |    |          |   |        ||
Sbjct ygdadtdXYLGNPLLXRDYLKAFtKKGL-KVVLLHCYP---YHREAGYLASVFpnLYFDI  286
DSSP  lllllllHHHLLHHHHHHHHHHHhHHLL-LEEEEELLL---LHHHHHHHHHHLllEEEEL


DSSP  E--LLLLlllLHHHHHHHHHhLLLLHHHEEEELLLLLeeeeellllleeeeeeLLLHHHH
Query T--SSIDepvAPAEGIARAVqAGIPLARVTLSSDGNGsqpffddegnlthigvAGFETLL  311
ident                   ||    |  |    ||                          
Sbjct SllDNLG-psGASRVFNEAV-ELAPYTRILFASDAST-------------ypeXYGLAAR  331
DSSP  LlhHHHL-hhHHHHHHHHHL-LLLLHHHEELLLLLLL-------------lhhHHHHHHH


DSSP  HHHHHHHHHHL--------lLHHHHHHHHLHHHHHHLLLLLLLLLllllllleeeellll
Query ETVQVLVKDYD--------fSISDALRPLTSSVAGFLNLTGKGEIlpgndadllvmtpel  363
ident    | ||                          |                          
Sbjct QFKQALVAHFNqlpfvdlaqKKAWINAICWQTSAKLYHQERELRV---------------  376
DSSP  HHHHHHHHHHHllllllhhhHHHHHHHHHLHHHHHHLLLHHHHLL---------------


DSSP  leeeeeelleeeeelleelllllllll
Query rieqvyargklmvkdgkacvkgtfetd  390
ident                            
Sbjct ---------------------------  376
DSSP  ---------------------------


No 35: Query=1onxA Sbjct=4mupB Z-score=16.0

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ----------------------------------------------lvrklsgtapnpaf   14
DSSP  ----------------------------------------------llllllllllllll


DSSP  EELEEEEEELLL------lllllllhHHLLLLL--LHHHHHHLLEEEEEELLLLLLLllL
Query CPGFIDQHVHLI------ggggeagpTTRTPEV--ALSRLTEAGVTSVVGLLGTDSIsrH  112
ident   |  |   |                    |            |   |    |       
Sbjct PRGAVDTQMHMYlpgypalpggpglpPGALPGPedYRRLMQWLGIDRVIITQGNAHQ-rD   73
DSSP  LLLLEELLLLLLllllllllllllllLLLLLLHhhHHHHHHHHLLLEEEEELLHHHL-lL


DSSP  HHHHHHHHHHHHhhlLEEEEEEEllllllllllLLHHHHHHHL--LLEEEEEEEElLLLL
Query PESLLAKTRALNeegISAWMLTGayhvpsrtitGSVEKDVAII--DRVIGVXCAIsDHRS  170
ident     ||           |                  |||          |          
Sbjct NGNTLACVAEMG---EAAHAVVI-------idaTTTEKDMEKLtaAGTVGARIMD-LPGG  122
DSSP  LHHHHHHHHHHH---HHEEEEEL-------lllLLLHHHHHHHhhLLEEEEEEEL-LLLL


DSSP  -LLLLhhHHHHHHHHHHHHHhhhlllLEEEEEELllLLLLHHhHHHHhlLLLLhHHEEEE
Query -AAPDvyHLANMAAESRVGGllggkpGVTVFHMGdsKKALQPiYDLLenCDVPiSKLLPT  229
ident         |                              |      |       |     
Sbjct aVNLS--ELDAVDERAHAAD------WMVAVQFD-gNGLLDH-LPRL--QKIR-SRWVFD  169
DSSP  lLLHH--HHHHHHHHHHHLL------LEEEEELL-hHHHHHH-HHHH--HLLL-LEEEEL


DSSP  LHHHLHH-------hhHHHHHHHHLL-LLEEEElLLLLLL-------lHHHHHHHHHHll
Query HVNRNVP-------lfEQALEFARKG-GTIDITsSIDEPV-------aPAEGIARAVQag  274
ident |                  |     |           |           |          
Sbjct HHGKFFKgirtdgpemAALLKLIDRGnLWFKFA-GVYESSrkswpyadVAAFSRVIAA--  226
DSSP  HHHHLLLllllllhhhHHHHHHHHHLlEEEEEL-LHHHLLllllllhhHHHHHHHHHH--


DSSP  LLHHHEEEELLLLLEEEEellllleeEEEElLLHHHHHHHHHHhhhhlLLHHHHHHHHLH
Query IPLARVTLSSDGNGSQPFfddegnltHIGVaGFETLLETVQVLvkdydFSISDALRPLTS  334
ident     |                                 |   |            | |  
Sbjct HAPERIVWGTNWPHNSVR------etAAYPdDARLAELTLGWL-----PDEAARHRALVE  275
DSSP  HLHHHEEELLLLLLLLLL------lhHHLLlHHHHHHHHHLLL-----LLHHHHHHHHLH


DSSP  HHHHHLLLLLLlllllllllleeeellllleeeeeelleeeeelleelllllllll
Query SVAGFLNLTGKgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident        |                                                
Sbjct NPEALFKLSPV---------------------------------------------  286
DSSP  HHHHHHLLLLL---------------------------------------------


No 36: Query=1onxA Sbjct=4dlfA Z-score=15.8

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELLL-----lllLLLL---hhHLLLLLL--HHHHHHLLEEEEEELLLLLLll
Query cPGFIDQHVHLI-----gggGEAG---ptTRTPEVA--LSRLTEAGVTSVVGLLGTDSis  110
ident     || | |                    |                             
Sbjct -ALRIDSHQHFWryraadypWIGAgmgvlARDYLPDalHPLMHAQALGASIAVQARAG-r   58
DSSP  -LLLEEEEELLLlllhhhllLLLLllhhhLLLLLHHhhHHHHHHLLLLEEEEELLLLL-h


DSSP  LLHHHHHHHHHHHHhhlLEEEEEEEllLLLL-lllLLLHhhhhhHLLLEEEEEEEELlll
Query RHPESLLAKTRALNeegISAWMLTGayHVPS-rtiTGSVekdvaIIDRVIGVXCAISdhr  169
ident      ||            |                  |           |         
Sbjct DETAFLLELACDEA---RIAAVVGW--EDLRapqlAERV--aewRGTKLRGFRHQLQ---  108
DSSP  HHHHHHHHHHLLLL---LEEEEEEL--LLLLlllhHHHH--hllLLLLEEEEEELHH---


DSSP  LLLL---LHHH--HHHHHHHHHHHHhhhlllLEEEEEELLLllLLHHHHHHHhllLLLHH
Query SAAP---DVYH--LANMAAESRVGGllggkpGVTVFHMGDSkkALQPIYDLLencDVPIS  224
ident   |     |     |   |             |           |               
Sbjct DEADvraFVDDadFARGVAWLQAND------YVYDVLVFER--QLPDVQAFC--aRHDAH  158
DSSP  HLLLhhhHHHLhhHHHHHHHHHHLL------LEEEELLLHH--HHHHHHHHH--hHLLLL


DSSP  HEEEELHHHLH------------HHHHHHHHHHHLL-LLEEEElLLLLL-----------
Query KLLPTHVNRNV------------PLFEQALEFARKG-GTIDITsSIDEP-----------  260
ident  |   |                        | |                           
Sbjct WLVLDHAGKPAlaefdrddtalaRWRAALRELAALPhVVCKLS-GLVTEadwrrglrasd  217
DSSP  LEEEHHHHLLLhhhllllllhhhHHHHHHHHHHLLLlEEEEEL-LLLLLllllllllhhh


DSSP  -lLHHHHHHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeEELLLH-HHHHHHHHHH
Query -vAPAEGIARAVQAgIPLARVTLSSDGNGsqpffddegnlthiGVAGFE-TLLETVQVLV  318
ident           |  |     |    ||                   |              
Sbjct lrHIEQCLDAALDA-FGPQRLMFGSDWPV------------clLAASYDeVASLVERWAE  264
DSSP  hhHHHHHHHHHHHH-HLHHHEEELLLLLH------------hhHLLLHHhHHHHHHHHHH


DSSP  hhHLLLHHHHHHHHLHHHHHHLLLLlllllllllllleeeellllleeeeeelleeeeel
Query kdYDFSISDALRPLTSSVAGFLNLTgkgeilpgndadllvmtpelrieqvyargklmvkd  378
ident      |            |    |                                    
Sbjct --SRLSAAERSALWGGTAARCYALP-----------------------------------  287
DSSP  --HHLLHHHHHHHLLHHHHHHLLLL-----------------------------------


DSSP  leelllllllll
Query gkacvkgtfetd  390
ident             
Sbjct ------------  287
DSSP  ------------


No 37: Query=1onxA Sbjct=3irsA Z-score=15.6

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELLLL------lLLLLlHHHL------------------llllLHHHHHHLL
Query cPGFIDQHVHLIG------gGGEAgPTTR------------------tpevALSRLTEAG   96
ident     ||                   |  |                             ||
Sbjct -LKIIDFRLRPPAmgflnarIYTR-PDIRnrftrqlgfepapsaeekslelMFEEMAAAG   58
DSSP  -LLLEELLLLLLLhhhhhlhHHHL-HHHHhhhhhhhlllllhhhhhllhhhHHHHHHHLL


DSSP  EEEEEELLL---LLLLlLLHHHHHHHHHHHHhhlLEEEEEEElLLLL-lllllLLHHHHh
Query VTSVVGLLG---TDSIsRHPESLLAKTRALNeegISAWMLTGaYHVP-srtitGSVEKDv  152
ident     |                   |   |                               
Sbjct IEQGVCVGRnssVLGS-VSNADVAAVAKAYP---DKFHPVGS-IEAAtrkeamAQMQEI-  112
DSSP  LLEEEEELLeelLLEE-LLHHHHHHHHHHLL---LLEEEEEE-LLLLlhhhhhHHHHHH-


DSSP  HHLLlEEEEEEEelLLLL-LLLL--HHHHHHHHHHHHHHHhhhlllLEEEEEELL-----
Query AIIDrVIGVXCAisDHRS-AAPD--VYHLANMAAESRVGGllggkpGVTVFHMGD-----  204
ident         |                   |    |     |             |      
Sbjct LDLG-IRIVNLE--PGVWaTPMHvdDRRLYPLYAFCEDNG------IPVIMMTGGnagpd  163
DSSP  HHLL-LLLEEEL--HHHLlLLLLllLHHHHHHHHHHHHLL------LLEEEELLLlllll


DSSP  LLLL-LHHHHHHHHllLLLHHHEEEELHHHLhhHHHHHHHHHHLL--LLEEEELL-LLLL
Query SKKA-LQPIYDLLEncDVPISKLLPTHVNRNvpLFEQALEFARKG--GTIDITSS-IDEP  260
ident         |   |   | |       | |            |                 |
Sbjct ITYTnPEHIDRVLG--DFPDLTVVSSHGNWP--WVQEIIHVAFRRpnLYLSPDMYlYNLP  219
DSSP  HHHHlHHHHHHHHH--HLLLLLEEEEHHHLL--LHHHHHHHHHHLllEEEELHHHhLLLL


DSSP  LLhhHHHHHHHHllLLHHHEEEELLLLleeeeellllleeeeeELLL-HHHHHHHHHHhh
Query VApaEGIARAVQagIPLARVTLSSDGNgsqpffddegnlthigVAGF-ETLLETVQVLvk  319
ident       |  |        |                             |           
Sbjct GH-aDFIQAANS--FLADRMLFGTAYP----------------MCPLkEYTEWFLTLP--  258
DSSP  LH-hHHHHHHLL--HHHHLLLLLLLLL----------------LLLHhHHHHHHHLLL--


DSSP  hhlLLHHHHHHHHLHHHHHHLLLllllllllllllleeeellllleeeeeelleeeeell
Query dydFSISDALRPLTSSVAGFLNLtgkgeilpgndadllvmtpelrieqvyargklmvkdg  379
ident             |       |                                       
Sbjct ---IKPDAMEKILHGNAERLLAQ-------------------------------------  278
DSSP  ---LLHHHHHHHHLHHHHHHHHH-------------------------------------


DSSP  eelllllllll
Query kacvkgtfetd  390
ident            
Sbjct --------agr  281
DSSP  --------lll


No 38: Query=1onxA Sbjct=2dvtA Z-score=15.3

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  EELEEEEEELLL---lllLLLL------HHHL---LLLL---LHHHHHHLLEEEEEELLL
Query CPGFIDQHVHLI---gggGEAG------PTTR---TPEV---ALSRLTEAGVTSVVGLLG  105
ident   |      |          ||                     |      |       | 
Sbjct MQGKVALEEHFAipetlqDSAGfvpgdyWKELqhrLLDIqdtRLKLMDAHGIETMILSLN   60
DSSP  LLLEEEEEEEELlhhhhhHHLLlllllhHHHHhhhHHLLllhHHHHHHHLLEEEEEEEEL


DSSP  LLL-------------llLLHHHHHHHHHHHHhhlLEEEEEEElLLLL-lllllLLHHHH
Query TDS-------------isRHPESLLAKTRALNeegISAWMLTGaYHVP-srtitGSVEKD  151
ident                   |    |                                    
Sbjct APAvqaipdrrkaieiarRANDVLAEECAKRP---DRFLAFAA-LPLQdpdaatEELQRC  116
DSSP  LLHhhhlllhhhhhhhhhHHHHHHHHHHHHLL---LLEEEEEL-LLLLlhhhhhHHHHHH


DSSP  HHHLLlEEEEEEEE----lllllLLLLHH-hHHHHHHHHHHHHhhhlllLEEEEEE----
Query VAIIDrVIGVXCAI----sdhrsAAPDVY-hLANMAAESRVGGllggkpGVTVFHM----  202
ident |       |                            |                |     
Sbjct VNDLG-FVGALVNGfsqegdgqtPLYYDLpqYRPFWGEVEKLD------VPFYLHPrnpl  169
DSSP  HHLLL-LLEEEEELlllllllllLLLLLLhhHHHHHHHHHHHL------LLEEEELllll


DSSP  -------------------LLLL--LLLHHHH--HHHHlLLLLHhHEEEELHHHLhhHHH
Query -------------------GDSK--KALQPIY--DLLEnCDVPIsKLLPTHVNRNvpLFE  239
ident                                    |              |      |  
Sbjct pqdsriydghpwllgptwaFAQEtaVHALRLMasGLFD-EHPRL-NIILGHMGEG--LPY  225
DSSP  hhhlhhhlllhhhlhhhlhHHHHhhHHHHHHHhlLHHH-HLLLL-LEEELHHHLL--HHH


DSSP  H----------------------hhHHHHlLLLEEEELLLllllLHHHHHHHHHHLlLLH
Query Q----------------------alEFARkGGTIDITSSIdepvAPAEGIARAVQAgIPL  277
ident                                     ||              |    |  
Sbjct MmwridhrnawvklpprypakrrfmDYFN-ENFHITTSGN----FRTQTLIDAILE-IGA  279
DSSP  HhhhhhhllllllllllllllllhhHHHH-HHEEEELLLL----LLHHHHHHHHLL-LLH


DSSP  HHEEEELLLLLeeeeellllleeeeeeLLLHHHHHHHHHHHhhhlLLHHHHHHHHLHHHH
Query ARVTLSSDGNGsqpffddegnlthigvAGFETLLETVQVLVkdydFSISDALRPLTSSVA  337
ident  |   | |                                         |          
Sbjct DRILFSTDWPF----------------ENIDHASDWFNATS----IAEADRVKIGRTNAR  319
DSSP  HHEELLLLLLL----------------LLHHHHHHHHHHLL----LLHHHHHHHHLHHHH


DSSP  HHLLLLlllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query GFLNLTgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident     |                                                
Sbjct RLFKLD-----------------------------------------------  325
DSSP  HHLLLL-----------------------------------------------


No 39: Query=1onxA Sbjct=4qrnA Z-score=15.3

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllEE
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqIL   60
ident                                                             
Sbjct ------------------------------------------------smtqdlktggEQ   12
DSSP  ------------------------------------------------llllllllllLL


DSSP  EELEEEEEELllLLLL---------------------LLLHHH------------lLLLL
Query CPGFIDQHVHliGGGG---------------------EAGPTT------------rTPEV   87
ident     |                                  |                    
Sbjct GYLRIATEEA--FATReiidvylrmirdgtadkgmvsLWGFYAqspseratqilerLLDL   70
DSSP  LLLLEEEEEE--ELLHhhhhhhhhhhhhllllhhhhhHHHHHHhlllhhhhhhhhhHHLL


DSSP  ---LHHHHHHLLEEEEEELLLLLLL-------------llLHHHHHHHHHHHHhhlLEEE
Query ---ALSRLTEAGVTSVVGLLGTDSI-------------srHPESLLAKTRALNeegISAW  131
ident            |       |                        |               
Sbjct gerRIADMDATGIDKAILALTSPGVqplhdldeartlatrANDTLADACQKYP---DRFI  127
DSSP  lhhHHHHHHHLLLLEEEEEELLLLLlllllhhhhhhhhhhHHHHHHHHHHHLL---LLEE


DSSP  EEEEllLLLL-llllLLHHHHHhHLLLEEEEEEEEllllLLLL----LHHHhHHHHHHHH
Query MLTGayHVPS-rtitGSVEKDVaIIDRVIGVXCAIsdhrSAAP----DVYHlANMAAESR  186
ident                              |                              
Sbjct GMGT-vAPQDpewsaREIHRGA-RELGFKGIQINS----HTQGryldEEFF-DPIFRALV  180
DSSP  ELLL-lLLLLhhhhhHHHHHHH-HLLLLLLEEELL----LLLLllllLHHH-HHHHHHHH


DSSP  HHHhhhlllLEEEEEE----------------------LLLL--LLLHHHH--HHHHlLL
Query VGGllggkpGVTVFHM----------------------GDSK--KALQPIY--DLLEnCD  220
ident               |                               |             
Sbjct EVD------QPLYIHPatspdsmidpmleagldgaifgFGVEtgMHLLRLItiGIFD-KY  233
DSSP  HHL------LLEEELLllllllllhhhhhhlllllllhHHHHhhHHHHHHHhhLHHH-HL


DSSP  LLHhHEEEELHHHLhhHHHH--------------------------hhHHHHLLLLEEEE
Query VPIsKLLPTHVNRNvpLFEQ--------------------------alEFARKGGTIDIT  254
ident          |      |                                           
Sbjct PSL-QIMVGHMGEA--LPYWlyrldymhqagvrsqryermkplkktieGYLKSNVLVTNS  290
DSSP  LLL-LEEELHHHHL--HHHHhhhhhhhhhhhhhlllllllllllllhhHHHHHLEEEELL


DSSP  LLlllllLHHHHHHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeeeLLLH-HHHHH
Query SSidepvAPAEGIARAVQAgIPLARVTLSSDGNGsqpffddegnlthigvAGFE-TLLET  313
ident        |    |    |      ||    |                             
Sbjct GV-----AWEPAIKFCQQV-MGEDRVMYAMDYPY----------------QYVAdEVRAM  328
DSSP  LL-----LLHHHHHHHHHH-HLHHHEELLLLLLL----------------LLLHhHHHHH


DSSP  HHHhhhhhLLLHHHHHHHHLHHHHHHLLLllllllllllllleeeellllleeeeeelle
Query VQVlvkdyDFSISDALRPLTSSVAGFLNLtgkgeilpgndadllvmtpelrieqvyargk  373
ident         | |                 |                               
Sbjct DAM-----DMSAQTKKKFFQTNAEKWFKL-------------------------------  352
DSSP  HLL-----LLLHHHHHHHHLHHHHHHLLL-------------------------------


DSSP  eeeelleelllllllll
Query lmvkdgkacvkgtfetd  390
ident                  
Sbjct -----------------  352
DSSP  -----------------


No 40: Query=1onxA Sbjct=1itqA Z-score=15.0

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeelllleE
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqiL   60
ident                                                             
Sbjct ------------------------------------------------dffrdeaerimR   12
DSSP  ------------------------------------------------lhhhhhhhhhhL


DSSP  EELEEEEEELLLLL-----------lllllhhhllllLLHHHHHHLLEEEEEELLLLLLL
Query CPGFIDQHVHLIGG-----------ggeagpttrtpeVALSRLTEAGVTSVVGLLGTDSI  109
ident     || |  |                               |    |        |   
Sbjct DSPVIDGHNDLPWQlldmfnnrlqderanlttlagthTNIPKLRAGFVGGQFWSVYTPCD   72
DSSP  LLLEEEEEELHHHHhhhhhllllllhhhlllllllllLLHHHHHHLLEEEEEEEELLLHH


DSSP  L------lLHHHHHHHHHHHH---HHLL------------------EEEEEEeLLLLLLL
Query S------rHPESLLAKTRALN---EEGI------------------SAWMLTgAYHVPSR  142
ident                          |                                  
Sbjct TqnkdavrRTLEQMDVVHRMCrmyPETFlyvtssagirqafregkvASLIGV-EGGHSID  131
DSSP  HllllhhhHHHHHHHHHHHHHhhlLLLEeelllhhhhhhhhhllleEEEEEE-ELHHHLL


DSSP  lllLLHHHHHhhLLLEEEEEEEelllLLLLLL------------------HHHHHHHHHH
Query titGSVEKDVaiIDRVIGVXCAisdhRSAAPD------------------VYHLANMAAE  184
ident    |                          |                            |
Sbjct sslGVLRALY--QLGMRYLTLT---hSCNTPWadnwlvdtgdsepqsqglSPFGQRVVKE  186
DSSP  llhHHHHHHH--HLLEEEEELL---lLLLLLLlllhhhllllllllllllLHHHHHHHHH


DSSP  HHHHHhhhlllLEEEEEElllllLLHHHHHHHhlLLLLhHHEEE-ELHHH--LHHH---H
Query SRVGGllggkpGVTVFHMgdskkALQPIYDLLenCDVPiSKLLP-THVNR--NVPL---F  238
ident     |                          |                            
Sbjct LNRLG------VLIDLAH----vSVATMKATL--QLSR-APVIFsHSSAYsvCASRrnvP  233
DSSP  HHHHL------LEEELLL----lLHHHHHHHH--HHLL-LLLEElLLLLLllLLLLlllL


DSSP  HHHHHHHHLL-LLEEEELL--LLLL------lLHHHHHHHHHHLlLLHHHEEEELLLLLE
Query EQALEFARKG-GTIDITSS--IDEP------vAPAEGIARAVQAgIPLARVTLSSDGNGS  289
ident    |                              |               |    |  | 
Sbjct DDVLRLVKQTdSLVMVNFYnnYISCtnkanlsQVADHLDHIKEV-AGARAVGFGGDFDGV  292
DSSP  HHHHHHHHHHlLEEEELLLhhHHLLlllllhhHHHHHHHHHHHH-LLHHHEEELLLLLLL


DSSP  EEeellllleeeeeelLLHHHHHHHHHHHHhHLLLHHHHHHHHLHHHHHHLLllllllll
Query QPffddegnlthigvaGFETLLETVQVLVKdYDFSISDALRPLTSSVAGFLNltgkgeil  349
ident                            |              |                 
Sbjct PR--------vpegleDVSKYPDLIAELLR-RNWTEAEVKGALADNLLRVFE--------  335
DSSP  LL--------llllllLLLLHHHHHHHHHH-LLLLHHHHHHHHLHHHHHHHH--------


DSSP  lllllleeeellllleeeeeelleeeeelleelllllllll
Query pgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                          
Sbjct -------aveqasnltqapeeepipldqlggscrthygyss  369
DSSP  -------hhhhllllllllllllllhhhlllllllllllll


No 41: Query=1onxA Sbjct=4hk5D Z-score=14.9

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  EELEEEEEELLL----------lllLLLL--------HHHL-------------------
Query CPGFIDQHVHLI----------gggGEAG--------PTTR-------------------   83
ident  |   | | |                           |                      
Sbjct TPVVVDIHTHMYppsyiamlekrqtIPLVrtfpqadePRLIllsselaaldaaladpaak   60
DSSP  LLLLEEEEEEELlhhhhhhhhllllLLEEeeelleeeEEEEllhhhhhhhhhhhhlllll


DSSP  ---------LLLL--LHHHHHHLLEEEEEELLLLLLL------------llLHHHHHHHH
Query ---------TPEV--ALSRLTEAGVTSVVGLLGTDSI------------srHPESLLAKT  120
ident                        |    |  |                            
Sbjct lpgrplsthFASLaqKMHFMDTNGIRVSVISLANPWFdflapdeapgiadaVNAEFSDMC  120
DSSP  llleellhhHLLHhhHHHHHHHLLLLEEEEEELLLLLlllllllhhhhhhhHHHHHHHHH


DSSP  HHHHhhlLEEEEEEEllLLLL---llllLLHHHHHhHLLLEEEEEEEEllllLLLL----
Query RALNeegISAWMLTGayHVPS---rtitGSVEKDVaIIDRVIGVXCAIsdhrSAAP----  173
ident                     |        | |          |         |       
Sbjct AQHV---GRLFFFAA--LPLSapvdavkASIERVK-NLKYCRGIILGT----SGLGkgld  170
DSSP  HLLL---LLEEEEEE--LLLLllhhhhhHHHHHHH-LLLLEEEEEELL----LLLLllll


DSSP  LHHHhHHHHHHHHHHHhhhlllLEEEEEE-------------------------LLLL--
Query DVYHlANMAAESRVGGllggkpGVTVFHM-------------------------GDSK--  206
ident |                          |                                
Sbjct DPHL-LPVFEAVADAK------LLVFLHPhyglpnevygprseeyghvlplalgFPMEtt  223
DSSP  LHHH-HHHHHHHHHLL------LEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhh


DSSP  LLLHHHH--HHHHlLLLLHhHEEEELHHHLhhHHHH------------------------
Query KALQPIY--DLLEnCDVPIsKLLPTHVNRNvpLFEQ------------------------  240
ident  |    |               |  |      |                           
Sbjct IAVARMYmaGVFD-HVRNL-QMLLAHSGGT--LPFLagriescivhdghlvktgkvpkdr  279
DSSP  HHHHHHHhlLHHH-HLLLL-LEEEHHHHLL--HHHHhhhhhhhhhllhhhhhllllllll


DSSP  --hhHHHHLLLLEEEELllllllLHHHHHHHHHHLlLLHHHEEEELLLLLEEeeelllll
Query --alEFARKGGTIDITSsidepvAPAEGIARAVQAgIPLARVTLSSDGNGSQpffddegn  298
ident              |             |   |        |     |             
Sbjct rtiwTVLKEQIYLDAVI------YSEVGLQAAIAS-SGADRLMFGTDHPFFP----piee  328
DSSP  llhhHHHHHLEEEELLL------LLHHHHHHHHHH-HLHHHEELLLLLLLLL----llll


DSSP  eeeeeelLLHHHHHHHHHHHhhhlLLHH-HHHHHHLHHHHHHLLLLLllllllLLLLlee
Query lthigvaGFETLLETVQVLVkdydFSIS-DALRPLTSSVAGFLNLTGkgeilpGNDAdll  357
ident                |   |       | ||           | |               
Sbjct dvqgpwdSSRLNAQAVIKAV----GEGSsDAAAVMGLNAVRVLSLKA----elEHHH---  377
DSSP  llllllhHHHHHHHHHHHHH----LLLLhHHHHHHLHHHHHHLLLHH----hhHHHH---


DSSP  eellllleeeeeelleeeeelleelllllllll
Query vmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                  
Sbjct ------------------------------hhh  380
DSSP  ------------------------------hhl


No 42: Query=1onxA Sbjct=4ofcA Z-score=14.5

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLL------------------------lllLLLL----HHHL---LLLL--
Query cpGFIDQHVHLI------------------------gggGEAG----PTTR---TPEV--   87
ident     || | |                                                  
Sbjct --MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskgeaKLLKdgkvFRVVrenCWDPev   58
DSSP  --LLEEEEEELLllllllhhhhhllllleeeeeeelleeEEEElleeEEEEehhHLLHhh


DSSP  LHHHHHHLLEEEEEELL-LLLLL------------llLHHHHHHHHHHHHhhlLEEEEEE
Query ALSRLTEAGVTSVVGLL-GTDSI------------srHPESLLAKTRALNeegISAWMLT  134
ident         |||                              |                | 
Sbjct RIREMDQKGVTVQALSTvPVMFSywakpedtlnlcqlLNNDLASTVVSYP---RRFVGLG  115
DSSP  HHHHHHHHLLLEEEEELlHHHHLllllhhhhhhhhhhHHHHHHHHHHHLL---LLEEEEE


DSSP  EllLLLL-lllllLHHHHHHHLLLEEEEEEEELlllLLLL---LHHHhHHHHHHHHHHHh
Query GayHVPS-rtitgSVEKDVAIIDRVIGVXCAISdhrSAAP---DVYHlANMAAESRVGGl  190
ident                           ||                        |       
Sbjct T--LPMQapelavKEMERCVKELGFPGVQIGTH---VNEWdlnAQEL-FPVYAAAERLK-  168
DSSP  L--LLLLlhhhhhHHHHHHHHLLLLLEEEEELE---ELLEellLHHH-HHHHHHHHHHL-


DSSP  hhlllLEEEEE--------------------ELLL-lLLLHHHH--HHHHllLLLHHHEE
Query lggkpGVTVFH--------------------MGDS-kKALQPIY--DLLEncDVPISKLL  227
ident           |                    |      |          |    |  |  
Sbjct -----CSLFVHpwdmqmdgrmakywlpwlvgMPAEttIAICSMImgGVFE--KFPKLKVC  221
DSSP  -----LEEEEElllllllhhhhlllhhhhlhHHHHhhHHHHHHHllLHHH--HLLLLLEE


DSSP  EELHHHLhhHHHH----------------------hhHHHHlLLLEEEElllllllLHHH
Query PTHVNRNvpLFEQ----------------------alEFARkGGTIDITssidepvAPAE  265
ident   |                                           |             
Sbjct FAHGGGA--FPFTvgrishgfsmrpdlcaqdnpmnpkKYLG-SFYTDAL------vHDPL  272
DSSP  ELHHHLL--HHHHhhhhhhhhhhlhhhhlllllllhhHHLL-LLEEELL------lLLHH


DSSP  HHHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeeELLLHHHHHHHHHHhhhHLLLH
Query GIARAVQAgIPLARVTLSSDGNGsqpffddegnlthigVAGFETLLETVQVLvkdYDFSI  325
ident          |    | |  |                    |                |  
Sbjct SLKLLTDV-IGKDKVILGTDYPF---------------PLGELEPGKLIESM---EEFDE  313
DSSP  HHHHHHHH-HLLLLEELLLLLLL---------------LLLLLLLLHHHHHL---LLLLH


DSSP  HHHHHHHLHHHHHHLLLLLLlllllllllleeeellllleeeeeelleeeeelleellll
Query SDALRPLTSSVAGFLNLTGKgeilpgndadllvmtpelrieqvyargklmvkdgkacvkg  385
ident              || |  |                                        
Sbjct ETKNKLKAGNALAFLGLERK----------------------------------------  333
DSSP  HHHHHHHLHHHHHHHLLLHH----------------------------------------


DSSP  lllll
Query tfetd  390
ident      
Sbjct ---qf  335
DSSP  ---hl


No 43: Query=1onxA Sbjct=1a4mA Z-score=14.4

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct --------------------------------------------------------tpaf    4
DSSP  --------------------------------------------------------llll


DSSP  EELEEEEEELLLL---------------------------------------llLLLLHH
Query CPGFIDQHVHLIG---------------------------------------ggGEAGPT   81
ident        |||| |                                               
Sbjct NKPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmdkplslpgfLAKFDY   64
DSSP  LLLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhHLLHHH


DSSP  HL------------lllLLHHHHHHLLEEEEEELLLllLLLL------------------
Query TR------------tpeVALSRLTEAGVTSVVGLLGtdSISR------------------  111
ident                           ||  |                             
Sbjct YMpviagcreaikriayEFVEMKAKEGVVYVEVRYS-pHLLAnskvdpmpwnqtegdvtp  123
DSSP  HHhhhlllhhhhhhhhhHHHHHHHHLLEEEEEEEEL-lHHHLlllllllhhhlllllllh


DSSP  --LHHHHHHHHHHHHHH-LLEEEEEEELLL-LLLLllllLHHHHHHHL--LLEEEEEEEe
Query --HPESLLAKTRALNEE-GISAWMLTGAYH-VPSRtitgSVEKDVAII--DRVIGVXCAi  165
ident                   ||            ||      |           |     | 
Sbjct ddVVDLVNQGLQEGEQAfGIKVRSILCCMRhQPSW--slEVLELCKKYnqKTVVAMDLAg  181
DSSP  hhHHHHHHHHHHHHHHHhLLEEEEEEEEELlLHHH--hhHHHHHHHHLllLLEEEEEEEl


DSSP  lLLLLlLLLHHHHHHHHHHHHHHHhhhlllLEEEEEE-LLLL-LLLHHHHHHhhlllllh
Query sDHRSaAPDVYHLANMAAESRVGGllggkpGVTVFHM-GDSK-KALQPIYDLlencdvpi  223
ident                        |           |              |         
Sbjct dETIEgSSLFPGHVEAYEGAVKNG------IHRTVHAgEVGSpEVVREAVDI-------l  228
DSSP  lLLLLlHHHLHHHHHHHHHHHHHL------LEEEEEElLLLLhHHHHHHHHL-------l


DSSP  hHEEEELHHhlhhHHHH----HHHHHHLLLLEEEEL-LLLL----lllhhHHHHHHHhlL
Query sKLLPTHVNrnvpLFEQ----ALEFARKGGTIDITS-SIDE----pvapaEGIARAVqaG  274
ident       |                              |                |     
Sbjct kTERVGHGY----HTIEdealYNRLLKENMHFEVCPwSSYLtgawdpkttHAVVRFK--N  282
DSSP  lLLEEEELH----HHHHlhhhHHHHHHLLLEEEELHhHHHHlllllllllLHHHHHH--H


DSSP  LLHhHEEEELLLLLEEeeellllleeeeeELLLHHHHHHHHHhhhHHLLLHHHHHHHhLH
Query IPLaRVTLSSDGNGSQpffddegnlthigVAGFETLLETVQVlvkDYDFSISDALRPlTS  334
ident        |  |                       |          |  |      |    
Sbjct DKA-NYSLNTDDPLIF-------------KSTLDTDYQMTKK---DMGFTEEEFKRL-NI  324
DSSP  LLL-LEEELLLLLLLL-------------LLLHHHHHHHHHH---LLLLLHHHHHHH-HH


DSSP  HHHHHLL-----LLLLL--LLLLllllleeeellllleeeeeelleeeeelleellllll
Query SVAGFLN-----LTGKG--EILPgndadllvmtpelrieqvyargklmvkdgkacvkgtf  387
ident   |                                                         
Sbjct NAAKSSFlpeeeKKELLerLYRE-------------------------------------  347
DSSP  HHHHLLLllhhhHHHHHhhHHHH-------------------------------------


DSSP  lll
Query etd  390
ident    
Sbjct -yq  349
DSSP  -ll


No 44: Query=1onxA Sbjct=3gg7A Z-score=13.9

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLLllllllhhhlLLLL--LHHHHHHLLEeEEEELLLllllllLHHHHHH
Query cpGFIDQHVHLIGgggeagpttrTPEV--ALSRLTEAGVtSVVGLLGtdsisrHPESLLA  118
ident     || ||||             |          |     |                ||
Sbjct --SLIDFHVHLDL----------YPDPvaVARACEERQL-TVLSVTT---tpaAWRGTLA   44
DSSP  --LLEEEEELHHH----------LLLHhhHHHHHHHLLL-EEEELLL---lhhHHHHHHH


DSSP  HHHHHhhhlLEEEEEEELLL---lllllllLLHHHHHHHlllEEEEE-EEELLL---llL
Query KTRALneegISAWMLTGAYH---vpsrtitGSVEKDVAIidrVIGVX-CAISDH---rsA  171
ident             |   |                            |              
Sbjct LAAGR----PHVWTALGFHPevvseraadlPWFDRYLPE---TRFVGeVGLDGSpslrgT   97
DSSP  HHLLL----LLEEELLLLLHhhllllhhhlHHHHHHHHH---LLEEEeEELLLLhhhhhH


DSSP  LLL-HHHHHHHHHHHHHHHhhhlllLEEEEEELLlllLLHHHHHHHHlLLLLhhHEEEEL
Query APD-VYHLANMAAESRVGGllggkpGVTVFHMGDskkALQPIYDLLEnCDVPisKLLPTH  230
ident                   |           |      |       ||             
Sbjct WTQqFAVFQHILRRCEDHG-----gRILSIHSRR---AESEVLNCLE-ANPRsgTPILHW  148
DSSP  HHHhHHHHHHHHHHHHHLL-----lEEEEEELLL---LHHHHHHHHH-HLHHheEEEEEL


DSSP  HhHLHHhhHHHHHHHHLLLLEEEELLL--LLLLLhhHHHHHHhhlllLHHHEEEELLLLL
Query VnRNVPlfEQALEFARKGGTIDITSSI--DEPVApaEGIARAvqagiPLARVTLSSDGNG  288
ident                  |               |    |        |  ||    ||  
Sbjct Y-SGSV--TELRRAISLGCWFSVGPTMvrTQKGA--ALIRSM-----PRDRVLTETDGPF  198
DSSP  L-LLLH--HHHHHHHHLLLEEEELHHHhlLHHHH--HHHHHL-----LHHHEEELLLLLL


DSSP  EEeeellllleeEEEELLLHHHHHHHHHHHHHHLLL-HHHHHHHhLHHHHHHLLllllll
Query SQpffddegnltHIGVAGFETLLETVQVLVKDYDFS-ISDALRPlTSSVAGFLNltgkge  347
ident                 |        |  | |                 |   |       
Sbjct LE---------lDGQAALPWDVKSVVEGLSKIWQIPaSEVERIV-KENVSRLLG------  242
DSSP  LE---------eLLEELLHHHHHHHHHHHHHHHLLLhHHHHHHH-HHHHHHHHH------


DSSP  lllllllleeeellllleeeeeelleeeeelleelllllllll
Query ilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                            
Sbjct ------------------------------------------t  243
DSSP  ------------------------------------------l


No 45: Query=1onxA Sbjct=2gwgA Z-score=13.3

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELLLL--llllLLHH--------------------------hllllLLHHHH
Query cpGFIDQHVHLIG--gggeAGPT--------------------------trtpeVALSRL   92
ident     || | |                                              |   
Sbjct --XIIDIHGHYTTapkaleDWRNrqiagikdpsvxpkvselkisddelqasiieNQLKKX   58
DSSP  --LLEEEEEELLLllhhhhHHHHhhhhhhhlhhhlllhhhllllhhhhhhhhhlLHHHHH


DSSP  HHLLEEEEEELLLL-----LLLL--LLHHHHHHHHHHHHhhlLEEEEEEEL-----llLL
Query TEAGVTSVVGLLGT-----DSIS--RHPESLLAKTRALNeegISAWMLTGA-----yhVP  140
ident  | |    |           |       |                               
Sbjct QERGSDLTVFSPRAgdfnvSSTWaaICNELCYRVSQLFP---DNFIGAAXLpqspgvdPK  115
DSSP  HHHLLLEEEEELLLllhhhHHHHhhHHHHHHHHHHHHLL---LLEEEEEELlllllllHH


DSSP  LLlllLLHHHHHhHLLLEEEEEEEEllllLLLL--------lHHHHHHHHHHHHHHhhhh
Query SRtitGSVEKDVaIIDRVIGVXCAIsdhrSAAP--------dVYHLANMAAESRVGgllg  192
ident         || |                                                
Sbjct TC--iPELEKCV-KEYGFVAINLNP----DPSGghwtsppltDRIWYPIYEKXVEL----  164
DSSP  HH--hHHHHHHH-HLLLLLEEEELL----LLLLlllllllllLHHHHHHHHHHHHH----


DSSP  llLLEEEEE------ELLL-lLLLHHHH--HHHHllLLLHHHEEEELHHHLhhHHHH---
Query gkPGVTVFH------MGDS-kKALQPIY--DLLEncDVPISKLLPTHVNRNvpLFEQ---  240
ident         |             |       ||    | |  |    |             
Sbjct --EIPAXIHvstgahYLNAdtTAFXQCVagDLFK--DFPELKFVIPHGGGA--VPYHwgr  218
DSSP  --LLLEEELlllllhHHHHhhHHHHHHHhlLHHH--HLLLLLEEELHHHLL--LHHHhhh


DSSP  -------------hHHHHhLLLLEEEELLLLlllLHHHHHHHHhhlllLHHHEEEELLLL
Query -------------aLEFArKGGTIDITSSIDepvAPAEGIARAvqagiPLARVTLSSDGN  287
ident                         |                       |   |   |   
Sbjct frglaqexkkplleDHVL-NNIFFDTCVYHQ--pGIDLLNTVI-----PVDNVLFASEXI  270
DSSP  hhhhhhhlllllhhHHLL-LLEEEELLLLLH--hHHHHHHHHL-----LHHHEELLLLLL


DSSP  LEEeeellllleeeeeellLHHHhHHHHHHhhhHLLLHHHHHHHHLHHHHHHLL--LLLL
Query GSQpffddegnlthigvagFETLlETVQVLvkdYDFSISDALRPLTSSVAGFLN--LTGK  345
ident |                    |                                      
Sbjct GAV-----rgidprtgfyyDDTK-RYIEAS---TILTPEEKQQIYEGNARRVYPrlDAAL  321
DSSP  LLL-----lleelllleelLLLH-HHHHHL---LLLLHHHHHHHHLHHHHHHLHhhHHHH


DSSP  lllllLLLLleeeellllleeeeeelleeeeelleelllllllll
Query geilpGNDAdllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                              
Sbjct ----kAKGK---------------------------------leh  329
DSSP  ----hHHHH---------------------------------hll


No 46: Query=1onxA Sbjct=1j5sA Z-score=12.5

back to top
DSSP  ---llllhhhlleeeeeeeEELLleeeeeeeeeelleeeeeellllllllllleeeelll
Query ---midytaagftllqgahLYAPedrgicdvlvangkiiavasnipsdivpnctvvdlsg   57
ident                                                             
Sbjct hmflgedylltnraavrlfNEVK-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------


DSSP  leeEELEEEEEELLL---------lllllllhHHLL------------------------
Query qilCPGFIDQHVHLI---------ggggeagpTTRT------------------------   84
ident         | | ||                                              
Sbjct ---DLPIVDPHNHLDakdivenkpwndiweveGATDhyvwelmrrcgvseeyitgsrsnk   80
DSSP  ---LLLEEELLLLLLhhhhhhllllllhhhhhLLLLhhhhhhhhhllllhhhllllllhh


DSSP  -----------------------------------------------------lllLHHH
Query -----------------------------------------------------pevALSR   91
ident                                                             
Sbjct ekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKL  140
DSSP  hhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHH


DSSP  HHHLLEEEEEELLlllllllLHHHhhHHHHHHHHHL--LEEEEEEELLLLL---------
Query LTEAGVTSVVGLLgtdsisrHPESllAKTRALNEEG--ISAWMLTGAYHVP---------  140
ident |    |                       |   |                          
Sbjct LRDMKVEILCTTD-----dpVSTL--EHHRKAKEAVegVTILPTWRPDRAMnvdkegwre  193
DSSP  HHHLLEEEEELLL-----llLLLL--HHHHHHHHHLllLEEELLLLLHHHHllllllhhh


DSSP  ----------------llllLLLHhHHHHH--LLLEEEEEEEELL---------------
Query ----------------srtiTGSVeKDVAI--IDRVIGVXCAISD---------------  167
ident                          |               |                  
Sbjct yvekmgerygedtstldgflNALW-KSHEHfkEHGCVASDHALLEpsvyyvdenraravh  252
DSSP  hhhhhhhhhllllllhhhhhHHHH-HHHHHhhLLLLLEEEEEELLlllllllhhhhhhhh


DSSP  -----------llllllLHHHHHHHHHHHHHHHhhhlllLEEEEEELLL-----------
Query -----------hrsaapDVYHLANMAAESRVGGllggkpGVTVFHMGDS-----------  205
ident                                         ||  | |             
Sbjct ekafsgekltqdeindyKAFMMVQFGKMNQETN------WVTQLHIGALrdyrdslfktl  306
DSSP  hhhlllllllhhhhhhhHHHHHHHHHHHHHHHL------LEEEEEELEEllllhhhhhhl


DSSP  ------------LLLLHHHHHHHHllLLLH-HHEEEELhhHLHHHHHHHHHHHHLL--LL
Query ------------KKALQPIYDLLEncDVPI-SKLLPTHvnRNVPLFEQALEFARKG--GT  250
ident                       |         |                   ||      
Sbjct gpdsggdistnfLRIAEGLRYFLN--EFDGkLKIVLYV--LDPTHLPTISTIARAFpnVY  362
DSSP  llllllleelllLLHHHHHHHHHH--HLLLlLLEEEEE--LLHHHHHHHHHHHHHLllEE


DSSP  EEEElLLLL--llLHHHHHHHHHHLlLLHHHE-EEELLLLLeeeeellllleeeeeeLLL
Query IDITsSIDE--pvAPAEGIARAVQAgIPLARV-TLSSDGNGsqpffddegnlthigvAGF  307
ident                             |        |                     |
Sbjct VGAP-WWFNdspfGMEMHLKYLASV-DLLYNLaGMVTDSRK---------------lLSF  405
DSSP  ELLL-LLLLllhhHHHHHHHHHHLL-LLHHHLlLLLLLLLL---------------lLHH


DSSP  H-HHHHHHHHHHHHHL-----------lLHHHHHHHHLHHHHHHLLllllllllllllll
Query E-TLLETVQVLVKDYD-----------fSISDALRPLTSSVAGFLNltgkgeilpgndad  355
ident          ||                                                 
Sbjct GsRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF--------------  451
DSSP  HhHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL--------------


DSSP  eeeellllleeeeeelleeeeelleelllllllll
Query llvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                    
Sbjct -----------------------------------  451
DSSP  -----------------------------------


No 47: Query=1onxA Sbjct=4dziC Z-score=12.5

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllEE
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqIL   60
ident                                                            |
Sbjct ----------------------------------------------------------AL    2
DSSP  ----------------------------------------------------------LL


DSSP  EELEEEEEELllLLLL-------------------------------------LLLHHH-
Query CPGFIDQHVHliGGGG-------------------------------------EAGPTT-   82
ident     ||   |                                              ||  
Sbjct NYRVIDVDNH--YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfIPNPTFd   60
DSSP  LLLEEEEEEE--LLLLlllllllllhhhlllleeeeelllleeeeelleelllLLLLLLl


DSSP  -----------------------------------lLLLL--LHHHHHHLLEEEEEELLL
Query -----------------------------------rTPEV--ALSRLTEAGVTSVVGLLG  105
ident                                                 |        |  
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRdaRIAVMDEQDIETAFMLPT  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHhhHHHHHHHHLEEEEEEELL


DSSP  LLLLL----------------lLHHHHHHHH---HHHHhhllEEEEEEEllLLLL--lll
Query TDSIS----------------rHPESLLAKT---RALNeegiSAWMLTGayHVPS--rti  144
ident                           |       |                         
Sbjct FGCGVeealkhdieatmasvhaFNLWLDEDWgfdRPDH----RIIAAPI--VSLAdptra  174
DSSP  HHHHHhhhllllhhhhhhhhhhHHHHHHHHLlllLLLL----LEEELLL--LLLLlhhhh


DSSP  lLLHHHHhHHLLlEEEEEEEEllllLLLL---------LHHHhHHHHHHHHHHhhhhllL
Query tGSVEKDvAIIDrVIGVXCAIsdhrSAAP---------DVYHlANMAAESRVGgllggkP  195
ident    |            |           |         |  |     |            
Sbjct vEEVDFV-LARG-AKLVLVRP----APVPglvkprslgDRSH-DPVWARLAEA------G  221
DSSP  hHHHHHH-HHLL-LLLEELLL----LLLLlllllllllLHHH-HHHHHHHHHH------L


DSSP  LEEEEEE------------------------LLLL--LLLHHHH--HHHHlLLLLHhHEE
Query GVTVFHM------------------------GDSK--KALQPIY--DLLEnCDVPIsKLL  227
ident     ||                          |                        |  
Sbjct VPVGFHLsdsgylhiaaawggakdpldqvllDDRAihDTMASMIvhGVFT-RHPKL-KAV  279
DSSP  LLEEEELlllllhhhhhhllllllhhhhhhhLLHHhhHHHHHHHhlLHHH-HLLLL-LEE


DSSP  EE-LHHHlhhHHHH--------------------hhHHHHlLLLEEEELllllllLHHHh
Query PT-HVNRnvpLFEQ--------------------alEFARkGGTIDITSsidepvAPAEg  266
ident                                             |               
Sbjct SIeNGSY---FVHRlikrlkkaantqpqyfpedpveQLRN-NVWIAPYY------EDDL-  328
DSSP  EElLLLL---HHHHhhhhhhhhhhhlhhhllllhhhHHHH-HEEELLLL------LLLH-


DSSP  hHHHHHLlLLHHHEEEELLLLLeeeeellllleeeeeELLLHHHHHHHHHHHhhhLLLHH
Query iARAVQAgIPLARVTLSSDGNGsqpffddegnlthigVAGFETLLETVQVLVkdyDFSIS  326
ident         |        ||                    |          |     || |
Sbjct -PELARV-IGVDKILFGSDWPH---------------GEGLASPVSFTAELK---GFSES  368
DSSP  -HHHHHH-HLHHHLLLLLLLLL---------------LLLLLLHHHHHHHHL---LLLHH


DSSP  HHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeelleeeeelleelllll
Query DALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgt  386
ident |            |                                              
Sbjct DIRKIMRDNALDLLG--------------------------------------------v  384
DSSP  HHHHHHLHHHHHHHL--------------------------------------------l


DSSP  llll
Query fetd  390
ident     
Sbjct qvgs  388
DSSP  llll


No 48: Query=1onxA Sbjct=3qy6A Z-score=12.4

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eelEEEEEELLLLLLllllhhhllLLLL-HHHHHHLLEEEEEELLL-----LLLL-llLH
Query cpgFIDQHVHLIGGGgeagpttrtPEVA-LSRLTEAGVTSVVGLLG-----TDSI-srHP  113
ident     || | |                          |                       
Sbjct ---MIDIHCHILPAM-ddgagdsaDSIEmARAAVRQGIRTIIATPHhnngvYKNEpaaVR   56
DSSP  ---LEELLLLLLLLL-llllllhhHHHHhHHHHHHLLLLEEELLLEellllLLLLhhhHH


DSSP  HHHHHHHHHHH--HHLLEEEEEeellllllllllllhhhhhhhllleeeeEEEEllllll
Query ESLLAKTRALN--EEGISAWMLtgayhvpsrtitgsvekdvaiidrvigvXCAIsdhrsa  171
ident |        |                                           |      
Sbjct EAADQLNKRLIkeDIPLHVLPG---------------------------qEIRI------   83
DSSP  HHHHHHHHHHHhlLLLLEEELL---------------------------lEEEL------


DSSP  lllhHHHHHHHHHHhhhhhhhlLLLEEEEEELLLLlLLHHHHHHHHL-lLLLHhHEEEEL
Query apdvYHLANMAAESrvggllggKPGVTVFHMGDSKkALQPIYDLLEN-cDVPIsKLLPTH  230
ident            |                               |               |
Sbjct ---yGEVEQDLAKR--qllslnDTKYILIEFPFDH-VPRYAEQLFYDlqLKGY-IPVIAH  136
DSSP  ---lLLHHHHHHLL--llllhhHLLEEEEELLLLL-LLLLHHHHHHHhhHLLL-EEEEEL


DSSP  HHHLHHH---HHHHHHHHHLLLLEEEELLL--------LLLLLhHHHHHHHhhllllhhh
Query VNRNVPL---FEQALEFARKGGTIDITSSI--------DEPVApAEGIARAvqagiplar  279
ident   ||               ||    |||                                
Sbjct PERNREIrenPSLLYHLVEKGAASQITSGSlagifgkqLKAFS-LRLVEAN-------li  188
DSSP  HHHLHHHhhlLHHHHHHHHLLLEEEEEHHHhlllllhhHHHHH-HHHHHLL-------ll


DSSP  EEEELLLLleeeeellllleeeeEELLLhHHHHHHHHHHHHhlLLHHHHHHHhLHHHHHH
Query VTLSSDGNgsqpffddegnlthiGVAGFeTLLETVQVLVKDydFSISDALRPlTSSVAGF  339
ident     ||                     |    |   || |   |         |      
Sbjct HFVASDAH-------------nvKTRNF-HTQEALYVLEKE--FGSELPYML-TENAELL  231
DSSP  LEEELLLL-------------llLLLLL-LHHHHHHHHHHH--HLLHHHHHH-HHHHHHH


DSSP  LLLLlllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query LNLTgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident |                                                  
Sbjct LRNQ-----------------------------------tifrqppqpvkr  247
DSSP  HLLL-----------------------------------llllllllllll


No 49: Query=1onxA Sbjct=3iacA Z-score=12.0

back to top
DSSP  ---llllhhhlleeeeeeeEELLleeeeeeeeeelleeeeeellllllllllleeeelll
Query ---midytaagftllqgahLYAPedrgicdvlvangkiiavasnipsdivpnctvvdlsg   57
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  leeEELEEEEEELLL--------lllllllhhHLLL------------------------
Query qilCPGFIDQHVHLI--------ggggeagptTRTP------------------------   85
ident         | | ||                                              
Sbjct --aPXPIYDFHCHLSpqeiaddrrfdnlgqiwLEGDhykwralrsagvdeslitgketsd   81
DSSP  --lLLLEEELLLLLLhhhhhhllllllhhhhhHLLLlhhhhhhhhllllhhhlllllllh


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------ev   87
ident                                                             
Sbjct yekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafs  141
DSSP  hhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhl


DSSP  LHHHHHHLLEEEEEELLlllllllLHHHhhHHHHHHHH---HLLEEEEEEELLLLL----
Query ALSRLTEAGVTSVVGLLgtdsisrHPESllAKTRALNE---EGISAWMLTGAYHVP----  140
ident |        |  |                    |         |          |     
Sbjct ARGIXQQXNVRXVGTTD-----dpIDSL--EYHRQIAAddsIDIEVAPSWRPDKVFkiel  194
DSSP  HHHHHHHLLEEEEELLL-----llLLLL--HHHHHHHHlllLLLEEELLLLLHHHHllll


DSSP  --------------------lllllLLHHHHHHHLL--LEEEEEEEELL-----------
Query --------------------srtitGSVEKDVAIID--RVIGVXCAISD-----------  167
ident                                               |             
Sbjct dgfvdylrkleaaadvsitrfddlrQALTRRLDHFAacGCRASDHGIETlrfapvpddaq  254
DSSP  llhhhhhhhhhhhhllllllhhhhhHHHHHHHHHHHhlLLLEEEEEELLllllllllhhh


DSSP  ----------------llllllLHHHHHHHHHHHHHHHhhhlllLEEEEEELL-------
Query ----------------hrsaapDVYHLANMAAESRVGGllggkpGVTVFHMGD-------  204
ident                           |          |       |   | |        
Sbjct ldailgkrlagetlseleiaqfTTAVLVWLGRQYAARG------WVXQLHIGAirnnntr  308
DSSP  hhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHL------LEEEEEELEellllhh


DSSP  ---------------LLLLLHHHHHHHHLL---LLLHhHEEEELhhHLHHHHHHHHHHHH
Query ---------------SKKALQPIYDLLENC---DVPIsKLLPTHvnRNVPLFEQALEFAR  246
ident                          ||           |        |    |       
Sbjct xfrllgpdtgfdsigDNNISWALSRLLDSXdvtNELP-KTILYC--LNPRDNEVLATXIG  365
DSSP  hhhhhllllllleelLLLLHHHHHHHHHHHhllLLLL-EEEEEE--LLHHHHHHHHHHHH


DSSP  LL--------LLEEEE--llLLLLlLHHHHHHHHHHLlLLHHHE-EEELLLLLeeeeell
Query KG--------GTIDIT--ssIDEPvAPAEGIARAVQAgIPLARV-TLSSDGNGsqpffdd  295
ident                                    |    |        |          
Sbjct NFqgpgiagkVQFGSGwwfnDQKD-GXLRQLEQLSQX-GLLSQFvGXLTDSRS-------  416
DSSP  HLllllllllEEELLLlhhhLLHH-HHHHHHHHHHHH-LLHHHLlLLLLLLLL-------


DSSP  llleeeeeeLLLHHHHHHHHHHHHHHL-------------lLHHHHHHHHLHHHHHHLLl
Query egnlthigvAGFETLLETVQVLVKDYD-------------fSISDALRPLTSSVAGFLNl  342
ident                      |                                      
Sbjct --------fLSYTRHEYFRRILCNLLGqwaqdgeipddeaxLSRXVQDICFNNAQRYFT-  467
DSSP  --------lLLLHHHHHHHHHHHHHHHhhhhlllllllhhhHHHHHHHHHLHHHHHHLL-


DSSP  llllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query tgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                                 
Sbjct ----------------------------------------------ik  469
DSSP  ----------------------------------------------ll


No 50: Query=1onxA Sbjct=1v77A Z-score=10.4

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eELEEEEEELLLlllllllhhhlllLLLHhHHHHLlEEEEEELLLlllllllhhhhhhhh
Query cPGFIDQHVHLIggggeagpttrtpEVALsRLTEAgVTSVVGLLGtdsisrhpesllakt  120
ident    ||                    |       |     ||                   
Sbjct -VKFIEMDIRDK-------------EAYE-LAKEW-FDEVVVSIK---------------   29
DSSP  -LLLEEEEELLH-------------HHHH-HHHHH-LLEEEEEEE---------------


DSSP  hhhhhhlleeeeeeelLLLLLLLLlllhhhHHHH--LLLE-EEEEEEElllllllLLHHH
Query ralneegisawmltgaYHVPSRTItgsvekDVAI--IDRV-IGVXCAIsdhrsaaPDVYH  177
ident                                                        |    
Sbjct ----------------FNEEVDKE------KLREarKEYGkVAILLSN-------PKPSL   60
DSSP  ----------------ELLLLLHH------HHHHhhHHHLlEEEEEEL-------LLHHH


DSSP  HHHHHHHHHhhhhhhllLLEEEEEELlLLLLLHHHHHHhhlllllhHHEEEELHHHL--H
Query LANMAAESRvggllggkPGVTVFHMGdSKKALQPIYDLlencdvpiSKLLPTHVNRN--V  235
ident                                                         |   
Sbjct VRDTVQKFK--------SYLIYVESN-DLRVIRYSIEK--------GVDAIISPWVNrkD  103
DSSP  HHHHHHHLL--------LLEEEEELL-LHHHHHHHHHL--------LLLEEELLLLLllL


DSSP  HHHH-HHHHHHHLLL-LEEEELLLL-----------LLLLhHHHHHHHHhLLLLhhHEEE
Query PLFE-QALEFARKGG-TIDITSSID-----------EPVApAEGIARAVqAGIPlaRVTL  282
ident |           |                                           |  |
Sbjct PGIDhVLAKLMVKKNvALGFSLRPLlysnpyeranlLRFM-MKAWKLVE-KYKV--RRFL  159
DSSP  LLLLhHHHHHHHHHLlEEEEELHHHhhllhhhhhhhHHHH-HHHHHHHH-HHLL--LEEE


DSSP  ELLLLLeeeeellllleeeeeELLLH--HHHHHHHHHHhhhlLLHHHHHHHHLHHHHHHL
Query SSDGNGsqpffddegnlthigVAGFE--TLLETVQVLVkdydFSISDALRPLTSSVAGFL  340
ident  |                           |     |        |  |           |
Sbjct TSSAQE--------------kWDVRYprDLISLGVVIG----MEIPQAKASISMYPEIIL  201
DSSP  ELLLLL--------------hHHLLLhhHHHHHHHHLL----LLHHHHHHLLLHHHHHHH


DSSP  Llllllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query Nltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                                   
Sbjct K-------------------------------------------------  202
DSSP  L-------------------------------------------------


No 51: Query=1onxA Sbjct=3dcpA Z-score=8.7

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELlLLLLLLllhhhLLLLL--LHHHHHHLLEEEEEELLL-------------
Query cpGFIDQHVHlIGGGGEagpttRTPEV--ALSRLTEAGVTSVVGLLG-------------  105
ident      | | |                |        |                        
Sbjct --XKRDGHTH-TEFCPH----gTHDDVeeXVLKAIELDFDEYSIVEHaplssefxkntag   53
DSSP  --LLEEEEEL-LLLLLL----lLLLLHhhHHHHHHHLLLLEEEEEEEllllhhhhhllll


DSSP  -------LLLL----llLHHHHHHHHHHHHhHLLEEEEEeellllllllllllhhhhhhh
Query -------TDSI----srHPESLLAKTRALNeEGISAWMLtgayhvpsrtitgsvekdvai  154
ident                                                             
Sbjct dkeavttASXAxsdlpyYFKKXNHIKKKYA-SDLLIHIG---------------------   91
DSSP  llhhhhlLLLLhhhhhhHHHHHHHHHHHLL-LLLEEEEE---------------------


DSSP  llleeeEEEEEllllllLLLHHHHHHHHHHHHHHhhhhlllleEEEEELL----------
Query idrvigVXCAIsdhrsaAPDVYHLANMAAESRVGgllggkpgvTVFHMGD----------  204
ident                              |              |               
Sbjct ------FEVDY-----lIGYEDFTRDFLNEYGPQ------tddGVLSLHFlegqggfrsi  134
DSSP  ------EEEEL-----lLLLHHHHHHHHHHHHHH------lleEEEELLEeeelleeeel


DSSP  ------------------------LLLLL-HHHHHHhhLLLLlhhHEEEELHHHLH----
Query ------------------------SKKAL-QPIYDLleNCDVpisKLLPTHVNRNV----  235
ident                               | |                 |         
Sbjct dfsaedynegivqfyggfeqaqlaYLEGVkQSIEAD--LGLF--kPRRXGHISLCQkfqq  190
DSSP  lllhhhhhhhlhhhhllhhhhhhhHHHHHhHHHHLL--LLLL--lLLEELLLLHHHllhh


DSSP  ---------------hhhhHHHHHHHLLLLEEEELLLL---lLLLHhhHHHHHHH-LLLL
Query ---------------plfeQALEFARKGGTIDITSSID---ePVAPaeGIARAVQ-AGIP  276
ident                                |                            
Sbjct ffgedtsdfseevxekfrvILALVKKRDYELDFNTAGLfkplCGETypPKKIVTLaSELQ  250
DSSP  hhlllhhhllhhhhhhhhhHHHHHHHHLLEEEEELHHHhlllLLLLllLHHHHHHhHHLL


DSSP  hHHEEEELLLLLeeeeellllleeeeeELLLHHHHHHHHHHHhhhlllhhhhhhhhlhhh
Query lARVTLSSDGNGsqpffddegnlthigVAGFETLLETVQVLVkdydfsisdalrpltssv  336
ident        ||  |                          | |                   
Sbjct -IPFVYGSDSHG--------------vQDIGRGYSTYCQKLE------------------  277
DSSP  -LLEEEELLLLL--------------hHHLLLLHHHHHHHLL------------------


DSSP  hhhlllllllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query agflnltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                                       
Sbjct ------------------------------------------------------  277
DSSP  ------------------------------------------------------


No 52: Query=1onxA Sbjct=2a3lA Z-score=8.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------------llllhhhlleeeEEEEEEllleeeeeeeeeelleeeeeel
Query --------------------midytaagftllQGAHLYapedrgicdvlvangkiiavas   40
ident                                    |                        
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  lllllllllleeeelllleeEELEEEEEELLL----------------------------
Query nipsdivpnctvvdlsgqilCPGFIDQHVHLI----------------------------   72
ident                          | |||                              
Sbjct ------------------fyNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrd  200
DSSP  ------------------llLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeel


DSSP  -----------------------------------------lLLLLLLHH----hLLLL-
Query -----------------------------------------gGGGEAGPT----tRTPE-   86
ident                                                |            
Sbjct gtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlKYNPCGQSrlreiFLKQd  260
DSSP  leeelhhhhhhhhlllllllllllllllllllllllllllhhHHLLLLLLhhhhhHLLLl


DSSP  -------------lLHHHHH-HLLEeEEEELLllLLLL-lLHHHHHH--hhHHHHhhLLE
Query -------------vALSRLT-EAGVtSVVGLLgtDSIS-rHPESLLA--ktRALNeeGIS  129
ident                 | |                         |        |      
Sbjct nliqgrflgeitkqVFSDLEaSKYQ-MAEYRIsiYGRKmsEWDQLASwivnNDLY--SEN  317
DSSP  lllllllhhhhhhhHHHHHLlLLLE-EEEEEEelLLLLllHHHHHHHhhhlLLLL--LLL


DSSP  EEEEEELLL----------------lllLLLLLL---------hhhhhhhLLLEEEEEEE
Query AWMLTGAYH----------------vpsRTITGS---------vekdvaiIDRVIGVXCA  164
ident    |                                                 | |    
Sbjct VVWLIQLPRlyniykdmgivtsfqnildNIFIPLfeatvdpdshpqlhvfLKQVVGFDLV  377
DSSP  EEEEEEEELlhhhhlllllllllhhhhhHHLLHHhhhhhlhhhllllhhhHLLEEEEEEE


DSSP  eLLLL------------------lLLLLHHHHHHHHHHHHHHHHHHL----LLLEEEEEE
Query iSDHR------------------sAAPDVYHLANMAAESRVGGLLGG----KPGVTVFHM  202
ident                              |      |   |   |             | 
Sbjct dDESKperrptkhmptpaqwtnafNPAFSYYVYYCYANLYVLNKLREskgmTTITLRPHS  437
DSSP  lLLLLlllllllllllllllllllLLLHHHHHHHHHHHHHHHHHHHLllllLLLEELLLL


DSSP  -LLLLL-LLHHHHHHhhlllllhhHEEEELHHhlhhHHHH---hHHHHHLL-LLEEEE-L
Query -GDSKK-ALQPIYDLlencdvpisKLLPTHVNrnvpLFEQ---aLEFARKG-GTIDIT-S  255
ident         |                    |                              
Sbjct gEAGDIdHLAATFLT---------CHSIAHGI----NLRKspvlQYLYYLAqIGLAMSpL  484
DSSP  lLLLLLhHHHHHHHH---------LLLLLLLH----HHHHlhhhHHHHHHHlLLEEELhH


DSSP  LLL--LLLLhhHHHHHHHHLLLlhhHEEEELLLlleeeeellllleeeeEELL--lHHHH
Query SID--EPVApaEGIARAVQAGIplaRVTLSSDGngsqpffddegnlthiGVAG--fETLL  311
ident |                   |     | || |                        | | 
Sbjct SNNslFLDYhrNPFPVFFLRGL---NVSLSTDD---------------pLQIHltkEPLV  526
DSSP  HHLllLLLLllLLHHHHHHLLL---LEEELLLL---------------hHHHLlllLHHH


DSSP  HHHHHHHHHHLLLHHHHHHHhLHHHHHHLLL-LLLL--LLLLLL---------llleeee
Query ETVQVLVKDYDFSISDALRPlTSSVAGFLNL-TGKG--EILPGN---------dadllvm  359
ident |           |  |                       |                    
Sbjct EEYSIAASVWKLSACDLCEI-ARNSVYQSGFsHALKshWIGKDYykrgpdgndihktnvp  585
DSSP  HHHHHHHHHHLLLHHHHHHH-HHHHHHHLLLlHHHHhhHLLLLLllllhhhllhhhhlll


DSSP  llllleeeeeelleeeeelleelllllllll
Query tpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                
Sbjct hirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhhhhhlllllllllllll


No 53: Query=1onxA Sbjct=1m65A Z-score=8.2

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eeLEEEEEELlLLLLLlllhhhLLLLL---LHHHHHHLLEEEEEELLLL-----LLLLlL
Query cpGFIDQHVHlIGGGGeagpttRTPEV---ALSRLTEAGVTSVVGLLGT-----DSISrH  112
ident      | | |                            |                    |
Sbjct --YPVDLHMH-TVAST------HAYSTlsdYIAQAKQKGIKLFAITDHGpdmedAPHHwH   51
DSSP  --LLEELLLL-LLLLL------LLLLLhhhHHHHHHHHLLLEEEEEEELlllllLLLLhH


DSSP  HHHHHHhhHHHHHHLLEEEEEEELL------lLLLLlllllhHHHHHhlllEEEEEEEEl
Query PESLLAktRALNEEGISAWMLTGAY------hVPSRtitgsvEKDVAiidrVIGVXCAIs  166
ident               |        |                   |                
Sbjct FINMRI--WPRVVDGVGILRGIEANiknvdgeIDCS------GKMFD---sLDLIIAGF-   99
DSSP  HHHHHH--LLLEELLEEEEEEEEEElllllllLLLL------HHHHH---hLLEEEEEL-


DSSP  LLLLllllhhhhhhhhhhhhhhhhhhlllleeeeeelLLLL--LLHHHHhhhhllllLHH
Query DHRSaapdvyhlanmaaesrvggllggkpgvtvfhmgDSKK--ALQPIYdllencdvPIS  224
ident                                         |    |              
Sbjct HEPV-------------------------------faPHDKatNTQAMI-----atiASG  123
DSSP  LLLL-------------------------------llLLLHhhHHHHHH-----hhhHLL


DSSP  HE-EEELHHHL--HHHHHHHHHHHHLLLL-EEEELLLllllLHHHHHHHHHHLLLlhhHE
Query KL-LPTHVNRN--VPLFEQALEFARKGGT-IDITSSIdepvAPAEGIARAVQAGIplaRV  280
ident       |              | | |      |  |        |  |    ||     |
Sbjct NVhIISHPGNPkyEIDVKAVAEAAAKHQVaLEINNSS----NCREVAAAVRDAGG---WV  176
DSSP  LLlEELLLLLLllLLLHHHHHHHHHHHLLeEEEELLL----LHHHHHHHHHHHLL---LE


DSSP  EEELLLLleeeeellllleeeeeelLLHHHHHHHHHHHhHHLLLhhHHHHHHLH--HHHH
Query TLSSDGNgsqpffddegnlthigvaGFETLLETVQVLVkDYDFSisDALRPLTS--SVAG  338
ident  | ||                          |    |    ||          |      
Sbjct ALGSDSH---------------tafTMGEFEECLKILD-AVDFP--PERILNVSprRLLN  218
DSSP  EEELLLL---------------lhhHLLLLHHHHHHHH-HLLLL--HHHLHHHLhhHHHH


DSSP  HLLllllllllllLLLLeeeellllleeeeeelleeeeelleelllllllll
Query FLNltgkgeilpgNDADllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident ||                                                  
Sbjct FLE-srgmapiaeFADL-----------------------------------  234
DSSP  HHH-hllllllhhHLLL-----------------------------------


No 54: Query=1onxA Sbjct=3au2A Z-score=8.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ---------------llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeelLLLLl
Query ---------------midytaagftllqgahlyapedrgicdvlvangkiiavasNIPSd   45
ident                                                          |  
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPG-  179
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLL-


DSSP  llllleeeELLL------------------------------------------------
Query ivpnctvvDLSG------------------------------------------------   57
ident                                                             
Sbjct ------veRAELcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkerat  233
DSSP  ------llEEEElhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   57
ident                                                             
Sbjct vflknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekria  293
DSSP  eeelllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeee


DSSP  --------------------------------------leeEELEEEEEELLLLLLllll
Query --------------------------------------qilCPGFIDQHVHLIGGGgeag   79
ident                                               |  ||         
Sbjct geteeevyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYSD----  349
DSSP  lllhhhhhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLLL----


DSSP  hhhlLLLL--LHHHHHHLLEEEEEELLL----LLLLLL---LHHHHHHHHHHHH-HHLL-
Query pttrTPEV--ALSRLTEAGVTSVVGLLG----TDSISR---HPESLLAKTRALN-EEGI-  128
ident                   |                               |  |   |  
Sbjct ---gQNTLeeLWEAAKTMGYRYLAVTDHspavRVAGGPspeEALKRVGEIRRFNeTHGPp  406
DSSP  ---lLLLHhhHHHHHHHHLLLEEEEEEElhhhHLLLLLlhhHHHHHHHHHHHHHhHHLLl


DSSP  EEEEEeellllllllllllhhhhhhhllleeeEEEEELLLllllllhhhhhhHHHHHHhh
Query SAWMLtgayhvpsrtitgsvekdvaiidrvigVXCAISDHrsaapdvyhlanMAAESRvg  188
ident                                     |                    |  
Sbjct YLLAG---------------------------AEVDIHPD-------gtldyPDWVLR--  430
DSSP  EEEEE---------------------------EEEELLLL-------lllllLHHHHL--


DSSP  hhhhlllleEEEEELL--------LLLLL-HHHHhhhhlllllHHHE-EEELHHH-----
Query gllggkpgvTVFHMGD--------SKKAL-QPIYdllencdvpISKL-LPTHVNR-----  233
ident                           | |                      |        
Sbjct -----eldlVLVSVHSrfnlpkadQTKRLlKALE---------NPFVhVLAHPTArllgr  476
DSSP  -----llleEEEELLLlllllhhhHHHHHhHHHL---------LLLLlEELLLLLlllll


DSSP  ---LHHHHHHHHHHHHLLLL-EEEELLLLlllLHHHHHHHHHHlLLLHhhEEEELLLLle
Query ---NVPLFEQALEFARKGGT-IDITSSIDepvAPAEGIARAVQaGIPLarVTLSSDGNgs  289
ident         |     |   |    |    |    |      |           || |    
Sbjct rapIEADWEAVFQKAKEKGVaVEIDGYYDrmdLPDDLARMAYG-MGLW--ISLSTDAH--  531
DSSP  lllLLLLHHHHHHHHHHHLLeEEEELLLLlllLLHHHHHHHHH-LLLL--EEEELLLL--


DSSP  eeeellllleeeeeelLLHHHHHHHHHHHhHHLLLHHhhhHHHLH---hHHHHLLlllll
Query qpffddegnlthigvaGFETLLETVQVLVkDYDFSISdalRPLTS---sVAGFLNltgkg  346
ident                         |                  |         |      
Sbjct -------------qtdHLRFMELAVGTAQ-RAWIGPE--rVLNTLdyedLLSWLK-----  570
DSSP  -------------lhhHHHHHHHHHHHHH-HLLLLLL--lLHHHLlhhhHHHHHH-----


DSSP  llllllllleeeellllleeeeeelleeeeelleelllllllll
Query eilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                             
Sbjct ---------------------------------------arrgv  575
DSSP  ---------------------------------------lllll


No 55: Query=1onxA Sbjct=3f2bA Z-score=7.7

back to top
DSSP  -----------------------------------------------------------l
Query -----------------------------------------------------------m    1
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  LLLHHhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllLEEE---ellll
Query IDYTAagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnCTVV---dlsgq   58
ident                                                             
Sbjct MSGVK----------------kgmwvkvrgsvqndtfvrdlviiandlNEIAanerqdta  104
DSSP  HHLLL----------------llleeeeeeeeeeelllleeeeeeeeeEEELllllllll


DSSP  eeEELEEEEEELlLLLLLlllhhHLLLLL---LHHHHHHLLEEEEEELLLLlllllLHHH
Query ilCPGFIDQHVHlIGGGGeagptTRTPEV---ALSRLTEAGVTSVVGLLGTdsisrHPES  115
ident          | |                            |                  |
Sbjct peGEKRVELHLH-TPMSQ-----MDAVTSvtkLIEQAKKWGHPAIAVTDHA-----VVQS  153
DSSP  llLLLLLLLLLL-LLLLL-----LLLLLLhhhHHHHHHHLLLLLEEELLLL-----LLLL


DSSP  hHHHHHHHHH-HLLEEEEEEeLLLLL-----lllllllhhhhhhhllleeeeeeeellLL
Query lLAKTRALNE-EGISAWMLTgAYHVP-----srtitgsvekdvaiidrvigvxcaisdHR  169
ident             |                                               
Sbjct -FPEAYSAAKkHGMKVIYGL-EANIVddpfhvtllaqnetglknlfklvslshiqyfhRV  211
DSSP  -HHHHHHHHHhHLLLEEEEE-EEEEEllleeeeeeellhhhhhhhhhhhhhhhlllllLL


DSSP  LLlllhhHHHHHHHHHHhhhhhhlllLEEEeeelllllllhhhhhhhhlllllhhheEEE
Query SAapdvyHLANMAAESRvggllggkpGVTVfhmgdskkalqpiydllencdvpisklLPT  229
ident                           |  |                              
Sbjct PR----iPRSVLVKHRD---------GLLV---------------------------GSG  231
DSSP  LL----eEHHHHHHLLL---------LEEE---------------------------ELL


DSSP  LHhhlhhHHHHhhhhhHLLL----LEEEEL-lLLLL------llhHHHHHHHHhLLLL--
Query HVnrnvpLFEQalefaRKGG----TIDITS-sIDEP------vapAEGIARAVqAGIP--  276
ident        ||                          |            |   | |     
Sbjct CD--kgeLFDN----vEDIArfydFLEVHPpdVYKPlyvkdeemiKNIIRSIV-ALGEkl  284
DSSP  LL--lllLLLL----lLLLHhhllLEEELLhhHHLLlllllhhhhHHHHHHHH-HHHHhl


DSSP  hhHEEEELLLL-----------leeeeeLLLLL-EEEEE-eLLLHHHHHHHHHHHhhhLL
Query laRVTLSSDGN-----------gsqpffDDEGN-LTHIG-vAGFETLLETVQVLVkdyDF  323
ident    |                                |      | |  |           
Sbjct diPVVATGNVHylnpedkiyrkilihsqGGANPlNRHELpdVYFRTTNEMLDCFS---FL  341
DSSP  llLEEELLLLLlllhhhhhhhhhhhhllHHHLLlLLLLLllLLLLLHHHHHHHHH---HH


DSSP  LHHHHHHHHLHHHHHHLLL-----------------------------------------
Query SISDALRPLTSSVAGFLNL-----------------------------------------  342
ident     |             |                                         
Sbjct GPEKAKEIVVDNTQKIASLigdvkpikdelytpriegadeeiremsyrrakeiygdplpk  401
DSSP  HHHHHHHHHLHHHHHHHHLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct lveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmteitevn  461
DSSP  hhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct plpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkv  521
DSSP  lllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct pdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhnlelrga  581
DSSP  lleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct eidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsih  641
DSSP  hhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhllllllleeeeehhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct dnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvg  701
DSSP  lllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct tigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtctlsevig  761
DSSP  lllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct crddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymf  821
DSSP  lhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct pkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkrieeinak  881
DSSP  lhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  342
ident                                                             
Sbjct giqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfnaipglgt  941
DSSP  hhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhhlllllh


DSSP  -----llllllllllllleeeellllleeeeeelleeeeelleelllllllll
Query -----tgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                                      
Sbjct nvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 56: Query=1onxA Sbjct=1bksA Z-score=6.7

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ----------------------------------------------meryenlfaqlndr   14
DSSP  ----------------------------------------------lhhhhhhhhhhhhl


DSSP  eeleeEEEELLLLllllllhhhllLLLL-HHHHHHLLEEEEEELLllLLLL---------
Query cpgfiDQHVHLIGgggeagpttrtPEVA-LSRLTEAGVTSVVGLLgtDSIS---------  110
ident         | |                     |  ||                       
Sbjct regafVPFVTLGD-------pgieQSLKiIDTLIDAGADALELGV--PFSDpladgptiq   65
DSSP  llleeEEEEELLL-------llhhHHHHhHHHHHHLLLLLEEEEL--LLLLlllllhhhh


DSSP  ----------LLHHHHHHHHHHHHHHL-lEEEEEEEllllLLLLlLLLHHHHHHHL--LL
Query ----------RHPESLLAKTRALNEEG-iSAWMLTGayhvPSRTiTGSVEKDVAII--DR  157
ident             |           |        |                   |      
Sbjct nanlrafaagVTPAQCFEMLALIREKHptIPIGLLM---yANLVfNNGIDAFYARCeqVG  122
DSSP  hhhhhhhhhlLLHHHHHHHHHHHHHHLllLLEEEEE---lHHHHhLLLHHHHHHHHhhHL


DSSP  EEEEEEEelllllllLLHHhHHHHHHHHHHHHhhhlllLEEEEEELLLLL--lLHHHhhh
Query VIGVXCAisdhrsaaPDVYhLANMAAESRVGGllggkpGVTVFHMGDSKK--aLQPIydl  215
ident |  |  |        |     |                    |          |      
Sbjct VDSVLVA------dvPVEE-SAPFRQAALRHN------IAPIFICPPNADddlLRQV---  166
DSSP  LLEEEEL------llLHHH-LHHHHHHHHHLL------LEEEEEELLLLLhhhHHHH---


DSSP  hhlllllHHHE-EEELHhhlHHHHHHHHHHHHLLL-LEEEE-LLLLlllLHHHHHHHHhh
Query lencdvpISKL-LPTHVnrnVPLFEQALEFARKGG-TIDIT-SSIDepvAPAEGIARAvq  272
ident                      ||                                     
Sbjct ------aSYGRgYTYLL--aLPLHHLIEKLKEYHAaPALQGfGISS-peQVSAAVRAG--  215
DSSP  ------hHHLLlLEEEL--lLLHHHHHHHHHHHLLlLEEELlLLLL-hhHHHHHHHHL--


DSSP  llllhhhEEEELLL-LLEE--eeellllleeeeeellLHHHHHHHHhhhhhhlllhhhhh
Query agiplarVTLSSDG-NGSQ--pffddegnlthigvagFETLLETVQvlvkdydfsisdal  329
ident            |                                                
Sbjct ------aAGAISGSaIVKIieknlaspkqmlaelrsfVSAMKAASR--------------  255
DSSP  ------lLEEEELLhHHHHhhhllllhhhhhhhhhhhHHHHHHLLL--------------


DSSP  hhhlhhhhhhlllllllllllllllleeeellllleeeeeelleeeeelleellllllll
Query rpltssvagflnltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet  389
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  l
Query d  390
ident  
Sbjct -  255
DSSP  -


No 57: Query=1onxA Sbjct=2anuA Z-score=6.0

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct -----------------------------------------------------------t    1
DSSP  -----------------------------------------------------------l


DSSP  EELEEEEEELlLLLLLlllhhhlLLLL--LHHHHHHLLEEEEEELLLL------------
Query CPGFIDQHVHlIGGGGeagpttrTPEV--ALSRLTEAGVTSVVGLLGT------------  106
ident      | |||                           ||  |                  
Sbjct EWLLCDFHVH-TNXSD------gHLPLgeVVDLFGKHGVDVVSITDHIvdrrtleqrkrn   54
DSSP  EEEEEEEEEL-LLLLL------lLLLHhhHHHHHHHLLLLEEEEEEEEelhhhhhhhhhl


DSSP  -----LLLL----lLHHHHHHHHHHHHHH-LLEEEEEEeLLLLllllllllhhhhhhhll
Query -----DSIS----rHPESLLAKTRALNEE-GISAWMLTgAYHVpsrtitgsvekdvaiid  156
ident                   |        || |                             
Sbjct geplgAITEdkfqdYLKRLWREQKRAWEEyGXILIPGV-EITN-----------------   96
DSSP  lllllLLLLllhhhHHHHHHHHHHHHHHHhLLEEEEEE-EEEE-----------------


DSSP  leeeeeeeellllLLLL-------------lhHHHHHHHHHHHHHHhhhlllLEEEEEEL
Query rvigvxcaisdhrSAAP-------------dvYHLANMAAESRVGGllggkpGVTVFHMG  203
ident                                                             
Sbjct -------------NTDLyhivavdvkeyvdpsLPVEEIVEKLKEQN------ALVIAAHP  137
DSSP  -------------LLLLeeeeeelllllllllLLHHHHHHHHHHLL------LEEEELLL


DSSP  ---lLLLL-LHHHHHHHhlllllHHHEEEELHhhlhhhHHHHHHHHhllLLEEEelllll
Query ---dSKKA-LQPIYDLLencdvpISKLLPTHVnrnvplFEQALEFArkgGTIDItsside  259
ident                                       |                     
Sbjct drkkLSWYlWANXERFK------DTFDAWEIA-nrddlFNSVGVKK---YRYVA------  181
DSSP  llllLLLHhHHLLLLLL------LLLLEEEEE-elleeLHHHHHLL---LLEEE------


DSSP  lllhhhhhhhhhhllllhhheeeELLLLleeeeellllleeeeeELLLHHHhhhhhhhhh
Query pvapaegiaravqagiplarvtlSSDGNgsqpffddegnlthigVAGFETLletvqvlvk  319
ident                         ||                                  
Sbjct -----------------------NSDFH---------------eLWHVYSW---------  194
DSSP  -----------------------ELLLL---------------lHHHHLLE---------


DSSP  hhlllhhhhhhhHLHH---hhHHLLLllllllllllllleeeellllleeeeeelleeee
Query dydfsisdalrpLTSS---vaGFLNLtgkgeilpgndadllvmtpelrieqvyargklmv  376
ident             |  |                                            
Sbjct ----------ktLVKSeknieAIKEA----------------------------------  210
DSSP  ----------eeEEEElllhhHHHHH----------------------------------


DSSP  elleelllllllll
Query kdgkacvkgtfetd  390
ident               
Sbjct irkntdvaiylxrk  224
DSSP  hhhllleeeeelll


No 58: Query=1onxA Sbjct=3e38A Z-score=6.0

back to top
DSSP  llllhhhlleeeeeeeeeLLLEEeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyAPEDRgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                      |                                      
Sbjct ---------aqrrneiqvPDLDG------------------------------------y   15
DSSP  ---------lllllllllLLLLL------------------------------------l


DSSP  EELEEEEEELlLLLLllllhhhlLLLLL--HHHHHHLLEEEEEELLL--LLLLL----LL
Query CPGFIDQHVHlIGGGgeagpttrTPEVA--LSRLTEAGVTSVVGLLG--TDSIS----RH  112
ident      | | |                           |                      
Sbjct TTLKCDFHXH-SVFS------dgLVWPTvrVDEAYRDGLDAISLTEHieYRPHKqdvvSD   68
DSSP  EEEEEELLLL-LLLL------llLLLHHhhHHHHHHLLLLEELLEEEllLLLLLllllLL


DSSP  HHHHHHHHHHHHHHL-LEEEEEEellllllllllllhhhhhhhllleeeeEEEELL----
Query PESLLAKTRALNEEG-ISAWMLTgayhvpsrtitgsvekdvaiidrvigvXCAISD----  167
ident         |   |   |                                           
Sbjct HNRSFDLCREQAEKLgILLIKGS---------------------------EITRAXapgh  101
DSSP  LLHHHHHHHHHHHHHlLEELLEE---------------------------EEELLLllle


DSSP  ------lllllllhHHHHHHHHHHHHHhhhhllLLEEeeeelllllllhhhhhhhhllll
Query ------hrsaapdvYHLANMAAESRVGgllggkPGVTvfhmgdskkalqpiydllencdv  221
ident                       |                                     
Sbjct fnaiflsdsnpleqKDYKDAFREAKKQ------GAFX-----------------------  132
DSSP  eeeelllllhhhllLLHHHHHHHHHHL------LLEE-----------------------


DSSP  lhhheEEELHHHL---HHHHHH-----hhhhhhllLLEE-EELLLlllllHHHHHHHHHh
Query pisklLPTHVNRN---VPLFEQ-----alefarkgGTID-ITSSIdepvaPAEGIARAVq  272
ident         |                            |                      
Sbjct -----FWNHPGWDsqqPDTTKWwpehtalyqegcxHGIEvANGHL-----YXPEAIQWC-  181
DSSP  -----EELLLLLLlllLLLLLLlhhhhhhhhllllLEEEeEELLE-----ELLHHHHHH-


DSSP  LLLLhhHEEEELLLLleeeeellllleeeeeeLLLHhhhhhhhhhhhhhlllhhhhhhHH
Query AGIPlaRVTLSSDGNgsqpffddegnlthigvAGFEtlletvqvlvkdydfsisdalrPL  332
ident            ||                                               
Sbjct LDKN-lTXIGTSDIH-----------------QPIQ---------tdydfekgehrtxTF  214
DSSP  HHHL-lEEEEELLLL-----------------LLHH---------hhllhhhllllleEE


DSSP  LHhhhhhllLLLL-----------------------------------llllllllllee
Query TSsvagflnLTGK-----------------------------------geilpgndadll  357
ident          | |                                                
Sbjct VF--akersLQGIrealdnrrtaayfhelligredllrpffekcvkieevsrneqgvtls  272
DSSP  EE--ellllHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeee


DSSP  eeLLLLL-------------------------------------eeeeeelleeeeelle
Query vmTPELR-------------------------------------ieqvyargklmvkdgk  380
ident                                                             
Sbjct itNVTDLvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivap  332
DSSP  eeELLLLleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeel


DSSP  elllllllll
Query acvkgtfetd  390
ident           
Sbjct dkglkytisl  342
DSSP  leeeeeeeel


No 59: Query=1onxA Sbjct=2yb1A Z-score=6.0

back to top
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee
Query midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  eelEEEEEELLLLLLllllhhhlLLLL--LHHHHHHLLEEEEEELLLllllllLHHHHHH
Query cpgFIDQHVHLIGGGgeagpttrTPEV--ALSRLTEAGVTSVVGLLGtdsisrHPESLLA  118
ident     || | |                      |                        |  
Sbjct --aNIDLHFHSRTSD-------gALTPteVIDRAAARAPALLALTDH-----dCTGGLAE   46
DSSP  --lLEELLLLLLLLL-------lLLLHhhHHHHHHLLLLLEEEELLL-----lLLLLHHH


DSSP  HHHHHHHHLLEEEEEEeLLLLL----lllllllhhhHHHH--------------------
Query KTRALNEEGISAWMLTgAYHVP----srtitgsvekDVAI--------------------  154
ident    |    ||          |                                       
Sbjct AAAAAARRGIPFLNGV-EVSVSwgrhtvhivglgidPAEPalaaglksiregrlerarqm  105
DSSP  HHHHHHHLLLLEEEEE-EEEEEelleeeeeeeelllLLLHhhhhhhhhhhllhhhhhhhh


DSSP  -------------------------------------------llleeeeeeeellllll
Query -------------------------------------------idrvigvxcaisdhrsa  171
ident                                                             
Sbjct gasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyv  165
DSSP  hhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllll


DSSP  lllhhHHHHHHHHHHHHHhhhlllLEEEEEE--LLLL---LLLHHHHHHHHlllllhhHE
Query apdvyHLANMAAESRVGGllggkpGVTVFHM--GDSK---KALQPIYDLLEncdvpisKL  226
ident       |          |      |  |                 | |            
Sbjct shqwaSLEDAVGWIVGAG------GMAVIAHpgRYDMgrtLIERLILDFQA-----agGQ  214
DSSP  lllllLHHHHHHHHHHLL------LEEEELLhhHLLLlhhHHHHHHHHHHH-----llLL


DSSP  EEEL---hHHLHHHHHHHHHHHHLLLLEEeellllllllhhhhhhhhhhllllhhheeEE
Query LPTH---vNRNVPLFEQALEFARKGGTIDitssidepvapaegiaravqagiplarvtLS  283
ident                  ||   | |                                   
Sbjct GIEVasgsHSLDDMHKFALHADRHGLYAS-----------------------------SG  245
DSSP  EEEEeellLLHHHHHHHHHHHHHHLLEEE-----------------------------EE


DSSP  LLLLleeeeellllleeeeEELLLhhhhhhhhhhhhhhlllhhhhhhhhlhHHHHHLLLl
Query SDGNgsqpffddegnlthiGVAGFetlletvqvlvkdydfsisdalrpltsSVAGFLNLt  343
ident ||                                                      |   
Sbjct SDFH--------------aPGEDV----------------ghtedlppicrPIWRELEA-  274
DSSP  LLLL--------------lLLLLL----------------lllllllllllLHHHHLHH-


DSSP  lllllllLLLLleeeellllleeeeeelleeeeelleelllllllll
Query gkgeilpGNDAdllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
ident                                                
Sbjct -rilrpaDAEN------------------------------------  284
DSSP  -hlllllHHHL------------------------------------