Results: dupa

Query: 1m65A

MOLECULE: HYPOTHETICAL PROTEIN YCDX;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1m65-A 47.8  0.0  234   234  100 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
   2:  3au2-A 27.3  2.0  218   575   27 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
   3:  3dcp-A 17.3  2.5  187   277   14 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
   4:  1v77-A 14.5  2.9  174   202   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
   5:  3qy6-A 12.9  3.6  189   247   19 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
   6:  2vun-A 11.1  3.5  183   385   17 PDB  MOLECULE: ENAMIDASE;                                                 
   7:  2oof-A 11.0  3.6  187   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   8:  2yb1-A 10.4  3.4  157   284   23 PDB  MOLECULE: AMIDOHYDROLASE;                                            
   9:  3mtw-A 10.3  3.7  180   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  10:  3irs-A 10.3  3.4  196   281    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  11:  3mkv-A 10.2  3.7  173   414   17 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  12:  4c5y-A 10.1  3.3  181   436   13 PDB  MOLECULE: OCHRATOXINASE;                                             
  13:  2anu-A  9.9  3.3  157   224   17 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  14:  2y1h-B  9.8  3.4  166   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  15:  3f2b-A  9.7  3.4  160   994   21 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  16:  3gg7-A  9.5  3.2  158   243    8 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  17:  3cjp-A  9.4  3.3  177   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  18:  1k6w-A  9.4  3.9  183   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  19:  1bf6-A  9.4  4.0  177   291   10 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  20:  4cqb-A  9.2  3.9  186   402   12 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  21:  4mup-B  9.0  3.5  169   286   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  22:  2ffi-A  9.0  3.4  169   273   12 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  23:  2paj-A  8.9  3.6  177   421    7 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  24:  1yrr-B  8.9  3.6  180   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  25:  3e38-A  8.9  3.6  157   342   15 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  26:  4dlf-A  8.9  3.4  165   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  27:  1gkp-A  8.8  3.5  182   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  28:  4hk5-D  8.7  3.6  172   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  29:  3gri-A  8.6  3.4  177   422   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  3nqb-A  8.4  3.5  170   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  31:  4b3z-D  8.3  3.5  172   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  32:  2ob3-A  8.3  3.5  173   329    9 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  33:  1onx-A  8.2  3.9  192   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  34:  3k2g-B  8.2  4.0  183   358   15 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  35:  2dvt-A  8.2  3.6  170   325    9 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  36:  1itq-A  8.2  3.7  184   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  37:  2imr-A  8.1  3.3  170   380   16 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  38:  1j6p-A  7.9  3.8  190   407   11 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  39:  3ls9-A  7.9  3.8  180   453   12 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  40:  2uz9-A  7.8  4.1  176   444   11 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  41:  4rdv-B  7.8  3.6  181   451   13 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  42:  4ofc-A  7.7  3.7  178   335   11 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  43:  2vc5-A  7.7  4.0  167   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  44:  2ogj-A  7.6  3.7  177   379   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  45:  1a4m-A  7.6  3.5  174   349    8 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  46:  3icj-A  7.5  3.8  163   468   10 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  47:  2gwg-A  7.5  3.5  172   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  48:  1a5k-C  7.3  3.3  168   566    9 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  49:  3ooq-A  7.3  3.7  162   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  50:  3pnu-A  7.3  3.6  167   338   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  51:  3giq-A  7.2  3.7  174   475   15 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  52:  3e74-A  7.1  3.5  167   429    9 PDB  MOLECULE: ALLANTOINASE;                                              
  53:  2qpx-A  7.0  3.9  176   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  54:  3iac-A  6.4  3.5  167   469   11 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  55:  1j5s-A  6.1  3.8  172   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  56:  4qrn-A  5.8  4.0  160   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  57:  4dzi-C  5.7  3.7  160   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  58:  2a3l-A  5.7  3.7  167   616    7 PDB  MOLECULE: AMP DEAMINASE;                                             
  59:  1bks-A  5.7  3.6  141   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1m65A Sbjct=1m65A Z-score=47.8

back to top
DSSP  LLEELLLLLLLLLLLLLLHHHHHHHHHHHLLLEEEEEEELLLLLLLLLLHHHHHHHHLLL
Query YPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHFINMRIWPR   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHFINMRIWPR   60
DSSP  LLEELLLLLLLLLLLLLLHHHHHHHHHHHLLLEEEEEEELLLLLLLLLLHHHHHHHHLLL


DSSP  EELLEEEEEEEEEELLLLLLLLLLLHHHHHHLLEEEEELLLLLLLLLLHHHHHHHHHHHH
Query VVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIATI  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIATI  120
DSSP  EELLEEEEEEEEEELLLLLLLLLLLHHHHHHLLEEEEELLLLLLLLLLHHHHHHHHHHHH


DSSP  HLLLLLEELLLLLLLLLLLHHHHHHHHHHHLLEEEEELLLLHHHHHHHHHHHLLLEEEEL
Query ASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSNCREVAAAVRDAGGWVALGS  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINNSSNCREVAAAVRDAGGWVALGS  180
DSSP  HLLLLLEELLLLLLLLLLLHHHHHHHHHHHLLEEEEELLLLHHHHHHHHHHHLLLEEEEL


DSSP  LLLLHHHLLLLHHHHHHHHHLLLLHHHLHHHLHHHHHHHHHHLLLLLLHHHLLL
Query DSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL  234
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DSHTAFTMGEFEECLKILDAVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL  234
DSSP  LLLLHHHLLLLHHHHHHHHHLLLLHHHLHHHLHHHHHHHHHHLLLLLLHHHLLL


No 2: Query=1m65A Sbjct=3au2A Z-score=27.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------------LLEELLLLLLLLlLLLLLHHHHHH
Query ------------------------------------YPVDLHMHTVAStHAYSTLSDYIA   24
ident                                        ||  |   |     ||     
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqVKGDLQVHSTYS-DGQNTLEELWE  359
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhLLEEEEELLLLL-LLLLLHHHHHH


DSSP  HHHHHLLLEEEEEEELLLLLL--LLLLHHHHHHHH--LLLE--ELLEEEEEEEEEELLLl
Query QAKQKGIKLFAITDHGPDMED--APHHWHFINMRI--WPRV--VDGVGILRGIEANIKNv   78
ident  ||  |    | ||| |       |                        | | |  |   
Sbjct AAKTMGYRYLAVTDHSPAVRVagGPSPEEALKRVGeiRRFNetHGPPYLLAGAEVDIHP-  418
DSSP  HHHHHLLLEEEEEEELHHHHLllLLLHHHHHHHHHhhHHHHhhHLLLEEEEEEEEELLL-


DSSP  LLLLLLLHHHHHHLLEEEEELLlllLLLL-LHHHHHHHHHHHHHLLLLLEELLLLLL---
Query DGEIDCSGKMFDSLDLIIAGFHepvFAPH-DKATNTQAMIATIASGNVHIISHPGNP---  134
ident ||  |        |||     |         ||  |           ||   ||      
Sbjct DGTLDYPDWVLRELDLVLVSVH---SRFNlPKADQTKRLLKALENPFVHVLAHPTARllg  475
DSSP  LLLLLLLHHHHLLLLEEEEELL---LLLLlLHHHHHHHHHHHHLLLLLLEELLLLLLlll


DSSP  ---LLLLLHHHHHHHHHHHLLEEEEELLL----lHHHHHHHHHHHLLLEEEELLLLLHHH
Query ---KYEIDVKAVAEAAAKHQVALEINNSS----nCREVAAAVRDAGGWVALGSDSHTAFT  187
ident      | |  ||   |    || ||             |      | |  |  | |    
Sbjct rraPIEADWEAVFQKAKEKGVAVEIDGYYdrmdlPDDLARMAYGMGLWISLSTDAHQTDH  535
DSSP  lllLLLLLHHHHHHHHHHHLLEEEEELLLlllllLHHHHHHHHHLLLLEEEELLLLLHHH


DSSP  LLLLHHHHHHHHHLLLLHHHLHHHL-HHHHHHHHHHLLllllhhhlll
Query MGEFEECLKILDAVDFPPERILNVS-PRRLLNFLESRGmapiaefadl  234
ident     |            ||| ||      ||  |  |           
Sbjct LRFMELAVGTAQRAWIGPERVLNTLdYEDLLSWLKARR--------gv  575
DSSP  HHHHHHHHHHHHHLLLLLLLLHHHLlHHHHHHHHHLLL--------ll


No 3: Query=1m65A Sbjct=3dcpA Z-score=17.3

back to top
DSSP  LLEELLLLLLLLLLLL-LLHHHHHHHHHHHLLLEEEEEEELLL---------------lL
Query YPVDLHMHTVASTHAY-STLSDYIAQAKQKGIKLFAITDHGPD---------------mE   44
ident    | | ||    |            |         |  | |                  
Sbjct XKRDGHTHTEFCPHGThDDVEEXVLKAIELDFDEYSIVEHAPLssefxkntagdkeavtT   60
DSSP  LLEEEEELLLLLLLLLlLLHHHHHHHHHHLLLLEEEEEEELLLlhhhhhllllllhhhhL


DSSP  LLLLLHHHHHHHH--LLLE---ELLEEEEEEEEEELLLL--lllllLLHHHHHHLLEEEE
Query DAPHHWHFINMRI--WPRV---VDGVGILRGIEANIKNV--dgeidCSGKMFDSLDLIIA   97
ident                            |  | |                      |    
Sbjct ASXAXSDLPYYFKkxNHIKkkyASDLLIHIGFEVDYLIGyedftrdFLNEYGPQTDDGVL  120
DSSP  LLLLHHHHHHHHHhhHHHHhhlLLLLEEEEEEEEELLLLlhhhhhhHHHHHHHHLLEEEE


DSSP  ELLlllLLLL---------------------------LHHHHHHHHHHHHHLL----LLL
Query GFHepvFAPH---------------------------DKATNTQAMIATIASG----NVH  126
ident   |   |                                          |          
Sbjct SLH---FLEGqggfrsidfsaedynegivqfyggfeqAQLAYLEGVKQSIEADlglfKPR  177
DSSP  ELL---EEEElleeeellllhhhhhhhlhhhhllhhhHHHHHHHHHHHHHHLLllllLLL


DSSP  EELLLLLLL----------------lllLHHHHHHHHHHHLLEEEEELLL----------
Query IISHPGNPK----------------yeiDVKAVAEAAAKHQVALEINNSS----------  160
ident    |                                  |    |  |             
Sbjct RXGHISLCQkfqqffgedtsdfseevxeKFRVILALVKKRDYELDFNTAGlfkplcgety  237
DSSP  EELLLLHHHllhhhhlllhhhllhhhhhHHHHHHHHHHHHLLEEEEELHHhhllllllll


DSSP  LHHHHHHHHHHHLLLEEEELLLLLHHHLLL-LHHHHHHHHhllllhhhlhhhlhhhhhhh
Query NCREVAAAVRDAGGWVALGSDSHTAFTMGE-FEECLKILDavdfpperilnvsprrllnf  219
ident                   |||||     |         |                     
Sbjct PPKKIVTLASELQIPFVYGSDSHGVQDIGRgYSTYCQKLE--------------------  277
DSSP  LLHHHHHHHHHLLLLEEEELLLLLHHHLLLlHHHHHHHLL--------------------


DSSP  hhhllllllhhhlll
Query lesrgmapiaefadl  234
ident                
Sbjct ---------------  277
DSSP  ---------------


No 4: Query=1m65A Sbjct=1v77A Z-score=14.5

back to top
DSSP  -lLEELLLLLlllllllllhHHHHHHHHhHLLLEEEEEEELLLLllllLLHHHHHHHHLl
Query -yPVDLHMHTvasthaystlSDYIAQAKqKGIKLFAITDHGPDMedapHHWHFINMRIWp   59
ident                           ||                            |   
Sbjct vkFIEMDIRD----------KEAYELAK-EWFDEVVVSIKFNEE---vDKEKLREARKE-   45
DSSP  llLEEEEELL----------HHHHHHHH-HHLLEEEEEEEELLL---lLHHHHHHHHHH-


DSSP  leelleeEEEEEEEELLLlLLLL--LLLHhhHHHLlEEEEELlllllllllhhhHHHHHH
Query rvvdgvgILRGIEANIKNvDGEI--DCSGkmFDSLdLIIAGFhepvfaphdkatNTQAMI  117
ident            |                   | |  ||                      
Sbjct ------yGKVAILLSNPK-PSLVrdTVQK--FKSY-LIYVES-----------nDLRVIR   84
DSSP  ------hLLEEEEEELLL-HHHHhhHHHH--LLLL-EEEEEL-----------lLHHHHH


DSSP  HHHHLLlLLEELLLLLLLLL-LLHHHHHHHHHHHLLEEEEELLL--------------LH
Query ATIASGnVHIISHPGNPKYE-IDVKAVAEAAAKHQVALEINNSS--------------NC  162
ident   |  | |  |  |             |    |  |||                      
Sbjct YSIEKG-VDAIISPWVNRKDpGIDHVLAKLMVKKNVALGFSLRPllysnpyeranllrFM  143
DSSP  HHHHLL-LLEEELLLLLLLLlLLLHHHHHHHHHHLLEEEEELHHhhhllhhhhhhhhhHH


DSSP  HHHHHHHHHHLLLEEEELLLLLHHHLL----LLHHHHHHHhhllLLHHH--LHHHLhhHH
Query REVAAAVRDAGGWVALGSDSHTAFTMG----EFEECLKILdavdFPPER--ILNVSprRL  216
ident       |        | |                    |                     
Sbjct MKAWKLVEKYKVRRFLTSSAQEKWDVRyprdLISLGVVIG----MEIPQakASISM--YP  197
DSSP  HHHHHHHHHHLLLEEEELLLLLHHHLLlhhhHHHHHHHLL----LLHHHhhHLLLH--HH


DSSP  HHHHHhllllllhhhlll
Query LNFLEsrgmapiaefadl  234
ident    |              
Sbjct EIILK-------------  202
DSSP  HHHHL-------------


No 5: Query=1m65A Sbjct=3qy6A Z-score=12.9

back to top
DSSP  lLEELLLL--LLLLlLLLL---LHHHHHHHHHHHLLLEEEEEEELLLlLLLLLlhHHHH-
Query yPVDLHMH--TVAStHAYS---TLSDYIAQAKQKGIKLFAITDHGPDmEDAPHhwHFIN-   54
ident    | | |                      |   ||     | |                
Sbjct -MIDIHCHilPAMD-DGAGdsaDSIEMARAAVRQGIRTIIATPHHNN-GVYKN--EPAAv   55
DSSP  -LEELLLLllLLLL-LLLLlhhHHHHHHHHHHHLLLLEEELLLEELL-LLLLL--LHHHh


DSSP  HHHL--LLEE-----LLEEEEEEEEEELLLllllllLLHHHhhHLLE-----EEEELLLl
Query MRIW--PRVV-----DGVGILRGIEANIKNvdgeidCSGKMfdSLDL-----IIAGFHEp  102
ident                     | | |  |                | |     |   |   
Sbjct REAAdqLNKRlikedIPLHVLPGQEIRIYG-eveqdLAKRQ--LLSLndtkyILIEFPF-  111
DSSP  HHHHhhHHHHhhhllLLLEEELLLEEELLL-lhhhhHHLLL--LLLHhhlleEEEELLL-


DSSP  llllllhhhHHHHHHHHHHLL----LLLEELLLLLlLLLL--LHHHHHHHHHHHlLEEEE
Query vfaphdkatNTQAMIATIASG----NVHIISHPGNpKYEI--DVKAVAEAAAKHqVALEI  156
ident                              | ||     ||            |   |  |
Sbjct -------dhVPRYAEQLFYDLqlkgYIPVIAHPER-NREIreNPSLLYHLVEKG-AASQI  162
DSSP  -------llLLLLHHHHHHHHhhllLEEEEELHHH-LHHHhhLLHHHHHHHHLL-LEEEE


DSSP  ELLL-----------LHHHHHHHHhhhllLEEEELLLLLHH-HLLLLHHHHHHHHHLL--
Query NNSS-----------NCREVAAAVrdaggWVALGSDSHTAF-TMGEFEECLKILDAVD--  202
ident    |                  |           || |          | |  |      
Sbjct TSGSlagifgkqlkaFSLRLVEAN----lIHFVASDAHNVKtRNFHTQEALYVLEKEFgs  218
DSSP  EHHHhlllllhhhhhHHHHHHHLL----lLLEEELLLLLLLlLLLLHHHHHHHHHHHHll


DSSP  -LLHHH-LHHHlhhHHHHhHHHLlllllhhhlll
Query -FPPER-ILNVsprRLLNfLESRgmapiaefadl  234
ident   |            ||                 
Sbjct eLPYMLtENAE---LLLR-NQTI-frqppqpvkr  247
DSSP  hHHHHHhHHHH---HHHL-LLLL-llllllllll


No 6: Query=1m65A Sbjct=2vunA Z-score=11.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  lLEELLLLLL---llLLLLLLhhHHHHHHHHHLLLEEEEEEE----llllllllLLHHHH
Query yPVDLHMHTV---asTHAYSTlsDYIAQAKQKGIKLFAITDH----gpdmedapHHWHFI   53
ident    | | |               | |  |   |                          |
Sbjct gLLDTHVHVSggdyaPRQKTM--DFISSALHGGVTTMISAGSphfpgrpkdaagTKALAI  118
DSSP  lEEEEEELLLllleeHHHLEE--LHHHHHHLLLEEEEEELLLlllllllllhhhHHHHHH


DSSP  H-HHHLL-LEELLEEEEE------------------------eEEEE---lLLLL----l
Query N-MRIWP-RVVDGVGILR------------------------gIEAN---iKNVD----g   80
ident             ||                              |      ||       
Sbjct TlSKSYYnARPAGVKVHGgavilekglteedfiemkkegvwivGEVGlgtiKNPEdaapm  178
DSSP  HhHHHHHhLLHHHLEEELleelllllllhhhhhhhhhlllleeEEELllllLLHHhhhhh


DSSP  lllLLHHHHhhllEEEEEL-LLLLlllllhhhHHHHHHHHHhlllLLEELLLLL--lLLL
Query eidCSGKMFdsldLIIAGF-HEPVfaphdkatNTQAMIATIasgnVHIISHPGN--pKYE  137
ident         |                            | |         ||         
Sbjct vewAHKHGF----KVQMHTgGTSI--pgsstvTADDVIKTK----PDVVSHINGgptAIS  228
DSSP  hhhHHHLLL----EEEEELlLLLL--llllllLHHHHHHHL----LLEEELLLLlllLLL


DSSP  L-LHHHHHHHhhhHLLEEEEELLL---LHHHHHHHHHHHLL--LEEEELLLLL--hHHLL
Query I-DVKAVAEAaakHQVALEINNSS---NCREVAAAVRDAGG--WVALGSDSHT--aFTMG  189
ident    |            | ||           ||      |    |  | |          
Sbjct VqEVDRIMDE---TDFAMEIVQCGnpkIADYVARRAAEKGQlgRVIFGNDAPSgtgLIPL  285
DSSP  HhHHHHHHHH---LLLEEEEELLLlhhHHHHHHHHHHHHLLhhHEEEELLLLLlllLLLL


DSSP  LLHHHHHHHH-HLLLLHHH--LHHHLhhHHHHHHHhllllllhhHLLL------------
Query EFEECLKILD-AVDFPPER--ILNVSprRLLNFLEsrgmapiaeFADL------------  234
ident              |  ||                                          
Sbjct GILRNMCQIAsMSDIDPEVavCMATG--NSTAVYGlntgviapgKEADliimdtplgsva  343
DSSP  HHHHHHHHHHhHLLLLHHHhhHHHLH--HHHHHHLlllllllllLLLLeeeeelllllll


DSSP  ------------------------------------------
Query ------------------------------------------  234
ident                                           
Sbjct edamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  llhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 7: Query=1m65A Sbjct=2oofA Z-score=11.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  --lLEELLL-LLLL-------------------------LLLL------------llLHH
Query --yPVDLHM-HTVA-------------------------STHA------------ysTLS   20
ident      | |     |                                              
Sbjct tpgLIDCHThLIFAgsraeefelrqkgvpyaeiarkgggIISTvratraasedqlfeLAL  120
DSSP  eelEEEEEElLLLLlllhhhhhhhhhlllhhhhhhllllHHHHhhhhhhllhhhhhhHHH


DSSP  HHHHHHHHHLLLEEEEEEEllllllLLLL-HHHHHHHH--LLLE-ELLEEEEEEEEEE--
Query DYIAQAKQKGIKLFAITDHgpdmedAPHH-WHFINMRI--WPRV-VDGVGILRGIEAN--   74
ident          |     |                                        |   
Sbjct PRVKSLIREGVTTVEIKSG------YGLTlEDELKXLRvaRRLGeALPIRVKTTLLAAha  174
DSSP  HHHHHHHHHLEEEEEEELL------LLLLhHHHHHHHHhhHHHHhHLLLEEEEEEEEEll


DSSP  ----------lllllllllLLHHHH--HHLLEEEEELLLLLLLLL---------------
Query ----------iknvdgeidCSGKMF--DSLDLIIAGFHEPVFAPH---------------  107
ident                               |          |                  
Sbjct vppeyrddpdswveticqeIIPAAAeaGLADAVDVFCEHIGFSLAqteqvylaadqygla  234
DSSP  llhhhlllhhhhhhhhhhlHHHHHHhlLLLLEEEEEELLLLLLHHhhhhhhhhhhhllle


DSSP  -----lhhhHHHHHHHHHHLLlLLEELLLLlllllLLHHHHHHHHHHHLLEEEEELLL--
Query -----dkatNTQAMIATIASGnVHIISHPGnpkyeIDVKAVAEAAAKHQVALEINNSS--  160
ident          |          |      |               | |   |          
Sbjct vkghxdqlsNLGGSTLAANFG-ALSVDHLE-----YLDPEGIQALAHRGVVATLLPTAfy  288
DSSP  eeeeellllLLLHHHHHHHLL-LLEEEELL-----LLLHHHHHHHHHHLLEEEELHHHhh


DSSP  -----LHHHhHHHHHHHLLLEEEELLLLL---hHHLLL--LHHHHHHHHhllLLHHH--L
Query -----NCREvAAAVRDAGGWVALGSDSHT---aFTMGE--FEECLKILDavdFPPER--I  208
ident             | | ||   |  ||                            |     
Sbjct flketKLPP-VVALRKAGVPXAVSSDINPgtapIVSLRxaXNXACTLFG---LTPVEaxA  344
DSSP  hllllLLLL-HHHHHHLLLLEEELLLLLLllllLLLHHhhHHHHHHHHL---LLHHHhhH


DSSP  HHHL--hhhHHHHhhhllllllhhHLLL--------------------------------
Query LNVS--prrLLNFlesrgmapiaeFADL--------------------------------  234
ident          |                                                  
Sbjct GVTRhaaraLGEQ--eqlgqlrvgXLADflvwncghpaelsyligvdqlvsrvvngeetl  402
DSSP  HLLHhhhhhLLLL--lllllllllLLLLeeeellllllhhhhlllllleeeeeelleell


DSSP  -
Query -  234
ident  
Sbjct h  403
DSSP  l


No 8: Query=1m65A Sbjct=2yb1A Z-score=10.4

back to top
DSSP  LLEELLLLLLLLlLLLLLHHHHHHHHHHHLLLEEEEEEELlllllllllhhHHHHHHL--
Query YPVDLHMHTVAStHAYSTLSDYIAQAKQKGIKLFAITDHGpdmedaphhwhFINMRIW--   58
ident    ||| |   |     |    |  |      | | |||                     
Sbjct ANIDLHFHSRTS-DGALTPTEVIDRAAARAPALLALTDHD-----------CTGGLAEaa   48
DSSP  LLEELLLLLLLL-LLLLLHHHHHHHHHLLLLLEEEELLLL-----------LLLLHHHhh


DSSP  -llEELLEEEEEEEEEELLLLL------------llllLLHHH-----------------
Query -prVVDGVGILRGIEANIKNVD------------geidCSGKM-----------------   88
ident       |   | | |                                             
Sbjct aaaARRGIPFLNGVEVSVSWGRhtvhivglgidpaepaLAAGLksiregrlerarqmgas  108
DSSP  hhhHHLLLLEEEEEEEEEEELLeeeeeeeellllllhhHHHHHhhhhllhhhhhhhhhhh


DSSP  ----------------------------------hhhlleeeeellllllllllhhhhhh
Query ----------------------------------fdsldliiagfhepvfaphdkatntq  114
ident                                                             
Sbjct leaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshq  168
DSSP  hhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhlllllllllllll


DSSP  hhhhhhhLLLL------LEELLLLLLlLLLL--HHHHHHHHHH-HLLEEEE-ELLL---L
Query amiatiaSGNV------HIISHPGNPkYEID--VKAVAEAAAK-HQVALEI-NNSS---N  161
ident         |          | |||                         |    |     
Sbjct wasledaVGWIvgaggmAVIAHPGRY-DMGRtlIERLILDFQAaGGQGIEVaSGSHsldD  227
DSSP  lllhhhhHHHHhhllleEEELLHHHL-LLLHhhHHHHHHHHHHlLLLEEEEeELLLlhhH


DSSP  HHHHHHHHHHHLLLEEEELLLLL-hhHLLLLHHHhhhHHHLlllhhHLHHHlhhHHHHhh
Query CREVAAAVRDAGGWVALGSDSHT-afTMGEFEEClkiLDAVdfppeRILNVsprRLLNfl  220
ident     |      |     ||| |      |  |              |        |    
Sbjct MHKFALHADRHGLYASSGSDFHApgeDVGHTEDL---PPIC-----RPIWR---ELEA--  274
DSSP  HHHHHHHHHHHLLEEEEELLLLLlllLLLLLLLL---LLLL-----LLHHH---HLHH--


DSSP  hhllllllhHHLL--l
Query esrgmapiaEFAD--l  234
ident            ||   
Sbjct ------rilRPADaen  284
DSSP  ------hllLLLHhhl


No 9: Query=1m65A Sbjct=3mtwA Z-score=10.3

back to top
DSSP  ----------------------------------------------------------lL
Query ----------------------------------------------------------yP    2
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeelE


DSSP  EELLLLLllllLLLL-----------------LHHHHHHHHHHHLLLEEEEEEellllll
Query VDLHMHTvastHAYS-----------------TLSDYIAQAKQKGIKLFAITDhgpdmed   45
ident  | | |                                      |               
Sbjct IDMHVHL----DSLAevggynsleysdrfwsvVQTANAKKTLEAGFTTVRNVG-------  109
DSSP  EEEEELL----LLLLlllhhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELL-------


DSSP  llllhhHHHHhHLLL------eELLEEEEEE-----------------------------
Query aphhwhFINMrIWPR------vVDGVGILRG-----------------------------   70
ident               |       | |  |                                
Sbjct -----aADYDdVGLReaidagyVPGPRIVTAaisfgatgghcdstffppsmdqknpfnsd  164
DSSP  -----lLLLHhHHHHhhhhlllLLLLEEEELllleellllllllllllhhhlllllllll


DSSP  -------------------EEEEL--------------LLLL--LLLL---LLHHHHhhl
Query -------------------IEANI--------------KNVD--GEID---CSGKMFdsl   92
ident                    |                                        
Sbjct spdearkavrtlkkygaqvIXICAtggvfsrgnepgqqQLTYeeMKAVvdeAHMAGI---  221
DSSP  lhhhhhhhhhhhhhlllleEEEELllllllllllllllLLLHhhHHHHhhhHHHLLL---


DSSP  leEEEELlllllllllhhhHHHHHHHHHHLLlLLEELLLLLllllllHHHHHHHHHHHLL
Query dlIIAGFhepvfaphdkatNTQAMIATIASGnVHIISHPGNpkyeidVKAVAEAAAKHQV  152
ident     |                         | |  | |                |     
Sbjct -kVAAHA-----------hGASGIREAVRAG-VDTIEHASL-----vDDEGIKLAVQKGA  263
DSSP  -eEEEEE-----------lLHHHHHHHHHLL-LLEEEELLL-----lLHHHHHHHHHHLL


DSSP  EEEE-ELLL-------------------------LHHHHHHHHHHHLLLEEEELLLL--L
Query ALEI-NNSS-------------------------NCREVAAAVRDAGGWVALGSDSH--T  184
ident                                     ||       ||     | |     
Sbjct YFSMdIYNTdytqaegkkngvlednlrkdrdigeLQRENFRKALKAGVKMVYGTDAGiyP  323
DSSP  EEELlLLLHhhhhhhhhhhlllhhhhhhhhhhhhHHHHHHHHHHHHLLEEELLLLLLllL


DSSP  HHHLLLLHHHHHHHHhllLLHHHL--HHHLhhHHHHHHHhllLLLL-----hhHLLL---
Query AFTMGEFEECLKILDavdFPPERI--LNVSprRLLNFLEsrgMAPI-----aeFADL---  234
ident                     |                |                      
Sbjct HGDNAKQFAVMVRYG---ATPLQAiqSATL--TAAEALG---RSKDvgqvavgRYGDmia  375
DSSP  LLLHHHHHHHHHHLL---LLHHHHhhHLLH--HHHHHHL---LLLLlllllllLLLLeee


DSSP  -----------------------------
Query -----------------------------  234
ident                              
Sbjct vagdpladvttlekpvfvmkggavvkapx  404
DSSP  elllllllhhhhhllleeeelleeeelll


No 10: Query=1m65A Sbjct=3irsA Z-score=10.3

back to top
DSSP  -lLEELLLL-----LLLLLLL----------------------lLLHHHHHHHHHHHLLL
Query -yPVDLHMH-----TVASTHA----------------------ySTLSDYIAQAKQKGIK   32
ident     |                                         |          || 
Sbjct lkIIDFRLRppamgFLNARIYtrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIE   60
DSSP  llLEELLLLlllhhHHHLHHHhlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLL


DSSP  EEEEEEELlLLLL-LLLLHHHHHHHHLLLEelleEEEEEEEEElLLLL-lLLLLLHHHH-
Query LFAITDHGpDMED-APHHWHFINMRIWPRVvdgvGILRGIEANiKNVD-gEIDCSGKMF-   89
ident                                                             
Sbjct QGVCVGRN-SSVLgSVSNADVAAVAKAYPD----KFHPVGSIE-AATRkeAMAQMQEILd  114
DSSP  EEEEELLE-ELLLeELLHHHHHHHHHHLLL----LEEEEEELL-LLLHhhHHHHHHHHHh


DSSP  HHLLEEEEEL-LLLLLLLllhhhHHHHHHHHHHLL----LLLEELLL----llLLLL--L
Query DSLDLIIAGF-HEPVFAPhdkatNTQAMIATIASG----NVHIISHP----gnPKYE--I  138
ident                                 |         |            |    
Sbjct LGIRIVNLEPgVWATPMH----vDDRRLYPLYAFCedngIPVIMMTGgnagpdITYTnpE  170
DSSP  LLLLLEEELHhHLLLLLL----lLLHHHHHHHHHHhhllLLEEEELLllllllHHHHlhH


DSSP  LHHHHHHHHHHHLLEEEEEllLLHHHHHHHHHHHL-LLEEEElllllhhhllLLHH---h
Query DVKAVAEAAAKHQVALEINnsSNCREVAAAVRDAG-GWVALGsdshtaftmgEFEE---c  194
ident     |        |           |                                  
Sbjct HIDRVLGDFPDLTVVSSHGnwPWVQEIIHVAFRRPnLYLSPD----------MYLYnlpg  220
DSSP  HHHHHHHHLLLLLEEEEHHhlLLHHHHHHHHHHLLlEEEELH----------HHHLllll


DSSP  HHHHHHL--LLLHHHLHH----------------------------HLHHHHHHHHHHLL
Query LKILDAV--DFPPERILN----------------------------VSPRRLLNFLESRG  224
ident           |   | |                                      |   |
Sbjct HADFIQAanSFLADRMLFgtaypmcplkeytewfltlpikpdamekILHGNAERLLAQAG  280
DSSP  HHHHHHHhlLHHHHLLLLllllllllhhhhhhhhhlllllhhhhhhHHLHHHHHHHHHLL


DSSP  Llllhhhlll
Query Mapiaefadl  234
ident           
Sbjct R---------  281
DSSP  L---------


No 11: Query=1m65A Sbjct=3mkvA Z-score=10.2

back to top
DSSP  ---------------------------------------------------------lLE
Query ---------------------------------------------------------yPV    3
ident                                                             
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpgLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeelEE


DSSP  ELLLL--LLLLLL----------llllHHHHHHHHHHHLLLEEEEEEellllllllllhh
Query DLHMH--TVASTH----------aystLSDYIAQAKQKGIKLFAITDhgpdmedaphhwh   51
ident ||| |                                 |                     
Sbjct DLHVHvvAIEFNLprvatlpnvlvtlrAVPIMRAMLRRGFTTVRDAG-------------  107
DSSP  EEEELllLLLLLHhhhllllhhhhhhhHHHHHHHHHHLLEEEEEELL-------------


DSSP  hhhHHHL-LLEE----LLEEEEEE------------------------------------
Query finMRIW-PRVV----DGVGILRG------------------------------------   70
ident           |      |                                          
Sbjct -gaGYPFkQAVEsglvEGPRLFVSgralsqtgghadprarsdymppdspcgccvrvgalg  166
DSSP  -llLHHHhHHHHllllLLLEEEELlleeelllllllllllllllllllllllllllllle


DSSP  -----------------------EEEEL--------------LLLL-----llllLLHHH
Query -----------------------IEANI--------------KNVD-----geidCSGKM   88
ident                        |                                 |  
Sbjct rvadgvdevrravreelqmgadqIXIMAsggvasptdpvgvfGYSEdeiraivaeAQGRG  226
DSSP  eelllhhhhhhhhhhhhhhllllEEEELllllllllllllllLLLHhhhhhhhhhHHLLL


DSSP  HhhlleEEEELlllllllllhhhHHHHHHHHHHLLlLLEELLLLLllllllHHHHHHHHH
Query FdsldlIIAGFhepvfaphdkatNTQAMIATIASGnVHIISHPGNpkyeidVKAVAEAAA  148
ident         |                 |       | |  | |             |   |
Sbjct T----yVLAHA-----------yTPAAIARAVRCG-VRTIEHGNL-----iDDETARLVA  265
DSSP  L----lEEEEE-----------lLHHHHHHHHHLL-LLEEEELLL-----lLHHHHHHHH


DSSP  HHLLEEEE-ELLL-------------------------LHHHHHHHHHHHLLLEEEELLL
Query KHQVALEI-NNSS-------------------------NCREVAAAVRDAGGWVALGSDS  182
ident  |                                               ||     | | 
Sbjct EHGAYVVPtLVTYdalasegekyglppesiakiadvhgAGLHSIEIMKRAGVKMGFGTDL  325
DSSP  HHLLEEELlHHHHhhhhhhlllllllhhhhllhhhhhlLHHHHHHHHHHHLLLLLLLLLL


DSSP  L--LHHHLLLL-HHHHHHHhhllLLHH-hLHHHLhhHHHHHHHhllLLLL------hhHL
Query H--TAFTMGEF-EECLKILdavdFPPE-rILNVSprRLLNFLEsrgMAPI------aeFA  232
ident                   |     | |              |    |            |
Sbjct LgeAQRLQSDEfRILAEVL----SPAEviASATI--VSAEVLG---MQDKlgrivpgaHA  376
DSSP  LhhHHHHLLHHhHHHHLLL----LHHHhhHHLLH--HHHHHLL---LLLLllllllllLL


DSSP  LL------------------------------------
Query DL------------------------------------  234
ident |                                     
Sbjct DVlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  LEeeellllllllllllllllllleeeelleeeeelll


No 12: Query=1m65A Sbjct=4c5yA Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  -lLEELLLLLL---------------lllllllLHHHHHHHHHHHLLLEEEEEE------
Query -yPVDLHMHTV---------------asthaysTLSDYIAQAKQKGIKLFAITD------   38
ident     | |||                         |      | | |              
Sbjct pgLWDCHMHFGgdddyyndytsglathpassgaRLARGCWEALQNGYTSYRDLAgygcev  120
DSSP  elEEEEEELLLlllllllllhhhhhllhhhhhhHHHHHHHHHHHLLEEEEEELLllhhhh


DSSP  -------------------ELLL------------------------------lLLLL--
Query -------------------HGPD------------------------------mEDAP--   47
ident                                                             
Sbjct akaindgtivgpnvyssgaALSQtaghgdifalpagevlgsygvmnprpgywgaGPLCia  180
DSSP  hhhhhllllllleeeelllEEELlllllllllllhhhhhhhhllllllllllllLLEEel


DSSP  --------LLHHHHHHHhllleelleeeeEEEEEEL--------------LLLL-llllL
Query --------HHWHFINMRiwprvvdgvgilRGIEANI--------------KNVD-geidC   84
ident              |                 |                            
Sbjct dgveevrrAVRLQIRRG-----------aKVIXVMAsggvmsrddnpnfaQFSPeelkvI  229
DSSP  llhhhhhhHHHHHHHHL-----------lLLEEEELllllllllllllllLLLHhhhhhH


DSSP  LHHHHHHLLEEEEELlllllllllhhhHHHHHHHHHHLlLLLEELLLLlllllLLHHHHH
Query SGKMFDSLDLIIAGFhepvfaphdkatNTQAMIATIASgNVHIISHPGnpkyeIDVKAVA  144
ident             |                    | |         |            | 
Sbjct VEEAARQNRIVSAHV-----------hGKAGIMAAIKA-GCKSLEHVS-----YADEEVW  272
DSSP  HHHHHHLLLLEEEEE-----------lLHHHHHHHHHH-LLLEEEELL-----LLLHHHH


DSSP  HHHHHHLLEEEE-ELLL------------------------LHHHHHHHHHHHLLLEEEE
Query EAAAKHQVALEI-NNSS------------------------NCREVAAAVRDAGGWVALG  179
ident |                                                   ||   |||
Sbjct ELMKEKGILYVAtRSVIeiflasngeglvkeswaklqaladSHLKAYQGAIKAGVTIALG  332
DSSP  HHHHHHLLEEELlHHHHhhhhhhllllllllhhhlllhhhhHHHHHHHHHHHLLLLEELL


DSSP  LLLlLHHHLLL-LHHHH-HHHHhllLLHHHL--HHHLhhHHHHHHHhllLLLLH------
Query SDShTAFTMGE-FEECL-KILDavdFPPERI--LNVSprRLLNFLEsrgMAPIA------  229
ident  |                         |                                
Sbjct TDT-APGGPTAlELQFAvERGG---MTPLEAikAATA--NAPLSVG---PQAPLtgqlre  383
DSSP  LLL-LLLLLLHhHHHHHhHLLL---LLHHHHhhHHLL--LHHHHHH---HHLLLllllll


DSSP  hHLLL------------------------------------------------
Query eFADL------------------------------------------------  234
ident                                                      
Sbjct gYEADvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lLLLLeeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 13: Query=1m65A Sbjct=2anuA Z-score=9.9

back to top
DSSP  ---LLEELLLLLLLLlLLLLLHHHHHHHHHHHLLLEEEEEEELLL------------lLL
Query ---YPVDLHMHTVAStHAYSTLSDYIAQAKQKGIKLFAITDHGPD------------mED   45
ident       | | ||  |      |          |     ||||  |               
Sbjct tewLLCDFHVHTNXS-DGHLPLGEVVDLFGKHGVDVVSITDHIVDrrtleqrkrngepLG   59
DSSP  leeEEEEEEELLLLL-LLLLLHHHHHHHHHHLLLLEEEEEEEEELhhhhhhhhhllllLL


DSSP  LLLLHHHH-HHHH--LLLEE----LLEEEEEEEEEELLL--llllllllHHHHhhlleee
Query APHHWHFI-NMRI--WPRVV----DGVGILRGIEANIKN--vdgeidcsGKMFdsldlii   96
ident |     |                  |     | |                          
Sbjct AITEDKFQdYLKRlwREQKRaweeYGXILIPGVEITNNTdlyhivavdvKEYV-------  112
DSSP  LLLLLLHHhHHHHhhHHHHHhhhhHLLEEEEEEEEEELLlleeeeeellLLLL-------


DSSP  eellllllllllhhhhhhHHHHHHHLLL----LLEELL--lllLLLL--LLHHHHHHHHh
Query agfhepvfaphdkatntqAMIATIASGN----VHIISH--pgnPKYE--IDVKAVAEAAa  148
ident                                   |  |                      
Sbjct --------------dpslPVEEIVEKLKeqnaLVIAAHpdrkkLSWYlwANXERFKDTF-  157
DSSP  --------------llllLHHHHHHHHHhlllEEEELLlllllLLLHhhHLLLLLLLLL-


DSSP  hhlLEEE-EELLLlHHHHHHHHhhhlLLEEEELLLLLHHHLLLLhhhhhhhhhllllhhh
Query khqVALE-INNSSnCREVAAAVrdagGWVALGSDSHTAFTMGEFeeclkildavdfpper  207
ident     | |  |       |              || |                        
Sbjct ---DAWEiANRDDlFNSVGVKK----YRYVANSDFHELWHVYSW----------------  194
DSSP  ---LEEEeEELLEeLHHHHHLL----LLEEEELLLLLHHHHLLE----------------


DSSP  lhHHLHH-----HHHHHHHHllllllhhhlll
Query ilNVSPR-----RLLNFLESrgmapiaefadl  234
ident                                 
Sbjct -kTLVKSeknieAIKEAIRK-ntdvaiylxrk  224
DSSP  -eEEEEElllhhHHHHHHHH-llleeeeelll


No 14: Query=1m65A Sbjct=2y1hB Z-score=9.8

back to top
DSSP  --LLEELLLLLLllllLLLL---HHHHHHHHHHHLLLEEEEEEellllllLLLLhHHHHH
Query --YPVDLHMHTVasthAYST---LSDYIAQAKQKGIKLFAITDhgpdmedAPHHwHFINM   55
ident     || | |      |      | |    ||                        |   
Sbjct gvGLVDCHCHLS----APDFdrdLDDVLEKAKKANVVALVAVA-------EHSG-EFEKI   48
DSSP  llLEEEEEELLL----LHHHlllHHHHHHHHHHLLEEEEEELL-------LLHH-HHHHH


DSSP  HH--LLLEelleEEEEE------------------------------------EEEELLL
Query RI--WPRVvdgvGILRG------------------------------------IEANIKN   77
ident               |                                       |     
Sbjct MQlsERYN---gFVLPClgvhpvqgldqrsvtlkdldvalpiienykdrllaiGEVGLDF  105
DSSP  HHhhHHLL---lLEEEEelllleelllleellhhhhhhhhhhhhhhllllleeEEEEEEL


DSSP  ---------------lllllLLLHhhhhhlleEEEELLllllllllhhhHHHHHHHHHH-
Query ---------------vdgeiDCSGkmfdsldlIIAGFHepvfaphdkatNTQAMIATIA-  121
ident                                                       |     
Sbjct sprfagtgeqkeeqrqvlirQIQL-akrlnlpVNVHSR----------sAGRPTINLLQe  154
DSSP  lllllllhhhhhhhhhhhhhHHHH-hhhhlllEEEEEE----------lLHHHHHHHHHh


DSSP  -LLLLLEELLLLlllllLLHHhHHHHHHHHLLEEEEELLL----LHHHHHHHHHhhlLLE
Query -SGNVHIISHPGnpkyeIDVKaVAEAAAKHQVALEINNSS----NCREVAAAVRdagGWV  176
ident                       ||           |  |                     
Sbjct qGAEKVLLHAFD-----GRPS-VAMEGVRAGYFFSIPPSIirsgQKQKLVKQLP--lTSI  206
DSSP  lLLLLEEEELLL-----LLHH-HHHHHHHLLLEEEELHHHhllhHHHHHHHHLL--hHHE


DSSP  EEELLLLL-------hhHLLLLHHHHHHHHHLL----llhhhLHHHlhhHHHHHHHhlll
Query ALGSDSHT-------afTMGEFEECLKILDAVD----fpperILNVsprRLLNFLEsrgm  225
ident  |  ||                         |                   |        
Sbjct CLETDSPAlgpekqvrnEPWNISISAEYIAQVKgisveevieVTTQ---NALKLFP----  259
DSSP  EELLLLLLlllllllllLHHHHHHHHHHHHHHHlllhhhhhhHHHH---HHHHHLL----


DSSP  llLHHHlll
Query apIAEFadl  234
ident          
Sbjct klRHLL---  265
DSSP  lhHHHL---


No 15: Query=1m65A Sbjct=3f2bA Z-score=9.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ------------------------------------------------LLEELLLLLLLL
Query ------------------------------------------------YPVDLHMHTVAS   12
ident                                                   | || ||  |
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegeKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllllllllLLLLLLLLLLLL


DSSP  -LLLLLLHHHHHHHHHHHLLLEEEEEEELLllllllllhhhhhHHHLL--LEELLEEEEE
Query -THAYSTLSDYIAQAKQKGIKLFAITDHGPdmedaphhwhfinMRIWP--RVVDGVGILR   69
ident    |       | |||  |    | |||                          |     
Sbjct qMDAVTSVTKLIEQAKKWGHPAIAVTDHAV----------vqsFPEAYsaAKKHGMKVIY  170
DSSP  lLLLLLLHHHHHHHHHHLLLLLEEELLLLL----------lllHHHHHhhHHHHLLLEEE


DSSP  EEEEELLLL------lllllllhHHHH---hlleeeeellLLLLllllhhhhhhhhhhhh
Query GIEANIKNV------dgeidcsgKMFD---sldliiagfhEPVFaphdkatntqamiati  120
ident | ||||                 |                 |                  
Sbjct GLEANIVDDpfhvtllaqnetglKNLFklvslshiqyfhrVPRI-----------prsvl  219
DSSP  EEEEEEELLleeeeeeellhhhhHHHHhhhhhhhllllllLLLE-----------ehhhh


DSSP  HLLL---LLEELL----LLLLlllllHHHHHHHHhhhlLEEEEEL---------------
Query ASGN---VHIISH----PGNPkyeidVKAVAEAAakhqVALEINN---------------  158
ident                           |   |         ||                  
Sbjct VKHRdglLVGSGCdkgeLFDN-----VEDIARFY----DFLEVHPpdvykplyvkdeemi  270
DSSP  HHLLlleEEELLLllllLLLL-----LLLLHHHL----LLEEELLhhhhlllllllhhhh


DSSP  llLHHHHHHHHHHHLLLEEEELLLLLHH----------------------------HLLL
Query ssNCREVAAAVRDAGGWVALGSDSHTAF----------------------------TMGE  190
ident     |   |        |      |                                   
Sbjct knIIRSIVALGEKLDIPVVATGNVHYLNpedkiyrkilihsqgganplnrhelpdvYFRT  330
DSSP  hhHHHHHHHHHHHLLLLEEELLLLLLLLhhhhhhhhhhhhllhhhlllllllllllLLLL


DSSP  ---LHHHHHhhHHLLLLHH--hLHHHlhhHHHHHHhhllllLLHH---------------
Query ---FEECLKilDAVDFPPE--rILNVsprRLLNFLesrgmaPIAE---------------  230
ident       |           |                                         
Sbjct tneMLDCFS-fLGPEKAKEivvDNTQ---KIASLI------GDVKpikdelytpriegad  380
DSSP  hhhHHHHHH-hHHHHHHHHhhlHHHH---HHHHLL------LLLLlllllllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct eeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylv  440
DSSP  hhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct gsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtk  500
DSSP  eelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct ykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvad  560
DSSP  leeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct ktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiq  620
DSSP  hhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhlllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct ypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvm  680
DSSP  lhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct gifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdv  740
DSSP  hlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct wlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeae  800
DSSP  llllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct mrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfd  860
DSSP  hhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct ldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqat  920
DSSP  hhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleelllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  230
ident                                                             
Sbjct efvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrg  980
DSSP  lleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhll


DSSP  ----------hlll
Query ----------fadl  234
ident               
Sbjct cldslpdhnqlslf  994
DSSP  llllllllllllll


No 16: Query=1m65A Sbjct=3gg7A Z-score=9.5

back to top
DSSP  LLEELLLLllllllLLLLHHHHHHHHHHHLLlEEEEEEElllllllllLHHHHHHhhLLL
Query YPVDLHMHtvasthAYSTLSDYIAQAKQKGIkLFAITDHgpdmedaphHWHFINMriWPR   60
ident    | | |       |                                            
Sbjct SLIDFHVH----ldLYPDPVAVARACEERQL-TVLSVTT--------tPAAWRGT-lALA   46
DSSP  LLEEEEEL----hhHLLLHHHHHHHHHHLLL-EEEELLL--------lHHHHHHH-hHHH


DSSP  EElLEEEEEE----------------------------EEEELLL------------lll
Query VVdGVGILRG----------------------------IEANIKN------------vdg   80
ident                                        |                    
Sbjct AG-RPHVWTAlgfhpevvseraadlpwfdrylpetrfvGEVGLDGspslrgtwtqqfavf  105
DSSP  LL-LLLEEELllllhhhllllhhhlhhhhhhhhhlleeEEEELLLlhhhhhhhhhhhhhh


DSSP  llLLLHhhhhhlleEEEELLllllllllhhhHHHHHHHHHHL---LLLLEELLLLlllll
Query eiDCSGkmfdsldlIIAGFHepvfaphdkatNTQAMIATIAS---GNVHIISHPGnpkye  137
ident                                                  |          
Sbjct qhILRRcedhggriLSIHSR----------rAESEVLNCLEAnprSGTPILHWYS-----  150
DSSP  hhHHHHhhhllleeEEEELL----------lLHHHHHHHHHHlhhHEEEEEELLL-----


DSSP  lLHHHHHHHHHHHLLEEEEELLL----LHHHHHHHHHhhllLEEEELLLL------lhhH
Query iDVKAVAEAAAKHQVALEINNSS----NCREVAAAVRdaggWVALGSDSH------tafT  187
ident          |                                |    |            
Sbjct -GSVTELRRAISLGCWFSVGPTMvrtqKGAALIRSMP--rdRVLTETDGPfleldgqaaL  207
DSSP  -LLHHHHHHHHHLLLEEEELHHHhllhHHHHHHHHLL--hhHEEELLLLLlleelleelL


DSSP  LLLLHHHHHHHHHLL----llhhhLHHHlhhHHHHHHHHllllllhhhlll
Query MGEFEECLKILDAVD----fpperILNVsprRLLNFLESrgmapiaefadl  234
ident           |             |           |              
Sbjct PWDVKSVVEGLSKIWqipaseverIVKE---NVSRLLGT------------  243
DSSP  HHHHHHHHHHHHHHHlllhhhhhhHHHH---HHHHHHHL------------


No 17: Query=1m65A Sbjct=3cjpA Z-score=9.4

back to top
DSSP  lLEELLLLLlllllllLLHHHHHHHHHHHLLLEEEEEEE---------------------
Query yPVDLHMHTvasthaySTLSDYIAQAKQKGIKLFAITDH---------------------   39
ident    | | |              |      |                              
Sbjct lIIDGHTHV------iLPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkkln   54
DSSP  lLEEEEEEL------lLLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhhh


DSSP  -------llLLLLLLLL-HHHHHHHHLLLEelleEEEEEEEEELLLLL--lllLLLHHHH
Query -------gpDMEDAPHH-WHFINMRIWPRVvdgvGILRGIEANIKNVD--geiDCSGKMF   89
ident                       |                                     
Sbjct dvvngktnsMIDVRRNSiKELTNVIQAYPS----RYVGFGNVPVGLSEndtnsYIEENIV  110
DSSP  hhhllllllLHHHHHHHhHHHHHHHHHLLL----LEEEEELLLLLLLHhhhhhHHHHHLL


DSSP  -HHLLEEEEELllllLLLLlhhhHHHHHHHHHHLL----LLLEELLLlLLLL--LLLH--
Query -DSLDLIIAGFhepvFAPHdkatNTQAMIATIASG----NVHIISHPgNPKY--EIDV--  140
ident    |  |         |                         |  |              
Sbjct nNKLVGIGELT----PASG----QIKSLKPIFKYSmdsgSLPIWIHA-FNPLvlQDIKei  161
DSSP  lLLLLEEEEEL----LLLL----LHHHHHHHHHHHhhllLLLEEELL-LLLLlhHHHHhh


DSSP  HHHHHHHHHHLLEEEEelllLHHHHHHHHHHHL-LLEEEElllllhhhllllHHHHHHHH
Query KAVAEAAAKHQVALEInnssNCREVAAAVRDAG-GWVALGsdshtaftmgefEECLKILD  199
ident      |  |  | |      |                                  |||  
Sbjct AELCKAFPKVPVILGHmggsNWMTAVELAKEIQnLYLDTS--------ayfsTFVLKIVI  213
DSSP  HHHHHHLLLLLEEEHHhhhhHHHHHHHHHHHLLlEEEELL--------llllHHHHHHHH


DSSP  hlLLLHHHLHH----------------------------HLHHHHHHHHHhllllllhhh
Query avDFPPERILN----------------------------VSPRRLLNFLEsrgmapiaef  231
ident      |                                 |        |           
Sbjct --NELPLKCIFgtdmpfgdlqlsieaikkmsndsyvanaVLGDNISRLLN----------  261
DSSP  --HHLLLLEELllllllllhhhhhhhhhhhlllhhhhhhHHLHHHHHHHL----------


DSSP  lll
Query adl  234
ident    
Sbjct --i  262
DSSP  --l


No 18: Query=1m65A Sbjct=1k6wA Z-score=9.4

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------yPVDLHMH    8
ident                                                       |  | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL


DSSP  LllllLLLL---------------------------------LHHHHHHHHHHHLLLEEE
Query TvastHAYS---------------------------------TLSDYIAQAKQKGIKLFA   35
ident                                                       ||    
Sbjct L---dTTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVR  117
DSSP  L---lLLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEE


DSSP  EEEELLllllllLLHHHHHHHHL--LLEElLEEEEEEEE---------------------
Query ITDHGPdmedapHHWHFINMRIW--PRVVdGVGILRGIE---------------------   72
ident                    |                                        
Sbjct THVDVS----daTLTALKAMLEVkqEVAP-WIDLQIVAFpqegilsypngealleealrl  172
DSSP  EEEELL----llLLHHHHHHHHHhhHHLL-LLEEEEEEEllllllllllhhhhhhhhhhl


DSSP  -----EELL--------LLLLL----llLLHHHHhhlleEEEELllllllllLHHHHhhH
Query -----ANIK--------NVDGE----idCSGKMFdsldlIIAGFhepvfaphDKATNtqA  115
ident        |          |                    |            |       
Sbjct gadvvGAIPhfeftreyGVESLhktfalAQKYDR----lIDVHC----deidDEQSR--F  222
DSSP  llleeEELHhhlllhhhHHHHHhhhhhhHHHHLL----eEEEEE----llllLLLLL--H


DSSP  HHHHHHLL------llLEELLLLL-LLLL-lLHHHHHHHHHHHLLEEEEELLL-------
Query MIATIASG------nvHIISHPGN-PKYE-iDVKAVAEAAAKHQVALEINNSS-------  160
ident      |             ||      |                     |          
Sbjct VETVAALAhhegmgarVTASHTTAmHSYNgaYTSRLFRLLKMSGINFVANPLVnihlqgr  282
DSSP  HHHHHHHHhhhllhhhEEEEELHHhHHLLhhHHHHHHHHHHHHLLEEEELHHHhhhhlll


DSSP  --------LHHHhHHHHHHHLLLEEEELLLLL------hHHLL--LLHHHHHHHHH----
Query --------NCREvAAAVRDAGGWVALGSDSHT------aFTMG--EFEECLKILDA----  200
ident                     |  |  | |                     |         
Sbjct fdtypkrrGITR-VKEMLESGINVCFGHDDVFdpwyplgTANMlqVLHMGLHVCQLmgyg  341
DSSP  llllllllLLLL-HHHHHHLLLLEEELLLLLLlllllllLLLHhhHHHHHHHHLLLllhh


DSSP  lllLHHHL---HHHLhhhHHHHhhhllllllhhHLLL-----------------------
Query vdfPPERI---LNVSprrLLNFlesrgmapiaeFADL-----------------------  234
ident                    |              | |                       
Sbjct qinDGLNLithHSAR-tlNLQD----ygiaagnSANLiilpaengfdalrrqvpvrysvr  396
DSSP  hhhHHHHHhlhHHHH-hlLLLL----lllllllLLLEeeellllhhhhhhhllllleeee


DSSP  ---------------------------
Query ---------------------------  234
ident                            
Sbjct ggkviastqpaqttvyleqpeaidykr  423
DSSP  lleeeeellllleeeellleeeellll


No 19: Query=1m65A Sbjct=1bf6A Z-score=9.4

back to top
DSSP  -----lLEELLLL-LLLLL-------LLLLLHHHHHHHHHHHL---LLEEEEEEEllllL
Query -----yPVDLHMH-TVAST-------HAYSTLSDYIAQAKQKG---IKLFAITDHgpdmE   44
ident           | |                                               
Sbjct sfdptgYTLAHEHlHIDLSgfknnvdCRLDQYAFICQEMNDLMtrgVRNVIEMTN----R   56
DSSP  llllllEEEEEELlLEELHhhhllhhHEELLHHHHHHHHHHHHhllEEEEEELLL----H


DSSP  LLLllhhhhhhhhLLLE-ELLEEEEEE---------------------------------
Query DAPhhwhfinmriWPRV-VDGVGILRG---------------------------------   70
ident                     |                                       
Sbjct YMG----rnaqfmLDVMrETGINVVACtgyyqdaffpehvatrsvqelaqemvdeieqgi  112
DSSP  HHL----llhhhhHHHHhHHLLEEEEEellllhhhlllhhhhllhhhhhhhhhhhhhlll


DSSP  ----------EEEELLLLLL----llLLLH--HHHH-hlLEEEEELLllllllllhhhhh
Query ----------IEANIKNVDG----eiDCSG--KMFD-slDLIIAGFHepvfaphdkatnt  113
ident            |                             |                  
Sbjct dgtelkagiiAEIGTSEGKItpleekVFIAaaLAHNqtgRPISTHTS-----------fs  161
DSSP  lllllleeeeEEEELLLLLLlhhhhhHHHHhhHHHHhhlLLEEEELH-----------hh


DSSP  hHHHHHHHLL-------llLEELLLLLLllllLHHHHHHHHHHHLLEEEE-ELLL-----
Query qAMIATIASG-------nvHIISHPGNPkyeiDVKAVAEAAAKHQVALEI-NNSS-----  160
ident        |               |        |                           
Sbjct tMGLEQLALLqahgvdlsrVTVGHCDLK----DNLDNILKMIDLGAYVQFdTIGKnsyyp  217
DSSP  lLHHHHHHHHhhllllhhhEEELLLLLL----LLHHHHHHHHHLLLEEEElLLLLlllll


DSSP  --LHHHHHHHHHHHLL--LEEEELLLLL--------hhHLLLLH-HHHHHHHHLLL---L
Query --NCREVAAAVRDAGG--WVALGSDSHT--------afTMGEFE-ECLKILDAVDF---P  204
ident          | || |    | |  |                         |    |    
Sbjct deKRIAMLHALRDRGLlnRVMLSMDITRrshlkanggyGYDYLLtTFIPQLRQSGFsqaD  277
DSSP  hhHHHHHHHHHHHLLLhhHEEELLLLLLhhhlhhhlllLLLHHHhLHHHHHHHLLLlhhH


DSSP  HHHlHHHLhhHHHHHHHhllllllhhhlll
Query PERiLNVSprRLLNFLEsrgmapiaefadl  234
ident               |               
Sbjct VDV-MLRE--NPSQFFQ-------------  291
DSSP  HHH-HHLH--HHHHHLL-------------


No 20: Query=1m65A Sbjct=4cqbA Z-score=9.2

back to top
DSSP  -----------------------------------------------------lLEELLL
Query -----------------------------------------------------yPVDLHM    7
ident                                                        || | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeelEEEEEE


DSSP  LLLllllLLLL--------------------------------------HHHHHHHHHHH
Query HTVasthAYST--------------------------------------LSDYIAQAKQK   29
ident |         |                                                 
Sbjct HMD----KSFTstgerlpkfwsrpytrdaaiedglkyyknatheeikrhVIEHAHMQVLH  116
DSSP  LHH----HLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhhhhHHHHHHHHHHL


DSSP  LLLEEEEEEellllllLLLLHH-hhHHHH--LLLE--ELLEEEEEE--------------
Query GIKLFAITDhgpdmedAPHHWH-fiNMRI--WPRV--VDGVGILRG--------------   70
ident |                                     |   |                 
Sbjct GTLYTRTHV-------DVDSVAktkAVEAvlEAKEelKDLIDIQVVafaqsgffvdlese  169
DSSP  LEEEEEEEE-------ELLLLLllhHHHHhhHHHHhlLLLLEEEEEeellllllllllhh


DSSP  -------------EEEELLL------LLLL--LLLL--HHHHhhlleEEEELLlllllll
Query -------------IEANIKN------VDGE--IDCS--GKMFdsldlIIAGFHepvfaph  107
ident                                                |    |       
Sbjct slirksldmgcdlVGGVDPAtrennvEGSLdlCFKLakEYDV----dIDYHIH------d  219
DSSP  hhhhhhhhhllleEELLLLLlllllhHHHHhhHHHHhhHLLL----eEEEEEL------l


DSSP  lHHHHHHHHHHHHHLL------llLEELLLLL-LLLL-lLHHHHHHHHHHHLLEEEEELL
Query dKATNTQAMIATIASG------nvHIISHPGN-PKYE-iDVKAVAEAAAKHQVALEINNS  159
ident                            ||                              |
Sbjct iGTVGVYSINRLAQKTiengykgrVTTSHAWCfADAPseWLDEAIPLYKDSGMKFVTCFS  279
DSSP  lHHHHHHHHHHHHHHHhhllllllEEEEELLHhHHLLhhHHHHHHHHHHHHLLEEEEELL


DSSP  L-LHHHHHHHHHHHLLLEEEELLLLL-----hHHLL---LLHHHHHHHHH---lLLLHhh
Query S-NCREVAAAVRDAGGWVALGSDSHT-----aFTMG---EFEECLKILDA---vDFPPer  207
ident |            ||      ||                        |      |     
Sbjct StPPTMPVIKLLEAGINLGCASDNIRdfwvpfGNGDmvqGALIETQRLELktnrDLGLiw  339
DSSP  LlLLLLLHHHHHHLLLEEEEELLLLLllllllLLLLhhhHHHHHHHHHLLllhhHHHHhh


DSSP  LHHHL--hhhHHHHhhhllllllhhHLLL-------------------------------
Query ILNVS--prrLLNFlesrgmapiaeFADL-------------------------------  234
ident     |     |                                                 
Sbjct KMITSegarvLGIE---knygievgKKADlvvlnslspqwaiidqakrlcvikngriivk  396
DSSP  HHHLHhhhhhHLLH---hhllllllLLLLeeeellllhhhhhhhllleeeeeelleeeee


DSSP  ------
Query ------  234
ident       
Sbjct deviva  402
DSSP  lleell


No 21: Query=1m65A Sbjct=4mupB Z-score=9.0

back to top
DSSP  ----------------LLEELLLLLL---------lLLLL---LLLHHHHHHHHHHHLLL
Query ----------------YPVDLHMHTV---------aSTHA---YSTLSDYIAQAKQKGIK   32
ident                   ||  ||                        ||       || 
Sbjct lvrklsgtapnpafprGAVDTQMHMYlpgypalpggPGLPpgaLPGPEDYRRLMQWLGID   60
DSSP  llllllllllllllllLLEELLLLLLllllllllllLLLLlllLLLHHHHHHHHHHHLLL


DSSP  EEEEEEELlllllLLLLHHhHHHHH--LLLEElleEEEEEeeeellllllllllLHHHHH
Query LFAITDHGpdmedAPHHWHfINMRI--WPRVVdgvGILRGieaniknvdgeidcSGKMFD   90
ident    ||        |       |                                  |   
Sbjct RVIITQGN-----AHQRDN-GNTLAcvAEMGE---AAHAV---viidatttekdMEKLTA  108
DSSP  EEEEELLH-----HHLLLL-HHHHHhhHHHHH---HEEEE---elllllllhhhHHHHHH


DSSP  H-LLEE-----------------------------EEELLllllllllhhHHHHHHHHHh
Query S-LDLI-----------------------------IAGFHepvfaphdkaTNTQAMIATi  120
ident                                       |                     
Sbjct AgTVGArimdlpggavnlseldavderahaadwmvAVQFD--------gnGLLDHLPRLq  160
DSSP  LlEEEEeeellllllllhhhhhhhhhhhhhllleeEEELL--------hhHHHHHHHHHh


DSSP  HLLLLLEELLLLL-LLLL----lLHHHHHHHHHHHLLEEEeELLL---------------
Query ASGNVHIISHPGN-PKYE----iDVKAVAEAAAKHQVALEiNNSS---------------  160
ident          | |   |          |                                 
Sbjct KIRSRWVFDHHGKfFKGIrtdgpEMAALLKLIDRGNLWFK-FAGVyessrkswpyadvaa  219
DSSP  LLLLEEEELHHHHlLLLLllllhHHHHHHHHHHHLLEEEE-ELLHhhllllllllhhhhh


DSSP  LHHHHHHHHHhhllLEEEELLLLL---------hhhllLLHHHHHHHhhLLLLHhhLHHH
Query NCREVAAAVRdaggWVALGSDSHT---------aftmgEFEECLKILdaVDFPPerILNV  211
ident   |  ||           |                     |  |  |   |        |
Sbjct FSRVIAAHAP---eRIVWGTNWPHnsvretaaypddarLAELTLGWL--PDEAArhRALV  274
DSSP  HHHHHHHHLH---hHEEELLLLLLlllllhhhlllhhhHHHHHHLLL--LLHHHhhHHHL


DSSP  LhhHHHHHHHhllllllhhhlll
Query SprRLLNFLEsrgmapiaefadl  234
ident                        
Sbjct E--NPEALFK---------lspv  286
DSSP  H--HHHHHHL---------llll


No 22: Query=1m65A Sbjct=2ffiA Z-score=9.0

back to top
DSSP  ---lLEELLLLLL-----------llLLLLLLHHHHHHHHHHHLLLEEEEEEELlllllL
Query ---yPVDLHMHTV-----------asTHAYSTLSDYIAQAKQKGIKLFAITDHGpdmedA   46
ident       | | |                     | ||  |    |                
Sbjct lhltAIDSHAHVFsrglnlasqrryaPNYDAPLGDYLGQLRAHGFSHGVLVQPS-----F   55
DSSP  llllLEELLLLLLlhhhhhhllllllLLLLLLHHHHHHHHHHLLLLEELLLLLH-----H


DSSP  LLLHHhHHHHH--LLLEelleEEEEEEeeellllllllllLHHHHHH-LLEE--------
Query PHHWHfINMRI--WPRVvdgvGILRGIeaniknvdgeidcSGKMFDS-LDLI--------   95
ident                                                             
Sbjct LGTDN-RYLLSalQTVP---gQLRGVV---xlerdveqatLAEXARLgVRGVrlnlxgqd  108
DSSP  HLLLL-HHHHHhhHHLL---lLLLLLL---lllllllhhhHHHHHLLlLLEEelllllll


DSSP  -----------------------EEELlllllllllhhHHHHHHHHH-hHLLLLlEELL-
Query -----------------------IAGFhepvfaphdkaTNTQAMIAT-iASGNVhIISH-  130
ident                                              |          | | 
Sbjct xpdltgaqwrpllerigeqgwhvELHR--------qvaDIPVLVRALqpYGLDI-VIDHf  159
DSSP  lllllllllhhhhhhhhhhlleeEELL--------lllLHHHHHHHHllLLLLE-EELHh


DSSP  LLLL-------lLLLLHHHHhhhhhHHLLEEEEELLL-----------LHHHHHHHHHHH
Query PGNP-------kYEIDVKAVaeaaaKHQVALEINNSS-----------NCREVAAAVRDA  172
ident                             |                     |    |    
Sbjct GRPDarrglgqpGFAELLTL---sgRGKVWVKVSGIYrlqgspeenlaFARQALCALEAH  216
DSSP  HLLLllllllllLHHHHLLL---llLLLEEEEEELHHhllllhhhhhhHHHHHHHHHHHH


DSSP  LL--LEEEELLLLL------hhhllLLHHHHHHHHhlllLHHH--LHHHLhhHHHHHHHh
Query GG--WVALGSDSHT------aftmgEFEECLKILDavdfPPER--ILNVSprRLLNFLEs  222
ident  |      |||                |                  |             
Sbjct YGaeRLXWGSDWPHtqhesevsfgsAVEQFEALGC----SAQLrqALLLD--TARALFG-  269
DSSP  LLhhHEEEELLLLLllllllllhhhHHHHHHHHLL----LHHHhhHHHLH--HHHHHLL-


DSSP  llllllhhHLLL
Query rgmapiaeFADL  234
ident         |   
Sbjct --------FELE  273
DSSP  --------LLLL


No 23: Query=1m65A Sbjct=2pajA Z-score=8.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  --------------------------------------------LLEELLLLLLLLL-ll
Query --------------------------------------------YPVDLHMHTVAST-ha   15
ident                                                      |      
Sbjct pawvnthhhlfqsllkgepfralfderrfrlaariglielarsgCATVADHNYVYYPgmp  120
DSSP  eleelllllhhhhhllllllhhhllhhhhhhhhhhhhhhhhlllEEEEEELLLLLLLlll


DSSP  LLLHHHHHHHHHHHLLLEEEEEEELLLL----------LLLLLLHHHHH-HHHL--LLEE
Query YSTLSDYIAQAKQKGIKLFAITDHGPDM----------EDAPHHWHFIN-MRIW--PRVV   62
ident           |   |                                             
Sbjct FDSSAILFEEAEKLGLRFVLLRGGATQTrqleadlptaLRPETLDAYVAdIERLaaRYHD  180
DSSP  LLHHHHHHHHHHHLLLEEEEEELLLLLLllllllllhhHLLLLHHHHHHhHHHHhhHLLL


DSSP  ---lLEEEEEEEEEELlllllLLLL----LHHHHHHL----LEEEEELlllllllllhhh
Query ---dGVGILRGIEANIknvdgEIDC----SGKMFDSL----DLIIAGFhepvfaphdkat  111
ident                                                             
Sbjct asprAMRRVVMAPTTV-----LYSIspreMRETAAVArrlgLRMHSHL-----------s  224
DSSP  llllLLEEEEELLLLL-----LLLLlhhhHHHHHHHHhhllLEEEEEL-----------l


DSSP  hhHHHHHHHHLLLL---LEELLLLlllllLLHHHHHHHHHHHLLEEEEE-LLLLhhhHHH
Query ntQAMIATIASGNV---HIISHPGnpkyeIDVKAVAEAAAKHQVALEIN-NSSNcreVAA  167
ident                      |                 |           |        
Sbjct gkSPVAFCGEHDWLgsdVWYAHLV-----KVDADEIALLAQTGTGVAHCpQSNG-rlPVR  278
DSSP  llLHHHHHHHLLLLlllEEEELLL-----LLLHHHHHHHHHHLLEEEELhHHHH-llLLL


DSSP  HHHHHLLLEEEELLLllhhhllLLHHHHHHHHHLL--------LLHH---HLHHhlhhhH
Query AVRDAGGWVALGSDShtaftmgEFEECLKILDAVD--------FPPE---RILNvsprrL  216
ident    |||  |  | |                                              
Sbjct EMADAGVPVSIGVDGaasneaaDMISEVHMTWLAQrarlasiaEVIHwgtAGGA---rvM  335
DSSP  LHHHHLLLEEELLLHhhhllllLHHHHHHHHHHHHhhllllhhHHHHhhlHHHH---hhH


DSSP  HHH---------------------------------------------------------
Query LNF---------------------------------------------------------  219
ident                                                             
Sbjct GLDevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddl  395
DSSP  LLLlllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelll


DSSP  -----------hhhllllllhhhlll
Query -----------lesrgmapiaefadl  234
ident                           
Sbjct iegvdikelggearrvvrellrevvv  421
DSSP  lllllhhhhhhhhhhhhhhhhhhhhl


No 24: Query=1m65A Sbjct=1yrrB Z-score=8.9

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------yPVDLHMH    8
ident                                                        |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeelEEEEEEL


DSSP  -----LLLLL---llllLHHHHHHHHHHHLLLEEEEEEELLllllllLLHHHHHHHH--L
Query -----TVAST---haysTLSDYIAQAKQKGIKLFAITDHGPdmedapHHWHFINMRI--W   58
ident          |       ||          |      |                       
Sbjct gcggvQFNDTaeavsveTLEIMQKANEKSGCTNYLPTLITT------SDELMKQGVRvmR  114
DSSP  eelleELLLLlllllhhHHHHHHHHHHLLLEEEEEEEELLL------LHHHHHHHHHhhH


DSSP  LLE--ELLEEEEEEEEEELLllllllllLHHHHHH---LLEEE-----------------
Query PRV--VDGVGILRGIEANIKnvdgeidcSGKMFDS---LDLII-----------------   96
ident                |                                            
Sbjct EYLakHPNQALGLHLEGPWL----naalVDFLCENadvITKVTlapemvpaevisklana  170
DSSP  HHHhhLLLLLLLEEEELLLL----llhhHHHHHHLhhhEEEEEelhhhllhhhhhhhhhh


DSSP  ----EELLllllllllhhHHHH-HHHHHHHLLLLlEELLLLLllLLLL------hhHHHH
Query ----AGFHepvfaphdkaTNTQ-AMIATIASGNVhIISHPGNpkYEID------vkAVAE  145
ident        |            |     |    |      |  |                  
Sbjct givvSAGH---------sNATLkEAKAGFRAGIT-FATHLYN-aMPYItgrepglaGAIL  219
DSSP  lleeEELL---------lLLLHhHHHHHHHHLEE-EELLLLL-lLLLLlllllhhhHHHH


DSSP  HhhHHLLEEEEE--llLLHHHHHHHHHHHLL-LEEEELLLLlhhhlLLLHHHHHHHHHLL
Query AaaKHQVALEIN--nsSNCREVAAAVRDAGG-WVALGSDSHtaftmGEFEECLKILDAVD  202
ident           |                   |    |  |          |          
Sbjct D--EADIYCGIIadglHVDYANIRNAKRLKGdKLCLVTDATsgsslTMIEGVRNLVEHCG  277
DSSP  H--LLLLEEEEEllllLLLHHHHHHHHHHHHhHEEEELLLLlllllLHHHHHHHHHHHHL


DSSP  LLHHH--LHHHLhhHHHHHHH---hllllllhhHLLL----------------------
Query FPPER--ILNVSprRLLNFLE---srgmapiaeFADL----------------------  234
ident                                   | |                      
Sbjct IALDEvlRMATL--YPARAIGvekrlgtlaagkVANLtaftpdfkitktivngnevvtq  334
DSSP  LLHHHhhHHHLH--HHHHHLLllllllllllllLLLEeeellllleeeeeelleeeeel


No 25: Query=1m65A Sbjct=3e38A Z-score=8.9

back to top
DSSP  -----------------LLEELLLLLLLLlLLLLLHHHHHHHHHHHLLLEEEEEEELLlL
Query -----------------YPVDLHMHTVAStHAYSTLSDYIAQAKQKGIKLFAITDHGPdM   43
ident                     | | | | |             |   |      | |    
Sbjct aqrrneiqvpdldgyttLKCDFHXHSVFS-DGLVWPTVRVDEAYRDGLDAISLTEHIE-Y   58
DSSP  llllllllllllllleeEEEELLLLLLLL-LLLLLHHHHHHHHHHLLLLEELLEEELL-L


DSSP  LLLL--llHHHHH-HHHL-LLEE-LLEEEEEEEEEELL----------llllllLLLHhh
Query EDAP--hhWHFIN-MRIW-PRVV-DGVGILRGIEANIK----------nvdgeiDCSGkm   88
ident                          |     | |                          
Sbjct RPHKqdvvSDHNRsFDLCrEQAEkLGILLIKGSEITRAxapghfnaiflsdsnpLEQK--  116
DSSP  LLLLllllLLLLHhHHHHhHHHHhHLLEELLEEEEELLlllleeeeelllllhhHLLL--


DSSP  hhhlleeeeellllllllllhhhhhhhhhhhhhLLLL------LEELLLLLLLLL---LL
Query fdsldliiagfhepvfaphdkatntqamiatiaSGNV------HIISHPGNPKYE---ID  139
ident                                                |||          
Sbjct ----------------------------dykdaFREAkkqgafXFWNHPGWDSQQpdtTK  148
DSSP  ----------------------------lhhhhHHHHhhllleEEELLLLLLLLLlllLL


DSSP  HHHhhHHHHH--HLLEEE-EELLLLHHHHHHHHHHHLLLEEEELLLLLHH---------h
Query VKAvaEAAAK--HQVALE-INNSSNCREVAAAVRDAGGWVALGSDSHTAF---------t  187
ident       |          |  |      |      |        || |             
Sbjct WWPehTALYQegCXHGIEvANGHLYXPEAIQWCLDKNLTXIGTSDIHQPIqtdydfekge  208
DSSP  LLHhhHHHHHllLLLEEEeEELLEELLHHHHHHHHHLLEEEEELLLLLLHhhhllhhhll


DSSP  lLLLHhhhhhhhhllllhhhlHHHL----HHHHHHHHHH---------------------
Query mGEFEeclkildavdfpperiLNVS----PRRLLNFLES---------------------  222
ident                                     |                       
Sbjct hRTXT----------------FVFAkersLQGIREALDNrrtaayfhelligredllrpf  252
DSSP  lLLEE----------------EEEEllllHHHHHHHHHLlleeeeelleeellhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  222
ident                                                             
Sbjct fekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigf  312
DSSP  hhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeee


DSSP  ------------------llllllhhhlll
Query ------------------rgmapiaefadl  234
ident                               
Sbjct kqgikggdvnfevtnfivapdkglkytisl  342
DSSP  llllllleeeeeeeeeeeelleeeeeeeel


No 26: Query=1m65A Sbjct=4dlfA Z-score=8.9

back to top
DSSP  -LLEELLLLLLL--------------llllLLLHHHHHHHHHHHLLLEEEEEEEllllll
Query -YPVDLHMHTVA--------------sthaYSTLSDYIAQAKQKGIKLFAITDHgpdmed   45
ident     | | |                                                   
Sbjct aLRIDSHQHFWRyraadypwigagmgvlarDYLPDALHPLMHAQALGASIAVQA------   54
DSSP  lLLEEEEELLLLllhhhllllllllhhhllLLLHHHHHHHHHHLLLLEEEEELL------


DSSP  LLLLHHHHHHHH--LLLEelleEEEEEEeeellllllllllLHHH-hhhLLEE-------
Query APHHWHFINMRI--WPRVvdgvGILRGIeaniknvdgeidcSGKM-fdsLDLI-------   95
ident                        |                         |          
Sbjct RAGRDETAFLLElaCDEA----RIAAVVgwedlrapqlaerVAEWrgtkLRGFrhqlqde  110
DSSP  LLLHHHHHHHHHhhLLLL----LEEEEEellllllllhhhhHHLLllllEEEEeelhhhl


DSSP  --------------------------EEELLllllllllhhHHHHHHHHHHHLL--LLLE
Query --------------------------IAGFHepvfaphdkaTNTQAMIATIASG--NVHI  127
ident                                                 |  |        
Sbjct advrafvddadfargvawlqandyvyDVLVF---------eRQLPDVQAFCARHdaHWLV  161
DSSP  llhhhhhhlhhhhhhhhhhhhllleeEELLL---------hHHHHHHHHHHHHLllLLEE


DSSP  ELLLLLLL------------LLLL-HHHHHHHhhhHLLEEEEELLL--------------
Query ISHPGNPK------------YEID-VKAVAEAaakHQVALEINNSS--------------  160
ident   | | |                      |       |                      
Sbjct LDHAGKPAlaefdrddtalaRWRAaLRELAAL---PHVVCKLSGLVteadwrrglrasdl  218
DSSP  EHHHHLLLhhhllllllhhhHHHHhHHHHHLL---LLEEEEELLLLllllllllllhhhh


DSSP  -----LHHHHHHHHHhhlLLEEEELLLLL----hhhllLLHHHHHHHHHlLLLHHH---L
Query -----NCREVAAAVRdagGWVALGSDSHT----aftmgEFEECLKILDAvDFPPER---I  208
ident             |          |||                                  
Sbjct rhieqCLDAALDAFG--pQRLMFGSDWPVcllaasydeVASLVERWAES-RLSAAErsaL  275
DSSP  hhhhhHHHHHHHHHL--hHHEEELLLLLHhhhlllhhhHHHHHHHHHHH-HLLHHHhhhH


DSSP  HHHlhhhHHHHHHhllllllhhhlll
Query LNVsprrLLNFLEsrgmapiaefadl  234
ident                           
Sbjct WGG---tAARCYA-----------lp  287
DSSP  LLH---hHHHHLL-----------ll


No 27: Query=1m65A Sbjct=1gkpA Z-score=8.8

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------yPVDLHMH    8
ident                                                        | | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeelEEEEEEL


DSSP  LLLLL---LLLLLHHHHHHHHHHHLLLEEEEEEELLLLLllllLHHHHH-HHHLLleelL
Query TVAST---HAYSTLSDYIAQAKQKGIKLFAITDHGPDMEdaphHWHFIN-MRIWPrvvdG   64
ident          |  |       |   |                                   
Sbjct IYLPFmatFAKDTHETGSKAALMGGTTTYIEMCCPSRND--daLEGYQLwKSKAE-gnsY  117
DSSP  LLLEElleELLLLHHHHHHHHHHLLEEEEEEEELLLLLL--lhHHHHHHhHHHHL-lllL


DSSP  EEEEEEEEEELLLllllllLLHHHH-HHLLEEEEE-LLLLLlllllhhhHHHHHHHHHHL
Query VGILRGIEANIKNvdgeidCSGKMF-DSLDLIIAG-FHEPVfaphdkatNTQAMIATIAS  122
ident                           |                          |  |   
Sbjct CDYTFHMAVSKFD-ektegQLREIVaDGISSFXIFlSYKNF-----fgvDDGEMYQTLRL  171
DSSP  LEEEEEEELLLLL-llhhhHHHHHHhLLLLEEEEEeLLLLL-----lllLHHHHHHHHHH


DSSP  L----LLLEElLLLLLLL----------------------------lLLHHHHHHHHH--
Query G----NVHIIsHPGNPKY----------------------------eIDVKAVAEAAA--  148
ident            |  |                                      |      
Sbjct AkelgVIVTA-HCENAELvgrlqqkllsegktgpewhepsrpeaveaEGTARFATFLEtt  230
DSSP  HhhhlLEEEE-EELLHHHhhhhhhhhhhlllllhhhllllllhhhhhHHHHHHHHHHHhh


DSSP  HHLLEEEEellllHHHHHHHHHHHL-----LLEEEElllllhhhlllLHHH---------
Query KHQVALEInnssnCREVAAAVRDAG-----GWVALGsdshtaftmgeFEEC---------  194
ident              |     |   |                                    
Sbjct GATGYVVH---lsCKPALDAAMAAKargvpIYIESV-----------IPHFlldktyaer  276
DSSP  LLEEEELL---llLHHHHHHHHHHHhllllEEEEEE-----------HHHHhllhhhhhl


DSSP  -------------------HHHHHHLllLHHHLHH-------------------------
Query -------------------LKILDAVdfPPERILN-------------------------  210
ident                     | |                                     
Sbjct ggveamkyimspplrdkrnQKVLWDAlaQGFIDTVgtdhcpfdteqkllgkeaftaipng  336
DSSP  lhhhhhlllllllllllhhHHHHHHHhhLLLLLEEelllllllhhhhhhhlllhhhllll


DSSP  ----------------------------HLHHHHHHHHHhllllllhhHLLL--------
Query ----------------------------VSPRRLLNFLEsrgmapiaeFADL--------  234
ident                                                 |           
Sbjct ipaiedrvnllytygvsrgrldihrfvdAASTKAAKLFG--------lFPRKgtiavgsd  388
DSSP  llllllhhhhhhhhhlllllllhhhhhhHHLHHHHHHLL--------lLLLLllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct adlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwg  448
DSSP  lleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelllllll


DSSP  ----------
Query ----------  234
ident           
Sbjct kllrrepmyf  458
DSSP  llllllllll


No 28: Query=1m65A Sbjct=4hk5D Z-score=8.7

back to top
DSSP  --LLEELLLLLLL-----------------------------------------------
Query --YPVDLHMHTVA-----------------------------------------------   11
ident     || | |                                                  
Sbjct tpVVVDIHTHMYPpsyiamlekrqtiplvrtfpqadeprlillsselaaldaaladpaak   60
DSSP  llLLEEEEEEELLhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhhlllll


DSSP  -----llllLLLHHHHHHHHHHHLLLEEEEEEEL-LLLLL------llLLHHHHHHHH--
Query -----sthaYSTLSDYIAQAKQKGIKLFAITDHG-PDMED------apHHWHFINMRI--   57
ident             |          ||    |                              
Sbjct lpgrplsthFASLAQKMHFMDTNGIRVSVISLANpWFDFLapdeapgiADAVNAEFSDmc  120
DSSP  llleellhhHLLHHHHHHHHHHLLLLEEEEEELLlLLLLLllllhhhhHHHHHHHHHHhh


DSSP  LLLEelleEEEEEE-eeellllllllllLHHHHHH--LLEE-------------------
Query WPRVvdgvGILRGI-eaniknvdgeidcSGKMFDS--LDLI-------------------   95
ident    |                                    |                   
Sbjct AQHV---gRLFFFAalplsapvdavkasIERVKNLkyCRGIilgtsglgkglddphllpv  177
DSSP  HLLL---lLEEEEEellllllhhhhhhhHHHHHLLllEEEEeelllllllllllhhhhhh


DSSP  -----------EEELLlllLLLL--------------------lhhHHHHHHHH------
Query -----------IAGFHepvFAPH--------------------dkaTNTQAMIA------  118
ident                |                                | |         
Sbjct feavadakllvFLHPH---YGLPnevygprseeyghvlplalgfpmETTIAVARmymagv  234
DSSP  hhhhhhllleeEELLL---LLLLhhhhlllhhhlllhhhhhlhhhhHHHHHHHHhhhllh


DSSP  --hhhLLLLlEELLLllllllLLHHH--------------------------hhhHHHHH
Query --tiaSGNVhIISHPgnpkyeIDVKA--------------------------vaeAAAKH  150
ident              |                                              
Sbjct fdhvrNLQM-LLAHS----ggTLPFLagriescivhdghlvktgkvpkdrrtiwtVLKEQ  289
DSSP  hhhllLLLE-EEHHH----hlLHHHHhhhhhhhhhllhhhhhllllllllllhhhHHHHL


DSSP  lLEEEEEllllHHHHHHHHHHHLL--LEEEELLLLL--------hhhllLLHHHHHHHHH
Query qVALEINnssnCREVAAAVRDAGG--WVALGSDSHT--------aftmgEFEECLKILDA  200
ident    |             |     |      | |                           
Sbjct -IYLDAV--iySEVGLQAAIASSGadRLMFGTDHPFfppieedvqgpwdSSRLNAQAVIK  346
DSSP  -EEEELL--llLHHHHHHHHHHHLhhHEELLLLLLLllllllllllllhHHHHHHHHHHH


DSSP  LL----lLHHHLHHHlhhHHHHHHHhlllllLHHHLLL----
Query VD----fPPERILNVsprRLLNFLEsrgmapIAEFADL----  234
ident                        |        ||        
Sbjct AVgegssDAAAVMGL---NAVRVLS-----lKAELEHHhhhh  380
DSSP  HHllllhHHHHHHLH---HHHHHLL-----lHHHHHHHhhhl


No 29: Query=1m65A Sbjct=3griA Z-score=8.6

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------yPVDLHMH    8
ident                                                       || | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeelEEEEEEL


DSSP  -LLLLLllLLLHHHHHHHHHHHLLLEEEEEE----ELLLllllllLHHHHH-HHHLLlee
Query -TVASThaYSTLSDYIAQAKQKGIKLFAITD----HGPDmedaphHWHFIN-MRIWPrvv   62
ident           |       |   |                        ||           
Sbjct lREPGGeyKETIETGTKAAARGGFTTVCPXPntrpVPDS------VEHFEAlQKLID-dn  113
DSSP  lLLLLLllLLLHHHHHHHHHHLLEEEEEELLllllLLLL------HHHHHHhHHHHH-hh


DSSP  llEEEEeEEEEEL---LLLLlLLLLLHhHHHHLLEEEEELLLlllllllhhHHHHHHHHH
Query dgVGILrGIEANI---KNVDgEIDCSGkMFDSLDLIIAGFHEpvfaphdkaTNTQAMIAT  119
ident   |  |                 |                                    
Sbjct aqVRVL-PYASITtrqLGKE-LVDFPA-LVKEGAFAFTDDGV-------gvQTASXXYEG  163
DSSP  llLEEL-LLEELLhhhLLLL-LLLHHH-HHLLLLLLEEELLL-------llLLHHHHHHH


DSSP  HHLL---LLLEELLlLLLL--------------------------llLLHHHHHHHHH--
Query IASG---NVHIISHpGNPK--------------------------yeIDVKAVAEAAA--  148
ident        |  |  |                                          |   
Sbjct XIEAakvNKAIVAH-CEDNsliyggaxhegkrskelgipgipnicesVQIARDVLLAEaa  222
DSSP  HHHHhhhLLLEEEL-LLLHhhllllleellhhhhhhllleellhhhhHHHHHHHHHHHhh


DSSP  HHLLEEEEellllHHHHHHHHHHHL-----LLEEeelllllhhhlllLHHHH--------
Query KHQVALEInnssnCREVAAAVRDAG-----GWVAlgsdshtaftmgeFEECL--------  195
ident                |     |||                           |        
Sbjct GCHYHVCH---vsTKESVRVIRDAKragihVTAE------------vTPHHLllteddip  267
DSSP  LLLEEELL---llLHHHHHHHHHHHhllllEEEE------------eLHHHHhllhhhll


DSSP  ------------------HHHHHlLLLHH-HLHH--------------------------
Query ------------------KILDAvDFPPE-RILN--------------------------  210
ident                     |                                       
Sbjct gnnaiykxnpplrstedrEALLE-GLLDGtIDCIatdhaphardekaqpxekapfgivgs  326
DSSP  lllhhhllllllllhhhhHHHHH-HHHLLlLLEEllllllllhhhhllllllllllllll


DSSP  ------------------------HLHHHHHHHHHhllllllhhHLLL------------
Query ------------------------VSPRRLLNFLEsrgmapiaeFADL------------  234
ident                                                             
Sbjct etafpllythfvkngdwtlqqlvdYLTIKPCETFNleygtlkenGYADltiidldseqei  386
DSSP  llhhhhhhhhhlllllllhhhhhhHHLHHHHHHLLlllllllllLLLLeeeeelllleel


DSSP  ------------------------------------
Query ------------------------------------  234
ident                                     
Sbjct kgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  lhhhllllllllllllleelleeeeeeelleeeeel


No 30: Query=1m65A Sbjct=3nqbA Z-score=8.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------------lLEEL-LLLLLllllLLLLHHHHHHHHHHHLLLEEEEEEEll
Query ------------------yPVDL-HMHTVasthAYSTLSDYIAQAKQKGIKLFAITDHgp   41
ident                      |              |   | |     |        |  
Sbjct srrdaaqvidaggayvspgLIDThXHIES----SXITPAAYAAAVVARGVTTIVWDPH--  114
DSSP  lllleeeeeelllleeeelEEEEeELHHH----HLLLHHHHHHHHHLLLEEEEEELLH--


DSSP  llllLLLL-HHHHHHHH-LLLEEllEEEEEEEEEE--LLLL-------llllLLLHhHHH
Query dmedAPHH-WHFINMRI-WPRVVdgVGILRGIEAN--IKNV-------dgeiDCSGkMFD   90
ident       |                                                     
Sbjct -efgNVHGvDGVRWAAKaIENLP--LRAILLAPSCvpSAPGlerggadfdaaILAD-LLS  170
DSSP  -hhhHHHLhHHHHHHHHhHLLLL--LEEEEEELLLllLLLLlllllllllhhHHHH-HHL


DSSP  H--LLEEEEELLllllllllhhhhhHHHH------hhhHLLL-----LLEElLLLLllll
Query S--LDLIIAGFHepvfaphdkatntQAMI------atiASGN-----VHIIsHPGNpkye  137
ident       |                     |                       |       
Sbjct WpeIGGIAEIXN------------xRGVIerdprxsgiVQAGlaaekLVCG-HARG----  213
DSSP  LllEEEEEEELL------------hHHHHlllhhhhhhHHHHhhhllEEEE-LLLL----


DSSP  lLHHHHHHHHHH-HLLEEEEelllLHHHHHHHHHHHLLLEEEElllllhhhllLLHH-HH
Query iDVKAVAEAAAK-HQVALEInnssNCREVAAAVRDAGGWVALGsdshtaftmgEFEE-CL  195
ident     |   |                  |   |   ||    |                 |
Sbjct -LKNADLNAFXAaGVSSDHE---lVSGEDLXAKLRAGLTIELR----------GSHDhLL  259
DSSP  -LLHHHHHHHHHlLLLEELL---lLLHHHHHHHHHLLLEEEEE----------LLLHhHH


DSSP  HHHHHLL----lLHHHLHH-----------------------------------HLHHHH
Query KILDAVD----fPPERILN-----------------------------------VSPRRL  216
ident     |        |                                              
Sbjct PEFVAALntlghLPQTVTLctddvfpddllqggglddvvrrlvryglkpewalrAATLNA  319
DSSP  HHHHHHHhhhllLLLLEEEelllllhhhhhhlllhhhhhhhhhhllllhhhhhhHHLHHH


DSSP  HHHHH--hllllllhhHLLL----------------------------------------
Query LNFLE--srgmapiaeFADL----------------------------------------  234
ident    |             ||                                         
Sbjct AQRLGrsdlgliaagrRADIvvfedlngfsarhvlasgravaeggrxlvdiptcdttvlk  379
DSSP  HHHHLlllllllllllLLLEeeellllllleeeeeelleeeeelleelllllllllhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct gsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvth  439
DSSP  lllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct rhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxa  499
DSSP  lllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct vasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatla  559
DSSP  eeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllll


DSSP  ----------------------------
Query ----------------------------  234
ident                             
Sbjct cnigphqtdxgiadvltgkvxespviev  587
DSSP  llllleelllleeelllleeellleeel


No 31: Query=1m65A Sbjct=4b3zD Z-score=8.3

back to top
DSSP  -----------------------------------------------------lLEELLL
Query -----------------------------------------------------yPVDLHM    7
ident                                                         |   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipgGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeelEEEEEE


DSSP  LLLLllllLLLHHHHHHHHHHHLLLEEEEEEELLLLlllllLHHHHH-HHHLLleelLEE
Query HTVAsthaYSTLSDYIAQAKQKGIKLFAITDHGPDMedaphHWHFIN-MRIWPrvvdGVG   66
ident                   |   |                     |               
Sbjct YLQK--taADDFFQGTRAALVGGTTMIIDHVVPEPG--sslLTSFEKwHEAAD-tksCCD  115
DSSP  LLLL--llLLLHHHHHHHHHHLLEEEEEEEELLLLL--llhHHHHHHhHHHHH-lllLLE


DSSP  EEEEEEEELLLllllllLLHHHH--HHLLEEEEEL-LLLLLllllhhhHHHHHHHHHHLL
Query ILRGIEANIKNvdgeidCSGKMF--DSLDLIIAGF-HEPVFaphdkatNTQAMIATIASG  123
ident                                        |                    
Sbjct YSLHVDITSWY-dgvreELEVLVqdKGVNSFQVYMaYKDVY-----qmSDSQLYEAFTFL  169
DSSP  EEEEEELLLLL-llhhhHHHHHHhlLLLLEEEEELlLLLLL-----llLHHHHHHHHHHH


DSSP  ----LLLEELlLLLLL----------------------------llLLHHHHHHHHH--H
Query ----NVHIIShPGNPK----------------------------yeIDVKAVAEAAA--K  149
ident      |       |                                  |      |    
Sbjct kglgAVILVH-AENGDliaqeqkrilemgitgpeghalsrpeeleaEAVFRAITIAGriN  228
DSSP  hhhlLEEEEE-LLLHHhhhhhhhhhhhllllllhhhhhhllhhhhhHHHHHHHHHHHhhL


DSSP  HLLEEEEellllHHHHHHHHHHHL-----LLEEE--------------------------
Query HQVALEInnssnCREVAAAVRDAG-----GWVAL--------------------------  178
ident   |             |     |                                     
Sbjct CPVYITK---vmSKSAADIIALARkkgplVFGEPiaaslgtdgthywsknwakaaafvts  285
DSSP  LLEEEEE---elLHHHHHHHHHHHhhlllEEEEElhhhhhlllhhhhlllhhhhhhllll


DSSP  -------------------------ELLLLL-------------------HHHL--LLLH
Query -------------------------GSDSHT-------------------AFTM--GEFE  192
ident                          ||                                 
Sbjct pplspdpttpdyltsllacgdlqvtGSGHCPystaqkavgkdnftlipegVNGIeeRMTV  345
DSSP  llllllllhhhhhhhhhhhllllllLLLLLLllhhhhhhhlllhhhllllLLLLllHHHH


DSSP  hhhhhhhhllllhhhlhhHLHHHHHHHHH-------------------------------
Query eclkildavdfpperilnVSPRRLLNFLE-------------------------------  221
ident                   |                                         
Sbjct vwdkavatgkmdenqfvaVTSTNAAKIFNlyprkgriavgsdadvviwdpdklktitaks  405
DSSP  hhhhhlllllllhhhhhhHHLHHHHHHHLllllllllllllllleeeeeeeeeeelllll


DSSP  -----------------------------------------------hLLLL--------
Query -----------------------------------------------sRGMA--------  226
ident                                                             
Sbjct hksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkAFPEhlyqrvki  465
DSSP  llllllllllllleeeeeeeeeeelleeeeelleelllllllllllllLLLHhhhhhhhh


DSSP  ----llhhhlll
Query ----piaefadl  234
ident             
Sbjct rnkvfglqgvsr  477
DSSP  hhhhllllllll


No 32: Query=1m65A Sbjct=2ob3A Z-score=8.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag   60
DSSP  lleeelleeelhhhhlleeeeelleellllhhhhlhhhhllhhhhhhhhhhhhhhhhhll


DSSP  LLEELLLLllLLLLLllLHHHHHHHHHHHLLLeEEEEEELlLLLL---------llLLHH
Query YPVDLHMHtvASTHAysTLSDYIAQAKQKGIKlFAITDHGpDMED---------apHHWH   51
ident                    |                                        
Sbjct VRTIVDVS-tFDIGR--DVSLLAEVSRAADVH-IVAATGL-WFDPplsmrlrsveeLTQF  115
DSSP  LLEEEELL-lHHHLL--LHHHHHHHHHHHLLE-EELEEEL-LLLLlhhhhlllhhhHHHH


DSSP  HHH-HHHLlleelleeeeEEEEEELLLLL---lllLLLH--HHHHH-lLEEEEELlllll
Query FIN-MRIWprvvdgvgilRGIEANIKNVD---geiDCSG--KMFDS-lDLIIAGFhepvf  104
ident |                   |                                       
Sbjct FLReIQYG--iedtgiraGIIXVATTGKAtpfqelVLKAaaRASLAtgVPVTTHT-----  168
DSSP  HHHhHHLL--llllllllLEEEEELLLLLlhhhhhHHHHhhHHHHHhlLLEEEEL-----


DSSP  llllhhhHHHHHHHHhHLLL--------lLEELLLLLllllLLHHHHHHHHHHHLLEEEE
Query aphdkatNTQAMIATiASGN--------vHIISHPGNpkyeIDVKAVAEAAAKHQVALEI  156
ident                 |              | |        |      | |        
Sbjct -----aaSQRDGEQQ-AAIFeseglspsrVCIGHSDD----TDDLSYLTALAARGYLIGL  218
DSSP  -----lhHHLHHHHH-HHHHhhllllhhhEEELLHHH----LLLHHHHHHHHHLLLEEEE


DSSP  E----------------------lllLHHHHHHHHHHHLL--LEEEELLLLL--------
Query N----------------------nssNCREVAAAVRDAGG--WVALGSDSHT--------  184
ident                                  |  | |         |           
Sbjct DhipysaiglednasasallgirswqTRALLIKALIDQGYmkQILVSNDWTFgfssyvtn  278
DSSP  LllllllllllllhhhhhhhllllhhHHHHHHHHHHHLLLhhHEEELLLLLLeellllll


DSSP  ------hhhllLLHHHH-HHHHHLL------lLHHHLHHHlhhHHHHHHHhlLLLLlhhh
Query ------aftmgEFEECL-KILDAVD------fPPERILNVsprRLLNFLEsrGMAPiaef  231
ident                                     |          ||           
Sbjct imdvmdrvnpdGMAFIPlRVIPFLRekgvpqeTLAGITVT---NPARFLS--PTLR----  329
DSSP  hhhhhhhhlllHHHHHHhLHHHHHHhllllhhHHHHHHLH---HHHHHHL--LLLL----


DSSP  lll
Query adl  234
ident    
Sbjct ---  329
DSSP  ---


No 33: Query=1m65A Sbjct=1onxA Z-score=8.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  --LLEELLLL-LLLLL------LLLLLhhhHHHHHHHHLLLEEEEEEELlllllLLLLhH
Query --YPVDLHMH-TVAST------HAYSTlsdYIAQAKQKGIKLFAITDHGpdmedAPHHwH   51
ident      | | |                            |                    |
Sbjct cpGFIDQHVHlIGGGGeagpttRTPEV---ALSRLTEAGVTSVVGLLGT-----DSISrH  112
DSSP  eeLEEEEEELlLLLLLlllhhhLLLLL---LHHHHHHLLEEEEEELLLL-----LLLLlL


DSSP  HHHHHH--LLLEELLEEEEEEEEEElllllllLLLL------HHHHH---hLLEEEEEL-
Query FINMRI--WPRVVDGVGILRGIEANiknvdgeIDCS------GKMFD---sLDLIIAGF-   99
ident               |        |                   |                
Sbjct PESLLAktRALNEEGISAWMLTGAY------hVPSRtitgsvEKDVAiidrVIGVXCAIs  166
DSSP  HHHHHHhhHHHHHHLLEEEEEEELL------lLLLLlllllhHHHHHhlllEEEEEEEEl


DSSP  LLLL-------------------------------llLLLHhhHHHHHH-----hhhHLL
Query HEPV-------------------------------faPHDKatNTQAMI-----atiASG  123
ident                                         |    |              
Sbjct DHRSaapdvyhlanmaaesrvggllggkpgvtvfhmgDSKK--ALQPIYdllencdvPIS  224
DSSP  LLLLllllhhhhhhhhhhhhhhhhhhlllleeeeeelLLLL--LLHHHHhhhhllllLHH


DSSP  LLlEELLLLLLllLLLHHHHHHHHHHHLLeEEEELLL----LHHHHHHHHHHHLL---LE
Query NVhIISHPGNPkyEIDVKAVAEAAAKHQVaLEINNSS----NCREVAAAVRDAGG---WV  176
ident       |              | | |      |  |        |  |    ||     |
Sbjct KL-LPTHVNRN--VPLFEQALEFARKGGT-IDITSSIdepvAPAEGIARAVQAGIplaRV  280
DSSP  HE-EEELHHHL--HHHHHHHHHHHHLLLL-EEEELLLllllLHHHHHHHHHHLLLlhhHE


DSSP  EEELLLL---------------lhhHLLLLHHHHHHHH-HLLLL--HHHLHHHLhhHHHH
Query ALGSDSH---------------tafTMGEFEECLKILD-AVDFP--PERILNVSprRLLN  218
ident  | ||                          |    |    ||          |      
Sbjct TLSSDGNgsqpffddegnlthigvaGFETLLETVQVLVkDYDFSisDALRPLTS--SVAG  338
DSSP  EEELLLLleeeeellllleeeeeelLLHHHHHHHHHHHhHHLLLhhHHHHHHLH--HHHH


DSSP  HHH-hllllllhhHLLL-----------------------------------
Query FLE-srgmapiaeFADL-----------------------------------  234
ident ||                                                  
Sbjct FLNltgkgeilpgNDADllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  HLLllllllllllLLLLeeeellllleeeeeelleeeeelleelllllllll


No 34: Query=1m65A Sbjct=3k2gB Z-score=8.2

back to top
DSSP  ---------------------------LLEELLLL-LLLLL-------------------
Query ---------------------------YPVDLHMH-TVAST-------------------   13
ident                                 | |                         
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHlQNDCRcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLlLEELHhhllllllhhhhhhhhlll


DSSP  ------------------LLLLlhHHHHHHHHHHL---LLEEEEEEE-------------
Query ------------------HAYStlSDYIAQAKQKG---IKLFAITDH-------------   39
ident                    |       ||  ||                           
Sbjct sieilselrqdpfvnkhnIALDdlDLAIAEVKQFAavgGRSIVDPTCrgigrdpvklrri  120
DSSP  lhhhhhhhhllhhhllllLEELlhHHHHHHHHHHHhllLLEEEELLLllllllhhhhhhh


DSSP  ------------LLLL-LLLL----------llHHHHHHHHllleelleeeEEEEEEELL
Query ------------GPDM-EDAP----------hhWHFINMRIwprvvdgvgiLRGIEANIK   76
ident             |       |                                  |    
Sbjct saetgvqvvxgaGYYLaSSXPetaarlsaddiaDEIVAEALegtdgtdariGLIGEIGVS  180
DSSP  hhhhlleeeellLLLLhHHLLhhhhlllhhhhhHHHHHHHHllllllllllLLEEEELLL


DSSP  LLL---lLLLLLH--HHHHH-lLEEEEELLllllllllhhhHHHHHHHHhHLLL------
Query NVD---gEIDCSG--KMFDS-lDLIIAGFHepvfaphdkatNTQAMIATiASGN------  124
ident        |    |                                               
Sbjct SDFtaeeEKSLRGaaRAQVRtgLPLXVHLP----------gWFRLAHRV-LDLVeeegad  229
DSSP  LLLlhhhHHHHHHhhHHHHHhlLLEEELLL----------lLLLLHHHH-HHHHhhllll


DSSP  --lLEELLLLLllllLLHHHHHHHHhHHLLEEEE-ELLL---------------LHHHHH
Query --vHIISHPGNpkyeIDVKAVAEAAaKHQVALEI-NNSS---------------NCREVA  166
ident        |        |    |  |      ||                           
Sbjct lrhTVLCHXNP--shXDPVYQATLA-QRGAFLEFdXIGXdffyadqgvqcpsddEVARAI  286
DSSP  hhhEEELLLHH--hlLLHHHHHHHH-HHLLEEEElLLLLlleelllleelllhhHHHHHH


DSSP  HHHHHHLL--LEEEELLLLL--------hhHLLLL-HHHHHHHHHLLL---LHHHlHHHL
Query AAVRDAGG--WVALGSDSHT--------afTMGEF-EECLKILDAVDF---PPERiLNVS  212
ident     | |      |  |                      |  |          |  | | 
Sbjct LGLADHGYldRILLSHDVFVkxxltryggnGYAFVtKHFLPRLRRHGLddaALET-LXVT  345
DSSP  HHHHHLLLhhHEEELLLLLLhhhlhhhlllLLLHHhHLHHHHHHHLLLlhhHHHH-HHLH


DSSP  hhHHHHHHHHllllllhhhlll
Query prRLLNFLESrgmapiaefadl  234
ident                       
Sbjct --NPRRVFDA-------siegh  358
DSSP  --HHHHHHLL-------lllll


No 35: Query=1m65A Sbjct=2dvtA Z-score=8.2

back to top
DSSP  --LLEELLLLLL---LLLL---------------lLLLHH-HHHHHHHHHLLLEEEEEEE
Query --YPVDLHMHTV---ASTH---------------aYSTLS-DYIAQAKQKGIKLFAITDH   39
ident     | |  |                                        ||        
Sbjct mqGKVALEEHFAipeTLQDsagfvpgdywkelqhrLLDIQdTRLKLMDAHGIETMILSLN   60
DSSP  llLEEEEEEEELlhhHHHHhlllllllhhhhhhhhHHLLLlHHHHHHHHLLEEEEEEEEL


DSSP  L-LLLLL-------lLLLHHHHHHHH--LLLEellEEEEEEeeeellllllllllLHHHH
Query G-PDMED-------aPHHWHFINMRI--WPRVvdgVGILRGieaniknvdgeidcSGKMF   89
ident                               |       |                     
Sbjct ApAVQAIpdrrkaieIARRANDVLAEecAKRP---DRFLAFaalplqdpdaateeLQRCV  117
DSSP  LlHHHHLllhhhhhhHHHHHHHHHHHhhHHLL---LLEEEEellllllhhhhhhhHHHHH


DSSP  H--HLLEE------------------------------------EEELLLL---------
Query D--SLDLI------------------------------------IAGFHEP---------  102
ident                                                   |         
Sbjct NdlGFVGAlvngfsqegdgqtplyydlpqyrpfwgevekldvpfYLHPRNPlpqdsriyd  177
DSSP  HllLLLEEeeellllllllllllllllhhhhhhhhhhhhhllleEEELLLLlhhhlhhhl


DSSP  ------llllllhhhhHHHHHHH--------hhLLLLlEELLLLLllllLLHHH------
Query ------vfaphdkatnTQAMIAT--------iaSGNVhIISHPGNpkyeIDVKA------  142
ident                                    |  |  | |                
Sbjct ghpwllgptwafaqetAVHALRLmasglfdehpRLNI-ILGHMGE----GLPYMmwridh  232
DSSP  llhhhlhhhlhhhhhhHHHHHHHhhllhhhhllLLLE-EELHHHL----LHHHHhhhhhh


DSSP  ----------------hhhHHHHHlLEEEEELlllHHHHHHHHHHHLL--LEEEELLLLL
Query ----------------vaeAAAKHqVALEINNssnCREVAAAVRDAGG--WVALGSDSHT  184
ident                                                |        |   
Sbjct rnawvklpprypakrrfmdYFNEN-FHITTSG-nfRTQTLIDAILEIGadRILFSTDWPF  290
DSSP  llllllllllllllllhhhHHHHH-EEEELLL-llLHHHHHHHHLLLLhhHEELLLLLLL


DSSP  hhHLLLL-HHHHHhhHHLL-lLHHHLHHHlhhHHHHHHHhllllllhhhlll
Query afTMGEF-EECLKilDAVD-fPPERILNVsprRLLNFLEsrgmapiaefadl  234
ident                          |                          
Sbjct -eNIDHAsDWFNA--TSIAeaDRVKIGRT---NARRLFK-----------ld  325
DSSP  -lLHHHHhHHHHH--LLLLhhHHHHHHLH---HHHHHLL-----------ll


No 36: Query=1m65A Sbjct=1itqA Z-score=8.2

back to top
DSSP  --------------LLEELLLLL--LLLL-------------lllllhhHHHHHHHHHLL
Query --------------YPVDLHMHT--VAST-------------haystlsDYIAQAKQKGI   31
ident                  | |                               |        
Sbjct dffrdeaerimrdsPVIDGHNDLpwQLLDmfnnrlqderanlttlagthTNIPKLRAGFV   60
DSSP  lhhhhhhhhhhlllLEEEEEELHhhHHHHhhllllllhhhlllllllllLLHHHHHHLLE


DSSP  LEEEEEEElLLLLL-----llLLHHHHH-HHHL---LLEE---------------LLEEE
Query KLFAITDHgPDMED-----apHHWHFIN-MRIW---PRVV---------------DGVGI   67
ident                                                         |   
Sbjct GGQFWSVY-TPCDTqnkdavrRTLEQMDvVHRMcrmYPETflyvtssagirqafrEGKVA  119
DSSP  EEEEEEEL-LLHHHllllhhhHHHHHHHhHHHHhhhLLLLeeelllhhhhhhhhhLLLEE


DSSP  EEEEEEElllllllLLLL-------HHHH-HHLLeEEEELLLLL-----LLLLL------
Query LRGIEANiknvdgeIDCS-------GKMF-DSLDlIIAGFHEPV-----FAPHD------  108
ident                                         |            |      
Sbjct SLIGVEG-------GHSIdsslgvlRALYqLGMR-YLTLTHSCNtpwadNWLVDtgdsep  171
DSSP  EEEEEEL-------HHHLlllhhhhHHHHhLLEE-EEELLLLLLlllllLHHHLllllll


DSSP  -------------------------hhhHHHHHHHHHHLL-llLEEL-LLLL---LLLLl
Query -------------------------katNTQAMIATIASG-nvHIIS-HPGN---PKYEi  138
ident                                 | ||        | |             
Sbjct qsqglspfgqrvvkelnrlgvlidlahvSVATMKATLQLSrapVIFShSSAYsvcASRRn  231
DSSP  llllllhhhhhhhhhhhhhlleeellllLHHHHHHHHHHLlllLEELlLLLLlllLLLLl


DSSP  lHHHHHHHHHHHLLEEEEELLL----------------LHHHHHHHHHhhlLLEEEELLL
Query dVKAVAEAAAKHQVALEINNSS----------------NCREVAAAVRdagGWVALGSDS  182
ident     |             |                                  |  | | 
Sbjct vPDDVLRLVKQTDSLVMVNFYNnyisctnkanlsqvadHLDHIKEVAG--aRAVGFGGDF  289
DSSP  lLHHHHHHHHHHLLEEEELLLHhhhlllllllhhhhhhHHHHHHHHLL--hHHEEELLLL


DSSP  L-------lhHHLL-LLHHhhhhhHHLL--lLHHHLHHHlhhhHHHHHHHLL--------
Query H-------taFTMG-EFEEclkilDAVD--fPPERILNVsprrLLNFLESRG--------  224
ident                                     |      ||   |           
Sbjct DgvprvpeglEDVSkYPDLiaellRRNWteaEVKGALAD---nLLRVFEAVEqasnltqa  346
DSSP  LlllllllllLLLLlHHHHhhhhhHLLLlhhHHHHHHLH---hHHHHHHHHHhlllllll


DSSP  -------------llllhhhlll
Query -------------mapiaefadl  234
ident                        
Sbjct peeepipldqlggscrthygyss  369
DSSP  lllllllhhhlllllllllllll


No 37: Query=1m65A Sbjct=2imrA Z-score=8.1

back to top
DSSP  -------------------------------------------------------lLEEL
Query -------------------------------------------------------yPVDL    5
ident                                                         ||  
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviappPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelllLLEE


DSSP  LLL-LLLL------------------LLLL---lLHHHHHHHHHHHLLLEEEEEEellll
Query HMH-TVAS------------------THAY---sTLSDYIAQAKQKGIKLFAITDhgpdm   43
ident | |                                           |             
Sbjct HTHlDMSAyefqalpyfqwipevvirGRHLrgvaAAQAGADTLTRLGAGGVGDIV-----  115
DSSP  EEElLLLHhhhhhlhhhhllhhhhhhHLLLlhhhHHHHHHHHHHHLLLLLEEEEE-----


DSSP  llllllhHHHH-HHHL-LLEEllEEEEEEE---eeellllllllllLHHHHH--------
Query edaphhwHFIN-MRIW-PRVVdgVGILRGI---eaniknvdgeidcSGKMFD--------   90
ident             |     |                                         
Sbjct -------WAPEvMDALlARED--LSGTLYFevlnpfpdkadevfaaARTHLErwrrlerp  166
DSSP  -------LLHHhHHHHhLLLL--LLEEEEEeellllhhhhhhhhhhHHHHHHhhhlllll


DSSP  --hLLEE--------------------------EEEL--lllllLLLL------------
Query --sLDLI--------------------------IAGF--hepvfAPHD------------  108
ident    | |                                                      
Sbjct glrLGLSphtpftvshrlmrllsdyaageglplQIHVaehptelEMFRtgggplwdnrmp  226
DSSP  leeEEEEelllllllhhhhhhhhhhhhhhllllEEEElllhhhhHHHHhlllllhhhllh


DSSP  ----------------hHHHH-HHHHH-hHHLLLLlEELLLLLlllllLHHHHHHHHHHH
Query ----------------kATNT-QAMIA-tIASGNVhIISHPGNpkyeiDVKAVAEAAAKH  150
ident                                        |  |              |  
Sbjct alyphtlaevigrepgpDLTPvRYLDElgVLAARP-TLVHMVN-----VTPDDIARVARA  280
DSSP  hhllllhhhhhllllllLLLHhHHHHHhlLHHHLL-EEEELLL-----LLHHHHHHHHHH


DSSP  LLEEEE-ELLL-----LHHHhHHHHHHHLLLEEEELLLLL-hHHLLL--LHHHHH-HHHH
Query QVALEI-NNSS-----NCREvAAAVRDAGGWVALGSDSHT-aFTMGE--FEECLK-ILDA  200
ident   |      |             |   ||  |||| ||     |                
Sbjct GCAVVTcPRSNhhlecGTFD-WPAFAAAGVEVALGTDSVAsgETLNVreEVTFARqLYPG  339
DSSP  LLLEEElHHHHhhlllLLLL-HHHHHHLLLLEEELLLLHHhhLLLLLhhHHHHHHhHLLL


DSSP  LLLLHhhLHHHL-hHHHHH------hhhhllllllhhhlll
Query VDFPPerILNVS-pRRLLN------flesrgmapiaefadl  234
ident  |        |    |                         
Sbjct LDPRVlvRAAVKggQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  LLHHHhhHHHHHhhHHHHLlllllllllllhhhlhhhllll


No 38: Query=1m65A Sbjct=1j6pA Z-score=7.9

back to top
DSSP  ---------------------------------------------------LLEELLLLl
Query ---------------------------------------------------YPVDLHMHt    9
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTH-   59
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEEL-


DSSP  llllLLLL-----------------------------LHHHHHHHHHHHL---LLEEEEE
Query vastHAYS-----------------------------TLSDYIAQAKQKG---IKLFAIT   37
ident                                           |          |  |   
Sbjct ---aPXTLlrgvaedlsfeewlfskvlpiedrltekxAYYGTILAQXEXArhgIAGFVDX  116
DSSP  ---hHHHHhllllllllhhhhhhllhhhhhllllhhhHHHHHHHHHHHHHlllEEEEEEE


DSSP  E---------------------ELLL--lllllLLHHHHH-HHHL-LLEElleEEEEEEE
Query D---------------------HGPD--medapHHWHFIN-MRIW-PRVVdgvGILRGIE   72
ident                          |                  |         |  |  
Sbjct YfheewiakavrdfgxralltrGLVDsngddggRLEENLKlYNEWnGFEG---RIFVGFG  173
DSSP  EllhhhhhhhhhhhlleeeeeeEELLlllllllHHHHHHHhHHHHlLHHH---LEEEEEE


DSSP  EELLL---lllLLLLLHHHHHHlLEEEEELllllllLLLHhHHHHHHHHhhHLLLLLEEL
Query ANIKN---vdgEIDCSGKMFDSlDLIIAGFhepvfaPHDKaTNTQAMIAtiASGNVHIIS  129
ident                                                          |  
Sbjct PHSPYlcseeyLKRVFDTAKSLnAPVTIHL---yetSKEE-YDLEDILNigLKEVKTIAA  229
DSSP  ELLLLlllhhhHHHHHHHHHHHlLLEEEEE---lllLLLL-LLLHHHHLllLLLLLEEEE


DSSP  LLLLllllLLHHHhHHHHHHHLLEEEEELLL------LHHHhHHHHHHHLLLEEEELLLL
Query HPGNpkyeIDVKAvAEAAAKHQVALEINNSS------NCREvAAAVRDAGGWVALGSDSH  183
ident |                          |  |                  |  | || |  
Sbjct HCVH----LPERY-FGVLKDIPFFVSHNPASnlklgnGIAP-VQRXIEHGXKVTLGTDGA  283
DSSP  ELLL----LLHHH-HHHHLLLLEEEEELHHHhhhlllLLLL-HHHHHHLLLEEEELLLLL


DSSP  L-hHHLLLLHHHHHHHHHL------LLLHHH--LHHHLhhHHHHHHHhllllllhhHLLL
Query T-aFTMGEFEECLKILDAV------DFPPER--ILNVSprRLLNFLEsrgmapiaeFADL  234
ident         | |                                                 
Sbjct AsnNSLNLFFEXRLASLLQkaqnprNLDVNTclKXVTY--DGAQAXGfksgkieegWNAD  341
DSSP  LllLLLLHHHHHHHHHHHHhlllllLLLHHHhhHHHLH--HHHHHHLlllllllllLLLL


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  234
ident                                                             
Sbjct lvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelari  401
DSSP  eeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhh


DSSP  ------
Query ------  234
ident       
Sbjct ekelys  407
DSSP  hhhhhl


No 39: Query=1m65A Sbjct=3ls9A Z-score=7.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgli   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct nshqhlyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevaravllesll  120
DSSP  eeeelhhhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhh


DSSP  --LLEELLLLLlLLLL--llLLHHHHHHHHHHHLLLEEEEEEELLL---------lLLLL
Query --YPVDLHMHTvASTH--aySTLSDYIAQAKQKGIKLFAITDHGPD---------mEDAP   47
ident          |          |     |  |   ||   |                     
Sbjct ggITTVADQHL-FFPGatadSYIDATIEAATDLGIRFHAARSSMTLgkseggfcddLFVE  179
DSSP  llEEEEEEEEL-LLLLllllLHHHHHHHHHHHHLLEEEEEELLLLLlhhhlllllhHHLL


DSSP  LLHHHHH-HHHL--LLEE---lLEEEEEEEEEELLlllllLLLL---HHHHHHL----LE
Query HHWHFIN-MRIW--PRVV---dGVGILRGIEANIKnvdgeIDCS---GKMFDSL----DL   94
ident                       |                  |                  
Sbjct PVDRVVQhCLGLidQYHEpepfGMVRIALGPCGVP-----YDKPelfEAFAQMAadydVR  234
DSSP  LHHHHHHhHHHHhhHHLLllllLLEEEEELLLLLL-----LLLHhhhHHHHHHHhhhlLE


DSSP  EEEELllllLLLL-lhhhhhHHHHHHhHLLLL----LEELLLLllllLLLHHHHhHHHHH
Query IIAGFhepvFAPH-dkatntQAMIATiASGNV----HIISHPGnpkyEIDVKAVaEAAAK  149
ident     |     |                             |                 | 
Sbjct LHTHFyeplDAGMsdhlygmTPWRFL-EKHGWasdrVWLAHAV----VPPREEI-PEFAD  288
DSSP  EEEEEllllHHHHhhhhhllLHHHHH-HHLLLllllEEEEELL----LLLHHHH-HHHHH


DSSP  HLLEEEEELLL------LHHHhHHHHHHHLLLEEEELLLllhhhllLLHHHHHHHH----
Query HQVALEINNSS------NCREvAAAVRDAGGWVALGSDShtaftmgEFEECLKILD----  199
ident   ||                       |||  |  |               |        
Sbjct AGVAIAHLIAPdlrmgwGLAP-IREYLDAGITVGFGTTGsasndggNLLGDLRLAAlahr  347
DSSP  HLLEEEELHHHhhhlllLLLL-HHHHHHLLLEEEELLLLlllllllLHHHHHHHHHhhlh


DSSP  -----------HLLLLHH---HLHHhlhhHHHH---------------------------
Query -----------AVDFPPE---RILNvsprRLLN---------------------------  218
ident                      |                                      
Sbjct padpnepekwlSARELLRmatRGSA--ecLGRPdlgvleegraadiacwrldgvdrvgvh  405
DSSP  hhllllhhhllLHHHHHHhllHHHH--hhLLLLlllllllllllleeeeelllhhhllll


DSSP  --------------------------------hhhhllllllhhhlll
Query --------------------------------flesrgmapiaefadl  234
ident                                                 
Sbjct dpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 40: Query=1m65A Sbjct=2uz9A Z-score=7.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------lLEELLLLLL-----------------------LLLL------lllLHHHH
Query ---------yPVDLHMHTV-----------------------ASTH------aysTLSDY   22
ident            || | |                         |                 
Sbjct lshheffmpgLVDTHIHASqysfagssidlpllewltkytfpAEHRfqnidfaeeVYTRV  120
DSSP  llllleeeelEEEEEEEHHhhhhllllllllhhhhhhhlhhhHHHHhhlhhhhhhHHHHH


DSSP  HHHHHHHLLLEEEEEEellllllLLLLHHHhhhhhLLLEELLEEEEEE------------
Query IAQAKQKGIKLFAITDhgpdmedAPHHWHFinmriWPRVVDGVGILRG------------   70
ident        |                 |               |     |            
Sbjct VRRTLKNGTTTACYFA-------TIHTDSS-lllaDITDKFGQRAFVGkvcmdlndtfpe  172
DSSP  HHHHHHLLEEEEEEEL-------LLLHHHH-hhhhHHHHHHLLEEEEEleelllllllll


DSSP  ------------------------------EEEELLL-------llllllLLHHHHhhll
Query ------------------------------IEANIKN-------vdgeidCSGKMFdsld   93
ident                                                             
Sbjct yketteesiketerfvsemlqknysrvkpiVTPRFSLscsetlmgelgniAKTRDL----  228
DSSP  llllhhhhhhhhhhhhhhhhhhlllleeeeEEELLHHhllhhhhhhhhhhHHHHLL----


DSSP  EEEEEL---lllllLLLL--HHHHhHHHHHHHHLLLL---LEELLLLLllllllHHHHHH
Query LIIAGF---hepvfAPHD--KATNtQAMIATIASGNV---HIISHPGNpkyeidVKAVAE  145
ident  |            |                             |               
Sbjct HIQSHIsenrdeveAVKNlyPSYK-NYTSVYDKNNLLtnkTVMAHGCY-----lSAEELN  282
DSSP  EEEEEElllhhhhhHHHHhlLLLL-LHHHHHHHLLLLlllEEEEELLL-----lLHHHHH


DSSP  HHHHHLLEEEEELLL------LHHHhHHHHHHHLLLEEEELLLLlhhHLLL---LHHHHH
Query AAAKHQVALEINNSS------NCREvAAAVRDAGGWVALGSDSHtafTMGE---FEECLK  196
ident               |              |        || |                  
Sbjct VFHERGASIAHCPNSnlslssGFLN-VLEVLKHEVKIGLGTDVAggySYSMldaIRRAVM  341
DSSP  HHHHHLLEEEELHHHhhhlllLLLL-HHHHHHLLLEEEELLLLLlllLLLHhhhHHHHHH


DSSP  HHHHLL----------llhhhlHHHL---hhhHHHH-hhhlllLLLH-------------
Query ILDAVD----------fpperiLNVS---prrLLNF-lesrgmAPIA-------------  229
ident                       |          |                          
Sbjct VSNILLinkvneksltlkevfrLATLggsqalGLDGeignfevGKEFdailinpkasdsp  401
DSSP  HHHHHHhlllllllllhhhhhhHHLHhhhhhlLLLLlllllllLLLLleeeellllllll


DSSP  ---------------------------------HHLL-----l
Query ---------------------------------EFAD-----l  234
ident                                            
Sbjct idlfygdffgdiseaviqkflylgddrnieevyVGGKqvvpfs  444
DSSP  lllllhhhhlllllhhhhhhhhhllhhheeeeeELLEeeelll


No 41: Query=1m65A Sbjct=4rdvB Z-score=7.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlpgmpnlhshafq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeeleeeeeelhhh


DSSP  ---------------------------------------------------LLEELLLLL
Query ---------------------------------------------------YPVDLHMHT    9
ident                                                    |      | 
Sbjct ramaglaevagnpndsfwtwrelmyrmvarlspeqieviacqlyiemlkagYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhhhlEEEEEEEEL


DSSP  LLLL-------lllLLHHHHHHHHHHHLLLEEEEEEELLL------------llLLLLLH
Query VAST-------haySTLSDYIAQAKQKGIKLFAITDHGPD------------meDAPHHW   50
ident |                      |   || |                             
Sbjct VHHDldgrsyadpaELSLRISRAASAAGIGLTLLPVLYSHagfggqpasegqrrFINGSE  180
DSSP  LLLLllllllllllHHHHHHHHHHHHHLLEEEEEELLLLEeellleellhhhllLLLLHH


DSSP  HHHH-HHHLL--LEELLeEEEEEEEEELLllllllLLLHhHHHH---lLEEEEELlllll
Query HFIN-MRIWP--RVVDGvGILRGIEANIKnvdgeiDCSGkMFDS---lDLIIAGFhepvf  104
ident                 |   |                                       
Sbjct AYLElLQRLRapLEAAG-HSLGLCFHSLR-avtpqQIAT-VLAAghddLPVHIHIaeqqk  237
DSSP  HHHHhHHHHHhhHHHHL-LEELEEELLLL-lllhhHHHH-HHLLllllLLEEEEElllhh


DSSP  LLLLHHH--hhHHHHHHHHLLLL---LEELLLLlllllLLHHHHHHHHHHHLLEEEEELL
Query APHDKAT--ntQAMIATIASGNV---HIISHPGnpkyeIDVKAVAEAAAKHQVALEINNS  159
ident    |                  |       |           |   | |          |
Sbjct EVDDCQAwsgrRPLQWLYENVAVdqrWCLVHAT-----HADPAEVAAMARSGAVAGLCLS  292
DSSP  HHHHHHHhhllLHHHHHHHHLLLlllEEEEELL-----LLLHHHHHHHHHHLLEEEELHH


DSSP  L------LHHHhHHHHHHHLLLEEEELLlllhhhllllHHHHHHHHHLL-----------
Query S------NCREvAAAVRDAGGWVALGSDshtaftmgefEECLKILDAVD-----------  202
ident             |      ||    |||                |               
Sbjct TeanlgdGIFP-ATDFLAQGGRLGIGSD------shvsLSVVEELRWLEygqrlrdrkrn  345
DSSP  HhhhlllLLLL-HHHHHHLLLEEEELLL------llllLLHHHHHHHHHhhhhhhhllll


DSSP  ------------lLHHH--LHHH---lHHHHhhhhhhllllllhhHLLL-----------
Query ------------fPPER--ILNV---sPRRLlnflesrgmapiaeFADL-----------  234
ident                                                             
Sbjct rlyrddqpmigrtLYDAalAGGAqalgQPIG---------slavgRRADllvldgndpyl  396
DSSP  lllllllllhhhhHHHHhhHHHHhhhlLLLL---------lllllLLLLeeeellllhhh


DSSP  -------------------------------------------------------
Query -------------------------------------------------------  234
ident                                                        
Sbjct asaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  hllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 42: Query=1m65A Sbjct=4ofcA Z-score=7.7

back to top
DSSP  lLEELLLLLLL-------------------------------------llllLLLHHHHH
Query yPVDLHMHTVA-------------------------------------sthaYSTLSDYI   23
ident    | | |                                                   |
Sbjct mKIDIHSHILPkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenCWDPEVRI   60
DSSP  lLEEEEEELLLlllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhHLLHHHHH


DSSP  HHHHHHLLLEEEEEEE--LLLLL------llLLLHHHHHHHH---LLLEelleEEEEEEE
Query AQAKQKGIKLFAITDH--GPDME------daPHHWHFINMRI---WPRVvdgvGILRGIE   72
ident     |||    |                                                
Sbjct REMDQKGVTVQALSTVpvMFSYWakpedtlnLCQLLNNDLAStvvSYPR----RFVGLGT  116
DSSP  HHHHHHLLLEEEEELLhhHHLLLllhhhhhhHHHHHHHHHHHhhhHLLL----LEEEEEL


DSSP  EELLLlLLLL-lLLHHHH--HHLLEEEEELLllLLLLllhhhHHHHhHHHHHLL----ll
Query ANIKNvDGEI-dCSGKMF--DSLDLIIAGFHepVFAPhdkatNTQAmIATIASG----nv  125
ident                             | |  |                 |        
Sbjct LPMQA-PELAvkEMERCVkeLGFPGVQIGTH--VNEW--dlnAQEL-FPVYAAAerlkcs  170
DSSP  LLLLL-HHHHhhHHHHHHhlLLLLEEEEELE--ELLE--ellLHHH-HHHHHHHhhhlle


DSSP  LEELL----------------------LLLLlllLLHH--HHHHHhhHHLLEEEEEllLL
Query HIISH----------------------PGNPkyeIDVK--AVAEAaaKHQVALEINnsSN  161
ident                                          | |                
Sbjct LFVHPwdmqmdgrmakywlpwlvgmpaETTI-aiCSMImgGVFEK-fPKLKVCFAHggGA  228
DSSP  EEEELllllllhhhhlllhhhhlhhhhHHHH-hhHHHHllLHHHH-lLLLLEEELHhhLL


DSSP  HHH-------------------hhhhhHHHL-LLEEEelllllhhhllllhHHHH--HHH
Query CRE-------------------vaaavRDAG-GWVALgsdshtaftmgefeECLK--ILD  199
ident                                                           | 
Sbjct FPFtvgrishgfsmrpdlcaqdnpmnpKKYLgSFYTD-------------aLVHDplSLK  275
DSSP  HHHhhhhhhhhhhhlhhhhlllllllhHHHLlLLEEE-------------lLLLLhhHHH


DSSP  H--LLLLHHHLHH------------------------------HLHHHHHHHHHhlllLL
Query A--VDFPPERILN------------------------------VSPRRLLNFLEsrgmAP  227
ident                                                  | ||       
Sbjct LltDVIGKDKVILgtdypfplgelepgkliesmeefdeetknkLKAGNALAFLG----LE  331
DSSP  HhhHHHLLLLEELllllllllllllllhhhhhlllllhhhhhhHHLHHHHHHHL----LL


DSSP  LHHHlll
Query IAEFadl  234
ident    |   
Sbjct RKQF---  335
DSSP  HHHL---


No 43: Query=1m65A Sbjct=2vc5A Z-score=7.7

back to top
DSSP  ----------------lLEELLLLLLLLL-----------llllLHHHHHHHHHHHL---
Query ----------------yPVDLHMHTVAST-----------haysTLSDYIAQAKQKG---   30
ident                      | |                             |      
Sbjct mriplvgkdsieskdigFTLIHEHLRVFSeavrqqwphlynedeEFRNAVNEVKRAMqfg   60
DSSP  llllllllllllhhhllLEELLLLLLLLLhhhhhhlhhhllhhhHHHHHHHHHHHHHhll


DSSP  LLEEEEEEEllllLLLLllhhhhhhHHLLL---EELLEEEEEE----------eeeelll
Query IKLFAITDHgpdmEDAPhhwhfinmRIWPR---VVDGVGILRG----------ieanikn   77
ident  |                                  |     |                 
Sbjct VKTIVDPTV----MGLG------rdIRFMEkvvKATGINLVAGtgiyiyidlpfyflnrs  110
DSSP  LLEEEELLL----LLLL------llHHHHHhhhHLLLLEEEELeellllllllhhhllll


DSSP  lllllllLHHHHH--------HLLE-------------------------------EEEE
Query vdgeidcSGKMFD--------SLDL-------------------------------IIAG   98
ident                                                         ||  
Sbjct ideiadlFIHDIKegiqgtlnKAGFvxiaadepgitkdvekviraaaianketkvpIITH  170
DSSP  hhhhhhhHHHHHHllllllllLLLLeeeelllllllhhhhhhhhhhhhhhhhhlllEEEE


DSSP  LlllllllllhhhHHHHHHHHHHLL-------llLEELLLLLLlllLLHHHHhHHHHHHL
Query FhepvfaphdkatNTQAMIATIASG-------nvHIISHPGNPkyeIDVKAVaEAAAKHQ  151
ident                                     | | |               |   
Sbjct S----------naHNNTGLEQQRILteegvdpgkILIGHLGDT---DNIDYI-KKIADKG  216
DSSP  L----------llLLLHHHHHHHHHhhllllhhhEEELLHHHL---LLHHHH-HHHHHLL


DSSP  LEEEE-ELLL--------LHHHHHHHHHHHLL-LEEEELLLLL-----------------
Query VALEI-NNSS--------NCREVAAAVRDAGG-WVALGSDSHT-----------------  184
ident                             |          |                    
Sbjct SFIGLdRYGLdlflpvdkRNETTLRLIKDGYSdKIMISHDYCCtidwgtakpeykpklap  276
DSSP  LEEEElLLLLlllllhhhHHHHHHHHHHLLLLlLEEELLLLLLllllllllhhhhhhhll


DSSP  hhHLLLLH-HHHHHHHHLLLLHHHL--HHHLhhhHHHHHHhllllllhhhlll
Query afTMGEFE-ECLKILDAVDFPPERI--LNVSprrLLNFLEsrgmapiaefadl  234
ident               |       | |            |               
Sbjct rwSITLIFeDTIPFLKRNGVNEEVIatIFKE--nPKKFFS-------------  314
DSSP  llLLLHHHhLHHHHHHLLLLLHHHHhhHHLH--hHHHHLL-------------


No 44: Query=1m65A Sbjct=2ogjA Z-score=7.6

back to top
DSSP  --------------------------------------------------------lLEE
Query --------------------------------------------------------yPVD    4
ident                                                           ||
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeelEEE


DSSP  LLLL--LLLLlLLLLlhhHHHHHHHHHLLLEEEEEEellllllllllhHHHH-HHHLL--
Query LHMH--TVAStHAYStlsDYIAQAKQKGIKLFAITDhgpdmedaphhwHFIN-MRIWP--   59
ident || |                       |                                
Sbjct LHVHiwHGGT-DISI---RPSECGAERGVTTLVDAG-----------sAGEAnFHGFRey  105
DSSP  EEELllLLLL-LLLL---LHHHLLHHHLEEEEEEEL-----------lLLLLlHHHHHhh


DSSP  -LEELLEEEEEE-----------------------------------------EEEEL--
Query -RVVDGVGILRG-----------------------------------------IEANI--   75
ident         |                                                   
Sbjct iIEPSRERIKAFlnlgsiglvacnrvpelrdikdidldrilecyaensehivgLXVRAsh  165
DSSP  lLLLLLLEEEEEeelllllllllllllllllhhhllhhhhhhhhhllllleeeEEEEElh


DSSP  ------LLLLLLLL---LLHHHHhhlleEEEELLLLLLllllhhhHHHHHHHHHhLLLLl
Query ------KNVDGEID---CSGKMFdsldlIIAGFHEPVFaphdkatNTQAMIATIaSGNVh  126
ident                                   ||                        
Sbjct vitgswGVTPVKLGkkiAKILKV----pXXVHVGEPPA-------LYDEVLEIL-GPGD-  212
DSSP  hhhlllLLHHHHHHhhhHHHHLL----lEEEEELLLLL-------LHHHHHHHL-LLLL-


DSSP  EELLLLLL--LLLL-----LHHHHHHHhhhHLLEEEEELLL------LHHHHH-HHHHhh
Query IISHPGNP--KYEI-----DVKAVAEAaakHQVALEINNSS------NCREVA-AAVRda  172
ident    |  |      |                    | |                       
Sbjct VVTHCFNGksGSSIxededLFNLAERC---EGIRLDIGHGGasfsfkVAEAAIaRGLL--  267
DSSP  EEELLLLLllLLLLlllhhHHHHHHHL---LLLEEELLLLLllllhhHHHHHHhLLLL--


DSSP  llLEEEELLLLL-----hhHLLLlHHHHHHHHHLlLLHHH--LHHHLhhHHHHHHH----
Query ggWVALGSDSHT-----afTMGEfEECLKILDAVdFPPER--ILNVSprRLLNFLE----  221
ident         | |                 | |     | |                     
Sbjct --PFSISTDLHGhsxnfpvWDLA-TTXSKLLSVD-XPFENvvEAVTR--NPASVIRldxe  321
DSSP  --LLLLLLLLLLlllllllLLHH-HHHHHHHHLL-LLHHHhhHLLLH--HHHHHLLllll


DSSP  ---------------------------------------------hllllllhhhlll
Query ---------------------------------------------srgmapiaefadl  234
ident                                                           
Sbjct nrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 45: Query=1m65A Sbjct=1a4mA Z-score=7.6

back to top
DSSP  ------LLEELLLLLllllLLLL-------------------------------------
Query ------YPVDLHMHTvastHAYS-------------------------------------   17
ident         | || |                                              
Sbjct tpafnkPKVELHVHL----DGAIkpetilyfgkkrgialpadtveelrniigmdkplslp   56
DSSP  llllllLEEEEEEEH----HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhh


DSSP  ----------------------LHHHHHHHHHHHLLLEEEEEE-----------------
Query ----------------------TLSDYIAQAKQKGIKLFAITD-----------------   38
ident                                   |                         
Sbjct gflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYsphllanskvdpmpwnq  116
DSSP  hhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEEllhhhllllllllhhhl


DSSP  ---------------------------------ELLLLL---lllLLHHHH-HHHHLlle
Query ---------------------------------HGPDME---dapHHWHFI-NMRIWprv   61
ident                                                             
Sbjct tegdvtpddvvdlvnqglqegeqafgikvrsilCCMRHQpswsleVLELCKkYNQKT---  173
DSSP  llllllhhhhhhhhhhhhhhhhhhhlleeeeeeEEELLLhhhhhhHHHHHHhLLLLL---


DSSP  elleeeeEEEEEE-----lLLLL------llllLLHHHHhhllEEEEELlllllllllhh
Query vdgvgilRGIEAN-----iKNVD------geidCSGKMFdsldLIIAGFhepvfaphdka  110
ident                                                             
Sbjct ------vVAMDLAgdetieGSSLfpghveayegAVKNGI----HRTVHA--------gev  215
DSSP  ------eEEEEEEllllllLHHHlhhhhhhhhhHHHHLL----EEEEEE--------lll


DSSP  hHHHHHHHHHHLlLLLEELLLLlllllLLHHH--HHHHHHHHLLEEEEELLL--------
Query tNTQAMIATIASgNVHIISHPGnpkyeIDVKA--VAEAAAKHQVALEINNSS--------  160
ident                    |                    |     |    |        
Sbjct gSPEVVREAVDIlKTERVGHGY-----HTIEDeaLYNRLLKENMHFEVCPWSsyltgawd  270
DSSP  lLHHHHHHHHHLlLLLEEEELH-----HHHHLhhHHHHHHHLLLEEEELHHHhhhlllll


DSSP  -lhhHHHHHHHHHLLLEEEELLLLLhhhllLLHHHHHHHH-HLLL---LHHHLHhhlhHH
Query -ncrEVAAAVRDAGGWVALGSDSHTaftmgEFEECLKILD-AVDF---PPERILnvspRR  215
ident                   |  |                      |      |        
Sbjct pkttHAVVRFKNDKANYSLNTDDPL-ifksTLDTDYQMTKkDMGFteeEFKRLN----IN  325
DSSP  llllLHHHHHHHLLLLEEELLLLLL-llllLHHHHHHHHHhLLLLlhhHHHHHH----HH


DSSP  HHHHHhhllLLLL-HHHLLL------
Query LLNFLesrgMAPI-AEFADL------  234
ident                |          
Sbjct AAKSS--flPEEEkKELLERlyreyq  349
DSSP  HHHLL--llLHHHhHHHHHHhhhhll


No 46: Query=1m65A Sbjct=3icjA Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  lLEELLLLLlllllLLLL------------------------------------------
Query yPVDLHMHTvasthAYST------------------------------------------   18
ident    | | |                                                    
Sbjct aFFDSHLHL-----DELGmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrw  115
DSSP  lEEEEEELH-----HHHHhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   18
ident                                                             
Sbjct ptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkii  175
DSSP  llhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhh


DSSP  -------------HHHHHHHHHHHLLLEEEEEEellllllllllhHHHH-HHHLL----l
Query -------------LSDYIAQAKQKGIKLFAITDhgpdmedaphhwHFIN-MRIWP----r   60
ident                         |                                   
Sbjct nekiltvkdykhyIESAQEHLLSLGVHSVGFMS------------VGEKaLKALFelere  223
DSSP  hhllllhhhhhhhHHHHHHHHHHLLEEEEEEEE------------ELHHhHHHHHhhhhl


DSSP  eeLLEEEEEE--------------------------EEEEL-------------------
Query vvDGVGILRG--------------------------IEANI-------------------   75
ident                                                             
Sbjct grLKMNVFAYlspelldkleelnlgkfegrrlriwgVXLFVdgslgartallsepytdnp  283
DSSP  llLLLEEEEEelhhhhhhhhhhlllleellleeeeeEEEELlllllllllllllllllll


DSSP  -------LLLL-LLLL---LLHHHHhhlleEEEELlllllllllhhHHHHHHHHHHH--L
Query -------KNVD-GEID---CSGKMFdsldlIIAGFhepvfaphdkaTNTQAMIATIA--S  122
ident         | |                                                 
Sbjct ttsgelvMNKDeIVEVierAKPLGL----dVAVHA--------igdKAVDVALDAFEeaE  331
DSSP  lllllllLLHHhHHHHhhhHLLLLL----eEEEEE--------llhHHHHHHHHHHHhhL


DSSP  LLLlEELLLLLlllllLHHHhHHHHHHHLLEEEEELLL--------------------LH
Query GNVhIISHPGNpkyeiDVKAvAEAAAKHQVALEINNSS--------------------NC  162
ident      | |              |      |                              
Sbjct FSG-RIEHASL----vRDDQ-LERIKELKVRISAQPHFivsdwwivnrvgeerakwayRL  385
DSSP  LLL-EEEELLL----lLHHH-HHHHHHHLLEEEELLLHhhhlllhhhhhhhhhhhhllLH


DSSP  HHHHHhhhhhLLLEEEELLLLLhhHLLL---LHHHHH-------HHHHllllhhhLHHHL
Query REVAAavrdaGGWVALGSDSHTafTMGE---FEECLK-------ILDAvdfpperILNVS  212
ident                   ||                                    |   
Sbjct KTLSS-----ITKLGFSTDSPI-ePADPwvsIDAAVNryvvdpgERVS--reealHLYTH  437
DSSP  HHHHH-----HLLEEELLLLLL-lLLLHhhhHHHHHHlllllhhHLLL--hhhhhHHLLH


DSSP  ---hhhHHHHHhhllllllhhHLLL----------
Query ---prrLLNFLesrgmapiaeFADL----------  234
ident       |   |          |             
Sbjct gsaqvtLAEDL----gklergFRAEyiildrdplk  468
DSSP  hhhhhlLLLLL----llllllLLLLeeeellllll


No 47: Query=1m65A Sbjct=2gwgA Z-score=7.5

back to top
DSSP  lLEELLL-LLLL------------------------------llllllLHHH-HHHHHHH
Query yPVDLHM-HTVA------------------------------sthaysTLSD-YIAQAKQ   28
ident    | |   | |                                                
Sbjct xIIDIHGhYTTApkaledwrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQE   60
DSSP  lLEEEEEeLLLLlhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHH


DSSP  HLLLEEEEEEE--lllllllLLLHHHHHHH---HLLLEelleEEEEEEEEELL-llLLLL
Query KGIKLFAITDH--gpdmedaPHHWHFINMR---IWPRVvdgvGILRGIEANIK-nvDGEI   82
ident  |  |                                                   |   
Sbjct RGSDLTVFSPRagdfnvsstWAAICNELCYrvsQLFPD----NFIGAAXLPQSpgvDPKT  116
DSSP  HLLLEEEEELLlllhhhhhhHHHHHHHHHHhhhHHLLL----LEEEEEELLLLlllLHHH


DSSP  L--LLHHHHH--HLLEEEEE-LLLLllLLLLhhHHHHH-hHHHHHLLL-----lLEEL--
Query D--CSGKMFD--SLDLIIAG-FHEPvfAPHDkaTNTQA-mIATIASGN-----vHIIS--  129
ident       |         |                          |            |   
Sbjct CipELEKCVKeyGFVAINLNpDPSG-gHWTS--PPLTDriWYPIYEKXveleipAXIHvs  173
DSSP  HhhHHHHHHHllLLLEEEELlLLLL-lLLLL--LLLLLhhHHHHHHHHhhhlllEEELll


DSSP  ------lLLLLllllLHHH--hhhhhhHHLLEEEEellLLHH-------------hhhhh
Query ------hPGNPkyeiDVKA--vaeaaaKHQVALEInnsSNCR-------------evaaa  168
ident                   |                                         
Sbjct tgahylnADTT-afxQCVAgdlfkdfpELKFVIPH-ggGAVPyhwgrfrglaqexkkpll  231
DSSP  lllhhhhHHHH-hhhHHHHllhhhhllLLLEEELH-hhLLLHhhhhhhhhhhhhlllllh


DSSP  hHHHL--LLEEEelllllhhhllLLHH--HHHHHHHlLLLHHHLHH--------------
Query vRDAG--GWVALgsdshtaftmgEFEE--CLKILDAvDFPPERILN--------------  210
ident                                  |     |    |               
Sbjct eDHVLnnIFFDT-----------CVYHqpGIDLLNT-VIPVDNVLFasexigavrgidpr  279
DSSP  hHHLLllEEEEL-----------LLLLhhHHHHHHH-HLLHHHEELlllllllllleell


DSSP  -------------------------HLHHHHHHHHHhlLLLLL-HHHL--ll
Query -------------------------VSPRRLLNFLEsrGMAPI-AEFA--dl  234
ident                                                     
Sbjct tgfyyddtkryieastiltpeekqqIYEGNARRVYP--RLDAAlKAKGkleh  329
DSSP  lleellllhhhhhhlllllhhhhhhHHLHHHHHHLH--HHHHHhHHHHhhll


No 48: Query=1m65A Sbjct=1a5kC Z-score=7.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -------lLEELLLLLlllllllLLHHhHHHHHHHHLLLEEEEE------------EELL
Query -------yPVDLHMHTvasthaySTLSdYIAQAKQKGIKLFAIT------------DHGP   41
ident           | | |                 |   |                       
Sbjct egkivtagGIDTHIHW-------ICPQ-QAEEALVSGVTTMVGGgtgpaagthattCTPG  172
DSSP  llleeeelEEEEEEEL-------LLLL-HHHHHHHHLEEEEEEElllllhhhhhllLLLH


DSSP  lllllllLHHHHHHHH-LLLEEllEEEEEEEeEELLllLLLLLLLhHHHH-HLLEEEEEL
Query dmedaphHWHFINMRI-WPRVVdgVGILRGIeANIKnvDGEIDCSgKMFD-SLDLIIAGF   99
ident         |    |          | |                                 
Sbjct -------PWYISRMLQaADSLP--VNIGLLG-KGNV--SQPDALR-EQVAaGVIGLEIHE  219
DSSP  -------HHHHHHHHHhHLLLL--LEEEEEE-ELLL--LLHHHHH-HHHHhLLLEEEEEH


DSSP  LllllllllhhhHHHHHHHHhHLLL-----LLEELlLLLLLLLLLHHHHHHHHHHHLLEE
Query HepvfaphdkatNTQAMIATiASGN-----VHIIShPGNPKYEIDVKAVAEAAAKHQVAL  154
ident                |                             |     |        
Sbjct D--------wgaTPAAIDCA-LTVAdemdiQVALH-SDTLNESGFVEDTLAAIGGRTIHT  269
DSSP  H--------hllLHHHHHHH-HHHHhhhllEEEEE-LLLLLLLLLHHHHHHHHLLLLEEE


DSSP  EE---ellllhhHHHHhHHHHL-LLEEEElllllhhhlllLHHH----------------
Query EI---nnssncrEVAAaVRDAG-GWVALGsdshtaftmgeFEEC----------------  194
ident                                                             
Sbjct FHtegaggghapDIIT-ACAHPnILPSST-----------NPTLpytlntidehldmlmv  317
DSSP  LLllllllllllLHHH-HHHLLlEEEEEE-----------HHHLlllllhhhhhhhhhhh


DSSP  -----------------------hHHHHHL-LLLHhHLHH--------------------
Query -----------------------lKILDAV-DFPPeRILN--------------------  210
ident                            |   |      |                     
Sbjct chhldpdiaedvafaesrirretiAAEDVLhDLGA-FSLTssdsqamgrvgevilrtwqv  376
DSSP  hhllllllhhhhhlllllllhhhhHHHHHHhHLLL-LLEEelllllllllllhhhhhhhh


DSSP  ----------------------------HLHHHHHHHH----------------------
Query ----------------------------VSPRRLLNFL----------------------  220
ident                                                             
Sbjct ahrmkvqrgalaeetgdndnfrvkryiaKYTINPALTHgiahevgsievgkladlvvwsp  436
DSSP  hhhhhhhhlllllllllllhhhhhhhhhLLLHHHHHHLlllllllllllllllleeeelh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  220
ident                                                             
Sbjct affgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaa  496
DSSP  hhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhh


DSSP  -----------------HHLL---------------------------------------
Query -----------------ESRG---------------------------------------  224
ident                                                             
Sbjct angvaerlnlrsaiavvKGCRtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadv  556
DSSP  hhlhhhhllllleeeelLLLLlllhhhllllllllleeelllllleeelleellllllll


DSSP  llllhhhlll
Query mapiaefadl  234
ident           
Sbjct lpmaqryflf  566
DSSP  llllllllll


No 49: Query=1m65A Sbjct=3ooqA Z-score=7.3

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------yPVDLHMH    8
ident                                                       || | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeelEEEEEEL


DSSP  ------------lLLLL---------llllLHHHhHHHHHHHL---LLEEEEEEELLLL-
Query ------------tVAST---------haysTLSDyIAQAKQKG---IKLFAITDHGPDM-   43
ident                                                    |        
Sbjct iglfeegvgyyysDGNEatdpvtphvkaldGFNPqDPAIERALaggVTSVXIVPGSANPv  120
DSSP  lllllllllhhhlLLLLllllllllllhhhHLLLlLHHHHHHHlllEEEEEELLLLLLLe


DSSP  llllllhhhhhhhhLLLEelleeeeEEEEEELLL--------------------------
Query edaphhwhfinmriWPRVvdgvgilRGIEANIKN--------------------------   77
ident                           |                                 
Sbjct ggqgsvikfrsiivEECI---vkdpAGLKXAFGEnpkrvygerkqtpstrxgtagvirdy  177
DSSP  eeeeeeeelllllhHHHE---eeeeEEEEEELLHhhhhhhhhlllllllhhhhhhhhhhh


DSSP  ----------------------lllllllLHHHH--HHLLeEEEELlllllllllhhhHH
Query ----------------------vdgeidcSGKMF--DSLDlIIAGFhepvfaphdkatNT  113
ident                               |                             
Sbjct ftkvknyxkkkelaqkegkeftetdlkxeVGEXVlrKKIP-ARXHA-----------hRA  225
DSSP  hhhhhhhhhhhhhhhhlllllllllhhhhHHHHHhlLLLL-EEEEE-----------lLH


DSSP  HHHHHHHHL-----LLLLeELLLLlllllllHHHHHHHHHHHLLEEEEELLL--------
Query QAMIATIAS-----GNVHiISHPGnpkyeidVKAVAEAAAKHQVALEINNSS--------  160
ident       |        |   | |                 |                    
Sbjct DDILTAIRIaeefgFNLV-IEHGT------eAYKISKVLAEKKIPVVVGPLLtfrtklel  278
DSSP  HHHHHHHHHhhhhlLLEE-EEELL------lHHHHHHHHHHHLLLEEELLLLlllllhhh


DSSP  --LHHHHHHHHHHHLLLEEEELLLLlhhHLLLL-HHHHHHhHHLLLLHHH--LHHHLhhh
Query --NCREVAAAVRDAGGWVALGSDSHtafTMGEF-EECLKIlDAVDFPPER--ILNVSprr  215
ident      |  |     |   ||  |                         |           
Sbjct kdLTXETIAKLLKDGVLIALXCDHP-viPLEFAtVQAATA-XRYGAKEEDllKILTV--n  334
DSSP  llLLLLHHHHHHHLLLLEEELLLLL-llLHHHHhHHHHHH-HHHLLLHHHhhHLLLH--h


DSSP  HHHHHH--hllllllhhHLLL-----------------------------
Query LLNFLE--srgmapiaeFADL-----------------------------  234
ident     |                                             
Sbjct PAKILGledrigsiepgKDADlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  HHHHLLlllllllllllLLLLeeeelllllllllleeeeeelleeeeell


No 50: Query=1m65A Sbjct=3pnuA Z-score=7.3

back to top
DSSP  -------------lLEELL-LLLLlllllLLLH-HHHHHHHHhhLLLEEEEEEEllllLL
Query -------------yPVDLH-MHTVasthaYSTL-SDYIAQAKqkGIKLFAITDHgpdmED   45
ident               | | |             |       |         |         
Sbjct enlyfqsnamklknPLDMHlHLRD-----NQMLeLIAPLSAR--DFCAAVIMPN---lIP   50
DSSP  llllllllleeeelLEEEEeLLLL-----HHHHhHHHHHHHL--LLLEEEELLL---lLL


DSSP  LL-LLHHHHH-HHHLL--leeLLEEEEEEEeEELLllllllllLHHHHHHLLEEEEEL--
Query AP-HHWHFIN-MRIWP--rvvDGVGILRGIeANIKnvdgeidcSGKMFDSLDLIIAGF--   99
ident                           |                     |    |      
Sbjct PLcNLEDLKAyKMRILkackdENFTPLMTL-FFKN---ydekfLYSAKDEIFGIXLYPag  106
DSSP  LLlLHHHHHHhHHHHHhhhllLLLEEEEEE-ELLL---llhhhHHHHLLLLLEEEELLll


DSSP  ----LLLLLLlllhhhHHHH-hhhhhHLLL-----LLEELlLLLLL-----llLLHHHHH
Query ----HEPVFAphdkatNTQA-miatiASGN-----VHIIShPGNPK-----yeIDVKAVA  144
ident                                                         |   
Sbjct ittnSNGGVS------SFDIeylkptLEAMsdlniPLLVH-GETNDfvmdresNFAKIYE  159
DSSP  llllLLLLLL------LLLHhhhhhhHHHHhhlllLEEEL-LLLLLlhhhllhHHHHHHH


DSSP  HHH---hHHLLEEEEEllllHHHHHHHHHHHL-LLEEEelllllhhhlllLHHHH-----
Query EAA---aKHQVALEINnssnCREVAAAVRDAG-GWVALgsdshtaftmgeFEECL-----  195
ident   |          |               |                        |     
Sbjct KLAkhfpRLKIVMEHI---tTKTLCELLKDYEnLYATI------------TLHHLiitld  204
DSSP  HHHhhllLLLEEELLL---lLHHHHHHHHHLLlEEEEE------------LLHHHlllhh


DSSP  -----------------------HHHHH-llllHHHLHH---------------------
Query -----------------------KILDA-vdfpPERILN---------------------  210
ident                          |        |                         
Sbjct dviggkmnphlfckpiakryedkEALCElafsgYEKVMFgsdsaphpkgcaagvfsapvi  264
DSSP  hhhlllllhhhllllllllhhhhHHHHHhhhllLLLEEElllllllllllllllllhhhh


DSSP  -------------------HLHHHHHHHHHhllllllhHHLLL-----------------
Query -------------------VSPRRLLNFLEsrgmapiaEFADL-----------------  234
ident                                        |                    
Sbjct lpvlaelfkqnsseenlqkFLSDNTCKIYD-------lKFKEDkiltleekewqvpnvye  317
DSSP  hhhhhhhhhhhllhhhhhhHHLHHHHHHHL-------lLLLLLleeeeellleellllee


DSSP  ---------------------
Query ---------------------  234
ident                      
Sbjct dkynqvvpymageilkfqlkh  338
DSSP  lllleellllllleelleell


No 51: Query=1m65A Sbjct=3giqA Z-score=7.2

back to top
DSSP  --------------------------------------------------------lLEE
Query --------------------------------------------------------yPVD    4
ident                                                            |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivapgFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeelEEE


DSSP  LLLLLlllllllLLHHH--hHHHHHhhLLLEEEEEEELL---------llLLLL----ll
Query LHMHTvasthaySTLSD--yIAQAKqkGIKLFAITDHGP---------dmEDAP----hh   49
ident  | |                       ||        |              |       
Sbjct VHGHD------dLMFVEkpdLRWKTsqGITTVVVGNCGVsaapaplpgntAAALallget  114
DSSP  LLLLL------lLHHHHlllLHHHHllLEEEEEELLLLLlllllllllllLHHHhhhlll


DSSP  hhhhHHHHLL----leELLEEEEEEE---------------eeellllllllllLHHHHH
Query whfiNMRIWP----rvVDGVGILRGI---------------eaniknvdgeidcSGKMFD   90
ident                                                             
Sbjct plfaDVPAYFaaldaqRPMINVAALVghanlrlaamrdpqaaptaaeqqamqdmLQAALE  174
DSSP  llllLHHHHHhhhhhlLLLLEEEEEEehhhhhhhhlllllllllhhhhhhhhhhHHHHHH


DSSP  -HLLE-------------------------------EEEELLllllllllHHHHHHHHHH
Query -SLDL-------------------------------IIAGFHepvfaphdKATNTQAMIA  118
ident                                                         |   
Sbjct aGAVGfstglayqpgavaqaaeleglarvaaerrrlHTSHIR------neADGVEAAVEE  228
DSSP  hLLLEeeeelllllhhhllhhhhhhhhhhhhhllleEEEELL------llLLLHHHHHHH


DSSP  HHHLL----LLLEELLLLLLL--LLLLHHHHHHHHHHH-----LLEEEEELLL-------
Query TIASG----NVHIISHPGNPK--YEIDVKAVAEAAAKH-----QVALEINNSS-------  160
ident   | |         ||             |              ||| |           
Sbjct VLAIGrgtgCATVVSHHKCMMpqNWGRSRATLANIDRAreqgvEVALDIYPYPgsstili  288
DSSP  HHHHHhhhlLEEEELLLLLLLhhHLLLHHHHHHHHHHHhhlllLEEEEELLLLeeeeell


DSSP  ---------------------------------------------------------LHH
Query ---------------------------------------------------------NCR  163
ident                                                             
Sbjct peraetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdedEVK  348
DSSP  hhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeelllhhHHH


DSSP  HHHHHhhhhlLLEEEELLLLL------hhHLLLLHHHH-HHHH-HLLL-LHHH-LHHHLh
Query EVAAAvrdagGWVALGSDSHT------afTMGEFEECL-KILD-AVDF-PPER-ILNVSp  213
ident                |||             | |   |      |               
Sbjct RIFQH-----PCCMVGSDGLPndarphprLWGSFTRVLgRYVReARLMtLEQAvARMTA-  402
DSSP  HHHHL-----LLEEELLLLLLlllllllhHHHHHHHHHhHHHHhLLLLlHHHHhHHHLH-


DSSP  hHHHHHHH--hllllllhhHLLL-------------------------------------
Query rRLLNFLE--srgmapiaeFADL-------------------------------------  234
ident                     ||                                      
Sbjct -LPARVFGfaergvlqpgaWADVvvfdpdtvadratwdeptlasvgiagvlvngaevfpq  461
DSSP  -HHHHHHLlllllllllllLLLEeeelllllllllllllllllllleeeeeelleeeell


DSSP  --------------
Query --------------  234
ident               
Sbjct ppadgrpgqvlrax  475
DSSP  llllllllllllll


No 52: Query=1m65A Sbjct=3e74A Z-score=7.1

back to top
DSSP  ----------------------------------------------------lLEELLLL
Query ----------------------------------------------------yPVDLHMH    8
ident                                                       || | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeelEEEEEEL


DSSP  LllllllllLHHHHHHHHHHHLLLEEEEEEElllllLLLL----LHHHHHHHHLLleelL
Query TvasthaysTLSDYIAQAKQKGIKLFAITDHgpdmeDAPH----HWHFINMRIWPrvvdG   64
ident                  |   ||                                     
Sbjct I--------GYETGTRAAAKGGITTXIEXPL-----NQLPatvdRASIELKFDAAkgklT  107
DSSP  L--------LHHHHHHHHHHLLEEEEEELLL-----LLLLllllHHHHHHHHHHHllllL


DSSP  EEEEEEEeEELLllllLLLLLHhHHHH-LLEEEEELLllllllllhhhHHHHHHHHHHLL
Query VGILRGIeANIKnvdgEIDCSGkMFDS-LDLIIAGFHepvfaphdkatNTQAMIATIASG  123
ident                                                 |           
Sbjct IDAAQLG-GLVS--ynIDRLHE-LDEVgVVGFXCFVR---------dvNDWQFFKGAQKL  154
DSSP  LEEEELE-ELLL--llLLLHHH-HHHHlLLLEEEELL---------llLHHHHHHHHHHH


DSSP  ----LLLEELlLLLLL----------------------------llLLHHHHHHHHHH--
Query ----NVHIIShPGNPK----------------------------yeIDVKAVAEAAAK--  149
ident              |                                     |   |    
Sbjct gelgQPVLVH-CENALicdelgeeakregrvtahdyvasrpvftevEAIRRVLYLAKVag  213
DSSP  hhhlLLEEEE-LLLHHhhhhhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHHhl


DSSP  HLLEEEEellllHHHHHHHHHHHL-----LLEEEelllllhhhlllLHHHHH--------
Query HQVALEInnssnCREVAAAVRDAG-----GWVALgsdshtaftmgeFEECLK--------  196
ident               |    |  |                                     
Sbjct CRLHVCH---vsSPEGVEEVTRARqegqdITCES------------CPHYFVldtdqfee  258
DSSP  LLEEELL---llLHHHHHHHHHHHhllllEEEEE------------LLHHHHllhhhhhh


DSSP  ------------------hHHHLllLHHHLHH----------------------------
Query ------------------iLDAVdfPPERILN----------------------------  210
ident                            |                                
Sbjct igtlakcsppirdlenqkgXWEKlfNGEIDCLvsdhspcppexkagnixkawggiaglqs  318
DSSP  hlhhhllllllllhhhhhhHHHHhhLLLLLEElllllllllllllllllllllllllhhh


DSSP  ----------------------HLHHHHHHHHH-hllllllhhHLLL-------------
Query ----------------------VSPRRLLNFLE-srgmapiaeFADL-------------  234
ident                                                             
Sbjct cxdvxfdeavqkrgxslpxfgkLXATNAADIFGlqqkgriapgKDADfvfiqpnssyvlt  378
DSSP  hhhhhhhhhlllllllhhhhhhHHLHHHHHHLLllllllllllLLLLeeeeelllleell


DSSP  ---------------------------------------------------
Query ---------------------------------------------------  234
ident                                                    
Sbjct nddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  hhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 53: Query=1m65A Sbjct=2qpxA Z-score=7.0

back to top
DSSP  ------------LLEELLLLL---------------------------------------
Query ------------YPVDLHMHT---------------------------------------    9
ident                | | |                                        
Sbjct gxddlsefvdqvPLLDHHCHFlidgkvpnrddrlaqvsteadkdypladtknrlayhgfl   60
DSSP  lllllhhhhhhlLEEEEEELLllllllllhhhhhhhhlllllllllhhhhlllhhhhhhh


DSSP  -----------------------------------------lLLLLllllhHHHHHHHHH
Query -----------------------------------------vASTHaystlSDYIAQAKQ   28
ident                                                     |    |  
Sbjct alakefaldannplaaxndpgyatynhrifghfhfkellidtGFVP-ddpiLDLDQTAEL  119
DSSP  hhhhhhllllllllllllhhhhhhhhhhhhhhlleeeeeeelLLLL-llllLLHHHHHHH


DSSP  HLLLEeeEEEELLllllLLLL-----------------hHHHHHHHLlleelleeeeEEE
Query KGIKLfaITDHGPdmedAPHH-----------------wHFINMRIWprvvdgvgilRGI   71
ident  ||                                                       | 
Sbjct VGIPV-kAIYRLE----THAEdfxlehdnfaawwqafsnDVKQAKAH--------gfVGF  166
DSSP  HLLLE-eEEEEHH----HHHHhhhlllllhhhhhhhhhhHHHLLLLL--------llLLE


DSSP  EEEL---LLLL-----------------------------lllLLLHhHHHHL----LEE
Query EANI---KNVD-----------------------------geiDCSGkMFDSL----DLI   95
ident                                                             
Sbjct XSIAayrVGLHlepvnvieaaagfdtwkhsgekrltskplidyXLYH-VAPFIiaqdXPL  225
DSSP  EELHhhhLLLLlllllhhhhhhhhhhhhhhlllllllhhhhhhHHHH-HHHHHhhhlLLE


DSSP  EEE--lLLLLLLLllhHHHHhhHHHHhHLLL--------lLEELLLLlllllLLHHHHHH
Query IAG--fHEPVFAPhdkATNTqaMIATiASGN--------vHIISHPGnpkyeIDVKAVAE  145
ident                                             |               
Sbjct QFHvgyGDADTDX---YLGN--PLLX-RDYLkaftkkglkVVLLHCY-----PYHREAGY  274
DSSP  EEEellLLLLLLH---HHLL--HHHH-HHHHhhhhhhlllEEEEELL-----LLHHHHHH


DSSP  HHHHH-LLEEEEE--LLLL---HHHHHHHHHHHLL--LEEEELL-LLLH-hhlllLHHHH
Query AAAKH-QVALEIN--NSSN---CREVAAAVRDAGG--WVALGSD-SHTA-ftmgeFEECL  195
ident  |         |             |                || |              
Sbjct LASVFpNLYFDISllDNLGpsgASRVFNEAVELAPytRILFASDaSTYPexyglaARQFK  334
DSSP  HHHHLlLEEEELLlhHHHLhhhHHHHHHHHLLLLLhhHEELLLLlLLLHhhhhhhHHHHH


DSSP  HHHHHLL------------lLHHHLHHHlhhHHHHHHHhllllllhhHLLL--
Query KILDAVD------------fPPERILNVsprRLLNFLEsrgmapiaeFADL--  234
ident   | |                   |                         |  
Sbjct QALVAHFnqlpfvdlaqkkaWINAICWQ---TSAKLYH--------qERELrv  376
DSSP  HHHHHHHhllllllhhhhhhHHHHHHLH---HHHHHLL--------lHHHHll


No 54: Query=1m65A Sbjct=3iacA Z-score=6.4

back to top
DSSP  --------------------------LLEELLLLLllllllllLHHH-------------
Query --------------------------YPVDLHMHTvasthaysTLSD-------------   21
ident                              | | |                          
Sbjct atfxtedfllkndiartlyhkyaapxPIYDFHCHL--------SPQEiaddrrfdnlgqi   52
DSSP  llllllllllllhhhhhhhhhlllllLEEELLLLL--------LHHHhhhllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   21
ident                                                             
Sbjct wlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpf  112
DSSP  hhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlll


DSSP  -----------------------------hHHHHHHHLLLEEEEEEellllllllLLHHh
Query -----------------------------yIAQAKQKGIKLFAITDhgpdmedapHHWHf   52
ident                                    |        ||              
Sbjct gitgtlfgpdtaesiwtqcneklatpafsaRGIXQQXNVRXVGTTD---------DPID-  162
DSSP  llllllllhhhhhhhhhhhhhhhllhhhlhHHHHHHLLEEEEELLL---------LLLL-


DSSP  hHHHH-LLLE---eLLEEEEEEE-------------------------eeelllllllll
Query iNMRI-WPRV---vDGVGILRGI-------------------------eaniknvdgeid   83
ident                                                             
Sbjct -SLEYhRQIAaddsIDIEVAPSWrpdkvfkieldgfvdylrkleaaadvsitrfddlrqa  221
DSSP  -LLHHhHHHHhlllLLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhh


DSSP  lLHHHHH----hLLEE--------------------------------------------
Query cSGKMFD----sLDLI--------------------------------------------   95
ident                                                             
Sbjct lTRRLDHfaacgCRASdhgietlrfapvpddaqldailgkrlagetlseleiaqfttavl  281
DSSP  hHHHHHHhhhllLLEEeeeellllllllllhhhhhhhhhhhhllllllhhhhhhhhhhhh


DSSP  --------------EEEL-LLLL----------------llLLLHhhHHHHHHH------
Query --------------IAGF-HEPV----------------faPHDKatNTQAMIA------  118
ident                                                   |         
Sbjct vwlgrqyaargwvxQLHIgAIRNnntrxfrllgpdtgfdsiGDNN--ISWALSRlldsxd  339
DSSP  hhhhhhhhhhlleeEEEElEELLllhhhhhhhllllllleeLLLL--LHHHHHHhhhhhh


DSSP  hhhlLLLLEEllLLLLlllLLHHHHHHHHHHH-------LLEEEEELLL-----LHHHHH
Query tiasGNVHIIshPGNPkyeIDVKAVAEAAAKH-------QVALEINNSS-----NCREVA  166
ident         |           |    |              |                   
Sbjct vtneLPKTIL--YCLN--pRDNEVLATXIGNFqgpgiagKVQFGSGWWFndqkdGXLRQL  395
DSSP  llllLLEEEE--EELL--hHHHHHHHHHHHHLlllllllLEEELLLLHHhllhhHHHHHH


DSSP  HHHHHHLL---leEEELLLLLHHHLlLLHHHHHHHHHLL-----------------lLHH
Query AAVRDAGG---wvALGSDSHTAFTMgEFEECLKILDAVD-----------------fPPE  206
ident       |          ||         |    ||                         
Sbjct EQLSQXGLlsqfvGXLTDSRSFLSYtRHEYFRRILCNLLgqwaqdgeipddeaxlsrXVQ  455
DSSP  HHHHHHLLhhhllLLLLLLLLLLLLhHHHHHHHHHHHHHhhhhhlllllllhhhhhhHHH


DSSP  HLHHHlhhHHHHHHHHllllllhhhlll
Query RILNVsprRLLNFLESrgmapiaefadl  234
ident  |                          
Sbjct DICFN---NAQRYFTI-----------k  469
DSSP  HHHLH---HHHHHLLL-----------l


No 55: Query=1m65A Sbjct=1j5sA Z-score=6.1

back to top
DSSP  -------------------------LLEELLLLLllllllllLHHH--------------
Query -------------------------YPVDLHMHTvasthaysTLSD--------------   21
ident                            || | |            |              
Sbjct hmflgedylltnraavrlfnevkdlPIVDPHNHL--------DAKDivenkpwndiweve   52
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLL--------LHHHhhhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   21
ident                                                             
Sbjct gatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfni  112
DSSP  llllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhlll


DSSP  ------------------------hHHHHHHHLLLEEEEEeellllllllllhHHHH--h
Query ------------------------yIAQAKQKGIKLFAITdhgpdmedaphhwHFIN--m   55
ident                                        |                    
Sbjct kkviseetaeeiweetkkklpemtpQKLLRDMKVEILCTT------------dDPVStle  160
DSSP  lllllhhhhhhhhhhhhhhlllllhHHHHHHLLEEEEELL------------lLLLLllh


DSSP  hhLLLE--ELLEEEEEEE------------------------------------------
Query riWPRV--VDGVGILRGI------------------------------------------   71
ident         | || ||                                             
Sbjct hhRKAKeaVEGVTILPTWrpdramnvdkegwreyvekmgerygedtstldgflnalwksh  220
DSSP  hhHHHHhhLLLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhh


DSSP  -----------EEEL---------------------------------lllllLLLL---
Query -----------EANI---------------------------------knvdgEIDC---   84
ident                                                             
Sbjct ehfkehgcvasDHALlepsvyyvdenraravhekafsgekltqdeindykafmMVQFgkm  280
DSSP  hhhhllllleeEEEElllllllllhhhhhhhhhhhlllllllhhhhhhhhhhhHHHHhhh


DSSP  lHHHHhhllEEEEEL-LLLL----------------llLLLHhHHHHHHHHHHHLL---L
Query sGKMFdsldLIIAGF-HEPV----------------faPHDKaTNTQAMIATIASG---N  124
ident                                                             
Sbjct nQETN---wVTQLHIgALRDyrdslfktlgpdsggdisTNFL-RIAEGLRYFLNEFdgkL  336
DSSP  hHHHL---lEEEEEElEELLllhhhhhhlllllllleeLLLL-LHHHHHHHHHHHLlllL


DSSP  LLEELlLLLLlllLLHHHHHHHHHHH-LLEEEEE-----lllLHHHHHHHHHHHLL---L
Query VHIIShPGNPkyeIDVKAVAEAAAKH-QVALEIN-----nssNCREVAAAVRDAGG---W  175
ident          |            |     |                               
Sbjct KIVLY-VLDP---THLPTISTIARAFpNVYVGAPwwfndspfGMEMHLKYLASVDLlynL  392
DSSP  LEEEE-ELLH---HHHHHHHHHHHHLlLEEELLLllllllhhHHHHHHHHHHLLLLhhhL


DSSP  EEEELLLLLHHHLL-LLHHHHHHHHHLL---------------lLHHHLHHHlhhHHHHH
Query VALGSDSHTAFTMG-EFEECLKILDAVD---------------fPPERILNVsprRLLNF  219
ident      ||      |   |     |  |                                 
Sbjct AGMVTDSRKLLSFGsRTEMFRRVLSNVVgemvekgqipikeareLVKHVSYD---GPKAL  449
DSSP  LLLLLLLLLLLHHHhHHHHHHHHHHHHHhhhhhlllllhhhhhhHHHHHHLH---HHHHH


DSSP  HHhllllllhhhlll
Query LEsrgmapiaefadl  234
ident                
Sbjct FF-------------  451
DSSP  HL-------------


No 56: Query=1m65A Sbjct=4qrnA Z-score=5.8

back to top
DSSP  --------------LLEELLLLLLL-----------------------------------
Query --------------YPVDLHMHTVA-----------------------------------   11
ident                                                             
Sbjct smtqdlktggeqgyLRIATEEAFATreiidvylrmirdgtadkgmvslwgfyaqspsera   60
DSSP  llllllllllllllLLEEEEEEELLhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhh


DSSP  --llllLLLHH-HHHHHHHHHLLLEEEEEEEL-LLLL-------llLLLHHHHHHHH--L
Query --sthaYSTLS-DYIAQAKQKGIKLFAITDHG-PDME-------daPHHWHFINMRI--W   58
ident          |    ||     ||                                     
Sbjct tqilerLLDLGeRRIADMDATGIDKAILALTSpGVQPlhdldeartLATRANDTLADacQ  120
DSSP  hhhhhhHHLLLhHHHHHHHHLLLLEEEEEELLlLLLLlllhhhhhhHHHHHHHHHHHhhH


DSSP  LLEellEEEEEEEeeelllllllllLLHHHHH--HLLEEEEelLLLL-LLLLlhhhhhhh
Query PRVvdgVGILRGIeaniknvdgeidCSGKMFD--SLDLIIAgfHEPV-FAPHdkatntqa  115
ident                                       |                     
Sbjct KYP---DRFIGMGtvapqdpewsarEIHRGARelGFKGIQI-nSHTQgRYLD-eeffdpi  175
DSSP  HLL---LLEEELLllllllhhhhhhHHHHHHHllLLLLEEE-lLLLLlLLLL-lhhhhhh


DSSP  hhhhhhlLLLLE------------------------------------------------
Query miatiasGNVHI------------------------------------------------  127
ident                                                             
Sbjct fralvevDQPLYihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkyps  235
DSSP  hhhhhhhLLLEEellllllllllhhhhhhlllllllhhhhhhhhhhhhhhhhlhhhhlll


DSSP  ----eLLLLLL----------------------lllllhhhhhHHHHHHlLEEEEELL--
Query ----iSHPGNP----------------------kyeidvkavaEAAAKHqVALEINNS--  159
ident       | |                                         |         
Sbjct lqimvGHMGEAlpywlyrldymhqagvrsqryermkplkktieGYLKSN-VLVTNSGVaw  294
DSSP  lleeeLHHHHLhhhhhhhhhhhhhhhhhlllllllllllllhhHHHHHL-EEEELLLLll


DSSP  -lLHHHHHHHHHhhlLLEEEELLLLLHHHllLLHHHHHhhHHLLlLHHHLHHHLhhHHHH
Query -sNCREVAAAVRdagGWVALGSDSHTAFTmgEFEECLKilDAVDfPPERILNVSprRLLN  218
ident                  |    |        |                            
Sbjct epAIKFCQQVMG--eDRVMYAMDYPYQYVadEVRAMDA--MDMSaQTKKKFFQT--NAEK  348
DSSP  hhHHHHHHHHHL--hHHEELLLLLLLLLLhhHHHHHHL--LLLLhHHHHHHHLH--HHHH


DSSP  HHHhllllllhhhlll
Query FLEsrgmapiaefadl  234
ident                 
Sbjct WFK------------l  352
DSSP  HLL------------l


No 57: Query=1m65A Sbjct=4dziC Z-score=5.7

back to top
DSSP  ----lLEELLLLLLLLL-------------------------------------------
Query ----yPVDLHMHTVAST-------------------------------------------   13
ident        |   |                                                
Sbjct alnyrVIDVDNHYYEPLdsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfd   60
DSSP  lllllEEEEEEELLLLLllllllllhhhlllleeeeelllleeeeelleellllllllll


DSSP  ----------------------------------llLLLHHHHHHHHHHHLLLEEEEEE-
Query ----------------------------------haYSTLSDYIAQAKQKGIKLFAITD-   38
ident                                     |      ||      |        
Sbjct piivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIETAFMLPt  120
DSSP  leelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEEEEEEELl


DSSP  ------------------eLLLLlllllLHHHHH--hhhLLLEelleEEEEEEeEELLLL
Query ------------------hGPDMedaphHWHFIN--mriWPRVvdgvGILRGIeANIKNV   78
ident                                         |       |           
Sbjct fgcgveealkhdieatmasVHAF-----NLWLDEdwgfdRPDH----RIIAAP-IVSLAD  170
DSSP  hhhhhhhhllllhhhhhhhHHHH-----HHHHHHhllllLLLL----LEEELL-LLLLLL


DSSP  L--lllLLLHhHHHHLLEEEEELllllLLLLlhhHHHHH-hhhhhHLLL----LLEELLl
Query D--geiDCSGkMFDSLDLIIAGFhepvFAPHdkaTNTQA-miatiASGN----VHIISHp  131
ident                                                      |    | 
Sbjct PtraveEVDF-VLARGAKLVLVR-papVPGLvkpRSLGDrshdpvWARLaeagVPVGFH-  227
DSSP  HhhhhhHHHH-HHHLLLLLEELL-lllLLLLlllLLLLLhhhhhhHHHHhhhlLLEEEE-


DSSP  lLLLL-------------------------lLLHHHHH----hhhhHHLLEEEEELlllH
Query gNPKY-------------------------eIDVKAVA----eaaaKHQVALEINNssnC  162
ident                                                   |  | |    
Sbjct lSDSGylhiaaawggakdpldqvllddraihDTMASMIvhgvftrhPKLKAVSIEN--gS  285
DSSP  lLLLLlhhhhhhllllllhhhhhhhllhhhhHHHHHHHhllhhhhlLLLLEEEELL--lL


DSSP  HHH------------------hhhhHHHL--LLEEEelllllhhhllllhhHHHH-HHHL
Query REV------------------aaavRDAG--GWVALgsdshtaftmgefeeCLKI-LDAV  201
ident   |                                                     |   
Sbjct YFVhrlikrlkkaantqpqyfpedpVEQLrnNVWIA--------------pYYEDdLPEL  331
DSSP  LHHhhhhhhhhhhhhhlhhhllllhHHHHhhHEEEL--------------lLLLLlHHHH


DSSP  --LLLHHHLHH------------------------------HLHHHHHHHHHHllllllh
Query --DFPPERILN------------------------------VSPRRLLNFLESrgmapia  229
ident         ||                                     |  |         
Sbjct arVIGVDKILFgsdwphgeglaspvsftaelkgfsesdirkIMRDNALDLLGV-------  384
DSSP  hhHHLHHHLLLllllllllllllhhhhhhhhllllhhhhhhHHLHHHHHHHLL-------


DSSP  hhlll
Query efadl  234
ident      
Sbjct -qvgs  388
DSSP  -llll


No 58: Query=1m65A Sbjct=2a3lA Z-score=5.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------------------------------lLEEL-LLLL--------
Query ------------------------------------------yPVDL-HMHT--------    9
ident                                             ||    |         
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrKVDThVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllllEEEEeEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    9
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  ----------------LLLL------llllLHHHHHHHHHHHLLLEEEEEEELLLllllL
Query ----------------VAST------haysTLSDYIAQAKQKGIKLFAITDHGPDmedaP   47
ident                                                             
Sbjct nlkynpcgqsrlreifLKQDnliqgrflgeITKQVFSDLEASKYQMAEYRISIYG-rkmS  299
DSSP  hhhhllllllhhhhhhLLLLlllllllhhhHHHHHHHHHLLLLLEEEEEEEELLL-lllL


DSSP  LLH-HHHHHH--HLLLEelleEEEEEEEEELLL------------llllllLLHH-----
Query HHW-HFINMR--IWPRVvdgvGILRGIEANIKN------------vdgeidCSGK-----   87
ident                           |                                 
Sbjct EWDqLASWIVnnDLYSE----NVVWLIQLPRLYniykdmgivtsfqnildnIFIPlfeat  355
DSSP  HHHhHHHHHHllLLLLL----LEEEEEEEELLHhhhlllllllllhhhhhhHLLHhhhhh


DSSP  -----------hhhhLLEEEEELLlllllLLLHHH-------------hhHHHHHHHHLL
Query -----------mfdsLDLIIAGFHepvfaPHDKAT-------------ntQAMIATIASG  123
ident                                                    |        
Sbjct vdpdshpqlhvflkqVVGFDLVDD---esKPERRPtkhmptpaqwtnafnPAFSYYVYYC  412
DSSP  hlhhhllllhhhhllEEEEEEELL---llLLLLLLlllllllllllllllLLHHHHHHHH


DSSP  L------------------lLEELLLLLllllLLHHhHHHHHHHHLLEEEEelllLHHHh
Query N------------------vHIISHPGNpkyeIDVKaVAEAAAKHQVALEInnssNCREv  165
ident                                  |      |              | |  
Sbjct YanlyvlnklreskgmttitLRPHSGEA----GDID-HLAATFLTCHSIAH--giNLRK-  464
DSSP  HhhhhhhhhhhlllllllleELLLLLLL----LLLH-HHHHHHHHLLLLLL--lhHHHH-


DSSP  hhhHHHHL----LLEEEelllllhhhlllLHHH--------hHHHHHL-LLLHhHLHH--
Query aaaVRDAG----GWVALgsdshtaftmgeFEEC--------lKILDAV-DFPPeRILN--  210
ident                |                                            
Sbjct spvLQYLYylaqIGLAM-----------sPLSNnslfldyhrNPFPVFfLRGL-NVSLst  512
DSSP  lhhHHHHHhhhlLLEEE-----------lHHHHlllllllllLLHHHHhHLLL-LEEEll


DSSP  ------------------------------------HLHHHHHhhhhhllllLLHHHLLL
Query ------------------------------------VSPRRLLnflesrgmaPIAEFADL  234
ident                                      |                |     
Sbjct ddplqihltkeplveeysiaasvwklsacdlceiarNSVYQSG--------fSHALKSHW  564
DSSP  llhhhhlllllhhhhhhhhhhhhhlllhhhhhhhhhHHHHHLL--------lLHHHHHHH


DSSP  ----------------------------------------------------
Query ----------------------------------------------------  234
ident                                                     
Sbjct igkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 59: Query=1m65A Sbjct=1bksA Z-score=5.7

back to top
DSSP  ----------------LLEEllLLLLLLL---lllLLHHHHHHHHhhhlllEEEEEEElL
Query ----------------YPVDlhMHTVAST---haySTLSDYIAQAkqkgikLFAITDHgP   41
ident                         |                |                 |
Sbjct meryenlfaqlndrreGAFV-pFVTLGDPgieqslKIIDTLIDAG-----aDALELGV-P   53
DSSP  lhhhhhhhhhhhhlllLEEE-eEEELLLLlhhhhhHHHHHHHHLL-----lLLEEEEL-L


DSSP  LLL------------------lllLLHHHhHHHH--LLLEelleEEEEEEEEELL--lll
Query DME------------------dapHHWHFiNMRI--WPRVvdgvGILRGIEANIK--nvd   79
ident                             |                |  |           
Sbjct FSDpladgptiqnanlrafaagvtPAQCFeMLALirEKHP----TIPIGLLMYANlvfnn  109
DSSP  LLLlllllhhhhhhhhhhhhhlllHHHHHhHHHHhhHHLL----LLLEEEEELHHhhhll


DSSP  llllLLHHHHHH-LLEEEEELlllllllllhhhhhhHHHHHhHLLL--------LLEElL
Query geidCSGKMFDS-LDLIIAGFhepvfaphdkatntqAMIATiASGN--------VHIIsH  130
ident               |                           |             |   
Sbjct gidaFYARCEQVgVDSVLVAD--------------vPVEES-APFRqaalrhniAPIF-I  153
DSSP  lhhhHHHHHHHHlLLEEEELL--------------lLHHHL-HHHHhhhhhlllEEEE-E


DSSP  LLLlllLLLHhHHHHHHHHHLL-EEEEElllLHHHHHHHHHHHLLL-EEEElllllhhhl
Query PGNpkyEIDVkAVAEAAAKHQV-ALEINnssNCREVAAAVRDAGGW-VALGsdshtaftm  188
ident         |        |                                |         
Sbjct CPP---NADD-DLLRQVASYGRgYTYLL-alPLHHLIEKLKEYHAApALQG---fgissp  205
DSSP  ELL---LLLH-HHHHHHHHHLLlLEEEL-llLHHHHHHHHHHHLLLlEEEL---lllllh


DSSP  lLLHHHHHHHhhllllhhhLHHH-------------lhhhhhhhhhhllllllhhhlll
Query gEFEECLKILdavdfpperILNV-------------sprrllnflesrgmapiaefadl  234
ident                                                            
Sbjct eQVSAAVRAG---------AAGAisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
DSSP  hHHHHHHHHL---------LLEEeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll